E-Yearbook Home  Quick Search  Advanced Search  Quick Browse

Illinois State Normal University - Index Yearbook (Normal, IL)

 - Class of 1926

Page 1 of 346

 

Illinois State Normal University - Index Yearbook (Normal, IL) online collection, 1926 Edition, Cover
Cover
Page 6, 1926 Edition, Illinois State Normal University - Index Yearbook (Normal, IL) online collectionPage 7, 1926 Edition, Illinois State Normal University - Index Yearbook (Normal, IL) online collection
Pages 6 - 7

Page 10, 1926 Edition, Illinois State Normal University - Index Yearbook (Normal, IL) online collectionPage 11, 1926 Edition, Illinois State Normal University - Index Yearbook (Normal, IL) online collection
Pages 10 - 11

Page 14, 1926 Edition, Illinois State Normal University - Index Yearbook (Normal, IL) online collectionPage 15, 1926 Edition, Illinois State Normal University - Index Yearbook (Normal, IL) online collection
Pages 14 - 15
Page 8, 1926 Edition, Illinois State Normal University - Index Yearbook (Normal, IL) online collectionPage 9, 1926 Edition, Illinois State Normal University - Index Yearbook (Normal, IL) online collection
Pages 8 - 9		Page 12, 1926 Edition, Illinois State Normal University - Index Yearbook (Normal, IL) online collectionPage 13, 1926 Edition, Illinois State Normal University - Index Yearbook (Normal, IL) online collection
Pages 12 - 13		Page 16, 1926 Edition, Illinois State Normal University - Index Yearbook (Normal, IL) online collectionPage 17, 1926 Edition, Illinois State Normal University - Index Yearbook (Normal, IL) online collection
Pages 16 - 17

Text from Pages 1 - 346 of the 1926 volume:

“

M.- f-t, Q 'xg , : '12, n-GFTIFYTWYT. ,lqgveh 'fi-: Ji N rx' n.i:' A, Jiiffiif T X ' i'81,5L-J AL.. 5 ' 'mv ' Q 1'Jr..- -xE5,', ,Q -X '?2' J 'ez ' -'f,:q,'-3. mugslg. '..4'4J,'wW4f L', fc' , , .mv 14. 2- 5774 ' 3.4 gm 5 :gf -.,-4 ' V'. 'jg dl' + . I , 1 , , Av.. - 4. -1- 315, -LM ., . 1. mi' ' ' .f y 'gt 'r .: .x.., . 1, f, K ,,-ru' .Nw - -s ,. - ,nf 'wie' J.. fr v' X., ..', 'f,.,, 4, xl N - 'I 55:4 - . Q.. 1.v!,.l., VL QA fig-fgfrh .4 ..,M, QM ' 5-fu A .F a W ' l G 'Q QQ, V L -Hfff' .V - ' w'1 ' , I' h. Pam' f ,'4-Yff.1- - I 'f ,gin V ,-N. ! ' X . BA ..., pf? 1,1 uc A h T Qc.- - .,pgf,..- linxg, - 5-,IA ,'if'- 7.1L 1 - A. 1- t , 1, , f. , , '31,-Sf, .pl 5. -L ' : N 'mf . ' af . , .:J., ICQAS' , L4 P - ,1xS 'L'mx ' .v.,37!.. , V-,1 ' ' 1- :ww f 5, ,- ' '.: 4' , x - ., Ni' - . .IH .V I-J' A . 1 W ., v ,BvA:?:4,,. ' W sith, 0'Q' 1 ' .WR3 74 HM' 1'g.f 'W'1 ' xx :si-UQ.. ,tjffft N' n. .v-Z-, ,. ,. Y X . ,., ,fr 'I ' ' . , 1 , :A A , f.-5x4iNH' k D 1. I 13. .'lf'5lQfPa., ' -we--if' , ..':,3ff'-.,g .. ,X .Q Y t , U :fi 2 'Q u .-V . Ah.. ' 1:35 Qfff? f ,. K Y: A 3. i CN - ,'-. 4' Mg-vi M., ' , J ,-4,--4' ,'. 5:6 'lr . 25, ' .J ,--35 ' - .., . V . A fi.. 'N : fa A.. l-' 1 xl tl . , gy? , s'!f?i'f N' V, -. A 471 - 'aiu' '17- f .-19: ,A 'I C J n. , . 1'-'Wie ' ' :fm w .MQ 2 5,545 ,of MQ ' . .. hw. n If-'1 'fn 'r'iffA L-ff M.-L 1 465 1,354 C .Fw - Ll ..I Q, .I. . ,Q ,z . r .-Q, J. I , A. fy, . I1 -51 Ava 1 bf 1- '1 fi! 'I gk 'sl vi, x Q! . f. 15' ?7 a 4 H, ...U ' J s v f-5... , f .G ks , ' 2. .11 wg 4 ILII ff .. .19 1 . .M S -' .-.,,g ' v v f ,R , 1 l fy. .,. L x . 51 .. 'W 9, .W f .- '4 vw. 1Ifi'.xQ'f'7' 3 ISK ' '5 1'p f 9-:gf AI ' 'Elin' 3 ' I 9' .,I . . .,. I I I I Q' T53 - .. :II Im I-I I I I . I . II I -yi - I., -I IIA I f Qf A ' 4 Q. -.. r gf, ' ' L, A 4. ', SEV- .' ' V f 'Ls ' N ' 55, --4 I, II, QIL-F, II ' , . . M, - A , .: 1 ' . -, v ,I. - ...' 4- ,. . .I , I .:,-, .f,I II .. XIQL. -, ,f I I I , I, Id I.,,.,f,.I .3 ggi.: ,f III fn . f ' ' . ' , :pig f II ' -p ' ' A 3: -f JL 5-4. ' -' V II . I - - :g.44.,5.5 ,' .-,rg 4, , I I, ' I A , . .3 M ' Q I IJI 11 .. I I .r n , .531 II I . I I 1 I :III IIII ,I 1 , ' . u' - . ' - - ' -L.: V , I...,. ,' 'x . i '-7 - I '- ?'I,,Z6'f5 fi. ' 'sz' JW: ' . . I , . , ,,. W , N' fi ' FEW V FF . ' '- vyf. I .I :sy ' I . I ' P' .f A ,f 4 . . V fx- 1 ' I .X 'lr .X F114 7 ,I ' I . 0 II, .IIQI ..: ' :J f g, ,,gf 'ff . . I 'Y ' fII.,,1'I I I. E IIII f, I I-3.1. . :. '., vw: I I,II' ' II ,IIZFILI I II . 1 II II.IrII'gi . IIN.. . , --, I,,I. gf' V-.' I I ,f . ff w ' . f A ' 1 .'-I ' 53- .Vw gif? Q '- 'S' ' 2-A ' - we .fm ,H ,gx 'QA f. 'Sw vm fifiw W '-wid W 'f., u .r-'A ' my 53 - ' 4 .N 41 ' . ' .' ,f ' I - ' :L ' c -,fy ap .. I my 45. If, . 5 yi-4 ,I , A ,I.,I , . ,IIIW I. .I 'gf 0, ' , J ' .my-.,..I .. , . 91,3 I H- . II I I 2 'N' ' 'Q ,saw Af.. f .n , ng., , 51 ' A ' ' , 5 ' 1 W i . 1' X' 'I .I II,II Ep- I VXI, ' . . , . .- uf - t , , V .I II' Q . , . I .Firma :II II II I IIIIII. I gi: I. I 1- 4' vb ' . 5. - I 1 j..:Hli:k. ,' '. I' v- .,.1I5f ., . z 1 .' '. ,1:rJ ?. ' - ww' ,w-,nw ,IU I If ,L A .Iw . ,Inns . my 1 1r,p?xII .1 . I III I I QI - mfiif, . V f 1 1 . vw- Y Mg- . - -f 1 I , IN V X .f+,,.' , . I 11 I, ,f su'-: , , L-III. I I N NI 11 ,.- ' ' . HH . ..,, 1 Y- M - K -. NA. I. f, I ' . I I, .1 I I , . .Q ' f .Q ' hwy' I - egg! , rf ' A if- 'ff ' w A -- 6. 5 'v 7' x 4 . '-' .Y ill. . lf. I fx QE ff-5 4- ,Q ..,. . .m-db 1 1 h.,. 5. -M 4 'Av .W I , ..,. A' ,,a'QIIII,I. IAEIH . ,UA 1, . J'-a, , , 45 wr- 5' ,. -.1?? !. L! 1 V! X -. Q 'W ' ' . '..1f.1Il. ... 17 'W' nv 'F ' 'I ' r. 14 ' .plgw 'N 91 ,agflx . 'vw 1' I I. .f Us f 1 .A 1 U L... ,. -. 195. I x. , 13 K v . . ,I ff ff ,,,., ,.1 .1 iffai.. . 1-ff--A.1'r. 'Q' . 4' 1 ' .1-'. 13 . , ,. J 3 f , .'f. 'P A -.TF 1 Q 5 . ' L., 4 -2'1 f' gf ewsf -1 'T 4- ,'A...V ny.. T4 .- ? f-?+.'159f 1, . . f 5. 1 A ' 'I Zl.1'v1lbTv'f.71r.11'-.f. tu ...L .H . KN. . g ' .LA . 5, , :aw .rx x ' , s.,P Pk 4 'vysXa'Af ,jj 'Q-Al' - .un . A.--A , . ,KL 7 f. . fxffg. 5 . . .I-H Q. ,rx ff' ' 1 YQP4 W iw 'LW -.g.. ef, Q.-Y nf. -' 2 ' . hz LA- .X-? :A1fV.A'v,' 2255-4 . ' .,f' ,S- '5'f...,-.. ..1, 1 '-1 X L. if xA...- .gm 3 ... . N .A .Gow hffff- 3:9 , : 12.5. . .--.gqhx A ..,..C- r .?t ' A 25' : T- 2 AE ,'..:1'f,A Wi- . ' wwf: Q: . .4 ' 3 Y ,W lv I-fi V : .s -H-' ..:' , L ' V ' .4-1 ' '- '4 fe: ' 2 ' sw .V uf: -- fl ,g, Q'. 5 A ' 1 , ,',',!J -A gg. 'A A U! ' 4 ' W'U,.. ., , ,, .. A, , ,A Ag.. f ,- 'Az AA 5.5-.. A ', ,, ' ' ' . -j,..r:'.1 nf: FFS. , ,, '-.':f',, ' .A LWB. A . V. f.. ,, . A A 1 1 . P-Qfifgfk .gwyli ,QlL,?::A Vw ' ' ' 1 f 516- -79 .ik ': f' - N HN- 'H A -A ' , mf :z. .... 17+ '-v.'fA1r3' 1 .A 'x '. 1. - . -' E.. 'iii' 'f , -A .mf-' .4 ., V.: .NH . I .wif 1, ..,., I 1' I ' ' 'H 31'1lr'- E- fx 'Aw' ' ' f J., ,V , A mg-Q ..,-,gi lv--wif' , N A-g,.,,.' ' .. YJ f ' , . A1pg A.1A ,. A A. A ' ' H '- M: ff: .A ,. A ' -v 1. .,ff:' ' 3' f 'A J-6 ...:3. Q , , ' 2 ..., ,,' A Af.wg?i i A . ' -. . Q -. 1.11 , , A 31. 'ffm ' I 'ff -V 1 1. - I nh ,lf f Q, - 1, - ' 'WI rl L - 3' ' y'?g'r.' 's A ,- ' ,A , ,. A J Vw fR1,f1f'. 7u,. ' 1 1... - ,M .1 f 3 - ,AQ A, . . AJ' ,- .--- Y r .A ' ,,.l .Q If 3-I 7 s A - , A A . lfqwd .H , l -A '.1'.,.' . . A it H, . wif' 1 . ....k.',v, - A. A A. fy. .3 A F N 21.4, ' A 4 A 'J' ,X-:ifgv ..,!,.g I . - v P , yy. me f7N55AfQA 3g 'IM' A- ' -Q-Q,jf,7r . 5... ' , '-' 'Y A. A A 5+.fE.f'? . . ' ill' , g'g1'.v:?fu! . .J A -gX.j',' -A - -4 .,- Av- . .var . : . x- , A ,,, . 1.4, .H W. - -A-A Ag.. .. A HQ:fQ'l'.4 vs . I .2 , ', :Af N fr 'Q,,u.,.w 1. - -n ,- . ' N-A:v,'A .ei-, . ,,., , . 'A fa -,.'..-gi V ,, f ' A , . A . 5 flu. ' ' ' f Ag 1- .lf 4. -1245 -.A f q '+w4+' ,Q A A A A .4 ,, 'A if ,,..-, VA f.:f.r. '-' ,.:f5Ei.'I 'gfmff ', Aa' .,f1',' 'u V , . QIVT, ,f 'qw' 'F 4 'iff V: . 2 J! f. . - wah' Q A A 3. ' Q :E-' J, -'lf ' N' ' -. v -X -1-A A .-. 'f .,., - 'L ' V 4' 91 1 : fn rg-41. , , ...gi 1 Dy, .5 WM' ' :A -w. -4 fi . ' ' . j'. w an , l nm ' 3345: . J. 1? .i Q A ' : '. ' . .354 'fin' . ' 5. .'1.Ql.I.',H.- 1111! abd ., 13' Al. 19p1l' 1 rr vw Ir W Tldmilllliii III. ..,,. 1' .. .,,,1 I mm1xiiiih ' WMI! Mun n lluu H S ,, - n ull mmm! Qhrmtting pau tn a treasure r nf ' - 5 Qlijerisbeh jllilemuries l The btuhents uf GPIB 3RurmaI MX present I Bnlume ilibirtghbix uf Ulibe Zinhex VIIIIIHIIIII Y -V I 'np -, ll mining r lllur ulm ,Il :IIIIIII elllllnl I! um ! X- W -f X l ull 76 lll H U e JGKZDZX r 1926 e b W r r Wm rlfl re ,. I I I I N 14 N l l lumn ag .i.11mu:,EIII'!IlI111 jnremurh Scan our college days will be over and we, like many who have gone before us, will be looked upon as cfllumni, and some of the things We have done will be called tradition lf, then in the years which are to come, this book will aid in bringing back fond remembrances, in recall- ing old faces and friendships, and happy experiences of the days which sped While We were at Normal, long grown dim with the passing years, our effort shall not have been in vain and We shall have justified the faith. ,,, . g 1 Illllllllll X- W llll -f X I mml lllu I f7?Z76X 'I t M . ,y flllwzllli ,, w -l it , . ' it W H T tllffiiiiiniift tft llu mf hllllll cc ci iiaiiiiiiiiifillnuna A The Zlnhex Staff Editor-in-Chief . .......... . . B usifn.css Ma niagm' ....... L-lsst. Business Manager. . . Associate Editor ....... Assistant Editors . .. NORA BRENNEMAN ROY NICCOLLOM JAMES GLASGOXV RUTH ADAMS LELA YVINEGARNER NIAURICE GRAFF Literary Editor MES. GENEVIEVE SCOTT U' Mcfnfs .ithlfftics .... FRED HUSTED T P1 , --5 TVomf 1t's Athlctics . . . MABLE SAGE Humor Editor ...... GENE PARTLOXV 1 Snap Shot Editor. .. RALPH KOBER I -- Art Editors ..... GLADYS WILLIAMS ARTHUR CRUSE CLARENCE ODELL g RONALD LOVVDERMILK Tweusurcz' . .......... JESSE SI-IIDLER Advei'tisiiz,g Manager ....... VIRGIL LIKINS Typist . ................... RUTH RITENOUE High School Literary Editors. MARY JANE POLLOCK EVERETT QUINN High School Art Editor ..... LEOLA HAHN High School Snap Shot Editor BYRON HALLALI High School Typists ......... PAUL SPAFFORD ALICE BELL -- L L. , . f-fi lnuulllll ,lllllIlml,,.. ..qllIm ll mlplm--..... . l I , dnl T 2 ,,. ' I eq S X H n W T' ' - T 5 'I Ill UI E 752 A v' 1' I 17? ZDQSX A x 1 2 6 l A 1 , i ,Q N. , I , I NND! I GTG rw SW Tfie j7ZQ8X 7926 QV QS Z .L 3K4 4, W' Q4 M I , J1 1 N. 1 I 1 1 X 4 W I w W W Q Z .2 Qi' 4 M X I 4 x W 5 N JWQDGX S 64 I tm ff-X , 4 , v X 3 Y! 1! Q 5 .1 M Q33 y flu : ll ll ' W il mlilllfe lvllllnnwn ggg l i irir la. ,, I a t , an lim. 'ml Illm get NEW ...tm l llllllllnllnllll Z.BeiJitatinn To QANGE V. QMILNER Xvhose seventieth birthday found her in her office serving our school. In appreciation of her high principles of right living and right thinking, of' her fervid desire for the promotion of the highest ideals of university life, of her patience and selfisacrifice in the betterment of' the institution, but prin- cipally because of the marked influ- ences she has exerted upon thousands of teachers by her kindness, justness and franlcnessg in this her thirty-sixth year of service the THIRTY-SIXTH VOLUME ofthe INDEX DEDIEATED .:' QII I H IWH II' 'IInn !mlIIllIIllP x .-- X- ' ' ' llllllll Ullll I' Impex I -J li ' 762 1 l .,,,,.,,,,-, --.-.-..,',.7., ,, --- if -'- a . n a L up ...i f' l.yl ' auM lmffEEEi!humum' u ,,t, lml, . i .. mmnn1ii a:.: mm, v T w 5 1 Q 1 W I . . H l N I w 1 1 Y 1 1 W V n I l 7 u n lull lll lll ffl Q B llllllll w me mllll 1 1926 1 . , , V f l A ZW mg m Zin Memoriam Kind in thought and manner, patient, generous, companionable, loving scientific truth for its ability to minister to human needs FREDERICK DELOS BARBER freely gave himself in teaching, in writing and in public service that science might liberate mankind from the thralldom of' ignorance. He loved God's fields and wands and streams. He loved and served his fellow man. n i in '1 '4 ' w w I i- V IVR! i I O '1i a. H i i ,I I siillllllllliiiiiimlllillll n ........ - 1 ,E Q . ....... .. .1.un nll llllinl llllIIIlI QBriJer uf Banks B i BOOK sl 96' The University BOOK 2 Classes BOOK 3 Organizations BOOK 4 Snap-shots BOOK 5 Athletics BOOK 6 Activities BOOK 7 Humor BOOK 8 Literature BOOK 9 High School ..!'R W- B IIIIIIIIIIII l ,,.. I i I ' ,.. u ' I I lllll D I , ' 1 6 . ,,V..,.-f-VV-yVVf-,2zf1s:- ' ,.':-'Vw . V f ' -V ' VW- 1, .,,,. V, -f-' , ,, . , , --V V . ,IfVrsgiUm?-'Aw. -4,1--'9.'5VV .V . V V VV:Vv:.V:fafV:-f,-1gV-..V-,VV,'V---'-V'- 'VfzVL.:Via-s-.aVV.--Vi f'.L'.:QV.V-.V,V. -r.. ..,J-7VJ'f'VVfVVa-f:crf,1:-.,.'V H1 V-. . V- V-Vr ,. , , V ' jing, ,Vs:,,1N,.,V'L,VV.VVu, . -1- . V- ' V-V,V VVVV-V-fl-wf.w -VVVVV:-,V--VV 'V V-.-V1-:V :I ,VV .V--:Vw . .V V V V.V-'yn V- V .VV V V V.V - 1g,nff5n'Ve-4..'rS':5'+1::7V V 'Y V . V 'V.H?5V'f,vVc--'-VVV-- LVFfQg'aV.-.Vw-r-3'11,v7:, ?Aw-in mfgLffw5, 'Vf-17--wwVV.'V'VV:.v.u9.?3VV2f VW'-1--f:5'mV1::,-'LVM:V..-V..--4-Vff,V-,LL!VfV,..:-U57f-.5 ',-V:VV-'Vw-ff-,gffl-'55-sfs?,Vw-V,gVg,'gv,,VLV.-'gVV,-Vw'-y,'VsJ,4,yQ?-.VV---,ua-V-g,:.',-V .gains V 4,wi7q5 53-wr., 1 V V. v. ' 21.-:'fjVi. f.:-CMV,L..g:g,315'-1:J11i'o'r. VV e.,Vq'--swf-511.1!sVV15-wV,V?V'--1.fVV1.7',.:g-.1VV,,--VSV'-1 .VgV,,gs-VVQ.,VV--z!Lg1:7,'gV,r:VV1-,,,V,.V.-V,V- Vfgp, -, ,f,3g'5.,f,5:'-V,uI5V.yu,-Vim,g1.ggq,,VqL-w5V,,V7-,y,,Vgg,a..,L,,.-,9l,ffg,34-gt,, ,Q-,UG . Vvwwllyikry-p-VST-.sVyV:ff'V,V 'V V ' V-:VL VLV-Yrw-V--115--Qu-au:-1VV:'V-V-TVwa'-:m.VA-.':V.--wV?nVff-'wa'VVVV'-1--fV':-ww,'.11vVfV3V-V1-VLV-Vr,2f:'nfr53Q5V.:VV-VVV :Vggf,Vn5V5rff,VAVV-VV!V..: Elf..:.-g..A-V.VV-VVJSfg1VgiV'Se-!VcL-:VV-VV:-',V1,,-QVSHAHVVVwen'-511.5'Vyvwf-V-L-FvJ.:.' '- g5ge:,qVVVfw'.51.f-VV525551-1-fv'.12rV.,V3,mg-gg-11.gg5,4f?.5LVg.gig.i,g'VV-,eijlfgeagiV-1-2-V'L-'Ui-'Liii21gzV':S5Vzg'V,1V,V.4G5'.mig5Vf5!inVVV-quVLzzff-Q-TciVg-gff:z2 5'V'4W1'R1VCVz'.:2xcfr.4z-1-4-72,25e5gV?2:zv3w?g1Z5s?Vnf f-he - , V V--qi-'VV'V2'1:jA1'sV'.gaps--VV-g1V2:f11'aV.V-577-4Vgqgslfim-Vg :,,V:'V4.7Q.!VV-'VV-VaV-,LVVVQVV-f..,gL 'VV V-if-5 haV?-V-.VVJ.-11:91-2:2b1V--, ig-,,VV-,!V:fV'VeV25-',5V5w,z1:'ssJV.V1f:-rdfVV V-fa-WMif!-V-V-VV' VVVJSWQGIQEQ-:VV ,VVVWLVQ , -...VLH-,-Q-p.,f -. . V --V..-,.,,,.,.,V... -V,,,.,,,z,V, .,- , V, V.,.VV,.V..r. N V- ,, ,g,Q,,,Q,,V. ,,, , MV., ,V ,Q:VV1,. ,. ,V VV,,,. ..,,,.VV.V-,-V,,,,M,w.VV- ugifzz-':,2f',.V-2d?g1wp51E,w-r-qlsp , V ' ' .l,L12'iT'7VV:4V.,V,.g-v,'!':4i-, V',my-V-L S.'b V3-1---Vv3VV,g.,V.7 gVV ,f,v--1 ,213-,'.,gfVVVV2',,-1,L:J'.':,gVVVVLVW '1,,:,g.1':V',.H34VVt11z.15i3L.:,mVV4-V g,z3':g.3gV,VV,4q-Vg--.:27j'zz9.:g41V.n.,g5:V:V -- if V-I -z . g V, VV ' 2H:!.JVzVa'1' 57145 'VE'1EV. V, Sgiimix.-VVS ' . , U -h'V1.-A IR 1VVV:V' -V 'VV ' V .' V' 'G'-1-'V42.V,-g9f,-V'iif-'affef-P-fviiimai-Zi'-k-'QVVi,V,VaV3fV112vV.?--,-V4-p,gV-V'Lyfmsn?-V,V,zVV-f:1.1'f1f:VVVV-si-Vmy3r.L'.1'fj'Nmug-gy1'5V-at-xii551-11yJJV'Vg!VVwawrggggv:f'V:AV1gVg155f,givp: V V - - , VVVVQJV-,: , Vs-12341-VV:-.Vigr-mfr.,QV-esq-f4e.am1'V5'fffilfgfmfaez-2VwasQimV,..'f5'-xiii?- Vziav:Lg1V32'VaY-Wg-ii-155:LV-VV.-1259-fm-Vai74-aifghe-QVm1'fV5a:fV2VZVa4a2z1fpg:7f:?zeV2Vg-igfg1zV: 1:95,-12,1 ,ff , V 'S.75'ff32gV'.uf-VV641-23171:e?msVv:55az7.:is.'.-Vf1givg:'xzx2,V1VgLV.'.V--VV5-Vvagal?-.'7V-.1312741,Q1V.CQVsp'q2g-,553-V,.Vp.:,-3VVgfg,2-g5mV4.,E,-VaVVY,wg9:bf'.5.1izp:sV,mL1Qg1LV'VLvflaws: 1?-'VM FSVVV' V' ,V , 1 V V: -iG5s1,JV3V-':V1'fV9rr-if 7'11V5'1l-3'fJ4-i 1.79- 1'-:V-:F '-71'-Ser.-:VJ5fi2ivS5,Qf .V.V7VQ,2nV'V'V2'1CV.-,iZ--V,-v1fVf- ,V-1.r?V,ff:G? 'SML -1-VaaVA2.-5L:'ZL'.iV- Ven'-'-Q, -- .5-Z'fL.i VV-V--VV - . 1 -VV.. . V Va:V2:-V:V2Vf--iffnVw..-MV--VVf-2-VV-mewVw-Vwr.-fi:-VV..-LVfQfV-ff-ww-fV2-V.V-mf-wVg1V::.V1V.aV-VV-V,-fu-1:2--, ff-V-wVs.wVV--VVV-.'f.fn-.f'VV1:wV-V-VV-eV.we-Va'V'Va'V'z-. U-VV- ' -- gram?-439-35 -.pV3,:g,,: VVVV4--I--g5.V?,gf::gkf1xyyg5gsqVmV.7a,.V4V-w-5f1,-yV:-V.1-?.,.V3.VVq.15,15J!VfVHVQVWL-gV,:fn.galfwfffg:Qi .-3.VVAV7-1-V'nzw1-g1,Q7--WAVssfyialm we If.M:V:fg,z5w,LVr'5,-VV .VVV'Vpf:-5VV?f. VV V 'H V. ' JI.. ' .V ,V ' -91-VVVe'-VSV '-V5-7:'V:'V'f-i'ZJv.-V'Vw'Vg'-1335.125.31-'f:4f-Var.-Vefa1www-iVZ'Vz'3cZfzg'V1'.'vVc,iV.fLVaV-LVVVgyZ'V,:.':'-gf-..1VV43faeys::'a1xn'-VVQQgfg:1e5,1-Q:-p.-gg-.-VV rm-'bgsimpg ,. famffzm-Vefgeua-.e:zV' - , -' V'V -V V' ---.VV VVVQVVVQV,'nas-VV...VV-VV-V-VfVV:f:gf.f,:VL'-LV:-fVVff5'ga'V2.-QLVVQ-.ufV,-,.V:w.zcVV-541.:fVg,V- at'---VT--uaV-'7Lw.1i2-Ve- 2.-vnezs.VMVQW-V14-V:'V.c1'VarMVfVVV1-V,- ' icq, -5 1.-vim-.ff-':r,L:2-Tx!-V zw?.f1-M11 Y -.v.V'.mf-.le-JV f-.w-'JV:aVLT,Z6iV -11-V'.4PL2..52--VZVVvigaxf.V'1.'w1-VV'3z1V.VVVV Z.Q2g7VVfV fV',VVV,-:V V,V,f'5nV.31f.-VV4cV.'-fp-ggr.,:v,VW-..V--VV.,f1-154,171-ggVg- 4.1,-W V. - :-www:-.z.sV1Vir-nw.. -r'L',:.V:V225' t 'VAN-1-Vv5,'J.1ivVV'V55-LV -M Vjg1LZf'VV'VVV -ffq-Vg-f' -SUQVVV-VV-,fggfgf 34V VV--V3V-V11 LJ--.VVVV-gg,Vr'1V1,V,Vi. ,.- -VV-4759'-fzL :V9.f49V,-V7-.VV--V-,.ggg,V 1. ,V V- - ' 1 --',eV2zlQVVgVV-Vwn V'.zH-?V7l:e--VSV--V-1L.4:i-:fV-32122-1.,V'16 11127-4511-r?'jii73h,f-' :V ,gi-11:75 VVVg3gV. 21V'V..1:VV,1V-gV,k4Vj-Aga,gi4f.v1.'.,VV.,-,V-VM: VV. V:V- , - V V .QVVVVQV-11.2--Vw-Vewsgzf-Hs V.-Vi-.f-c.Vf:1m-VVV- QV :,w3.QV-V-' xJ.fVg-a:VV.V1-VV4-ffx.a:yV, -Q.-V,--VVeQVVf V - V 1 VV'?V5'Vf- VV553111:-'VV'5-QYYYV VW-4Zim?41'i1f'T12fVEf,c'1..'45VHVZ5?ef?'Eh'VZf'i2V'Vi'L'VV5'ZfaQi-2-'' , EV '- 'V V' . V f:V,.:'.V.:SaiHie?fQV-1151sfW2i-i9'7mi:.CiQfV-V'L.2: '.1.Pf1'-Vg'VfaVQ1'??EEZ.?VV 'VVWP V ' ---Vim. Vibiwsm5:4-wesp-7,00-fir.:-QV'-'-2.,V, Vw- .,VVV .V '- 3.5.iN1:vSig:V'Vs,1gfsVV-,VJ--VV, 1-1.5:-V,V-1-,V:VVQVWVQ :fuVVVV.,--.VV5q,:::gi-.,-V V121 f-Vy5.,1ViV.'91,VVV -,-5VLZVVLQLV. 14V-5.55-V7n:z-fVy55'ZV,Z:V-.11-V1-'uf .,VV,.-.yz-pq?-' .zweei-ejsvaif fV1:. :V ' V,2-is-V3iV2.:.V1V--V-gfVm-zs5qgg-Lf.f,5.V-5-3-V,V-yiVI11'?VVf.V-e-H:V-'z-VJ'VMS'-WV-4,af:fm'V1:7'fLV-VQVVFVVM:scelwfssd-PV-111-3,2g:::'fV-QV-:iV.Q,V,L' ,,5,2-:-',?kV:Vr,- ' -, .' 2.5,i2,qimW'W'29?g1ff,zz:VJ-V15.?V?f2fVfg5 -- V V , - ' VV - ,V ' '51-VVUVVV-,-'V,ZV42f'f:VfV-V,VVwas 1':'V24-'1V,31,w-,.VVCSV?2'-YC'--SVI!-VV'VezsVf:11A-fb---V-VVV.V.,a'a-WiKIVV-Mid-Vx:1'f'11'Ff'F-ShVVV: V. .V . .. 'QV' nf?VV:'L1:5f11i?5'53?,':'.V'543' -V:'f'-::1.3'1f7:-5e 1,'V':5 -51, 9,5052 ':?9'3:2'LZ5-V'V'f. VV?-127'9A-'L 1 'SC:9. '-3- -2315. ' V V '2fu1 75.i'.' Q' - VV 1.-1 '- -Ve, 1J ..L.lYDvq1' 'J1iJ'I'.l- 'V- ',Sf'::f5i fV7.'. 1V' 'f'5'.', '1L2E.v'GVV-V- 12 C1i'UL?,-fi,V.-f1 V '7 Q 'L7ECi UAMV ' I 'IALLTVVF - V 1 V, VV VV -Vi.5Q.Va'QV'-'V -V,.V2- .-TVQ1?ffe25.1VgjV11-r3VV11515.VM-V'i:5:EZziV 'fQ.Vi',131UQV72215-V?EV46jV?gai-?37'lV15?Zf'EZV:jV. -' ' V V v A 2Vf,V-'VIbrf0fi EVP1- 3f7:'Vv. 5I:Jf ?'?i'-:S j-'Swf'-: .f: -41 F-,alfa , V:-VV, ' V-:--' V . I fa: 2 'V , - V I,Vg.V 5515.23 V17 . ., LHVV 5, 4g',V :' ':'7'2,,4J 7-Vi.,,:. ,-V:-e,gf,7,Vj!'5,.,?.7v agp--g7'VVgn 1.3, . n ,gr-1 17:4 'glib' ,' -yi -fVfV!fygjV'g,P,V Vg. Vn34'g,f'qVf:1,a3,3+5S,:J.w:,g5'JS5S 7::1' VV V.VE', V ::'5-4121-'V 'D5VV1 V- 1-f V V. ,:V,VV.'gy-nj 2V5g'14VV'V , ga-z:z,V.V ' V-1: 36V :'V,1iV'-V gf-5 rf-VV,-,Ig-'V6..CVV1VfeV-JV'-C-V.:-V,:a,-,Vf:f.'r, 'dxf ,. in .-21-.,VV - :-.V,V,- V -,V ,, VVVVV5,-:.Vw,.VV V -V ,VV .-L. -- .. ..V QV,-V,.V-V,V,, 1, , V ,VLVV . -VVVV .V-VL. 5.4.-VV V. 5.1.0, V 1,,L,,gQ,w,,-AV, Nw, 'gas VV V1JV.sfwz+V.V:f:. V -Vw V fr -rVVf VL -Vs.:-Va z-- -,uf V V -I . V 'jf f--1VVffcTV11-?f'q5fVfg1p:,jVg9VV?Vmg-VV-11z'VQ'VgVV--5-Iwi'vw5.:fnVVV,.VVV--VV iii-f'?'3.V1-7-Tl - ,Z iifll '- iff' ,-af-VI f-'.V'I'VVV:fV'ifi'3i-5555ff'-V' '1 V - iVG1:,V, 1 ' I , . V , , , , 'VV V- . V J,-' . .1--VfsV5V:aV:VVVs12-V+--V,-:VV-5--Vw-e.VVVaf'as-3.-a-V--VVV'.-Vf,.V '- ,, ' -N-.VV..V.VV-Vw- -.V4V':VV- -fV'V'- V -. VVVVVV-sf:-1V-ff-,.-VV---VV--:-5omrV.T-ap-QV.VV-VS.7mV+Vf-V?--.wavVPSVVAV-fqffV,VsVf.zw V .f ,-z,1,,mVV,1-VVQVVW.,V,sVs,- V-qi.-.a-V-:xxx ,-VVV4-Q.:-. -V4.9-VVV-.V,V - - VV .Vx-bg-VV,V.V VV-,V -. V . . .. V1.9-,: .V-4:V-:- Vzfvws-sf ,155 ,V JS . , V V . m5,VgV:5..V,V,--V ,V1.1MCVVVV-VVDV'----VVni..-LV .VVVV,,v.VV-1.5VQSQV,-,vw-1VVfV-'fm 453.3-V.-+4 ,' -VVg,-51:-93-g:k?Hp51-,rV?g,V459 -V'-1 -V-:'.1gkVfg1.i,-' -,-V1V.JV'VV'lV-95 5,531 VV .V,,-iw-Vw --:-15--:rz VQV,,..: ' VV -V2 ag.: Lffgqgf-if'.V':.VVdgf3V QW gg-.sf 4-2,314V,VV'g5f-4:5-g5Qg2i.1.V'V--ggi-5Vv,7:fi11EVf ' ,VV V--.JVVm,V.-VLVXVVVSVVe VV, V .- -Vx .. -- --'ff V -1--1 .1 V. ,V --,. V - 1Ve'-Vx:--V.VNV--VVJ2VVfVfi'VV--JV-'VV'-Vznfw-km-QV.V1V'-MVA:-.,VV-QfV?v'--11-V 1, ' ' '- . ' ' ' I-'LQ' -'23 Q . , 'V -F, 'g 3' V 4- VV: aVfaw'VVV . .. ' V- V zVVVVVV:' -V V ' -- V-V-,V-VV' -V-V-P V. -1.1 ,- ' VVV:-csV211VV-VV-V511-g..:,:.2,VsVVV?-VV-V,-V-1.wmaVlVwVVVf,4fVV:':f22H-VeVV-V: . 'V ' V .jg 'U-3.3.5. jQ.VV'f' V722 ', 'Q?7,f4.Q V V g.. :Q: , :VR .'V':i - -, V' f' 'LVVV 1 ' V' N 11-I' V, - ifjT'V','1V1-Q Q-429,-9.14 .-'V.7'fVPlN:Q9-Vd,Ua- QZEG-7'fq-V' i! 7 5 fr1ifJf'v V ,. ,::-1':'- V1 15:23--V 'VV V .-TV:,VV..:'V--,fg:.x-- , JVVV-4.4 . V '5'- - 31:-1'-'V '11 IQV-21-1.115121-12293:571an-12i7l-W-'75E:sm:'VJ9f14?-?2f.V:f'2'f'-'. V-Vg-ee:-1? g,-:Vf .,.,V.V:55V,V'VV2-5VV.-3V.V ,V V- Ima 33'-z ' 'V-1-.VIP 3 -7- .V VK-2, V V V ,Zim 52.2f'V-11-3231-WV31gi-pci-VzVViffVQf?!2M12fc.f1zi3r5 aA?Zj,fw'fi:g:V2'V ',:.21-V,3yV43j:21IAV5Vr,,-,V,.-Nfgisf.-.a-Q'f,1--'5'.':2gV':QiI5-'iqVQ-2,3119 :J 3:11553-'1lE1',-95,1 , - 2,V-?1g- LV V V , , ,. if 'V',:i'f-V V ',.,' V-, V' 4 Vffl, gr F1-: i.IfV',.2V.-'i1.- .5 , '- .,- 7lVfL '3V.-V. V-71 V17 j5fL'r.lVV'-7,f,C ,'ff LUfi4'E'4'f+4 SV V Y27i fl.v'i:UHV?Cj!1 lV V .,-'Z,:a3E'.5E'Ef:-,-,. Vw! -V--up --' V- ' ', - V6Qf.fe'-Ve-ff-VV:-1V ig4if-imc:heat-V,ZVQEZVLQYQPJQIZ-2-T55VW--iu'5rbZQ21525Q-1: 521. '-VJ: 215- Vi'P'if:--' ' Q:-fl of Vii'522VV '- E-i?'V5i?-'315'EVV??f:i'LI'i?V'1 ' 5 KV ,V-C' Vlj .-:-'QQLI-1V,V .':.jJ',,2 Q,-:gV:::A ,,V-N: ',V.3gf:lZ',V.5.g1'VV.JVg.- .Via-.-.1IV-.-53'5.fg,n5S-',51:.V.Vg:::.wi'-,3 Vp--5 Q 'g Q . .1 f V 79-Q ' L71 ,. 'VL 'Vit -'jpg-5, ,,.V-ggi,-V v ,V I, I,L,4VlV15.u51,jVg!5'7- VV ,j.!iV1g'g-2134-3nQ:.17, gf .1-lrjyj-silrgffguffjafyysx-Qvjfizfm -1, g,i7.y-1, fwfiw? y . -19:2-:-.rg -'.zVVV--:,EcV'a-:-1-V1 A'-mi'-: N,-. L9-Va5e?V'1-2VVr'V,: . ni-V',V-V:V --'Vw ,'VV - 1 4 Vx- :VV ,,, ' ' V, HV' -' -21.--5. 'L1VV,, V ,- ,,VV-1,352-Vyw?-,pfq ',VVgV7L.V5pJ-41,176-V'-ggi-Lzflgg-1.4Eei5V7qAxgfV.f6wifgg-grim-fdl.V. ' ' V -71 V25f3'.V VF-VA 2-32'P9'--'1'33'Z5.-fivcis, , . 'E'VI'QV V.: 1' - 'IV Vf','.I1 - fc-f'VZ ': V v i,IVf'-. .f-1 -V ' I . Pb ' ' ' 1' - V7 - ' Jfii. VCV f W. '33Zki7i-' -51 ' .JZLVTV5 'MD'-2' FJ,'LV'VVV-'f-ff'-Wiff7 1f'1'iffY,G11lL.:f-f' ' f VI.-1 f',lV1V - ,Vp,V--V..a.-fog:af---y5.:VV--4:5.V--.geeV:-2:5.- , ,V-VV --.924---..f.V-VVQVV -4-,1.V,1-,V V, V VV , . - -- , VV-,VVV , ,,,,Q1+-ima:-V-1-.55f,V.,.: ,V VVrcz1SV5f41z,.,4:fVV-V-4- Vemgzzzyi-Vip: -:VV-Vesfrhzg.-,-,V-Q-VV , V- V ,V 1 ' 4. ' .,..-rawV-V:weQ.-.:AVV--,:v-:V-:-,ag-.-V-VP1gVVVV.V-:V4.7,a,..VV -::-.V.-QV-z,Q.y:::..1-.fVV a-.-1 VV' - Vrfe- V V :., - V-V: Vz:VV-rV-?::.,- 1- 112.V-V -V--If-Vwfff.-'li-fa''VP-V47v'1FLU1-'V'11'?v'V' V- :-VHF 1: V Va.:7Vyi?s2f'1-V'fi:visas.:5:-I-f5f.:aeEV:,'e: fg.'l1'2?:1swV:::'- 2-e -':::gV-'-,QM V f 32' , 'V V- V-1 aff- z- V -, -:aV.V'f1Vi-V, V ' f'Veif-VfVi:?a'.'-MZQV 1-Hi4l5-Vs-w2sf.qL1fV'5Jf' , -V 41'54-'-55-15,'-2:-:'f,:5:1f Jwzigicg-E-qigzg9!5gfi:Q+:E',EFg'i'T Y? '-:QKVIF5'f.VgQ-1-1i?:Q'E1C'1.F-3 1' , '1f'V'f 1,g2V'2:1fkf -' 1 V .Hg V - Q.5FfCV,- V,l ' ,' QVV,VVV5,, ' f.. I ,qw TJ7q'7f,Q'fli'Vff V-:IS-f7'fV9i'L2gVI?g 7V,VV,?-grep: Vp'-52' L7 V VVVLMV.-,-:q1,V:V-Vw .CV - Vf: - . ' V-rfff V- - 'V IV1-U,fV5V:-EMQSQLHQVVV-svfmifrf:-QETJVQH -,VV ., '- V- J -VV V- -V ,. V .. V I' -I '-1.1253PLM?-ff-Vi.i:2V.iV:1V'VfiVf!2L-f VV--ui-V-VV-. :s.1,,V.f- -1: .V-,V-.,-V-VA-.-V:-1-V-V,--1: z VV -:-fm-Q-,,V.VV: V - .- -, . ,- - VV.. V-VVQ-V:-pgmz: frVe,gV-L:.:- . -V - . . V'. -'-A251312-112. Q,--U, V'Q,,211-iss?-fVV' ,j.-:,i:'.,gV ' VVHQIKJV .- -. V Y 1 pf --, . it-.fcziri -:LV Qi-Vw:f5.1?5q2U5V-9.-:,:,j11f'.V'V5flw1V' ,A:55:gqV,:3,gV.3f,gV5,gg,-.5953V4'Q,:2?Vv:g1:'Qy9-22521, 'mm - 'eggs .,-VV-jig 'V'-3,1 Vfsisgwi-1.3, SSL X' -':f,.V' : VIVQ. . .- V V' VV . V -Vzlffi' - '.-if. V-5vwv2V'5VV1:V..V-Syse:z 'r'l:VLiHQ7-if -- V V,V.-gV1-,:VV--Q4V5,wiVy,,2mir:-1-Vw-'-S'-wflieragm '-7'-V, ZA? .f3V'V1-F'vf- -V:,VLrV: V11:2f..- - :V V s'13:w-p?fr5r.r- JV' - 3.1, .-,-V-:V1-1- V.. 1, M- , V- in-1. 'V VWLLVJVTQV-f1f:G'L?53sgi1'V-.1'1- -'V.f--Vfwjgzl-V. 1 . 'V :V--1-tGLVf-:Vftb I lVffV'TI22'5'- fiickiiiwifv' Y! 151' 5f'1VS i91'5:R41,5: Yip: 1 -V VV JV- ,V-33 frlj J' :If ' ,J j1'A1'?:',' V51-:-V41 'fVL:VQ4gV'.?42L m',,1Vv'5'L:Z3 :Q-'aw-LVVV'.'-wif-V-VV-13e'eVGV - W 2 .Viz . :V-V:V'VVVV'--'-Amrvii'-Vmesizrxwssg-5--'-zV::s-fidfiriw-2? VV 2 , , .,- ,V V,V'-VVcvVS2-V-few-1Vi-LiV'3-V'aVV'---VV-:.v:u:zV4z-'VV'-VV V. V- , V -1525- V V V 3. , , fi -fif'3gt43'f'5'!li3flQfVH15-'gS'vg:f!1.Iij.5iQ'-PV V1-1-3. -, 12 V V. 1-1 VV: V' :.- .1 VV3:P.'::-IJEVVV-V521 .V.'aiVliVT-WIJVVVV' VV---V,:-V-...41-Vx-VV--,-V VQVVQL- -s'S-swf-:'JQ5p. ' V --9-5-15-',.,-'aff-zerqwmzVVQ35,-2--225-1-wma?-w?.ffmV-,-:sQg-- . V ,, ,.V,-4- 2 . - -- . . ,VJ - . V. ,V V VV V. ,V..NV--V9.9 1. fri 'ffVlif.1s-?-f--Vsf2,'3':V1'-: ,zpygigs-wg!Vgffn 'vw' -' Vw- V f , Y .- ' ' Q ' 11 9 V ' VV: 11559-Vf wi:--VV ff.13,1V32'V 'V 1 H--V:22,fV:.:2'2Vgp,V'-sfVQS.z'fV.:2'--fr Vx,-V--V-'-:gh V, - V-V-VSV-'QV ,:V,-V Vu-., ,, :V,VVv1V-Vy,VV1u.V::.V-.,7VVVV5bn1az:- . I1V3,E'mQ1s2::zsVEi:'.'21f1ble:I-f-V Dire.- .i'VVsV-2:2P,eVv'-34.3- -. V F-what :Vmsgsq-E.V-',',',1 ,-,2.rpVV1V:V'-,-..1E:'.:3E-1:25:r1V:j,3.,VV-.1--. VV -' g,V,V .-1 1 .V1-V, V x f VV :-,1 V V-7-3 gg- -,,.V1Vf:fv ',.VV.g,:f ?.V5-VVyw-VV-fe-- V 5 ,. , --V ' V V - V-V-1-gf V-3-,Vr 1:',1V.vZfV-ZVVVQVQV-VVUVVVVVVe-ig.41.11f45,V. V-1 V-.--:-ck .. 1V- .,-fs-mf. , Vw.--,syn -asV,:111-VVSVV-MV'VVV2nVV-'VH-'V--2-V'.1: f --V--':::1.VVVf.r1V,.1.-V:':a:,.,,-VVV :VV V -fV Vw V 'V . V . -V 'gr 'VLVAV-VC?-v.--'V E:1. +uQ-H'wV'-V VP' -V,--A ' V -1-.. we-CVVJV: ' ' H., .' V2 11' , M ' 2-.wlreip ?'sV' Vu:5-vV.-- es.. 4-'ff'-Vebaqzff' ',VV1':f4-Va -: '-V-.ff-V--V , -f.z1V,'V: -1'EVIVIV-'.-:V:',.--sh.:. V ' --.1-VV.-,. -L 'V :RV--V . V -1,--Vw.. z1.:'V.y 'AV:,.,-df--V+ -V 1,1-'VVV..V.fs-wg, -tp' ,V Vg. f , V, ' V, V 6 NS: VV- ' ,-Vz'-? - 'T jf41'Vi'5,'2-' 9'3'l'-V4'. 72'f1fE - V-,rj ,V V 110555-52 fV1fE:Zgfg:5 VL.'Vb2 -wfqVp,iVg3.i'VL V -V , .V , W, . . ' V ,g- - V ' -,:s.gaV--gV-Q-as- 'V V, .. -' ' V V - gy,,-3'--g1:,yV,':F,z-ff.wg-V-'wa-,-if - 2- VVVVV, 1: ,, -nj-V .,-ga.. V-fy-.,-1' :71 f fm-VV' -VVg2?,'- - 'V 5f,':gK VV -V 5-si f,.V 1 -1 vxsgii-V-1zzsiffgfg-4V.zzf,'Vg1:3 f'V1eV-VV - V- - V1 V v eQ.1m2-.fW:- ,V - . V pw -sg -V ' , ,VVV-5-2.423-VV.., -V1,....V V ., -V ,. ,, ., , , , - if-s,V. V VV rw- UVVVVV- Iv-24.122-.,'jfl-55-12 V 5 ' 2 0 V ' V ' V AVQVHV ,J CQQVQ 7' N' 'V ' , - V . . V-'TJ VCV' L 'I 'f ' ' Vi' H - 7 .. V -V f' .gif V-!:I,V.L-'VV.fV1g,,'V-mf-V:I1:', iff, VVQV..-',f. V ,'1V,:p'2aV.' ' V V-15,-QV V51T2gVV1sffgfgi-.Q,V.,i.f.-:VJVV-'-1V'7V' ' ' V V ' V - .- WS-2 E-'ix-W5'V L7,'f-- - ' F- 37'-':'.' ' ' 9:'f5'Vf7:'l ','.:':L V 2 5'EW Pf V- 'i '- 'FS7',1-'iilf'-J:Vi'5a'.52f:i1Ef?VV'2 V' ' 1-F-.'VV'V41v PEI-.-V-4'f'?I.1 ,'XZ, 'VV'-:2197iSVi5 'V aw- V- N - 15 V- -- 5 JW ',I Z?WVV.iTL:fi?VV?E'., -S31 V ' '+V3Ti':fV'-':l:.2'f'V E5 ''W' ' 'Ji' ' limi - :Vi ' V' --VVVf:L-1-5-2 QVEQVVQV-T, -,km,'Vx-3,-'-.VwgwV,wVi-- V-,M iw- Vf.LV'25i-,VVV:V 'V -,,, - - VJ' ' . , -a9E2?'.1V4-?'ff1i-1V 1133221-1 , ' V-- VV- fV Vf. T f' V- 'ae-1?-1.2. '- ' -' V 1-Fflfs ark'-gw:if:Qp'g1f,aL ' I1-f !fg.'Q.'f,g L5- .H V' -1-1-'.:'fl,iVgV -1' 5-I7 IL- ,V A5 i ybpw V .,V. -g, V' VT' ,1Li1' V'-V- VV 'X ' ' ' .V V V ' , Vr: - :,-,wr 34:1-1.,' V,V.V.-v.:V---Vf:2Vc-142-'2- -sage' ,.1z1rV-5-VVVV-V V.: ' ' ' Vf?f,rV,,-VV - V V , . V-V, 1 , VI' ' ?V,E,'?,5,!9-21713V'QC'!fV,. 'f7:'f-EVVQ - , f!f?,'iY,?V-'J-.73 Lrffiffi-VVTVV--V ' 'Q -giFf3C5gVV!5E.VI R' 'LAT fwyj- V . - V ,. ' V ',g:V'f1V., 'GQ-225QISKNQQZQV'V-ti.i2,23:'.',',IVTFQQII uzlf?-yiVf1wV.15VVeV-'-fmwis-91:-:V-V ,V---LV-VV-.iV'VV-VV-gf ' - -. VV -. eng-,,zVV. V'V -V---' - -. V 'V - 7 - fa V-VV1: ff:-:VzwV1-VVS,m-ra-V-VaVzV--:.V3VZ1,V:-VS-H 1, V ':'s5V3s3Fg,gS,'i5gV ' , -,,'- :VV V :' -' . V , 'L 17 V- - . , . ,, 3 - ,VV VVV- 'V V V --- V V V - V MVCVH-1 r-.'fLVV .V ' ' ' .,VVV-n.V VVV:,,'i5ZiT, V- V ' ' . V . ' - '- : S-' ' 'VV' V : I P 'V i'Q.'.V:T5L1aV,, ' ,.V-V..1-1VV 'Q V - ' ,fa-17:V'v'.:1 if 'V ' E V 4-j.gs.V,:VV . - V VV: V ' V , V , f. W2E'fGw4.t.. ,sg f. - 2.41 V 1 -il-V, , V - VV 'fs-,iVg 1-if? -V ,. gfg.f2,s?VV V . 5-:gpg-,.z..-. -. ,zj-,..V V Q .V V ' .,..V , A ,: 1 V , ---V-Vggw V V, 1-,:,,gQ.,,, .kg-V .Vfpu V- ,Vx .I y-i2g5f:,-5a2'.7 V- W' V V V VV , , . V 2. ,V -if '- Vg V, ,' V. 4 4 21r:,-.1127L2fAi:f4QQ31 - . flqi-iVV4f1r'V.zV' ,.: 1: .' '11-2 ,V 'V V ,V V - ' . h'V2'V.V., ' 'V 'iifii':'??f:f'V'iEi'Vi'V 'C l'V:fi-'?? FV -VV-'se-Tsr.-V..:fV1--., '-VV V V - . V , - V V . - - V - V: - . f, V:-1V-'.V:f-V::1':V:v-V .V'V-V1--:VVV'V-VV.1V -'VV 1, V:giVvf, VVs1VfVfV- big- ,- 3, Q -V . V V- , 1 ' ' V VV i 'V ' - .iV,ga.g V - ,j-35,,V--,V-.,g-335V,gg-:VVVZV V,V.m,-.7-g5.gjp,gf,,,-g YV7 E V V . V . ' ' 'jf-si:-' ' i-.V-215 - V ' 3 ' - A . - ' ' - ' ---V 'V' VV'V-,gin VV-ff5 ' elf?-i--Vg f ---V--VV :V ' Vp - V ,riff -- 5 E . 'Q y Q ws, V ,l h E : vc A H -V Vu.-,-,l-K,-.K-V.,-j'j, 'Q 3 3 - S l V V V f 2 af 1' S 'fx . ' 2 IV ., Ci: fl ' - . V . 3 - V Q , - , V V Z - P JL 5-V V5 1 ' E ' ' I ,' - I ,N -vfgll ..5V,VV1. : Y V V, C - E C? ff' - V V ' V' 1 . 'mm' F V Q i - . 'Z 1 , , ' V 9 2 -V 1 5 V Ig ' . V VV V1 5- VIZ' 1 E . I .F , V 2 'V fa- V' 5 V ? .E ' . V, V- 1. V .-'V-1 'g 1 V f V ' 'V 1-'S' V, V 9- , V.lV-fVV Q V. .oV.- V VV V , - V V-. V .,., VVVV V , .V V - ,. , V , , V i - 1V V -. . V V V V- ,V:VVg V me Q V, f V- ' , f:V,5f'Vi V X ' ' ' i Q .Y g - A':,,f'k. , f VV if -'VVQVZ-.Vrsiff :V .V , V .f -V V - '-ffm- f Z VV :.V ., 1 . ' f I 1.3471-l flllarnr L .... ., Y .,....,--.,,.-V 1 9 7 x 1 1-ffm-wwww. -w.:,..1-.V..-..,..,.w.V. T.V...VV.vV-vnvi. VV..V..-v-wJ ' ' Lk WXW if if we Y1'w3 i fff' : .viii '35i3f 5fgyi?'ig- H , , , -dl, :I ' ' v ff , . I ,l .A ' hs.,-0 Y Q, J . 53.10 1' i. D N. -. ypqtitl qt I ,.,. . f f T fuk-:.fff:w 1,w 1--ff' , 'f:'5iiwr'.4f'.. fR.f'.5Q'!'AAw?gsx'! i1gQPj'was'5.3' ,ff 193' z r4m -f.1ny- . , r X qf.'81l.fg V usa. V '5Ef'+3? ',f f'- fi 'fC '? f?5W?'i11 5ffLfl' 4'fff2f'f5 554Xf?5f5Qfffd ? ?5'fk, .Q.f3',x.. 4 uit TNF! ,'iLJ.f5N!FAnsf'vi,5F,,:lQglgZ,'5fiix3Sl7if,,,-l?1e4 ..-gr:-fgaa de, Ll -film, S grainy. PM pf, A, ,g,r4,Q-,L :DN W ya? dvege J :yi fm U '35-'f?'T1: ' I -. 'QHQ' Nf'f2 .'i' W-f?'.-.f' 'Y -i Wi qlqf w' 1 -49' f'.:3' ' r J ' Lf P7314 Q 143,37 1,,'f 94.1. - ',:'. : 'rA W:-ff'-af' f, 3 'u5?TN4?fyg W' .wg ,f 52592 4 SY' in IIN- ?'1g'ff'? S 'T-5+ 'fwxfl ,155 .455f'?Vn'-!g.1Qf'iq'HW1. sfgfiffh 'Gswsgi' ffw4'?'-'ff Lf P'- , -I 'A O v t A . V4 4 . 'A K it g -, ,V -. lj- ' 5' 7- 'mx .,,-Q, : 1-'..,Hi ,.,, O -. .,:. :, 6 .- f wi-:W .1fQf,'fmfW v ev Q W mf fini ,Q 3:g.+.::f- v' M s 51 MT? ' , r.f':- :f'f 21'i'f+fi' L 1+ ILP: ' ' w ' L fT '.' Y ' '. fn fx. P' 'f 1- 1 i 'Sg2H-:MQ 'bf' -U,f51? w 2 S im?-L' 'QL - .1-'E-eff-Q. 'SL fvzg, vi-... .Hi-: PG 'H'-,',ftpgv':L3 ' fi?v1fw.1fffI-22 'f'5JLff'if2 -MSW D' 1 lvl .-J- 5 . ,'i'L . f. l ' its, ,- . , :Oki A ', 111'-1 'ht ' if Xin. ,. FJ... i'5 'lAv'4'tf: N? '1' li' t - 41' 51' f?4'fk.i'2',lJ ' 'A eg' 425' ,QQJWQ3-'ffw U ' Giza t'gLk'.si:3-ai..-Yifiggan fW4'55. 'P 45? W' f - 4 '. ' Kim '1' 14? ' 'f 971243 wi-M- '-' 1 -1Qf ,'Fm4-4if.fg'5 51Q'?Y 'Him .x f 1 -'F we Q .0 V - W AF' it. 'ffflgff H1ffE3fm 5QZEEw-f'vvs1,-. -fn Qff- - 5'5 -' i 47I'lf' ' 'im QM ' ' -' 4f'! 3f.n 5Eaf M' 'l'f'1'5?5-'f2 U+5? hfgg' 'O' 51- . 'ww -. kai I ' '-xi. J- jk, 'r,.f-f1di,1,'.g'. - r'f.'a'- ' n b 'Vw ' K ga' 'Q .1 1 f ff:':'-1? 'Z-,-,. TWIN-.' .nfifgff-I. vial J.?,3E5e:', A'i4.wEf1f,Z-,Af-rw .+f- 5 D I '55'+' l ,A .3 9.H4??4,7d.-a . fxsa ?', ',.T-' Elf 'f 1 .',! ' I-Q'-4YvZ,4-5 'f?I'g's 16.455 '-' Vx- .fi 'f'qg5S!p .i'1f-zgw 1 5359- -X5-1 Zf.,.,g-.5,nP'1'.f5t1'?f'F:g4--4'.f - yi 3'r-ff, ' , '3f42Q5'.q,- r A ,. 1 1 va , . - .4 q -4i,,,x-if +s,.:.gE'H 4, f-,,..L,f1 . -,MFA . -52+ -pf frfvrfgqp uz'gfJ1.f f.,ffFf5 ' A ' 'ff ' ' 4+ 13. A 'si' - YJ' 4 ' l:. A' ' f .- 5 '4' ' . '-AWE ff'-' MW' Qi' -5 '1- QQ 4 . '- , fern? F-ifffiifgw f' 1731. 4:53:65 glicikff iagff-MEM 55 .mga 'q:L ,i.,x'?S?+qg , ',g'j1gf'g4als114'2. ff-1- LQ':Lii'?mI Yi sg:-. ' . ' - .,.:' ,W-iv' ' W . if ,1'. rf143.vw-, ' w1w:Li af'.'w.-1: 'Wim 'X 7'-'ff' 'f WWC-' Qhgfft' w..'f gA!b,.+sv- 'fiiiv -'1' X ' ,J- 'f ' .'1'-fv+'f -f'-www--fy,,-1'ai'ff-2 ' T N ' ' -' - ,,, 1 ' ' . 4 ,.,A...',-v 11,3 V. W u I 0 V ' --,ggvi-,N x:!'!l.n..tEt- fl JL!-2-,,gg7rif. Y 4, if 'f3'fF 4-,Z-72 'L - f- 'f '-' Q' 1'-W Jw Q J' .-f?'1'5e '-.Pfff '?iA E'w'.4:f wffef 5. ' ' -' P fm' wr Ven? n f'Wf -.53 Wi-a '4fef '2ff 55 '1f1E'f 'E'M fim? grim 49: ggaglgig Pb .,f1?::m,.. .v ix., sr. 54 .A 'Lx Ltkfp 4 ff!f.tg'lE32g?1v.o.o?::4 I-g .J t,u,wi?3. 1 ' W: vlpmf ff fiffww , fff 4 1+i'j2v5,Tv '1'.ir.gg '7E'2-,u:,i- wg A f5i'4-'f - Z1 1 vt -Q1 J- 'uf' 29:3 4. fqiff fpmia- -.f51'7+ -'3 .1-iq5.2L7' f f' w M' -as . QIVUPA-tt' U-A'-'ff Pfm'- N2f' I fx--sfafi. , W'-fr v3? Bw-QQSJH V3.3 gb ,255 'im 1's,.'v.,l.L? 2' .c4r,gy??i,5k'9 QQ-V? , . ' ' ax ,YN U. Q, YN. :ga 'H , , 'J , ,' '- J 4 3.0- -:L ' , v. 4 V ' ' A- ' I -'nz-'g l', ' ,IQ :NA 'V .31 Ti' . .Ji .ug .'Q3thi.! 6. U .K -fi :0q,fv,rQ all l ?.t1pY1f:v!fl'Qhi-.S.5:.T9.. -.?'ffle,,igg.f'RQ,,,,3gY.f,-lx VDQMF 'ffm 53' vlium lg? ' 4 sf-.3515 ww- '-Paw 'f'+1'ff2?a-' ff? 1 --'Q e':1f2 2,1'-1ffw f1gg52ff?if:nf'1'Q1 '-1A2ff l-,aw 'HQ-. lr1 . nfs- up A 'ra' fmf.fQ J. . -' 4 2 f -' if. ' up HL., 'J' 0 2',- aiu. . V- HV '9 93-'Ahnv -xlj.'?v:sJ'Qp5f Qjxfir-. agSsCf3:q.2I51w MB: f. ' rm- mm, wa Q. F V V 'G' f: sb 5 gag 't- 4' ff e5., x'-gjim W ' ' . .f:.'S'fIif?G4'3M 'i!f 'v'+y 'C-ff? ':'.f'ii5 J 5 ' A 51- ' I n 'A 4 5 . 2-5.1 ' i' IE ,A 1 .752-. Q. Uri V 'fa UFQQ' 5 rs -A 1 ff,-' Z5 - L35 -1.15, 'Q 134-, C:.K1W1 iig'.3g1'1'ff+f.Zf.gg.4k?, ffm, ,ff w3 i: -2525+ gf 5253: N: U',+ - -Q2 ly ' , 'Z fv,l,g ffg:,,,-g,M.,agi.g,x.,. -bp,,5wfg,,y 'x9g2f:-FE: 5,1 4.54'5,fff-ia -s,,,LigAtf'.J1 ,Q- 1 qi! if , 'fmg' fit. Mag is Q.-.'7e?.'Wv3 hf-Q43-fa 4 xii-fig' ., v Q-,If y N524 11,9 , , V' ,U 'L 'V ., ,inf bf. :wlgglv jig., lrffqir, ni, A, v'. y .,i.?M, .w,,,. .5-fi. fi 12,,f2wgS'1Qq'?f'rI,QQfi15fgE,5Hiv: P'..:.n+ 1 's?1 v.5N5'-'W ' -if. . ', ,vjgjwvflig '-r?f.-'ff ' ' r 4fiv i9Qe5iiN' 'vz. f'-a W4 .7 . -. -33 TS'-' r iff290 F ' WW , Q53 ff!-'zfff - ' FiA'e' Q !wrG'?sfF'ff'f1. V , f ' EG- -H+ 5'-:A Q1-:M I ! Ml's,, fipfffdmzvf 'Him 5,33,,2 itf Ef,fywff'f, z?vZa,rmT .T'?2f- P.5 f 1 -if IRQ, ffQ?q++f-QWif-rvg,g4e5fg'E-1 'k'grfjfirwg-v+ 3gy4s'?7wr-.1 -Q ::2f'i'2 3-if5U ?'if25i -'Q ' .'-. 'r,,v ' . I ... ', '. -, a 1 1,.,. -. ' - . . W' 'QQ ff-1' -lfzal-.es 1 f1ffv:-fwffzf?-1f11- . -:'::f'2mf-?.. Q-ff f'fFQ'?1 ' if rfgq 8,0 tv ' ivflww-4' ' l'ql8L'QV:F9 mwll oxlfxfi au' R' an . 'G Qs 55, -'Q' Lg ,.. gef fn Str-J1Qf',.13f.p':1 ?u.'.,Af3H1'f4 W Q .- lm, ,S 1-:ply M356 Khin . '3 'I' -'Alf ---LJ SX age 9,-V 5, 4 I s i I XM' 4,5 'AU,'.','g-,QI ' ' lf-f 'V' Q,yr'23 7 f H - 'f :Mmf 'IL ' L - V. 5 sl ' ,Q ..b I H 2 ' LT 0':N'! 0,4 7- uso :':!4 'd7'n-.-33.51.591 if ' ' rf f-. - .- M xv- Q -A -1 . . I if E24 '.em5f.,v-' -1. fi-, .- W-. ge wu'..55 r'5'::1-b '?'. 'Rf' wrx.. .el My .o?-Pq.+'Lt: -: Gkij I-L Vigixifau !.!i -1 vii. I ' .4 .L w5b4945'f1'-. 'Lf-H. ,. Egg. -'Pig .wg r, vu. ' r.pv.-wrfs'-1.41.4 .A-L -tf.a..,-':::r:Q-.2:-. 'wZfX,.f-nnQ. uai:.r'..4v A 11.-if .a..f:,a r4' Jaw-..-1: an---1 M N I B- I .. W ll l , 1llE1115iaasll...l..::1. ..... 1 lllllllf ffl 'lllll1lllI' -.g.. ..... :.. .llllelil..1Tl jaurmal Svcbunl Baath ADDISON M. SHELTON ..... FRANCIS G. BLAIR ....... JOHN C. ALLEN ...... ROLAND BRIDGES ..... CHARLES L. CAPEN ....... I STERLING F. CAPEN ...... MRS. M. K. NORTHAM ....... EDGAR B. STILL ........ ELMER T. WALKER ....... MRS. GRACE WYHES ...... E. C. COLE .............. I ..., , 4 . . . . . .Springfielcl . . . . . .Springfield . .Monmouth . Carbondale Bloomington . . . .Oakland . . .Evanston . . . . . . .DeKalb . . . .Macomb . . . . .Benton . . . .Chicago lIllIlml'l'!lnllIw-- 0 '- llllll 'llmlll num ' vnu ' V 'l 762 ' ITZZDGX 126 ww .ful n I 'W' WX , F Q U 1' , 5 E X i i A K pl X, w l 'Q 1'-N I ' R i F 1 I K I 1 5 i r I i i , S , V I f I T E I 1 I DAVID FELMLEY i AB., LL.D., L.H.D., QBK Pwsidefnt j J if G41 Q 1 JAX 4 12 '-FN A-y-vsaff Wx 'A fqjjgf ,gm , fb Q31 17529594 Q9 E f C52 My Y Qi, M Q 'W K 'N 1 1 'E IE llll E f RS S 2 '15 i I E I 4 E l LH ' i 15 i 2 Is ? 1 M M15 Q20 Ze E Aff ENTRANCE TO THE CASTLE jfxxls 13 1 2 Q9 -f E -,V---E -if-. ,E E E ww f' Dfbiz' V XC gm? V E YQ H2 1. 9 Q L, Q Z 5' 4' g STROLLING OT4THEf CAMPUS f 4 G 5JQ5S5 Q Q fwwf W fi E 1 QW B A 1 rn. 1926 49 I 1 W I 1 I 4 r w 4 w ' 4 AS WE OFTEN SAW IT 40 17523896 an ? Q 5.57 S' tr A Q Q I. S. O. H. 'lPRACTICE-TEACHING 5 W 31' 16 S30 V AA A-if qffvgi, if A 3 Q9 X 4lg?3f5gQi,?jS1g7 ff- JWDGX 'QM 9 ,, N I Y N in THE FELMLT X C X MNAQIL BI 'N' fa Di A Q L me 17? 23836 W 6QTZQLwQVZ QS C6 w , , , x'A f A 1 4 V A ,Ej 59 s 3 J THE FARM AND LIBRARY N gif' 8 up, SL N f!?i? ?yXlRsLCi?D Imax I 26 I 5K5VQQM I XJ Ig QI ' CL I If-XII .Avy NQJI NAI f-QI 1I I II I I III I I I I I I I I I I I I II I I I 'I II I,I III III II II I I I III II III II II AI I1 I II II III xy W II 7 MGI I I 9 I QMCYWQ -L-Qxl , , Q Y .. D I I SI Ik., I -A I .I . . . . ., I , I II , ,Q 4 y ., N v fx. f .J IV If 3 , IIA 5 .3-4,'yl,7 V Y, II 1 A I ,, ik I I I u w I I , V , N-XCR I k lOl IH A yr I, . .V jj JI 'I . -.x A . N-' if ,' , II, -I .:. ., I I, I 2 Q I U . I, V 2 j yy L, y X I, ki ,Q .I,..qII,Ik,m . j,fI,Vf 'v,fgfIf,n?5fi, ,.I Img, xy, . I 54 I Ik ,f X - sy' ,345 gf 'K xI,ILf' 414 If? ,X II ,I If I fzqiwfi V4 Ik ! J - I I V II I IX ' V 'III JI' III' If fd' ff IKQXI -- . ..,-., Q 1 1'-I ,, II -Y 7, . b A' ,I 'iv' I ' I I- f I fiiggm I If IW TJ I ff 11 ff gf! I I I I f-If Xxrff n Y ' IA wnayixf -I I ' ,J ' ', I f, ,V XII ,-, I-,fl nf, I fx, f,JIIxIIWIIfI'mw,nI 1IIfI - .I ,va , vlax , I 1 I , ,I Ig I If Lj, ,I I I- I ,-fiI,f I f' , I ' -, I. 2' II - MI- ' ', 1 ' I' W' ' H N QI: xx I ,,f.j'. gn? I Y-7 is 63- T I I ,I,4,.IqQ1If 'Y If 7 ' 'IX II. If 'I V JL EIT' 'V' 7 I 9 -' JI 73.57 I 3- Q-. ,-SN.: I ,II , , i'f f.,fmI I I '1 x i -' M .K 'gli I, it-N XXI X I ,..Y.I- t 'kk ., lb XW nh il xzfff' If gii b 12, I'-N .Xi 5 I ,I I., 'I I 'j '71, MCT iff? Diff! I -I I I I 3 , I I I f , L' 7 , ,Ii.+4ffr'ff', ' I +I, 5 ' 'X ' - If If I I- 1 , ,K 5 . I. ' K 1 ,1y 425154 I' 'MINI hr, 1- VP 2, zg yyrf ,5 62 5 ' g I wir' I gl , 1:2 - gQ'g2'ZAgg 1 ,Q-IA Q' 3 f'FfI,-IIN' ' I ,IV III .If 1 I., I ' I3 f I Ie IILI.. IIA! ' YI in ref 4232,-,I -T -Img? -, ' If -.,1f:T.ff'- 1 . . If - Ii If I1 -- ' --twin PII II- 'I' II, w w w I di II - Ia I 1 , ' . Y ' fix -'55 - mg, ff' If - ,-,L ,fI. Y 'A 4, ' I' , 'J I . - ,Ig '4 M' E,?',I7',.wfI I I '52 P -JSI Ixffi 'gi ' y .II I Raza IYKI WZ 'I- I 'I ' I fi A My . 'I ' II . I ' V' Iggy f 3, If-I , -I in I I wif -' ff ' f ? :f':'zI1' . 2 I,,f I I - S ,I I if NI '- EQIILW ' 4. 1'-ix li. I ' 12+ I ' If If 1-LZ . ,. ,mi f I-Q-I 'f I'-if 1 ,I,. I-,fif I- gf ' I In 'figs Q I 1if?EZl'2 I 1 3' 'iflv ' , 1 ' Q f , III Q Y I -z I 3 4 it N 5 , -1- .I QQ, I E , Iif . I - . I 1: -I In I gg I I A 'P I I I ' II I- ,I I . I. 2 g SQ 5 I I .MX W I K ,. 'I 5 . NJ!! . N , I I I I I I I 1 I Ig I I? Qi M I Ja '04 I I Q HQ 4 4 w + l f JWZJGX 'W 2 D CE J 4 I I f 4 ' Q i 11 f ? if we SPRING VACATION J Z ll a ,-- gbidfm A m:s SW 8- vi- S vvA ran 1926 ' Hfe ' . U , Q : 1 Y' ' I ,7 . A i Q gg I s 5? fs- ya 3 1 1 'f-Aw I 4 1 2 n 1 i S 1 if-5, THE FACULTY r 4 1 ?fQ QQ f w W 1 w 1+ 'Q fl N x f 'o17'f : oo Q3 7 S ff:i v'Z3zf as ww WXFQJQC f , o +C ,ffxvgiffa Y -. . me 17? QPSK W 4. X. J 3 if 'iw 7 o ' Qs . X M ul! ,F 1 7 fx' n ' Va Us .W li' 13+ 5 A 1 Rf 2? M H 1 . . o V M I , I ORSON L. LIANCIIESTER, . A-B-, A-M-y LL-D-, KAH O. LILLIAN BARTON W Doon of Tho School A.B., KAII Profcsxofr' of Ef'0'lIOlIl'iC'.9 and Dmfn Of I1'0mm Q So0io7of1y 1 The Beans . o , N ,,, P W l. Ii V lf 3 o 4. E is 'Z I MHS. CLARA G. PEW lllahon of Ffll Hall RALPH H. LINKINS ELINOR B. FLAGG N,,f 7 ' AB., AM., Sigma Xa, Hs., Ms., mn w fQ,4f MU, UM, Head of Fell Hall Q. Professor of Biology Assistant Pro cssor o 1 y 1 . Dorm of Mon lUfIf11IC lIlflt'iCS o 1, Z tk o . ,W FN 22 'Fl Qi 'L 6 f i ' 7?YF15Q Q Fl 5- .. .- . f -sfgiiilx 'Q SHE. 17723596 W. -- A A - AY - iff-fi' -A H 'Q IN Qu '-Eff 4 P X P If Il 4 tr' , Q g i GEQRGE H. BRINEGAR MANEREII JAMES :HOLMES A.B', AM., fbAIi E B-L-, KATI As.si.stant Professor of Profcssor of Education Education f A I i H. H. SCIIROEIIER i Ph.B., KAII, f1:BK Pv'ofc.S.So1' of Education l I Eepartment I I uf - Qfhucatlun HARVEY A. PETERSON M. ROY STAIqER A.B., A.M., Ph.D. B.E., M.A., KAH, IIKA E5 .issistafnt Profcssor of Professor of Psychology Pgygllology EDVVIN A TURNER I I if ' :gf A.B., A.M. I I E Al Dircctor of Practice A ' Teaching I I ' 4 I fu CHARLES E. DECKER LINIIER VVILLIAM HACKER fl A.B., A.M. B.Ed. 3 ffqi' Assistant Pfrofessor of Assistant Professor of Q' D i Education Education JK J A A A 23 AA A- A - A R ' :EMM RM' E QQ Scif L .L Q 7165 C5 IE V r 1 N . -E MARY N. PORTER DOROTHY HINLIAN A B A M BA M'A', , Ivzfstrnctor of English Irzstrnotor rn Englrsh and Latin J. ROSE COLBY A.B., A.M., Ph.D., QIJBK Pro fossor of Literature Bepartments nf Cfnglisb i9uhIic Speaking anh Bramatlcs MRS. JOHN L. PRICER GEORGE M. PALMER B S Ph M KPBK . ., . ., A'B'7 I'77St'l lLG7f0T G I'CVlTlfl7ltl7' Professor of Rhetorfio and Mtemtwe IX-f LM ,A ,J ELMER W. CAVINS IGNATIUS DONNELLY TAUBENECK 1',nSt,r,MCtO7. in Orthog, B. Ed., KAI-I, 1-IKA, GAT 'rgphy 'N Assistant Professor of 1 Public Speaking ' 24 6 -- s .fs-. ,JA - s - woes E CE ' 1 I I GN E Q 93' A sf frwex ,VCDQTMQFQ si we ,1 4 , WANDALINE E. NEISWANGER JESSE CARTER Mus. B. Instructor 'Lu Music and A Assistant Professor of Lam' M usic FRANK W. WESTHOFF Professor of Music A Departments uf A Music ant: Qrt HAROLD FRANCIS JAMES B.E. Director of Ftue and CLARISSA E. ELA Applied AW-9 Instructor in Art A t A 7 ' i M54 A A Q ? n R lf fx MRS. CECELIA CROMER FRixNcRs A. 1?E1?.cHLERd , 1 MCATEE 'llSt7l'Zl0?0'l' VH, 'MLC CHL W P , , Applrecl Arts , Instructor ru Dcsrgn ' , D 25 JAC? f R Q0 fs. ,- A A V gk A 6 KLM +39 KP' 17723835 WZ A It Q n A Aw A , X Q, J I EX F Q, L 1 I E 97 4 14 N QA I A N I L APSZUR J' HOLLOWELL IVIOXVARD WITJLIAM ADAMS ANNA PLATO M' ES., M. . , V' Instructor tn Cla6mist1'y Pmfpgqoi of mmmistw B-Ldv KAH y I J Ifrzstmotov' in Botany A 1 Y I A ? i Eepartments uf 1 ' ' i Qllbemnstrp, Physics I anh Igmlugp A N ALFRED CHARLES XKTOGELE ALICE JEAN PATTERSON A MS. B,S, ASSi3ff'7'It P7'0ff'-9-907' Of Assistant Professor of B0tUf 1?! Natwe Study K N 4 I I N 7 I 1 we A oi I A V, CLARENCE L. CROSS LE2NBSHiL13ION SMITH yi P ' W B.S. M.S. ' ' ' X I I,A1f UVA vt, Ifnstruotov' in Physics 1, I X ' X ' ' , and Chemistry D Professor of Physws 243 G I A A25 C Izffmsms I A +91 A .C - I -Q ID I R49 5 SWWJNSXQW 1739896 1QQ.QE0W?'f x CKE di MZ , 2' f Af Q Q1 , 'P m HL 4, si mi ii +5 ig 1 U al all .fl I QU! I: Eli fi? ,U N M 'ff r X NJ m W! 'il if ui 1 FIA ll i 51 '1 v 1 I W 1 x A5 wg v AY N-4 M Zimwvfw fix 1 Q5 ffzoox 1 9 3 Q 1 f CHARLES A. HARPER. B-S., AM., KAH, KPAK DOROTHY M. GAREETT . B.E. M.A. KAH Asszstout Pro essofr o , ' ' History awdfSoodolog5 VV ILLIAM A' L' BE'YER Instructor' in History A.B., A.M., f1wBk Professor of Hfistory and Political Soiovlrcc Bepartments uf Zlaisturp, Geography ant: Sandal ivcience N-JP PARKER M. HOLMES X 'N B.Ed., A.M. V7 Ifnsfruotov' in Econonmlcs VLQQ RO1?ERT GUY BUZZARD and Ge0g,,.aph y MABEL P CROMPTON ' SB., S.M., Ph.D. BE S KAH EH , EE, QACII N - 'v ' '9 7 154 gig Professor of Geography Instrurotor in Geography P 'x 'Q' 28 ,D 5 f' 37 M5 P PC Zigi? 70- gg ,O , O 1 V' - 5 'V T7 if' 17729826 , 9 lx QN Pr' L .Q 13' W' :Q A as 5' fr E, ' 2 LEWIS BOWYER CLIFFORD N. MILLS B. Ed., KAII B.S., M.A. Instructor in Mathematics Professor of Matlzrematrics Eepartments uf Qgrirulture, illilatbematirs f anh jiiilanual Training CLYDE N. HUDELSON Bs., Ms., Az., AFP Professor of A gricnltnre QP 6 ALVA W. DRAGOO ADNAL C. NEWELL Q W B.E., KAH B.S. N f in Assistant Professor of Professor of Manual S A Manual Trafrknrlng Training ,X KW 9 D 29 SQ f 1703595 Q63 V Ivhxmzy F. APKDMIRE IlISfI'Hf'f0I' 'ill' 1'ypf 1m'it'i11g ELIAS W. ROLLEY I'HSt'I lIC'Zf0'l' in A f700ll7H'7'i'l1ff1 ARTHUR R. WILLIAMS A.B., B.K. Director of Conznzcroo Bepartments nf Cliummetre ants Zlaume Qlfcunumicsi JESSIE E. RAMBO A.B., A.M. Professor of Home RAYMOND M. LUEDDE Graduate Tri-State Com- moroial College I nstrfnctov' in Slzortlzand IDOROTIIY ICITCHENS PILB. Ilzstwzctov' in Clothing Economics ANNETTE B. COOPER GLADYS ELIZABETH FLAMSON BE. B.S., A.M., KAII I7l'St'l 1lCtO7' in Hofuselvold Ivzstmmtov' Foods and Arts llouschold So11e'nces so . Q9if541lTf+T fo O O A 'ff-1-A xr-if J XQQQOZQQ - R VQW I awe 1926 HQ MQ3, AJ QQ? if I 1 r N 4 R 4 rt 'C ,fx 'Xxx 1 ' M r J ENNIE A. WIIITTEN AB., A.M. KATHERINE E. CARVER Irrstrzzctor tn Frcnch A.B., A.M. MSf,,.Ucf0,. W Lam! ALEJANDR0 H. RIVADENEIRA Critic Ll'cachcr Urttrcrstty AB. , High SCHOOI In,structcr trt Sparttslt Ben artments uf jf urexgn language anis Zmnhergarten f .L ,k 3Q w f X F! ! fm' f t ts' -.., , .W ,V.x MINNIE MAE SCHMIDT HEIAEN S. HARRIS bij, Assistant Director of Ph-B fxvf ,LN Kindergarten Department Irrstructor in Ktrzdcrgartefn A dm , Prtmcrry Q A Q, ' MARGARET E. LRE r Director of Ktndergartcn ' l fr Depar'tm6rrt 1 A 1 r -Ot 1' rf'-N I 1 f A .51 1 I D ,GG -'VQTRA 7 MY H' Q 5RfAQDMfQeQ3R 5 AQ- ,55 T 0 fl fffwf L A 123 T Q 1 47 4' J E 'h T r or 1 + Qi . d C !f x N N RALPH W. PRINGLE A.B., A.M., M.S. Principal of University iii E h -J High 19071001 ALMA M. HAMILTON ETHEL GERTRUDE STEPHENS BUS., B-1-E., A-M., A.B., QJBK, KAH KAH, TKT Critic Teacher University Critic Teacher y High School University High School laugh Srbnul Jfanultp i N N i y T i I T MAE K. STEELE y A.B., B.E. XX-JV Manager of Book Eat- TIXHIZAS M' BARGER y xy i change - - T br Teacher of English Instructor in Physics T Q W T University High School 1 w 4' I A 1 A 32 A G? ig' Q ft- , L Q Q3 frfwf F0 02 L5 F T WWV V S E IZ . ' n I-is 1 K1 T FQ! ,gg ERMA F, ILIBODEN . Lam M. DEXHEIBIER P11.B-, QDBK T C7ri-1170 Teacher CVWQ: Teacher S'1'.1'T7z Grade S6v6rHi7l GTGCZ6 THOMAS J. LANCASTER BB., mm Pl 1'1IC if7ll7 of Training . School Cl l1f'fC Teacher Eighfh Grade D W Training Svrbnnl jfarultp CHRISTINE A. THEONE JESSE, WY DIFLON BA MA Crrfze Teachrr ' ' ' Fourth Grade Crvlfic Teacher Fifth Grade N LURA M. EYESTONE fir BS. hi Critic Teacher A T Third Grade . , LEILA M. ARMSTRONG 5 4 ANNA WEZETTE HAYDEN B.Ed. T 4 Z Critic Teacher Critic Teacher X ,fwi Frrst Grade Second Grade wr 4 WX , D 33 1 .. . Q. sg 'N' 17? 9595 'W 5Qf6 w,QZH5 .Q ' , J... 1 ,fi -. . A I .M GRACE F. ANDERSON MAY GOODXVIN MAUDE E. BIRKEY M-XBEI1 PUMPHREY Tfraiizwing Tfacllvr RE., KAH B.E. Trcmzmg Teacher First Grndr, I. S. 0. H. I'Irin0ipul I. S. 0. II. 1'1'0i1zi'11g Tsncclwr' F0'l7'U and Fifth G1'f1d0S, Scsconcl and Tlzisrcl Grades, I- S- 0- H- I. S. O. II. bulhiers Q9rpbans4 Jlaume jfanultp DOHOTIIY SPARKS IfA'1'I'IRYN SYLVIA SNEATH I Insfruvfor in Art and EAU U0f7HI .!I, I. S. O. H. Instructor in Music I. S. O. II. Ly df 1,7 l N, mr . . I I n f I 1 VP?lgli35fI O1IiqA GNP FRED J- KNUPPEL GRACE L. TUCKER LOUISE SPAFFORD I 2 TQAGMIZH lwzlchw Qmvth I'ILStl ZlCIO'7' in lllufmml IJ'Il'lf'Cf0l' of Kisndvrgarten T1'tl'Ii'lI'l:'Il.fI Tmzclzcr Fo'zn'th I Q and ge,U6.Q, ,jQ IGYTMQS Tl'lYiHi'lIfI, I. S. O. 11. Df,mmnefn.r, 1. S. O. H. cn-adv, I. S. 0. 11. 4-im 3 Q5 1. S. O. IJ. 34 JK .Ma - ss 'Z sf7r2jisZ7 fs' Qi Elm D -C?,f3O Q QQ. If 'Q W ' TXA , -,- Y S E AM - 7170 1926 , , O - O- O - O Q3 1 Q is :I H thx I w 41' .V O ' Q O Qin W - I ANGE V. MILNER LTb7'Ul l:fl7l, EDNA .IRENE IYELUQY G1511:'1'nULvE H. ANDREWS O Assistant Lwmmm Assffstnnt Imbrafrian 'ilihrarp ants QBffire Svtaff JENNIE A. JOHNSON FLORA P. DODGE :10C'Oll'lItG11f Sf'0l'6'fllI'-lj To H112 P1'f'Sidc1'nt IE! O 5 GENEVIEVE A. POHLE Od w B.A. 4 ' A l,ib'rm'y Cutczloguev' Qty 1 tp A 1f , 5 O A 4 GA Q W Q ij W ' f - - , g my CQ 6000 UQ xl ' 3DCi ffzvjfcgbe QQ C3953 G C Q. f-NJ ME X ' J I I I , , . I I II II, ,. .,. I I I II I . II ,,,,I,,I.,:.I ,I.,.:I. z,gj'iIII,,I,I,I,.,.igsggf-5---E -l'!! 'n..,,,:7g59,., ,., ,.,., . -mn . . ., . 1,--yr-af'--wv.:mz.afgfgEl::-sg-Wsqgfq,.-35211-.ff,.z-ffwwgr'.,-Anflir-'IZ-,H -' 1 -JL -5 - g G-' HUQWEH-'ffwli P- si -Q -'--- .'.- 11' -1- Q35-y.'-'.ggqff.'wQLf1i:-Sv--4-56235-1552.fsfsapyifi-seem.Zami if-.'q-sfkdsiaffbmifadmwfff f s .- 'ff' U' .-: PF -S - - fee. 'fbiieissnJ'f'iLHfs'Hf'L,?FP-4i3i'imgEHfSdlfPFTssfF-2?5:a?w--'PSS5:1ljS?dn5gfLE2i'Hr1si'f54V3sm115'7f 6?f3d7js.f!a217-?:i.'51:'i'3'f.rdf41::-QIir?-H-upif4a3Jifffr1SG2b:--E5-i.f'fdLE-.fnfi-f51'e-ffS'S'w.-sgaafiia.-iff:--1qf52f,iffl'f-1liviki-sr-sh!-'isis-vs:-51522 -: qv-gig- - -sf - 'wFw!m?idefH1P-2119555 'I-FH-E+24-5?-zimdyiry.we?-FiJs.ff---'f-M4-rfsH.'-P5-fgq!-mbamwlfffiffFf-:Mu-:'f1fs'-vs7.-'i-A-:'f:uJi'PS1-ig--Fvr3:f-Lsffsfizibsw:cruise 2:1652--'-foie! - :.zs . -.L ., F.w1,6,4J.-fbffmssf-'uw--fy-m,nQmm.g,, usnvmwl-mmf.-,5.q,w--,m5..p..f:q,m.-+ a-rP--.-Q.-nmwfizw:-.s:.'f.-rf.-Lf:.,---rrf-'---'--W1--+?:1s-Issvsqywf--5212453.57-:L+- ,-ul-.:-1--.Q'-,-1.--pw ---nf.-,ww-5-71.6.-.w-1-..--5-.5--n-,.f.-,-,V--ML-1,-1-rw-wygzw-1-H: n. I I I. . - - .. . - -g ps.-.HMnqpz-.,,,,uqzbggng.-y-pr,:fa1:F?wf1.1-Qufqi..-,WW-U.Q15--,y.-.ff-W .,,,...u3c+mmnZ,,qpcWI,-.P-few,, hy.-np..w1:Lf.:-9,-,,!,.-f,-of---,..-pf,.,,q..f....f.-F-fl-.,f:h:us-,Sf--1,J:,,I-I.,,.-N--,:--w-.wx-fiIa,--2-.-L----,ffW- .. .6-,-.1 ---1-.4-,QI-ri:-52.-:Affv-- - - ' '. 5. - I- In . ., - I 5. . .I'--I-,W .gi ,gn M- -:sew--5-::,1,1,aq:sgqI.,,np,5qfg,5yi,:fpgkg-Fgpfxyiflfr-,f-,,f-5:33gff.,fgwy,.up--mgI,-We-pf-5,gQg,,,,Tgfr-'5-gps-ass:-5'firm-f54:7,7.f1,.mf-fe-15:1.H-wry--1-L-psf-:ff'argasg-sfmms,-2-wrgsnsf:--ff,Uw7.fssn'Q-,mwfs--WFvqcpvswag.. ' 1 54 Dm- I I II .I -I.I.. .hI,II I.II.I.II .I.-III ...WI-,FII M.,,5,.,,,5:FIIFiG,:E,,,p:-npgqdpacl a1fLHm1-,RMQLW-,Q-,a5Qwfwfy:--is-75159Iwi.diff-MF-I.y..--M..-M.1-Jag-mf.---1f,, ,fu-,WL4,,1n-,.--Jil-5-,-W.:-.-my-W.:.L--wp...-.5,-.f-,'cg.-I-.W-.,,,J.,a-:f.fg..-W - w.wi55:f-- I...14215915655-Sgqvf-siiiimm.pi-4L1wif:args:-gina-fy.-wqznwub.-as-qrgiif:-,gm555LLJye--mz'-,--q3,iapfqgfi,z4U--lla:-4gL1h.ngaf.!' iw..mf,-m?,f.ffegdpfpfHs--,wma upsJ-L:--:-w-ff-U15-..wfsw:m::1iwpam-fy-sf-1-,mm-D3Q4J:-.fDf..vqqQ-,.1s::Sffvap,w7., FS .-i.-Q.-., .,?'ff 1:7-LZ?--'-IP.'Hq-ffa'-fEm2zb!7dww-'f--favgsffsi 55.-f-ire-ffswhif--f'-ff-1.-MPLS-5awsfiw-:mira-ff:-awkr2re-af-J-N-mf-.f1:.wri.'Z54aeFw- ' -- . .. -- -. .F - '.-F!-.'-Q ' ff J-.fn :'-.-::,-u!-..-- P-fp.-:.P.. - -1-.v.-H-gL,a:ipsin,,1fg2flfufra-www-rf'-sniff:awe--Q,-ss:-.--M---'fps1-awe,-.I..:f.1Q,,u4ay:14Lsm:,5..fs-I.Iwe--.,I-r-1Iff:.,.,g-Qp--:g-4?H--151+5:-J.-My-:fn-17:1-.51-,unn,5q1-.:k-1ff-f.gz.q.-,nkL'-QLl:g,was--.-525.4 WH- 151. V '-:..!?jf f5ffii-m -f-f5'ws-'-aarii':af,.,-Liv.F-QQedgy-i:sfay.fIp.5pp1Gm1ir,-ma-,--,Qpf-U-59.....:f.E.f'sga,-my--1.p,I-.f-in--'-.gf-,-,fg?77-,..gApsf.-M.:-.psqH,f::-Q-7--M--fra.--,.-:su -Lawf--f--.3-uynH-.-Fmf-..,.-,WR---,ww-MPHrfusww-:.-2-----.-if-Q!--.Qw+m::n-aww--f,-an .54 ,I IIaw-v-dqgsmggugqpfwgv-Env.jam,w5Zrg,Jfgff,,-. pid,-,y.,,. ..-M,-yszg-,,p,jbFp1,y. wif...--QIP5-I,fjbII, .. Qin?-H.. 'f-Qi?-iwfq--if -.pm-g..-may. fF5'm.fH1-,gr..:Jn1fN:.fqm I,-.mf---g-,I.gF,.p---:,:.F5QJF1--.fmH,..gm.7rdQf.g-ff-Lvwwf-s1-uf,-.-mf--ws:-fffmuw: 'Uv-1. U- : ff--J-. 1 W, nf' '-sew. v-sqm--. .- wa.'wi-1?fZ1-gawiivf-F.,.efwmi-Hffyemf-3-Lqdfqaaw - sf- -.ww s-v-pa -4, -M . -im '.-FFS'm-fmP5f5u,'-yfdf- My-.' as'-gf --5-ffwfz!fm-iwnmridasmivwwff-5 - g, ---...Mugs-,,..1,...s. JF, -f4-i.,,..-af-T4pPm5a',w4,-y- -,H.yg.,5gbf5gqvQ..,p1:..-1--im-..amiifasbrz-fmp.,.,53q-wrap.-f.kH-Ep,u5p+w.b-.Lf-.MF.A,,.,5.,n..gg,4,i.5,fl-.1-.5yy.,-by.-f-f:-,f--yas,-sf--:efv..Hf-ff'-,PQ .M--.fff-b'-gb.:---1-fr.1.-urn?-:fr--'-msaalgf--fm-fm:-. nm -.uw-f-:1ef-k--swf:----.-:aff-:-wfw-A L .f ,Q P+. 2 Q-mmm skpf, Q H-.W fgwspgizfb-qvmmqylf-5eF:.q.-. -my.,iw,,.-.mf-wc.-by--1-1.-:pimq aw wfwp.--mv.,-955 -..,-D-Sgf75:5:AF.v+-.zw,f-af-mug-, -- wr- -- .- I-I ,I I , ,D PI q,.,.I,.I,-.,..-IIQIII, .d.,,,,,,. I-,Ig -H-.i.,.,,,,.,.:-A,-Uywffg-.ELI-I,,5f,p,g,,Qg,,.,ff7.51-E-Q,.ny..I,,mg,-E-aww.,-:,I-,,pf-My,,.,-,,4pp.g-,,v-.-FL-H.-4-,da.-nip:--.rfifmqrq--.sq-Huw--f -,, .f-U3-.-,..,--yy-U-rar--a-,mqpff-snhf---.'-Q,-wh-S--'LI--,bpm-'U1fm.-.1f'-:1-x-fn:-:hfw- gd -,, ' '1 55, Jimi'-,, fggjq. UWA -5.99251-L,aww4.-Q..qU,,n--44,-w..fk,:51.?-...M-d.W.,y5L,.V.qu-:-.-:bw-Q--,f-Lp.flggmwyw- -mu -,f-M. -my-,wah-T-+1 -.--.-2.-,---fn.-Q,-N--afu.z,v-wf-:Jima-.L---51 . . pf. V1fiPP.us1q.. -. HzgfiiwfiwgscgfbbL'13b'2-imm54'L'7ui5:E-612-.'irf3pg--um--2-am.2-F.-ffsgfwzbiafqsufi.-we-gmm..gS!1wef-sb?-51.-rF'uzf.saLnf-feigmg.,-f,---fq.f'-f-.b-3fr.fFf--f-my--gf-g,-,-,..,.5k.--.Mfw -.Mg-mfzcf-:-:-f-4.216-Fw...-.,-f- vw5mQ4.2,Q -JG'-Q ns.,e'5,45sq-gipgdu.-515-445,,5..g55,fA,y.45i -mmyfp.,.gif.75-gg,gy.5555igFgg.Lusp:fL1t'mapy, sump!-I-51.--qv flkig,-ppnffg-gufjggf,'pkggi-dl-Sm,-w1,g7.fu.--F...-img.:pw- ffsfpsnqzwfv.-.5-:asm--aff-.nr-9 .555-up---'---'az...-.f-spa-5,124Himra-ms.-fniwlaw--17-1,-ae--1--5' Qin--.'uwnfffg-ip:-1--:miz -: .- -,,. . ., ,I.I,f.--gn, II-, -E II..-I,-,Qu,mI.p.-5,:I,I I,-..-.. -1-,.,,F,..L.-.4,:,,, .fn-.ELIIIIRTI-Q ng 5p?.,,1.-- L-,,:.f.1,1:. ..-Lq,,,,.-,mf-. -ny!!-f --,.--,I-,pf-,.r..LF-:f...g1n.,-. g.,f:s.mfi7,.f,,-:f':f,- -I--pf:--1'-img-.ff-1-1,-,M--rm---:L--..ffr:-fr--.fm-Hnhw uv.:-:.,f,I..-Jnff':'1-h-..--:fw1---,,.- f-,.fq,-w,5.L,,5-31515.-f,f.ip'5,..Qp.,zi5',,g'em5i5.7iZiMcg-is'-mfmkf -W,bynew5...-f:.,,pH5f4,u1F..gwwMglpsmwaniqlfpi,-.M Q1-,TL-Q.6-,-1,-.,,snf..1-.ky--.am -m5mexZn-:e-J'sw,..L- n1--5--.:Jw-.-uf--L1-as-:f-L1-mf-.-wp-.1-.1----.--fr-Jeux-1.1-.I.I-.H--Q.:-in-n-w..,-.,:-s-Uu----.w:-ful-Y-f ir- Mn'-1.fff:1:1,w.-M-L-.G --fa.. . .,s::-.v-- u -Mn:-.n---,il-.qu-a1a,..ff1..:'gU-:.,--aP-Q-,rwk--'.:s,1-,--M-m r-r.-A.,-.51-arcs.-f-.-2,--7:-.1-,-v.pc.---1:1---1-fLf--.user----duff...1-H---mawf: --,.-,.,-IM..I.-,.,.,I,-v..Ig,,.,,,,,,.sI..-Q-, .CI-5, I, ,, IM..L,.,...,..Af..-g.--,-L--f.---.-...WgQ--.f,,,-..,.-I---I.-I,,,7...- L.L..w:,f-,N wwf?- F'a5:7a.rr'f1,jz,9'.:n-21fgg'- J- ,'f1!4n'f-:'P9.l--wi'f+4n?-If-:Tr-gqwa an-'fQL.w-.-..75-2.mfvfaffiknfuffnrf- --sssgfrnf-'L-x..-:wr--!f:. f.1.,n1.ww:-::-QQs:f:4g-,::m--5-?7n-- 1,r:::N-'::-:.:wf5fLf...'-f1:.y-p'f',Nun-rn-:',::Lf7Jv7Iv-, - 4.-J-7'-.4-:ur--w:1--fC'--i.-In-:N-v'f.,Lq:www:,wwf-nf.1--..-,--'--5-.-L4,sv-A-!1LU::-+n:'g.- -.ff- :wr ' .- .-had . nv. HMT- . .wgvhw s-az'--5-spsr'GpL-w-N.,7-..ff--:H-r-,e:.JH:Q,:-f.swwlfmsff-sfsfl.,--QI:f-.mf-.if-..:-S-1H--fu'-P-s-J----fm--gas. H.-mth:.aff-f-.:f,:y,----vF?-,131-an-5F:.nL.fmg,-v wif :- 1--1:---.f----I' ,:-- .--11151.g-.+-Tr'--fa:-fm,--g -W, E,-...fgpf-.,f-f-.1.....E-.-N11-1-....,L-i-F-1 .: 5.gg-.,4ggfeF,.E-i,1,P:y53.5c1ig,.upzpc-,.-.W,5zqg.,f,,---W2.5.55-55qg1p,,fagLy55,-gr-1-w5p.y..qf-f-,-g'z4..?Jef455,52gaipsgg-r'12's'iwWEE!--:ffl 1-1tml--1QsfH-1--mimf-7g.5spsr5m41- ?a+wfff5i-Lf,-:-+-.:uniJ-'-'f-:1i?.+H-ww-33.5-f.vrl1:sdi,-.J-.vf5212.2-'ffQf-z1-fHsxr--ii-.1- I. x - may ziffarsvg-Uiqezyaybf-5611165fs.w55r:.4g'a-I'-, --.rw 1:2:aqi?:zg:QWs,4aIg5a7Sr+--fzfggxv-,If4.-gm-fb'-.'.J,-f7:qg,I3:,,F-q351311-E-,fr-1, . -ffm-flifi?-sfifffgigaft .hgugaiaisprgfgbgw-fug17..,5gin5aggpfl.F5455L-5,-9-5247555-scqggrgzfgiaiwgaq.gs-::.1 is-'.f-arg-15.511 Eff-uzmfssffs-er. -4 , .,,7.a1:---211, -:fav-' sz gghgf-I--my.. .Ii gvmfziuQrsfmvavsiui-4:.5F-6:9:1?.f!.:m5-:Jw'rfzmlef-fsffmffifanffmwv:-ir:-11951L7-1-if-fzifmsuf:-'wwwffiizimiiffff-imfkw..-ffwasLfwwf-b,:?-:f51a-'.?ra-ssm1i--1- I -f --,lf fi- '-ff.-s.:rQ9dv- mamma--v:f.m 'L-ei-M-2:15.-fswf-a-, F' -'m-:.sI':f:.Aib-1-psf' 'ns-fglwgw23,5asmQ?-EE-w,p.,I--3'3:L'f'Hfi11:::wf:yf1f5mink:f-Qafwiimefi-:'v,'4:sfw-4-5'1--17us--Q55:L-:':-fsffga-gvggruns-Sag'mlm-ukrgl-LQ!if--:fg n'ff:.1pfQwf:!si-5+-ffsifjmrser 'I'-1' --I-f',J .E-I-fi-'sf iam.-I.-epqLi151.I54fwi7.slrgfw-.f 1'-qpqh'rf--,-151:f:,Jap':giiiv.-I U. 4- H 55-M4555ws:-5,wws5'QZp+5mivsraaun'-:Fx v-spri4r.Qw::f'-m:3.usfs1s.L.Guw--'ml-f7--.wus-5:L-,cn-1,-w,f..:,--fs-:s59-L51sfh1G1-fq-.-- -1 -. ww'bf-.U:------Q-.4..'f,-e:fcw1qv:- -- -Q-' I A- ze .3-f, - '-,.L....--.Wagga--1 --QI-ffv - gm.-.. .E-1, -.gf-Q,-., --nf -:gg-...f--w LCJQ 'SASL-5-gizm :.73'.-,.-.ep-f - -- -. -'-QL .Q -'fy :-Sz-n.-1i'.12-'ff ' -,Q:fmeff-.'i3.zg2253:-.53'gff1r- -Qiifwtzkla2fsFi'5i12s-fffpimwff-M214-fl-f'H?2E',9:5fsgwf-Jsmsiiifw-w-ffyssf?ff5.iww1211Ebszqr-.'-Lazisfdfpgraham.-iasiv.-fan:sri--11-5r--.-faivissfbi'-r'.'.11ir-:ff-:xv . .. -.-'.,g1f.:.:-.i-.15:,4fen's5ih-5..,s-.-11' :Q-5-f-m,1-4:,.-1-sys..-1---if- .1--S..-'J-.-4553.fnff-1i?:fsus?p:5,9,gr.mfsfsgbmpbfs:'z1iil1f95yqs22s, keff,-.--Firm:-f.11'yLs,-,Nfqwrglf-gsipfm-52112555555-5-J,Jlfiych--.-s.TsHsF:-Q1wzkvissnrgsiirlzvshfvUzFL-'An?s-::'-:':iw--:H-J-'L-9Eu.eJ:ff.,- r . 14' .. -141:-1' ...rfb .-11975.--H' in- -- wif--H -ibmLr'---'-L?.Q:'Js'kf4-.Ll: 4v5h15Pl7'-'gib?sc,5vP2Z51wsasshscsrffs-Pwhaa.-npgzf:Tes.sqg6iiwlr'.'e-Jiifia--ffwahww-1-1n-1:1-n'f-mfmwnaii-1---Qnwz..yew-inf-,,u.f:1aLNmyp:w'fbfgf.fQIyI5ngQsf,-..,--u1i.z7:.aff'-L.fJ:g'u5wf-177544,-.5,.-.7 - 1-,.1f..-'af-ff P--.-:--J A--+-.--.f ,..2-1----V-11..?qp:-a:'hf.'a-5.4:--1 ww- -,-wig-gfffwgnf----fag-:Fay P. .1.1-If-fyfps-...Mmm-msy-fiisps-.awwzfnzqds...+mLQ.nQi-.-M.-1.-gbm7.,,I--I--Q,-5.-W.-:ffqmqscgmzg-.-I-fp.--.1-gb-we-.-7-2...-f.,.-.af-'-.LQ7,---:--q.z.,.-.nw --.645 aa.. - -f : I -wwf. --.-:f . --sz -. -.-Twp:--V-71:-H sr:- pkes ni'-gpg-ings,'ppfilffigfasggcb,-'g:a5?g17.1,-.-M5331-55:5-556-gsgugwpgygiibffing,.g.g15g- -Q-nisdgg-:ASE-55455-1:15,.s,I.,sI-.gpgggign-I-'g,5?4::s:.5:gg-rv:-5 1 , - - f -'5I :g',: ,IDU .':w,1:g7So.'s-fig'-' I---'y -- 'rgLJ'r-Trf-.:515:,5:,-E.1'g:f1:1-fly1 .,9Q.gILI3ggQgg5ji,p1M-,g5eg,5f55gm5L57j5.a4?5pfwefzw7IgpwW1npEggka.a.12gq75-gffgwiiginpnwg,f,f,5g-wagdcgyai:Q.:-.LfAri1-1.5gf--9-I-nsqawwp.:f.:Q-.5-s.fQ-555:ff-,977--,--I,f,1-,-I1,4:H.-:-wa--5-1.-M- - is -----rf,.f--hw.-Q-y5:.'f1 iv., 7 v--5.4F1a-..,-fpgs:-ff:--75-gm - -il T- -5?-i-Vw, -1-Q' . 1-41 , 5 4 ' fI':fS?fH-'-1'Q,-.reg-M sfv-A .-'f'-, 'slwsg . .I -ra .Sie . V114-QL -'di'A'f?f-S .-Hifi-1 .:,-uw '-1 I.' --Ji' -gif: -'sr f. - ,551fsfrysglk-'-5-1,7-1'f2f-ff:--'Z': -- --2-2-my-ff xksgfivfi - -ff--fi.--:fr..-re--1.---f-uzz-.J--.f H. - fussefnf-.zzwluu ' fp.p--..,-.gf f gy. -5, ,,.,---- - gb. -1vg-.1w,-.-+f-:a-- ---f-- -JL-LN----Hw1,5,f-ZL:la-5Lg4-,I-:LGfrf -cn'-1--e'2.,:.7:QvDwiQgulf-as-F--Eifvffvavd-L'L,-fadf-vF-'QL-ff-HS-wc.-c--M-M-ls:-H urvfffm',--..--3,-swL-,2--f.u:-p-mJ.-:s-::-----.-1--f-Sd E., J.-F-iw- ,.'rf5S::s. -ff., H -ms: .-, - Q P-. -Q-.-H.,----7' . Q ----, -L .----,Jr I.II-as '1 sagem-iw-5-15-wieef:-f1q'a.:Gs-1545-9622:1- m'7slf,I:.'s fs- fyeiaws' fe-11F127---J-'gf.- eL21: . :,.14'!fuPz.' -'NMFS nf . - 1 S-.-. 1-.L '3i'41-- .--1zf1:221iLSr'-':f'.' ,. w.fxL. ww- - ,f-1.643-.-....-..ez.w-iw.--wi--dw,f..gQ..QQ.f:.--e1.Q.unf-...ag-npg-amdfw.sf--532-ei-.QsHmm!-H4--v1.21-sm-gsqfgnf.sfww'ifawfge rm-.sm-5-sgzmggiwf-:.5--, ,:I:- mi s-:g -I-----.1ae?:.HQefra9 .. . dff- . fs --wi - N- .J-vf..-, -' .'--.rw-cgi:-,-J--Q :w fffrgcvmfqn 5-,pfng-mlm.,-I---Sgwg..mia:5.-5zg..,5,fps.,w-,ugnepfr-.f?q,:.sfas-. M---5.51-:-ym2f.3-ffsgpf ,mag-w-pg,:-5 -fFsfff1Pm1.,- -ps7H..ff,2.9.1,-as-apgayryf-4-gms-ufnssgf---1: . I --,.--J-,mt..-- --vg--,---,Jff--gfi-Q-,. f's'-wwf--'swffffeme-wif-1s 5i' if-Irs--'-1'-,---,ufn'fH'ff 44ff-fsff.'6w7h?-assff--ai1?fsf:1yHnviHb7ief:wmm5941-1--ff9a.::y.-ssemsci-f-:my-s7::s-597:33.,e.s-Us-ww:-:nys-af'-A-..yPy--:4z:-5-J - ' - N-, '-.:.-::g-.a,,-.f,--,- 5-L-1::H-Q:-5--Q :L47:-:ff-nf5n34.5bgu:f:f2pw5f-LaylamL1w:!'g-qf-5 n vt, - -. 4 f --,a:,-,:---1 ,--Q-:--.I 5-qf.s5'm2'Aw5-411, afsfgmivqv- .-fafusgs'-Swgefafiuwaniw.,Qs.-L-r-a:x.?,sspTwQ'q!m51-FMQGQQ. -1-.Q'L2iuif,sn::..Lm1.y-:-Q56-jgspeffz-1.5-fgyffps..--QQ-fm.-:sm2?:f:s-:mi-,,-Meg.-: -L 3 3 Q ,f -- J.,--1--4-.-f:L1'zLd :- L11-fin-.-Q1-'mliwaff-f'.22.45--aff ..S-.: 1 L 5111 . .1- ., , I ---.nwg-a.M,w..,.-inQ.-w1af,w,ffef...nrt-lv 5-.,.,c.f'.-.Me---+-:--. S.----.--:,:--H.----Q+.1.1--.--.--z.Lfw-.1-- D7 .4-s-wfgf-u.I,i1,s,. - ,praysfmww--gapww'-Lfyffff-55I7,1,,p--sigh-.L5:arf5Lz'rwng5:.fJQ1-f.-':1,.-I-1--F'fit. fqf:L - , Ig.-.Q----fag. --f I ' . 9 I - ' T I.-IQ.,,IQ54if5If..-LI I I - - . . 4 gd.,--L,1w7,Jwf,fg, byI.sI,p,.,U.p---1.z,,.,,,zfegqzkfwvfwwf.-f:.,f-,f.,J---,-- 4.1,-.Jw.-,,,..pmFqI..,.r.-,-- ,1.-.,,-,- -- NI ,. .L .f.w-Jiggqgs, .. .- 1 --Lfgmglg.H-H4255-.'3pQq-Lf.?LJ!:GH5d?Ti1J'w.''-wfs-gives-1225544-5.15lf31'.5'.-5-asz55:q1f:'-fs--f.:1755--.1-.1-5112-if-fi?-Iiffe ' .1 - - .--1112.1-Jef.:-' usW'f-in , ' '- 1 -T.: T ' I L L25 F--:fa I-3-122-5--aif5s:1'f1 ,- +43'I..', -'- I -ff 1 '- - -H5293-yew5575113iwffsgifya'-rQSPEQGFEfsisasg-:3Ey..ff:f2gEfTfsar'-1Li-'7-1:Qifikqi-LT:-f:i1:'P5ss?95L41iET-'-Q'mf ff 1' -M ,- -'l:g1?h.!---+vfrJ..L, 1-rg, - N , If-rfnfzgvi-w'r f1wbi?::-JFQLPPHSL-ffl- 5165tis?niirgfvlxffk-7fr7:vf---'wfJw.zs,-'-f,s-'F+wfsf:Qcgz-.Lv I 5 - -e-QI., ,,-I :. ,--1-:ii 1 , -sy'--fff-H7 lam- -. . ...... 3-- 1-5:5131-5--H -i---gif ' - fvjsgsfri1:'sf7Q35fiylrfqsfgg-s1y:if5Qv5zCQ-sf-fuwg-5554-1-3aye-,yT15s5sgfLii-shzr'Eilaeysi'gram1 .... - II ...M '- - J. 7. .. . . , 4 . l.mI,.-H new 9,9-f-,J QF.,-...'9,fm1qp.-.,I..,,f..vS I Q Tr-f..-..,,.w-..,wg,.,, I. L,, . ,, , -. I I J-,-., C -- ', - bg,1--ffqzis.-:-mayami?ru.ine23,3.:E:g1+T'72ifQ.:rg:iv.If-:25:f3:.Dp.+1:,gLviifwess-:'.zif.a1e4---5111 ...W , - I ...... 1 21--P -::z.. rr..----we-fri?--r, , it ' H3---w?'sf-'wm3n-.a-saP- f5IufFx-E15-L,fJL.fH--w,1'pv.-,-,mini-5-,.-M-1.1-:.,',-.ah:1-g:-f',..f:f--.1 M... -...M .--f.1iz.-,.--.1 1 -uf Z- .1 - - 3 . .-L-3ss11kvf.'N1'f-R?--W'1::.iJe.QJ:Q74-.-.,f:v'.2t-.LJhqidzzzfggwvs'14-Z-f-i:,r'.b 2511- '---af ' 1--H-:H- -.-Lbrwe--'--1 1 . . . -: ,.x M f--' ' -.-7-gy .. I- -- 27 , -- - - L .,- -7.--I II III .I .L..-fIJ., .1 ..L A .-,IF . I., 1- .I I.. L. -319-Q ii 'lf-5'-'f 'Lf ' P'f-155'-I-55,-.--.I ','.Ii'L-ie'5-'. :-.sg ,--ilf,-.-'Wil ' fvlfbu-H ' - -. 4 - ...I I I.-I II-VIII-I .,.. 1 I, . '-1 1-5,-fgiipii --ig,-f -j ws- , -1 I I -fziiiili '1 .1.1l'If 5 fl' ' - Y'-I-'1 , I if- 1 . , -1' . . - .- , '.- ' ---' - 1 5- ' -. - - Y -.--I f fT-S-','-1 .---'-ffw.-.1 --gix ::..- -- -. -' - ' I - g -1. .'-15-5Ijf-jg-gg .f, -1,-I----2 fr- 1, I- f '- - . - II -Q., . I - A 'M I II I I II I I II I WI I I -fs.. 2-1:52-u,-,-.iigir-I-3,-' Ig-Iq.1 ..:.i, -Irv, ---1:12 .I - 'I -- '-,' ,- - -:.--.- 1, --z-1-1-----'saqeucsf- --In 2 --'2:-z-- -1 -. ' 12-1,1-L21-mi.--5f:','Lr1+,. ,117 --Iiv'--.aa-'Q':ia.' I-I-g22'p 2:23. -.-11 -5--ii-'sm'151--'aI-. :Iii---. ' -2- - - -- - ' ' ' -f ' ff' 11--5' - :J-'II 1g1.I1' Q-I.11.'--pf 11252 '-1 2' - f 5 ,. I-E--iff --I3gggszfIf,-.- I I- my-L-4. f,.:-fm 2- z . , I,,,f.gyr,.J-- I - fm I1-,I-.I:II I 2? - . ,' GI-5--ii-Z'1 I-EIU.-'2---, .--.3?'e'9.':f ': ' ' .T--, .Ifaz 1 1.551 '- -. - 1 . 2 fi 5- -,-qzm-5:'2'5?il',I '--gz-,-.-ggyfw .. 1-1.1:-5:jQ....':v-.1-f f'-51,-Jw I-III? -I II II II . I . I I Q If ' I - . I -I' ' I . ' :Ii . ' Q. ,- X 1: LEE 1 f, 1 .,,, - -QW .- ...... W- - I ,. ,ksvf--'inf-L -JF'-' -if ' .iff -, 4-259222, 521--.. I ' 1-15-ff-'-sz-5--al V -5' ,:,'-1-in .. -155' 7-,iff 2-UzR,13g .5v1Ig'-M - 2-1:'6'i.. -CW-'-E-5'fT -r I1'-'! --,?l fi'.-1. 7 J:I'jE'T Iyfgggy :Q-..I1-I-gy -- I - 51 1.412212 11- mf . , , -1-41:52-1.f., 12 ' W-sII., I I- I I I J-I,If II5,--.Ii 1.,- I -' . f-z.-S-f-2: ,,. - r' -- , QI' -III:-, IIII:I . - . - ... 9 . ', I. vII- HM- I I Ik, K.. III -f. ll . I M M M- -.I 5, vmegmfgg- AJ84 'p.I.'- ' 1 -M 1...-.r,,Q4 - Q:- .- ff? II .f wif ' .. MII ',,m,v. ,N fa '-3, ,, ' 1.' .3 -' .,, fvI'I1-H932 I Ain' 1 ' III'-if- QL gf, .II 14 I II tab AIIIFJ-JI, was MI YIIQAJLQI Il f,I r-n. uf- ,4,:f31at5fK5K1IIV I- Ivi?,aIV I IgI3,?3HIII, II' III R95 .,g,?f3Q+?:,2:W5,f,Q,: wg- ,, 9 ww?V2f?5 q3if3'LLf'91':i2L 'QAWXV' 'W' 1f'1f'.f.vfm ' at 11 MF '-Hffffk -'ff2f- -i -iw S . U u V' w-V... Vjm-1'125 Q: ' .gh J ,.w 2sqf'.7'2iQ '-.fK.- f- migt mx C ' 8 M -. o H , ' .9 I - .. . ,. I. .. -, . M Ip eq 2f0g.m :wi -V .zf5I,W fXf1.g Y ' 'M-HAM fifm-1w.f,-uf -. waxy.: 1254? 4? 15- ,Q gs ' , -D ,P,Hlf+j7g1 fv-g 1m- , ?,'3?gf-v,4 -QM-1: -qg, ,mf- ,,.,?1'5Q':A'ggffyfwm-ix,,f5g. xgfI ' u g ff5,+f2fi f 2' if Aff M - fm we . f1lf1T1?4-5 -K I Ib 'XvIuI3',q. .WWI we Ifkgfmli ry ,QMJIH ,III 'ina . ,,II, W1-' .x yifififs -WW -f W Hwm' 1rf 1f-w2wff- fer Iq41-iff'wf5tW? F-wwf '- f1f'f i3lf?J -' ,, WE 1 4.1 85 -2'-'f':af4gliIII3:St? 'Sara .QQ III Klip tif h - - 4, III I - II! 4I -,Lg :I ,gpg ,I , , ISM .I M I, iq-1-47 ,- 7- 5: ff U ,Q IH IQQI3 v, -jg ',.5 I Q-we, yfaffziwg gf,ffg,g5W,wggw jf-W-fE,5Y+sw mga-w?aaH: fa? NW ,Wf H - ,. 4+ . .9 - ff? I :hx '! u . A li, Mm Y- . q'. ' ' wi w-'G+ -fn h 2- f fffmfst ' W Wffn-ff Qu 'M .M 'Q .. V 2, f . '71, , I - 'w- - .1 A-ff. if L Lmigqg. 4-.V 541-!gLnf?fA5 few i,-www K P -- V ' 1 -in if 5' '-H 41 I. ' Q -'-.4 1. 'V 1-bk 14 4 - ' -2- -If ' ,' 4 '-'. lv' f --.- 'W . '- 4 fl ' v, ' 4 5. ,IIQI A IIIQI I, My ,: vfq, '1.,IlI.I.. I ,Ewa ,, H 5, - ,414 f .If?f,,ggiI55,, II. I Lf P ff: 5, 4 I I.v:Lc..3- ,, ' QI 'I'I,Ig5iI -'A .. H Q 5, I.I 'I 'F' 51 '12, ' 975291-'Vt A. Q.. ' t A,1I Iqg,-W. I S? J+..I1- 45' me f j -V '. 'N?Hl0 II Q III ,e 'I C ' . ,' 1 I- L '. : I .:,.II IIIII.,bI.. II A. :I .Q 'Cf I 1, , III., .-1, ' .gifs-.III I IIII II: II I I Q: gf' ff? WI, N51 5-IIgL 'h' , ' CZV4-Q' ', ig Q' .H E4 'Hr . -' . -' -' -' - ' .Q ' f - -' ' o J - . A - - vp.-. gf h - if H, kg ff- W ,nf -wi 'f -3'fmgA.LQ. Wf V- ATR Q, f '. O if Us g,.rQ'il'. ' fx :g'.i'fn .ir iY'?I1t ' .2-If 41:0 pfk' v. 'f-- U f .4-'V f 'v,f fx l'fffiIM5IvS-'f.L'f'.g 'sg . 'W ww -0, f-- -' -fn fi- , f Efgz,-:, II...,. 'I -2Hif3ff1AS 1 'La '- .um I , Q ,I' I V 'fI ' N WLJI ' VT 'N H II I , IIIN ,II--I'-lI'NII 40 ,I , N 'f - I, Wai:-ff? 'Lf FP I '.' 9, my .-555' 1 h53'f'Ml 1 3-.1,1 'i k.3,'I.fv-ff-'Iii-J 'fag + 9'it i'LX'7!:i15 7?3 ' 1, 1 2-W' , J ' ' 'fiiffifi rw-1ff. f.K ,1z ' 'ffa'?f'-1.45.1Wls3r ?'T5i' r 0451. ' 3,5 'I, i 1, I 0' t ., 1-I I ' '12-OD om 4,--Q ' 'N'- '-I W1 'fr .5 ' 3 '-y. I- '11 ill ' If .ff .'?U+ .- Ml, 'rn 'ff ..h:5J ' 'iIj1f2' i'i,f'1W31'n' 4z AQ,I5Qrv-ig. AW: W r 1+ v . f 1, - 2 -1--1.4 ww wif sf W x'+Rn . v 4 Q3 Q . 1 -' -I 5' '55 Q ','f'L? . . .n . :hgh H, if 155' T?Q.,fg'4, 'L-,q,,i',3I,'I . 43 1: ff , iff Il F'-.W-- '. ' f W if 'f' ' - ' 'wh 'HW ' M- J --JW f . ' .p1, LF'-' 151355 -.13-'fe 1 E '5 'w'Qk 17'2r' 3' Mp, Ywyl, IWQHIEII .' I U IVR at N3f1.wf W 1. QJIIZ .,IgQQhF1-BJ' :SQ tl .IJ Q '3 I MU: nuI'Lflv.oIIh ' 1,'II-yrfy' 5 I -1.I 'JE' IT' I. I' Il' ' '-2 , HI QI I -I, 9 'I -all' III'-' 1' 1 ' 'i. w'f'N- 'N' U- 'W-K? 7 . fr 5- ' '18 if 1-1, + H'wv. ' .' ' ,-ff ' 912 -1' y ? H2.f3'-I' Tig Ir?-.TW H','l,F4e1?f'- '-y Qt.-K,?l + all .lf rw' ,l ul J. ' NCI ' III..v3'JI4 ow?-vf'Pn M .4 ,- ' .IIIH-I TIII ' - I4I.IQ,I ..,III el- x - , - If . ia., '1 I 14: I- , IQ, if fam' :ii ifi '1SW'mg-WWW? ?W:1rfe'laifb if 1W'5F'w 43 .I' -Q L A 3 I IIT I-. -IIIFIIIIIII ' I 4Ik'I I: Ji' '.II 'I I t I .pl QI4 aT'1U 'IIQQ CI IIIII.-,I- qc-I,,c?k'i?:k1I.dw Lhfxffig JQWIIQFI41- ,?N.4JL6i 'A ' .. ' Lu wf 1. an la' ' 1 A 'nvf ,mi 4 OvJA: L ' y E. .ir 6'-.vmlvrl ..h':s, 00:2-L O Q if 1 4 'T' ' ND fi 'fs .'!' 'H ' Q., ., 'rv : 01 Y' x - ll: ' 1- il'U5 ' . 'nifd' N 155 E gb ,xiii ,Q I 4.J 4 il: v 4 Iifgsqzu.-,I tix.. btw.-Ev 'Q' II -Oggflhg x I I. Hai: f 22 fi' Q df 'ff if-I xr' f-'f:f1' ff :ffL , PQ44L+fiis?iw ' la f..if fU'ff'f5L1'4sf.l a'?i'fig'?' ' ww 4F I'MIIIII, ' :ggi-v .II Ir :Q 5 t 5+ I I Bk 409 II -up . t rf' III I!eTII',!A.x' Il' . Inj YIII. W5 ? 4- '. . 'f' 1f',- 4?,'.1s'wf5'1fI ff Q-f::'1s E551 Sk ?':-. All ,vi-1-.f1'l-v?-'12-WT' fz?+i1..f fm I W .t ,Q Q -vffmt' fl ' A4 I' I L' ' -4 Int.. ff4v'iAX:W of ?QI 'f?g f- ' ,QQ ia' J ! X' 9 3 G' 4' ' I s. fa 'M W J 'of W 6 I., 4,-, , .' I. '14 ' 7 I, K 'K 'D 43.5 I tgilfn Q , :-- 'F 'b .1'I ,' II 12.1,-' f' 'Tv -,afI4r0 I,I -.4 ' 1xf.:I5gi 5,11 2, Q: Fw ,.f?g5. , fig '- IV -' jg. 1' gig-s'f'g1?'f ,, -P'-1' ,4!L,fUfTQ iif?9'if5ifp-ff' .uf .gm -3 1 .. QI.I, 'LQq I 4' ' iii .'4? 4 E w qi an i As 4.' T, gr xf .i.s',Q: ' f.. ggi 13' 5 itvqf f-1. '.f'.l 1 f,..' 5 I, rn'-my ' fn Q .'qygrfIc.-fy-L..Ai'.,,ll .f KLM 'ff' .IE9'7'i',1ti X A.--E.Iffmf-If,'.'?f- '1.. ?i 4',iq ' Q ug WI! -4- g ,. ' ff'-1'V3:rQ . ' 5 if ff Q ' III - Q -I Ai ILIII5 A Ib. ,vi t J'b4 .IIII-l-.-,Iv , , ,nil . LII I In I a F I L ILE c- v ' .I I I. i Q k 4 ' I. 1 , W1 ' '. J ,.v' ' 'uw 'VY ' '. ,W ' 4:-vs 1i' 'W ' ' N 'f 1 iff- PA- -'f -'Wi . L ' W.-ff 4 '- ' ' 1 --Y faq -ff 4 4 u lf., V f 4 IL-'.I I Q. :II I I-5' M. -. .- T ' .III :I ' .I' I I nI'I Y. ' L ',-.-e T .0 Iju 1 II ,IN tk 85 I. . 5 ,tg I' Jw Q Q .-Q 4 OI ' -lf5'g,Ii'II X 3 'E -Umx Ikjlgf' QM- dxggeg .L .mi '7' Ag. 4 -pf ,fnhfkf ,ft-f.'f ',--'-I iff,-A jig' ' I I fir- . f'f:,,3 ' IJSIAII JS, -A Gif ,. - .f -:cz LLM 1,JmyZw-L2f'.-1' mn ,9'x.sf,,,. : .5a8.1figw1f'ff- :ffW,g,1I2Mg,x,+, 5 257' 0' ' ' fm' I, f' 3' 'Ip A W'''E-'sf'4'.Afi'.i,'l9:'5'9 :'L 'WY' i+'.b'5K: 3'J ?1i..f'fx!dff77g7 1' '15, P . I I Mk. -Mi, I ,LI ' II, ,Lf-I ',,I'v- 5 I -, '1 f jr'-.,I, LI-I:-3 X, - II ,5 ,,.' ,p ,I, G, , A I A' if ..I'IIQgI I :l- j' LI -I gp yr? If mf' ' 'f? -SW'f'-f3 3e f'f3W'f 3 j'if'?f1'afr' 55'f ea W' Wife.- Bei ' '. ,1Q-f ..' kiwi? .:+:w ws 4 1 ' flu 'S 5452- rlS i4q'A'T4 gf-, '931AlV54 - 'NSg?'125'.a A ' Q A gifgjwzlgiv xii ' ci b5' Q w H III,I 'I - I ,T-9: I, . L1i IIIf' f 'Q 'B J. 'I' of??I ,I ffl? I II-9' Ii, II 1I II . I' I'I Q7 'W- + '4' A? 13' w?3 ff fff9 3- 73 Q'A1i72'f 'wM'i 15H2 012W?f25'-?a57+3 .. J if iw-'24, .1 iw- i,,,4.r f4' 1f.f-f fw i,,f g1'hf 'inf-rev 'I wi 9 W fiifwff' 1 fl,-f'f,, f sififi wi I V' r I L ' 'J : 'H ' 4 J 5231 1 9iwW', mJ4x5'Q.nm'T'rLPf-'rw-Lf fafff' M f?1f ' . 'Ai 3' .' 1L A 'lgiffii-. 1F'fi5'3 'ki' fo F if-5gEW'f? 'i-A 'A L H 'g 'i i5 W , AQ f,fJl,f 'f.Q' fQv'g:l1ig:33'. ii4f v '+4lgL1TrQY'2,f -',ff is . . Mfmfif E W f?fLv1.wN '2Wf f1 f ' -W5:s .1' if + ' ' fw 3+' 'x47'?4' 'II 17 I-jfs . -- Q11 V I .,. Muze 1 U Igpj-N .I,-'-'Q 0 I , -5- Im? v 4-M 'I' my 351,-I-:A 1 wwf. 'QM 1 'q,IQ,-Qf ?- M- fs,-1955 , ii-. :JW ' vw .Y 'JF f 1,XQ'.ffg':,-af',ylT Ffa fwlgffa 'i-pf + A . r. is A' 1 --Q. UJWP if - 1'f'W'W- ffl 'af .4 'sv 2 me-, .NJ 1 as wx. 'IQ gf-5' '. 1 . 4. I I L, I I-.1 ' , ff' If .uno tt wg' X I 'I ,B L! gtk ' u Wil o '.' ', 'I ',. Q L7f' jj A Q U ffl? ' '35-, ,', 'f,p'7ef' Jfofnqjfll- Wm: gy W --I ' g,fbI ,K4 III::' II-F' '-'- Y ',.' pro -1' - . 'I X131 ' S I iii! U + By ' ',v ' WR Q I VI ' Q3-4,5 Q 5 I'6g'vhmIf 'WT' Is, vga wg .J 'I .J-HEEL I:I - QI I iil'-CMP.: gf ' 3f..1.'i'+4H2i' .. ?'i'3 7 fsi-:f'?i!:',:1'af.. .'f2 1E.f4.: .4:fI3.1fWL5 if1f.e2+gQf 5 EN H0125 QQ-Qgqff , fffzoox 'ge rg .129 AQ Q25 3: 'S' ri f A ,-,X SENIOR CLASS OFFICERS Presidfnf . ...... ......................... R oy INICCOLLOM, THOMAS BREW Vice-President . . . . . . .ERNESTINE HUFFINGTON Secfrctary . . .... . . . .RUTH RITENOUR T1-easwer . . . . . . . .THOMAS TRAUGHBER ROY MCCOLLOM Teachers College l Student Council '24-'25, President fall term '25g Science Club '24-'25g Varsity Club '24-'25, President spring term '25g President KAH '25g Presi- dent Senior Class '25-'26g Business Manager '26 Indexg Treas. Lecture Board '25. THOMAS BREW Teachers College Basket-ball team 'IO-'llg Manager baseball team 'llg Intercollegiate tennis '1Og Senior Class play 'llg Philg Athletic Board of Control '10-'115 i Hieronynrus Club '25-'26g Senior Class Pres. '25-'26, ERNESTINE HITFFINGTON, Normal Home Economics Home Economics Club '24-'25-'26g Art Club '26g Hieronymus Club '26g 7 Lecture Board Pres. '25-'26g Vice Pres. Junior Class and Senior Class 265 Y. W. C. A.g Phil. RUTH RITENOUR, Streator Teachers College-Commerce Commercial Club ,23-'2-1, President '25-'26: Journeyman N. F. C. G.g Vidette Reporter '23-'24g Glee Club '24-'25-'26g Tennis Ass 'n '23-'24-'25g Y. W. C. A.g WV. A. A. Executive Board '25-'26, Big HN -Varsity Bowl-- ing '23-'24g Index Staff '24-'25, '25-'26g Student Council '25-'26g Presi- dent Women 's League '25-'26g Secretary Senior Class '25-'26g Debating Club '25. S..f X M rp l TRAUGHBER, THOMAS LLOYD R-.7 nm Teachers College Q l Science Club '22-'23-'24-'25g Hopkins Agri. Club '22-'23-C245 Varsity Club i 1' X, '22-'23-'24-'25-'26g Phil '23-'24g Football '253 Student Council '23-'245 4 4 i Athletic Board of Control '24-'255 Senior Class Treas. '25-'26. I l K l 525 Q Qi wwf JESSE SHIDLER, Lanark Biology-Chemistry Treasurer of Index Staiic 19263 Varsity Club. ANNA PRICER, Normal Teachers College Science Clubg Kappa Delta Pi. T. LEROY MARTIN, Sullivan Teachers College Commerce Club-Trcas. Junior Class 192-1-'25g Journeyman N. F. C. G.g Varsity Club. GUY CUNNINGHAM Teachers College Football '22-'23-'24g Var- sity Clubg Manual Arts ELSIE BRENNEMAN, Minier Teachers College Commerce 3 Pi Kappa Delta 5 Kappa Delta Pig Hierony- mus Clubg VVrightoniag Ed- wards Metal Contest '25g Soph, Basket-ball Team '22- '23g VVo1nen 's Intercollegi- ate Debating Team '24-'25g Summer Lecture Board, '253 .Iourneyinan N. F. C. G. FRED GRAFF, Minicr Senior College History and Social Scienceg Pres. Pi Kappa, Deltag VVrightonia: Varsity Clubg Inter-Society contest '23g winner Livingston Cup Con- test '24g State Oratorical Meet at Macomb '24g Var- sity Debating Team '23- '24g '24-'25g '25-'26g Var- sity baseball '24, '26g Varsity Glee Club, '23-'24g Inter-Society Contest '24g Treas. Oratorical Board '24- l25g Athletic Editor Vidette '2-1925: Index Staff '24- '25g Student Council '24- 25 3 I-Iieronymus Club. PAIGE MCDEED, Decatur Teachers College Home Economics Club. ,- IXARL C1-11f:s'rER ZEHREN, Flanagan Teachers College Social Science Phil. Science Clubg Nature Club. Study Clubg Jestersq Senior Play '2-lg Pres. Student Council '26g Pres. Men 's Debating Club '26g Inter- collegiate Debate '26g Ir- resistible Marmaduke' ' '26 S..x Lt IPQQN-fi , -, , ,, X LANDS 423 Y Q5-by 'I 111 fusion-,fif1111.s f f 1 o 'ee 51 175236395 . o 2yJ H 1 1 19 13 1 ll, l 1' A. lx l 'ly ff! Q K9 1 ,S KXC1 iff-S LILLIAN BAIIR IRENE KINSELLA, Bloomington Teachers College Teachers College- NVrighto11iag Kappa Delta Commerce Pig Hieronymus Clubg In- Kappa Delta Pig Commer- tereollegiate Debate ,255-'26. eial Clubg Journeyman N. F. C. G. J osEPH J oHNsoN, Normal Teachers College BLYE FOREMAN, Pearl Teachers College l 1 1 BERTHA E. WURZBURGER MAIVY A. Einar, Roberts 1 , . Teachers College Home Leorionnes W , Cl Cl b 723 W4 I ' VL ll 723- VOIHCH S I G6 111 - .1 - Ep0Ijig1FiO11l0In1Ci C Hb '25g Hieronvmus '24-'25g -4 .Q .1b, Science Club y U , 1 11 729 mi '23-'24-125-'26g Wright- MU! Lam? C ul ,O 'ff ' Oman' 255 President --1- 255 Y. NV. C. A.: Student Coun- 1 eil '23-'24q Honor Resident Fell Hall '24-'25. ZETA MARIE MERRIS, Bluifs Teachers College, Cominerce and Social Science RUBY RICQI1EY xv. Cablllet Home Fconomipq '22g Honor Resident of Fell J ' s Hall, '21-122-'25-'261 var- Home Eeonomies Club: Art sity Hogkgy Team 7215 Seq- Cilubg Pliiladelpliian So- 1-ptayy of S0pl1011101'e Class Clety' '21-'22g Vice President of Commercial Club '21-'22g 1 XV. A. A. '21-'22' Hierony- I mus Club '22,g KAII5 XY1'lQl1f0lllH 3 Journeyman N. F C. G. il ' XJ' l 1 1 l 1 Q 1 ii I 1' U S 2 ' 1 ,iw 40 l, h T123 11 111 fl ' Y f T TF' T , - gk C5 Q3 'W N395 X 'W 0 Qi if P R S' '7 X Q, l ' 2. Z4 f MILDRED BOOTH, Bloomington Teachers College HARRY H. LEES, Normal Teachers College Secretary Men 'S Debating Club Fall '25, EDITH ARMSTRONG Home Economics Home Economics Club '24- '25-'26g Hieronymus '25- '26, Treas. '25-'26g Phila- delphian. MARIE E. GETZ, Mineral Teachers College-Litera- ture-Public Speaking VVrigl1tonian 5 Executive Board of KAII: Hierony- mus Clubg District See'y and Treasurer XVomen's Leagueg Girls Intercollegi- ate Debating Team '26g Debating Clubg Pi Kappa Delta. LAURA MAY EBERT, Roberts Teachers College Science Clubg Y. W. C. A.g KAII. MRS. LENA IVIAE LEES, Normal Teachers College Hieronynrus Club. OPAL PARKS Home Economies Home Economics Club '24- '25- '26g H191'011j'111l1S '26g Art Club '23-'26g Glee Club '233 Phil. CHARLOTTE IWIANCIIESTER, Normal Teachers College VV0TllG117S Crlee Club 1922- 21-33 Y. YV. C. A. Cabinet 1923-'24-'253 VV. A. A. Ex- ecutive Board 1923-'2-I-'25g President of French Club 1926 q Apportionment Board 1923-'2-lg Student Council 192-1-'25g Associate Editor of Index 19235 Editor-irv chief of Index 1925. all in l 524 f I Iii? 6 4 E l 66 'fr A Asif? --- -A - - ' -CP 00 Q' iltgemion fffwf 0 9 1' i x l Vgf ' l VGA Q El Q ALVIN FRENCH PETTY Teachers College Xllrightonia., Treas. '1-15 lVrightonia extemporc con- testant '2G: Y. M. C. A. Senior Play cast 'lelg De- bating Clubg Intercollegiate debating team 226. W. J. ROBISON, Monticello Principals and Superintend- ents Men 's Debating Club HELEN IQERR A.B. Illinois Vllesleyan Debating Club Intercollegiate Debating Team. EMMETT E. WACASEE, Lovin gston Social Science Football 19259 Merton in the Moviesg Hieronymus. FLOYD F. CUNNINGI-IAM, Flat Rock Teachers College- Geography Pres. Junior Class '25g KAIIQ Hieronymus Clubg Science Clubg Varsity Clubg Student Council ,253 Pres. Oratorical Board 7255 In- dex Staff '25g Inter-Society Contest 725g Edwards Medal Contest '25 3 President Wrightonian Soc. '25g Ten- nis Assoc. '22-'23. RUTH HENLINE, Bloomington Teachers College Homecoming Playg Wom- en's Debating Clubg Inter- collegiate Debate Team. RICHARD ICELLERMAN, Pinckneyville Teachers College . ANNA FORAN Teachers College Philaclelphian - 1 '4 A 5-fi! Q A Ji 2 1 1 l w 9 ii il C :C C V ' KC? Y' i C7 Qi JWDGX W ,cific f' fi Q9 P QQ oi, we ,Rv 4-' 1 n M i 4 ' w 5 4 ,-X jpg MARGARET KELSO, Streator EVGENIA MOORE Home Economics Home Economics Science Clubg Home Eco- Ilonie Economics Clubg nomics Club. Science Club. l KENNETH L. TETER, MILDRED GRIFFITH Bunker Hill Home Economics TeaC.he1.S College y Home ECOIIOHMS Club' Varsity Clubg Science Clubg VVI'lgllf0l1l3. 4 S . I l H 1 BESSEOUTESE IBARGER' HATTIE LUNDGREN, Lostant , , Home Economics 2 'leaehers College . C1 I S , Student Council '25-'26g WV, in A. F uirightqnim Y' W' C' A'5 Y. C. Cabinet '25Z i X'1Qe'P1'eS' , Nature Study Art Clubg Honor Resident 5 Club 725' Secfrrreas. of Hall 721-722 725- Science Club '25-'26g Chair- ,06 PMN ,25, Sgudent i man Student Council Pro- Ciuincil ,2,15',.,6,' Preqident I ,, ' 7 -7 . 4' ' ' 1 L ' glflm Commlttee 25 26f of Home Economics Club Hieronymus Club Pres. '26g ,04-,.,5 Pres. Kappa Delta Pi '26, H ' ' 4 l EDNA M' GUEFFROY' HANNA GUENTHER , T Blijommstan Teachers College 1 veac 1615 O egfe , Y. W. C. A.3 Hieronymus kappa Delta Pb Tfeas- 25' Clulig KAII Secretary. '26g Wrightonian. l Lil l J, l 0 ZS' 'pq 4, , 1 4 l l U 5 l A l fN I if Q, Q13 so L -LLC' fwwf 9 I 'I .Iga gb N FW I I I I II I il II I 'I I I I I I I I I I I I I I I I II I I I I I I I I I I I bl'AI WN W6 I T ei BERNICE fHINSHAXV, Cropsey Teachers College lVrightonia. EUNICE HARRIET OLINGER, Springfield Home Economics Y. YV. C. A5 Honor Resi- rent of Fell Hall '2-l-'25- ,265 Sec'y-Treas. Home Economies Club '25-'26g Nature Study Clubg Glee Club '20, CORNELIA Siuirn Teaehers College VVl'lgl1f0lll3.Q Glee Club '22- '23- '21-'ZZ55 Home Econom- iesg Hieronymus '2-L '25g Lecture Board ,211-'255 Ora- torical Board '25-'26g Y.W. C.A. Cabinet '24-'25, Vice Pres. '25-'26g Honor Resi- dent Fell Hall '21-'25-'26, RosA L. S'r1MrEm', Panolo Teachers College Y. VV. C. A., Pres. '24-'25, Vice Pres. '23-'24, Cabinet '25-'26g Honor Resident of Fell Hall '23-'2-lg Pres. W. A. A. '25- '26, Executive Board '25g Junior Class Sec ly '2l- '25g Correspond- ing See'y Kappa Delta Pi '25-'26g Student Couneil '26g Hieronymus Clubg Phil. sig NELLIE DELL, Pittsfield J. Teachers College. ELMER PENTECOST Teachers College Varsity Club '22-'26g Ten- nis Ass'n '22-'26g Phil. S0- eiety '22-'265 Debating Team '25-'26g Men's De- bating Club. ANNA PLATO, Granite City Teachers College Y. W. C. A.g Nature Study Clubg Honor Resident Fell Hallg Kappa Delta Pi. FRIEDA MAE GIPSON Bloomington Teachers College Debating Clubg Philadel- phian, YVOIllCll,S Intercolleg- iate Debating Team 1925- 26. 4 gf? I I I QQ FQ? I9 ww ei A le fe Q 7ifl?'27?'l QNYQQNNQZC f me 1 J QQ-, fcfzznex e e ,W , QQ lxyn! V ., .4 kj g GQ! fi? 4'?'7N'Q HARVEY W. MCMULLEN, u Hopeclale 1 l Teachers College 3 l Aclvertising Manager Vi- detteg Index Staff '25. l l MABEL RIPLEY, Bloomington Teachers College Hie1'011ymus Club: Nature l Study Clubg lY01ll01l7SGlQG l Club. 1 l 1 l l 3 E I I 1 I Z in lW l l 2 l i ll el N - w l 'ex fx, ,gn 45 W X u lf' 1' 'l 'Pl gi AAY bg T gg g 1350 gm lm Q - L ex Exfgjvb ixgliy 'H' 19723 '926 F N74 '59 9 WQ 1 4 l ,XX5 bixtybehentb Cliummzmzement Week 1 1 ? UNION INIEETING 'Q Philadelphian and Vifrightonian Societies gf'Q Friday, June Fourth, Eight P. M.--Auditorium fx PRESIDENT 'S RECEPTION TO GRADUATING CLASSVAND FACULTY Saturday, June Fifth, Eight P. M.-Fell Hall BACCALAUREATE ADDRESS The Value of Ideals PRES. DAVID FELMLEY Illinois State Normal University Sunday, June Sixth, Ten-thirty A. M.-Auditorium ANNUAL ADDRESS BEFORE YOUNG PEOPLE 'S ASSOCIATIONS Concert hy University Choral Society Sunday, June Sixth, Seven-thirty P. M.-Auditorium SPRING FESTIVAL Students in Physical Education University Campus, June Seventh, Four P. M. SENIOR PLAY Arms and the Man by Bernard Shaw Tuesday, June Eighth, Eight-fifteen P. M.-Auditorium ALUMNI REUNION Wediicsfiay, June Ninth ALUMNI ADDRESS ROBERT E. HIERONYMUS Community Advisor of the University of Illinois VVednesday, June Ninth, Two P. M. if tl 4: I 4 142 E i CLASS REUNIONS Class of 1866 Class of 1896 Class of 1921 Class of 1876 Class of 1906 Class of 1923 Class of 1886 Class of 1916 Class of 1925 YVednesday, June Ninth, Three P. M.-Main Building GRADUATING EXERCISES UNIVERSITY HIGH SCHOOL VVednesday, June Ninth, Eight P. M.-Auditorium GRADUATING EXERCISES Address- The Challenge of the Changing XVorld S1QNA'ron HVAROLD E. IQESSINGER Thursday, June Tenth, Ten A. M. Presentation of Diplomas, Hon. Chas. Lahan Capen, State Normal School Board-Auditorium ,X 1 1 ANNUAL ALUMNI DINNER , A , i Thursday, June Tenth, Twelve P. M.-Fell Hall X' 3, 'A 46 is 2 4, A - 1 ,g 3 K C f' ' ami ' Nj 'Y V - ' 1 f A I JUNH Q5 T: F'i'lY WWII 7llllf lll! ' IIIW34 Q t-fl rum 694 Q0 l'lmIv 47' X I I f 'm 'f 4 l 172' fr' iam X ,--if-aff - -- frfoox gig are T tl lk-f ' C 1 4' Sf W4 EA Eiuniur Glass P?'6Siflf llli . ...... ....................... H OMER, HURST Vice President .... ........... . . . .... MEHIETTA MoULToN iS'f'cretary . .... .... D onofrnv HIBARGEH 1'o'easm'eo' . '. . .... .................... H ARRY ADAMS The fourth Junior Class of I. S. N. U. with an enrollment of ninety- eight members, was organized October I, 1925. Ralph VVeaver was chosen to represent us at Student Council and Clyde Neathery was elected representa- tive to the Athletic Board of Control. Several members of the class have brought us special honor through their extra curricular activities. Wayne Patton and Clyde Neathery are triple N football meng Bertha Hill, Merietta Moulton, Anna Maloney, Theresa Quinn and Ralph VV'eaver won debating N's. Nora Brenneman representing the W'rights, and Lucille Hall, representing the Phils each won her number in the Inter-Society Contest. VVe are also proud of Nora's work as editor of the Index and Ruth Adams as an assistant. Adrian Book and Velma Horn have won distinction in the Held of drama. Elizabeth Scott has served as president of Fell Hall and is president elect of the VVomen's League. The class activities include a dance given at the Castle,' March 2OQ and a part in the Freshman-junior play. Under the guidance of Mr. Beyer as sponsor, the Junior class of ,26 has been striving to set a precedent for future classes. The large number of juniors who plan to continue their work next year is an indication of the X! tendency of Normal school students to complete an uninterrupted course in teaching training. 9 Zeal Q i I Q 5 48 f X- - iv -X 5 Q19 fwex f 055 ff! 4 1 Q H9 l , fx Q E L5 s li ? 49 4 f 393, QQ? Q9 W 1 M W L f J ffl ', tx 3 EZ Qi Lg, ,f' ,f x fx N A J f ' 50 ,SQ . D A f A t A f V v 'ISK Wfwffiqs F4 fwex wa vw ml, .2-X W5-Q N E 7 N PES 51 gg I Sm, 420 5 Q31 XHW M35 AC? Y ' CL X1 , If C536 65 C53 fbi? XS G QFQKVVED .X J M JII IIIIW H! IQ I WI . 4 - - .T in - if W, so .Q W 1779595 1926 5 , . di Q SQ - rf X i l UAS R l - SOPHOMORE CLASS OFFICERS P7'C'SlClC l1t . . ...... .... F RED HUSTED Vice President .... .... M ARGARET COOLEGE I Secretary . ..... .... M ARGARET MOTT T1-ca.s1n'c1' . .. ............................. FRANCES NIANTLE bupbumure Glass From September I5 to June 9 several shades of greenness had bleached from our sweet innocent faces, until, lo! we have been sophomores for almost a year. The intricate rights of way of the buildings are known to us now, the mysteries of college life have been solved, and we know it all! An enjoyable social event this year was the class dance given January 16 in the old gym. In athletics we claim unusual distinction. Fred Husted, our president, was basketball captain. Percy Scott, Claire McCreight, John Robinson, Rueben Elbert, Lloyd Abbey, were other members of the basketball team. Carl Firley, Russell Thomasson, Carl Gregory, Jack Stoltz, Reuben Ebert, Clifton Stoops, and Harold Conger were on the football team. Claire Mc- Creight, Fred Husted, John Robinson, Percy Scott, and Charley Winegarner, were on tl1e Track Team. The Sop-homores were also well represented on the baseball team. A number of the Sophomores were on the debating teams, and several took part in the Jester Plays and the Sophomore-Senior Play. The success of the class this year is due to the efficiency of its officers if and the efforts of our sponsor, Mr. Cavins. X, LN And now as this Index goes to press, the question of each Sophomore is, K, Qi' Have you a position? We wish you luck, members of this class. May you lg E! make the best teachers old Normal has ever produced. gl r ll Qi ' CS Q-.. a,.-- g --, YYY- T-. A C . 1 in - H2 M ' e 7925 ,Q Q43 'KQX 2. V1 25 55 Yifrf Q 4336 .- l ': Q3 , 4 I ap Tim 5 M 1 4 CY I 9 wwf W A f gq HQ QL wwf W w N X 4 F EA: l i NN..f , 1 i I 1 if-wi 57 fi me 1779896 7926 Q9 X Q39 45 Q,,-X , 1 R xx. uf V n M, w I I I 1 lw N ,xl I wb Y lxlx IM v 1, w w V-If Nl i!! V v G r X Q I 1 'r W N 4 1 17723895 253 S 9 9? M 'J 'lg W ,4 yi Hg 13 W, , 5,1 W? PM I I 1 X1 if ' i - ti- T, 'Q ZX 59 D - AA A- 45365, fwfvf 1.1 1 1 gf 1 1 21 1 f S54 1? Q1 2 'X . 1 1 1 1 1 1 1 1 1 F 1 V 1 J Z3 60 1515 A1 f K 17729594 af WS kf 3463 V22 x X Y 1 1 X If X 1 N W w 1 4 XJ if 1 y A 61 ? '62 'lf ,A JG P- I I II 'I I,I I II III I III I. II II II: Illx II II II II. I I I me 17? DBX me Iam KI QS IS I? I II IS A Q IW I I I I I I II I I I I I I I I I I I 5 I I I I ,EI I , I I I C I I I I I I , IQQI Q' 72 I I 62 Ig MH I QQ, w,W Ax AIG If-LI IQXQIS I 5 Q19 1 ,4, ' f .JI X I N 177296395 qw Q0 ,Y S 1 l I l s 1 1 l 5 f 1 w f I sy r 5 n A i f ' E ' Q 4 N Q N l Y m 1 I 1 i + , J We f 'xx O UJAQ 4 W 1' QA We Q V 5 1, z, x.--X x..x 'Q M cs is QW 17? DSX W 012 A w K fmex ily 43 l 5 N I , I f , FJ XY y l 5 1 -Y 'Nl I Y 1 i 1 4 N 9 i Y W X H 4 Y-fn! Q50 1 'X X' Vke 4 m as, AS Q L Y 3 N l Li A- ' ff 2jj i'jY V5f-- ff' 1705896 W ,5 jK6QYjgQwQ0'g KF K4 1 43 4 f' X U4 V w ' w 4 I , A Ig Lfx Y W gd SEQ G I fx? 66 I. V W P W ff' 17723896 ffm QV Q5 Q Q L ', Qu PM , , jd 212 W5 X ' Q35 N 1 N I K 1 fffmx P is Z y? , M ,A W sg N , , I Aff- X X Y 4 fxkj u ,f fri J W A 1 1 1 fx? L Q, 4.6 'hw VWOA? '1- ' 'me 17 : 1926 -- J ,L 4 f EQ QF! lg? ?ijj'T 1,3 69 5 Q JG 4 ,X QM?-Q I Q. 'J 912? fi 1 1 N P Sy l Q 'Q ff' 17323836 1926 355gWZQw1QV0 9 Q l 15, 1' cg GN. .-576-77-t :'m'1vx-o:fc': '. . . .evxvnln-rr.'?'t'Z'?.-.-.-.-. ....... A , 5.5.5.5.3.5.5.5.3.5 if-IC -I'Z'I-1-2-1-f'H'I'f'f-1-1 '.'.'I'1'I'!'C'f-T f:5:-:-:-:- . . :5:5:5:5'f5:f:3:5. . . f:f:f:f'5'3 2:f:f:2:f:f:52:f:Sf:f:3:5: J V. . , :5:7:5:5:f:1f:5:i:3:5: i.5.2,5.5. 55555: 5 I5I5I5555555555555f5fE555555555 ., 5 I 5325525555 :I:izf:1:1Ef52235255'K'ET:155515555:2 2125552532125 2E55IEIE1M5152E251EiE25 2555255525252 5.5.5552525E55555?Z5E5252525E5E5E5E525252555 ' ' 5E5E5EEEi25S5E5E5S5E 535525555E5E55525E5'5'5' 1:5IIE5E5515 .-.-.355535353565555555555555'5'5'5'5'5':'5 '5'5'E551E55155E55I51515 5-552-5555 :5:5:5'5'-' 5:515:5:5:5g5:5:5:5:5:5:5:-:-:- 5, ,A,,.,..,. -:-:5:5:5:5:-: 5'5'5' .5.5.5555552155555551555552555555.5.-.5.55555555355555355E555E55g.,.,.,.,. .,.5.525:35:fi:5:5:5:5:515:35:515:5:Sz5:5:5:5:515:5:izjcijifzfzfz5:f:f:5:5.,.5. f :5:-:- -:-:iz521:525:5415:2:5:525:3:5:iz5:5:5:5:5:5:5:5 'HT-:-:5:515:45:521:5:5'5:5:5:5:5.-.-. . . . . X - 5 5155555555555f5551555555E5E15551525555Ejffgiifi5255555255E525EfEI55S55??flf555555I.-,- , . E5252252525212 55555555553255555525552525252525E525?2525E5S5E5Ef252f5252rf52525555525255525E523E5rE5E5E5E525252 Z:2:555g555?2555g55555jI:I: Q ...,... 5552555555 -.-...-.-.52525252525525235535E52525552535252555.555E3553?iE5ErE523E5E5252151552352555S52525252525552IE525252525E5E525?i5E525E5E5E35 5252.2-2-2-2-25E525E5E55355252-2-2-252-2-:Q 2.25:555E555255555255555555555555555555555555555155555553555555555555555555555E5555i5?55529555555555555555555555555555555555555Q55S55555555 . . . . , . . 2izI:5555555E5E52555555E5ifE525552555555555E55555:1212f22:1:f21:f:f- 2222522522535sizisiisizizfsisiz:'s55255522525225E25E235525525E2?2E552?252E2?5E2ii2:2.2 f 2.2.2E222i2222252.2 5121212122252 frifif 25:5:5:515:525:5:3:5:5:5'-.3:5:3:3:5:5:3:5:5:3: 5:3:5:5:5:5:5:5.ggg:5:5:5:5:5:5:5:g: 5:5:5:5:5:3:3:3:5:3:-52:15:31::5:5:5:55:51:15:-:5:5:g:5.g.5. x 5.5.5:5:5:5:-:5:5:5:3:5.-.5. 5552515252 5:5:525:5:525:51-:-:-:-:5:-:-:5:-15:-2-1-2-:':-:5:5:??75T':QYE-:5:5:1:3:5 5:5:5:5:5:5:5:QJ3:?:5:5:3:3S5:3: 2:E:izfifzf:zE:f:f:5:f:E:f:2:5:3:3:3: 5:f:2:f:f:f:f:5:3:5:7 :cf:f:f:5:f:f:f:f:f:551525:523515252525 :5:f:f:5:f:f:f:f:f:Q4I5:f:5:2:5:3 ' 5:3:3:5:5:i: ' ,I :f:3:5:3:i:f5:i:5:i:5:5:5:5 'Q:3'i . 3:1:3:5:f:1: 3:5535151575351535353515153515555fi5351:-5-52555535553:5:5:1:T555155fifififhifffffiffffffifl 5:5:5:i-t5oi5?8P3if5iT'35555:2:2: '5555155555155555155515555525252E15555552-5-5555353555555 535255555555 5'5'555E5'5'5' '5555555555535E555E55:':'5 E15521:-fI'5:5:5525?i5E555515f55525 If5EI5I555I55555553EIEIEIEIEIEIEIEIEIQEIE2ESEI5if25IE2525f2254Ef5w..f'5'525'5'Q-51525 k5:3: 5:- :5:5:5:5:3:5:5:5:5:3:5:3:5:E: 3:5:3:f:5:2:f:f:f:f:5:f.-''3:Q5:f:5:f:f:f:f:f:f:Q:f:1:3:f .5:5:5:5:5:5:5:5:E:f:f:f 252:52 5:5:5:5:5:5.3. X '5:3'3:3:3 ' .Tf5535T51:i:?:f3:551335355515155 15555551.5555155fi53535553525555:35'5555535355535'3.-:33555555555555555355 S:5:5:2:f:-5 3:35:31:13:5:7:3:7:3:5:7'f'5 -:-:-:T:E:QE:f:515:-:- 0 5 -..3:5:3:5:1:2:5:V'fi525i535153f55 35352555355X5353555555555357535555555539535155555555555351555355 f5'i'5'5'3'5'5 f '5 -5-5-5-5-2 3:5:5: 35355555355551555:55555:P5'3'5'7'3'5'5'5'-'-'-'5'5535555555255525252525251515252525252-.5I51gZ52fZ5 4 '535I'Z'-'Z'I'15'A 7:5:5:5:i:5:5'k3:-:f:1g:3:7:f:5:5:5: ':5:5:7:i:TS'1:5:1:3:i:3:i:1:7:5:f:5:1:1:f:5:3:3:5:3:3:5 2525252525515.5555555555555525555525552555555f55f555f5f53535555555f55555Eff5255525f5f5f5ffQ5f555f5555555255555555555 '5'5'5'5'51ff5f5555' Ei52E5Eg2525 ' 525fg255515255Ej'1E5E53555.252525532555555 5555i535f5mSf35?f355f5515 -:-25:-:-: 5:5:5:5:5:3:5:-'-',-,'-46' I:3:5:5:5:5:5:3N:3:5:5:5:5: 515:515:5:5:5:5:5:5:5:5:5::: 1:2 :gig15:315:3:g:::5:5:5:3:5:5,5.5. .,,5:3:5:5:5:5: 3: .4i525:3251'-:5:5:5:5:3:5:5.,,, :j:5:5:5:5:5':f:5:f:5:5:j: 5:5':f:5:5:5:5:I:5 5:55 5:515:5:5:5:-'515:5:5:5155:5:5:5:5:5:gf:5:5:5:5:5: 'A 5,5.5:5:5:5:5:5:5:5:5:5:5g5:5:,:3E5:5.5.5 I :5:g:5:5:5:5:5'!35g45:5:5:5:?7g5g5:5:5:5:5:555 :5:5:5:5:5:5:Z5:5:5:5:5:5: 5:5f:5:5:-:5:-:5:5:5:? -25:5:55155:5:5:3:5:5:5.5:5:5:5:5:3: .5.3.5.5.5.5.5.5.5.5.5.5 .5.5.5.5.5.5., 555:5:5:5:5:5:5:5:5gg5g5.5:5:5:5:5.g-'2'- 5 :5:-:-:-:3xf:5.-.:-:-:5:-15:-:-15:-:5 ,:-:-:-:-:-:-:-: Z22-2-I-2-I-2422-I-Z-I-2-2.2Z'Ij-Z- 1lQI-C51'1-I- -:-:-:-:-:-:-: :-:-:-:-:-:-:- ' ..:-:-:':-:-:-1-:5:-:-:-:- ....,.. :-:-:-:-:-:-:- ..-2-:5:-:-:-Qg+rZ-C-:-:-:2:-:-:2:-:-:': '-'- -'N 3:3:T:f:5:f:5 .-21:3:3:i:3:5:f:5:T:5:I:3:3:fff:2C:f:5:5:1:i:1: i:5:f:1:21:1:f:5:iL7:i 15:-55955:-:5:5:5: ' - - ' ' :-:-:-:-:-:-:2551-1-:515:515:5:5:5:5:5:-1.-:-5:-ze-:-: ..:+:-:5:-:-:5:-:-:-:-:- :-z-:-:-:-:-:-v- ...., - ..,.. X 5.5.5.5.5.5.,5.5,5.5.5.5.5. 5,54.5.5.5.5.5.. L r ' ' ' ' ' :5:3:5:5:5: 5:5:5:5:5:5:5:5 0:7?7:'1'J'-:':5:5:515:5:5:5:5:5:5:3:5:-:5:5:gq.5:5: -:-1-55535555595-255555555355 '5 ' ' ' ' ' ' ' I ' . . . . .'f'I-I-I-' .-1-I-I'I'1'I'I-I'l'.'linHr90i'I'. , .'I'I'I'I'C-I -get-:5:3:5:5:3:5:g:5:5:5:3:5'-'-'-'-' ..,..... -I2I'I'I'I-ff-I'I-I-I'I-I-I-Ii-I6I'l-I-I-I' :5:515:5151V.-:55:3:5:5:5:5:5:5:5:5.,p13:5:5:': -.-. . v, ..... . . . . . ., , . Z- 1-1-:-1-:-1-zyf-.-.-:-:-:-i,:f5:-:-:-ffSr-b:-,-:-:- 353555555355123555555535i555351552lN5:-:-if: : :-:-:-:-:-.-.-.5.5.-:5:-:5:-:-:5:-:5:-:-:-:-:':5:53gE5:5:5:5:5:::5:5:5:5:5 '5'5'5551EI5i:-if55535552525K 1.25:224422552ga:222:222:215:s25:522:z:s:s:s:zs:s:2:s:s:z:f 1------- 5 ---- - ':'55555E5E- 55555255555255522222325512 - , ..... . -:-:-:-: -:-1-:-2-15:-:Az-1-:51-1-:5:3:5:5,-.5.5:5.5,5.5.5.3.5.5.54.5,5::'Q.5,5:- -5 .,52gsg3g2g5:fg252g3g5g5g5g'- ,hagzgigegigegagsg2g5g5g2g2g5g2g2?-1:1 .5552E535252555S525'Q'52555555255Q555E5S5S523S .2 55332525 1E135E555E35533E5E5E5E5E5E5E3E?E5E55555Il''I2rE532f3E5E5i?E5f5?2fr2 5155525552525252122212525E5E5E5E5Z52?E5E5E55.25- 4 :5:2:2:5f2:2:5:s:5:s:2:2:2:5:5:5:2:fs..2:5 2:5:5:2cs:5:2:5:2:21-1.2:2:s:5:5:2:5:2 'A1:2:2:5:5:s:5:Q:5:5:5:5:2:2:2:2:5:5:2:2:f:3 12.2.2- EQE5552525E555255525E5E5E5E5E525f5,525E5EI' .555355555E355E15F5.5:555E252EIE1E15525E5E535352255555555-www-'jjQIjQQIjijIjI5I5:'Ii,E5EgE523252 555255555555555555555555555525555555f55EQ5555555553:5523555555555 52525252325252525211,525252gE525E 52525E5E5E5E5f 525E5EgE5EgE535E5E ffffffffffffff5252555225555 355' 5:5:55355555555535I-:5555555555555554 2725555555555-. 25E5E5E5E5E5E52?E525 55535253555552525252525555 2sss2sssss5'.2faisisisifiaisiffffa'5ii:222e2s2Q2se5se255se2si22ei2isi 2ff1Q22eiff5f'2 . . . , . . . .. ..... ..... I .-.'.-.-:I-I-I'I-I-H-1'IAI'l'I-' .-I-292-IAI'I'I-1'I'I-' ' 2.2.2:s:3:s:5:51:5:5:ss5:5:5152:5:12.5:5:l:5:s:5:5:s:5:5-ff ':5:5:5f2:5:2:5:5....... 5E5E5i525.,., :5:5:55555555555555555555555555555555255Z:5555I 5555555555555555 52525 352555552552255255555555 555555555555 52525252525252ifi2i2i2i2ifi2i25f1E122e2if'l.52f-'ieisieisisisis , 52255 1:Z:Z5I5I5I5I5I:1:I -.-,-51555155253152'4'2-'Z 2Z. '55:55555555555555.5.-555,-:5E555555Z555E55f5555 -:5E555.5f55:555555... 25522555555555:555E55551E5E :2:5:i5i?ZEi5Z5i5if'2' . Ziffiiiiifiigiiiiiiiii :5:5:5:3:5:3:3:-'.g:--:5:3.3I5:5:5:5:5t5:p -iyflu-PI.1232232-Z:Z3Z:Z3Z:I3I:I:IjZ -:5:5:5:5:5:-'..5:5:-:-'-'- 535:53-:-:-: -:-:-:-:': :5:3:5:f:f:f:f:2:?5'1zf:f:Q:f:5:f:525:525:f:Q:E:f:Q'f.5:f:Qzfiiiff 5:f:5:5:5:5:f:f:Q:. 3:3:3 -.3:5:5:5f3'..5:f555' -5552555 '5'5'i5i555i. 5355555557 25222rEr2rEf2rErE22 23225825553f555535553555155Q' 2222E22IE25'.-Q5E15QifE1E1ErE1E1E:212:22EZ 2rE: ' 5 5-5255252 S5E55?Ei553i3i?fiZT5i?55Eii2:S5Qi55i5555355253355iii?5-555555255955555:2.2155555555Ei?i?i5iii5Er5:255i55+?fIfi5- 55555 555555555555525555555E5555555555555E5 -5 ., 555255555 z:z:a5i25Ei52525252f2s. 2555555555555 fsfzfizifizEizziivsieifiiififii2152525252ifi2ffPeff222f'12522222222IZ..f2z2f-: 5255255555 -'4' 55.52555251221312:s5aEgGZ?Es2zE22z1122f ,, .... 5f.2a2sEeEs .,.g. .5.5.:.5.3'5 .-:-:-:-:-:':-:-:-:-:-:-:-:-:-:-:-:-:- .-.-.-.-:-:-:-'eT':5:5:TCT-:3:5:5:5'5'5'3'3' 5 7 3 55.5.3.5 ..:-:-:-:-:-.2'5'5'5:5:5:5:5:5Z:5:5:5:5:5:5:5:5:5. ...5:5:5:5:I:5:5:515-1-'55:5:5'b':fE:5:?:f:i:i '3'3'3'1'5'3'5'1'3' 5.2.2.5.5.5.5.5552525E5E325E555.,,,552555532E5252325E525E525E52'5.525E5E525E525E5252r5E5Z5Eri'--E52525E5E55r52 225252-252225252522 -I-I-I-I-I-I5'5'5 2525252525252555E5E5E525Eif25i5E5E ' 255255E5E555E525S5E5w5E525252525Eyf3LjI525E5.5.5E5E5E5E5E5.5.5.5.5.5.5,5.5.5.5.5.5.5.5.5.5.5.5,5.5.5.5.5 .....,..,.. 52525 5525252525235 52525E5E5252g .5E5E5E5E521E5ir. 2522252521 :5:5:5:5:5:515:5:5:5:5:5:5:t5:f:5:5:''':5:5:5:f:5:5:5:5:5:f:Q:5:ff ,:5:5:5:5zfzfzf:Iii.-:5:Wf:3:5:f:3:5:5:5:5:5:5:5:5:f:5:I:5:5:5:5:5:5:515:5:i:522:5:5:5:5:5:5:5:-.-.-15:5:515:155555555f5f5f5f5f3555i555f5-..' '5'5 ' 5i'T5f55:f'15 55555553555?fff5555f55f55555555..5555555555351 5555555553525 E5E5E5E5E5b3?8S:?HE5E5ErE5E E5E125E5E5E52525Er2r255'2E525252r25E5E15'E312'SE52221255.555553i5'25,555.5,55i5.55,5555552,E.f.,,,,,..,,.f555555555555RQ51555555iLEi552555f5i5535555E5255555555525E3E5E5E5E525E5E5E52- 252 1E515E1E5E525Q 5552555252525E5252525E5S555252525E5S5E3E5E3E555E5E5E?.-.- 15552555255 555555555255 :55555555 . .55355555555533-.- 5::553515552535555f5535' 5 '55I5I5I525 '15555555555555' :-:-25555525555535555555 55555555'5':':'5'5':'5':':5 :'5'5' .5.5.ii5ii2is5si5Qs5z53555z5.,.5.5.5.5.5.5.5.5552535si2ieE1E2I--iif55Qs5s5s5z552e51E1Ef 555555555E55555555i555E 5555555555335 2552525 1551 ' 5252525E525E5it2525252525252525252525E5E5E5E5E525E5Efii ' 5E5E5E525E522rErE5E5255 ...5E52525E525E5E5 2525S525E52.. 2EE5Si?EEESEE5'5EEE5EEZEi5E2EEEEEEESESEESEEEEEEE55':if55iiEi2i2i5SSi25252 2225535zEs?gs5sEzis2siz:sS 25E22525252z9fSfs22EsEz2isE5Szfs:5:2 5:5:5:3:5:5'.-:5:f:5:515:5:5:5:5:5:5:5:5:5:5:5 .-:3:3:5:5:5:5:5:5:5 '5:5:5:5:5:55:5:5:f:5:f:Q:5 f:5:5:5'5'3'5'5'? :Q:5t5:f:35:5:5:5:5:f: 2555255525.5E525E53E5E5E5E5E525E252r5 5525552525255525252525252 252525 5225252525252 2525252123135 252525252z5252325252525 :- -:-:-:-r:-:-:-:-:-' .-1-:-:-:-:-:-:-:-:-:-:-:-:-: :-:-:-.'-: -:5:-:5:-: :-:-:-:5:-:-:-: -:-:-:-:- .-:-:.:-:-:-:- 5252555552 -5325555555555 . .-:555555555555555555555555255555 :5555555 555555555555555255f5555555551555' 5555555555g5555555555555 5.5555555555553555555555555555555555Eg? 555555552 5555555555E5555 .1.II:If::I:f:Ij2:f:I:2:I:f:I:1:I ' ' :I'I:I:f:C:I:I: 1225122251222- '-2:5121 ljI:I:C:I:IjI '''55252555255555555555555' ..E1E1f'I-2129 225252225222 555555155Z255?5'.-2 55555 152212251555 .. f5i2i222i25fi2i1f1522f1F 5252,.,, E525E5E5E5555525E5E5ErE5E2 -5122552525552--' :-:-:i.5f555f5f555'5'5 5555555555:5: 2.2-E5555555E5EEE5E5E525E5E5E5E5E5f55fE5f555E55.-.- ...55555.55555555555555555555555555555555555555 ..... ' ..... .. 552555:55'5'tf55I5.-1-52-5' ' Egjfgizlilg Aisieiiiiiifiiiieisi ..... 5555555555555z:s:3555555555s:5 .a:i:z:3:5:a:s:5:5:1-1:2 2-2-55555 :5f5555 ''555555:55555355555555''5E5555555555555555555:5:5.55'5555555555S525535f555f55:5:5 .-,5E5Ef25551fi5555555f5E5E55555.. 25----5 25255225 5 5 5555355555555 .. .2 ...., ,..,........, ........... .,.. ..,,,,,, . 2 . , ,,,5,2,2,:,:,:,2,:.:,:,,:54 I5:55:55I55::5:5::::::::::5:::::::.. X .,.,. 15:35:52 5 E 5555555 - -'-:-:-:c-:-:-:-: . . -:-:-:-:-:-:- '-:-:-: -515:5:5:5:5:5:5:5:5:5:5?:5S:5:5:7:5:5:!:5:5:54 25252525252,2ii252525?215252,25252,252,2,25252,2 :gf ,5,:55,,.55:5,, 55:Q51555,-,-,.-.-.5:5:5 .-.555.35.-.-525:5:5:5:5:5:5:I:5:-:-:-: 'I-I-I-2-1-PC-2'.'I-I-I-I-I-I+I-I-I-gil-I-I-I-. fri-I-I-Z'I'Z'I'I-I-I . . . . nl'I-I2Z-Z'Z'Z-I'Z'Z-I-I-I-I-I , 1 W ' .1 ............ . . . -M'?f'H4+Z-Ci-I-I-I ... ....... .... ....-.........-,9 .....'...v .........- . . . ...... I . ...... . . . . ,N,'.'.,...+.5...'. - - - - - -'ZZQI '5:3:5:5:3:5:g3:g:1:5:2f 55:2:5s:5:s:a:2:s:s:5:s:s:s:-5----'--- - . :2:-:-:-:-:':-:-:-:-.-.-.2.-.-.5.-. :1:i:3:... ...... . .... c-:-:5:-:-,5:- :5:5:5:5:5:Q25:5:5:5:5:g:5gQ:f:5:f:f:2:f:f:?!f3:5:5:5:5535:5:5:5:5':5 :5:5:5:i:5:5:5:5:5:5:C:5:5:i:5:5:f:3:5 :?:5:5:Q5:5:35:i:5:5:5:5S:5:5:5:5:k5:5:5:5:5:5:5 -. ',5:5:5:5:5:5:5:5:5:5:5:5:g5:53:5.5525:5:5:5:5:5:5?5:5:5:555155:5:5:5.,,:5:5:5:5:5.,5:5:::5:5:5:52:5:5:3:5:5:3:5:5:5:5:i5:5:5:5:5:-:5:- -:-:-:-:5:5:5:5:5: .. 54-M-ww'-'W' ' ' ' ' ' ' ' ' ' ' ' I-5-I-1?-5-2-55I53:552254bF5fi555155555252525-Mwwv-'5'5'I'5'I'5'2'1'5555:155?55E25S?6i-2123525552E21:5?525 '' 5:555:5:5:5:Z5:l:S:5:5:5:5:5' x -'-'-'5--'---:-:-:-:-:5:-:-:-1-1-2-2-1-1-m.g,2.g.2.2.2. -:-:-:5:5:5:5:5:5:5:5:5- , , :wer aa: :-:-:-:5:-: :-:-:5:- :-:-:c .-:5:-:-:-:':-:-:5:-:-:-:-:-:-:-'+:-:5:. . . , . :5:?: 3:5:T152511:5:5:5:5:7:1:5:5:5 . 3:ft5:3:C:3:3:i3:i:5:5:f5. . .5:C:5. . . 5.5.5:5::: 3:5:5:5 :5:5:5:5:5:5:5:-gcgzg .5:515:5:5:5:3:5:3.3:5:513:-:-1-:5:-:-:-:+:,. .5:5:5:5'-' .-:-:5:-:-:5:-. . . , .,.. -:-rp:-:-1512:-:5:2-:vzo:-:-:-:5:5:-:5:5N-:5:-:-:5: 25:-:-: '-5-:-44.9144-:4,:44-1-4-zo:-:-2-3-9:25:5:5:g:5:52q1g:5:5:5:5:5:5:g:5:5'a-' 71 mi? 17359595 'sf W E-Wav, XJ -- J-. A, 1 w lyk!! so 7, 4 .315 J 1 Q bm ri FRESHMAN CLASS OFFICERS President . . .... .... C LARENCE ODELL Vice-President . .... GRACE WILLIAMS Secretary . .... .... M ARVIN DEAN Treasurer . .... MERTON BALTZ :Freshman The Freshman class put on a section in the Hobo Parade for the first time in several years. About thirty Freshmen took part in it. The section was led by a Hobo Band playing Here Comes the Bride. Following the band was the preacher and bridal couple. The bride rep- resented Charleston while the groom was Death The bride carried a bou- quet of thorny briers and wore a lace curtain for a veil. Numerous ribbons were tied about the limbs with a large watch worn as an ankelete. The groom wore a long draped black gown. They were followed by the best couple which were dressed according to the great occasion. Girls bearing letters that spelled Freshman were arranged along the out- side. The letters were green on a white back ground. E7 The section caused lots of laughter on the part of the onlookers because , N of their costumes and was considered a success. it T kg gl l T ' X ,X l 72 G T ,7.D..W a a 130 I me 17? ZDCX 1926 , 9 QQ x f' WX 4 1 Q C , 1, X jf: +525 154 nfl? V I I 1 i ? EQ v 1 15 f nw mm 1 2 f' GQ H5 ' -A fA'i77Qif? -f-5 + ig?-A MQ? 'NZM SHE .2 W A ff' ffffw ag? M D 1' T Q2 Q 25 G lfw 74- QA N I N K 1 fwex .ef YQ If J, f 'x K 4 1 5 l !. s v 1 4 ' 1 + 1 1 i p a Q Q Q , X J QQ' 75 ', F gpm - A A M A xg V2 . 1 5 I ! X . A H f Q wwf mx 'xv' . X7 N' , 1 QQ? fgfv gp 1 4 X' V x' A XF X Q2 L, ,gi v X 1 V N X M i m l i Y Y N I , 1 N 5 N N Q , 1 I N 2 l V ' , 's Q E 1 ' I , , + V 1 X V7 Q' ff il 'ggi 2 1 T 4 f xi I-:aj VK'-XJ gg? Jfgf 1'-f ff, U Kb- f , lg, L f f XS i' nf1Q1, ,f1 - ff-K , A GJ f,x fffwf 9 If fyfjx x ' fi Q, ii X f P443 f f x Zn-Q f ' N F ,1 lx! I I n o , A I X , 1 x qi :V Im V I 2 ' r fl ,yi 1 N I wi I J ,N N gi! 1 1 il + IW inf' W W 's QI Fw fi ,i' .M 1 I l. 11' ll! :ij 1, !Q W. H I'l 5 K N Sw . f 1 ir -'F Q7 r Vfifx AN VX-,f N n G17 TXX1 CJ, 'fl-N E W X N ' D 15' WM 3 453 Mk! .7 5 'A E 1, 'fn W ?f fx ,i w 1 1! I X..4 A i LJ X! rg 4 78 4, 5 4 ,K 5 Qs 1799595 QS N , X WK .gi 3 4 P V 1 Q Q L A lfx-x xi-ji Nvfx Y 79 4, f Pj QQ W wg 17729595 4 W W 633 035 Q2 h W EX W Lf-X X gi W V54 6 42 A M 5 80 Av' A F JAG Q '01 W' M QW fy me 177953 X mf, W 9 I 1 I , 5 W , , N Q M N x L M 1 + N 1 w 1 W , 1 A f w U , ' I I L3 W MF a V I F F in 1 1 W w 1 Q 81 .Q A fvwyf Nf Q OOGUQ l asm J SD TZQQQ WICQD N, . 0 -'-' -'Q-5?z Qqggxjiarfa-.f,-X2Qf2aw.z,fk 212-wmaiwf-W -iffrifey ' 1-'Q' ' .,:s:z:z:s.zf.z.5:z:::.--1:5- ,--:.-.1--515:-:::z,-:,..:5f.3:3:-' ' :-viz::wx-2.:r:,,. M1153-.vf'?5Mi:g ff6'1.'agf-fiwfv 0 12- :af-' .:--,::-::-:::-::-f.-:::-,::::-. .::-:---:.-::- - - -::::e::::---- -:-.-:1:-2-,::Q:......-:-:--:-5--:-:-:.---- ..335125-::a:::S-2:E.:5:a5E'1:z6s2:2z:s:zs:sa'1:f:2:z-.1-1, -22342 .' -M-,gw2,sfM?2v-1-'Eazgc -41253 M fP2'w:rf1?.:.-:-vm iffffffa-1,924-1'w,'f NW M2-,?v '-3 ws- af' 4--,ff-f'4::Z': . fff5:.-4-'- 41- -2:-24 55-22-a2f'Q'e,2335gX,3Sv5f?v23.3vgqy.,gg-53:5-.gs-5-5.3-Q-3.5::',-5::5.j:1--5.5:,-3:1-' 49,15-', I I,gg:45:33:5-5:5:gf-r:e5:1:gr.5.3.5:'- ::'.,:2-:5:::2:j.gr:2g-:f::r.:::2z::222-::M::::::-22 vi 2-1-21 '2-13 4 ffW-Iixfk-F4 Sv'Ggf97'fi 4i!05?-V?','5wf5ZZ5'f?35 -5 5'3qw5?54? ' ' 4 ., . II AX :ag 2 .-4422 .' - f 35 'H '3f W5223ff923a i2'rk2x'?J'i-xmifdvzfaeg-?f fQ:2. Z x-Q'f2re2'f22w3xM?2':eWf-?'N22:vs?2'T2-3m2H'23g+?5212f5f:52254vg,4Pa'3? '29 f'0 '2?222z-222 9532-Q'?m2wa2xQwz.f'a?4:s:g?.g2eX:2?a-.2353-fs-xXQ234fgg,. i25fP3-3-W -ieg21?5'g5?2' 5:2f2-2i-i?,vf:-Qxz:33'X35x:3f2 X- 222. 355-Z2 - .-f,-Qif4,e-Zifmfswa .- .- gxifw- - Q: -2 fa: - .ez 39 wxz.f4:,-3-a.Xmg22-::g4:rX-Q-4-Xe: .- . - x -:Q i-QQ x 2 f x: rf--2: QM-ay X2-mf?-.wf :,zf 44 gif -2 a,?2Qgf2XS,i,'Q,QJo k QI.f- . - I ----:--:-,4,.-:2-- 5 5? ' -Mg' . ,- 'YQ :X Iy'4aq. ..X?g1-A-2 , Q .-.Vw ,f33,I:,+'.,Q' iz Igvfggggggg-:,.,a,f? ggfldgw ,- 5?-22 'f' 2654355252613 Xf:-aQmjg.w'-:-s5,:X:,,2:- 2522?-X:f,X3 Kay- 5?:wg?:gsf52??9Q' 1- ,-g2'.32-3f3,fS22a53,rJi?-f .' -- . -2 yi' nf: w.2e.Q'Q3m,:. 'fr-Hagaaw-X'ar-Q: xgmff , - --2 852:--+4 Xr-,Q .few , Q-M, wage? .. , -,-243, .- w , . .f ' ,1 . - ,W ,322-?:,we2fgf -2 32 Z-f.m,g4 .Qga-saiggegiggv-6 3'-'flag Q.-6 4452? X.g,'+YzXe,2'-25-,-5255:-A-Y1, km - ff Q: 9 9 - - .M y52gg:Xf3:a5,5s-,:- -f Ma w yfiogz- . - +5-Y . - '- -- wmv? .-,frz'Xh'iv'3fb:fa3m',:52 - - .-'ff-.u. . wwf? eQ,f9'2.-rg? 'wav : w e- F- P. ay-bf.fs212 222'-45,-X Q ' me g 6 za- -'A-ff z?4?'542Mf222 :21?55i-'fz2a-5r-v xJa3:'i,gf:ISQ42,g,,22b:,3gf,g5g:f . g If.,-5229 a'2egb5i?,Ig92,,4 . X-, . -:Q a. 4- -- - x v . 554525 ,5e2i?g'4w?24-22322 xgvgiyvgvrmahgvaahfwa-awww - -'N Q2-:.2?-Q P---f .,-: - 1 - 32:-X,4 2 12' -, - , :vegas-.:X.:2wx-QQQXQQQBQX-vfrgi-QQ --b - . ,-.gy - 4 Sw -. v .QQ . . 23244-r We-mx, -22? :- X: -wi.- 54? - -2,2-M824--?M2:z2.fz.fapfsaw2w -- - - XX 'gag gzbtga QIQI I 3 ,, XX- 39- 5-5,2 - X, I -94014. -XX , .- ,542-mg,i5g.23' Qa' 2 ' ,.',.'..a' fv21r,,:-'-QQ - -2. gif ,. iqvr-53-3-fbxxizieragfi-gem' 5'2vsQ5??wM y - s52.e X ,A.A.. ,3 13 ek - + -'.-- - -.3-2- Q W-.-4.-.--1 -4 . .-,apo ,4.-.g:::g.g:g:g:g:f5:::gg::g.g:-:::,, ,,,, .- A X-. :gy X '-1 2 L--9:,.,.w ,ggli-',,-:,-,--1.'::.z:5:z-1.8 K2'4-...-:L-4:224-is-fI27::i -4.295- f'ff:. - f'?:,fz:if?fsfa'fg ' 15: ' - ' XX 8162.-'32-Q' wfexamir- X.: 32 . -1' 'ov' ?3'?' .2:-1:.:a:5z:25:e-5:5.5:s3:2a:a::2-1-2:25-:::-:::.. 2? -. a- . 3. .'-2' --?'0' - --M:-..1:-.2:' .2:fff---'.--6-2-11:-.22-If-1 :rf1 2-2-11'--S-2-115-2-fl 5323459 mv- -' -if-of-'5? ' 3 'P' ZW? w .h-xv - , , ' - X! X -1-- . ::.55:5xg:3:z::g:5:j-g5:2-:1.-:2-'-- '-'-'--:-1,-1:5--:Z:::,.,, -'- . '. '.-mfg N111 ,,- 52:31-'r55511155.,I-z55EZE5E,:25EI-I-:'-.-E2E1 ?E -.-135-wi' wap 2',q,2? ,gf . , RQ? 59-' -' f 633552 ,.p?3X- 'PY--Q . .: - yr. - .W --yf.i5'5 Wg- 2- 5?5-:-aE-s:1-:--:f--,,,. .,..,4 -'-2123 73 '0'::-'- -2'-152.3524-22 -2:2625-2-:2,:a5:1-2-:5:1:54::s:5s::ifE:':::.2:5z522221.. ....2Ef3sS: ' fI9g?i22'55gfg,15f'41' 'P' . ff Mx- k5 a5'3'i.ag? - 'g.?x- . 0 4 ig 'RQ . ' X-1'-X . .2 W 2-f? -1-W , - D+:-g-.-f:,Xfa,g-M-,:, .: -2 5g--- . , :. - .-.wx-:o?Xggff.g,f9,1292-q,g,am ffeiz'-2-2.22 .2626 .- -- -. - .2.-:-f-.:-,.-:-- , Q , ,X -.:- 03, gg-2, .Q I -I ---,--5.-1,, -- ,fr :.' , ,:-'-2, -Q-,Fx .2 s-:::-21,Q,X3,Z2 9 :Q - - -- Mfr: ., 1: .fg:f.s4,4'f'-'ff' 2-:IA2 - w2S'.4g,h.22n?.4' ', .- QQ., .rw . -f-. --11.5 --g-J -- zrzafzwefaz , . -X:---:: ' . '- 1 - ' - 'win-2-Qzfq -rg :gg-fb,-.Fo-.J 5, . fo- z. . 35,1432-Q, - ,,. -9-far'-'.-,Q-,-v,5f':,-.,-I-I I -F' -22.-.X 53' ..:r:1:zf:1:-s-:2'.-ww--.-: 4' 4-.- -2s-'r-'C.- ze- -'32-,'2X52:3:f-Df.H - -- --2.-g Wffff-, -. . S-425.-SSYQ'-v,fg'?'-54?aff:-f'-AFMQ5. 4 -ff -2 7- 4 ww--22-1 --:M z--:XX f .032-202. -'-.w .w --2--ww - 29 -N: .-S-2, .::e4::::1--.'::f:4:- -:Wk +fY2Sw?z,ec0' ,.--:.'-:1:- -- - 1' - .X-:4 ' , -f 1-: F536-'42 -- 1 ' . - f -.3.--'61-W'-Q Q --0 fl- --2 -'W-.A ---2f.f:,-X--.-...W .+:-.- .::.::-::-153754:-1 24-2:5 -f:iQw25:.xv?.-453055,-My,:.:-.-,.::.- -. - . 1- - -2 . -- 1.:.:--.1tw-iffmi-?S'+-'Q-.W-s?f9fSwLf'W X----af: .,f. A- Y V' -- -. 'firing a?:X.W? '.4., fYf9.'z'-?.'.-. V ia . '.a--zb'? 2'-2 ' --.X-af Y ,- --a-.-'iv .-.-5-1:2:2:2f:1' :.1s:2:r2 'Q9'2 Yakgxir- - 2-'Qafpvg-..-'3'i'X:fE3f:s ::::..::-:.::.-'.-:--:'.. .. . I .- ' 5 -if44'L'-123434'i.f 42Pf.'f-'31Q'--Mk-.PGQ ' 'W' 'Pix' -'91 fi f ' xx,-yvgfg-if-:.q-. A2Qf:g5fx.4.,?',,,.fQ 51:31, ,M . .,- ,gk QX.f.-- --film- ,f:4A:yz 5,g.ysX:?5:Px:- -.:-:-r.- , -I -. - -.:-::-:--. g7'5pg3-g?2f,f.,M-,fyqaifffgwa 'fgyfw -Q-.M . .qgffqf .gi--W NZ? . I .... .- I .- ,s 1 - QI I-In: 72: 2, - -j-.Xw:--- I,,.I--:,:,:55:2-2:5:3:ga5:5:2:,:,::.,, '2':2,fzy,,-,,,:,-- -2 - ---.p-:--5-:::-:-5::,:g,,-,,:-:,.--:- 4 5:52 .ff'f'lsiffi--1si9g3?e:4f24,,.v!1.v.1-3fi'gffgL2m-'- -iff? Q-- '91' 5 K ' 2 ' 1 - 335135-Efifi-fe-. '2:'-22:1-:ak'-I--ff' ,-'fs-is-1 '-'- 21-1- :EE:2-Z'.:I,'321:Ziff55-g-:::-f'-3251-. --'-ff'3'i?'?v4?: ' 'siFgf?'i:'ffQi41-'w5zgI5a:,z,-1-:,- -: ::.4zq.,,ff2-:-1-214-2 1'f.-26-555'-TA-fK5'fA?'2'2f?'fkiaEr1Ef:2'-z'?:5,rGX5:2v'74iff1fQYMf:ZE2I?52:z?e33'5f+XG'f' :1.'.-:1:--:-2- 225:-:gr-'-'- ' .VF fiffhif' -12:31-34-., . -fVivre-f4FS ?f:-'-ffaifzbisxrp -: :- '--.fm---. ' -1 -I -?g'i i-ggi .-I4 :I-2223?-I-56952-1? 5fie2'??Sv3vi9f.: 1:-Eis'-:--:E:':E- f5 iI-:'-.::.1 -512' . 2'f:'- 'H -. 'Z-2' 523,-: -..2 .f Q25-6-Xgalg if.-0,-,,: ' .- -' .- ' '-'.g-,,:gg1::1rg2-:gi 2-5::2'3::5si:-1 '5j:5-9-E5. '-I-F , ., .,1- .- -' .2'f:,:,--.1 ' , 4 -ri. -' , - .- . ,..,, '- -:--:-z:---:- :- .C-s 2- - , --1.714 -.QX .. . -i--::- - 2 1:1-1-4 f..:.::.,--::::-1: ---- 17-:-:--1-nf.-..--Ml .02222'-3':'2ff?'f 3f2-Pvifxifaf-5f?7'4 f1f::'E1-9?'ff'?9i'Q':: Aw-f -4lf::-5v:- S ' --::-:- .- .1- gif? 14' 4-2,-2 ,- :Is -21-.2-:I1'f??zz3i2XzK-,l?':::.:-'::::: ' :-. -- ' 2 ygbik ' :' --: f:1:- : :v-. :.'.zr2-'wi'-'ffffwff'6f440 :::--,, 1: ,. . . .- 1 -:ig-:::: mfeiwaf ,- .,::---,: 1- .. 3 .,:.:.,.:--.-.:., , ,gve-,, 59.14-9253? -, .....W---.-1:22-:wi-2-f-Mywif' .-:::g-.g ,,,, ,..-2:::::-,-5 .12 .. .: -::..:-f-:-:.-5:::. ----'-.-s:':s..:-:f-2:2 . -1.11:--2:fe-2--:.:2:z.-2. - :z?,1zg:4 .2105 ,--.1gf,-5.qi-:Jiri-5:.2.f.:?2:.32:':fs..:-iffwvv-.aff 2335.513 Eff- 1'-:E-n -I'sf-- -:: :-S53f:::E2-.'5E:2':s:fE?s-2.5-2'-:f -'-.-:Ez-f-5:1-sf:-52 5:'Is?5ii:7 fi :.::--E'-:-3-'Z'-1'- : -'f'1'Z:53'-Iz:s.. --' J.: 1'-::Z.2-:Jef -' - ---' 5512- ' .. . .. f-.,.-f.-f-,------ I-2.-2.2..-':2 f-1 -Ei.f:.?-- .5151 1 ---- -If-fx-22 , I-2-'ff' :- -'gig' -'-5-3--.5-,Q -..:.::'.',: .- .: - -:.1.a.- :'.5 9-3,2: ,f'2 'wg Q- 1-2. 335.'gf'--13,:'-2jg::--:g:,,::.,g:.g.,QQ 1 9- -2. -. .g-5-15--gf,.g,---3-5-1-2.-1a1 ,-1,2-:.'-'J-5. -g-g if -' 1.-'..g,.-g.g,:- --:g- fjiifjfz if ,-..- , .--.M-.:V.qx.. ,.,.4.4.,.,,,.I,. rg, . ILI , I , .Jr 4-35' - ., .--.- --,- , U I ., -. ,. - - -. fa- . AZNQ 1,5 ' if , -'1-2523535-Q,?-gg ., g:.-,. ....Xa-125222:i:-5:-fj-g:2- g-,-.,- -'-32r-gsg2s51g53g5:52g5Efl,Q:' --.r '5- -' 15iI.':f'::'-1i:Z ff -. : '.: ',:.,. .. :- ::.5:-s:A1--- 1. ':1 'x5ff22,92QyFf5 fl - 1 -- - I ,. y -' -, - -' : . 1 , .. :.. as 2 . ,, ,. .g 5.-2.-5: .i . X ., ,..., 1 . ,,.., I-II Z. ,,',,, ,SI sg' . .. .5 - - ,I . ,I IMI IE -.2 I, 51 - III. .. ,rx X -g'g.'2,,. . I -I I.-5-1:5,.5 ,.,, -- :-,:, -:,-z.:-. 1.-,,: 1. ' 'QQ XX . sm? :-. : - :-:.-:::-:2 :-:,:::.::..f::-:-'::,.. --3 1 Sw- 2: : :..:i -. .V.:::::::.i.22:1E-:2I:E2Z1.5' -fl - ' Q:-f5.'31Z'l?93 - El' 1 2-XPNS5..-.-I ij,51f5i2EfE:I:I'E'E:g?'ff-'11:'I .::.- 'lg'Z'Q5s'5I 'I- i- 'I f 122- ' -1 . :I . ,.., ,,,- . 4 Ei ' ,.'-:z-Q9 J . . ., .I 124,15 : . --.---::i - 1 . 1 - -- S5 554 , . - ., . . , . ... Iwgsh I I .. . ,.,:,.. : -, :as-.f - - . -1-1 IZILQS?-.zfw iii: fszm , ' ' 5 32 fi- 9g1e.4.::'.49'f--'wiv -1:-::: d..,a .. J -. .- -.Q-eg-. '5???w 13 , , Q 2. -,+L 'P - 'Z ' . '- sf ',.-MSI :imma cw - , S' . bfi- f y 1 X PIP.- I MIP?-IIII. A' ..'-.'::2 . -. si Lv - :' .,f.::-- Af- X-5--.-,ws-7-eq-.r,':-----2 ' if-Iii-,.a,,A W.- ei- :-. ww-s ye' 0:4531-wQQo4-of':,g,,-Q, -. . . ..M--.:-N .. .- -4 --2 9. --iw, 1 9: -A .- 'x 21'- 3? if -,::'-55.5 -5- -: :-5: A 0 L, II- . . . .... . . '-1' A A Xf I MI 5IqIIIIIII,IQIf. 4, 74 XI 53 qu I II VM Xgydq- b. . 4., . I 5. 0 . ,W-.vw - ,,, ,-M .,,-.,pX.X:si5-1519-QQXF-X-X. ,: : ,W ,. . ., .7nw,mhz, .mf ,:,Q.,f-fps: M04 --I -' -: P423 377 . :ff-E21--1-11? :4.-'fS4ffX, .:-?:wg--wgfq-4,-1:53 3.3.00 1:-2. .:-':e',- 1 ' 9- 1 -.-, 'ya .:. 31, 4:11. qigsgfmms - -::I-I.-:I.-03.-.,,.-343.1 qi -f f-,:-. 4.-by .-uv: .wr -1:-',g.,g-,px-, 'II- 7. M . '.0f'2 J. C-f. ' ' ' ' .:'.-:-.1 . .-if NI I- I- .X-.p,.s:,sps:,..2-,J-U, :fg- - -2 - 5:2-5:sfT5vv,q.,g-vym Ava-gf,,,:-. -. u X :fa . -Q-TCE? wwf-F.-.:v.-ag:---f--id--.44 4- .,::,.:::I,I3,,Q. 9-., -, . 9. w,.,Xq:4pw.: . -, .- - I, I . . I . -.Xb 2 mm--.amd:-ww-14,m:,-w J abs-Xw -:'.'SZ:, -, af--we .fy-,aw -,: -1 : -a-::':f.::'1a.1- 4 :M 4- ..w.49-Xw,,an- 14,--QA.: 2-1. 13502-Q rf-ai? -p.,2-.,f:- .. . . -, ' , -,Q-.--.--fm. mfX-gw.,:f::gf-,,a1:31'-:. gm'-f-1-f -2 ' ' -1. ,-' i . , ..,,.-z . Hg. - ., , - 1 A f I5 'A ,. Q, 5419. wwf' f' 5. ,. r- 5 -: - - ,, , 1 - iya.:gSQ,o-423, 'SW' T35 Gjyf-HI AEI X0 ,,. . ., ,g A, 553453 '---F S2-'W 11 - . 5 . , .ws ' fgafygxb g?Iafx.5q 1 ' 4 if 2 A' vi ' , , iff' ' . -. . ,..,. X ...,. :,.. .,.,. I4-f.-. 1 3 vga? it X' X N ff ' wr W? 'fsffll ' 1 v.-' . :III I. AI ,... . . ....... .ff 1.--2 . -. - f K' K , ,,,, , -H -33:2 ,,,, ,,,, , . . .,.. ' ' ' - 2'IQ-'22-123'-if'-ff'ff5-'-55-Q2 ' -- E i: -, II ns- ' -- - 1-22 , J s - I, f ' If ---' ' . I. Mads, . 1 .-M. ft ,Xa .--.:534.:z4.kf.-MU 54-z:f?e:2?,,rg,,.y:w.-, - , . ffm, Iwg. -.Q .:- - 5 . fA ,.-. ,- , ' ' ' A ,X , E mg M2512: 433 f'- ':': ,' ff ., QC ' --v I -4:-:'-:f.::-4,:-:-.4.f- -,::.:-4--,-f - 0 22262-5:3-:-m:.A-. - 4 - - -5a-51-m:ezs:z:-s-as-z::z:f::. L1 -grae if-:1:i7Q:'f?9'Z'-5 ,, -' 2 :-2::-z-:me-.2-rs-1-:'.f: -:-4. .fa-1'-f-. - . -. ,H - , .I .2 ':ggX,y'4-s- --,Q ,, --:-::':f:2?2-'-r-- ... XX .-:ff-N, :N 4? -. - . - - X f ' if ' : ,I'vI?'. . 243f,4,,:' . ' X X 4 iiifzfjjfj: ' EX: 35E1:35:3ES5?i- .... , .... 'V --525355 552,-155'-Q2 .. Qi ' ' ' - . - :aft-:. . w r.- Q 1 'fi 4:42 -II I: III I - 9. 2. '- , .... 12 ' '.'. i I iV3 .I I ' 2 2 2 - . . 3 , :ET - .. N... aww- I I I I I 55,1-g f .. ' i A . ,I .-' .1 -1, .tl I IIQII I II .2 FJ' - 221.1 , ' -If vig' if , , 12-5:-::.:Q':I cg. 251'W?5fZ:'2f52'j:Ef? z:::::24::::??Z:----2 - :. 1:21-25 2-15152256134 -1:f.:.- - . -. :'2 1-fz:--- :2-2 ' :?z::s :,z- -4-.-,X-.-,-:::-:eg-:2:5-45-3-:M -.-.iv--2-21 --2s::::-:ffa::2-:-.-r : :--: - 1-. f ,H :.-.,.-1,-.W--X 3:5:3f1?21fff25:5f5f2f'f2.1. .,.-, 4 21-2:22-1:52::2gaz2f':6::'f:-SIE?-2 D 5'53325525Ef2EI5'E5EfE'fE-:--:E .g5,:.:.-:Q WX ' -. - wi kE2E??9:ES1L'N 92- X. . ' -- 5 5- X- , .-'r-.::j1-.--:2:g :2M'I---g:,-: - ' - I' if551-aiyi-Q'f,XNgRW53.5Wg'?bI'QSf in Jig? .. gI I-I .I . I, . IIWI,,..,,X:, ,IX ., -. i an ig ,wx- 1 '- :::::' S::2Ei2sIf-3I??E5:: 5'f'Er Xia .1 - Fw' -. , ,. ,,. ...I 9,555 4.3.2 -. X1-4,0 . .Aw . .. .fi .-:j:-: 2:2:2:z2 - 'N- , ,... ....,.. , 1,, -P5 , . .. .z ,..- gfgbfglz 513- II .1-Q-.--35 gf 2 II, girX..MS'P W ,www XX 'QQX XXX X X XX I XX 'g :', Q. -1. -ng M :-1 -6- ,. an gf: 1-X -5' I N? -X-SX-mir'-, 1 X XX XXX Z X XX X XX ,XIX Qgkqx IX xg' S33 WXX X, X 5 RQ XX mv-ws-4-pn xffx 3: ?,X2X3e2s3m: fX-QYX, XXX X X f 2 ,- f f A, UPG if ,413 1, X f 1'-,XVff',y ,Q 1 fy NH Xa XX vf 9 ,.f.Xo? xsX 4 XX XQIIA2 wx-X Q- Z X XXX, wb XX-as xx 'S XXX i XXX XX XII X XgQI,QxS NIM X X X X X MXQNNXXXSQX SX 5' X W Xx P X XQQXEXXX SXXXEZQ 1 X -XQ XX M K XX Xwwxixyx X X X 'Q QXXXNQWX X X QXN X X X s '83, X X X 15,33 'S , X5 sg , X02 Xigfizswx XXX wXXM,I X 2343:-5?gXbXX :XX NK XX NN NX N xx Q X'-mi .Qi32g325fjgQ:.5IQf - -I :-- .-I 53 . 5' sw ,XA ps-2 222- QW ff? W- '-22521-Ei5Ez-f:f?s::f:-:..-1-51-I.15-2-' :::.:Z:5:::s:':s5:E:2f2sE:Isi15f':Isf1IsI:2s3:E.':.-.i::--115512:Z'fI2'52?:I'izI'. ,CII wav? A 55--5' KWMWX as:-:-.fgs.::a:z:f.'s:'-.-.-'.-z-1:5-1.2---- -. ,.V'--11-3:1:z11,zg'513:gz:sg5:if:.gsgg1.g-:s,:..,-12:231.:-.:'-:--.--.:.f--.:--:e::::- . My A A - N -322.223i::5S::iE:5'1f::--,---2-iii-':.,.-'f-3.1 .:.:-2-. 2-52-:gif11252-55,3-:Q-fr'--3.-5--Z,gf-1-'gf.Q--5.-EQ-1-E ,',.-.2Z's:'f:f2i: VJ L-R9E gl1-'L55 39 Sv db' 45:32 3f?'53?Zi-il -1:-::----: . -Q---'-Ef-'-1-i--'-' .-.2-.-as-2:-z:2-113-f:z:24:..a21-::.:1--f-:--.-1: :,:--gg::,:--51.-,3-fs, A , 0 X 4- M v Q 5 0 ww ge, 5.323531:g-gs-...jg--:,-1.-:-,ff' j..-Q.:-5:-1.:gg'f- ' 31..:-gsff,:g23E:,g'j:5zE5i::-::2i'-:.i'-'f W -. --'2-:-1 -2-1i: Z1':'s - bra N xw M, '-if-55:55-551.3-I525.,::,:-g..:-.g'-.,-3I:--I,-5-,E --Ig.,g.5--55:5-g1:g:,1g:5--.-In-.I5-II.-I..'3..I'-'3.-I.::I: 5331-EI,-: 623 C I Q5.z3Y g V I, I, g::5:-:-.-13-5--5-'::.-'.-.5:5 .,s'g'E,:g-- , -. '.--:Q,E-121253-521-E5:2--.-2:2-.:'..':1:2:'-I55:22'..-sE3::...?E:2,.i:5 W 'Q ,S ' 'L-:- :1-:-..':.gI.' 1 'S I.:-1'-'E-'E'iz:E2?'5z:i2Ei. 2 Q -c 'W 1 QQ W X: 5 5,2 Q fgf-Y' 5, W, ' 'Q 'gs -51.215313j:,:1-54-g:j:g-2:-2-r-'--,.-,-:2,-:- ' u.-.'.-:':1::::::::.:Q'::k ::Ij:':E:Ef'1'.-fi- ' . 'f'f:1'1.-r1.11' 'H -v , W jf Y .,. V '- :-:-:X1-:-:-:.-:--Q:-:.::-1-:----:-..:-':.-:::1. -..::-1-. .:- f.. :..1:.:-.::-:.:::::....I:--.f..,.:-.,...,.:- .,-,:,--,,.- J ,P X M v A s..f Se'-225 3 2 N-ff Wow: fi A X WX -M.':-2:-:kxfw-2221':Fa-151:55-2:2-':s:1-. z:-:2.se.s.s:z:as.-:a:-me-5:2-f2,22f-'-,-2--s2:f222:21 .1-221-2222215 f f W A V+ A ' A .5-11,3-ff:-3: 1a32:1X-'Ffa-iz.::s-s -f T f W 'lf 2 'vw 3 Sf Q 4 , -'hwqg '35 '-'W ' .2-si .W in W Sl 'W XX Q -:-1-:efszz-s:-1:5-.X----,:--:.,:-s::.:-.:1 - J..::.2..4111:.a.:-Qz:.:.z:.:-:':sf:-:-s: -Q .:.:: 'ff ' - A X N V A , Q . 'jf5fss:e,ei:Q,sfas-:-1'.-'-'11-.:.-s-z-:..-sf-E.--1-5-.-2 --:,-g,:,a--:qz:s:4z::::zz:-gg:-egg--5 :.,- A -s.:--a ,. 22- li w 'Q M5233 wb- W f ,.-cg,g.X-.-:..-.:.-.: - :,:.:1. ...: - Phan Q f ,NX A Q X -5:ag'-js:z5Q2ai2.feis:g:E.:.-.'-5.,.-f5,:3g-3zg:53ffzg:32f:-egg j----'EQ-'XI :ug--ga: 511, aw A X -VX VS II Qin J - 2323. --fy: - X W - b Eff . . ,Ti 318 5' : M 'IFES x ff' bi W .,,.. ,. ....... . .M . ....... . . . . S4 -1:4,a:::42:X:-1-:z-:-2:-1--1-22::f:-s- -.-:r:::::r:':1::2:'.r::.r.-:'-:-----.-:1-:,-- .,:-:-:::,:,:,:::9-:,:5p:,:,:,q,-s:-y-4.-:-:--:-.:-: -. + ' 0' 0 19- ai QIIIMII-:5g321g5g:321:2,:1::-:g,:-:,j:I ,2:13:5:2:5153.5:2:5.gjg:j.:.j:-j.'.j--5.1-I-':5-'f -:ag-j:2:1:5:g.33355:25:3:g:21ZEz5-155513-'52-:'--I'I1Ef11.'.E'1:'E1I'f'-2:25 22 I .-I-:-:'.r:--. 2-: .. V .1 0 gig' V '54 'L Sy V:M-9X::M::g:2.::-:,----::g,:g,:g:g -::::,:5-5:-5:::::.-:-:.....:::-:.:::..2.fr-1: 11:,:-uf:-:Q:-1-.,::-:aaa.-:::X:-:::::s:::1:-'.:.s'::s:f.s::z:s:zs:s. as z 11f:2:-.: - A . 2 as 5 2-'f:: :'-: E-'-. E2-'-3 f 'Xi , sf f 5:5XW?w 5:iz55ffiifgifif'--F255-SEI-2521 2 -' .1121-.212 X M' A -Y 5 WML 1 1932--3-Saas:'i?1a.2z.2:2225-i:':s2i:.::-2-si5-s25Ss2:22z:2s'5s:-z:--- .-1:'2:15-,1-5:2c:-:zaas12-as2:'-z+::f-.:-:s:--2-:z.1.1.1.1f:..:f::s:z.1-21:-af- ,:: s .:-2'32.'f' f' :fi 2 V 1.--i,-:Z5.si:: ' - Li. :--'-,ff - -A K- ---- X- - ---, ..,. ...... ,.. ., . . . . . . . '-'f:.i-3-'I':: Ear!-22:5-22-Z2-YSL' '-'--5---1 -2-3- Z .-:Z'1f2:22 '- W'--M - M. .. '-:-1:21:ZiZfI:I'2?'s:f.-fs-'-'-f--1'55-3 .:'.:':.:fiql-.-3-525---5.2: . -- '4 - - 3 .- ...... .. . iq-'.-E-22:2-I1-525:-I25E-I5I':z:'f.-.-:-::----.5:.I----''S-:sE:Z:'.:s:1E:'2 .221 :Z -'-- 1 ---:.-.'Z-Z1.I.-.- IQsi:zSz::sis:1:3S2ffi-1-2-:z2-sI-252'-21-': :..i'-'-1.--f':2:sE2's2-:S-if A ' 'M ww 55552115E1E?5::15ZI.51i-:'C'.-Zi-' -' fi'E' 'Y2-1':Z.5-1155:312:55355755E'55E2E:2i:5?E':5f1f' 22:--:T-5-Y -E5-3'3'3:'5'5f!5' .5-1f:an-z:s11:2:f:9..fz:'-'fs-521311. mx.:-.a:51:':: :-f-':-- ::'-.-: .'.-If21:zIsl1:12121:2-1s1'1s'sfz-5:52a-1'-,-.-----1...-::1.:.s-:-.--g:z.z-z- . 5-5:5,52551,4295:-241:zgglgg.-1:.:s.ff,2yg-gs1'g-ff,,:--r:.- 5, - 2-If e-5e:- :sw-:'s:-::.:.:. 1:-. .- --.-.-21:-i'l-I ze A-111:-:-ag:-5.5: :-:::,f:::g.:-3.:.g-1:g:g:g--g- if 'f::.:gzg-2gsg.::,z,.gsg:g::g:g,-sg-2,:g-235 :.. '- g'1-.:g --51-,- 'ff-5.5.55-.?:'3E:E'Eli5fE'5IQ-E'-'1.-I-'y.I '. - 2 15 : ' - 2.-1513 -I:3-5512.521:2'sZ1.-If:--Z.'.5:-. -- -- 'Q-3 - -. F ' -315253EEEQQEEEEQEEZF-3-355'31fE--'.'i1' '21-5 F -- ifkefiff-.2-1-2-1-.. 'i -.ii--'.2g.,.f..-fifzi:-12 P ':r'f::1.-. . ' f 251:1f-IE-23:35-Q55-?f5E5'5:iEC.3E5ffE5-f I 2 '52i2fr.'3-'-5?':.:5'.35:2:1:T5-Q55f5E3E5i??Er-. '2 5'f-1:51 . Q:22:'-f5i2f.s2e.I-1f:i'2a::E'Z2z:i:'f 'f I-.:. -...LTW im -. ::-:---:-:-,,,-.:-- .I:--v-5-,,-5II,.-I-,-,., I -.fI:,:-:::g,: :-:,:::::::- .: - wr vw .1::::--:a::r:.-..------. :.f.g,g..:.-1:g.g:,gg-,gg-. - 2:-::::.-:--,.-:gy-.,:z.::'::... -:-.-':1:.,:-:-f.:.::: f-f-'-2- ev 9 ev e. ...:l.gI,-::.s,.z:1gII.,,I...., ,.:.s.3...si,:1.z::::sz..:52 P '-.z,,:g:Qggzggggsgqa-3--:5.:-- --..:-15, We 4 IIA I -:-: .. .:- : 1-1--3:-?-:g.-5,3 ,w:::- ...4-e:.f- ff. :--2 - , .51-1--2--az.:-2-1 1 1- .X f ' V 2 . 1 2 U ..:.,-,.,-,-..,.. -, ..:-,...::f..g.. ,, 2,:,y:::g...g:..:----.:.g1g:g:qsg 5-5-1.Q-,z1.g--.3:s::.-s-a i-25:2-s2.:f.1:s:iz:1:.s:a A 1 lf- as-,J M .2-1-. 1-z-115.5 z A .:.-. -3- -2,3i,-:251sas-:.Q:ff-I::zz:5:-:ze:z,:a-e,:z-- .22-:.21:siazE225:..-f.,-::.-:,:S51215-f122.:':22-22'i1212-2. jfs- 21:-fn :ww A A 'E' Z 1'2 '232'A 2' : ':' fE'T-22 ng, 2X'Q5?,-E35 ,AXN A i'lf312:3.'.-I-':Z'.' 7'-2-:fi-3f:15F?' E2E23E5EE5Qf'E-25-E55'-E35E13133.3Q2Ef5:::2E'rf5351E'5ECEEIESEEEZEIEEEIEEIEETI 2Zf ITT:'..1'.f-5:':'.-:'--:1.-: .X gy our 233.-i.2'ff I 3I2'.Q 11:':5'2g-:!2:'-. S1:g3':2:,:Q:f:52Qf:2523:5-3-I-:'1.3.:.'.ccI:PI.fSQ15.2:?3:iE:i'1i:5:'f'-311.52 ' 'VV , -. .z-.H-:-:.,., ,I:,:,:1.A::2:::-:-:,:::::-:-.4-.I::g,,.--1, ,-g,2:,y-1:,.gz-:-y::'-.1..::,':2:3-.,:-1--.::-5-:,.:1-:::,.:I:,:I.I:I:,-1- - .-.'.':.:'-'-'--pry:-:-:-5-:r:'322:1::':2:2z':1:x:2:223-:rm---:L2:-. -f:y::6r:2:v?::2.2-:'1'f.1:f6r:F-1131.QQ?sy-8-L'-'S-2'--Fr'2-JrI --1 2 '. 2' .qqgp --1 Z5 i:11 I.2. zu. 1.21:-5-s 1-:ei-.s-2:-5.z.a:5.af:::z:1f':5:i1-- E: zz, - -I sf.:-1 ----15- I-1. A a.Am 1 X -,:---::':---.-.-1 Q-:U---.:::.I-.:.:..::4.-s'-:-:I-2:1-' 'af -X14-5,s'.--Fw.-:F-.,f:r-13-.-f-2-.-:I-2-2.-Q'-.-2:-1r:f:::-'.1-.-'.- ' -M A mf-f.' .2 new ff? 5 ' ' 3- . ' ' Ywmfis, 'Q U42 Q A ,, .,.,-.:.,,-4.-.,,.,,..: ' v A 'vm --rz-25:52:s:s.::.:-2-5-:24:a:.::z-ss:-men-:fa22:22:11:-wi--1--'Fifi -:S--2::-::s-. . f , ,,g,,g . A ,. ,. ff-55?--:Q bfww -1 is - .fa ' ' -.21-iz' Saw' S -' W 1- 4-M. '- .:Ef'f:-:52-f-ff5f'?'-537' oh ,Q '7'?1 i'JM?nE Z dank 505' W .ia ffev 'f2'-::-:-.::?',f-'.2:1-:ff:.- fZ-.-:2--1:fa2.Qa:g:',.:5Q:'f, -1:2-Z'-:Q-1-f-:--2.:---.4-a.:::.::.e:':zz-sf:. f- - - ' W A - . ..2:5:ss:ei-fix-.:-1:-:9':I. :.Z.'':-gff9'Q?-'E:':-E95f-E-.-5--21 59?-,'w--1 Y Q ' 2625 '52 gg. we 63' iss-' ' ' 'Y' 1? Ng, ' '52 . X '2f f i:.:---: - '-.--.1 4, ' V ' + J Sw ,. . III, . -- - W: ., . 1. . J-SI - f. , ,gg::::g:::w:,,.. 1+1,:.,fg:-,,.-mas:-124..P- -.-:-: .. w- : agar-ff fu- J' www - W'-1 Ti ww we gw' wa. WV 'WWSX Q' T' OW Q7 ':'I-f'1:--.-.2...- - - 'Z'i-if-152-if,- vff? v wgmgwr W hm in 0 ' :fm-:-.--'--:ar-.e:1-:Q--:f-1.::Ss:1:-s:a2...z-s:::-ff-'- vz:-zz:121.:2:'-s-?z:s:a2.5F:.z-if.. '2.1E14::-: 1:Z-I-I'-5213:fefzi-'zZf.:E'2,1.: .-224-5--.1 'W - 1-Qc'-2 , ' 'f:E1I -.:-2-'fgpywwwmv -'-- N -f,--,3:,-gf, yi-,:-1,--,:-ef-:'::-s:'.r:f'H2 22:::--::r:' ---'Q-:2-14.r:-2-:r.a-:2:2:2-:'-2:.--.. '-'-1:2-.-:,2:2.--sf ':::1-2a.v:S-2:'-1E'- 1-1-2' -:1r'X 'w-s-W, 'f,-:f-::i:::,3- .,w:-2:41.--1-:,-1.31-' ' :2':'1:2::'- -1:X41:1:-:-:-:.z2:r'2f4:2.ff::...,...:,.,.,-212.--s.1:Ef :.'.f:2:f.z22.1:2S:'- X 1-I'.f'2.'::'- ':f:'f-:-. ,'.': ,. Q' X, 121631-s:2::-:2z:za:Q .,:.:I112sf' ''1:-1-r2sZsiZia21'-i2:S-'.'''Z'Q2z::2:f:'1-'-.::s9z:.:5: ,az:s::s:::s:sf:s:s::. - 'NWN X WNY f-9:22:2z2-.-'-1-44.::-'::::E'-'.Ej- 5212521122-'E2' -:EZ-2, :1:1:2f:1:2:2:--Izrzm.. ',-: :2q--:I-3-2:1-2. 1:-s:2:1:2,r.2-1-2:2:1z --:S-.11-.-.-IIrI1Z2Ei'?1Li -21-1232 cv!-. sg::z:.gzs1zgsg:1 - - --5:-2-gz:asg:5sg:a:s :lsr-5:-:-:-:s.:s:'.:::.'.- ' A ' '-5322-22 5f:s::-::..Z --.-13:55 '5':I:::I53E2EE2E2iEf 531225-125 11 A ..a:.:-z221---s:::1:sg:-ss--rw-3:-:f:.. ':1--:.::-s:-e:5:2:a.:'- -1-12-1.-f11:.f -- 2:-1----122113-1: :--:-.'.s:?::s.::' : I3-:35::,5g:::.:,. M.: .-3--I--1.-.. A , -, me-1: . ,ff-wi.-,. 1-:-':::g:::::fa:-'.--45:24. :f sf.g.e: --:iz-3::-Q .1----':a::.2'-:-fr:.:--5. K A 331211342122 f-22-:-':-34-'.--3 :-:'-.-.-.Q-:.yQ.x2.': 1:??:-?:E251251555-S1522irE1E2E'E2:--1 -r'- 2 -iz -.ima-..'!':1-If -'I-:f2'.F'f'Z?51' - '111'1' . -::z:f:'ff'f-2:-'20 ,-22:21,-:f:r1::-.1.a:::-:s:':-:-.:::---::-:-:rw-. .ix--:.:.--.:.j:5.-3 - J fssfs.-fhzm 1 -I :apiM5954-:-1:!fQ45:1145:.f,,2-'-:2f::g::::,:2-rs:-:r-2 3r-a:::f:- - -' :2- 2: - :2-1 +1-.:.-. 2:21 'f-2 - J X 1:5 new--1-sc-zaaz,-:ws-2 C--fy 5.-2: :s 2.-2:5 ,.:: 1. ffz- f V -fc-' -2-few---a--fa.:..::- 1:21-,:2zg-sw -15:41-f.f1:-:Q-2-1:5-faf-1-:'f.a:s-wmszzz--''-ar --'-:---:r-A11-5:5-:isa-1:az-11 ..,-gg5.,,,,,-1-.-.-4. Q-...M , -f gn:255-,--5:-:v.:-:--.-':,:g,m:,ya:- . -- -:: . . .. 0 V X T ,D Vr -a age- SF, You j'e 1 'CW Q if N E 5 Sin-fifi JZ if fiL'f'?5q-fr Q -f jaigiliiggiwgiigk' 51?E.33iS5'fQ, J i?,,,5gQa'ig 5,.Z,i-'giili i . vf .A W L-g Q 6 EWQEE-f'f'-fb-1- 53f-E1 fggifkm L. ggi A515 ati-ii' kv? F' E33 YQ -QW' I-.1,w.s NJA l ln? llmiigggib.. .ig-iavpggt A A' ' 2 ' ' t p .W :J -L.- QQ., .4 . .-F1 - H tail' is I-ge, '.L L,-.-E-353, Ljfikifi ?Y'5q,':i?i-ffl? - lg-E . 'L 'iLi::oPl1,Z xg , . . .- ..-- .- ..A- , : -- 1: -' if f- - 2 :,L'3'-' e '..,Z-Li 32 .- ' ' f72 ..- 1- '? HM, -5' i' - ,,-:ui-Tw. 'PQ-,' lf n---Jf -'U'-,,L, .. .' -- .Wx Emi f' -' f f Q 3'i' Q -Q - -M -2. - .Q kgB'Ll1,g.3'-'I ws ,A '-A :iss ' 'lil 4. figff 43-bl 'Ziff gg xiygvhfiiry D .I v J 5 lh??n,a-2 W' f' 'fzw -'-'-M4 --Q-'+'bQw Fitxfdf f wg M ,X ,gusfgx m ,ggi QW 33,45 -1-4-5, gm 'E MQ? sw J 1 P gif ' 1 . --'5iFQ5Sf?fE'2'5.. 2-if -' ?i'G1?'H22'WT'3?-'-ff'f?Q -fN3.f?:--gig. lf ,-as P-few P 'vin a -I - 'v 'J-1 xe 'ilrm - 5 1 '- 'fy ' '- ' ,. 9-'. 'gf u -' :uv - 'f 2-f ini .Lv 'wg .-'Av ' -- Q 3: C- if Sif ' -'l4l.g7 ., fgjfafkf M955-wc- - -. .4 Q. MQW.,-. ,1ff.::v. S1 -'HF ilk- ' ' 31 4- .'f, ! 3 if G Sn Af twig? 2f 3'?sj51 -f 'Wai f -ffjfi-.3 . f-f'5?-Wy e..:w2-fins? -g'z H-. .ff . 'ff -, .?5ffN ?i ?:wi 3i'f,Eg1-9'vgnsi52 ,giggle '51 zjnwdggjagay Y-'ui'-f Ish 'ffgaf Q: fqgbpvgltggk ?g?:i im Qigzffg aw 1 ' Q L 'sg J- -' ,, 'f , - ing -w 5-1 if.- ' 45. ,rim - H. , M ,gf J. ,' -'-- 4 2 m . t. i . ,-.1 P55 g,,L,-',,'gV,, --,' in E. , aj ,g R..-fy 3 -Y .-3,5 L'.,,,: 'ff Q- ,. .- ,- :-I ' 'Tyw 7 ,L -, I '. H, '-2 JJ --MQ . . wgfa ' -Q1 .G BQ' ' if' , f, -Z If ' 15' I. ' S51 v- L- All NL:7 :' EQ' -f-'.jf'1s-V. '-'if 1' I -iff. A' '- F L' .X - ' .Eli if-,1'.'-r5Sf,L Q' gL?3k-' 4 A ff, . -jf. .. ,L 5 .5 . Q., 2'-:. 17' ' r ' 5 ' V: H' A em.-1 '-: n-L 'A . V. -6 14.5 3. -.1 g-QQ'-l -5 -1- .','fy - vw '. N ,552 'T 5: :nc '- Af- 5,5 if-1' .ijt-v -3, -4-155 - 5-1' E .-'j F2 .jf ..,- 'gf ,sf ,fg eif F7 4: 5.-f'-,- -'fx 11.9, 56 + ,-3 F5 gf we-f X--.. W -f A-iff E.'?-M J 4 H1255 -f -Q-3 M ai' ' r . 1' 'JL' ' -'- ' - -'- ' -3 - '..- f ' .AJ . F. r-. '- .. ' '. 'Q S :NFA ' K -r' '-51, --'J' '1 , 1 -xy ' . 4' I -3-1 5 - 8 ' is . -?-' ' -' S' - . , ' 1- ., 3 - 1.-- -. v--ff .g - .- - qfnz 4 .- -' 7 --H-' -j,f'+9:?. 5 .,-,he -,.. qv. , . :- c - w 1,5--1--.4 .4 , .Aff ., 577543235 Q fi 5255331--Sa .4454 1 - -ggi' -iziififiikwyf'-?-fwf.-94 if-,,,-' -. 14 147- f'a.?2i5 fi- - 1 ' ' l' . e, V: Q' .. ,. 5' 5 L 1 v P 4 -5 , 'fj ,?g3f,v Jflwfi-11' ' vigil. 14 Q 3224? MFA-aw 9952? f?fff'1-i39f1Sjff3'3'EFf'fe-eff., sf3ijggf S5959 4 -PX R1 fi P-dug . A Angra' u y, ,wr 1 4.221 1?2'4'5 f Wqvfi args? fic i an- 4, - -'- NR-.-.V . ' 'L2?' ' 1 f .. ' ' ?:P.f' . ' Qi. .iii :rw . .. 5 '. -'+ I -- ' .V f ' - f ' ' -- 4- '-,- P - . f z'-rg -, -1-5 -Un., .ab -'. r,gl?55X1e31Q4.2fQf5i?'?, L gg gg ' f gif-1.3 ff 12' if . Q I i'f 2 -. Hi 9 gm. if iiiggtwafzffgi nf-ii? fm!-53? ff-W if-' mf -Mig w 3515339353-E f-4f'1f22:f ff ,fl 52 We 'iififkiii' 1 .53-'l .iw - - .- - -- . . 1 -. .ff . f 1 -: -5- il -Q14 -- ,Q .1- Q- 3 vf- - 1.415 l if-51 14 ,Q Q E,-' - 3. .2 Tj-f- - V .-,A Y- S0 'E1e.f '- J-' Mgr. :-3.41.55 ' W- ' ., -.1 ' iq.. .gli . L -'Z - '- gf - '74 -' yr. ' Q' ' .. ' ' v --if ' '1'::xf5W7'.f?? ' ' ' f 'iii S-5 Q -' 'X' I. i: '- - A 5' lb-Hi' 'X E: -' 'Y' , wg' A' T A' ' g erm . 5-.-Eff, 'tif Elgar- QI .. 3 G35 'gpg Y ,J . 1.530 ,9'24!Q Q ,5'n:-- .IJ :,:'L,'- A 5 1' ,,- Luigi! . . g :. W - -' ' ' r .-C nh' 5 -'. .-.:f' .. , W- ugr-5, 2- 1 5. . - ,'-. Q :gat -w-RQ-558 , P-- v. .-e . - - - . K- gl. cf' HN: , ...- -Y a. 1.-Q , -vp -iw, V . ..Q- . ,V ..4.r ,A - -v gg!-if if W 5-wig-M2511 -hw VW 3.-T1-ww ' rr ,. . ff-452 v I v,,'? '. 3' . ..f9.'5., .l'. f-L '?13Sf5'f.,,J. . ,? .'! ' . . 5-6' Q. . x l Egffy? 'v ig wfkkgg Rc gwgxhifyg T, qgffjfeii f ug' M3485 4363 pg '?fa5'gvf'-5 P'aQx-if it 41535, 4 .ff --if ' 'f' ' f 3 .. 'ff . - Ye-:-'-9'k' f- Q' 2. i??4,l'J-1' -' '--.W-ff Q 5 - -5-'42-',7.3? PT..-P' 7 Vi -QW - 'ff M' - - .-. - .-411 .2455 Wi! Tri? 35533 REA? 3254-Q fa? I.. fggjwil o V ,nu Q I ' ' L1, HEX. 1, lv 'vcagw ' 4 ' ng ' ' ,gs-4 SJ . Q ' -' - 'vffff fi - pfi-33? 'i,'ji'rilxd' b?iJ, r?g31'.,1,EQi13fk:s--5. 245',a?isff'3i555?qi5Ei3fWF? 5134222 ..- ihiil- . . I W -- ggi.-.43 - A l - A -25-2 wg- -sa. - -.ff M. - -was-iii?-.W C? ' 'ig 3h.,?1--f-- i'eWf ' ' - -- - .. 1, '-fi? if S . A vii'-' ' Q .gn-' .L f '-'Q ., . :ray , f ng ' -.lf :lf f-,552-,v'j3:-w'Q ?-Rf-i-'ig l -'U if if-2f.',esq .- ' '2i5'w+'L1' 'aiiw 2' 55312-':e.f'5f'f.Qf:?: 'aft A 1' -Q3w?4f?f'?ff? 5525-P' .' 3-3315315-4,12 S! 12 A :paxil E 4351? . Z, A Eid A, , - 1 . -- , , f , 5, . - ' . w- ,. H gg. 'Sy Ti ' . -. . '- ., up -,ff . -...' A - , gg r-: 1. gh gs? A - V137 - - 'l' . 6-1 ' au' 'fs' 7195 V .ff kv? iz- ' -.' -' H-f QFD ' V'-7 - ' sniff' C - iw. if Jsgilgvu. il:-I-C 'Q is-:Q 'is :El-fg'-3-:Ti4fCa?g' I ' ' 115, ffl: -I 5f:E1 g3'1:w', 4 a'-,,.'.' ,--' -E-Q'E H152-Rg L.s i- : -g:q36'.'Q' ' . ,. ' is My an -f fp- Q. - ',f he f.. if-.5 .- if jing Yf- .21-L 1-T91 ff .'- 1' 1. 1 as . . : ill' -1- v.- - is fl , 1:11 :lv x :V 1 1 'if ' if 4 . .f .- .. 4 7, 3213, 5,':5QKf Q.: :' .45 f.-n ' :':SgLff'z 1 .--V . -if-le 'gf I' 3? gg: Lf ' -ffl ml 5' 1 9 4 cv' fl at 5 r'rvr3'0QLfsvj-Negilni. tif.. 19.2 pf law Q95 gg?-Y QA: t '-'QL'-9 .gk .rl3,!3?,2i n-gf vig-,ag Qdtufxqgn A .A C3-f-bg Qi? , . Rqglfu, ,547 1 .,., , 3.5511 I ' f ' u. iw L.. ,L Inf Li 4' W l., Iii? 5 r-w -- - . 5 .- ':'fP'ff1?13.fffg,3 J, gag?-i.4fE1f+.':2,. ,-.g'xf...10i?'.y'fggf:sfff f-ff'?iifvQgR'5 -25.3-k'4 '--Max W -az., - .3 -- ' i ' - '- . ..3,ffL We A' ' '1,'1 -.i' 'C .Q ' '..-'. S' . - ' . ' . ' 'I' 1: 'I 1 ' .' vc 1 '95, 5 ' 4. 4 'I ' -f I -l 21- I,-'5 'Y' 'i'-- L '.-' Q' 2 ' - . ff s. -1 3 -12 , -3'-' 7 'I' ' '. -fi QI. ff- 'alas-G-1.92 -'-1-'Y'Q '?15-'- V 'QQ11f::g'g1 'l7:'.2l-, 'JH' YW--if? v .521 g Sri' ' ' A J mi-'Lf-lrjf ' .-9, F' gf 1313 ,, -, ' 55:25-513.5 ' ., an Q' 5155. .C'L'-Mfg ,-255g . ,f ff' ggi' f f? 52490: ,,'.if,f,g,-ig - - - . . V . . 1 v.. , . .Q - U is Q . ,J E 5 if A jpg P 1 JFF .' ??Tf?c ,! .Q-.15ii 'f' ,.'f,!--5.'9gE ' - 9. .- . Ft.: -42. W.. f3'fa'ge'iE2'1 f-iff- lik-:fi gym Tm' Qfilvig.-2af,f gigkbg iggilvgtggiidv gh it MY' nail? W 1 1 ' 1 kv 5' ' 'VF iii! -FL Y fx' ' -.--f - f- , :'- ,JWV T T f- li - Q' f: -1 - - :Q f -. .2 . 1- ' ' ' 2- . ff' 1-Q sv: ...if - -4 'af arf,-5-Q:-. A- vi.- f -:h ' Q: , V Q.. cis N T Y' 'QgQ T'! .Yagffel ,',:f5,' f'f,,4,f,.: 1.515 2 LLEQB, at 1. L 6 7311. 5 ,lr :pf ici' L k'?l?1Q'f2,- gh 1-, - -A- 'Ye' kr? Mcgbefg- ,ggvfg ifbbu- A-t .HL ' ' -FEL-. ElM Tp..,', 3:5 -.Af rag- :I -L .- 'skis 51.5535 -gg'-cgi? --5--or M1 -F ' 7 JNL, ar. 1 U-Fi' cf NY -1-1' 1Pw 2' is li' F 'Pu' .ef W M , S',L'cp IJ 3 A it .3 . l M A L ,,, -ggi -3, -g '5w' f gif fp 'diva' '33 -1 -ff 5715, ff. Vxbgiflpgf. Q if wlfv'f Q55G Ur 'll 1 . ' 1 ' ' . 41 . L ' ,.. 4 ' . 'W 3 lu 4 . ,Q---. 4?-L -, ' .T 3:-QW, 1, JZ' Q. :lf F' 2 Q 'pin'-,1'Q. . .L-N, '. '- 3,e+ 1j .:. ... - - 1 bf 1 by 2+-. 'B' ., -. , :.g - y,.-- in 5. . aa- QE? 'ff1-Q?-'- 5 'i --Q MG- - qf -: .. v. 'i, , ,5. ' up-, -m y . guess .f.- - - Q 1 ,.-Qzfjfgf? 51 1 Qi-2 3' 5'f115..,A'.g Y'-5.333 P' -Q, 4---, 9121: .1 if if-..' A. f- gi f- I lkwgq, :..'-xgiw. -cf y '.-'Wim ' 'gi -' -9- Gr. 5i?'f', '-ITEM ----ff 5 'fg -iq ff 'Me1i?-- -5f f?'f wwf- fi ve- if Mrk. ic.. .1-wig' fgx .fw-Jfffi.. -f-.M..4-A -.1 5 3 33:2 1 '-'Qi-3? 2 .W- ' . .-Q5 6-9319 5 'FRE' -956 '- 5.f ?'fNf-1Qs:5E.' ' P73 ff- - 51 '71 -'iiffisi WE'i Qf2gF3f5 -.ifggf-fgigiiffiflm-aA?2,51?..f ggi: A W f - 4.-. fr W N ' 5- ' V:-. 'r ' - 12- 9 'Gi EQ- ' . 1 '4f ' vggifu 9 i U5 -A gi- Q- Q- 'R ft!--7L?ff? 1i QQ .B R Q' n-.Lg if 9 'H' n 'Sf Mgt? wars: my 424' '9 if ,Kg 4, LTSTK, img?-'v W .S-11 Q' 1.2 :l..4W Z ' . ' 2 3'-9 -5' J55f yJi f'k'?dga+' .5 ff, PAQ 'EL ':'L '- - -I -' 'lf-.1 -ff! L--' '-is P. f :,ir.3,.:,..?:-Fi , - D .t-1. .'5?v .TA h .-Ugg-2 5 -:V f,' 'f T,-. -.'. . Y.. 'QA -?.:,,,' l--?4::.:A-i if 41- -,U V. 4 In ,g 7: A-, Irv.-'g-. l J - ,grin Ai .E-v E' - ' . fg. . -'-f -. 7-.4 -. -. 1' ,, -Q.-. L- W Q' .. '-25:13 - af.: -.:- ' , . P-. ff- C' no 4 av. .H r ' wiv- ri 175 V 'G' I-I-, A 'ri' ' Lg .vi 3? Xl- ' Q .1 - '-'E 9' iii' If 'P 1- r .'h,5'g1 - 4-Q ' 4 - .- LN gf- nga- ,flap -gc. iiqpixsnf-flj?2'?xrf1'Q 5- 'F' if if-ef,g-gf? 'E Q., 1 I 53.4.6 L .4-fffglf f-gf-3 jT.5.1,., 2- 1-ffl. -at P' f 5' , b . ll : -.' --C 5, A: ': 4-bf.-' - , , v, M 51- 4' I C ,J, i-,sn Q- , - '-' i .1 fi' -'2'e 'int' 5 , gfli. 1 df? gp Qing 5 M, ,,: if f-Eminem.. 3? igifff-H,-: gg .iw -.tiff 33'-. 1 h im. --c', V ix,-. 35 ...L pleas' 71, ll 'T : lux. ' ' gl fi 1 E. 3-iff? - -,U Q- ft 5 Q4 'f'-'Iii' : AQ A 2, :E : .1 'iz Y lf T- E in , . U Q' A H' , f. 1. . if-1 3. 5 .. . .E , ,J-QI, .f .2 -, . . . . . .g. Q -1 vu . . ., -E ': f'--kv'-' EV? 'fl-4' 'ggi - iff..- 5? -?:2Sif'i.?'5 t -. - -F5 lfzvfl 3- 5 fafggs ij ,eufffgzfei -V -15511 ws-gf?-F332'?Ef'L3f3.i'2i-me-'-Lf'kf6?Pff+g g4?1'2 ,gig-an l-ll3g:: -- mfg -11'-3 Jiqpvvvl - 'je - ' ,' 1 -.,- 'f v V- K .. ! . iv fx , , . f' W. 55 . - 3 1' . , f-if -- Wk ex Jr' 9- DN Mu as 352551935 -F g 1 ,ir dl.-Xfffiwgt I .gfggxgqaik 5.1 Yr.,-3-Q.. A-Q F. , Qin. iq ,. -c. gg.-v ' 'Qu 8? -- 1: 2 4. :J . . ' ' ' F, v g' Jn, . 141.-. -. 1 . 2 -A glvff' 1 'R wg, . -. si' - 'A J - 2. 'Q' ' Sqft-.gz--fp' f . ?s .5-fiQ'5,Ef,Q3'f 'vii' if ,wif -if, Q Q 1' pi-Qfga 5:3 jg., '5 4, kgiw is Q-'Lf-4' 59 Us I ffl. 'is' '- . , 'Vi Fig '?1.F : ' 'va-.:, '. ' - ' 'I' .Qi 5 V: f -Jig' 1. 'iz' ' 'J 1 I r . V -- ' --' ggxhi '55 ' y L' -, - -M' , Q ' 2 ...,.' -6 . ri '. , ff .gf1..:w::- - .532 ' ,.H 4' .- . 14 'v -4 '- 'QLF1 1-6. '. Q . -- 5.7.-faivsiit: ?J.: 'Yn,lk,n,:..6g, 7-at 1 r, Fi,av'f1a,,af4'2E'-5,3 -,-vY!3 5v pn jpg, s 1 I, J.. 4 In L. ?:, A :Y 'f ,J - ow q Q -L ,Q v L ' - r ,J ,ii - .V -. :- . I ,icy :I -1 Q, ,. ,K , .V 'in , r.. 1 fu S ,E , , .1 my V'-S' ivy 0' -..4,.3..-,VA 9' gh 4' .- Q, 'ff 2 Q41.:.?fi??.r'f'aE..,g.i,.,'.. fp ,ski ... gg, , ., 4 Lf. ff. 95? , 5 ,giigfg fQff.g'i?Qg2f+.iE3'3Q'fr-i1N,..fg,,z.. , - .1 1. - ff' ',-'C ' - -a--u. 1- 'a . . . ' ...,-H -.. !-- 11+--7' no ' 'fl 555,31-TE?-2142 -Ji 4 ff 2-fQis+32fg5.k3--1' ' if :Li 211 fIg',,?1.g -f ' ,un , - -' ' I - 4, ' ' - 1 -.-. 4 v , . .J -V V- ,, Z. a .- L, Z.. 355.3 L GLA-s.2ff.. wsFr.. wa' Q..'.EE:Z aan-33.36. 21- .ffl - I l I 1 1 Q l l n I V 'qx f 53, in its ffzoox hoc ,swf QQ ,io 'YQ 1 0 if thx ll r 'Nl li 44 ,fi Qu l SQ NSI l VE -it 4f 'x M I , I y 1 i l , l lf i A L L . Zllibe Qppurtmnment Baath Faculviy Reprcswntntirves .............. PREs1msN'i' FELMLPIY, Pnomssous BUZZARD and ADAMS 1, Umfuerstty Heprresfantutifves ..... ............... R ALPH KOBER and J . DEsMoND LoGsDoN University High Represefrrtative. .. . . .................... PAUL SPAFFORD l Clzarirrznan of Boa-rd ....... .... ..... P R ESIDEN1' FELMLEY l Secretary of Board .... .... H OWARD VV. ADAMS l 5 1 It is the duty of the Board to apportion the receipts from the Student I Activities Fee to the various organizations and activities of the University l . , . . and the High School. During the current year the receipts amount to more it than S 00.00. Mone was an ortioned from this fund to the Vidette, the , . Y IP , Men's Athletic and the VVomen's Athletic Associations, the Lecture Board, L l . . . . . fi Social Conferences, Music, Home Coming, Literary, Society Contests, Ora- torical Board, Films, Spring Festival, Varsity Club, Index, VVomen's League and the High School Oratorical Board and Athletic Associations and the Library. his ii l if ig 6 83 frm, 59Q,,-,,A- ,L,e, JQQ 'St UQJESQQT IWJGX W is i 4: A pa 'less I The Qthlstir Baath nf Qliuntrul The Athletic Board of Control is an organization to promote all the athletic activities of I. S. N. U. The Board consists of live members from the Student Body, three Faculty members and the Coach. The duty of this hoard is to decide all cases of discipline, to appoint man- agers for all the major sports, to approve of the Athletic Schedules, and to award the official FACULTY MEMBERs Mr. C. E. Horton Mr. C. A. Harper Mr. NV. A. L. Beyer Mr. D. T. Karnes STUDENT REPRESENTATIVES H. Dean ................................ .... F reshman Claire McCreight .L. ..... . . . .... Sophomore Carl F. Firley .... .... S ophomore gg, Clyde Neathery .... ...... I unior fig Lawrence Harper . . . . . .Senior 5 A if I l i ig'-Xl 84 l X , fi T 'T Tarts so si. .25 A A Ari Xi fs is TL'-X N l 1779595 ily .555 T l lx, , V X i if 1- 'x tx ll l l ZX P l C72 ,fa I l l lerture Baath , There were seven members of the lecture board for the year 1925-26. They were Miss Erma Imboden, E. A. Turner, R. H. Linkins, Homer Hurst, Robert Bishop, Ernestine Huffington and Betty Smith. OFFICERS EHNESTINE I'IUFFING'1'ON ................. .... P 'residmt ROBERT BISHOP .......... ....... .... V ol ce-President HOMI-:R HURST ......... .... i S'FCO'Ild Vice-President BETTY CANNON SMITH ........................ Treasurer During the winter term five numbers of the lecture course were given. Sybil Comer, soprano and Clayton Quast, baritone were heard first. Florence Easton sang Nov. Io. Erma Blaine Mcliindry was here Dec. II and pre- sented Rachel Crothers Comedy A Little Journey. Ian. 18 Sigmund Speath was heard and Jan. 29 Lew Sarett from Northwestern University gave some of his own poems. During the Spring term we heard Richard Czerwonky, violinist and Watt VVeber, tenor, on Feb. 9. Bronson De Cow with his dream pictures, on March 3 and on March 23 Grace Wood jess, soprano, entertained with Folk songs A in costume. :gill Doctor Glen Frank, President of the University of Wiscoiisin, was to lecture here in April but unavoidably his lecture had to be supplemented with yt 3 another number. Each number of the lecture course was given only once. . l X g 85 lg 1 E as g Jig f , - a X if Ya- g g-.2 1 1 1 1 1 fm QQ-QT ij A rw 7 fimi i-iff? f VI rf saigsrakw-, .cv W 17523035 W T1e,1Q!1.,Ff fa' 1.1 1 aa 1 M 'v r 5 U' V1 1 'RA N , 1 1 15 Mfg, 'N1 1 1 1 1 1 11 1 1 1 1 1 1 1, 1 1 I , F1 1 1 1 1 .1 11 The 3Haturs Svtuhp Clllluh 11 PTFSlIIr Ilf . ..... .................... G LAIDYS S'r1EmvAL'r 1 IYTOI'-P1'C.9idC'?lf . BEss1E HIBARGER Sff'l'C'fll'l'jl . ..... NORMA T1-IADY 1 y Faculty Spornsf 1' ......... Miss PATTERSON 1 1 NIEMBERS 1 Ruth Bozarth Oreta Lee Julia Mae Schell i, Mildred Brennernan Lea Leroy Grace Sehertz 11 Hallie Cross Ferne Melrose Bertha Sprague i Velda Erdmann Frances Nelson Agnes Tappe 'T 5, Angela Fagan Gertrude Oeseh Louise Toek 1 5 Leslie Hewitt Eunice Olinger Grace Tucker 1 Gerald Hill Anna Plato Louise Waldron Mabel Keister Vera Sakemiller Mary VVebster The Nature Study Club which was organized thirteen years ago is con- ' stantly growing in interest and numbers. f1 Regular meetings of the club are held on Tuesday evenings of the fourth, 1 1 eighth, and eleventh weeks of the term. The programs this year have cen- . . H . ,, . . 1 tered about the very important topic of Conservation. Forests, native ani- mals, wild flowers and birds are the chief phases of the topic which have been p1 Q-ju , - . -'stf iw consider ed. Ni? MQ1 The club furnished Natures Orchestra in our annual Hobo Parade. 'Q I? lt also had charge of the annual Arbor Day program. Q 1 111 1 17 1 ws 'ffxl ' fx: 86 id 1 E 'JG 1 1 1 M D -of Q-Eglin Q S137 l I l i my ,-H fe , 1 FX! X Nl.- AJ- A- , Q 930 Q,.,,:f.i,ff Te gi1f4.l 1 li L 9 if aQQr A4 V ? 1 Q1 X lr www l fl 1 f 'if ,Q 'f 12, pb 'Y 3 ..-.. t . 71 -f AL s fel 14-5-J 1 1 sssw? , l 1 .. I 1 . rr r 1 . A, - I A 1 Iiauernnpmus Qllluh Program r 1 1. N. U. 11925-1926 ' r Noveinlwer 25 1. Rural Education Courses IZ. Rural Atmosphere January 6 Book Reports on Rural Play 1 February 3 1. Parent-Teacliers' Association il 2. Rural Survey March 3 Commonwealth Conference Report 1 April 7 1. McLean County Farm Advisor rr r 2. McLean County Home Advisor 1 May 5 Recreation 1 r May 15 Community Contests lr 1 COMMITTEES Rural Education Courses fAsst. lay Music Comnrj COIIHIIOII1 Wcaltlz. Coitfcrevzce Chairman-Edith Robinson Edith Nelson Chairman-E. E. WHCHSQI' 5 Alice Stewart Bernadine Schuck Oza Couch Denise Hugenbureer y . H2201 B1'11NJS31' Dorothy Hibarge? I gf'l,Ph'y , , I Nora Brennemann r ' lH11'1llHll?Lllll?lH Bahi M 1. 1 R- 1-,v Harry Adams N 9 lt' 1P L3 Mrs: Lena Lees Bertha Srrrrrgrrc I r Rural Atmosphere and Com- Adrian Book . . . r 1 '. W . , l. Music C0'lI1Nl7,ff66 1 1 'munity Contests Mane Getz Ch' irman-Bertha Rho l3I'I'Il91' l 4 Chairman-Elizabeth Scott Ernestine Huffington rjaiwrvrrrrrr germ K ' 1 1 R053 Stiynpgft DQD1l21lC'l BUllVC1' 5' r -, V. lrj ,. , ,- ' Dorothy Mchllunev ! 1r Norma Hussey X Hgll -Petty Ral all Carter M A l For-ue Melrose Vifglllla Craig r I A. J , , 1 Homer. Hurst A Q PU'l6?l,lf-TFGCIICIS Assocwarfifon r Rlflfll Slfllffy Chairman-Hannah Guenther I I Rrfcrccztwn Chairman-Thomas Brew Opal Parks 1 Chairman-Cornelia Smith Dorothy Tolley Mary Helm l XM Edith Armstrong Wade Leona Sutman Ruth Bozarth 1X X. :ggi James Bentfeld Wade Eberly Ruby Schwarzwalder fi w 1 l MQ .f OFFICI-.Rs ld N 'W Bnssm HIBARGER .... President EDITH ARMSTRONG. . . Trreasiwer r F fl NORMA HUssEY ..... Secretary LILLIAN BAHR ...... Program Committeemafn Q CORNELIA SMITH ..... Vice P'I'f'S'id67l1t L. W. HACKER ....... Faculty Sponsor P1 :Q MOTTO- EvH'y Member a ll'07'k6r ' 1 Q7 1 Q L Am 6611 l --L ve-+A.-A -5 AQ fr Aj? DQK 11: if Q se 13? -A is -, QE: .ge..eXNt, wi mr Q!- 2pf SKY - D g5,l3lwa,. 177296395 ,mcisify , T Q W 1 I I i if li A l i CN Q9 ' 4 l 1 J are C l l l K 1 Yiutnell Mason Qiluh i The Lowell Mason Club is composed of the students in the music course. The club is named in honor of the Father of Public School Music, Dr. Lowell Mason. The meetings consist of musical numbers, discussion of cur- rent musical events, and many good times. ie new mem Jers enro e a a ar v Given a r. es o 's iome. Tl I lldtptrg tMWthffl A thorough initiation was held at the home of Miss Rachel Brandicon. The Homecoming of 1926 was a never-to-be-forgotten day. Even though p the judges didn't decide on It Pays to Advertise for first place Lowell T Mason Club was there for a close second. Luncheon was served in Room 33 in honor of our homecomers. A Lowell Mason Club had a Christmas party in the Y. W. C. A. rooms in Normal. There were gifts for all. We feel that we have been successful due to the splendid help and sup- port of our director, Mr. Westhoff and the helpful suggestions and advice of our teachers Miss Nieswanger and Miss Carter. MEMBERS , Rachel Brandieon, President Halliday, Bertha Snyder, Francis Athey, Leona, Secretary Hatfield, Katherine Tegtneier, Otillia Bell, Helen C. Hedges, Mary XVampler, Leonora Bell, Hazel Halvey, Evelyn Wa1'd, Dorothy sg-, Carter, Miss MeJunkin, Lorine VVesthoff, Mr. W Day, Ruth Mantle, Frances Steward, Bessie Dunlap, Verbina Michalov, Helen Du Montello, Gladys if l Fick, Dorothy Nieswanger, Miss Thorpe, Jeanne xl y Roth, Irene 4 88 ll sd e im fr' 175235 PC fer 3 Q22 4 X ICM, -, k IW f A :riff . Q:fjILg,f7 - Q ' A ' y, P pigs, ::-js-ia W, 5 f f is My fa iiaume Qlicnnumirs Qllluh President . ........................, HA1'TIE LUNDGREN ZHO feta Vice-Prc'sidf'1zf . ..... .... B ESSIE BONNER Secretary-T1'0asurcr . ...... . . .EUNICE OLINGER Faculty Sfionsor .................... Miss RAMBO CLUB MEMBERS Barnard, Cecil Henschen, Ruth Oleson, Beatrice l Barton, Clarice Jackson, Marjorie Parks, Opal Bender, Lola janett, Lesah Potter, Katherine Bonner, Bessie Johnson, Leah Rambo, Jessie E. Carson, Fern Kelso, Margaret Rose, Ina Collins, Maud Kraus, Sarah Reis, Teresa y Crawford, Grace Lundgren, Hattie Rowe, Dorothy Chalfand, Rachel Litherland, Lenora Satterfield, Ruby Etter, Gladys Lydick, Elizabeth Scott, Mrs. Genevieve Freese, Vida McDeed, Paige Richey, Mrs. Ruby Flamson, Miss McKay, Marjorie Shuck, Bernadine Fuser, Florence Millder, Edith Staecklin, Pearl Gandon, Dorothea Millard, Lavona Sutman, Leona Green, Marie Miner, Sarah Van Tuyle, Almira Griffith, Mildred Moore, Eugenia Wfhite, Ava P X-f Haefle, Mildred Lewis, Ethel VVilliams, Leulla N Huinphry, Margaret Nelch, VVil1na Willet, Helen VG' Hurst, Violet Olinger, Eunice VVurtzburger, Bertha QL Huffiington, Ernestine Ostland, Florence VVheeler, June Kg 89 'gg ' SKY' F 'A' F P' at la ,,, at frfwf is lf .T Q lj A T l ' The iiaume Economics Qllluh ,Qi The Home Economics Club organized during the Spring Term of 1924, 574i consists of faculty and student members of the home economics department. The membership shows an increase over that of last year. Meetings are held ji twice a month at which topics of interest are discussed. li The value of music and play was very well given by some members of l the club. The subject of art was discussed, at two meetings. One lecture j was given on art applied to the home and its furnishings, and the other to ll lj art applied to dress. ll 1 Miss Colby talked to the club on Literature in the Home. She stressed the importance of good literature in the home and how through reading the j 5 proper development comes. She centered her talk around the idea that, Any l human life is rich in proportion to the number and iineness of relationships it has established with the environment. On December I 1th was the birthday party. Each girl brought as many pennies as she was years old and the money was sent to the Ellen H. Richards Memorial Fund. Ellen H. Richards was the founder of the American Home j Economics Association and in her memory there has been established a fund i to provide a scholarship for research work in home economics. Une event which helped to make this year's work interesting and enjoy- able was winning third place in the Hobo Parade during Homecoming. This I ' was the first year that the club has participated in anything of this kind and it was proud of the Green Cooks' Band. Each member of the club wore a i I green jacket decorated with tin spoons and played on an instrument made T5 from a kitchen utensil. The instruments varied from dishpans to funnels L and from broom handles to curtain rods, thus making the personnel of the .I band quite diversified. l XJ The spirit of cooperation with other organizations on the campus was 15,9 il shown by the joint meeting of the Nature Study Club, Hieronymus Club and gl S Agriculture Club. Dr. A. W. Nolan, professor of Rural Education at the f'Nl 90 lf Q2 1636 ls, . - me -E .- -E . ,I II I I I I I II I I I I I I I A , I I II 'I I, .I I II I II ! I If mfr A 't , fi. 7 firm H - 2 fffaax I ' ' 2' 2' fl 09 if is IJKPI I I . . . . . . . 2 . 3' S University of Illinois spoke at a joint meeting of these clubs on, I1ducat1on Ipf, :F i Through the Great Cut of Doorsf, Ikgg 'tbl W tg The Home Economics Club is affiliated with the Illinois Home Econom- ics Association and thus automatically affiliated with the American Home Economics Association. The event of the year was on March 18 when Dr. 'I Katharine Blunt, president of the American Home Economics Association visited the school and talked to the club. The club had as its guests at this meeting faculty and club members of Illinois Wfesleyan University, Bloom- Ii' ington High School and Normal Community High School. The club is II planning to send a delegate to the meeting of the American Home Economics I Association in Minneapolis, june 28 to July 2, 1926. I l II HOUSE AND HOME in I I l A house is built of brick and stones, of sills and posts and piers, I But a home is built of loving deeds that stand a thousand years. A House, though but a humble act, within its walls may hold II A home of priceless beauty, rich Love's eternal gold. The men of earth build houses-halls and chambers, roofs and domes. li I I But the women of the earth-God knows-the women build the homes. A 5 I I . s , . l I I I m I I Ii . I I ,y I. II X. ,X-I 7 I Vi' fe, Qi I, nv I l 5 X 4 I I gil ifN 91 'mfg I 'Q IJ Ib - i g AA A ,deign bfi W 'jjypi H AEJTQ tai is fi i l x l l 4 f igfgl -'Yi A - KJ- a J fwwf Q lxgwl fs .fi liars it ft -be MQ V-14' I E J l I l ' i latin Qliluh y The Latin Club has just finished the sixth year of its career. The Club l has had one of its largest memberships this year. l Many interesting programs have been given, which are to serve as an l aid to young teachers and which are for pleasure. One of the most interest- T ing meetings of the year was the banquet at which typical Roman food was l served in the true Roman style. T The Club has meant much to those students who have regularly attended. Q The success is due to the splendid help and support of the president, Miss NVilliams, and the sponsor, Miss Carver. l I v V OFFICERS Prcsidwzf . ......... .............. G RACE WILLIAMS l Secretary-Treasurer . . . .... MILLICENT CRABTREE l Vidcfte Reporter . . . .............. RUTH SAGE L Sponsor . ....... ................ lX Vlrss CARVER MEMBERS Adaline Bushee Ruth Pugh Adele Stafford Jewell Hostler Alma Oehmke i Millicent Crabtree 1 l v Mable Sage Carl Cook Nora Sharp by Gertrude Wells Pauline Adams Grace Willianis Dorothy Dean Ruth Dillon Dorothy Lee Q1 Vg Majorie Karr Doris Whitehotise Mary jane Pollock Qi ,Wi Katherine E. Carver Ruth Sage Belle States QQ 92 Q6 Astral A-so - ,Qi Yo., A T C g 's M., W, , ,.-- n------.':.. f v ,-.-H.. -,-2-vii.-.-.-.w-'-'-2-:+ U 2 2 W 2 ......-2 H 2 V--www . . . . ' ' I 14 it 27'-1-1-:-I-1 .+.-.g.5.:.5. ' ' A '-2-22:22 ' A A' A'A E 222E22222222i2i2222:E.21fif..,-.'12-.i.2222:e:2222E2i2E222i2222?2 ..,.. ., 232525. A 22255233521E1E12r222IE221522222E2E1E1225 '221525fj2j1ij Q1Z1iji.1.Z.Q. QL,L,ijigjifif2' ,Ei3:2,212,2,i21 21i1E235?3?25252?22'?2i-5222522222222 1.522222222252222 2222222212252 2222222212222 i2a22122s222a2e22.2.2.2 ' ' ii 2 E 2 E-EE25Qf21a:e:2g '4'- , , 2222222222223 2532225 222222is-2222222252232232225222.....2 ..:4-nj, :113212121I:1:1:S:f11 .yigirzIg1gIg1g1:112:1:E:i:2:g.9 -- '41:J'3:?:5:i:Q:f:Q:2:Q :?:1z2:Q:2:5:2:E:E1 :iizlzizi :1:51:3:2:52:12-:1i12g2g1:1:1:2:1 Ziififlfiz I:1:1:1:1:211:1:1:I:1:1:Q:f:Q,, i1'f:':': ,.,..:.Q:21Q:2:E:E:2:5:5 j:2EQ:E:E:2:2:2:2:Q:Q:2zQ22ggQ1Q:f:Q:fb,S 1:S'E:QEEQ:Q:Q:Q:Q:::5:g: jEQ2Q:Q:Q:2:Q:Q:Q:f. 1: 212:155232:Q:2:2:f:fI?:3:f2Q:Q:Q:f1Qg5 2:21223 52:3522:2151212121222QE2:Q:f:Q:2:Q:- , 2 i'4 2a222222ia25?Ei25' ':?'fE3E5E3E5E5EfE555 'A 2352122 21 ' 122222222222222222E2i21222' -222222 :T ' ',2:2:2Z1 2si2E2is2222? . 2113311155111-'f-Z-I-Z-1'Z-19331232-Z-1-'-2-122415:-I3Z?A'+7.,i iz-:-2121131111321 -.2,5,-.g.1.g2:11.: :-: - .,,,, ' ,f W - ,-:2:-:-:-:-:-:- '2:2:1:-:-L+ . 22222eE2E225522x .2222f'1 2s2aii122?' 52fi3E5E5EQEQEQEQ .....,i2E222i22222eQ2f'Q- - 3255? 'i2k' z.:iiE2E252 ' 5521:i:2:2.2.E - - 2 1 2 2 ' 2 fl. , ' 1:11:Z122-5 -2'-'2'4:f:1:I: I3I:IZ1:I5I:1:3:i:' 15:1:i:i:irI-4g551:2f5:i:2:i:55:?:11i15i-izffvfi?5:21222:l:51i231li:I:5:5:i:5:1: ':2:1: , . -I 12.-.-.-:3:5:1'54f49'-4EffQi:1:5:i:1:f?I- . iff-i5112f1:I:1:1:1: 22-2-22-2-2:53 '-3'-'-5222222222252 :2:2:2:z22?252?22222E2i222522E22222222s2e22525252?22Ei2222 ..'f3fE:Eif2i2E2222222:Z...iEf12Zi'Z-- ,232 1E2:11i:1I5535f55555252525f32f25E5E35252 2E22a2fE2i2?2?Ei2f2?f52?1fff??5?2122i2i2if ,EEE2E2E2222221212'f22222i2E222iEE2i2i2 ,,-.-.- 29'--'f -'-' 3:51-:-'-'-'-1 ...:-12:-:-1-:-I-I:2:V:-1-I-:-:-'JN-1-I-1'I'i'11-1-: .-:-:4-I YfT4N5', f.'f'+15' '5'i-:-' .vffifz-:-5:1222-:-I+. it-12:-1-22: . '-'1:-:-:-:-:-1'1'-2- 'T'1'f'I5'5 4112-1-I-I-142-1-I-I-f. .....,..., -2-1:i'1:-1-:-:-,-:-if 2213:iiiii2222222222f2:z2a2a2E22222222 222' 222 fa 2ze2ii5252i222i222i25222iiiQEiii'' 2 ii52i2i2i2i2i2i2sI2i522iiiiEiii2i2i222i2E2222' ' 2533E5253i523EiE323'fEE525gf3E3E5E3EE 2222g2gE22s2322i2E5i2212 E535E3 j531,E5.5E5E5E314:E1:i55Z2'iE3E5EEE5E5E-,F' 25EQEQE5E2553E5E5E3E5E5E325f5f25?I:E.fi113251?1lf55,EQEQE3E1' :V 553221f?P6252222222322i22Eg ' ' -- ' '2221 2 222522522522222,.2:22E22222s51?22122132325232i2i2222E2,'1Ez5?gQ'221?f2egigEif22f2gi.g2if2222523222221233 2525222,1E5EQEQEfiQ32325E3EQEQEQEQEQEQQEQEQEQEQELI:-1:52122523-5:3:5E1221'1 21:l:1Q: 21252522 'iiiiiiiiiiiiiiiz 252323252 f2QE E2EQEQEQ2fEQi2E . ag ' ...A .:Q:Q:2:Q:f:Q:Q:112f:fQg?E '52Q:Q:Q:f:2:f:f:Q:fj52QE5:2:Q:Q2:15:3213 . 222:25 ' ' . . . .3355 . . . . . , 'fZ5?ii?f.g2r' .gE52iggE525E3E5325E52IE3EQEQE525552255E525EQEQEQE3E2Ei5Eg23E5E5:.,QQE3221.::5E3E5E5E5E5E5EgEg:2 5E2E2EQE5E52gi?gE3E3E5:, 'EEEEEQEQEQEQEQEQEQEQEQEQEQEQEQEQ223252353 22225 . 2 . 2E222222622222E2i22 . . , ..., ii2i222EEE2222222225i,Q2:-Qiiigf5,QiQ12f' 22222' 22aaaaaeeeeeaseesxaizz 2 .2 A ,,,Q 2222:22EE232552227522525522225 5223222222222 222222'2E5i5i3i3i3i3E5s2i2i1522222 :f?3igigiQe2aQsie2222f2' 2253?iii2i22si2i2iei222i2i ,Q2222223252iii22222i2i2isi2E2i2i325i3?3?2 32Q2QEQEQ22EiE25iE235 2' 'Q2iai2i2i222i2i2i22222i32 2235222222222 525if3252222222222222253252325232 IIA. :sisiagzizgsgeiaiagiiE22iEE525sQa5e2a2a22' 2222222 L '.,?2z22Q2i2i222Q '2 2ie2222i22sis222' '?2E2i2Eg2g222Qa5222212 'IEEEEEQQQEEEEEQEQQEQE 212f2222'2 5 5. 'E22e52i252i2E5E32g52i5s52 EQiiQ22222QEQEQEQEQEQEEEQEEEQEQEQEQEE 52325E22Qsie522ai525252252E222352gig52222512222Q25252:222225253ig25E22252eQs52iai23a522eE2i2 :::gi1:I:life-:-P31313Ig13212313-1-3-:-121-:2:-:-1-I-:gtgigig!52'-155:-3-1212:-1-:p .gr 532123 2:-:cgi- -212:-:':2:-' '-I-2591--' g Jig., ,.-1-Z-1'-I-D 3251311211521-:-:-:Zz-:-2 :-1-112115151121 Z: :-:2:-1-:-:-22:-I-2-1-2115112321111 :-'-'-2-'-Z6-5-t3122311:I511:3512:-:Q-:- 1-:-:-151523211231:1:-1-5-:Z-:-L+:-2-1513:-1313112 2 -,'.- .-2 .'.-.-, 2222225252 52522ii55iii?i2a2a2a2f2222iii?5?ii25222 2s2i2if:2 . .iiiii2i222i2225f.-252 '2'3':A:'f':':':':Q5ifIfIfi2ifTE1f3:3:2511:3513:7:f:2:2Z2ZE1Qlfffifiiififfg 112212222122-ffl' 1322 1537: 3:312112221212I21fiE1ff1:3:?:3:1:i:5:1:3 .1 3112222325232311:3:115:7:3:f:f:21EZf12If5ff3212525:5:3Zi:5:IZ2:Q:fI2iEZf1f5f5f3E313:5:?:f:Q:1: 2:11222 f7:'fff1:3:i:3:311:Q:fiififififffifflif72113 :f:2:f:Q:f:fiEZfIfliifillfffiziz2: 3122QIQZEZEZQZEIEZ3:I12?3?3i'1f1f:5:QZ5ZQE213255:iif52111Sfc2:Q:f:Q:f:Q:fZ2ifIf1E1:1 2222222222222651215225222222. 212222121222252225522222252222422fiiiilifiii 12122252222222222255225i222E2ii222222?i 2.22Q55222222222i2222E222222aE222Ee22222222522255EEEE2525is2522E22222222222252252iEE22EE2z222225E222E112-1232EE5E2222222222s2z2222i2222a22Q2225Ei232222 552222Q22252222i22s252252iiEEiEzE222 2222352222222 E5E5E55532525252525E5E5E5E3E523E5E5E5EfEQ5232f2f555 E'EE'E-E21-??2-ifi2i2?i2iE5z5eQ222i2ieia 3a52i2iei2i2i2i252i2E2i222-12225252232 ig., 11 if '221212121212222222252 3222222Q2225222Q2ia322e2252i2i2i252i2i5i2222223222 252225222225222522222i22i2222e2a2si2i222i 2f2'ii' 1 ,.2g22a5a EQEQ22EQEQ22EQEQEQEQEEEEEQQEQEQEQEQE 2222 ,ei22252222222iiziiiggegagagzgeisgzi' 5522222222522 EQ222QEQEQQEQ223fEQifii5i3252fE5E3E5E5E5E: ' ,,,,,, . . , -,f ff-Q-4-:-.4-nf .-:-:-:'.-:-.-:w- 1-:-1212221-2glgrigrzlzlzizizizhi:1:1:f:f5:T:2:f2g211:1: ,- Y ,-.-.-.-.-.5.1.1.Z.142.3.1,g.g-1-:V:-:-:2:113.1:::q:g1g1:IgI:i:1:2: 351:1.3.513.gg:151:55:3:g:g:1:5:glgIg1:- -:-:-:-:2:2:t-:V:-:::g:::3:3:g: - N ---:-1-2-12:-:-:-:-2V:-:-:-:-:X-z3:3tit513231,-.2.2.I1-:-12:-1-1-z-:-:-1211355515 Wwxfllfiwfsfgf 2 2'2 2 2 2 2 2 2 2 2 2'442 2 . . . . . . . . .-2:1--:-:- ,'-1-:-1 .5-,Q-1-1 . 93 17? 23896 me MQ 2 fl E 1 'J ' T' T 299 053 kia 45.1 'SN 7 filfq ' Q My iQ E714 iff we l 5, ll l I l 4 1 ll H li l I l ll l l .ll ill The QBrcbe5tra The Orchestra of 1925-'26 was one of the most successful that the uni- g versity has produced for several years. Its success was gained through the l ll interest and faithfulness of its members under the untiring and experienced iq l direction of Mr. Vifesthoff. l l The orchestra made its first public appearance at the Homecoming play. 15 It furnished the music for most of the other plays presented during the year, ' i besides giving two concerts in General Exercises. It also furnished the music l ' . . . for the Spring Festival. The processional march played at the Commence- ment exercises completed the work of a very successful year. PERSONNEL Vllolifns Saavopllones Leola Valine Rachel Brandicon Caourtney Longworth Robbffft Snell Garnet oar-dei Althea Mitchell Wllllffed Bally Leona Athey Charles O. Eaton French Hmm Lillian Gee , , A Ruth Powell Trombones William J. Long Bel-tha Hill Christian Harpster l Beatrice Oleson P3111 L- Smoot R ID. t Cioqnets i Virgil Petty Cello whiff? If em Mildred Edna Scott R tl Tl 1 mr Cece Hugh Kain u I lompson Bass Lucille Sharp Flutes Harold Stretch Fern Shummin Reuben Ebert LOWGH Messmav Ruth Fullenwider DTWTS l X-ifl Mabel Stennett Daissvlind Scott Kenneth Dragoo buf l, Nellie Hribal ' , , tim, Ma,-ie Sitts Clarfmets Plano ,Al V ll Alvina Rosch William Bean Bessie Stewart Y' , V y Evelyn Does Adaline Bushee lf fa ti I gl 94 .X l 2 'JU Q e A.-Y Yu- as lg fi Y ft! BQ W' NN W fi- Mba le to is 1 1 4- -+-A il, ' 'vf ' Q YG JNQFWC ' cG 0 s wgggfyg so , frzioex ESGQCJ, C Q, 'S , Cd. Wx lgzxlll l ' Qi' 1 lizekgfl 1 ,N X 1, ,XX M, 'I l 4 l 14 1, ,CQ 4 We Sf E48 FQ I f women 5 Glen Clllluh Director . . . . .lEss1E M. CARTER Pimzrist . ....... . . . QTEILLIA TEGTMEI14 President . ............. . . .BESSIE STEVVARD ,l Secretary and Treasurer. . . . . . Miss SMocK , l Y Librarians . ...................... HAZEL BELL, IEANNE THORPE l Un the third Monday of the school year the VVomen's Glee Club held its l Hrst rehearsal, making preparations for its opening concert. Q During the year the VVomen's Glee Club and the Varsity Club gave a ' joint concert during General Exercises. The Chorus also sang for the Mother's Day program, and for commencement exercises. l MEMBERS Gibb, Gertrude Mantle, Frances Roth, Irene Keller, Noami Bell, Helen Snyder, Frances Daughtery, LaM0in Cassairt, Louise Michalov, Helen Fockles, Frances MacDonald, Gladys Thorpe, Geanne Bender, Lola Cunningham, Catherine Flora, Marguerite Smock Oneta Jeffrey, Helen Potter, Rosalyn Hefnei, Nellie Bowman, Elizabeth Hensehen, Ruth Bowman, Ruth Hallock, Guyneth Ward, Dorothy l Falney, Evelyn Abrams, Lillian Ritenour, Ruth Harfield, Katherine Hedges, Mary J anett, Lesah A A ii Crawford, Grace Bozarth, Ruth Tuter, Florence li? 'Emp Coosey, Josephine Thady, Norma Carlson, Ethel l Klockenga, Edna Jackson, Dorothy Tegtrneier, Otillia Q l, 'xl Bell, Hazel Wampler, Lenora il Q l gl 95 rg i Jfhi . D j J, QQ Lf gb ' AFV EQ 'XQLjRl Mig Memes is fr no - e 54,3955 17723096 Mueggese 02 E ui- -E, Y- -4 Y 1 19 - QS 1 '1 lk-f 1' l l 5 1 Wl V Q Earsntp Else Qllluh , Another prosperous year has rolled by for the Varsity Glee Club. The Club helped at the Inter-Society Contest, and cooperated with the VVomen's Glee Club in giving two concerts. The Club is very grateful to Mr. VVesthol:f, the director, for his earnest cooperation and splendid leadership. Credit is due also to Miss Roth for her faithful service as accompanist. It may be said that even more has been accomplished in the way of musical training this year than has been evident for some years past. The club is composed of a fine group of young men who enjoy their work and , are determined to succeed. 1 OFFICER I'1'f.sifZe1zt. . . ............. FRED HUSTED i 1+'i1'.st Tc-nofrs First Bass Second Base Firley, Carl 1 Ebert, Reuben Glasgow, James Jolmson, Clarence Hnsted, Fred Fronikneeht, Ralph Mills, C. N. Kolrer, Ralph Durkee, Charles T Spitzer, Omer Carloeh, Cecil Mohar, Nathan 1 VValden, Paul Hostetler, James Rirkey, S. Cook, Carl Grismer, A. R. Sneond TC710'l'.S' Seifert, -Xficfor LW, Stretch, Harold Tarwin, Donald ,-X14 L,, l Joellenbeek, August 'XJ 1,1 1 Petty, Virfril , Q Miner, Cyril l 1 1 1 X 96 X ,fwl 1 x l Qi -,G f 55 il7?l'iQYi 191 A V .. - X 1.2 I w it -or -he r -' yoj? E-L7' - T o 177235395 Eeacmiiz Q at ff SQ T77 I i ' F T A A r l I 1 l l l The Bank The I. S. N. U. Band of 1925-26 made its first public appearance at Homecoming, when it played for the football game in the afternoon. The band was composed of twenty-two members. It met each Tuesday l evening for an hour of practice. Although it was hampered by the lack of complete instrumentation, yet through the faithful and efficient leadership of Mr. Westhoff, it made considerable progress. HY T 1 es ' T i if ii i 1 Y Qfxi' 97 lg nb l 6 l we g if , gl Q Q31 i r l I 1 r -r' -25 . L, , L L - L i2IQ3Ewte.1'fI. JWDGX W Kv I 55 TA 5 QW PA 5 intense Qllluh OFFICERS Prcfsidcfzf. ........ .............. A RTHUR I. HOLLOWELL Vice-Prcsidczzz' . ..... .... I QENNETH ADAMS Sccrcfarbv-Treasurer . ................ BESSIE I. HIBARGER I PROGRAMS Qctober 2O- Story of the Automobile Tire ...... ARTHUR J. HOLLOWELL November 17- The Geography of Cape Cod ...... ROBERT GUY PJUZZARD December I5-KiHOftlCLlltL1T6 of Illinois .... .... A LFRED C. VOGELE l january 26-Student Program: A Geographical Study of McLean County . . ...... EDNA GUEFFROY Child Psychology ..................... .... M ARGARET A. KELSO The Commonplace in Science Teaching . . . ....... ROBERT BLAKE Typhoid Fever .......................... .... L OLITA WHITE February 23-USOIUQ Properties of Human Bloodu.. .... DR. PHILLIPS March 23--StL1Cl61lt Program: I Carbon Monoxide in Automobile Exhaust Gases . . .KENNETH TETER IL! The Structure of VVood ........................ I-IARLAN STOLTZ 7 The Quartz Lamp .......................... LEAH LOIS JOHNSON VGA, May 4-Report of State Academy of Science Meeting at Harris- A lj burg, Illinois ...................... RALPH KOBER, Student Delegate I 47 1 l 98 4 I 6-NN '2,t I XT' ,: my XV L I T99 ZW? Q3 ' if iQ YV 'TN7 C C 05 mi 1759595 7926 JQ53CiZQf3Q J at as l +L! I 4 s ,xx Z is 'Si A If N- ,eva i 6 f l l ihrimarp Teachers Cllluh Presidfzzf . ......................... lXIARoAR13T DAUM l I'z'cc-Pwsidczzf . ..... .... C ATHERINE BEEDLE Serratary-T1'caszzrc'1' . . . .... VELMA THOMAS Faculty Sjwzzsor ..... .... ll TISS EYESTONE l The Primary Teachers Club was organized during the Fall Term of IQ24. with thirty-one members enrolled. The membership at present is seventy-two. The purpose of the club is to afford an opportunity for closer friendship among the girls in the department through social activities and to engage 1 lecturers who present interesting, constructive and elevating ideas. The meetings this year have consisted of the following lectures: Train- y ing for Citizenship, by Mr. Hacker. Our Illinois Poets, by Mrs. Turner. Yellowstone Park, by Miss Crompton. Motoring in Colorado, by Miss P Barton. Wl1y Teachers Fail, by Dr. Felmley. The Preferred Teacher, by Mrs. VVilliams. The Primary Teacher, by Miss Sageser. Nfl M i ' i if r lx l ' 99 lg be at P ' TTPQTT 77 'T T T ' Q, Q12 is is f -S QGLH' -'W A AT f if Sf me 17729595 W L elffwg at T l T l fr 4 Members nf the Qtr Qllluh 19254926 Thirzak Buckholz Irene Macke Mary Stuart Blanche Cleveland Gladys McDonald Pearl Stoeklin Dorothy Callen Lavona Millard Leona Stutman Vica Frees Irma Morrill Almyra Van Tyle Florence Fuser Ruth Gakford Gladys Vvllllflllls Ruth Funk Opal Parks Grace Young Catherine Hatfield Beatrice Pregaldin Jeanette Coolidge Ruth Hagi Catherine Poole Arthur Cruze Helen Hockett Ruhy Rickey Clarence Odell Helen Hoffman Marie Ropp Clarence Oleson Margaret Hoffman Ina Rose Paul Lehman Ernestine Huffington Dorothy Rowe Xlfinifred Graff Helen Hunter Evlyn Scott Leola Kipfer Blanche Lainey Helen Smithson Margaret Humphrey Georgan Ludwig Lieta Smith Arta Morrison Ruth Maurer Velma Stevenson France Bates Prcsidcvzz' . .... . . . . . LEITA SMITH Vice-P1'csic1'c'1zz' . . . . . VELMA STEVENSON SCCl'Cl'fl7'y . .... . . . VVINIFRED GRAFF Trcaszwcr . . . . . . . EVLYN SCOTT if M34 Vidcfic Rcfvnrfcr .... .... R UTH FUNK W :Dbl 100 gg i r - ' -'H -Q5 f I D' ' F ' F1 iwpwf J FZLM rp s W 17723595 'fm Q A W ' F Qs AKFL 4.3.2, , ll tiw1..i:Qg'ig213T. - A M'-5: 11' Xl if i . im:-5 Q2 Qi J . f f' Sw A 6 2. l The jllilanual Qrts Clliluh Fall Term TVi'11.T1'r Terim. Spring Term President . ..... . . . FRED STILES F. A. HOLMES H. J. STOLTZ Vice-President . . . .D. A. YOUNGER H. J. Srorfrz P. R. SMooT .S'ecrretary . . .. . J. STOLTZ D. A. XYOUNGER K, C. PING MY BOYS AS PROF. NEYVELL CALLS THEM H. Adams K. C. Ping F. Holmes C. Hubbell R. Akers J. Shidler J. Robinson R. H. Danner C. Barr H. J. Stoltz C. Carloek F. Mock G. Cunningham F. Stiles P. R. Smoot Gladys Vtfilliams J. Hosteller A. Trummel F. McKinley Blanche Cleveland A. W. Dragoo D. M. Thorpe NV. R. Mason Helen Hunter F. Knuppel F. D. Vincent J. Bynum Evelyn Scott A. C. Newell VV. Wliite R. Barber Velma Stevenson B. J. Osborne D. A. Younger W. Vehrs D. Foster YV. Patton C. F. Firley VV. Foster The Manual Arts Club was reorganized in 1923 by a group of students and faculty members for the purpose of meeting and discussing topics which would broaden their vision of the Manual Arts Held. Under the very efficient guidance of Prof. A. C. Newell the club is able X-fn to have eminent speakers, its animal banquet, educational motion pictures, and 1254 lectures on topics of interest to the Manual Arts students. dl LJ? i l ' Q l J' TQ? E Nfgl 101 1 , We JG f 3 fc' n as an C5 is . f7??3f'59C 9 Q Q,..N 1 lk, ea V 3HIIen'5 Eehating Ciluh The Men's Debating Club has completed its second year of activity. Through the efficient leadership of Prof. Harper, sponsor of the club, and the guidance of Prof. Taubeneck. head of the Department of Public Speaking, great things have been accomplished. This club meets regularly every Tuesday evening. The programs consist of parliamentary discussion, extemporaneous talks and debates upon live topics of the day. During the past year the club has drawn and adopted a constitution, which has placed it on a firm, organized basis. Membership is selective, and from the line and encouraging results, a great deal of excellent talent has been developed to carry the colors of Old Normal through the intercollegiate de- bating campaign next winter. The Club is especially indebted and grateful to Prof. Harper, whose faith- ful service and ability have been so instrumental in making the year's work a success. l The officers for the year were: P Fall TVi'nter Spring Presirlcfnt . .... .... C LARENCE BLAIR IKARL ZEHREN RALPH WEAVER xg! Vice-President . .... WM. REAUGH WM. REAUGH FORREST COCKEREL p Secretary-Treasurer . ............ RALPH WEAVER RALPH WEAVER HARRY ADAMS lm P ' li red Graff acted as Club reporter for the entire year. KKK li, J 102 sg me Q P PMA . I 'ft 177 9595 'W .W if l l CZ! I r l l l Zkappa Eelta i I Kappa Delta Pi is an honorary educational fraternity which has chapters in thirty-four universities, land grant colleges, city and state teachers colleges. Its purpose is stated in its constitution as follows: To encourage in its members a higher degree of consecration to social service. To this end it shall maintain the highest education ideals and shall foster fellowship, scholarship and achievement in educational work. Mu chapter, at I. S. N. U. was installed March 4, 1922, when seven charter members and nine others, elected by the charter members, were initiated. Up to the present time Mu chap- ter has initiated 154. members among them the following, since the appearance of the Index of 1925: On July 20, 1925. Lillian Bahr, Leagurd Bloomquist, Clyde E. Frye, Marie Getzg on Oct. 31, 1925, Ozah Lee Couch, Laura M. Ebert. Irene Kinsella, Zeta M. Merrisg on Feb. 15, 1926, Ruth Adams, James A. Bentfeld. VVallace H. Fristoe, Bertha M. Hill, Ralph Francis, f Leah L. Johnson, Ronald R. Lowermilk, Ferne M. Melrose, Anna Plato, Edith M. Robinson, Daisylind Scott, Elizabeth Scott, Pearl B. Stoeckling on May 17, 1926, Dorothy Dean, Fred Graff, Margaret Hayden, Merietta Moulton. In addition to the thirty-four local chapters Kappa Delta Pi now has a 'tLaureate Chap- l ter to which there have been elected the following eminent men and women in the field of 1 education: in 1925, Dr. Frances Fenton Bernard, D1. VV. VV. Charters, Dr. Elwood P. Cubberly, Dr. John Dewey, Dr. Frank Graves, Dr. Charles H. Judd, Dr. Edward L. Thorndike, Dr. Helen T. VVooley, in 1926 Dr. Edwin A. Alderman, Dr. Frank Ballou, Mrs. Susan M. Rorsey, Dr. Paul Hanus, Dean James E. Russell, Dr. Lewis M. Terman, Dr. John Adams. During the present school year Mu chapter has had several social meetings at one of which the Rev. Rupert Holloway, of Bloomington, gave an interesting' and proiitable talk on I ttThe Motion Picture in Art, based in part on personal observations made on a visit to Hollywood. At another meeting our chapter counselor gave a report on the Convention held , at VVashin,Qton on February 25 and 26, and which he had attended as the delegate from our l local chapter. l Mu chapter has adopted the plan of annually presenting a gold medal to the sophomore with l the highest average scholarship. Last year this medal was won by Miss Hilda Johnson. This l year it was awarded to Kenneth Adams. OFFICERS OF MU CHAPTER 1 l Bassas HIBARGER ............................. Prcsifdent IPPN lf .l OTTO TAUBENECK .... . . . Vic-+A Prrnsridcrzt 1 . l b 'N IIANNAH GUENTHER . . . . . . Recorclfing Sccrftary rfb j fl Rosa STIMPEI-:T .... . . . Corrcspoizding Secretary . l, 1 f 1, EDNA GUEFFHOY .... 1'r-cusurerr A pal, H. H. Soaaorsnrsa. . . ..... . . . Cflflllfel' Counselor- tl 'IIN 103 I P --se 5 A--+ eff-psf, +A- ee as -Y i .if .gaggaww Q35 ' c -'W O 'x fosia f UA O O t ' iSiQQXN2?f7lf me 17? 9595 'W' j j 7 1 i ' rffx The ifiinhergarten Qlluh Prcsidczzf . ....... . . .CARLENE EBERHARDT Vice-Prcszdcfzf . . . . . . .IDOROTHY JACKSON .S'crrc'z'airy-Trcaszzrvr . . .LAURETTA CODY The Kindergarten Club Organized in IQI7, consists of faculty and student members of the kindergarten department. Meetings are held once a month, at which time topics pertaining tO kindergarten-primary education are dis- cussed. j This year the membership of the club was ninety, the largest number in T the club's history. Various phases of the Cultural Development of a Child were discussed in the meetings. This included such subjects as Art in Rela- tion tO the Child's Environment at Home and in the Kindergarten, also Crayoning, Painting and Blackboard Drawing, which are his tools of ex- pression. A special meeting was devoted tO the subject of Etiquette, at which time Miss VVhitten spoke. Miss Hinman, also of our faculty, spoke on Children's Literature. The social events, including a weiner roast, participation in the Hobo Parade, homecoming luncheon, an all-school Valentine Dance, and a picnic X4 in the spring, were enjoyed by all the members. j'Xg,f O l The members thank Miss Schmidt, sponsor of our Club, Miss Lee and jl 'Val Miss Harris, for their helpful cooperation in making the club a success. Q, i JN l Ai 104 l f or so O rr cv 'Q gl .Q 9191 If 19 wi Wg 5129 me !7ZQDc,X mb Eh, Y Q J I9 I I Q I fi! I IS Z I' I I ,I QI, A aft I ROW 1-Harry Larson, Linwlvn Bodkin, Roy Easting, Richarml Kvllorrnan, 'Paul Glavsvr, PrOf. Of Agriculture C. XV. Hutlvlson, Ellis SllCllf'llllly0l'. ROW 2-Harold Dorlanfl, Charlvs Glnver, John Robinson, Pm-Cy Scott., Earl Licldlfr, Harold SllCl1PllllU'f'l', Truman Knilmhs, Chansllvr Durkvv. ROW 3-Omer Spitzer, Dvrald Reynolds, XVEIITPII Gwen, Haroltl LQO, Harold YValk, JOSSO Barnes, Dwight. Altlffrson, Lawrenvv WVa4lO. Other Ml1I11lItll'S'firl91l Marshall, Frank Kipfor, Lvslio Drcnnan. iiaupkms Qgmultural Qllluh OFFICERS Fall TVinte1' Spring President . ........ .... D XVIGHT ALDERSON JESSE BARNES FRANK HIPEEE Vice-Prfsidcmf . .......... PERCY SCOTT EARL LIDDLE PAUL GLAESER Sccretufry-Tfrmsurm' ....... CHANDLER DLTRKEE GERALD REYNOLDS HAROLD SLICIIENMYER MiXJtfIR EVENTS OF THE XYEAIE 1. 'Initiation Of New lnmnlmors. 2. Hobo Parade. 3. VVinnOr Of Intrannlral Basket Ball. 4. Barn Dance. 5. Intrzl-Curricular Track Mcct. 6. Ag. Banquet. IIIINOR EVENTS 1. Cigars On Knilrbs. 2. NVaflOs Ombarklnent on the Soa Of llI2l'EI'lIll0l1y. MI Ig?-Q9 I I I X I EX? I I IZXI I2 I I I I .9 .ig 5545 Myfwbwfi WR 'T E0 O V Rf f7?9f5X ily 0-33 ii QC7' 1 a T A A Q I l g l iBi kappa Reita OFFICERS Pzfszfdczzf . ..... ............. C LAUDE GRIFFITHS I'ivc-Prcs1'dv1zf .... ..... J . DESMOND LoGsDoN Secretary . ..... ..... N oRA BRENNEMAN T7't'G.Sll1'c'l' . ..... LOIS VVATT l Pi Kappa Delta is an honorary fraternity for the purpose of fostering i better public speaking. At the time of this writing steps are being taken to i make a local constitution for the Eta Chapter at I. S. N. U. 1 a V4 QS ZA 106 lgmw We e - e JG 1 11 il 1 1 from 9 W Q 1 I W3 R7 Q 1 C, 2.16 ,251 l F i 1 1 1 1 1 i The Qiahmet, Q. W. CHI. QI. 1 President . ............................... ELIZABETH LYDICK Vice-Presidezzl . . . . .CORNELIA SMITH Secretary . .... . . .NORMA HUSSEY Treasurer . . . . . .RUTH ADAMS Finance . . . . . . .DAISYLIND SCOTT 1 Social . ........ . . . BKAUD COLLINS Przzblielfy . ........ . . .VTELMA STEVENSON 1 llforld Fellowslzlp . . . . . .LELA WINEGARNER SZL1lfliCIlf Council ..... . . .ELIZABETH SCOTT ii Social Ser-zflee . . . . .BERNADINE SHUCK I I Meetings. ..... . . . HANNA GUENTHER 1 Rooms . .................. . . .BEATRICE QLESON I Bible Sindy ............................... GERTRUDE WELLS A Urzdergradzzafe Rejwesezzrafire ............... ROSA STIMPERT A T HE ADVISORY BOARD 3 Miss Jennie VVhitten, Chairman Mrs. 0. L. Manchester ' Miss O. Lillian Barton Mrs. R. W. Pringle I ' Miss Christine Thoene Mrs. ROy Taylor ,TJ hi Miss Jessie E. Rambe Mrs. W. W. McKnight Q 117 ' Miss Annie Wlezette Hayden Miss Edith Atkin yi! X1 i 1 13 107 1 K' 1, ' C ' ' I YVY L 49 7 Q sw wg J Z ox L 1 f N Q 19. E. CEE. Q. The Young WO1llCHiS Christian Association welcomes all girls to its Wednesday evening meetings in which student problems are discussed. Thus we share in student thought the world over. Many girls have happy memories of the Walkoiit Breakfast the first Saturday morning of the fall term and the Birthday Party in Fell Hall, in November. Many, too, have found and used the Association Rooms at 303 North Street for other parties. The Association at I. S. N. U. feels that it has an unusual honor and l also an added responsibility in the fact that the very first Student Association in the world was formed here in 1872. In Scri'iCc' for the Girls of the lV0rla' by fig x.f4, l l fi TJ i D l G r 523352325252 E5gE2E2Ef2E3E5E5EgE5..5- 555:5:5:5:525355135.51g.gg52523:3E3E5E5EgE5355 5:5.5.5.5.5.525.5152525152 :...515.55. '5,5.5.55?5E5E5E55: fn..-155515. -15.5.5 -1-g.:-55--,'-.5.,-.5.5.5.5. 5.-,5.5.55..g.5.5.5,g.g.3 , 1-1-15151-1-1-1-.-.-.-.-.-.5.5.5.5.5.5.5.5.5.5.5.5.g .g-1 .- .5.5.5.5.5.5.5,5.5.5.5.5.5 5.5.5.5.5.5.5.5.5.5.5.g 5.5,5.5.5.5 2515117513 -1-1-1-1- 5 'Z':25151515173755173155195Q5325?515515fX513:5:5:512 fi25:5:515,1E5E5fI151i2 .-.131-f51551C15... 5151i5?15151'i'?55?22iQgZ515:5g5g.5.5.5.5.5.5:5: 5:i15:11315:2:515:f15:5151 .515:515:51515 211515152511 1ErErE.. 5151511151515-E-1 :5f11515f7151f.135155555555 25131515151515515:i15:Fi:5:5:i:5: 15f5f5f515'5:i5:5:515:5:5: .5.g-1-1-151515.-. -.-.5:5:515'5Z5'5I2If5f525f 515151515 5fSEf515?5f51Yf f?Q515:515:5:5'2 ' 1' 32525252515 15f5:5:1:3:515:5:51515:5:5 3:E525E5C:I:I :gIgI1ig5:5.-, 'I-I-5111532-1-i-1-1-1-1 52:5:51-1-15545:-152515151 552g115:I:5:5:i1515:-3-15-1-15:-15:51 515:515:-1-1511'-1-151515151515:5151gi:5:3:51521-15:1-1-1-:5:515:5:5:5:5 515 I:5:5:5:5: .-.'.-I4I5IjI51:Ig.-l:.5..- -'-5121515151-1-1-1515.'-:-g:5:5:5:5:51515 15151513 515:i151515:- :-152-1-q1515:5:5:gg515.5.g-.-. 1-2-1-1-1-15. !rE1ErE2E1E1E2 5351515131512 51515111ff:-1515151515221251252515151515f5?i5Zi51E5f5f51f:5:5 79351315195151515:5151515151535121232523515151f5f51515:5:51515152:5Zg5f115f'4'5' '3'7':5551515155EN15:5:5f2:5Z ff:f:5:515:525Zf5f525f51 55151515151515151515151f152f5f5f5:515 I 53.5.5.5 -1-2-1-I'-'-' 15-55:51 5'5:51i:5'-. 51-:-1-1-151-1-'-I-71-I A5'I:iz5111551551-X151-I-1-:5 +51511:51-1-215:-1-:-'P'-I-'-5-54:4511:-1-:-:-:-:-:-151-1-'-151-1-2+ 1-1-1-:-1-1 4-255-P5-515' .:515:5:5514 'Nz-1--1-1-1 51-151-I-I-I-5-1-51515151 15:-1-15:-1-2-15151-:-1-1-15:-:-1-15: .-1-1 .. .... . .,,- . ..... . ..,. .. .x.,,..x. .... ..... ,Y,,,, ,,4.. .5:5:-'-- :-:-1-:-:--:.-:-:-:-1-:5:-: 515.-15: .5:5:5.5.5,5.3.52:5,1-1-1-15: .5.5.5.g-5:5:-151,7ff5Q,:5:5.5.5.51-:-1-151-:-x-1-1-:-:f5:51515:515.,, .-1-:-:-1-1-1-1-1-15:51-15:555.5.5.5.5.551.1-:-1-:-1-1-.Qc-'-151-1 5:5:5:515:-.5.g.5.g-:-:-:- 15:515:-1-xv:-1-:-1-445515.5.5.5.555 ' ...-.-.5.gz41g-:a-:-1-:-:5:- 1-,-S.-3.5.-.-.55:-:-:-15:-14-:-:51-:- -:-1-:-:-15-1-1-1-.-1-151-.5Q:-5-----w:-:-1-1515:-1:-:-1-1-1.-.Q-.-.-.5.-. 51-15:-:-:5:-1-:5:-1-145.-:-.-.-.-.-.5.-.-,5.-,5.5.5.5.5,5.515.g.,?,-:-:- 55.5.5.55-1-1-:51-:-:-.-.5.-.4.-,.,-5 , 15351525122--.Ig 513:515:5:5:5:1 15:5 :Q.51515IQIE11212:5-I:5:5:5:115:5:i:515 I:2g5:515: 5545155:5:5:5111551515122251511:5:i:5:55:515:5:515:5: 525221325 :?g5:5:21515151515151515151525:515:54:52151215215Q15-2g5gT:I:5:t5. 55252: :512133g1ZIEI53E5E5:5g5: 5:5:5:515:-1515:5:5:5:515:515:21Q:5151515' . 15.255255222522222 5355 2223if51225151252i2i252522252f22ff ' 5 '. .iS12f7f515?151515151515:-15:515:5151515Z 212i5S511151115:515:5151Z51'z31I5I5I75EZ25f5:511151355'51ff7iff''E15515:QI7235525511515151515:5:315155523:515125521252513::5:5111515:5'f5:5:51515'11'11-gif525f52515E5:5:i:21115:5:5:5:5:515:5:5:5?I7'5 1251 -15fZ?:515:5:5:5:5:5:i1 1:5:3:5151515255EIE525f .-'51-1-1-:-1-1-1-1315151515151Q515:515252153512-:4-:-1-:5:5:5:515:51515551112:511151-1-1-1:-:gc5:5:5f15:515:425SZE-:5:5:5: 3-1-:55:5:5:5z5:5:1:515:' ' '151-14-1-3:-55:515:5111541151525''.-15:11-:-1-1-15:-1-1-2-35:-1-:-:-1-15:515:52Q2:515:25?bfi-:- ' 1515152515:515:515151:555.5:5:515:1:5:5:5:-15:-1 P 5'5-1:515151521+'-1-:-151':f.'1-i51'1-i-5'I- I:fzlizf:-1-1-1-:5:5:-1-1:-z-1-:-1-1-1-151-15.g?g5:5:-145'-:-15:2-1-Q15:-:-:-:- -'I 5.5.3-1-1-:5: .,1-1-15:5:5:5.f.5.5.5.g.:-'Z1-1-:- .-1515:-1-1-1-1515151515 -1-1-1-1-1-2-1-1-.5 5:51 5:5.5.5.g.g-.51-1515:-1-1-1'-:-15:-:-:-1-:515:-:- 1 '5'5515151515115131515:513:515:5:51EIQIEIf5INT:5151S1515151515:E5:51515:5:5:5:515:5Z5lg,5g51i:b5:55215:5:515 2215222515 5 15151 1515:5:5195235-h5:5:515:515:25:515 -.515 1515151515151 'f:5:5:5I515Sfg5g5g- :5:5:i:515i15:5:5:5:51515: 5:515:5151515151555 I ' '55Q151515151513151531515151515:5:5:f:ZQi5f51315f513:515 511515151 1515151E225f5f5f5151f5153151515: 515157 1 f'-': ' I'Z'151ifS5151251513f5f515f5151iZ15:5:i13:51 5l2fZf3f't 'N- .ff 515131?:515151i151515:5 15:515Z55f525f51511151515..,. 151515151 w 5- -'-5-5:5:5:51 5:5:1:515:-1-15:- 1:-15:51-1-15 -:5:5:-1- .Ig2g1g1g25g5:5: -'-'-r1-1-1:-1-:-151515152311-15151515 H+:-:-1 -:-1- 1-1-15.52g1121115:5:C:5g1:5 1-1-:-1-1-:-:-1-1-15:-15I-1-1-Ig1355:555:5:5:l:515:-:5:-:-151-:- 152-r5151f5:115:2:1:5:515:5 1215: -15:-1-1-15:i: ' +1-1:1g5:1:5:Z-.,':5:5:5:5.. ..-15:555:5:515:gI, '5:5:515:f13' 15152515 '15:5: 5252: 11151-1-1-I-I-1g2gI:5:1:5:i 151l:1:5d:k515g52:5:51515:5:-1-:515:51515115g11512:5:515:5:5:i.-.- :5-5:5:515.51515Ig1p51' 15 ' 515:51i:515:515:5:-.5.5.5.5:5:5:515:515:35'g1:5: 5:513. .51515:51515:515:5:515:5:5:51g2: 5:51515 ' ' ' .5.5.5:5:5:515:515:5:5:,.,..511: 5251: '5:51i:5:1:512:5ig'fkh5:- .5151515151515124-1521955515:-32955- 'g1-5:1:515:51515:5.-., X , 1-3151515515155135145,1-1-1 g-,J12:515-I1515:25:51-1-15:-gz-151515 15:5611:IF5151515:5:51-:-15:-145254-151513215555 5:5:5111-:- ..151-15:-1-151-14-15:5:5252gIqI:2:5: 51515 151515151551 5Igigig!:5:5:5:5:515:5:-:f-:-:-SNf-:-:5:5?fff:5g5:5:5:5:5:5:. -15:-15.5 .5.5.5.5.5.51:.1-1-15:51-.. ----5:-:-:-1P5x-:-:5:-:51-:-:-.-1-.5.-. 5.557:-:5:52:-:-:5:5:-:51-1.5-:-.,-rf-.-1-.--5. :-:5'-15:-:.. -:-1-:5:-151-1-.-1-.5:5,5.5.5.5.5.5.g.5.?g-g-5 -I-DNA 15.5.5.5.5.5,5 6.5.5.5.5.5.5.5.5.5.5.5.5.5.5.5.55.315,-.5.5.5,5.5.5.55 -.5.5.5.5.5.5. 5 121515:-: f 515151511151-1-1-Zftgtgigi':1:5:51515 I-515-5:53-5:5515:5:55:5:2l:5:5:k 5:-: -1515:yg5g5'' ' 5zl:45:51f:5f!f???E:5'551i15:5:5: .1:5:l:5:5:4!5'Ff1?'rzQg3-1g:g15I11,:5S1 352-11.5.1-1-1-1-1-15:-1 5:515:51515qgq1515:g1g1ii:l13Q151-1Z:-1-:-151-:5:5:fEr'5151g2515I E :53.515151515.5.5 X :I:5:5:5:f5:51515:5:5:-2-151 51-:-15:51 ''.5:-1-SZ-2I51515:gg5.515Ig1:5:f5:5:i3:-1-QQ:-1 xi-5'515'315151515:5:51515:31-:Ti-1515152513555 'i15151515:5:51515S15:5:5:5151-1-.MQ1-ifI-Qg5:5g515:5:515:5Q:k2:51 -21-2144-1-151-2:15251521353-55155251115:515:51-1-151-:f-151-1515' I--'-.-:-1-1-25:-1-1-.. -1-:51-1- 1f1'2-Fijljljijlj 2351211 1552351515: 5:-1-1-1-1515:-1-1515.-:-1-515:51-.5415 -142451-I-Zjigijl 51-'--515:---1-151-1-1-.-.5. .-.-.5:I:-151-:-:5:-:-'-1-1-1515'-'-151-1-15.5 .:-'-.-N:-1-151-1-.-1535 .5112515Igi:5g5:5:5:5:-1515:-1-1-.-1 '-1-.f '-1-15152g2g13I:1:513:5:5:5'5'- 152515:-1-are-1-14-1-15 -1-:5:-1-1-:5'5-:515:515.5.g-g.:- :-1-1-15: ----55-:-:-21515:5:-1-15:5:-:5:-J15153g5:41-15t- 1:51-:-:-5.-.55.5215735:-F1-1-:-1-15:-:5i5.5,5. 55.5.5.5.5.5.g.5.5.-4-fig.:-g,,5':k1gqQ.4z-35: 1-:EJ '-1-151-:5:.g.g. 1-5.1-g.: ''1515:51-15:-:5:-1315152225-.5.5.5.5.5.5.5.5.5.5.g ..,. ..... .... ---'Q-15:-1-1-1-1 N 1-:-:-:-:-1-12-1-:-:-15.5.-.-.5.5I5.5.5.5.5. -.-.5.5.5-35:-1.:-1-:5:-1-1512-nz-1-35.-. N .-.-.5.5.5.5?,5.-5 59.5. 5.5.5.5.5.5.5.54-g-1-1-:5 '1-Z-5'5' -1-152-2-Ph54-I-5-11515151515 4-1-15:-1-2-1-1515:-1-:-.1-:5:5:5:- 1 '-A-155:-15.151555.54.34-,gg-:-15:-1515: 5:5:5.5.by.:!S3f-1-151-:-15:-15155:5:5:5:52,5.g-1 1-15:-151-15:-iq:-15 1-1-1-:51-: 5:-:5:515:5:51 -5--:-:-:-:51-:-1-252515--M:-1-1' :-:-:-:5:51-: '-:-:-:5:-:-'-'15:-:5.5.5,55 -4515.5 ,.52.-:-1-,-.5:-.5:-.-.5:-:-:-:5:5:5.5.5.5.5.- s.-- .-15:-1-15:-. :51-1-1-2 .-15.5.5.5.5.5.5.,- - -1-1-15:5:-1'.- 3.5.5.5.5.5.5,5.5.5.5,5.5.5.5 -..5.5.5.5.5.5.55,5g5,5.5.--- 1.5. , 1-15.5.5:5.5EE5EE5EE1EEEE5,.EE 5 5-5.5.55Z153515gQ5QgQg5:5:5Ef:3212g5g5z5:5,5.5 fE55:32355:Q:Q1Q:5:f1y:Qc5 'f.-.'Q'51515151515QQ5351Q1515:515151515151215:5:5151515:5:515:5f2.5 -1.1-g.:.1.1515155g5:51512:51215:515,'5. 5.11.5535-,. 11225131 ' 5 525f515i5f152155f5f51:.,fi,. 5151515315555213ffE52525f5i535555E1255fif5152:E: QE?-::ZfS515':.:.gI535 g5.::5:1:51 ...-55.35125131555Z3i515Zg.5i5Z- 15:51515151554.5.5.5.5.5.51kg5gif:519f:5:515i5:5: .51515:515515153151-195.5iq:535151515:5:5:51555551515151515:5A5.,y5:55,515g5151515151515.5151.:-1.4:.1515.5 155515513555151-15:-:5.-.c-x55:g.g.5.5:55- 5.v.-.-.-5g-:-1-:-:5:-:-15:-:5:5:- 1-:51-1-1-1. 1-:-:-:-:-.-.-.--.5.5.5,5.5.5.5.5.5.5. 5.5,5.5,55.5.5.,-5.5.5.5 .-:5.5.5.5.5,5.5.5.- 5.5.5.5.5.5.5.5-55.51,5,5.5.5.5.-,5.-,M IAD f-'QA . -- 5:-3.5:-:5.5.5.5.5.5 .5.5.5.5.5.5.5.5.5.5.5.5.5.5.515AI ,-q5g5.5.5.5 EEIEIEIEI' --:1:1:1:23E12SESE5:5:1:5:2:2:Zi2E1E2E2E1f :1E2E2EiilS1E1E1EiE2525 72-1:1:5?:1:1:1:5 I ,I 252525IE2553465E2ifE2Ef:1:5:5:5:5:5151' 5E222E152222352515E5E5:1:5:2k5f5:5ek- .-.5.g.56rg2'-: '-:51-I 145151391 I?1E251555??SE5251E5Z155121255-.'15:1:1:.. 111252 ...1:1:1211z.. 'Q5 'E5E2E2E11i':1:11I1liz! .1.2:.:.:2:f,..:22f+f- .:s12:2:2: 51.2.1212:51.:---mf::2:-'-'-'-1'221:z:2:5:1-.12.2:.155mf125951152:z:2:2:s:1:.:5:.:2f:2w. -1235:-:1-2 '-2:s:z:2::.. i15:5:515: .-.-.51515:5:5:5:5:5:51.5 21212122212 1215221 151525:-1 1I151515151f5:517f515f ..:5:515:51555 I 1-1-igIfZfZ2iE?fi515151515' -151515151if2lf31315i5f51515151515155.Q1515:5:5:5:51fZ2IfIf5f5f5i?g513f 5155111351-. , -25i51'-'- 5:515:5:5:51515:5:5Qg5:515: 5.5,5.55:5:5: 5:5:5:5:5:5x5:5:5:5:5.5,5 .----:5:5151515:5:-:-:- 5 5g515:5555:5:5:5:- 1515151515555:5:,:5:5:5:5: 5551515151.5:525:515'-.5:515:515'f5.5:515.51515115:5151-'-1-:515:g5.5:5.-:5'5' . .5,5.5:g j-'-:5:515.5''51515:515:5515:5:5:515555,j-.15 -5:5:515:5:51 5'5'1'1 .g.1515312-!51515.5.5.5.5 5 .. .g5:5:51515SIg5g5g5p55f5 g.:-151515151 5135:Q:5:5:g5:55:5:5:5:5 :3Qg:f51f:5:5g:5.5.- 51515:5152151515:51E15151555153551Q:5155g:Q15Sf:5E9-51455351 5Qg.5.5.515:5:5:5.5 251551515:5Q:g'if2,,21i1515Q5g5g55151515512515151515152 -51515151515 - - 1-1-1-1-1 .-4-1-553-1.-:-:5:-15:-:- 1 :---:-:-1-:-1-:-' 1-If-I .-I-12.1.3.1-Q-1-,-'-.I-I-I-I-W 1',-.-15:5.5.5.5.5.g.1.g-g-:-: 1-1-15:-1-1-1-15:-. '-:5.j-.5.5.5.5.5.5.5.5.5.5.g.g.g g.g-1- .5.5.5.g.5 5:5:5:5:5 -:. 1-1-1-115-5-5151511151 1'I-I-515:5:I:-:-: ' 1-1-:5:-11-15:-151-'-' .,..-1-:51-15:3-1-251-15152 +22111'-2-15:5:-:-1-15:-102-'-1-1-QM:-' 'e25'E15:515.5.5-1.-f-1---:-:5:-:51321-1-1-:-qi-:5:5:5g5.55.5 .5.5.5.5.g-g.g.g.g.1.g y- , :5:5:1:5:5:5:51515:-:-: -:51-11:-1-.525:512151g2g51:3:Si5:5:5'5'5: g511:I:5:5:3f15:5:5:5:5:51 :2:Q:fiE5 -:-15:,5:5I5Zg155iiI:5:5:5:5:5 I2513E315:5:535:515121515:511175:515:5 13222555:5:5:5:5i15:5:5:5:5'A 52515251222125555515252525251:25Iffmfl-15252525251ECEZEZEZEIE' flflg' :515:I15:51315151513212125351-2552152515515:5:5:5:5151k5:5i:2:5'5'5 N 1511151515151-15:2151512121 ' ' ':315351513:5:5:5315:5:512:51f,.5 . . .'1'if11:5:515:515:5:51515:iz9:222Z3AG5:51515:515:315:2:f:Q15 5'-2535151515155 1:5:515:512151215151fi12E121EIE225E5g5:5:5:5:5::5:515:5:315 , 55555E5352f5f115fFE1f51521f5f5f1:51515.g125E5f5f515f5555151515Ei:-:5 5511551552111151513152 . 1 ' 55152QfQE512f22fiE5i53f5fi11 5:515:21221213E225215115515Elf1521513?15152?ffQ1Q15:21f2I21E ' ' 15151515155551215222E'7'552525E225225:51525151515551515f51f51Qf5:5:5:515 5151535523252323E5E1315E5E3E3E3IJ-if:E1515251332155iE5E32E2E2E2112 32gEgE5i5E5E3F325E5E3E5E3E 1 1 35151515153151f1515gf515 4 13131E1215122EIEQEgE2E5E25i5E33iEZ:iZ?5rEr21ErEr22285215525535, 2121225222151i5E5E5Eg:5:5 '1E5E3E3E '3E5E35'-' 2-1-3515:5:5:5g3g353,5,5 15151 '5'5'3'5':'3' '5'A'I':'1 -1515151531i:515:5151Q:55525f5111 '':Q1f:I1Q1fZ5ZfI5:55-,f- , .5 4515151525151.515:5:515:51 E5151515123151515215151515252522152515151515151531515515135151531 1515151if3151l15:5:S5151 51f if515131515:3:5:5:51515.5.5 1i15151-:- , 1115: 515151515151f:5:55:5:g5gZ:5:515:51 :515:g135'5:5:i:5:5.5. .. ,25i:5I5.,. 15:515:5i:51515:5 5.515:5:51-:515:515151g:5:51515:5.5RE5g1:515:5:5'5'5'5'3:5:5:5:5E555:5:51515t4 5152525251:5221222213215 ' ''5'5'5'51515151515:-'-'A gQg515:5:5.1, 5151515151-: :-:-1-1-:5:5:'- -. 15:-7:-1151515153515 ..:5:5:5:-rf:-151+ .-15:5151- 115' :ig-iz-1 I+5'5'5'54'-:-15:-15Fq15t52:- .gifigiiglg 1-:vt-:-1-1-'51-1515151515: 51115151515 151-15:-1-'b 5.5. 5'-'-15:-1-1-'-'-1 5-1-1-1-12'-' '-I-54151I55:51-151515155151-1-.5. '5'515:515:-:-1-:51-:- -1-1-1515:5155:5:5I55:1:55151-1-1-1-1531-15.5. -151-.-I5 5--- '-I-gZg5:5:5:5:-15:4f5g:-:-1-:-:- -5g5g53i:5:5f51515151-15Z-1 '-1-1515315115125 Q-.-I-I-I . 55-51515 '5:5:'3':' 2531515:51515:51Q151515i:5:f:f:5: 1515151215151 15if15:1I15:5515:5:5:5:51515:515:Q:Q15:21-52521213-1-151515151531 5'5'-'-'5P5151515:51215221-2515715153151 5 15:5:5:5:5i15:5:51f55' 5:-251515151512:5Z515.5.fi1515:'5'5'55 5:'15111' 1 1 5351515155 15:5151515:5i:5:515:5:,5 15:51 15:gig5353515j15:5:5:515:5151Q:515:5351515135351535:-1-:515:5:5.5.5 15:1:-1q:5:5:515:51- 515151515151 5:5-1-1gi:5:515.5.5. 5311515151515-15315:5:515:5153415:515151 551515151515 -1-1-1-15:-1-1 5:-25:-1 :5:-:-1-1-.-.- 5:-1-:-' '52-L-1-:-1.. I- :-:5:-1-:-w.5:-:-:-:-.-: -z-151-1-1-' 1:25 '5515535f515'5'5:5 1''':5:511:1355'15I5'5'5'5'3'Q'315:515?S:5:315:5:5?15:5:515:515 5',515:5:5:7F15t5I- 5:5'5:5 5131515555-5 5'i:5:513:5: 151515157513:-1-1-1-5-5?'5'5:5:3:5:31 ':5:5154 1-15:-1-15 Ijljifjjfjlj' -:-:-:-:- 1-:5:5:5:515:5:5:5.55.g-151-2:-1-15:-1-1-:-1-1-:4'' -15'51-1-1-:5:5:515.5.g:5.55, 1-1-1515251535:g.5.g.g-g- .-:-:-:51-':-:-:-:-:5:515:55:5.5,5-- :-:-:-1-: 3'5'5.-.. ' 1151515151 .-.5351-1-1-1-1-1-.. f :1:I5i:1RI1I'I'f-I-I 15:-14-1-1-1-4151515:5.5.5351g1g5g-,-, '515:51-15:51-1:-:-I51515' '42-I-I-I-I1:'l'I'I- ' g5:515:5:3f15:515:51-I-1-1-1-:-T5 - f y.5.5.5.5. ,5g5g5g5:515:1-:-:-:-: 55.5.5.5 53515151515 -'-'-'-'5:5:5:54.25,5.5,.5.5.5.3:35 5:5:5:5:5:55:5:5:515: w5:51515:5'-'-' .5.5.5.5.5.g-35g5:5:5:-1-1-1515 ., 1515115153 535:515:515 51-1-I3555Q5ZgkZ55g:g5g5:5: 5:5i5:5:f5:51515i5.5. 1515:51525E5g.g:g:::1 Iilzlgfji 5'5'5'2f71-151-I-P21511 1i:5:315:5S:5:Q:f151f I.V-51515151513252515151515151525151515 5.5.5.5.5 15'5'5'5'5'5'55 ' ' ' ' ' 51515151515:-1-:-1-1-1-1515151515.-.515:5.5.5 -1251515151: 112121215151 1-TXW. 525:s:5:2gsggg-1--5-5--2 1 51515115121-i15:5i:-.5.-,-. 1 . 'Z'I5ErE1E3:5NEgE5EgEgEEQ' :2:5:s:egg2.......,..5.5. 5355535555555151E5E5E5E52gE5 A I 5 I 5 ' ' 'T '3155:51-1-:-F1515151515125151f15:5:5:5:- S 15:-:-:-:-:5.5.5.g.g-g-:-.-.5.- .... 515131515:515'5151-1-1-:-1-51-1-15:-.-. 1-1-1-1: 2:2 -23.5255555252353222215555125212-212-If -.-.-fp,-.-., . 1 . . 4 55555555 ,5.,, ' 5:-1-1-15151515151-'5. L E5E5E5E3f'1E1E1E1ErE1E ..E1ErErE1Eg25E5E5E55, 5:35122E25222122222221215rf15ff?515Ei?EiE2E5ErE1E5:-: 1fri1E2ilififEgE5EgE5E5E5E5Eg.5.5 1515221521122ESE:ErE1EgE3555525E31515131515:Ei?E2ErE1E2ErErE2E1E1E551E3E3E5E3E3E'N' 515:55g3gE5EgfE5E5E3E5E5E' E525Q5Q5Q2QE2gE5EgE5E3E3Eg 1523E53325E5232351f1Q,51g1gE5535E5E5ErEr:- 2523235525321 f 'EQEQEQEQE5E5E3!5E5EgE5E3E5 .,5E5E5E3i5QEf3Q3Q3Q5:5Q3E5EgE52:E12:E1E2EIE2E525E555E3E52gQ5Q5Q5Q3QQg2EgE5E5 ' 255i555i5i?E?fE?i5?E?i555 5 51.522235iiiiiiiiiiiiiii25523255252 E555?5555521QiQi5i5EiiEii5iiii2jf 5if52552.2.255222552525i2i252525.f:.2.:5 ' 5 5 E22212221222Q555225155Aif5122222552222255225is2ai5Saisis2225325535525222522222i2i2aE22i5ii2iEz2a2sE'5.:1aiaQe5s2s2sg1g.5f222525232225255 .53 ' ,g2g2gaE2E2.2. :5:52E5E5?555555555512555555?55E5E5E5E5E5E5E5E5E5EEfE5E5E5E5E' 5 .i2i2255i22s', 5 ' E2E255225222255ii?Q252225252222252523222522225222325iiEiE2E2iiE2i252i122a2z2i25 5325535555535 22225222225122225252522531522252215252i2Ef2i?ii222i2i2?.2 121252521 12521255321.5222525ie?5252522255222222522SQSSEEEEEEESEEQEQEQEQEI5:Z5:2i22z222a22i15 1352323555555 .a:e:a2a22i3:5Z , , 5:a:si52s2zyEa222.:.: ,.2:s:aia?s:2:s '5a252s52:Q2522515222252552222225255s2a2fi2i62ei2i222215 If 1-22121212 .isisieisiaisiaieigii?5225525335211'1.g2Qs52535521f.5r'.zgiaifiaifagiiz . ,,55.5:122i2E2i2i222.Q.,'SsisQ35sQfQa5sgi22e52i25..., QEQEQEQEQESQEQEQEQEQEA 55533522125255252552552233252agzgagziaiiaisiaisi2525+ 552552 5E5E355E5E5EQEQEQEgE52255QE25',5:gE3E3EgEf:1Z.rE5E3E?E5E5E5EQE2Eg:515z5 ,,QZjI,55.5.5'51EgE55E5519QfQE3255353.'5E35gigEgEgE5E52EEE5E3i5E5E-q-:- '5EEi5E5E1E5E3? 35E3E325E3E5EiE5E5E5iQE2E52'5'5'5151E5E5E5fEE5Ef5235 532555552551 . 232125212si225:22222:151'2...12:z:5:2:121..:2:s:z:2:z:a:s:2:2121212121:r2s2z:z:s:2:si:a:z:21.:..:2'f:2:2:.:....--121212155:5:2:Q22:zs:2:2:z:az:s:e:z:s.5.1 231212121212:a:2:s:.:.:5: 1:23212-22 -:5:.:2:22213! - 5 ...... 12.1.2.2.:52--51..5525:322:511:-:..:a:e:z:a:2:2s:2:sggagsgsgegzgsgzg 132215221211:a:a:1:s:2:a:..,1g'gf125252595252.'252e:a:s:5:s:z:a:z:a5:ag2gs'' .. ''121222151azgsga5sgags5.5.5.5.gag.5g2g 252515152 :.:.:i:i:i:a:z:5:1.2s222a2s5e555a5z2f5'.Q222225232f515:15:sis2z2s2z2a2z2s535sQs5s25eg5gsg2g2g2g2a2a2' 212552252552222ai5235325552gag5gsg.5:f:1:sgagsg2g2s:i12522232z2z2a2a5e3s3s5zg2ga,.,. .5..5s55Q.5.5. 2225555523532325252g2g252g252322zEz2a:.:. 2-25 ' ' ,.,,... 2222125222223222522122222221... .s:a:gz:a:5:s:s:z:s:a :I-215555211J11.:sf2222225222aisra:5:22:s:z:2:s:sgsgzgagsgQ2g2 z2e2zE2222i2:f:1: .515f5:515151515 '1''2sie2522:21212:212:2:2:ara:sgsg23252gg2325222522252222112:12:2:2:2:215:2gagegsg252523:525:as:5:2:2:22.2515:25:1.15gegsgeg55255252525252522222sisis22:3:z:z...,....... ..,.. 1,5,gags5255gag5252325252325:m:a:z:s:e:5 5E5E5E5.5.5 255555353ggiQQjjE'fj555E55Q51'Q2515:QE553E355EgEQE5Q5Qif52323Qif2QEQiQEQEQ5gE3EgigEgE5E5E gE3EgEgE:r:x E Zmgffgf ' ' ' ' ' '2QEQ2QEQEfE' Q2523E53gE52523E52525E533E525552223222552Q222222E523E325EgE525E555EgE333E523Q5Q522Q552Q22E52QE523E55QE5E5 E523535523E553E523EEEEQ?QE55252EEEQE5EQi2EQEfE5E5EgEgE5Eg?5Egii2E5E5E5Q5Qg5Q3Q5Q3Q.:,. 2 2222225iiI.I1' 25222322252S25252231:-5.2a2Ei5?i22252225252252522252222252i222i5iiE252i2.... 5555255552225 55222iii552552232252222E222225222522252322255252232iii2235222525523222225252225252222222225522255 5 222552525252 f555552522iii?is2525QE5525225235325iii52552552E5252ii52i2i5Qig5g22i2i252i 3225225552 5 '2222222222252i2i2i222i2i2?' 55325E3i32i3i3?3f5555555555555555555552555252if2355?5355532Eif5555255555555i5E5i5ifi55551iE' -2252i2i2i2i2i2i?z2 fi-2132522iii52255222525222i2i2i2i2i2E2i252ii252E2E2ifiiiii5iEiii252ii2 , 5535522525525 22222222522251f122552522522225522153522252555255i2i2i2iEiEiE2:2:Q:''E?i??23f1i22'iQ.Q..g2525.,,5.,.2221i fi'f'flf'15f1f 51 2535525252555255555E5552555551555555551525E555555252525252525517-' -fi152z255fii:f .. IEQSQSQSQQQQEQSQQQQ:2Q222Q25Q25522Q55222iiiEi2iS5?z25E3325z13E2Q25aQ5Q2,52i252Q253 5555555555355 5'5'515?515553555:5-125551f555i255525255E?255523255525?532532552555535525515535535555E5E55i5E5E?E5E5EEEZE5E5iE5E fflffi. .11I.5fiIif525if535if5555532555i555555?5f5:jT.521? 155552.-1125555355: 5323252523251EEE5255252532525Q555f352?55555Ei55?555?EEEEEFEFEEEEEEEEEEEE? 5 5 555252513 5 5 5 552?55f553f355i5535E5E555 5255325535352EEE553:E11iifif1fi5555.52112235355235 ,52E33f5.1515'.-11E3Q5552?55555i.f'55Q5555355i55 5555555552522522EiEEEQEZQEQEEEQEQEQEQEQE 5555?53f35?555555fE52 5 ''2222'3525252232222235525255535if5252212222M2i2E2i252?2i2i3EE:325?i2i5iii2i525?.li252...a252E2525252if5225525552523ii255225552E232522252522252222222a,.2i2i2i5E2225iiEiQE5' 12211.-f'I.5222525222225222ig25i2igi222.FE553E5i552225225525222525222i2i222i2E2i2i2E5E55gE2i5E2ig52i5i5E2ii2z5z ..-53352355221 515225225Q2522255222525522555is225222525iii2252252525252255222as5225255522221I5.5i52E5i5i5i5i5i2E2i522552525252552222i2525g2gi2i555s5age5252523225QE35?222252522223igQg21g5gE552E Qi52255555555iii522EE5222552525222212523Egiiiiigiiiiiiifiizii ..z:e 5355252222232222E53EE?52?.55QiQiQfQ?525252f 555 .1552QQSQQQEQEQEQEQQQEEE' 5211-.15?55555553i55Q5g:5'155555Q525Q2QEQQQEQQQQEEZEEEQEEE2555232353i3E5fi5225E252f.5. I 2-1-1-95-54-54-5-I-5-5'5'5'1 ---.-.5:5:515'513:5:5'5 1515:5:-:-:-r1- 1-Z-'-- '515:5: 5'5 '.51i:5151-:...51-1-14-1-15151-54135g5:515:5:5:5'i15:51-:-1-:-351-:51-15151-1-151-112:I:2g1gZ1IgI:5:5:I:5:5:5: :-15:-1-1-1515:-2-I-I-L 55351511353 215:5:5:-1-1-1-, 515:-151-1-I-I-Z'1'15gIg5:5gI:5353513155:51i:5:-Z-51515:-1+ , 5:-1-1-15: ' , '5:5:3:1551i13S:5:5 ..5:Q:5:5155:5:-1 '5.5.5.5.g15152gI3l:5'l:5 .5:5:5:5:515:-15.5.5.f:5:5:51511I3 5:515:5:515151:51515:51515:515:51515152151515531:5151515151535151515:2151515:5:5:5:515:515151515255 ,-,5:5:5:i:515:5:515:515 .5:5:5151515:5.5 :515151gZ51g5:5. ':5151515:51315:5:51515:515:515:5:5151 1515:5151g1g5:5:k215:5131-' 5151335151 112515I5I715I12513I5I552515JA45E5:'E5E5E55:5:E5-Z-1-I5Z-15.-.-.4.5.-. ...s:a:s:.:1:5:.:-5:15:2:2:f2a:1-1:e:s:e'1-1..5:a:e:e:.:5.2.1.1212122:1:1a2:a5:e:s:2:a:12 -12:.:s:.:5:.:2:2:2121212' 111.1 ii'-1-2-122212:52515:51.2:.:1:2r212:121:1:z:s: f:s:5:5:s:as:e:s:z:.: .:.:2:1:2:2r2121:r: ':z:z:2:a:s:3:s.. 'A215:212:Q2z:a:5:.:.:.:.:.:.:21f2121121:ze:s:1-11222221212 .z:z:5:a:s:' ..-.-EEEQEQEQEQEEEQSQEQEQEQEQE25555525225255552353235225EEEEEQEQEEEQEQE2225555252 - , . . 255E5EgE5EgE3E5E3:2:.:f :I 51 Z2 ff1555E5E2EQEQE5E55EE5E' 51515251252515251515152515 522222QE25Q22E252EQEQi3.5 EgE3E5E3E3E5E5 '1235525532535552225255522222322112522355EgEfi5E5E3EfE1E1 ' ' 52552252522252E2E2i2i2i2i255ff -555E22if525iii?5522i5iii2ii5252i2i2ii 2 .25222i2i252i2i2i2i2i2i22iE2E 55551515151515551515155555151515 5155525355525255352535355555355555135555?.5.55EQEfif5151535555E5555555535551 ,... 2255222515''2i3235225gi5gi2i252i2E2 5552225222i252f 222i2ig5222i2.iigigigigigiiiiiii.'2i2iEigi2i22gE31fi3i1EgZgigQg2g2.2.E.Q52fE.2.E' EQ222.522252223252QEQEQEQEQEQSQEEEQEQEEQ222iii?52252212aif2i2E2EiE2EEi2E5E2E5E5i5?2i5Eii5E2E25i2i !Ei22iE2fEf 22f5gi5E2i2?ggigi2i2i2 522222523225 -523222552igigigiiiiiiiiiiii.2252522222225..2522252252555ii2235525525I.212255255E25if22525252ifi2E25252i2i2i352E5Ei225525222iii?52E52222255222522252Q2522252E2i2i2i2i2i252EQi 55f3i555f3i5 .5 -1-1-1-1-151-15:51-15:51 -151515 5115351515151 15:-1-1-1-1-152353135:5'5:515:5:51-151-1 '5-5:53515:5:-1-:5151-1-1-.'51-1-Z-1-1-2-1-1-1 -:5:515:5:- .5:5:5:51g.:.:-1-1-15:-1-' .51-151-1515:515:51515:515:5:52g1g5g5:515:-1-:5:-1-1-15:-1-1-1515:-1-1-1-:515:5:51515:5:5:5t55:5-'':5:5:-1-1-: L 5:51515-1 3.5. 1515:515Z5Zg5:5g51'5:'151-'.-151-151515151515 5:515:51515:515: 51:2 515 I:ljf:1jIjfj5j5j 515:-1-:5: 515:-:-' 5f151g5:5g 5:5:5:5:5:5:5151515 1-1-155'.5:5:5:5:515t5IgZg5g515 .51515:11515111-:-I51515:51515:5:5:515:515:51gZg1g1g5 15:5:5:511151515151515151-151-:515:5:515:5:5:5' 1515151515 1-15 5555535555 5551513515151 515151525 QEQEQEEEEEQEZEEQ1'EEEQEQEQEQEEEQ555 55523525222 252255 ESEQEEEEESE5432?53?5?i5f?i52?5r'5E?'5.gEQEQEQEQZQESEEEQE?. 11ffifif1ff:fifif5fififIifIQ5f2f1f1f1fff1:231f51EQEQ if323552355535ii55335555QQEEQEQEQEQEQEQTgiiifiii 5:51 5--5.rErE1E1E1E1kErErErE2E 1515151531535 512:22522131215IE15E1E1E5S52gEgEgE5E5Egf'5'525Q55.5:3E3EEE5:E:E1E1EfE2f'5' 5.5.5.5.5.5.,5.,rirEgE5E5E5E5:fI-551 1515fi1'Af5:5:5 22523512152SfE1E1Ef5rE5E52gEr 51515I5I5I5lLQj ''.-ErE1E1215121213225251QEgi525555?gi52555233EE52ZiEr2rErirErEfE1ErErErErErE1Ej-153E5532555253252gig?5E5E5?5EE1ErE1i1ErEr5rE1f 5'rEgEgEg .1111555155252255555525QiiiiiiiiiiiiifxifE33 .25252225Q2232353222Q.,....-,-5555235322 1.5.51 :QEQEQEQEEEZEZEEEQ Q?5523if2222252522522E222E222223QEE32555555?f5555525iiiiiiiiiiifiiiiiiiif fQiQ515if5 55EQ52ii?2323if5iiiiiiiiiiiiiiiliiiiiif 22 .T1-14: '515:51:5:5:E:E53TE . . 515151515 ' - .- E ' 515152315351515.5,,55..i:?5:::5l.:.5:5 -1-I-1-5-' '-:-1151-15:-1-151-Z5Z-5-I15:11-:515:-'5'wif:-efwg:-1-'-15:5151125152153-3-35:51-1-1 '-1515:5:5:5151515151515:515:5:5:51-.515.5.3.353-1-:5:5:525:5:515:515:5:515515:5:5:51515.5.555+1-15:535:515151515:5:5:-15:5:5151515:5:5151515.5,5.5.5.5.5.54535:-1-15,5,5.5.5.5,515.5.5.5.5.5.5.5.5.5.5.5.5.5.5.5.5.,.5..5.-.-.-.5,5.5.5.5.5,5.5, 1 5, 552252. '-:-1:.r1:51-25:5:.:5:.:.:.:.:f:..5..5g2 5222ai522252I11512222222215:52I151512:Q:ffff1222e:a:.:5:a. a:s:s:s:f:s:a:2:a:a:a:f ':5:s:e:5:2:s:5:2g 1.12.2.21.e.s.2.e.s.2.s.s.:11::i-2 2f2e:z:z:s:2:s:s:'-ffffwag15:5:215:212:2:21212121212111252225:215:Q:e:z:z:e:a:e:a:e:a1+1-'1'-'- 2'2'5'1221-'.i'22:a:a:s:2:.:.:.:.:. 5225525225522 .2252i2Q2a2e2a2z2a2z2z?255 EE5252555222223if.2a5fTl.gsa212z2'52i5iii2i 2f2z22lz25ff2. '5E25iii251252225552222252Q25E523iii222222F222222222E2E225252Qi251321z22iiiQEQ2.E.253QE2l2.51FE2E5522iEiE?f.2i?Ef5 5E5353555'7555553i5E ,. rE5E32523E5E5'32553552335555125Iii'555552532555252533253353 5525252525 AEEEEEEE'2325255532535EEE553532523555-SEEEEEEEEEEEEEE,13.-1235252532555 22225222 5151515E5151525.5Z51515151515f55f5f5f5 55252525 E525E?E35155525EE5553EE:2:E525E5EiE522E523E5E5E E3E3E5Eai?23EEEE2?5'5:5fXg5E5E5E5E315.-, 12122252125252555IE52525Z525f5E515f515i5f-.13155512f21,15f'f'5' 515.52515EE?E?E5EggE5E1.5.5EgEg23E5E5E3E525555555-iii:-252355E5E5E3ErE5E3EgEgE ' E5E3E3E3E3'55252552f5?E5E5Egigi525EgE5E5E3E332EE5E:511 5'5E5E5E5E5E3E5E5EgEgi3E QEQEEEEE'.523E5E525E3E5E5E5E5E3E5E?E5E5E5E1E3Eg 3232525251555 5335 EQEEEEEEEEEEFEE5EQEQEQEQEQEQEQEQE E5E5E3E'5252335E555555555252ri55E?E5E5EQE2Eg:51 E1E1EgE5.5E5E5E5E325E3E555EEEE5E525E325E5ErE1:g2gEgEg3E5E5E5E5E . ,.,55,,5, 252555225 E52522E5E41E555EEEEE2EEf3EEQEfEQEQEQE55fEA'5I5I5'1EfE5 .gsieizizgeggzgzas ,sgaizisiai25.Q121EaQ535.1121-f:e22gsa2z2e2siz5'5'5' 5525252525252 5252ag522si2522aisiaisizisiaieisiaiaisi '.552a2e2z22E12121E1isiz2 s5252i2i25'5 5 55E3E3E5i5E3fQEfEfEQE22QEQEQEQEfEQEiE5?SEQE5:55512325552525 21E'2s22i.,12i2isg2..Ff?2?2i2i22222E2EiE2E2E2i2222222222S22'555 '5:-52353235553523535252-55f3535523 555353555 FEEEEEEQEQEQEQEQE 25252225 51515151515555555i5g5g5g5i515i5E E235553525552555535555353E5ErE32Qff55EQ5 252525555515555-.f55f25E5251555f5f55555515155'555 QE2EQ2g,51Q.5Ei5i?555?i 2355235252522 55525552 QEQEEEQEEEEQEQEQEQE .5535 155532525 52522222325II52E553Q?55irE121Q5.3Y55555i3552Ei5i5iQf55?5 55:2-I' 5:E1ErE2EfiErE2E -215122525222552525525'E535535E5',1E533E5E5E5E3ErErE1ErE2 151525551 rig5gEg1gE5E5EgE5E5E3E1f',Q' 1225251311'135rf'53E52gig?5EgE3E5E2if33E5E?E5E-1 EQEQEQEEEEEEEEEEE55222135.r5rE1ErErEgErEg gE5E5E3E3E?E3E5E5E5 EIEriririE221E232E5555555555j5'13E3?5?33E5E3E5E5-1212rE25'1'5'5'f2f:E1EgEgEg''i5,515.5E5EgE5E5E5E23E'5 1sf..'12121E:ErE2Eg35E5EgE5E5:5 3552523535-1EEE3EiE5E5E3 EEEEEE 5i5i5?2EQsg5if2i?5i..,...5if5525252123335512:55252222225235525525ff5.5255325235Q1515Q:Q:Q:Q1Q.g.:15:Qg 55525553222255252253555j2sE3iQii5525i55,5. 25252253 2i222i3i2gf12s5a5s,.j1f12aEe5s5s5252i2Q2g2g2g 5,QQ5,5152ifgf5E?ii2E22a2fia?5E15'55555535221522225225 EEEEEi?EE225255325252552Q2Q5s5i23i2ii2iiiQ22i2E?2522if5iiiiiggaiaiziiiiiigaggzQ2Q25222g252293535225223222253323521515122:Eggig5gf15:2:Q2121E'22Q25EE2i2iQEiEQi522522gsg. 1325215325151 E12f353552E3Eiii?55EEEiEiE?EEEQEEEEEEE52323532521515251IEE2355QEQEQEEEQEZEEEQEQEEQF5515:515I515151.,..225325252553252525Q22522Q22E22Q52EEEZEQEEEEEEEEEZEEEQEQEQEQEQEQ' '5Eg55EgE3Q525Q3Q5Q5Q2Q3Q3Q3Q5Q25If1f 55555252525231E151315512Q512QEQ252QEQE52Q25E525E52Q25E525EQEQE2E215E512 1'fiQ21222ifEQ2QE5E525ifEQifE525EgEfE5E5E5E5253i55 55555555535325323.15:5355gg252521'1'i515:555':5 5'f'5'5'51E52 1' 1-'1 ' ----- 1 -rr -15:-11-1-12 .ggg15g1g:1:5g5:3:i' :5:1:.:.: '1' -1-'-1-'23:5:3:5f-'A 109 1 ' E CWTYJ f 17' R-f R f me 17? 29896 mf' 536189450 We 1 fs , T- s.- , 1 9 , Q CE 1 1? 1 1 1 1 F im 15 171 Q 1,-A l 1 1 l l 1 1 11 1 1 I E 11 1 ,, l ll Qnnual iiaumenummg 1911114 M1 HMERTON OF THE MOVIES CAST Amos Grashwiller . . ...... .... C ARROLL ASPLUND Elmer Huff .... EUGENE PARTLOVV Merton Gill . .. JACK PETTIT 1 RAYMOND BURDIOK ' Tessie Kearne ..... LILLIAN BAHR 1 1 Casting Director . .. MAYLIE GIRVIN 1 Lester Montague ..... E. E. WACASER Sigmund Rosenblatt MAURIOE GRAFF 1 1 Camera Man ......... OMER SPITZER l Weller . .............. FOREST TOLLEY l The Montague Girl .... PAULINE POOLE rl LOUISE BURKE 1 Jeff Baird ........ RALPH KOBER Harold Parmalee . . . ADRIAN BOOK Beulah Baxter .... LUOLLE CRAIG 11 GLADYS MOONEY R i Felice . ..... LUCILE WARREN 1 Max . ........ NATHAN ROSENBLUTH 1 Muriel Mercer .... GOLDIE BAKER Mrs. Patterson ....... RUTH HENLINE BI1'.W31b8l'g .......... R. H. EATON Extras on the Lot 1 Gateman . ........... RONALD TARVIN 1 Cameraman . . EUGENE PARTLOW 1 Ito . ........ JOE HAZZARD 1 Lightmen . .. JAMES GLASGOW l KENNETH ADAMS 1 Extra Girls .. ALVA MARIE ENNIE XJ1 VERNA HALIERICK xr l ERNESTINE HUEEINGTON 4' FRANCES MANTLE QS 1 Extra Man .... GLEN TILBURY X' 1' 1 Chauffeur . ..... PERCY SCQTT P A Little Girl .... ALICE BEYER I Q Freckles . .... .... C HARLES C053 1 V Q 110 G1 fhreff ' O A 1QN?.702:z3N GD Gi I 'sjgzabg JWPGX 9 L l Qi Q, AA,A,,, VJAAW lg . 1 4? ' l , y ii l l Zlesters The Testers of 1925-'26 have passed thru a very successful year. The first event of the year was the sponsoring of the Homecoming play. This was followed by the presentation of one act plays at the monthly meetings. These plays were directed by members of the organization. Miss Frances Mantle as president proved to be an able leader and co- worker. However we feel that much of the success of this year is due to our new coach Miss L. Louise Stephens whose congenial personality radiated to every Jester and instilled in him a desire to produce better plays. ROLL Carroll Asplund Pauline Poole Goldie B. Baker Mary Jane Pollock Harriet Black Ruth Sage Mary Bobb Karl Zehren Adrian Book Roswell Eaton Louise Burke Harry Fry Lucille Craig Bertha Gilman Mamie Custer Maurice Graff Charles Winegarner Mamie Girvin Idabelle Harwood Wa.rren Hileman XJ Frances Mantle James Hostetler ,X ,T xf - i -' TN Mary Lou Norris Velma Horn K, YQ., Clarence Odell Forrest Tolley Q H70 jack Pettit reg, Wa N Zi lg nga? my :DL at 7 'Sd e 1750395 'W ' w w f , 4 V W f 1 1 m Q Q 1 1: ix QA S ,,.-X The Jfnrfeit CAST Marjorie Hyde . .. .............. BERTHA GILMAN Howard Pyles . . ...... DELWIN BERGSTROM Mr. Pelham .... ...... F ORREST TOLLEY jum . ....... ...... C ARROL ASPLUND Mrs. Mullms ....................... IDABELLE HARWOOD Directed by Goldie Baker. d d in Z A 2 D d A KG ti R :Y T - lie A A W 1779595 'W' Q33 lil ll 4 W ki I gD'inhers:iKeeptrs CAST Mrs. Aldrid ........................ MARY BOBB Mr. joe Aldrid ............... ..... A DRAIN BOOK Mrs. Hamilton ..................... LUCILLE CRAIG Directed by Frances Mantle r E l T 015132 Eanhsr ilaat l i CAST Columbine . .................... MARY JANE POLLOCR Harlequin . ..... ..... F ORREST TOLLY Peirrot. . . ..... ROSWELL EATON T Q Margot . . . .... ................ M AMIE CUSTER Q, Punchinello . ....................... HARRY FRY Q Directed by Lucile Craig lg 113 of -A A Q- R A Z m5 Q31 fwex ,veeasfap 9 i ca P?'CS1iIZf lIf Qllummerce Qerganigatiun ...... ......-.... .... V1iCF-Pl'1'.9'1i1IClIf . .... . Secretu1'y-Trc f1Surcfr . . . Spenser Lillian Abrams Lolah Alderson Emma Allen Mary Austin Edna Barr Esther Black Vera Blair Lolita Bowersoek Alice Bradbury Ida Campbell Julia Carmody Jane Church Margaret Coolidge Leona Gothern Flora Cox Dorothy Crouch LaMoin Daugherty Olive Diggs Pauline Donaldson Thelma Ebert Dorothy Fauver Katherine Fenton Dorothy Fluck Frances Fockler Marion Fowler Helen Gardner Eda Geerkens . . . . RUBY SCIINVARZVVALDER ROLLEY OFFICERS RUTH RLTENOUR . . . .MEHLE THOMPSON ELIAS W. MEMBERS Ada Gerdes Eva Germain Vera Gooch Myrtice Goodwin Blanche Haefele Verna Hamrick Grace Hanson Mary Helm Rebecca Hileman Clara Iehl Irene Jene Eula Jensen Marie Jiessa Elizabeth .Tones Aline La Rochelle Gladys Lasky Anita Lee Mable Marshall Sadie Meehan Irene Miller Ruth Miller Josephine Mooney Helen Morgenthaler Lois Newburn Alma Obourn Helen Ferry Esther Pisell Isabelle Quayle Bertha Rhoadarmer Georgia Richman Alma Roettgers Vera Schroder Bernadine Sehueth Rubv Sehwarzwalder Alice Seymour Edith Shakespeare Louise Siebens Freda Siegert Ruth Smallwood Gretchen Smith Helen Smith Mabel Stennett Violet Stevens Bessie Swanson Margaret Tibbetts Mildred Ueateh Eileen VVeber Florence VVeber Cecilia Wlieeler' Ella Winchell Mary Young Charlotte Riemer Irene Kinsella Zeta Merris 114 Fern Melrose Ruth Ritenour Lloyd Abbey Donald Allen Bayard Anderson VVaverly Ashbrook Simon Birky Lee Brace Francis Brotherton Raymond Burdick Howard Crawford VVildon Crawford Weldell Clark Floyd Drew Roswell Eaton Raymond Elson Clarence Hamilton Melvin Hill Leon Lugar Leslie McQueen Glen Myers Athel Nolder Kuno Schroeder Howard Springer Jene Wilsoir Harvey McMullen Merle Thompson ft' f7?'959f 'W X6Y'QQQQM,Qf Q Q29 :ky r 1' r T- A' l J QP y l 41 I 'pf WZ Q f X l 'floral Qlbapter jaatmnal jfeheratmn uf Qinmmerne Eunlhs JOURNEYMAN l Elsie Brenneman Ruth Ritenour Irene Kinsella Le Roy Martin Zeta Merris Harvey McMullen R. M. Luedde, Fellow APPRENTICE Raymond Burdick Rebecca Hileman VVaverly Ashbrook Jane Church Melvin Hill Bertha Rhoadarmer Dorothy Crouch Irene Jene Georgia Richman Roswell Eaton Marie Jessa Violet Stephens Thelma Ebert Leon Lugar Gretchen Smith Eva Germain Sadie Meehan Bessie Swanson Verna Hamrick Fern Melrose Ruby Schwarzwalder Helen Gardner Helen Morganthaler Merle Thompson CCMMERCIAL CLUB The Class of 1925-26 is the tenth graduating class in the school of Commerce in Illinois State Normal University. In addition to regular business meetings held each month, the program committee pro- vided excellent speakers on current topics. One of the outstanding accomplishments of the Commerce organization this year was the formation of the 'fHuman Typewriter which attracted the admiring gazes of astonished spectators at the Hobo Parade. On March 26, 1926, the local Commerce Club was recognized as a Chapter in the National Federation of Connnerce Guilds, an organization which stands for high scholarship and x.,r achievement. We wish the Journeymen success in obtaining their master degrees. fb!! . 17 We trust that the impressive recognition services will annually commemorate the birthday W Q y of our local chapter. 15 l ' 4 I r, . + ' li 115 4. fr as 3 fs Els. sfsifgbh CQ W Sw 1709895 me Ulbe Eumerfs league DEAN O. LILLIAN BARTON The VVomen's League of Illinois State Normal University was organized during the fall term, 1925. The object of this organization is to create the spirit of unity among the college womeng to develop a sense of responsibility toward each otherg to cooperate with the school administration in its efforts to make and keep high social and ethical standardsg to encourage the women of the school to make their citizenship operative. ' The election of Friday, November 13, resulted in Ruth Ritenour, being made president, Mrs. Hazel VVright, vice presidentg Esther Reed, secretary- treasurer. These officers with Lillian Bahr, chairman of the fellowship com- mittee, Zeta Merris, chairman of the Census Committee, Gwen Clifford, chair- man of the Social Committee and Elizabeth Scott, president of Fell Hall, con- stituted the first Executive Committee of the VVomen's League. Gwen Clif- ford was not in school the spring term so Miss Shuman filled the vacancy. In forming the league the women of I. S. N. U. felt that they were tak- ing an advanced step which promised much for student participation and co- operation in the activities of the school. The girls of I. S. N. U. are greatly indebted to their Dean O. Lillian Barton for her keen foresight and untiring efforts in making the VV'omen's League possible. Thru her interest in girls and her realization of their social needs, she planned this organization as a means of bringing about closer rela- tionship among them. Qur hope for the WO1116H,S League is that it may fulfill the highest anticipation of its worthy promotor. 116 1 1 l l W 1779595 'W' 9 053 N My ik l Q X, LJ l 92924 'RZ lf?-S 4 I I p I I I I I I I I I OFFICERS President . ........ ................ R UTH RITENOUR Vice-Prosideni. ...... .... lv IRS. HAZEL WRIGHT Seclrefavfy-Troaszzrcr. . .... ESTHER REED Fellowslzijv Clzairmazz .... .... F ERN MELROSE Census Clzaiwzzlafz .... .... Z ETA MERRIS Social Clzairzzzazz ..... .... L OUISE SHUMAN President Fe!! Hall ............. .. .ELIZABETH SCOTT l Sponsor . .......................... DEAN O. LILLIAN BARTON DISTRICT OHAIRMEN District District No. I May Qliver No. II Maude Blue Q No. 2 Clara Whitheld No. I2 Mrs. Stevens, Wiiiter Term l No. 3 Violet Stevens Margaret Leltzer, Spring Term No. 4 Ruth L. Fullenwider No. I3 jane Church No. 5 Gladys Wood No. I4 Gertrude Buskard i No. 6 Mary Kendall No. I5 Merietta Moulton K No. 7 Winifred Bally No. I6 Pauline Spitzer No. 8 Florence Foster No. I7 Fanny Reinhart at No. 9 Alice Smith No. I8 Maude Gaul gig F' p No. IO Mildred Shaw No. IQ Anna Maloney 7Gl No. 20 Lucile Mason Q, No. 21. Margaret Daum, Fell Hall Rep. ,Q ' l f 'T l gl 117 'gg QL25 I I I I el' tl v QXTETXSIT' N 77 'O TF ev Q2 Wcdlffg iam R91 x f 17? 236324 SD Q af, ,Q W W 5 , I W W W ,A W W W Wf W 118 Q Si QW W A Q ----. 525S3252?2f2S2S5S?'2:z212?552221522Ss?52525i52?252?32s:5riff?'?z2s2s2s2525212121222ffl'EI'Ii14252225S525215151I151?I1Qsi2iSe?f1?sEE??H3?2?z2z:5:z.-fffzfecw:-X A A ' i 'If'I'I'ffff1111321111f1252?1i12f2f21: '1212r2g25s55SsE5S: '.55555252S5?3E12fEpf5fE??5?EE5235g5525222S5355325592125E5E52g252,.f111252525252f:lf.,12555E22521if11?1515if'erfEi?5i9'f2?5E3Z?ig??:?:?:2., ,.1,gfff:i1::ff, A ,V vw .... g,..ff-I.: xv ....,.,. -, -. I,I.3,1.II315:3151:gf535E523E:E3E:E:E:E:EEEEEEEE.g.1.g.5.:,56i:3l3:5:1::E:E '.'.A-A ffl: -.-. -.'.- . ,. ,A:i. I ,. X' f Q1jmf-1,2 .L..,H, Z 2 i,v',QJ?iMA KJ, xlqu K fffjxziln I V 4-.- bilzii. 5 .:.:,f.: , .1,:,:, gf. 4.,... .,.,. K , fi' 2 ,f x SQ xg 34 l i i l 1 S 2 if S is ' ', 'A'4 'A '4:':':':':':': ' Q '-.: 3235 N if sb, If 3 C3 2 uh 2 'Nw-1' WM 5 If 2 3 ff 0 ry, 3 .':3E5EE5E5 'A:: E:E:1 3252. -, -:jzgz,:::-:,:-1.1.:.g.1.1.:.,. , A A 55,Er2rE:5:3.I-s2:5E5S5E1' ,-:: 5:215:555E5E552515:E'fr5E33r3:5:?Sib5fzE3E:E:5:3:5:5:253?22132..5:5E5EzE5Sr .rar 5:5:555E5E5Er: -:-: 215151555222-1513- ,1-, 155224-215151321312 '2',-::1:1.1:1,,41 2.- 25:2 2:?'E5SgZfff3.f12'i 1ff '11 15-E234E55E1E 21E5:513 :1:121E1Ee-'131:-.-1-I-1:5-1 3-513311 ixfxigywfw fJ'iQf'1fMKwlfLQN:ffMw fwisigff miwgki k wwgge zl gz M x iffiilfixi 15?-1' ,:-: 5f?2?2i2fzi2:5.,'?2125f ,.L: g:i1i::1:e1'13Z ..:: a2a:5:l:1:i1ff?1:::1:5:4 -4:: 11251 'Z 4' i e g 4Qffffff , 'Nlf Mi,1 i g : jfK ,f 1g 3f jgk5i i g ' gN5Xg'0 ieff5 K3Uf2 jfX 'iQf5f f ,i32? WNf fl 4 1 . ,1-':fA '.:1 .'-1 ' Q Q l1 . , 1: Q ' 1 bllliw -,:,:1:1:::l.',. -lzzziiizigiz if DZZZ, .:.1:1:1IZIZ:IZZ1.:.1.11:1:1:1::::::11:1 2 : -,., Q.::. -.:,:4:.:.:11:11::1::.:..1:1f::i:,:1:l1.:.i::- 4 1, .1.:1::i1:f:., , ,iii .1.i:::i: 1 f 1 .'-: - ':':'111: ' ' '21 'l Q1l1llLll llLlf ' ' '- ' -'-' f 1 'l'2'l'- -'l-lil2 -... 119 A V55 QJXYETT TTY T ' 37' F5 7709595 ,omits-E2 J dl if li l Xi lg ,ff pi W l GRAFF NENNVTSON CARTER Erigbtunia Wrightonia has completed a very successful year's work. Things began W with a boom early in the fall with a majority of old members back. In the Inter-Society contest the Wrights were not successful but even in defeat, VVrightonia looked glorious. The contest was very close from every standpoint. The Wrightonians contributed generously to I. S. N. U.'s Intercollegiate Debating Teams. The following intercollegiate debaters were active Wright- onians: Fred Graff Ralph Weaver Walker Wyman I. Desmond Logsdon Clarence Blair Marie Getz French Petty Howard VVhite Grvetta Myers To Wrightonia, goes the honor of presenting one of the finest Student Council Programs of the year, when last March, a select cast of active Wright- onians presented Not Such a Goose to the school. The officers for the year were: Fall Winter Spring President . .................. RALPH CARTER OPAL NEXVTSON FRED GRAFF Vice-President .... BERNICE HINSI1AW RALPH WEAVER J. DESMOND LoGsDoN Secretary ...... .... R HTH DAY HOWARD VVHITE HARRIET BLACK Treasurer .... .... K ENNETH ADAMS DOROTHY HIBARGER IDA PETIT Reporter .................... PAULINE POOLE MARIE GETZ PAULINE POOLE l The society is very grateful and deeply indebted to Miss Blake whose X-qi patience and thoroughness and untiring energy have endeared her in the fX,,f to ' hearts of all Wrightonians. May she be our sponsor for many years to come! K V65 Wrightonia has unusually fine talent to close the year's Work, and we Q r X, see only victory in the contest next year. Let's go, Wrightonia! Q l fi -A , 120 'i P D Zi D R R el Q a.,4ijm,w,N - fii , .::,, 5, .,-,: ,.,g,,,5V ,,:,,:1,4, ,1:4..,.:,Z,,:4 ,fj,?,.,,g,3,.:-Z.:g5g,g,H., .:1.,1.1f.:f.:1.1, 3 ,::,.:..,..,..,,I1.::.:1 - ,,:i y .:1. ,A Z5 ,:,.,3. , ,::.,1.:l.1, ,.,.,, -.,:.1f.,1., 15.5, ,.:1.,1.,,. ffZff22ggf,5Q,g55 fwflw yksxfm Q2ff5'K2:SfW1f'fiiY'f2f1i?g! 5:25:51.Sfifirg2:z2:52:5?f::z?afsEf'-31 4:..'.:11: .,.. 35 :5 5,-232:gs152:Q2:52:51:5s:5Eg52ga2gQ:gz:g2:g1 555255235 :ga:gs:ga:?f3 E1EEIgf'fEf1l ,'1: 221:34526:5a:5E1:g2:g2:l951gaSg3251215515211521552111 -'f- 32311 gigi.g1:g2:gf:z2g5sggfgzT:'a:g3:55:5sq:ff., 5f MQ 9jff' ,QNf?2 A:'t ff3 fi w W 'gfHgg 5Q5,gj 5 f5fj,ff 22-12525525 3 535 151if252252225252253252522551 2523 55525525525 552552 325525525 255255 52552552 55255 25255555535E25ififif552ffifQEEEEQEEEEEEEQQEQEQQEQ1 5.Z55 55121Qj5'55gggg5:5:,g22Q25:252525325 132552 Q1 , '-egggizgggiagiasfzafagiagiaggaggsgisggsgg52-4, . gg 25552 525, M 6'mQf5Zf1iQ5f4g g 3Mg5f!5f1 p w yfswwffvmffwwy f, ' w5,,jx,Jf ,xwffif fii x 3gfi5f3?Qf?5fWff 6 f f l A v 'f K,fgWfif xf m M5 5g5l5iEQ,542i1f 13a55,5 fjwg i if 555255-ff+5M1 5if,31,f'?f?3Q .12 M m, g 5..5.55:15: ff5,g.f,,,, ,,::5A ,:,:55:5.: , .55 .,5.,5,, 5- ,5 ,.55::, ,.:55gC5.1-1535355 .5,,, 5.,5.:5.15.:5.:5.:5::52:5:15:55:55,,5l5.15.:5 - L., ,:,:5, 3, .:5,:5.,5., 5 ,,5:: -.,5,,5.,, ,:1,:, A ...15.l5. ,15555,:5 -.:1,:5.i5.:5..5 - .5.. 1 - .- . ,,..4 4 . , .5.,5.:5,,5.:5Z:5,, .5Z:5:55:, 5 ,:5,:5,:1.:,.:5.:5.:5 .5.,5::5Z, 5 I V5,, 5 ., ,,.,,. ,fi5g,,,,.-..,,. .,,., Wfi 5 5-f'1 2:? f,f 5 55 5 K, Zli ,i,::, ,5155i51,, lziiii ,ZZI . . .:,,:511 ,..5.,.,, ,, ,1,Iiiiiziiizizi,5:55,,...,,5,i...5 IZ1.. 2, .5:,:::51,:::1:,:,,:,5z lziizziz. ,,Z151:5:5. .1,:4. .,54,..51: 5 5 .15.. .5:,A ,:5:15::,.. .4,.4,5,:5,::1 I 1 .,5,5,5,' .::,, 5..5, Ea'i'33'N-fx+ifKgff,fP.iQ 'NMg,,v5 , '155 1f.!,5 'Mf,,'g, Q Q? 5i fffiig5agg35gig?55 f! ?Z 1f, WvKf?J,,Jfx 'f:Q !g' 5 55,'iM . ,, ..5, .,,55 ., . ,. 5 MX'Mz 5 Jy 5gg'QW M W5U,,.fMqf Q f H S W ILQ, pjikkp fj i555ff,f 5l '?Ww ,5,ffmf 2252 551:5 f22s2fe25e2i22E22f1--f522522!25e2ie2525122e251.isaief.--..:ef:5.-zfiiiif '151 '1' ' 32 if123551522522i25igiEaiEii2a5e5551525eiiaieafegfeiif 52252222522 3 ,5.1 - 55 551552 i?ff 'm b'w.MQf d, ,L2f3iff QXf' 3 fff F 5 Z 5fff53 x Sfg 'w, f'WM W 55,f gigff4242? fffiiefffiiffJ' L ' ikffggbg-xif 55 55'5 553 5 Q 5l.5 YJ'AfixJxf 'fZ::,3 5555,55 55555 Q 05i sXf? '2Q xA f x,if'5 ,,,f..,5Nf? . 5'5' f f g f ' 3 ' '5 555555 ' '5555555 515 5 555555555 I f vis ' r ii f ew' r '- f5Qg395XQWQ3C fffzbax , zioegliasgfa vt gg gg Tb, 1 fl Qi i A l HARPSTER BOBB HURST Bbilahelpbia Victory was indeed the slogan, the watchword, yes the goal of Philadel- phia this year. In the annual contest of the winter term the Phils won hve of seven points. Our honored contestants were Miss Grace VVilliams and Mr. Christian Harpster in debateg Mr. Robert Bishop in the orationg Miss Lucille Hall in the vocal solog Mr. Maurice Graff in extemporaneous speakingg Miss Mildred Hixon in reading and Miss Eva Weekly in the piano solo. We cele- brated our victory with a banquet at the Y. M. C. A. in Bloomington. After l the banquet the Phil orchestra provided some excellent entertainment. A very appropriate one act comedy, The Downfall of the Duke of VVrightonia written by Miss Bertha Gilman, followed. However victory for Philadelphia did not stop after the contest for we kept Going Cn. In every literary event that followed Philadelphia was there to claim the honors. Five of the six contestants for the Edwards Medals were Philadelphians, Miss Mary Bobb, Miss Mildred Hixon and Miss Bertha Gilman in readingg Miss Jean Dinwiddie and Mr. Robert Bishop in the ora- tion. Miss Bobb and Mr. Bishop were the winners. The Livingston Cup was claimed by Mr. Maurice Graff, also a Philadelphian. In the state contest Philadelphia represented the schoolg Miss Bobb won first place in readingg Mr. Graff in extemporaneous speakingg and Mr. Bishop in the oration. ln the debate squad we find Miss Grace Williaiiis and Miss Bertha Hill. Philadelphia steps to the front every where at every time, and why? Our presidents this year have been of the best. Miss Mary Bobb in the fall term was very faithful in securing good material for the contest. Mr. Hurst in the X., winter term worked untiringly to make each program of this term better than by the preceding program. Mr. Harpster's administration saw many excellent Q ik: programs presented and he showed the same faithfulness and loyalty. Our 'Q r sponsor Mr. G. H. Palmer has ably led us to victory the past two years. lt is J r ii through his inspiration and untiring efforts that Philadelphia is going on-as J ' A she is. A tml ' f E 122 A 6 or r-rf o Pr 'T77' 'er 1, n 3:A:-17:2IT:-5211-.-171-it-34:-rwrqcgeggqq.gqggyq.,y,,g.g.g.g.7.g.g.g,- .,g. -7 .-:rt-rev:-7 .em-.-uf... . .W . . . . . . . , , , , , Z4 -2 .222.5552253325EEE52522555212252152ii25irf??????3?22?zfsasf:2:2:5:3:5:2:2:5:5:2:2:2f5:2:2:2:5:2:5:2:2: ..,. ...-...i25E?Z5E3E?EiE3E5E35635555553535E535E335535333553E?E5E5E525E535E525E3E5375225552525E5i5E5E5E5E5E3E5i5E?E5E5E 3E5i5E3E5E5E3E5i5E2Ef E?E535E555E?Z?E5E5fLlZ:E5E3i5E555E5E3EES?2355?5E5E5?5?5E5E5E3E?E?E?E?E355E3E55355E3E525E?E5E5E525E5211-5232525532551:15E3E5E5E5E5E5E5S5E1225152 EEEEFEQEEEFEEEEEQEQZ- ,,.,.,.QEQ5QfQ5Q555fQQ5i2255ffQfQ?Q2Q5Q25fijfQQQQEQQQEQQQQQQQQQEQQQEQfiiif, 2525255 'A 'b'fEfEQEQEQEQEQE 2Z252ifE5E5E5E5525:55252325555525552325Eii?E525ii?55353555355iiE555E555E?E52?E5255555525555552EEE5iiE?2:5:z:2:2:s:2:25i?2?? 1''2'ii5555525E?i5i?ff'5'::2:2,.E555Eiiiiiiiiiiiiiiim. 515' :-:-:-:-:-:-:-'2-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-'-'-'5 '4 ' -'2'-'-'-'-:-:-2-:-:-:-:-:-:-1-:-:-:-:-:-:5:2:-:5:-:-:2:-, '-:-:-:-:-:-:5. -:-:-:-:-:-. Q-:5:3:5q:5::::::::: ,2 . .:2:5:2:5:5:2:' .:Q:2:5:2:5:2:2:5:52gf ,,252523252g2g2g2g2gsg5? '2,2g25255g:3:2a+ag:215:25g2g2g5g2g2g2g2g5g2g2gsg2g2g2g2g2g ififEfgfgigfiglxlflfififififfff 32:2 ''E5252525252g3if5?2f ' 212221222523 5555252523Q5f5fiif?fE25535953iEi??EiQ2g?:'5:5335f3f:ffffffQfQffQfQfQfQfQfQfQfESQ5f5f5555??f5iQQQ5QiQiEQif25223E5QQEQf5iQfQi55QfQfQi2fiii...,, 5535555 ,A 5252525 ,,,, EQEQEQEfifgff2f2Qg 25:E222525355i5EE25Q2252?55?E5E22525121 1.52.5E2i5E3?5252225252522522252552222252525E5ff5?5?3???3+ES5E2E5f5S2E2?255E5i5i?5E5525525E255252255... E555 '3:2Z5212E2E2E2 E5S5EfE5E5EfEfE5E5E5g 2. :.,,1.,,.,.,.,..:.:.,,,, .,:,,.,,,,x fff7f1f351fifi2?:3fif5Z'I f-I-:1f'ff:-fl:-:5:cififff3Q2ilill2Sf5f57F 1i5:f55f5fifi25f3:3355135:315:i:i:?oQi:i:5:1:f:T:3:5:51... :?:3:1:f:i' .3:731: ':i:5:5:5:5: 3:3:f:5:f:5:5:5:3:3:2 5:1:3:3:3:Q:-11:.fzi'..::Q:::Q:f:3:Q1Q3Q:1:3Q2Q:ii'7:QigSi:f:3:7:Q:5:f:j:5Q12'7:Q:Q:Qlfrfzjfgi'i'f:Q:f:f:Q:QffifZZ'E':5zQ2,iS:Q:::Qi:Q:Q:Q:ft2:3ff?:f:f:Q:f:f:2:f:2:2:f:f 2222153 .::f:Q:5SQ. izftfzfrfz f:f:f:f:f:f:f:Q:Q:2:E 5Elfi52552I3i5?'-fi-2fE1i1?fE12i2Sfxi..223555225E5326332925555?2i2i522E5E2Z5fffE5i5E2E2E255525252Q55525525532325225532i5iffi252i5i2i252i255E252 '252i555i5i252?Q5:'2i2i5i52g2g5g5 EQEQEQEQEQEQEQEQEQEQS , . .... .,........ . :il 1:23II.-flilll-l:lAl:f'L-' .'IIf'I'I'.- I-1'I-I-I-I-1-I-I-I-1-1-I-1-I-I'I-I-I-I-I-If-I-I'f:f:I'I:I:.-,'.1.2.j.i,:.E.E.'.f.E.E.:.:.1.1.1.1 -.3.3.5.1.5.5.4.3.5, . ' ' ' 0' .515-5 ' '-'-'-'-'-32::3:::3:::::i:3:1:3t3:::5:3:3:3:f-'-'-'-'2:-:-:2:-:2:-:-:5:-:-1-:-:-:-:-:-:gg315:pg15:5:31:15:1.y:::3:5:3:3:5:5: :g5g:5:3:53:1:g:5:g:5:i 5? 335 35:5 55555555155515i5E?i5i555E52ff'2f5 '5f515151f111512121ffEfi2i25.-5522 222E2S5f5E22525RZE22255E55252-5:2:2:2:2:2:2 2:2g2g2g2g2:2g2g2g2:E ' ,...,. A,.QA....4A..4 , ' '52225252E2515222i2Ei5fi2if525222i2E2E2525252525252321 z:s:z2: . . 2 .525255325E55525E53-55252525252555i5Ef25i5i5i555i3?555523252555555E555E5252555525E5E52525E5253525555555555555E5255555E5255355355525559551232f525252:5S5?i5iEi2EEiiEi551325752flI22:2:2:2:235:5:5:2:s:2jiiefifi11:s5EE5EiS5EE5i2iZ2.2.2. EEEEEEQEQEQEQEQEQEQES . . . . . , .52325f5iff3535f553f355f535225225Ei?55252353255525555255?5?2Q?Q?f55f32?5Qff5 ' WQEQEQEQEQEQEQQ 5 ...,. 5 ...-.. 5. -,4.- 252f5i5f5255f1E5f5if2?Q5f5i5?fEf?f?f3Q?555?5353 iff5f5f525f5f5i?55f1'ff5i3i?i5f5f353i?i5'512555555555551555325igi5f52?i?5f':55525ifi5f5i3i2i55i5f555?5E552?5355555 55555355555i5i52555555:5::ffffIf:iflil-133'i13Z'f:5f15f3E51::12.21235fE1irEiE5E325ii55i353i E11rf'2 'fI'f'I'IIflf'fAf2'52'-5555525555233I if3flfiffifiiiifflfliifififffiflf Qififffifififlfffi':iffE5fTf5f3f3?f5f3f5f3E14JE? if?f3fifif3fff3f3fif3 fifTfif?51fif1fi2Tf'-:3fIf5f?f5L' 551f5f123fTf3fif3f3f1f3f 5fifIfifif131fifififffgiflfifff' E1f3'.3f3:i: 1-.-1-:I:3f3' 'I':-.-:5:-:-:i:3:f:5:-:-'- .-:I:I:3:iii:7:3P':3:5:3:3:5:3:i:5'T . .-.- :-:3:3:1:i:i:-.'51iif:i:3:i:5:-:-.-,'i'5:f:5t2Z2f 5555555E?f?2?fr5553f55553f5i3Q32533Q5f5f3f5?5?ii3ff5?i5Q5'E5f559E?Q5f5i?i5fQ?i5f?255'.155235 5iQ35?i3i525QQf?5 3555355553232 :?i5i32525S' 2 525555525555532355555555 ,zfifiiifiiiigfiiiiiifQfQiQE252if531: ,.QQ355EiffQi555:iQ2552E222E2QfififQffiii5:Z1Q1552fQiQfQ552QfQ55iQfQiQfQE5 555f:ffQfQQ:Q525222222Eifiiiiifiiiiifiiiiiig I2ifZ5Q5Q25Qi2ii52ff5QEgQff5E: 3553555525255 22525252 252335E5f5i55l3f7E5??i5i5.3?i?f5??fQi?i5ii 12QE5Qfi5if2QQiQ55555S25222Q2QiQ525Q52E22232QQ2EEEE3Q2QE52EZ'f.::55QEZEiE2EQEQ?f3QEQEQE2525Q22EQ32E25232535Q5QE25E525232if231I'f.213552Q52EQ525252522Q32E252EQEQEQEQEQEQEQESEQEQEQE 21112522QEQEQEQEQEQEQEQEQEQE,l 5555515 ?25E5??fE?E?5?E?E?i22135i1355E:?S,Q5E5Ei5E325EE 33535525 :E:Z12:EEE5255533352335352525E5Er2 lf5E?3:5?E335 25512135 21: 1 2:21E:515:E:Er3:37S2s2:Ev2:5:5rE:Ef2:22 212525535125,:532E525552155S5535E555E5E5E5E3E2E5E3E5E3i2i?.225555555553552E555535551Fi:5E555332335252522E525E5E555E533E5E5E5E5E2E5S5E5E5E5E2':QE5:A'1S2E2E5E5E2E5E5E3E3E5E5E X5:2:2:2E22522522si255252522222QGEEQS52si2:5:52a23?522S5E5 12E22225:2:2:552S2Ea253s?1Si5?2Es55E5E22222E222222522:2..Z11212E12- 152252 222. 'f. '52525252525Z525E3E5E5E5E5fE5E5EfEfEfE5' I555gig5gag5522355:sg5gsg5gsg5g5g2g2:2:2:1:1-1- 'gE5EgEgEg2gEQE5E5E5EQE 5, ,A.44 l'7'1+3'3'1'3'l'5'7'i'5'7'i:2:? .-1i:1:i:i:5:1:T:1:1:3:3:3:i:3:3:?:2: -.-. .'.'.5 : -.'i:3.1:T,-.' .- 11:Pi:I:3:1:3:5:513:I:3:5:5:3:i:5:1:3:3Qff:i:i:-E3fff3f- fifi23f3f7.'A 3:j1,.-E3:1:::f:fffEf131.215,.f:f:Q12:3'f:Qf,,4.5.,..3.3.ppfg:95- '5'4 Y-if .4.-.. ''I'i:f:Q:f:f:5.5.Q'i:-.V''izQzf:Q:Q:Q:f:fI212:Q:Q:f:fZf:3.9:ii2:222:E22:2:fif. 7:g.3,Q2211:Q:f:f:Q:f:2:f:Q:f:f2f E5ifE5E5E5E5E5315E555E5E52555255552Q4E5E5E5E5E5E5E5E5E5E5E5E5E5E ' E5E5E525E5E525Z5E3E555ifE525E5Z5555I1.:if.1,1:1:11SRT?E5Ef2fE5EfE55fE5EfEfESQ23E5E3Ef52fE5EIf'5E5E5E225E3E325if25E5E5E5E3E5E5E525E5E5E3E55:''.5-ZI'.A1Ifj55l3?E5?5?5fi5E55?i'555?255i25E525E5E5EQQQQQ:5.175535E5EfmI.A'1S523E5E5E5E5E5E5E5E5E5E5E5?5E2.''5E525E525E55555532521f?Qf25EfE121:1':12E5E52fi: :.:,:.rfEfff3i5QE5i3Q55335f5i555f525fEfiffiffi , ' 33'.23fif5fif52355f5iff552555325E5E5E555E52?E33f25Ef:. 53E5f5f555??f5i?Q?i3E5f5f?l5-113555255522-I '553E523f553if5523E-QiF13f5E525E3E523E533E513'4..:53?ff3?:1fZIjiIilQIIIIIf1iff5I525251552f'512ZEEEZE2SiEZE5EZEiEf525iiS35:. 5332- '55iff5535555555ff?5555555535225i3f55353f553i555i555i 255252325 125223 2525222 555555553525Qif3f5Q3iff5i32E5Qff5i5f3E5E5i5f: 5ff5Q5255325235525Q5Q555Q?i5i555255555f'fI51Q-Qxriririn--5-2-ZI51Qif3f5Q5Q5fifQ3f3f525Q5f555fif5531.'A53f5i5f5f5f5f535i5i5Ef:1QfQf211522-,QQ2E5E5Efi3E55552225535555QE5EffQ555E121Q22'Z15525E52IE2Q-I'it55f5f5i5Q5i5f555i5?5f5:Ifiiffiiirgfiiifir'iiffifiififi if5555if523555525Zif555ifig?if5ifff?i5f5i5Q5f5Qi525f553555 I:I315133iif13l37733153:33i5I:155i:I:-155351515331 3l7i:i25:if3f1f3f?. 'lfifififfifi' .': 'f3f1fIE3f3fIi .-13135551'I-.5:-:5:3:3:i:17 '-'-. 'Zffffifffifffififffifififffffifffif5. ITfif3fi23fiEI535if1f?fif3E3255125'-:3:3:5'P75313:?133553331i:Q:1:Q:3:Q:3, 3:f:f:f:f:f::.- i:f:f:ftf:f:Q 22:22 f:f:fIf:2 .Q:Q:f:Q :Q:f:Q:f:f: Q: Q:Q:ff:f:f:Q:f:f:Q:f:f:Q:f:f: 2:Q:2LQ:212:21f:Q:2:E:f: f:f:Q:f:f 2:2125 4222225222eaas25122az21:22222522522222-f22z2s5 2255212225552525522525252522222222252Efigsiii2Efiiieiiiiifiiiigffifiiifi 525522 123235123559212553515323fif3f1f3f5f1?7:751:3' 3fIfIfiE52Ififlfiflflfiflfffiflfiifi:-:4 -:415:3f1f1f .-f3f35 .1:3fTfi: .-1ffTfif3fifif3E1fififffifffifififffff':::::f:f:Q:3ffQ2- :1iQ:f3:5:Q:Q:f:::3'ffffQf1' .Qffff2QfE113ffEffffffQiffiffQQgEffQfQfQfQfffQff: 'EfffEfffQfQffff:3f1iSj?fffff: gififfffi Eff: -EgEQ:2E2Q.f':rj15:5:5E5:Q:g:5:QE5Ef:g:5:5:1Z',5:5:5:5:3:5:3:3:5-'1:5:5:5:5:j:5:Q:5Ef 'mi ff: sffiilf: .225f5Q5ff5: ,-115325f?if525if525Q525ifffiE5Erfff521-ffQf1f1Q5Qi 1Q1ri3f555Q3fQf5i5Q3f5i5f5i32?i5?3fFi3if52?Qii?fEi5i?f5:fr25i?i55f.f1f5:Efiffiif'-EIEIEEEEQEE5E5Eii??55Ef5.. I' 555' 5525555552225 5 -Eiiiiiiiiiiiiii. ' 'A'4 ' 'A'A' ' ' A ' 5 .. 351fi:1:1:f5555555i5if5f5QiE3235553552 25 51.252-5.2-2-2.1-1-2 ..-.-. 5i?f?f5i5f555Q5i35'553ff?5E?Q5i?2?f5f5i53::'fif-512335E5Q?3523ErE:Q55E5i3f3QE2?f5 .12.fiff:5?E1.'ifIQrE3i3i5?3f555:3Z'flQ31112E325if5i?i?i55?52:fi2f:-11:2Q12-I'iiifffiiiiifiiiiiififiiifffiiiiiiiifi' 'A '4 'A' ifQ21f52,Af2E5.'555if25Q5i5iiQ2i.:L'fiQQfQQ2f5fi5Q52E51ffQEfQl5:f5fQi21f'5QfQ5Q E 5 iiiiiiiifiiiiiiiiz, 3EQ5QEQ5Q52.Q -.52 .522.5EEEEEEEESEBEQESEQSEEE ., ,iiiig 523355525555 .E522ii5QE5S5SQE559Q,:555Q5Qi525QE5552QEQE2E5E5i5i5iQEQi5iE?25E QEQEQEQEQEQEQ? ZEQEQEQEQEQEQEQBQ 21 22225255 522232522252525552553 '3fEfE1.55QEQi 5'5'5'52555252555255555535525552525535 55555555525E5i5i52555i?f:E5i555525.2ifffiI2Q:22i2i5i22f2E22i?5E52i22Ei2iEii5i5E225'.:5ii2iSiiESiSE2525 2:2:2:5:2:5:2:2:5:2s2:2:2:2:2:5:s .3.1...2.2.2.2:2:2:5:2:2:s:2:5:2. 2:21212:215:2:2:2:21221:5:2:5:2:s:s:2.2.1,:-142 ,1...5:2:2:5:2:2:2:2:2:2:2' ,.2:212:5:212:215:212:5:215:2:2:5:215:515:51215:215:5:ze:5:5:5:5:5:2:5:2:z:2:2:5:2:2:2:213:215:2:5:2:215:51f:f'f-1-i3ig,I552g5g5g2g5g2g5g5g2g5-1A2-2- 2g5g2gsg2gsg2g5g2g2g2 25255 5555 ,g252555555g2gig2521',.5252525255525E555255aE5222fi,525SzS2i2 225225525 X 22 222525 f2is222is252221222225i5i5i2i2if2fffi2i5i522i 'A ' 3:i:3:3:1:3:3:5:-. Y72'JgQ .:f:f:Q:f' ,Q :f:f:f:f:Q:f:fzfififififrfti ,.,,5ifI2121212IfIfifIPIE123fiE3552353512323Elf!ElfifffTf5E323fff5f5fff3fif?f1fif3f3f5fi ff5f5fTf7fififif72f:5 II22If52iE5ii5?ii2iga3'jij:gqI1 1213225gi5ig55E555355555Eg5gi2if122555552525gig5255igSQig5552ig25ig5gigiii5if55555555555gigE5555555E2Sgigigigigigigiiigigiga Eiiiiifiiiiiiiiiiizi 5 'E5E5EfZ5E5E5EfE 5255325 5535532fi5i5E5EfE5E5E525E5E3E5E5E5E5E5E 255255222 E5i5E3E5E5E5EfE5E5E5E 25E5E5E3E5E5E5E5E5E5 5252525 2522525222552i2E5:.e52E5E :3Z555E5EfEfE5E5E5EfEfS5E5E5E5'15?5EI.AifE555EfffEfE5i5E5E5EfE5E5Ef: 'ISEEEEESE'QEEEEEEEEEESEEE2525151515 :5:5:2:E2iEili 2:2252522321:11:155315515E55355EgEg35Eg2gEgEgEgEgEgiE5352325215,:Iggfgigigigigigigig .,,,.,, 3555555255525 EQEQE5E523igE5E3252gE5E5E5E5E5EgEg2gE5EgE Efffffff E5E3E3EgE5E5EgEgEgE3E EgEgE5E3EgE5E5E5E3E5 E3E5E3E5::i:2:1jij2jIjijIjZ,5E3EgEg E3E53gE3E52E5EgE5EgIgEg12SEg1.,'rEgEgE5:A'E5EgEgEgi5E5E3EgEgi3E5i gE5igEgi 5EgE5EgE5E5EgEgE3E5E5E5E5EgE555E5E5Eg3gEgEg5gE ffffffffffffffff2EffEfffifEffEEEEEEEESEEQEEEEEEEEEEEE' 2555555 52555253525255535iiiiiiiiiiiiiiiiiiiiiiii 552525555 25Z5i52555i5i55553E5E? 555E53551522Zllilliillillffiiiii? 252525 2525555 123 ,fl my ni A ' 1 1 r wi ' x , sl U I w HL 1 w r H ' 17325896 ,fifvx J' X ' 4 ' ' W HAY Q31 Q 1 51,7 lx!! N: VA. Q l A RQ W2 21:1 i Hif ll Q Q1 ! l QM N , Ml ' 1 H t W1 I I 5 ? E ' nw M f M4 V Mi lx 3 4 U 1 i 1 l 4 X 3 ' V 4 1 N52 W if. :V E M My y lx H11 Y FEV V! Q V 1334 w Q f -l W ,fits 124 16 1 N YG xx' f X: 4' 6 Q33 x xl l 3 , I 4 l l fffewf al? .ce V jfell Jean mu ctau I HOW TO KNOW OUR FRESHMAN 'NYQQ Virginia Adams-She smiles when she goes to the library. QW Q ea I ,-X w Dorothy Anderson-Her heart is not in her work-,tis elsewhere. Jennie Andrus-A pair of brown eyes. Mary Andrus-The silent woman. Ruth Armstrong-Seen, but not heard. Esther Black-As lovable as she is loved. Ida Campbell-Man Beware! Ruth Cecil-A cute little girl with reddish brown hair. Jean Cox-She has the compact fever. Virginia Crossman-One who has many charms. Irene Dankenbring-Laugh and grow fatiltl? Jean Elymore Dinwiddie-She hasn't grown up yet. Anita Dittle-Roses and Specials. Velma Etehison-A quiet and obedient lass. Louise Fiddler-Her heart 's in Wesleyan. Lucille Ginzel-The music master. i Vera Gooch-To know her is to love her. Blanche Haefele- I don't want to go with Mildred. Mildred Haefele-She never speaks. Harriet Hartter-She peeps into the future. Juanita Holmes-Is he tall and handsome? Elizabeth Hughes-A friend in need. l Mary Kirk-Sense and sensibility. Marjorie Jackson-Can't you talk? Margaret Leskera-Down in Saint Louis-. I Ethel Lewis-SHE knows. l Eva Louehs-She makes a handsome man. l Ruth McNeil-Mary's pal. Martha McQuilkin-There's music in the air. . Nancy Jane McRae-She hails from the North. J Irene Macke-The girl with the curls. Alice Marcussen-A quiet lass. l Ruth Mauer-An artist, even to her tam. Althea Mitchell-Hop, skip, and jump. Irma Morrill-She can paint! Anna Nalbach-Chatter! Chatter! Chatter! Nellie Oetken-Tall and stately. Mildred Parker-Small, but mighty. Izora Powell-The Rambler. Eileen Powers-She knows literature. Elinor Reid-Skeecizs. Alvina Roseh-If you wait, she 'll get there. Mildred Scholz-The girl who can persuade. Virginia Shoop-Pleasant and agreeable. lxfll Jean Shreiiler-Courteous to all, intimate with few. gifs 3 Ethel Slack-She has a smile and a fi ure. l P7 Oneta Smock-You have a caller. g im ly l Helen O. Smith-Her eyes and voice belie her name. l rg, p, l fx! 125 v S53 tv? A , A- lg ' ' TAXWJXA ' fs is r A 7 Y ' f - Y -,- - , fe 17? DSX W MEM sew I L' i ' V I 'W'e'A ' ld 1 Mabel Stennett-Vanity Fair. Catherine Stevens-Smiles, smiles, unending smiles. Ruth Stivers-Looking Him up. lf' V Lucile Swanson-She has little to say. My Dorothy Tobnick-She wishes she were home. IX FAVORITE SPORTS OF THE SOPHOMORES Dorothy Ann Bock-VVondering where her dress is. Leatha Christian-Doing something for someone. Violet Blanchard--Asking questions. Vivienne Brouillet-Discovering the next joke. Elsie Changnon-Out-talking them all-both great and small. Maud Collins-Getting letters. Mary Dale-Laughing. Margaret Daum-Going to Iowa City. Thelma Ebert-Slumbering. ' Marie Lundgren-Keeping High School Study Hall. Elizabeth Lydick-Keeping track of Shorty. Florence O'Neal-Giving Readings. Marguerite Quinn-Going to the Station Store. y Florence Roane-Being an Angel of Mercy. Luella Shinleber-Being conscientious. Leita Smith-VVaiting for the daily call. i Bertha Sprague-Getting thrills out of music. Velma Stevenson-Making posters. Leona Sutman-Hats and more hats. Betty Swanson-WVondering if everything is all right. Louise VValdron-Traveling to Ohenoa. i Edna W'ilson-Receiving Specials. l Lela Winegarner-Studying. Marguerite Young-Tuning in on Brookfield, Illinois. The Juniors-We wonder I Gwen Clifford-At her composure. Maude Danforth-VVhat her golf score is. Violet Hurst-VVhether she beat her brother. y Sadie Meehan-How one small head could carry all she knew. Daisylind Scott-VVhy her tongue ran on. l Elizabeth Scott-At her brilliancy. . Gertrude VVells-The embodiment of perpetual motion. l p The Seniors-Who are they? i Anna Plato- It's bedtime, Alvinaf' Hattie Lundgren-t'I've been taking a walkf' Zeta Merris- Life is such a hurry. Eunice Olinger- I've just got to see a show tonight. Cornelia Smith-f'Well, I don 't want to teach, I want to be a dietitian. x.,y Last, but not Least 7 F Mrs. Pett-She cares for us all. y Miss Flagg-She guides our destinies. p l An 126 if-Of, D a Y H -vt A ' Axgvff Y-A -V A if, 31 ,. 7 Q 93' -Mm... . ,. . ffuyi -v---.-.-me-y..... ,...,.,.... E22Q2Q3EgE13rE32Q1E1EfE122315155555255525E55gE2225i3Q5Q3EgEgEQE2.,,,, ,.,, I ,- .-.. 531' gfgzgigiiifl5522225322E255555252525325sgsiigifiiiiiiigigigigifisiiiiiig.3 .,.. gi515532555225225Q25E2255352225255525E22EESEEQEQEQEEEQQQEQQEQEQE I gseaigif 23125133:rfiff225525255222aiiiiiiiiiiisisiiiie''QQSQEQQEQQQ 522521534-225 225525222111 M531-'5122Af 4, Qagigiaiaiziaiagigigi IE252325si5535232225agigigisisisizisgf .gisisizisieiigigiff .1'-',1ggsEgg', :gzglglf''21,..''1if2giQ225252Q53EQE55gi2ieQ2525E3ig25i25a5eQsgEQ:g:g11 .3.-I-1-3-3-3.1.3.-I-Z-:-3-1.5:mh:4-5-3.5.35.-1-3-5.3.-.-I-:-'-g,gif.-:-:-g-g.g.g.g.- .-.- t-I-1-1-3 --.-.' 1-2-:-1-5.-.-,-Z 2522252222355 .2522 1523E22525523Q55235222523E52353E32232552Q525252522223Q32535gg?522iiiiziagaggigigiisgaii32522225531 ififEffffifQ22if2252225Eff2222222Eiififffgfffig, 'r2QE23Q3Q5Q5i53Q222Q555 5353255525555 1:Elia?51.13523:E32 '2z2i1ifi25siz5zi I'Z iii552522254225312222522sis5225522522fieisiiiiiififisie'5222522252222222252525252 .2f2f2:35ii2ieisa2? 15:QEQEQEQEEEQQQQQ1',:5E2E22Q5Q5Q '1112355555252223232iii522Q52523E332525Q22253235522E25Q525232553E22Q2E22355ErkE5Eg5Q5Q5Q5EgE5..5, QQQQQEQEQEEEQZ, A,A, EQEQEQEQQEQE Z5222225255523E232325Q5E5EgE52QiQ5Q3Q5E5EE Q2iEQ2Q5E3E3Eg525Q 222522222222 512:55 ifEsisieisiegaggiggia5sgsgg2g2g ,,,A gv ,D kj 2532asg252525sie2ag?'2geiz5z5z2gsg2gsgf 2siQ252525Q,5252325252525225222gegfisgaisizigazeaiiia s2s2zEa252i25aiz2s:22222255222 rE1Er2:5:2j2'1rfr115E2E5E:.2222555555252553Er52215:2:3:3132213:5?2?5?3E3:g:fg:1:5?5:5:5:gE:E:5:55E 'Sg2i555Ef11i2553 '5E3E5EgEQ5E2E5E3 E25ifEif232Sf5252fifSEQfQfQEEE325QfffQfQEEEEffEE2Eff3 l23EfEfffEf2f2ff5fE5 23252-5 5555325225255 2522322225252 525 I -3.g.g13:5:-:-Q.g2gZ1:3:-1-gZ12g1-'gm Iffxifkgtgkzgzzgfsigzg-71'123,gig::::1QgIg1g:3:3:f:Q:QgIg'g1g:f:Q1QgZgZ5 12323332g:3:1:-,fgQgE5:3:i '.- I 321213311131pfiflgtglziiifgggg3235.55 5is2z5g2gsizi. 11,f32i22s2s2a2gEg2gs5'.25252z2g2g2isia .15:5152gig5525z2zi52g5g2g2g5ga25.,.,., E2fQf5iEf5Ef EEEEZEQEQ., gggaisis52225255-1giQif522z21212g1e5z3s523f2?Xv,g,1faiiiwiifesirs?5agg 25eg:,522222525225.z2E2ieisi2Qs5a2i2 5fffiiiiiiQ2523Q5f':EfEQEQE5E5i5QEQEQE hfifiiiEQ25E5QE232EQEQEQE51QQEQEQEQEQEEEEE Er2:2:1:2?E12?1:1:2E2S2E:E:2:1:1:1Er' :2:I:122E2E1f5:1:1:2E1Er1r1:f'1 f f:2E1E2E1215:1:2- :rE1ErE:1:f:152E1 ..,,,A 53222: I'I'ff53ifEf45f3i555i5:5f555 ffif-Zsiiiaiiiiiiiiiiiegsgsf ff22f1iiiiEe5 ..4,,.A. .. fi? 22225ii5222if522iii5i252i2i2i2iii25i2i2E2i 25252225252525252222253225 2i2i222i5i?55iifif. 1:E22222322iii222E252i2iiii55i52i2i2i2i2iiiL ..,., ..,, Q .,.-. .v......,.,., L,Wi,w-Wgyftftii W fW'Xw---'-'f.L,-NR, ,,.,. 4 -'ii-55535322111111151:3E1EfE?E?2:E:f:1:5113F111111211f?f55?5?5E5EiE5'..2:5.f-5ZZ1:21253:3:55E323EizE3:11:1: 21fi3212325525232525335523253353E5253232525255353235EzE5Eg21252i5E52a252g Egiffgfifffgf 2225E5E52 5525522323552g142i223i225E3EgEi2E552E 5?g?r?3EE?2EE2E2ff2i5E5E5E593Eefef:1E:. 1.1.,.2E32252325E521E5E33555E25aEfi:215:3:z3:5:1: 52525255352523552i3i5i22Q55E5E555255E3E5255211111 5222552iiizieiiiiiiii252223232555253252252555igigieizieizasgegag1:Q52gi45121afei?525255iiiiiifigigiiiiisiiiifi Qiiiiiiiiiisigififis?15235222515235525E5121222555i3i5E2i2iii5iii23i2i2i2 5225523E2Eaiiiiiiiiiiiifiiiiii5Ef2f222i52i5iii2i2i2' ' -'-'1'If-2-I-2-115:1:I:lar:Ig:E22:I:S:Isgrg:E:2:I:2:211g:g:2:2:1: r12g1g:5:2:f:1g1g::: ici: 2g1g:g:2:2:2:2g .q11:1:1:2:xrgig:1:2:2:1:11231::izfzl:infgig:g:i:2:1-212g:g:g:1:2:1 512212: 2 :-zI1112g1515:2:I2If11:-15:Ip2:1g:g:g:5:2:1:2:1g1f '-'-'1:1:2:1:a2f2Z:3?:1:1:1:2222:f:1:2:f1111213:15:T:f1fgrEqf2S4:1:1g:i2R1:2:lf-i1:1:zAr115:2:1:2512ni 53E5E5ffifEEQE5E3Ek .5225 2222325252223125532525252522222252525252552552252522222252eE5ii2E2i222a2s2a5i2is iaEz2sSz1.,,. gm.125iiiaizia2:i2Q2i5izisi?ieLiE255225232225 151if22225252325352522525252222252252''4Q''iii25222223532if5222252522523233552isi55z55?5?:eE2e2s2 ''E522525255252225:iii555222Sifiiiiiiiiiififieiiiiie2i2i222iE3iiS2iei2?.Q iiiiiiiiiiiiififie iii2g:11ii1212i2E2E2222222' 355222232i2ii5iii2i2E2i2iiii2Ei EiiiiF15525225222525iii522522522225522225222ffiiiiieizifisiiiiiii .,... ., '2ia525s3i5E2E2E2i252iz5iiiii2i22ei2ii5i2i252i2E2' 252522221 2z2iEi2E2ieEi2?22f 1:EEQQEZEEEEESEQEEEEEEZESE 52522252525352225Qi'E12?2EEg2xgagagaQa2? 1225255355 5252Q25ai?5i2i2i2ief121,E15Esi221. 2553222225222525522.12225s23i2EEiQ2Qeiz3i5E2E2i .,,gQ5iii252is2,.,., ' ' A A ' EQESEEQEQEQEQEQEQQEQQ1 25555: 'QEQEEEQQEE525:21I1,:,1g1:525E5E5E25i2i3EzE5E5Ei1i1Ef5 552:gf1511.25521Ef211'iij.2:::3E5E1 F' .1155522222535523555225:232525162Z5:2532525552552gm,212255E5E3E55iEQ2552525E5E3 , Q , 1:111:1E22Q225?5E325215113Ezkfgg:525252222525232525525aSzE5ig2g2g2g2Q1ff1E ' ' '52325235ga5sis552523E52g5:2:Q15:5ig:gffi125:5:z1g1g2:32221ffT', .V,1g:E:EZEE5EfE5E535255E355?EiffEifiE52325535E5ffl?5E55525E32ff555E5Ef2EEE5f55E3E5E5EfE5E' ..,.4, 1 ffiiiiifififieiiefieiefziiiii' 'Zi'I225ii2ii2iiEE?25iii5iiiE5iEii5iiiii5EQiEafaezafsgsgagiiiiiiiiiiii5552255525555525225522iiaigigigiiiiiigi5255525255255525igigiiiigigigigii5255555255gig52E225eggegaQasQaffgggg?glglgagfgigiisiaiiigigi55 ' ' ' AL f Maxfli'if1IEIBESEEEQQQQQQEQEQQQQ555255522222255352222255525222523232252QEQEEEQQEQEQE5252E2225225252523222552is222E222iii222Ss2aiE2i5522z2aEz2z2EEE2Eiifiif '-'-'2l11l135iii2Eg5gi:2:3E2E5E5f'1'1'1'51irfr32Trf51523QEgi:E55232E355EgEgEg2EE5QEQE2EgEg5g15531if ' Z,:i:31Z-Ig:1:QJ 127 x 1759835 E NN w J 1? if ' ' A ,x- - ,QD A A A A .lg l i r 4 4 il f -rr L s A' i EWQJNNDQQK. me f7?-WX W YQ Z at Q53 Upg 4551! Rl: i ff F i 15 YQ A A li :fi l l I X . l l I l . l l l . The Barsitp Qllluh 5 1925-1926 l l Fall Term T17inter Term Spring Term Presvldcfnt . ..... .... C 71.AUnE GRIFFITHS HARRY ADAMS J. DERSMOND LoGsDoN Vice-President .... .... F RED GRAFF FRED STILES TOM TRAUGHBER l Secretary ..... .... C lLAIRE MCCR.EIGIIT RALPH WEAVER Pmzcv SCOTT y Trans-zmr . . . .... RALPH AKERS CIIAS. N. GLOVER Q l The Varsity Club has for its motto, A Bigger and Better I. S. N. U. It is the sole ur ose of the club to further its activities in order that it ma f I p P nan- 0 3 make this motto a reahty. At the meetings, the men consider matters of im- A portance to the club and to the school, making possible worthwhile discus- y sions concerning student problems. l The school ear of I 2 -1 26 was correctl started b a rousing Stag . . Y . . 9 Y . V U 6 i Party, preliminary to the invitation for membership to the new men. After l many days of watchful waiting, the eve of the initiation arrived. Owing to the large number of candidates, the time allowed to each prospective member l was short. Thanks, that it was said the new members. From the way the goat was groomed, the initiates were led to believe that the students in chem- i 4 istry, in Physics and. in Manual Training were trying to outdistance each A X-fl other in cleverness and in ingenuity. k, After the initiation the new members were introduced to another phase W 6 of the social side of the organization. Doc Linkins, our faithful sponsor, g fs l ,fly gl Zn 129 ol ri ZZ is G a --re A 'A' xrfrfjf-'gin or X D f s -or ri? f ve A --A TS WQGX Mfiwyekw .Ev ' I PA ADABIS GKIFFITHS LOGSDON spoke to the men on the History of the Club. Mr. Rolley discussed The Advantages of the Varsity Club. Mr. Parker Holmes without an assigned subject, reminisced concerning the personal value of such an organization. Then eats were served, after which Ewart Sneath entertained the men with his musical saw. The new men are now working faithfully in the club, striving for that Bigger and Better I. S. N. U. At Homecoming time the Varsity Club greatly enjoyed being host to the homecomers. The glad hand was extended to former men of the school. In the Annual Hobo Parade sponsored by the Agriculture Club, the Varsity Club contributed The Burying of Charleston, winning first place in the parade. The Alumni spent the Homecoming evening with the Varsity Club around the banquet table telling stories and listening to the harmonies from the Go- forth Black and Gold orchestra. VVith President Felmley as chief story teller the time came all too soon to close this function, the last of the Varsity Club Homecoming celebration for the year. The annual Founders' Day banquet was held at Maplewood Country Club. At this time the men were host to the football and basketball men who have represented the school in inter-collegiate sports and also the men who represented the school in literary contest. Everyone had a royal feast, and every one enjoyed the address given by C. W. Whitten. The speaker of the evening engendered loyalty rampant, and all radiated the one ideal, A Bigger and Better I. S. N. U. The men of the Club feel grateful for all those influences which made it X-A possible to carry through their program this year. They hope that they may N be of greater service to the University in the future. fd' I l QQ 4 jfxl 130 4 531 'Q 231 f77f3f39C .SQ W is Q9 l ldv' ik, K XXX! 1: , lk 'i 1 4l l Q91 l 9 women 5 ZBehate Ctlluh The VVomen's Debate Club was organized during the spring term of l 1925. At the close of the term the officers for the fall term were elected, but due to the fact that three of these young women accepted positions later, a new corps of officers had to be elected. The oflicers for the year were: Fall Winter Spring President. ..... .... G RACE Cox NYELMA M. HORN GRACE WILLIAMS Vice-Pmsidmzt . .. .... MARY SCIIIMMEL GRACE VVILLIAMS BERTHA THILL IS'ecrftm'y . .... VELMA HORN GRACE Cox - RUTH HENLINE T'l'6flS7l'I'6 l' . ................... ANNIE ADAMS NIARIAN DEAN HELEN KERR l In the intercollegiate debating Held I. S. N. U. has been represented by I6 young women who have debated on three of the most vital questions of , the day-the marriage and divorce question, the liquor question, and the child-labor question. The young women representing our Teacher's College l were: Marian Dean, Marie Getz, Frieda Gipson, Ruth Henline, Bertha Hill, Helen Kerr, Anne Maloney, Merietta Moulton, Mrs. Mary Schimmel, Grace VVilliams, Grace Cox, Orvetta Myers, Mildred Scholz and Theresa Quinn. xii The success of the year's work is due to the unfailing inspiration of our R59 I 'V leaders, our sponsor, Miss L. L. Stephens and our coaches, Mr. I. D. Tau- ' beneck and Mr. T. J. Lancaster. We owe what we are to them. Q, I , iq, A 131 X fb 4' D g 1 ig f 377 rs JR. A91 llc fs is Y f7?D89f 9 l Qi bi L L xii il li lx i l Q Q11 l gi QQ lfx ibbplz-final Qlfhufatiun Cllluh Prcs17a'c1zf . ......................... DELL CARRITHERS Vicc-Prcsiflczzf . .................... LEOTA BAUMAN Vidcifc Reporter ............. .... L oU1sE CONWAY Sc'cwta1'y-Twalsulfcz' . .......... .... G ENEVA REINEKE Stildczzt Cozntzcil RCf77'CSC'lZfCI-1'ii'C ........ ALICE BONAR Faczzlfy Adifisor .................... NIISS ANDERSEN Juniors Alice Bonar Zeola Dixon Sofvlzomores Dell Carrithers Elizabeth Kohley Thelma Allen Leota Bauman Dorothy Stuckey Lucille Northland Crystal Puckett Hazel Lyons Irene Kauff Vera Holdridge l Edna Drom Evangeline Custer Nettie Crabb Leah Kneedler l Fanny Reinhart Faye lVagner F7'L'SIl7llC7l Edith Miller Geneva Reineke y Louise Conway Athea Mitchell Grace Watts Alma Haws l Inez Roberts Elizabeth Knapp Louise Robison Vlfinifred Bally A May Fagan Alice Ashford Roma Shoemaker Esther French will Lois Heagler Annice Gaugh y if l l, f l i Q 132 l 14-Q I Sig is A i JG 'S Q75 is fwwf i P Q ffl, Q EQ Ii,-4 4, i r i p r? y g . X91 Stuhent fiuuncil Presidelzz' . . . . . . . .... K. C. ZEHREN, ROY MCCOLLOM Vice-President . .... . . .FRED HUSTED Secretary-Treaszzz'cr . . . . . .ELIZABETH SCOTT The Student Council was organized by Mr. Henry Underbrink in the spring of 1920 in response to a need for some intelligent body to have charge of the arrangement of social affairs in the school calendar. During its seven years of existence, its duties have broadened until today it is the most in- fluential organization on the campus thru the effects upon student public opinion. This year it considered and achieved noted results upon matters of athletics, student conduct, philanthropic drives, general assembly programs, school elections and other matters of general student interest. The future holds a bright prospect for an increasing activity and a widening influence upon the student body. Qi l Z N, lx QQ 133 ' 'Yf'NRfTf '7'- rA Y' ' 1 A Q F22 is wi 177296395 af We H Z Q 1 i I 5 H u u k I I 1 x T? f , iw u H , I , n ,, S g S53 fNII L w T v l f r :es :ee in ' i,j1Trf'f7f' A . W 177 9595 N .l4-g.r-L!A, 2,352 V' fl 3 . KF it .I 1, 1 . fi . My ' Of fe I 25-Bi if-Qi I i l l . l l Ulbeta Qlpba 15131 l i l Illinois Delta Chapter, the sixty-first chapter of Theta Alpha Phi, na- z i tional honorary dramatic fraternity, was installed on the Illinois State Normal Universit cam us on Airil Io, I 26. Membershib in Theta Albha Phi is y I IJ I n n ll- 1 n l awarded for high excellence in dramatic work, a national standard of achieve- , . . . . . , . . I 4 ment being met. Illinois Beta chapter of the Illinois Wesleyan University I ll conducted the installation services in the presence of Professor C. L. Menser of Knox College, Galesburg, the national president of Theta Alpha Phi. The I Illinois Delta chapter expects to foster the development of dramatics on the campus and among the alumni. The following list of members constitutes the charter group. An additional list will be elected and initiated in early June, i including those students who complete eligibility in the class plays. ACTIVE MEMBERS Q Goldie B. Baker James Glasgow Harold E. Ross 5 Harry E. Fry Mildred Hixon Elias IV. Rolley Bertha A. Gilman John M. Pettitt Laura Louise Stephens I 3 I U ' ALUMNI MEMBERS l l l Florence Blackburn Bertha R. Hudelson Charles IV. Perry I Veda H. Bolt Berle L. Jenkins J. Hugo Roman E IN Robert G. Buzzard Elmer T. YVilson James P. Schroeder :IQ Meryl H. Crihfield Bernice Moulic M. Roy Staker Wi Dorothy Erickson Lottie M. Nelson Lynn R. IVatson Dorothy R. Hendricks Frances Oxford as , ,Ai HONORARY MEMBERS t ff' Annette B. Cooper Ralph H. Linkins Ignatius D. Taubencck Vg V, ,B A George M. Palmer Frances A. Rentschler X x lf! 5 ZIIQN 135 i U, I yy wills M51 as -Lg A -I-L+. -e,A,A,L. -D . may 9. if : Bossa? Si ? xx . 77729595 w 1 P 1N.f ' H ' if Q ii 552 as AJ Mgfxfwfgmi 4 'I '1 KJ, x me 17723896 mf' QS 5 I 4 v l N l :gg fel: Z 5 I I , 1 ffxy' 4 ' . 'N 1 25 fffflwf was ci ,Qjl The QBraturicaI Baath The picture of the Oratorical Board was not taken this year because one of the members did not return to school and the other discontinued school during the year. The student members of the Dratorical Board this year were: Mr. C. H. Griffiths, Presidentg Mr. Edwin Nordstrom, Secretary, and Miss Cornelia Smith, Treasurer. The faculty members were: W. A. L. Beyer, Miss Laura Louise Stephens, and I. D. Taubeneck. I The functions of this Board are to encourage, cultivate and manage all of the forensic work of the institution. This includes the various intra-mural contests in declamation, extempore speaking, oratory, and debating. Thirty- five students were interested and trained in this work during the year. The various intercollegiate contests with other schools in the various leagues of which our Teachers College is a member were also planned and provided for. ln addition to the regular work of the school which was somewhat ex- panded this year, several special holiday programs were planned for various general assembly occasions. Student participation in general assembly exer- cises was encouraged and provided for throughout the year. The Public Speaking and Dramatic Departments cooperating with this Board sent differ- ent students on different occasions to participate in community programs in surrounding communities. Likewise several communities were provided with literary and music judges from among the advanced students of these de- partments. The Dratorical Board is especially appreciative of the efficient assistance and encouragement rendered by Professors T. Lancaster and C. A. Harper together with the ever willing encouragement and cooperation of President Felmley. :ff . Qi ED fl A fx: 138 as . .. sw .5 'xx 'fi ' ,-----N' 3- I ET F5 - I V 177295395 ,gf A IMI IA ,fx .I I ,II I I I I I I I I I I I I III , ,II II pI, I I I I I I I ll II ,I III LI , I - I III III I I I I II I I I I II II II II I I, III :II III III III III -III N 1 I I, ,, I V fGI I Q If I XT? IQ, 13 9 TQIII I I X If I3 Z, Q D Ig I I FJ Iif 1759595 QQ QI III , , If I , I I 40 W 'Sf I If-TI I I I I I I I I I I I I , I I . I , I 2:3 l I I9 ITN 140 VI SLR I, A digg? ESLN 6 9191 'I I I IFE' I IN ,gi X i J Q - M 0 ,M QQQV6' QR 1 17? ZDQX Q W. SV Raja il M 1 I if A W 1i1me,i! ii'iQJ SLS 17729596 r - 4 I 1 l I x..4 i it 1-ik! Q1 l K d K 1 142 S 'CW hw 17221024 aim L5 rw' V N 143 'Sm D J A 4 Ci QQ T I, 1 w fwex gf W Q M S gy 's .lf-EETSYMSAE Q W 17323836 ffm Z 3 + + 55 LF' M ,gg , N ' 145 gf? 125 f Q vfQ. f - A M 7 ' Q L J 723896 wg M Q ,Q ,f ' v M , 3 f --f V ff, n 72 Q4 P s ua Q55 RQ 2,4 A: fwfsx QR HS P .- N 1 V r 1 4 Af, Y , D Q 'ki l Q Q 17221024 22 ju 19 U S e a E A .4 P W A 148 Ei SQL , Ai Q fQ W ww- .. - S- 4 -. 1 .,s.ff- --.M ff --mf. f-. - -- .- Q- -P., -mf. . -.-M .. .. -- -mqfmws-1+---L-iff.--ew:-. am.,-eg-fm,-:,.-.,f,Q..f..-,,-.M.-.W,:.-H-Sf.-,bfffn,--,f,e,,.,.LS-,Q-,QW-E-4,mC--mv,g.-WNW--. -f .. fa-. P-, - M... . -...Z H. -Cwsngw-.nkwn-'4gw.f J... . .. .gan-q.9..--16415011-uf.-ns..,v-am W- Q .:uM-n1pm:Q-Q-Maz- --,N-.H+-,W-.-if.Lp,.-...LH w.55:e.vf--Sf-zp......,,.x,.-E.wg----.-anf.:,,-,:..1MS.fNfnewf -,J.y.,..J., ...gg -, ., . - i rage -W . apr- -WFS 4- un-lr - ff-A--f,-as--ye..,.w-mfLfwdf-wff2wfq5:gf- JH- - -.Q - ' --z ' wg- M vw:-Q-1-iHfwF,' P- H- . -f. -. -HMS. , .- mum F- -nflfsdzw---55. -Ez':m,.4,-.--Fq.- --feaP- 5 .pwwve-eff-I 1- -. 1-- as - . S- ..-:him F- jp- 1335- 554 -sffqvs gbiilwqzz'-:-ni.-1 . y -an -Q-fk1-.-s.-,i-4gT-'-i-d- aura -Q P-bil.-.mel-rmasgyf'-Emi.-sY-nnssp:-fpfalwz1.-- New-nffgivlwuvfvziswdfzgfi---fsqfsa:-5'ws:'Sign'-af-54-fwyspsfn--af-12252 S,.gfp77-:w,,f'Lfm-,muf.1-,.-'.ssfQ,fq4.-- -'4psi.f.,pf,,,L,5 1 - sin ws- f - - ws if - :iw-. -5 P-P-,-Q -. .. a .,-,9,-Saudia, .Tl .. .kb-5,ng,6,v,b, .,..s.A.-.wFwz5:4is'MpHe.5-MJ-F,1ggq.1g.us,.u.f,5q,,,g,fqsmv-QHimsa,1 .,,r.f.,wf,J- ,Q-fi-e.f..v,sZ2.gr:M2:p2.i - : ' .Q-bniyg.-N - mag, .,,,5,qL -Dfw: -.5-.,Q,f...-gf5.,Zi-.uagp.a94iw.5'5.f,:5e1-,i4f,..Jgff..,Q'gqE,w4,5Z5p.,-f-1- -fn-Ugg.-1 lump.-Eggs.-w.--,il-.2 -.5 .2 -.1 C- .- f.,N1g,,.-iy.-,--4., -, .P -E .-5114,-kumar-:-Q.-Uv.-u:.vaw-Egg-Uuqggpfgmgezrgfiwgiiffgzsiy,- w. -Q -iim.-HMS.,-apagzwr--.H53Za5.z.g.4Q1-,WKwpzmwgsmgW--f-ww-wdz ,f.,-.wmqvfa -v.?.Q!P1.z M- . 1. -1-sdwv -sv hs' ,fmbrrww wzrzaa-we s... - .- Amr.. M- -----f-s---mf.-.awww-.Q cffsvfr. 5. ww- -2- .- .. p1..s-.w2mm..,M:..... ..-cyan.-samw-wwf . -q.. .Jr -,..1,.,.5.,vg., -..-H 4..m,,g,,,,.,Ufbmm5QwfZLrN-,.:,-,Q 51,55-,4w1qg,.Qh-Lf...-,.,fn.e,--mzewgck.-Q-.,f,,L.p5qQ,Q.,,,, -.,.,,,.-F,-L -gf-f:ga.F.g,z,. -S5355 digs. ,s. ., - - - .,,E P-5.fg,,g,,L,:- -- -5n5efw:s1v:fSwP'f'f-- ---- if '-Q fH5:5L-5.-:,:fQ:n:frH'rP n- .-..-gS,g- - -- -QfsvQf:fsfas:fwS1f..1-,--Gcf.waufh-1f-,,-:of:m1fL:zf..u,,ffaf-Q:-,ysalu,r. -:Muff-glimvcm -Q,-.Ufnf ----w .- -- 4- - . 1- .,f, -S4-cfsasl-,wrpf-swf. .ggpae ,awhzwf--.4.-,:w,:.:s4-. ra isis-.-Sfgbwffqrwg-vggf:fp,.gw:4nw.:,. -1 - -Jfwvifrfwch -H..-1:-::,f.,f:5ff-f-f-fL74F izvdwuese.-. Fw? ay.-,511 -J-was-4 : .: . 14212. :- f- '-'fF- -L : 'Q' --PPD : if.- T'-Q h'i1:s:.a'.1zv.'f:1'h--'-:.,2si --i5'jA5'ff:F:PyfSSf-'fbih -ffldmiwrk su5fs.:f.sc,.ffs'sl'm?41 ln. - f--.SQ 6149..affcsas-,mfiksl-iz-mg?M.-sw-,2?wsm:zz,...Q -f:fQa5'3Zri- effm.f.ef:23g--:pswmw5:,nm..'af-.wJg,s,,..+5gfz4:.Sm:pmqffwgaazii-,f-.-T-IW-Q.f4.1:..,.,.f-,,-af-.---5-..-021.--dz-.semi-m-f,-Q-ww-.f,.-,.,. 'Lf ,gmsgsgj-yfn. w4ii,,,f4W,,,-w,?,fmfs:5...n.Ek,., w ,vgmlrggb U- f -asm'-.win-wQ..15.75m.,,cq1wfH PaisxiemasR?e.wsmnE-HJR..-Q?i?-525ssfw.Nwf-mywean-sumwnfwgp.-1 1M7211fiPSsf-w-:g.:g.w1f,,g5ff2 ,w:-sc-M.-us:wif . - ...wa - sfaswr- JFf'1wfsq?Z'v3.-iw:wwf--effffr.mahPSms:.- S:Eci:5nsfs:.'nrfvS- -.,a1mf65f-sufasmw av-S'4Fi:.fS'fNf9SfFMP -?1HR'L1sJw-swQrfnfrzf15-'t's:rsws,L.:-s5f1:Q? 'QGSLE-ww-wrff.' 1 mem- His. f'-eE.p5.p. 1wpspsw-pshrm:1.qF--TH-sqsfswsgsgypsy -TS -ezfimgff-1,3-Lgszgfs.-US-A3an:e4 :,iQ45:.FxQpwfsmmvfzgsiif-ffwwamw-Pnf1e:'..z.,gA:f.sf,m.w4f.,win .MLQe-w-fc-frf--1,:Lui-waswreff-f-'mfs--.-,Juli-w,-.f-ef--w -ff-'-Hia -- Si-qg--n ml- .-,rnfflsswqgiyim-. Q7,,...,wy-pP'sv,1.i-- --Elmffqmwf-fs--.q. --, wish. mam- --,q,.1iwi,f1wami:.ww:.-f.J-wma-H-af-0.-fr..-Q w.a.:nfm-mann-ffumm--.f-mww-:s4-f1--w:1.sf-fm.-ML--ff-Nm, b.,,L--.w-f-gLwws,:- -,z.:,L..L.-Hup-ff--.fn-rv-Q f'r4'-bfsfw wg? F fda: - . -.-. -425--Ms. :fyiekffvvwmzzsmip ff-ga:-is - Nfisg ---.gm:E:.w2-sfsfw-gvM'e:m,fsfLs15U-,gnsfmmzmgw-.:.'H-12-+7-112-1FH:w 1fri-:'--iee1:s-:ff-Q4-lfvaf-zfw,f,fav..Q.,-me sf- -5.fffSfH-022:21 ff ,w5gyb,g,:. -:,,.z5.g5Lfi a7:p.g.1 , ,-nf-,--awww.mf:E,gfpiLfmL,.. -, 5079-my-. -Qzvsrsbfm.-:su -.ZvQmsews:wP1Hvf-wgf-if-rysng,.7f.v www-'3--Lzgscabg-M:fpp.w-ff'-,-ii,-W-?f'pg?ff5wc:f5wv:25eLslfp.-1-,Eff 'Hpapa-fgzww-4en:-:farm-v21Li fsmmypfesp -argues.. .,.1,p,,t. .Ti,.Sf.g,.,., MM.. 7f?f9J.,l,-.5-Q..,.,,..,a,,,,,-eww..f.m,Q3Qg,g,,.,Jriwswgv- ---iqmqsiggbnylc.q.:51iQ5.fu,Ep..f-,pnp:,,1.1gm-za.--5nPww:g-.-..-119wJ-,ryyfslglwff-HLfm1FSxaa,L4w--gf.wi..-,.--fv::i:5Qg.-,.-.,f,,.-1:11-mf- .ZwghQ.+Qf--wf-:--v:-.:f.aw,.1:ga,-..sfL-h'---- ,- fwfr ws. sw- -fm-:qu Jfscswqsgf- -if -952511-ynsnfp-fss'rez17: JQtZl.f-va:-afnfnwi-'fta.4::5l11nusa,mm-Q -cqbqfget-Qgza. wsqw-f1.-aL1hfn:nf,1.-.,5Q74w5-- '-J.,-:bQNLa,..1,,qL....ff.7.-. f-pz,r4.:,,,,1.P-.1..wqf1. fgasqfm0.Lg,,-,U54155-f,w+u. .1,1.L.,.-.,-,f,fCw:.-r, .-. .Q-Q..-,y...M,.,p-.F-,,f,f-lyk, . .-Hwwzfsm? ---ww? ..WF.n..iQ 9.2W-aszpysqfa-.egfqazpgw-,g.-W.-5.-Hmfy+f5mzfQ.fQ--..9s-,pmMW41+zs.gz2-kwinu:f,f-gf-a..s-..-Sf..--:-1-by-,aff-nf .H,'s4.,iE-Mp.-.--.ppt--f.,Qm,M,. :-ug,- sa., . . -. . f1fe',2q'5u.-esflmiylvg-.gypsy-g1.,r:g5g Gaiam31:gfFarwHqss4zfgf.,,7,,,,p.g,-fspgg.-IQ..fm m5e5.g,15TA',.g,ff,,p5:::11iv5s5f3:L'iy. saswe-5:F5,'y--55.2.55UQa154-1qrwSfr-:1Fs!f5!1:..':Z,iscisirs'G'r:'-HH!- uf-Q Rfk?-'sscA-Mm'-'HHJFHQER3:11,-f:wn1.v:fif1U::'Hf'H e5??fi2wSf-:Sf-ps.f1.-L1-n-:wiiffl-iffffi.-ii: -kfiiigjfffk-f..s:vm.i3if. ,,5?Q5qw..f.vui,u 1Z5QSgQg?f,5QM,q,.g.,,..:5np,4.Emm5.,.,....L,Fn,...5 ..g1Q,ig5.Nm5-.,g,..W.,fnqi.b,i,3u,a5Tif,q,-qi,gg1w..5..g,,,,f..fs..,g.n,,,h:-beg .Ln-wwf.. bww. .f.,1:,.--11-3:54.-f.,,mwfaf-5.-, ww- -wf-,,zn.g.m-b-wnf-:-- fm-Taken... ,.--,wa .,,n..,. f- , 3 F.. . ,E,,:.-2,-ws.F..:yqf,.,,5,5 -.- --we F: '::w...'-S: -ff---S--,ff -.-ff.-fnsbfvs-,Q -+-54-rw-.2 .was-.fDus.ga5-L::.Qa:f4H1-,----a:-.--dL5gaQsw-y:f.yfs-Fmmir,-,Gam,..fJw-NBC-::4v!'5!-v'-Lmfsyskfffanswfvnw':2-:wP-:'-fF-:lf'fL'-' 1--wnwglmivwf - Qfffmnniffs. ffQwwwmgifefsrkfspskvwwfbzzeaefiwa-ad QnLHZ5fQ5I'7?5Simw.35gsg.Z1-Q55-qw.A-rg,-9395,-i7Zbi5f,-,fL,-, wp.-mzmnai-Q-tv?1.u.Gp.ig.m PW.,-w. -,.-..+-.-:1f-s,5,pm55EM.,- ,W,,pg,,,,1,5sm-1-k-M..,,. -U.-,5,..,gi,-,J-W ,,g,5z.g.y,,5,1Mp..1qfQyJnfu...,,,ff,m.y,7-ww :HHH--N -- wg -iq-ES..-as fam, :w.g,.,,.,-ah-4 g,f,.5:,:s.rq1,I', -.-fqmiQif,.g.fg.4:r.qw- PM-.,L,a,Q.N, QfW:,f,f-:r-vga1q-,i,'fef-.g-,- r7,n5n-puff ,n,:269nLpf.-QQ-.U mrs:-am-,L fqg-.,s..z,..p. Q? qv- -a:,v'z- Mc -m.sq.....-...C-mfr.-.F-,...lyme-,-k..-,cnL.,,q. Hz,4,.Mokfswia-ar.-SEQ.-wp,,,,gFS,apfr H-Q. -5zm:,M,s. .4 my- 1,355 -.m,,..W..i-r-vef'-?3- --...wuz-.,wp--3--ff,,M,.z.,-na viireipgflvffhm,--,Jg,....W .5vwgismw--,-Qefafcs-S.,-.,f-l----Lff- -ms.. - !w.g.:wsqgg:K-fw,5a5g1f-.5-5-- 11474-W. . -mwrv-.-7arf-w455,q,f+9f.QL-2,9523-:ara-flsfawfa M-iQwvywp4qv'PhmQ.g.TA.1.,fwn-1.vggmzfgigawwHWFEQGE-wagwive-aH,wsffNfn:--si:'1ziv5:51ifQ.,3v.n,.,.,-r.f5w.4f4.a--.--kb-595:-W,w19159.-peg ,Www..V-1-.,fmL5s:m-news,-.,f-w1 --vgffz--v:-fm vwfsr-fzwf'-Q2-.afmin-ff we L T rfgbfead-2 '- 'Umfeqfmi-DQ. -5?-vw-sf..-W4-mme: agvwfsifsif mswpssg-i5:gi:gz754 .was 5-3 ,m:s5gmP,. .1 wlswfui-Mass, --5D--fzzavwsawfxWpf-s-fsfmw-4.-?JQf-ff. asf-w , PP Sf--swf-r1'1a F- -y.,p,,-,.g-.- swgwfw-S13 gf' -1 f54:pv5QF-flfmfss.pswsmh -Q E- ..siLg1qfw54fu --3'fLI'2- --54. 1--wwf-a fJ12-Q7fi1f.- mv. drug.-Lnlr.--flQwf,--lwmv Pf5ffSQ, ' ww- ?.,.51-gym: ELg,,--iwia.-:gtk-S97-1-Q, 31,515-,W-'piys-sfregggaa-5Ls.r+-+wqp.-fret-wrwgzqf-ep?-r -'sw,p.pFS uLf:in: '- '- is-5 --Ss-Hvszf:-HP QL2-.1vfw.+2.''Q!w1fmf:'5md-.'-iesn:w1-nm-:Pd:F4Q.'?y.9:s-svslffffslm-H--da'f.,w5?-cwwnwe f.y,p'.:,Q'-51-2-.-zf-:Perf -:wwf-I - -qw-rf . -uhm---,fizwzaaw-sys.-.--,-.ffm-1-ff,:-mbps--swmf-2-5-5-1-.-wlqgib-.-..--f.-img-::u:..,f..,n1.-W-me-gd E ' 1.-wvfzwhgarffrsasaf-Msn.-as. ..fwiQn-vffpwq-51 -- -emyifufqifshicmagm..-'..:w,y-,vw-1--5... -.1 ..ww-gpiiffwgq---,,1femhfiu, ,lead-nfivgfqfmqmn . -3, ng-11,,Q.4,1,.,.1+-.epwyws-ve:-1-J.,.-bp... wwf.-fr.-U. Qwzifuuizxysfqggeeq-9-Vmzfx..-Q-QLIH4-bv,,r..w3'l-.ig':jQ,,n .wav,--,nam-Q.-mFqQ,fz4,af.m -,,,1-.fn-1,:-5'-L2-p.,:,f.,,. .1.,-iw.-Qrfik .... :.m-.ff-.gf-mneyv1-,1-1.-,,c.,Q.-Mfr-N---:DasQgmi-..-14:-f-:D-.s'MJ-- .QF -...,,,-,wg F Q. 7541?,,g,5,,,.'.r:fwP:5'r:f,1-.f,,iFQL-u,u:..a.n ..., -4--,'Pl7::i-Lrcka-rzailri -1:-ff?-LFGb,, 11'-wr'-dvi!-w'r'J5 iii,---::'.lT. hiv-:L'raF:'1 U'W-if-'1-Jw:-.ff,-.-1-Hifi:-wzfvi 27-1:fLA--w-'-ww: 'vfr- 5395? , 1' ri-ws:--1---Lzqsvfsifsv,vmL.Arg-.L-if-:HaivifLf?5SQiH:1G-fwvfw.amzxv.5:.QQzwn1.ewf,er- 1:iSc 1i-:- -.Ss1'me2a:2i,2r,v:Af-.Qs-11-ss-r-iufmlgiiiQF-JFS-SQQS-f'zw3'113129.-.sfef2-UH'L-:f.'a'z:.ffain-.2-M-fav-: wif Yrfuscgwsnsmpf--. 15' - .f-Q, -Q fly-:mf-vfmgu:.1.mP5hfwfyE5-g-gm,-141 - :.L1.,,,-QLfmqg,.P,.-.fmjJ54,,-,u,QQQ,5Mm.-i,gg1p,..5,Kwg..-FL-f.ger:vL1:JQ:e.- 4.-,J..f--1-f:--rff-fw-':w.J ' -ff gm:-zszizzm. swf-f-:, -dzz.. 3.-iz-fa -1swarf-f'w'v:z,Lv-f,g,.sf:.sf-.- ?mv.z'2gf,ig5fu.f-. me 1-...U . :awe-ff.-'aw fi I5 .. . as-,-53115554-ii-fniesagvivmfQieffmusebiiglfr-s1vFsfgz'hi?Jgslfsqsiwswsfsaff-f'G3s'fq:zl,1v: eff. --revs-f-f 511127127 cv-aff Llhqr- L fmfwfemw -.1 Qs!-avr 'fffh ir -N' -. rw 5-12-- F- Ask P- -igwrsfssfssifm-bzqwiggfspfw-, ws-wi2FTSZfkzi2iv?f-snfs-wh: rvfr41wJa?4Q,+-9aww-fail-:P-1:'5g1E?52scm.w?-n's-1:--9-12-51-alif',.5,:f,p-,Q-wa-21 -QL: we-41. Fw- Mmlf:-1:--spQf.-mm:--,Fxzwws-wqrwfffL14-1-P511-zz--aff-:wiarnsp-vf.::.-J. ,-fn, . F. f:.,,sq:-- ---4 -u .'.-aw . . Q, wp- - bmya5Q?mZwsf.f:,. qw. 414- 'agirfqsmsfyscmm-.,:, .W-.Mfnfwmz--aff-.r,.-.,.3J2.r:.wQ-as!--akin.:-.541-fl.-np-,ff ffpffwz -1-1 :,:.-,:.,,. -ngmyqsafww.--wq.-.5,..,sqpmN-qf.ff.,,.,, -Q yes. m-1:-bus..-fQ,....w-M155-mm..,,.-.ws-Q?-,f.-yf-M--amz,-1 .M ,, ,. ...,, M., ,.....g.,..,,.eg.,g.m,,,Q3. ..-1- -.L...g,w. ,,. .mm ,, - ...z,.,.4p-Ha-.-.-1,--.,Mu-,.,...f.f.,Fw-as-,--,.-...Emp-1.ww.-eff-1.1 ,W-,.-.- mfg-M-ape r-Lf-amwf.,-mizmwiffar -sz--.5-efwfw. Perma. .--LW gig?---.Q M.,--fwfr-1425,-1-.-., -.. .W 1,5.,.:4z7::,,.v.,uf,,.-fa,.g?,.,n-.E-.,,-.7 fm,-...WPT-, --mpaw. wr-Q.1,uq2snZ-r-f.Q.,mqpsn4gMq..4,.,- , ...N-Q--,I-,,'-.luduf-.,1. Q fyzugigr- J.-f.--..5w1-,bn-pz,.,,f,. --P..-. . -pf.-L. -wmwp. mf.-spew .- .s,z,...w. NU ,W,.,ns5famwse,:1s:,.-qp,,,Fw,?fE. sg qwafgwia. A-pfqsl-.ng-,mfg-fQ,2f:, .qs..n... -arp--1i,s5L,,,,.,,,--sm-winrffas--'-mfw-.nwQ,..?,,-,Hwi-1-H L.,.1Q,,-,.,4v-.9 'FQ?:?S:'isfivsmT-fizr.'Aww-. 1 5:sQ5fs1sgPsusy. 'f'Pm'J9E:.Fs5Qrfsfsgrfs+ Fs'2-b'- 'wwwis-:1:is'.75-sf-1.'ffnP:fwLSFQQSW- sf-ibnlwfgiggfw-ftwkvsf.... J.-.+-f.f.5f-.wPp:-fv:.- qfmssmpwng'-1-fish '-flmysgqsgsasmma 'flaszf--Sn,wgn.nHqse,-.iw -ich? -1-grew.-fr .fn-J-seq4ff9.--.mqaiffsfemr.,,-m..-5es:,g,.,Q.-f:----- -4-:rg-17.-: pgggrf, L Qifgpsowwkwfqqv- vi : 552131 xi IL sf! -wr'-ff r. -.P . a-arm: r QL. -. L. . .-. .. , .. W,.S, .. .71 v, . . ,,c.,.,,f,,,,,. ,. . ., ., W-.Mya-Q.-,.-.. .. -. ...P-.--ww, , '-f'f'-- ' 14.7,-fgqagfszysyzrarggqlffff-J--.-N f: i17f: evyvf- ::zi:H1 iQ5f1Q:suwHaM'm:ff4fs:s-spa :alum-wsgzyzrargiwsws. - - ,- 2-rfyzwsezmrfge.-f::1n .1fzf:m:1z5n.f 14: -9- 3 'PSE'-fii SUSKEZFE1-'1fn5:7L'i1v5'5f5-'7 'gif N555 HF,v55rL:2T5L'b7'-EEK.,uf 'if-,-'vf'f -'VI'-Yv? ?.2', z-wwf-ff. 1 -hlfwrn-Yyfnfrmipqfaiwenelr-4,,ff-,-fi---mffjgfqwm. F----,:m:f,-5.1,-..--.-, -f--L----1:25.--:M , -Q. syn5FmizQ:Sgi:LZ75eFksisfs1srf'ff1F'51 i,'f'si1'.QA-J.-4 aww- 2'f y H rf--Lgsi 4:--U -Q -2- - L - -meow-+v Hbf-4--Sh fu -s:-sas-ws'fgr1:gm72:Q1'H: ,mf 7 .LQ--mf,-f.-1 lfgmgeitziskf-m-f---sfgf-?waH,1- - 3-P - -: '1'r1?19-'-- f.- if-Lesh -Asn. f.L'VifJi2 -, - I ' .' , - -, -. 'kss'slhF-:Jr-.ieff2'--wo'---f' 'J-NI: .q.75n.c1-5 -.sur-90.51552 mn--,ffa-izrawewqpq--. err-.mai.-Ug..pH-w..+Fgmfzmc.,. .ff - ., -Q1-.Q,5.pd.-,ww15,-1-5-Lm, ,, gwwsa?-6345.-dw. : - . - . -f-:qpm-f-1nas:.fJf-L-vmi-.J--,.., W,f:Lsffyfass,,'ff91g5-g,'5igi,LQ-Q.'AL I' mga: q2ff'::z:E- 9 ' - Qrfkaid-f-34.-jf:,.'L?f-?c5.A..CL-I- .Jmmzv-g,M.i:,wigmw,--dpiW.-M139ma w.,4gzg.53jgwqpfmggfgfvwf .. ,,-rf? all v J wsfzzrfzzfef-, w.-Cfvk--samu- -ikfmgigigwsrsfnaigjiv.,Qsw'TimQJwgmv?f,5qih:g7f?bZ,Qf,qQp::rg-nfQ-kb:-,salt-:wr. -' --swf wap...-uf..-,f-112:.wa5dsLQ--51- 1-4 f- --r .ws ....,::fP-.-a:-5 F..,.rs'H' - -QQ.-,Q .' fswag:,fc'1:f---fc-W--,Lim-. Q Q 1,1-:,-A . ,,fNfQpf1-y41v-.fq- --,a.f.-C.,.- .,g515zM..,f1Q.f5E3Jf:prm-Page. Fdlasmw u:Fffz.Qmqfif:'if5Fs+:..f-ff.g- -Qs-ww-ff: --2, , -- --W -1- W- ,-.15-fv-.aff-1-f--.11-, bg,-W -,A-ma .--.f,,sEn:: rwgsqwrlff- figs:-Q-N-ardflsfsfs-:va-Qglf-:greg-:wkffu N., , -ff-wwaaif-n:1, Jw. fifssfffw. .4 mad. :1g,fzgz:qz5,9vI.,:r1f-- -- G2 . r 5,--:S-J: Y- ',, V iw:f1s'- - s-?+m'r'f1F:'1f572 5 'T '.'--'05ff.:r.F-f:-- - -5:5123 5--sfgf-77-Hkbkrkf 4- rs:-9 PHI- pfisiw- ' -320 'K' -:va-5:---, ,f-f:-i,.-:--vr1- T ff- -'rrzaif- .1' 1,--22 A-' -15QEl?-Fiubmdql,f--'v.-NTL?--4,1 - , - . 8 . :.-915,594:QQ-'-mg.-J--: :,3.i-5.-glsfiaswwg .S-g,,,,5,,.p.,-, ,fgmgff ,-'-'5,,,nn.2.w- -1,-u 3. raw!--1. --r-f.,.,,.w-,-Q.:---f. - Y-o1,w1.-. vw- :-.'ff-fs-vf-Q's-Mhfiz-mlb-:JAf.-,--sa,-1---.-,111 ''1?-vi,x'feP5.fe5Qi51k'9n.,9f.H4+i'J2zvms-mapnpqfpfw::na3F,.:a.f.-f-was www - 1,z:ewn3J,m1:!q,,,p. ima- Nx,,f-,pm ,Q-,p.,.--,?i,,, L, -G-Ely.-f-,,..,.w 5 xx ,.,Q.4-- -my-k1515fseQwz,g,,z-,5f,.up,-wwf.--, - :1F5,b?,,. N.-ps -1--W2-,mrsbnlgpgkwuszpf-in.Emu-1-,aA,5Q, - -. -1, asQ,,,g.spm-4w,,P51ik,gj.g.,. :Q---J.,-an f ws-ips firms.-Q11-A-11. - --cv ' fb-m!Fr4,Eifr-5-was-Fwy-:1-fifYi':vsf.h- ..4,.g,,..FgL2.f, .,.--.gm,,-,.,M..F,,,,,.,mN.44w....,,Nf.- rg, . M.-nzqugagfp ww-.f-.-m:...,.U, ,.---,M , M. ,- .,..,-5-..-, 7,9 -1. . . .:1Nufk,M-,-.-.-N--f-5-I -1----f-,QW- I-1-:frenz-L9SnL'5Pf'HE,:e:,?!Fewan, wF2Fmi,95i eeffac,z--fu,-,,.. -kcbsapfmy w.'feEe'vf3...'iipLesesf,:f- fs'a3-w?f-g-r- G L-W-,...-,-1-.rffe-----Hu:-'f.-pf., K 2-'-wQ-n-:f..:-n::svfgrf1S-qgiigfbfmq--,1 ,bpapbfy -5,G-m.'p9fSQe1f5-svqywggvggggmzpfggggwygm-,L -95. V --g.f,.1nu.,5. .d-m,54-f-Qimag,wu.,-,- A....m,.-5:2-21,9 - ,. -. L-:Umm -: '. fiifrfscsmisiiaimuri-1.-.:Q5Q,,,,-.,:,.fL,r Mk ' . ww. -- -5 914256. fPfsfsw:mQ4G.-.rGF'--M31-4-sv' L: :1 f 'Q -,---1.- 2 -1a.:ff'kLfs'-. L11?w alas- A'ffWGQ::-EQp7s-s:-w1Si--sshww' ear'--'i:.iJ.:. ' ,Z . 4 - 'f' M :ini-1r -, --cp.-,:,--X:1.afn:-ss iiwyg-zgfm -s ..?'i5FHf9fsf-'.v.f-f-v11,-qi Q-:trim-gQ.:L.-:---,W :M-' X 21.2-., . ,. p.,.Q-ww -ff:-W if ' EEQEY, -' iav:1 zH.p-- aff- -we VL L2 if-iii-Rx . f?f..F1-'if -',Q2?e:r.-we :wif 'SH r 6 5, 'AT - .?-.'i5SEii7SAi'.--'- 'f elif' 493 - L1ff.x-7-SQCQQISFSZSLEfs'frfS1 - Wi-W5-:LFJA-.if X -1-'Lf . . P 'I .mzfigszw f . 5175----:wwf ' ,--.: a.w3e.vff-- --:i.w'4fm :bffsfmn.:'.' - ' ' sifafrrf--f-af-.1r2v.G-ef2ez.:mf-s'- ,-'-.wa .- ,.., apawsp, .1-y-,--,QNQNQQJL-. .M-:mm vfiqrmni.-Sf: -M-P'--fi-gr .-Q -,ff-ww--1F:s1mf?u--Q4-4. , U4-sa. -, my. e-. LM,--1 4- 1: 5 -'2 .ww-'-f:--. ---Lane-Q-1. .-L---mL.:J.1,--v:- I .'wif-Q'-ffl..---ga:wi-U-ws.-pf-P H-.Ffm,mf.-.1421-wr-n-. .fwqQx-if-EQ., -1-mm:-U -.--.yi:ff--awww:---masses. --.--N,-f-.ww r - - - wwcw-1:----Q.Q-.-X-,.hf--.wfw,-:.,--..! 9. H., z..-Q. n,.,,nMwf-.R-f--,.-Q,nr., ---nwmwfanff -frvrsfa-.-.W ,Mr-m s. -.Lfw M-My 1- Q. --f-N-M-Q, -f--pw -Q. ff ,-.4,, ,ffm--51 -ISS A v ,mf-1-wwf-rw1:,,fu:-Q-..f..-.-H---sn --f 1. ff ,- ,hpgp qg.,,4, ..,Q,w.q...aF-F,w.1... v.. L,,,,,.an ,..1Y.5.,.,. -- ,,,-Jr.. . L..---fm u,..:..g'-7.ff?1:fy'f..f-n--- -4- -w,g,,.-,vw - --if-,,ehH -.f. .-,004 .QM L-ffwigeff-J. ,, ..-..-.,-nw ---,.-. ,- -WJ--:,e5:wmf.,-dw-ff.bfkgf-W:-Zfswffa . ffqsqemg-fs-S-4. ,-.wm'a2mQL.,wf,-rs-as. ,, ...f,1-me Y-, -r.-W-va-hw ' - , . -f .gi-L,g.fA-...mu-FfgigLf-.:,--.-f..,.,,...d,,,5,. , ,-Gifvfdrygffbgfpkpgiwspgif-5-.9l?q5ais,f- -,755-gg:-:z2f?aSS-.1 ,nw-asia r-a. -f.:vf:-vw ' pg: xr, ,.-,M-,J-,H-..-..--44.n.mf,f.ze,fi-,-,.-f.-gif. v J. A, P. -gf. -aw.,-. . . .- ., ,, .fm -. -,lv - 1 -'ws-+ .wand-:. 1-wwf--m:+15-1-L-wwf -11 ,um1.,,.k4p1-gall-EQL4z,g,,Lt.fE:Qi,4gfs-,. .- . guyz-YUM. fqm:-Ja-534- -. U.-Q.-.f.p. fH:p-.W-fm..-MN,:ww-2-.-f a--. 5 -f - , -wr :M - - -v - -fi---ge v.g.-M14-,:--vim--.:f.,: -asc:--9 ,---...:gf,w.4:-, Q,-'-U.,-. ...qf,,, -5.1.5.--,-Q,, -5 ,-,R-.6 .gf .LLwlpfnh,nuJ,g7g--.LW-.fcTb':p.:f.,ww--S..,:- N- ,. ,-H.-y7p1.17 , 0.4. Q.. , ,. . 5--,lgvhz-M5411-Hip.,1..,gn,f2i.L,.-..Q..,.i.,,:,. 'T-1 -:mm-wuz-14, 2 531 : -2 -- -f . -wwf,-wp if, fm-,HD -,,-..11...-,,,nf1,g7.-U:-wmrn . -, nw. .p. f-iygi,, .,.,-N, ., , -,wLf,Qi1Lg-1.-muylfy rq:,1fr--ff-...pu -Sb:-. ,lamp:G5wwgf1-f....-.-. . . , s s .-.smug MQ. 5-' -,-UH.-..-nf-N. -.pn - Pl . Y . ,mm .4-iss.-:,1g5:,f1:aS,,-:gfp-J,,y1,.fL,-1, - -gym wr-ygzpq -,:., nf..1-.ws-wyggg.-lwkgfiasnn-q-ff-vw-7hfsakf.ff-.sa-sfsrfiafff-L-2wFg'72EL..c.u.-sas-f-.Lww , .- askfcz-Q35 -wf'2 - Da,-a:,.p,-mwg--S L1f:'4mr,,f:,.:,:E,,:2 gh . .,.,.f?F:-P.. . --.. gif.Q-5:.a-.f-,V-C.-,,..f,j.-iw.,1 , -' X f ' . ,Q- P. -wybfggwbsbf-vfwiiifi-sw aw-Zsliifiiiise-+'fw:s-'rw1'f:.11:1f1--:Qin g f -f 3 1- ' 1 ' ':..L,:..J,.-.. .. .11-f21:21:11 --'f-1'-Sf ' ' Xa s- .C -Nw: '-'MQ-Q 5:..ii1v-.L-Ziff' , A . - . . , .-J... ,, M- 1-' - - -. .. ,---f.,-.-Q,-,-.W-, -- -:- .M . . . .- 3- - . .WM ,, k. , .- . , 6- . , ., 1.3 .H -1'-1 . ' -ff. Q' 2, ...,.... ., - ...... .......-.. -.,N.,.....,,..,W....,......,,............,. , .-Q . W..,..,-...u..,.-,...-,.,......,.-..,.....,,,.,.....,.. , ' -fs f A E ' ' .f Q H ,- A . 2, fs-Q . 2 ,s 1 M3413 ,. 4 Q, - L: A -'s .4-5, I, - - -, , y- . 1: CN wg 5 ' - 1. ' 93 Er . .A-1 -+5 3 2 n N - A -, wr , in at-5 X1 X Q. ,., Z f . .., - , . - . . . , .D . ,l , ,N -, ,M , ,. . K yi... 1' H A N ,Vx V , I 2 ' ' M , I. 2 ' 1- . . , . , 1 - Q ,- ., ., I . 'N .- ' I 3 . ,y 533' -w . ' fs -. 1 S- e M 1 --Jw ,I f , 6 . , . . , , 'A - cw, 5 ,I -, , ' a , .- ES ' in - ,. . fs A . . , 'L - , . , ' f I , ,, s, .. , kt- .' ,r g-'Rf-f-'Y : X u . - R e,l-5v,- f 5 Hwg 2 nys? . if I-, 1 :sg ,-S -, ,x ,g -ci-:--ffm 4 f - 1 -' 3 'll-if-jfs 5, s.- in -,mx ,j 1' ,,.,,,.,,,....,. . , .,,.,.,. ,,,.,, , , , . W. .. , Q . ., , ,.,. ,V , I WMM I 4. N . , . , ,,,, ,. , . . . Q . - , If Q- F K . , . K e - sf' 1, , Q 'fi Z 'T if QV vw Ax? Cn-.pzq iw . . 'f Qs' 'rx Q 3 A 'QYYWSQ A X... Al . , 1 ,, 1 M m -sn WLM K ---M - ,. X .. . -- ...U ,- - JSE W W..4.W,,1'--'I - - ... ,N -' Q Y .....-.,. . W .. ,.... ,-.MV . f- My M... , 4 . - J 'V f' Lf X cm ' E g . V N 4 . .1 I . S LW.. - , ...... -J Q- ., .-. - - - -W . .- - -- .- 2 I ,M -,.,,,.,.N.. ,,,,,...w...x ..,.. . ...... . .,.,Q-f.f.-- -- .zd-fax...-mx.-m,.,... M wg wlarrrmim WZ-V, rim: Ll: ...xg V, V Mm-J gun, 4 . -Q ,,---,Q Y s ft' f7795X 'W' Q55 ka 4 5 The Zlaeart of QBur Qtbletlts I i 1 y W P COACH HORTON COACH KARNES What could we have done without this wonderful and efficient source of athletic energy? Our coaching staff should be complimented upon its cooperation within itself, its ability, for the things it accomplished, and the higher standards that it always sought to maintain. Normal stands for clean athletics and we are glad to show our coaches that we think they can't be outclassed. Coach Clifford E. Horton, the head of the department will always be remembered by those with whom he worked as a hard working practical man, who knew how to handle affairs and men, besides being a veteran coach. Don Karnes added new life and vigor to athletics this year by his coaching ability coupled with his enthusiasm for the work and his understanding of and in- terest in the college man. Again, we say, T his combination can't be outclassed. x1 -ff lk: i qi 2 it A9 I SN 149 lk ts, Q 'Os AS' is fq 19-v if iy T e f f ygfwaweaeafs J mm del? Q53 NJ' r se 'FX' The 15213 Engineers V at g . 4 'N Efi H l YY Y' N l BECKER SNYDER SNELL Qpen the throttle and let her go! That's what these trained and experi- enced acrobats did. VVhen these boys called for a cheer they got it and it was a big one, too. Early in the fall term the Varsity Club held tryouts for cheer-leaders under the supervision of Arnold Snyder, a veteran from last year. Of the number that were chosen Snell and Becker were the ones to furnish support for Snyder at all times during the year. We take our hats off to these fellows. They gave more pep to old Normal this year than she has been noted for, for half a life-time. Yea Normal! Qi, by ' y 4 ,f U 150 g 25 A6 i f o 'sf TPTEYT is S t e- .u-Ffffzfzfzfzfz' :7:T:f:7:Y:?:3ttE-If-7 - - - .-.-.g.g.34Mg4,.-.. 33 ' A' 4 ' 'f'i'i'f'Y'?79Tf'f'? 5KY:7:f:f:T:7:7:T:Y:T:Yt-.TF:t3:-t:-1- , . x x :313:QffffQff2QEf:f:f f iuaffpiiiaiiiff- 7 .. me 5525555 5252525 igigigiiigigigigig iiiiiiiiiiiiiiiiiiEiiiiiiiiiiiiiiii I 5252552 212 5225152122252 252212 2525E52523Eg25E3E ffffffff 52325252 222225. EQEQEQEQEQEQEQEQQ 25232323 2523E3E3232523E32g 2222225 2222522Q2225EQEQEQZQFQZQEQEQEQEQEQEQ gEgEg25EQgE5EgEg2gE5 232 sgigigiiigigigi 2255555 gigigigigiiigigigi 522522552 55535525 525522 , 5525 5 5 1 1 253525252552 .51-22:2iE1E2322h - 2 fzfififfff .325E31F12323232323232523. 22- 3- -j'jIjQI3:gg3.3 3232322212123222I:221:2:3:5:2:Er21E52f2r222521E22rEr212522222221E32523232121222222232323232g252g252r2321 525255525531 232222225122 :52gf5f5f2' E-:f?:5155Ef?f2?5:1:-:-:- . ,I5:55255325EEEEEEEEEEEESESEEEEEEEE5155255552525f25ff51f15f5f225fff5f5f5 :-: 34:-:-rv:-:-: tg-:-:-:-1515:-,.'-'-' -, :-:-:':-:3.g.::-' -: :Q:3:I:1:3:313:5:3:315:3:3:3:3:3:3553-433:1:315:3:1:3:3:3:3:31523:5:3:3:3:5:3:3:3:3:3:::3:5:3:3:3:g:5: .3.3.3:3 QEQEQQQEQEQEQI: f5'7353f5f5f3'3.3:5'3.3:ff:, I .QQ:Q:Q:212:Q:Q121212:Q:2:E:f:2:i:Q:f:f:?Q:3 ''3if:Q:Q12:Q:Q:QLQ:Q:Q1Q:Q:Q:Q:Q:Q:Q:f:E:f:f:Q:f:f:fI2:Q:fZf 321212: 52525222225252525252523232f52QiQ255' 3232525225252 E5255525.,.,.3.3535252325232525252Q25252Q2325:'555552Q252522232323252525231f5555525232322252525252223252325252525252525232223252 22252323 55255525552555255552525 525.-215 5552525E525235.-:f?5E5E5E5E5E5E5E5252325255525553525E5'5I5f5f5E2:5f . ' 525E1252525252555E5E1E5E1E2:1:-15152555252521255122E2E122E1E5E2E1E2E1E2E2 12121212 :?:7:i:5:1:1:3:5:5:5:7:5:i:i fI:I:I:f' i:7:?:i:f:' 1i:3:5:5:f:1:3:1:?:3:3:5:5' '5:1:i:7: ''15'3ri:T11:i1T:T:3:3:5:3:5:7:f:1: Z:5:35:5:5:?:2:Q:f:f:f1Q:7:5:1 52222222 15222325252125515535225131 'fifiifffiz ififififi.43f3f513f5fi2ififfifif32i 3:-2' 'f'f2:- 51fff1f1:3 +525525151E22QfififQEQ1Q22fif35:2,J'EQEQ2QfffQ:f:f:Q:f:Q:Q1QEQf 1Q:::f1f . 525552525E5E5E5E5E525E5E5E325.'5EfE5E5E525.5552555 5252525252 5252525232 -1 521. ': '4'522z :EfE5EfE5E13 -: 51325252EIE1ErE1E535E2i252:2. ''3EE121E1E2fE5i325252525 555235 1 52523252525252525252525252325252525252,ff5552521232325222525252525232525232523252,f323232f555Eg1 523.51 3 5 3.3252525252222252523235152 552 5325252525235 :: 352:2122221222225ffffff22212121221222:fiQ12:ftfzfif:fi22:22Q1222:2:Q:f:2:Q:f:f:f:f:2:f.. 412122, 3:53 :fzj .5:2:21Q:f:f:f:f:E:f:f:f:f:f.3 .g.3 ' .3:2:E:Q:Q:QiQ: H 3:3:g:5:3:325:515:5:3:5:3:3:3:321:5:313:3:3:5:5:3:3:3:3:513:3:3:3:5:3:g3:3:3:3153:3:5:5:5:3. 55:3 3153:3:3:3:1:313:5:3:3:5:3:3:3:3 -13:3.3.3.,3:5:3:::3:3:::3:3E 3:3 122512221552IECE3215232515232E15151525235552525555355252525552525E5E525E5Eff5f5EfE52f23E5E- ' 1252555555E525E3E5E5E5EfS5E5EfE5E5E2.''535E5EfE5E5E5E5E5E5E5E5EfE2 1321222 ..f2f3f5f3f ,. 5215321555327Eif?212323535522fiiffiffffififigifIfiE521fif121212132If?fIfififffififfffiifffil -1:21251 1.5515IfEz:+2235Egfifizefgfgggfgfifig 'QfQEQEQEQEQEQEQEQEQEQEQEQE -z.:-2525252552525E525:.:. 52525255525252525E52525532525252525252525252525252325252525S525E525252325E5E525EfEIE2EI322: -:-E5252525E5E1E2E1E1: lf..-2-21Z53IE2E2E1E1E521E1E2E1E1E1E2E 'fffifififififififfiififif 5212353 2 2 22 22EEE5232 52323252522525252525232525252525252225252323232525252525252525222525252525252525512523252325252525252525225 25252Q252523232525252Q252 ' 5525 ' ':-:-:-:-:-:-:-:-:-1-:-:-:-:5:-:-:-:-:4:-:-:4-:-:-:-:-:A:-:-:-:4:-:-:-:-:':-:-: ..-:-:-:4:-:-:-:3:-:-:-,4.':-' :-:-.1.-:-:1:5:3:1:513:3:3:5:5:g:1:5:53 3:3:3:5:3:5:1:3:g:313:::3: 23232523E32523232323252325252325232523232333232323232325E323E3232525232g23252 325232523232gE5i3232g25232323E3212i 232323222323:3232523:g232g232323232523222 523252g2g2323232525232325:5 Eii2252525252E25252E2522522511isEfi25252E2E25252igi55gi5Egi2i2igi2agegs5Qgsgig55Q3522255E5555gi555525Qgigig2535gi5igigigigigigigigigigggzg33 :212r252525355555555555-'-' 252555515255g525525552525'25'25Q5'252325252525Q525252525252525I5,r252525 y'5'55552525252525255515.'f5:5:5:5:5:5f5f5f5 252555552525252525f525Q5f5f5Q' -- 5' 'ii3fi:3S:?:3:3:315:55:i:5:5:iz3:523:3:3:5:5:31?:5:i:5:1:3:3:' :3:5:3fx.3:3:513:5:i' -:5:f:'f:-'f3H3:71T1i, , :i:3:5:5:5:i:3:3:i:3:1:- :31?:?:5:1:3:1:I:5:3I5:3:3:3:1:2:5:izifffflfiftiz3:3:5:5:ii2:2131113:2:3:izIii:31512:3:3:i:f:i:I:3:T:513:3:315: -1- 33.3 :':-:-:-:-:-:-:-:-:4:-:-:-:-:-:-:-: :-:4:':-:-:-:Az-1-:5:-1-:-1':-:-:-:-:-:-:-:-1-:-:-:+:-:-:3: '4:-:-1-:-:-:+:4: - :-:5:-:-:-:-:-:-:-:':-:-:-:-, +1-'35:51-:rc-:-:-13:43 :53:1:5:3:3:513:3:3:5:3:Zz3:313:3zz:53:53:323:53gg3qg3:3:5:-:-: 5:-:-:-:-:-:-:-:-:3:':-:4:' 53151: '525:51315:5:3:5:5:5:3:f:5:7:5: :::5::::: :2:2:2:f:Q:Q:Q:Q:EzE12:EzQ:Q:Q:Q12:2:2:izQ:f:Q:f:f:f:Q:2:Q:f:Q::. : 1:5:3'5'f2 3:Q2Q:f:2:f:f:Q:f:f:f:f1f:f:f: f:?' 122232212258 3'3'-' -:315:3:3:3I3:zzz15:3:5:5:3:f25:3331:1-:-:-:-:3:::::::3:::3:-:-t 531315: 3E22r2r2r21212r222 5555252355155355525523E22525523571353ET57flfiififfiffififlfifil 32f2325232g23E3Er:-. 21232121252323232gE2E32gE52523.f .32ig232gE325Eg25232g2g25 2QE3232533252gE323E323E32323232g25E3 .1432-:2 52223232 -zizffffc-. 5353252153:-:-:5'. -2525551525252 fifififffif!5351fifiiifififififififfifif513f5f7f2i:5:?fif1f55Cf31523f5fif7fi:5:1f3i1E115f -:if1:2f5:1:1:2:5-' .212:5fif5:5:1:i11:lf3:i:1:3:?:i:3.-1.- :i:f :i:?iiQ:3' -rf:3:1:iz5:1:5:5:3:2:f:i1Q:f:1:1:1: :3:3 51:1:1:1:1:2:-.-. '3'3:f:2:1:3:5:5:P5?5:3:5:2:5:1:1:5 :i:5:1:3:1:57f:5:T:2:i:Q:f:Q:Q:5:5:3512:212:2:Ezf:Q:Q1f:Q:5:3:izf:Q:f:Q:Q:Q:Q:Q:f:f:i:?' Q:2:f:Q:2:Q:Q:Q.5: 3:2zQ12:2:211:112:Q:Q:f:2:Q:f:Q:Q:Q:f.3Q 3. '12:Q:Q:Qrf:2:Q:f:Q:f:fi3:Q:f1f:Q: ,,Q:Q:f:2:Q:2:f:3., 5255252525255 25252525252525252525252525252525.-.- 252525252525325232521212221252523252121212221212222252325252522212r2r2r2r212rE321E525 1212152252-25222 .-E122212121229152121212r2r212r2r2r2rE12rE1 2421222122232 3'252323232222222523E52g2gE323E32 232:23Eg23E3gfg2gEg232 13: 1 .... i:5fff2Effffffff5f ''525212121213.51252525252:32zf:2223:2222212125252:EIQ:f:f:f:f:Q:f:f:f:Q:Q'3 :2:Q:f:f:f:Q:',If12IQ:2:21Q:2:2:f:ftf:f:Q:2:2121f:2:f:2:Q:f:f1Q:f1f:5 ':f:f:f1f1Q:Q:Q:Q:3: 1:Q:Q:f:Q:f:Q:Q:Q:f:f:f:Q:f:i 'T'1:Q:Q:f:fStf:Q:Q:Q:Q:f:3:1: 5:31212 .5:-:-: 55553 , :::3:3:3:3:3:3:5:3:3:5:3:31323:5:3:5:5:5:3:3:3:5:1:g:3:3:3:3:3:3:1:3:g :3:5:-:-:-'- '23I-I 42:II212:ZZ112:Ig112:QIZZ:Ij2:ZjZ:1:Z1I1I:CZ2fZ4I:I:I:Z:l:I:Z:C:1:I 13:3:3:::3:3:5:3:3:3:3:5:3: :-:-:3:3:3:3:g:3:4:-:-1 3:33513 5 X zfif:22222:f:Q:f:Q:2:Ez222512221212:2:2:2:f:E:f:' '5'5'3'7'T' 31fSfkZ2'if:Q2:222:Q1212:Q:Q:f:f:Q:ftQ:f:f:Q:Q:Q:Q:f:3':Q:Q:f:f:f:2:f:f:1 2:Q:Q:2:f:E:2:Q:Q:Q:f:f:Q:f :5:f:5:i: 121212: .,I535223E35351225fifif!ffIf15151f5f5f3fff1f1fIfff3ETf?f35 '3355?253512121512112EffififfE1fifIfiZliififilifffififiifiz 'fifififfffiflfi 313fiiifiE221f1fiEifiEffiff ff 332:Q:Q:f:f:fi:Q:f'if:Q:f:f:Q:f:Qwv-M 'f'fff'f'Q33'- I 5:3'.N1Q:3:3f:f1252:1:Q:Q1Q:Q12:2:f:2:f:Q:f:Q:Q:f:Q:f:Q. ':E:f:f:f:f:f1f Q:Q:f:f:Q:Q:f3Q:fEQifEQ:Q:f 2:2 22224-2212221122 2.. .2.12.-12' 221W-F2-2-121324222225222eases:aesszaifassezsassaeass.fssaeaeieesf- saessissssessfazegsfsgsasas 522s2sEz:geSsSs?f?is?e2s 152525252525 22522252521a:s:5:s:2:z:s: ::::: E:E:f:f:f.iQ:f:f:Q'P 3 ' 3,3.3.::5:f:f:Q:Q:f:f:f:Q:f.-QQ.. 3.3.3.31I,I13.3Q.'.3ff72727212132:ftf:2:f:Q:Q:f:i:ff:Q:f:Q:Q:Q:f:Q:Q:QcQ:2:f:2t?3QfTfff:':Q:Q:f:3:i 2:Q:51725131757:7:EtQ:Q:Q:f:Q:5 i:1:5f3E2f5fif5:i:,. 5ffTfiif5fffifff3f1f3E3f72f5i55fif1f521f1fiiiE54Qi5f'f'f'f'1'f '4 ?f75??f1fff5f52fQf35f2513fifi21f1E151555727551If5E22If53f5Hi5f153f1f2f12f7?fil3 2225-,-,Q ,3.3ffgf3f3fffQfQ1Q3 1:2 5E5E5EZfE5E555E5E5E3E1E1 1 1 1 3'1I1I5'131E251E?, 22??E1SIE1E2212251521 3. 2212155.33 E12 5'5'2:E:Q:f:f:f:Q:f:f:i:f:' ', f'f'Q:f:3:3:f:f:ftW:f:Q: '.f:5:f:21::3.3.3 ....:1:3:7:i:5:5:i'5'3 I:Z:I:I:I:f:':':':':':':':':':':'5':':i'5 '5'5'. ':':'mmgi' .f:5:3:T:5:5: 7 l'!'f'2i:3:3:3:i:3:i. .-:-:7:5'.Sli:5 ':3:3:5:5: :-:-:-:-:-:-:-:-:-:':- -:':-:-:':-:2. . .......... Mr:-.''-'ff:':-:-:-:-:-xoawgyqaggg-:-1-rf-' 1 -:5:-:-:-' 1-K ,-31455:':-1-:-:4:3:-:-:-:-:-1-13:-1: - if 33.32323252323E323E5E5E5E32523 33 N 25232525252335252313I,13Q-2-LI-I-.-'-2-1525-QI3232959252323232323.3232fi3E325232523E5E3552323232523E32323:3:525E32323E' - -.3.,I32'E5' 3.532123212121EIR553E525E3E3E5E5E5E5E5E5E32f5 2z5:32g:g252g212rE 5252525E5E55555E5i5E5E5E5E5E5E52 525252525E525E5E5EfE5E5i E525f5E525E52555252525555355255525552535255525E5E555E5E5E5E5E5E525552? 'f5E '55 .,.. '.'.'. 5'51515i5E5E5E52553535.122525252 ' 'f3f7fifff52ff2251255152531 ' 5'5'5ff5fffifffififififiifffififi5325323fififsfifffififlfiifif?fifE521515355,1525i5551f5Eff1f123 lf4.-,- - - 5 A f5f5f?E1:1:1f121E3 'A f1f3f751?f5f1fifi 5'5'f315f557212iff212155fif125235EififiififfElf5532115ffiiifif3Effifffif123:1:3:-:-:iff221Eifffi5?215iA5635:iC5i0f5f?P?5f??'! ff5fffff1fifiE32?f1f3?'ffffiff1f12?fi' 5 ' 'ififiiff H - - Eff? 3 1...25225555555555i5i55E555.5 ..5:2:55f5f:2:5: :5:5:5555252f2:f:2 -:5:525252525:-:- 2.2.ii5225Ei?255525E35525535555E555555ifE555E5i5E5E55f5f555E5ffi5E5E5555555555555255555E55ffE5E5i5i5i5iff255fE5iE5525555555355 ' JY L'-'J-' ' L l'i'l'2l'1 .f 151 f bil' ei X! tfss g,.X l l l l I 1 w w il aaa ie 4 QQ 25544 sigassaazi 'mefrQarwMrfffEf:aeE2aeg jfuuthall Qur football team showed its mettle early this fall by holding Millikin to a score of 3-o. The same old fighting spirit characterized the rest of the games, but the breaks went against us too often. Normal lost her first Home- coming game 7-o in a very hard fought and ferocious battle with Charleston Normal. Spirits rose again however, when we witnessed Normal splendidly redeem itself in its victory over Shurtleff. Normal's incomplete season ended with two victories and five defeats. One win came by way of DeKalb who was forced to give us the victory because of her neglect to observe the conference rules. The men to receive football N's this year were: Capt. Neathery, Carl Firley, Carl Gregory, VVayne Patton, Fred Strange, Lloyd Traughber, Don Allen, Williaiii Groesbeck, and Fenton. Don Allen, a Freshman this year, was chosen to captain our fighting team of ,26-,27. We hope Normal's captaincy troubles are over. This year three had to be elected. Potsy Clark, first chosen, did not return to school. Conger, who was later elected, was put out of football by a broken leg. The choice finally settled on Scrappy Shorty Neathery, who finished the year battling with Qld Normal. Feel that Normal Spirit men, and Hold that Line. 152 'i ec- - af Eaaawzeaar iaassraaa QRgi95kX5Q2rlf me 17729095 W 4 I 'Rl M 1 t , 47a lg, ' . , la, . ' J - l?T',r! A We W wil ,ga FOOT BALL SCHEDULE Oct. 3 Normal ....... O Millikin . . . . . 3 Oct. IO NormaQ . . . 7 Illinois . . . . . .17 Oct. I7 Normal . . . I3 Eureka . .... .21 Oct. 24 Normag . . I DeKalb . . . . . o Oct. 31 NormaQ .... . o Charleston . . . . . 7 Nov. 7 Normal . o Macomb . ........ I4 Nov. I4 Normal . I I Shurtlcff . ........ 6 Games won. 2 Games lost ........ 5 , 2 Q L l Y .Lf J bi 7 DJ. L fi l 2, S 153 l Z2 GQ7fZE'iilx Q31 My Q G USAQQ lei- N fiik X C9112 crib Q53 CG S'-Qll fC5 JJ .X N Basket Ball x 1 5 i F X 1 A 17723595 ,Rr Gvgimfiffg ar fr Rf 1,EQ ! - f- ff, - ,V 175' mv-k - 1 ---f Wm l H WY l vr .j ' w ' 1 Q fr 'T X PW We 1 . Ir 3 1 5 , l 1 A A rs rgf J F i I : l r I A : FRED HUSTED, '28, Capt. , l 4'Gus 1 Guard , 3 r H XY'1LL1.xM HBUNKU YOUNG, Forward r A T00 modest to appear r i f Letter man I li 1 1 w 2 1 V F E I 5 I 1? r I 7 ir I r W r MGE' 7Q Y,,Y -V V ,, ,L , 4 yi Lmzfw HARPER '26 HARRIS DEAN '29 Q W jf HA- Heres r H Cerxer Guarg 156 A D Q gc? r V 5 In -r e ig 7 TF EEFQNREQK 1755595 rr- ef Va V i'A i 7 xi Ln' '-' - ' ' lx-M Q9 fl Q X llkjy' lg!! l f e M KX-47 7' ' f ! ! in . ' ..........:,--- -vu . Y. l lf' l fa 1' fa lf r 26 l 'gf-A l 1 l l l l FRED STRANGE '29 CLAIRE IUICCREIGIIT '28 1 l 4 ' Freddie Mae 1 Forward Guard Basket Zgall bnhehule 3 Jan. 9 Normal ............ 20 Bradley . . Jan. 15 Normal. . . . .24 Lincoln . . f Jan. 16 Normal. . . . .25 Illinois Col. . . . . . 1 Jan. 23 Normal. . . . .25 Charleston i Jan. 29 Normal .... .... 1 0 Eureka . . . rl Feb. 6 Normal. . . . .25 Bradley . . Feb. S Normal. . . . .22 Wesleyan . . . . . I Feb. 13 Normal. . . .... 16 Charleston ' l Feb. 20 Normal. . . .... 19 Eureka . . . 1 Feb. 24 Normal. . . . .20 Lincoln . . Feb. 26 Normal. . . .... 21 Illinois Col. . . . . . . .15 Mar. 1 Normal .... . . . .22 XYesleyan . . -.. I Total Normal 219 Opponents l Q 1 Q L l J l l , .wal Sf 4 1 fm' l Y 17 A: A Q ,..,, ,.,.,.. fr 51 ,f'N. ,A 'PY 156' 'A A A ' e' F2221 'A fi -fa in 1 I I 1 i 17223524 09 i T it to .5 Basketball at I. S. N. U. fared better than it did the preceding year, and Q stood approximately even with the record made by other sports this year. FQ? Although Normal had only three wins, many games were close enough to 10 l give satisfaction and a feeling that they might have been won by a single i break. VVhen the first call for basketball players was given by Coach Karnes, y fifty candidates appeared. During the ensuing weeks this number was cut down to about hfteen. Prospects were exceptionally bright before the com- ing of the holidays. When the squad assembled for practice on january I, it was found that Mohar, former U. High star had been declared ineligible because of matriculation, and Bray, a promising tosser from Mazon, had de- cided to abandon school. The best was made of the situation, and Karnes continued working out and preparing a smoothly functioning team. The new Felmley gymnasium was opened during the first part of the season, thus allowing for a more highly-trained team and improved accommo- dations for spectators. The modern gym surely did its part for basket ball V at Normal. , I The men who received N's at the close of the season were Captain Husted, McCreight, Dean, Harper, Young, and Strange. Husted and Mc- Creight were veterans from last year and worked in the guard positions this year. Dean, a Freshman, gained himself a berth by his excellent guarding i and aggressiveness. Harper, the smooth working center, was slick. He 1 had trick after trick up his sleeve to bewilder his opponents. Young, a T veteran forward at the game, still continued to shoot baskets in his carefree px-J' manner. Strange the second Freshman with a regular berth, showed good form and did excellent work as a forward in offense and basket shooting. QS ij W gi 2 l 158 lg i 4 WM QV if lg Fvfni ' 4 'rw im l x.Xl, I The men who did not receive letters but who gave service time after time on the floor for Old Normal were Miner, lrVoerner, Scott and Robinson. Their time will come. Dean was chosen as captain for the '25-'26 team. Wfe shall expect a lot from these boys next year, so we urge them to give all they can for the school that means a lot to them. Fight, Normal, Fight. ff' ' 'xxxf QR ,Zi 159 J z in , g l Ewa' 5 jail AN Ji lb fgfw lfem cis QD! VGA JV: A5 C55 B ,eiayieva A A igsielnh fffwf sa fa Qs, j Q 4 4' HK! F l' 1? W i .7 4 -6 4' 'N M ,T l V ez A l l Left to Rtlgllf-TURNER, LAnsoN, BASTING, GLAESER. Top-LEE, REYNOLDS. BRENEN, NEATHEHY. AGGIFYS BASKET BALL TEAM Zlnterzjlilural Qtbletlcs Athletics and physical education can be said to be Wide spread and uniform at I. S. N. U. Intra.-mural athletics is carried on by the physical education department to give the beneficial results of athletic competition and participation to as great a part of the student body as possible. Much interest and enthusiasm was shown in the tournament deciding the champions of the school on the basket-ball court. The Aggies, although pushed hard at times by other teams, managed to gain and maintain a perfect score. The final standings follow: Team YVon Lost Pct. Ags . .... ... 12 0 1.000 Sanders . . . . 10 2 .833 K. . .... 10 2 .833 Allen . . . . 9 3 .750 Giddings . . . . . . S 4 .666 VVhitman . . . . . 7 5 .583 Invincililes . . . . . . 6 6 .500 Carter Club . . . . . . 4 8 .333 p E. . ....... . . . -1 8 .333 Y-fl N. L. C. . . . . 3 9 .250 Xdf ' Byrnes . ...... 2 10 .166 If ki V. . ........................ 2 10 .166 A Q l House of David .............. 1 ll .093 l fb Baseball is also used as an intra-mural sport. gl w ' l Q 160 X ,rj 4 L :El .1 6 6 Afizwm. A V QW me 177238361926 ' 1 sl? , v ig 'D f 'il I 4 i l Q W4 i W ..... - ,, ,.. Mm.. The Gym Cilasses A further development of the universal physical education idea is the gym classes. These angel squads are composed of all Freshmen, who find it neces- sary to make credits in physical education before graduation is possible. Soc- cer and other games are resorted to in the fall. Calisthenics, apparatus work, pyramids, and basketball serve to keep the student occupied in the winter. During the spring term, classes in baseball, track, efficiency testing and theory of physical education are organized. Coach Horton and Karnes are in complete control of this work in physical education. l xg-Ja fx-ffl 4 i i i Y Y W Vg r u I i X I 161 9' ci e e at 'F Y lififi fb x' 'NY as lj wr fi... X My fig X f X X fl f fi? , GGCXUQATQX X H jig JDS 7,,QQQ Xi QQ, f' Af J .X A T:5:27:5:7'T' ':527f5!5Z5Z5f5'5' '5 ' .-.-2225f525Z'. 5Z7t7:25:7:5:T:5:5:5:?5'Iz220S'7Ti:2':,1 55:3:5:7:3:5:-:- ..... .. -5-1 ' :5:5:5:-'- ':5:5:5:5:1'-' 5:5:5:52,5:5:5:5555 5:5:5:5:555gqz9Qfg5g.g.g.g.g.g.5:. -'-.5.5.9355-'-:-.5.5.5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5.5 .5.5:5:5:5:5g5:5g g5g:g.g5gi.g5g:g.p. -.-:5:5:5: 5. 5:5 .5:5:5:5:5:5:5:5:5:55 -:5:5:-'-'5.5.5:5:5:5:5:5:5:5:-:-:-:5:-'' 5:5:5:5:5:5:1''5.5.5,NE.5.5.5,5Qg.g.g:g.g.5.g.g:g.g:,:5.5:5'5- :5:5:5:5:5:5:5:5:5: 5:5:5:5.5:5:5'-' 55:5:5:5:5:5.5 1:2:2:25:3f:1:5:-: '5:2:1g:5:115522g222 -'2:5:i:f23:2:f:2:1:1:-.-:5:2:2:1:1:2:2:1:2:i:f322t1'f9SK55:1:3:1:5:2:2:1:5 2'2:2:2:i:f:1' 212225 5:5:5:1:k2:2:2:2:2 -'-:5:5:5.5:5:5:-'5 -2-2525252525 '5:52525:52-'5'-'-3-:-1-:5:5:5:5:5:5:5:5:5:5.5q'5g,E5:5:5:5.5.5. -:1:-: '5:5:5:5:5:5:-:-: 2 . .5:-222-:- 5:525252525:3j5:5:5: 5.5.5.5.5.5Q:5:5:5:5:5:5.5.5 2 2 2 5222:2535353252522252525222i35'gf5252522:1' :2:5:5:5:5:Q:5:5 5 5:5:Q:5:565:5:5:5:5:5 5 5 5 5:5:5.5.2:5:2:3:2:5:5:1:2:2:5:1:1:3:5:5:2:1:f:2:2:5:5:5:2:1:2:-:-:-:- ifzfzfzfzfzfia-21:5:f.5. 5:3:5'1 .515:1:2:Q:1:2:52223:515:2:2:2:5232125222l:l25E1222i1222525:-:-:-:-:-:-:-1-2725522213222Q22222222'- - ' ' ':5:2:1:fir: '22 -:-:-:-:- '5'5'-5 5'2'Z'2 ':-t-:-:-:1:- 5.5.5.5.55.5.5.5.5.5.5.54.5.5.5.5.5.5.5.5.5.-.-:5:5:5:5: ' ' -'-'-'-'-:5:5:5:5:-:-:5gi:5:-:-2?:-:-:1:- 1 - 5.5.5.-.- 2E12121f2121212 .i21E12i2E222212 ' 222222213222121E22522E2222522 -:-2222 -'-:5:5.5:5:-:-: '5:5:5:5:5:--- -:5:5:f:5:-: '5:5:5:52:5:5:5: 5:5:5:5:5g , . . . ' :-: ' -2- 552325132 1- , -:-:1:- 5 - .5.-:-:-:5 ' 5.3. . '-:1: : 5.5:5:5:5:5:5:5:5:5:5.- 5:5:2:5:2:f:2:5:2:5: 5:- 5.5:5:5:5'5 515:35 -.-.-:-:-:-:-:2:-:-:-:-:-: .-:-:-:1:1:2S:-:1:-' :-:f:2: -.f.-:-:-:-:-:-: 1:-:-1-1 i'2221S?21222122 E221222122222222222' -2121252 '22222121?222122E2 'f'21E2EF :222212f232221' 2525222221222522.-51222222225 5:5:5:5:35:5:5:f .5.5:5.5. 5 '5:5:5:5:5 5.5:5:Q:52521222223222' :-:-:-:-:1'-' :1:-:-:-:-:-:-.- .:-:-:-: :-:':- '.-:-:-:-:-:-:-:5:5'5 ':1: -:-:-:-::-:1:1: ..:-:-:1:-:-:-: -'-:-: ' ' ..5:5:5:5:5:5:5 -.-:5:1:k5S5:5:?:5:1 .. 5:f:5'5' ' . .. :-:1:-:-::-:-:-:-:-:- . -1-:5:5:5:5:5:3:5:3f5:525:5'5 .2525:52l452525232' :-: :5:5:5:Z5:5:5.5 ' 535:5235:5:5:5:525:5:5:5:' .5.5:Q:5:5.5. 5:f:5:5:ffQ:2:f:Q: .5.5:5:5:5f5:5. '5:f:5'1 .5:5:5:5.5. 5:5.2:5 1:-:5:5g:5:5:5:5:5:5:-'-: :5:5:5:5g:5:5:5.5. 5:5:5:51:5:5:5:' :-:5:5r:-:5:5:- ' 5.5: 5:5:5:5:5:5.5 5:5:5:5I 5.5.5 5'5:5:5:5:5:5:1:5':5.' ':5:5:5:5:5:2:3:2 5:5:5:5f:5:5:Q:5 -'2'52523: ' N 5:52:f:5:5:2: 5:5:5:5:I 5.5.5:5:1:5:5:5.5 5:5.5:5q:5:f.5. ?'5'5: :5:5:f:5:2QE:Q:5: 5.5:5:55 i:1:3:2' .5 5:5:5:55 5:5:f:5:l -1125253553212 1-f:5:egsgs:eg.: :s:z:z3:s:s:s:s... :.:.:ag:2:a:... . ...:e:z:s... ,..,, :f.s:e:s:a:sgs:z... f:z:2:5:51 :-:5:5:2:2:2 12g2p25g2g2g2gZ,.5 :5:5:5:5y:5:5:5:5:5:5:55 '-:5:5:5:5:-:-: 55:5:5:5:5:5.5:5:5:5:Q3:C:2:-: -:-:3:5:3:2:5:5:?:1:. ':5:5:i23:5:i'1' 2:2:2:1:1: 5:5.5:5:55.5:5:5.5 :-:5:5:g5:5:5:5.5. 5:5:5:i5:5:5:g5:5:5: 5:5'-' '-:5:5:5q:5:5:5:5:5:5:5:5:5:5:5:5:5:55 11:1:-:-:1'1'i'2:2:2:2:2:2. .-:-:1:i:i.-. '7:i:2:2 ' , ':2:2:I1' ' ':5:2:5:5:2:i: 5 :2:2:1'1' .2:2:1:fgg:1:2:2:3 ' 5:-222522222295522I5:2:f:fi55:2:5:1 ''2:1:2:?:212:2:5?:-. 2:1: 2:1:2S:2:1:2:2: 5:3:3:5:3:1E .-:-:-:-:1 ' ':5:5.-. :5:5:5:5:1 ':3:5:5: . . .-:5:3:f:5:5:5:5:5:5. . .5.5:5:5'5:5:5:' 5:5:5'-'- 5'5i'5'3'222322'2' '2222i2'2'2 A 321225215 -:5:-:Q-:3:1:-: -:-:2:2:2:-.- ?:2:5:2:E:5:3:2:1 ri:2:5:7:5'5'2:2:1:1:26:5:?:l:5:22'2:5:g1:1'5:2: -:5:2:1'N :5:5:5:55:5:5:5 .5.5,5.5:5:5:55:5:5:5:5:5p5:5:5.5.5 55:5:5:5:5:5g-:5:5:5.5 -:-:-:-:f?:5:5-r:-1-:-:-:-:-:-:2-1-:biz-:-:-: . :5:5:5:1' A212:2172222222215:iz2:2:ir2:2S:5:5:?:1:5:2:5:N:5:2:1:-: .-:-:1.2:2:1:2:1:2:5:2:f 2:2:1:-:-:-.-.- 222522:-f1?:f:5222212722552212222722223f32222212 5.5.5:5.5 ':':11 2:22222 ' 2:1:1:121?22:22222-2 ' ' '222222:25121212222222221222132122222' 2222:5'2I22522IE2E2:- 22E222E15252f251515121511:5:1:2:1:1?5:2:2:2:2:' '- 1222222222222 :-: .1223 -.5.5.5.5.5.5.-.1 5.5.5.5.5.5.5.5.55.,5.5.5.5.5, --.5.5 .55-.-,5.5.5.5. .5.5,5.5.5-.5.5.g5:g.5:5.5:5:5:5:5:5:5:5:5:5 :-:-:-: -:-:-:- -:-:-:1:1. :-:-:-:-' 55'5:5:5:5:5.5 '.515:3:5:5:5:5:52:5:Q:5:5'3:' 252525:-:5:5:2i:f:121:r:1:1-2-2-22:1:rzrglxrszlfrsfz1:2212122:r5.1.r:r:r:. fglflfliflfiiifi' :5:5:5:25:5:-:- 13152525 ..:5:5:5:?St5?:5:5: ' -..5:5:3: -:-:5:5:313:5i:5:5:5:5...:5:5:5:E5:5:5:5 '.:5:5:5:5:5:5:75f:5:Z5Z5f25:5:5:5:5:5 5:3:5:3:E5f:55:5:5:5:3:5'5:5: :5:i:5:325:5:5:5:5 5'5:3:5'5: ' 5'-15:52 :5:5:5:5:55:5:5:5: :5.5:5:51:5:5:5:5:5:5g15:5:5:5:53:5:5:5:5:5:5:5:5:5g5:5:5:5:5.5:5:515:2g5qff5,55.53555:5353535555.3.3553.5.3.5525:-:gr5,g5.5:5:5:5515:5:5: 5.5.5:5:5:5:535:5:5:5:5: 55:5:5q 5.5.5.5.-5.5.5.5.5 .5.5.5.5.5.5-5.5.5.5.5.5.5.5.5.5.5.5-.5.5.5.5,5.5.5 .5.5.5.5.5.5.5555.5.5.5.5.-4.5.5.-.5.c-.-.-.-.N-.-.-:-11:-:-:6:-:-:1:-:-:5:-:-:-:-:1'1 '1-H51-I-'.-I-I-C-I-I-C :-:H 5.5.5.5,52.5,5.5.5. 5.5.5.5.5.5 5.5.5.5.5.5f.,54.5.-.5.5.5-.5,5.5.5.-4.5.5.5.5.-.-.-:5.5.5.5:5.gag:-:5:-:-:-:1:-:-:-:1:1:-:-:-:-:-:-.-:-:-:-'- :-:-:-:-g-:-:1:-:-r:-:-:-: -.-.-:1:-:1:1:-:. .5.5.5.5.-.5.5,5.5. - 5.5.5.5.5.5 .5.5.5.5,5.5.5.5q.5.5.5.5 -.5.5.555.5.5.5. .-.5.5.5.5.5r:5.g5.5:5g:5:5:555:5:5: 2 ' ' :-:-:-'-' .-.-:-:-go.-:-:-:-:-:-:-:1 :1:-:-:-:4-:1:-:-: ' .5:5:5.5.k5.5.5.5: .5.5:5:5:5:5:5.55 ''':-:-:-:-:-:-I-:-I-:1:-.-S-I-5:-:-1-: T-L-I-If-'I-'-I-2-I-'i'C'I-2-1-I :1:-:- . -:1 .-:1:5:-:5:5'5:5:5'-'5' '2'I'i'2'2-2-2+ ' 55555 ..... .... . 5.5.5.5i.5.5.5. -.5.5.5.5r,5.5.5.5,5.5.5. 1- 5.5.5.5.5.5.5.5. .5.515.5.5.5.54:5:5:5:-:-:-:-:5:-:5:-: :-:-:1:-:-.-. .-.-:-:-:-:-: :-:1:-:-:t-:-:-:-: :-:-:- 5.5.5.5.5 5.5.5.5.5 5.5.5.5.51.5.5.5.5.5.5 5 5 5.5.5.5.5.5.5. '-:-:-:-:-:-:1:-: '1:-:-:1:- ' - - 1:-:-:5:55:-:-:-:- -:-:-:-:-EQ-1-:vi-:-: -. .-:-:1:-:-:-: 5'5:5:51335:E5:5:5:525:5:l:5:5:5:5:5'3:5:5:53555:5 '5'5'i5:5'5:5:5:5'f'5zk3'5'I'5'5 -:-:-: .5.5.5.,5.5.5.55 .5.5.5.5.5.55,1.5.5.5.5.5 5.5.5.5.54,5.5,5.5 :-:-:-'-' ---- 2 . 55 5.5.5.5.55,5.5.5.5 --.5.5.5.5.5.5q.,,,5,5.5.- 1.-1-:1:5:15g5c-:-:-.-:-:-:- 11-:-:-1-yr-:-:-1-:-:-:-'-:-:-:-:-:-'4-:-:-:-: -.12-.-:5:-:-:-:-:1:-:-: -. .... 5.5.5.5i.5.55 5.5.5.54.5.5.5.5.5.5.5 ---- .5.5.5.5-:1.5 5.5:5:5:5:5.5:5:5 5:5:5:5:5:-:5:5:5.5 -:-:5:-25:5:1:-:- :-:-:1:45:5-:-:-:-:1:-:1:-1-111-1-get-1-2+ .5:5:51-:-:-:-.-:1q:-:-:-:2:1:-: 5:5:5:5g:5:5:5:5:5:5:5 'I5Z5.5Z5Z5:5:55 ':5:5t5Z5:53:5:5:5:5:5:5 -'-:5:-'- 55:5.5.5,5.5:5:5:5:g5:5:5:5:555:5:5:5:535:5:5:5 55:5:5:5q:5:-:-:1 '-'5:5:5:-:4f:?:5:15:2:2:2:2:2:2t-315252-'' 1:-:-:-:-:5:5:5:5?5i-:-:2:-: 5:5:5:5:5:5:- -:-:51 5.5:5.5:5.5.5:5:5.5. '-:-:-:-,5:g5:-:-:-:-:-:-:-:- '-:-:1:-:-:-:-:-:-:-:-:-:-:51-:5:-:-:-:-:v:-:-:-:- -..-:-:5:-:-:-:-:-:-:- '-'5:-:-:-1-2-I5:5:5:1'5'5:5'5'P5:5:5'2'3 :-:-:-:5:-:-:-:-'-' ':52 :-I f Y:2222252S:5:2S:522:2S21.-. ' 1:3:2:1:f'i5:k1:2:5:-: '2'5:2:if25f:5?5:E5:5:i:3 '5:5:f:7g:5fi:f22 2'2i:52E32f5f?2221222 ' .-.222322232221 2225:3352- '2'2 -:-.5:5:5:5.- .-.-21555 -.5.5.5.5:5.g5:5.5.5.5.5.55555 :5:5:5:5:-:5.5'1:-:5:5:-:-.-. :-:-:-:-,-:-:-:c-:1:-:-: .-:-1-:-az-:-:-: -:-:5:-:-:-:1:-:-:5: '-:-:E-::5:5:.g. .g.g.5I5:5:5:5:- K -:-:-:-:+:-:-:. -:-:-:-:-: 5'5'5'5:2:5:5:5:i:2:1:2:2:2:3:I:3:5:2:2:2:5:2:3:1:5:1:i:f:i1:5:k2:i:2:5' :-:-:-:3:5:1'1!:3:2:t1:1'2:1-I Hg?-2-If-I-:-2-I :-.-:1i:2r:2:2:2:. - 3:2:2:2'2 1:5:5:2:2:2:1:1:2:2 5'3:2:1:3:5: ---F2-I-2-17? W 55252525255252525252-Z-Z-..-IE122EI5I-I2322225222522222'Z-I-25152222512232215E52212Ziiifilkf-2222121525I''2' :Q52ffI512252-I-I5Z5ZE1I5 .:3:5:55:5:5:5:5 .-.-:515:5'3:5i:5:5:5'5'52f5:?:5:' '1223222322 ' '5:5:5:5:5 A5.55.5.5.5.5.53.5.5.5.5.5:5:5:5:525.5:5.5:5:5:5:5:55:5:g5gigg:5.515:5.5egg:g:5:5g:5:fq.5,5:5:5:5:5:5:' 5.5:5:5:5i5:-:-:5:5:5:i5:5:5.5. -:-:5:-:1:5:5:5:-:-: -:-:-:-:9-jg-.-:1:-:Zi-:-:5:5:5 5:5:5:Z5:5:5:-: K :-:- 5 . ' ........ ,x ..... ..,........ . ........ ........ ,,555 . 5 5 5 ------ . 5.5.5.5.1.5.5.5.555.5.5.5.5.5.5- .5.5.-.5.,5.-.-..- -:-:-:-:-:-:1:-:-.- ''5:5:5:-fQ:5:5:5:5:5'5:5:5'2:2-2' 2-2-2-Z-Z-I-I-2-'wi-I-'-' :-:-:-1-:-:-:-:-:-:5:-:-:-:-'-:-:-:-.-. .:5:5:5:-:5:-:-:-:i:5 ' :5:5:5:5:5:5:I:5'5:-:- 5'5'5- '2'2'2-2-52-2:2-3-2 5.5.5.5.5.5.5y:5.5.5.5. -5.5.5.55.5.5.5.5.5.5.5.5:5.5.5.5.5 -,-.5.5,55.5.5.5.5- :-:-:-:-: :-:-:-:-::1:-:-:-: -:-:5:5:5:-:-:-:5:5:5:-:-:-:-:-:-I-:-:ya-:-C-2-2-:5: -:-:-:-:-:51- -21:-1-r:-11:-:H :-:-:-:-:+:-:5.5. -:5:5:5:'S:3:5:5:3' -52-2-2:2'i'2'I'1'2-2-I-I-2:2-2' .. 55.g.5.g.5.3.5.5.5.g.5.5.g.5.5.5.5.5.g.5.5.5.5.5:5'-'- .5.5:5:5:5:5:5:5'55:5:5:5:c5:5:-:-.5, 5.-:5:-:-:-:c-:5:-:- '-'51-:-L:-I-:-:-: .-:-:-:-:21:5:f:5:3:5:5:5515:5:5:1 5:5:5:5:555:5:5:5:g5:5g-g-:-g5g5g.g:g.g.5.g.5.5.5- 5.5.5.5.55.5.5.5.5.5.5.5.52.5.5:5:5.5.5. .-:5:5:5:55:5:5:5:' 5.5:5:5:5r5:5:-: ':-:-:-:-:1:-:-:1:-:-:-:-:-:-:'' i1:-:235:-:-:-.- 5:5:5:5:5.5:5:5:5:5:5:5:5:5:5:5: 5.55.5-.-.-525253.5:-:5:5.-:5:5:5.5.5,5.5:5:5:5:5:5:5:5:5.5 5.5.515:5:5:5:5: 525:55355555153535153--5g.g.g.g. -'-'fig-jfjljlj' -.-.-:-:-:-:-:-:-:-:-qy:-:5:-:- ' -.5.5.5.3:25!-:-:5.-:C5111-:ft-Z-:-:-:-:-:-:-xc-:-:4-:-I-1-:-25:-Q:-5+Z... .4-1-:Or'-Z-1-:-:-1-:-14:-:-:-9 '2'3'2'2'2' 1-:-2.1-g4,,u4.g.y:-..g.1.g.g. 5.5.5:5:5:-:1:5:5.5:-xg5:-:-:-1-:-:-:-31:11-:-:-3:12-:-:-:-:-:-:-:1.-:-.-:-:1:-:-:-1-:-:-:-:-11:1:-:-:-:-:2:-'-:1:-:-:-' -1- .-.-:-:-:-:-:-:-. . . 1 - 5.5.5.5.5.5.5.5.5.5.5.5.5.5.5 5.5.5.55.-.-:-:5.-.5.5:-:-.-,-:-:-:-:-:-:1:-:-g:-g5:-,-:-:-:-:-11:1:-1-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:N-:1:-:-:-:-3-1-:2:-: ' :-:-:+:-:-:1:- , I-2' -'-:-:-:-:1:-:5:-:-:2:-1-:-:2.-. 5.5.-.5:-'-:5.-:5.54:51-:-2-15: ' ' '-1-:1:-.-:-.-:-:-:-:-'-:-:+:1:-:1:-:-'-:-:-:-:oz-:-:-:-'-rFt-:-r:-'-'-.-:2:-:-:- .-:-:-:-:Zz-:2:-:1 2-I+! 5 .,.... , ....... N5 .... .5 ........... .5555,5.5.5,5.5.5,5.5.5.5.5,5,,,5g5g5g5::g5,5,:,5 I 55.5.5.5.k5.5.5?.5:5.5.5,5. .5.5.5.5,5.5.5.5,5.5.5.5.5. .5.5.5.5.5:5:5:3:5!g5:5:Z5q5gt5.5.5.5.5.55 .5.5.5:5:5:5:5:5251525:-35555-555-5 .5.5.5.5.5.5,2, ..55.5. 5.5:5.5.5.5.5.5.5.5.5.5.5.5.-.,5.,5.5,5,5.5.5.5.5 55:5.5.5. .5. -:-:5:5:5g5:5:55'-'5q:5:5:5: 5:51-:5:5:5:55 .5.5.3.344.5.5.5.5.,5.5.5.5.5.5:5:5:5:5:5:5 :-:-.-.-.-:-:-:2:-:-'-'----'-:1:-:-:1:2:-:-.1. ..... ':i:2:1 ' '-'21 -:-:a-:-554:-po:-scifi:-:-11:-g-2-:2'1-1 5.5.5:5:5:5:5:5:5:5:5:5:5:5.5 5.5.5:5:5:5:5:5:5:5:5.5 .5.5:-1-:-:-:-:cg-25-:-:-1-:-: 1.-:-:-:-:-:5:-:5:- -:-:-a1:2:-:2f:2S:25:25:5:2:2:k1:?:2:2-'- -5 5'5'5'-'Y'if'5'2'5324'i'5'5'if'5252'9255325313532523222722122725222212 1 .,,.5.5. 5555 .5.5.5.5.5.5.515.5.5:5.5.5.5. 5,5.5.5.5.5.5.5.5,5.5.,5.5.5.5.5 5.5.5.54.5.5.5.5.5 , ''23:5252515:3'5:5:5:5:5:5:5:5:525:?S:5:5:5:515:5:5:5i3:3:5'5:5:5:5:' 5:5:-:2:2'2'5 .-2:2-2'2-PZ-2-2-2+ '-P2-2-35'-252215525I5:5:5:i:5:5:25:3:5:3:5:-:TQ5:C:2:5:1:5:i:5:5:5:5:3:5'5'5:5:?:3:5:2:5'2 -32'2'2-1-2'C-3422-222-2327222232' ''' ' 2515232213:51525:-:7f!f5?5t5'Mf ':i:5:5.. .--'2-2-J ...5.5.5.E5:5.5.5.5.5.5..25:5.5.5.5.5:5:5.5.5:5.5.55.5.5.5.5 5.5.5.5.5,5.5.5.5.5- -.1,5.5.gg.5.5.5.5.5.5.5.5.5.5.5i.-.-.-.5.5,5.5.5.555.54.55,,.5.5.5.5:1:-.5 --- ,A - -9. .-1-:-:-:-:-:-:-:-:-:-:-:-:-:-:-'-:- .-I-1-:-:- ..-:-:-:-:-:1:-:-:-:- 1-:-:-:-:-:-::-:-:-:-:1:-:-:-1223:-:-2-:-r:-:-:-:-1-:-1-:-:-'-'-'-:T:7:2:-1---'-'2'2-1'2'2-I-2:2-I-2-I-' -'5'-'-'-' :-:-:-:-:-:-:-:-:-:-:-:-:-'-' 'C-242-If .. .... :EEEEE5E:.,.5-5EE5.5.5.5.5.5.5:5:5:::E5.5 .,,5,5,5,5,5.5:5:5:5.5:5.-.2 .. - ---- -'-:1:-.+:-'-:-:-'-:-:2:-:-'- - 1.of.5q.5.1.-. s, 1 - - - 55:4-.5.5.f - - -'-:-:5:5g:5:5:-.- .5:3EgE' 5 5 5 5 , I-Z- '5'5:5:-.M ' 513:5:5:5:5:5:5:5:5:5:5.-.-:1:-.-.52 N 2'22E1213E221E2222 ''2222222'2'2'2'2'2'2222222121E122E?5:222I:1.-. . . . Z2Z2Z5 '5 ' 5'5'5'5'5:5:5:5:5: .-.3:5:5:3:3:5:5:5: ':5:5:5:5:5.-. 1 -.21:Q:1:5. 121E22121322E222222122212Q52i1222221 ..2:2:222212222 2525235222522-:2 121212152515222222 '2122212T2I212'21 ' .21E22222?22E222225 '2'E52122 5222Q25?22222I22 2222252222221 122E1E2?2122:2: 5.5 21222523?21i2222E2:-: ':2:2:1'-' -.122222222:2. 2122212?21E221:2: -:-:i2222221f2. '22I 5 21:122:2: 1222221222227 1212251525 '- .5:5:5355:5:5i5.5:5:Qt5:5:5:5:5:5g:5:f:5:3'5' 5:5:5:5:53:5:5:5.- ' 5:f:5f:5:5'5 : 2-2 - - 5'5:5:5:iS:5:5:5:5:3:5:3:f:5'52l-:5:5:5:5 ':5:515:5t5:5:5:5 J- 3:5 ' ' . -1-:5:5:5:g5gg5,g:5:5f55:5:5:5:11 5.5.5:5'1'-:-:5:- .5.5:1:-:-:2:-:-: .2 .... .gzizfz '1rErE2E1E2E:E1f 2 -2-15255225552555151..r.r25E535Er:- .5E3E5E5E3?5i555?5E5E5:r .5.5.5.5.5.5.5.5.5.5.5.5.5.5.5.5:5:5:5:5:5 5 5:5:5:- :1:5:5:5:515:5:5.5:5:5:5:5:5:5:-g:5:5:5:5 5 ':5:5:5:5:5:5:5:5:5:5:-: . :5:5:5 :-:5:5:1:4l:-1-:1:c-15:5:3:5:5:5:5:-:5:5:5:5:5:5:5'5:5:5. . ' ''5:5:5:5:K5'i:5:5:5:5'35'2'7'2'I'2-2-2-2-1-2'2-2-2-3-2:2-2 - :5:5:5'5'5'1 .5.5.5.5.5.5.5.5,5.5.5. .5.5.5.5.5.5.5.5.5.5.5.5.5.5,5.5.5.,,.5.5.5.5.5.-3.5.5.5 .-,5.5.Z5:1.5.5.-.':-:-:-:-:-:-:-1-:-:-:-:1:-:-:-:-:-:1:-:-: . ' ' . . . :-15:3:5:2:1:2:2yg1:2g2-ig :-:-:i:-.- ''25:5:515:5:5:5:5:5:553312225:5:5:5:1:5:5'3F:?:5'5' 2224352-Z5Z-23251515:5Z535:5:5:5:5'5:5:5:5:5:23:Z5:5:5:5:5 .... 5:5:-:-:-:-: .. -1:I'I2I2I2l'I' ..5:5:-: .-.5'5'?:5:2'.. 5.5.5.54.5.5Q5.5.5.5.5. 1-:5:5:5:5:515,5 551-5-35353-3-3''.-2--5.5.g.g.g.g.-.g.g.g.g.g.gZg.g,g.g5 5.5.5.5.5.5251525.53515151595525Z5'5253519'-.5.5.5.5252535I515I-I-Z-:5:5:-:-:-:-:-:-Q-:-:-2-:-.1.1:-1-1-,..152-:1 '-25231532-2gZg.5.'.g.5.5 .I-2-Z-Z-1-:-:-Z-.-.-,-.-2-35:53-:-13:-:-12:-1-11 21:EgEgE5ZiE5EgE555E:1'1 5.5 ':'E2E'2I' 5:g:5E5g5:5EgE3:g- '535535552525E5E5E322252E225i3E5.- .5.5252525E32535E553EEE:E122E2EIE25152525EIS121515135rE1E:E1ErE5E3E5ErE55555252555555525ESE5i5E5E325EQ25EiE-:- .2-1 '''E222252121212351512222.'''ElE55525E3555353I55?E5E3?f.59.?25E525iiE?i5E5E1 5:5.5:-'-'-1- 55:5:5:5.5. 55 5.5.5.3:5:5:5 ,g232gZgZgIgZgIg2-'5 5251525:-15:5:5:5:5q:5:5:5:5:-: 5:515:5:5:5-1525:515:525:525:5:5:55:55:5:5:5:5'5'5'5:5:5:5:5:5'1:25:1:517:5:-25:34315:5:i:5:5S:li:3:5:5'2P:f-.-:5:5:5'1 .-.-25:525:5:-. '2:I3Z3Z2f7f7Z5I512Z''f'5:3I5iZc-ii-bZ5Zlnu. '-45I5I5I5Z5Z312Z2' jj 5:5:fg3f:2:2:555 .5.1:5:5. 5.5:1:2:5:1:5:1i:2:2:I.-. :3:5?:5:5'i' 5222222212155E:2t2E2E:2.g.- 1'T:Ez2125:2:Q:5:355:Z2:2:2:52:i:2g1g'' 2123252552155t51g:g:gi5:5:5:5:Q:ji:2:2:2:5:5:5:5?:2:EzQ:5:5.5.5:5:5:5:g:5:2:35:5:5:2 -1-:3:g:g:g:- -'-25:515:5:21215:Ez2:Q:5:5:2:5: 1-2:2-2- .-.-:5:. '5:5252552115:5:5:5:5:5:5:5:5:5'5:5:-:-:5:52i:5Sf5:5:5252525'2 '512 ..5:-:5:5I5f-33222-255313:5:5:5 ' :3:5:5:5:5:5S22125f5F2Kf3:5f525 '22212231225:5Z5:5I5:5:5:5:5:5:5:1..3:5:5F:5:5:5:5:5Zf2Y2425:5:5:5:5:5:5:5:?'i5:5:5:5:5:5:5 2'7' ' 5251555553255 .5zgigsgggsggggzg2g5gsg32g21f1''11125252s212f' ' .222255EsizisiiziziaizifswsEQEQESE2... ...22225z2sis2sE3?2552SfiiE52552251: 2525E1E???E525ii22i252252255212121If212sEa2Ziiz2ag252s2a2a5HSQQQQEQQEESQS' .,.a:2:2:., 5 22122222223 2:25222522232222':': 2'2 E2212221512122E3S12121QZ?f21251Ef3?5222221212225212222522222222222223?2222E122'2222222 2 3'f55ff55ff5f55121225513121 22222212E221E122:2 5.5 '2'21E2215iag '22,2233E1:22221222'21212121212222''1EI212522221222221?i13i223222jf51225r 25'fi51 '12221222221:1E12122. 21-:-:-2222i2E2Eif1?3222192152222222222' '222E2:2E221222'2 -1- .5,5.5.5.5.5.5.5.5.5.5.5,5.55.5.-.5.5.5. -:-:-:-:5.-.-:-2-252-:12-:-:-:-:-:-:-:-:-:-:-:5:-:-:-:-'5' :-.-:-:-'-:-:-'1:-:-31:-21'-:ff'-.vm-'Y'5'2'5'5'1'5'2'2'2'C ' ' .5.Q:f:5:5:5:5 '-25:35:51-:-: 5:5:5:5:5c5c5:5:-:-:1:5:5:352155:5:535:522:523225:5:5:522:5151525 '5'5'1'5'5'5:5:?:5:5:2:2'- 'I525123525:5:9p5:5:5f'ff:5:5:5:5:5:5:5:5'5' :3:5:5:s5:5:3:a ev -:-:1:.:-:- '-1:3:f-1:2:1:f:2 s:z:s:z:5: +1 -r-11:5:.1-:1:ir2:1:'-':2:5:5+1-1:1:f:2:'' 1.1 'gzgif' j :5.gE3I5.- 5.5 ' 5...5.- 1:-E5Ei5E5E3.5. 5.5,55g2,., fjijfjfgljf Q:f:5:22:2:Q:5: 5.5:2:5:5:5:5:5:5:Q.5.5.5.5:5:P2:1:2: . 1-.2:2:2:222:1:2. . 2'2S222'2 53fIf3f5'fffljZg -f5E5f52Z52525:' 2122225252222222 '222521215 ' ':i22222i22222252E2E2E222222522222223 222222E2f2325E2222 H '212f221E1 ' 525f525fS52525f5f2525f5g-:525f2:S52525f22?52ff5:5: EISEFEQEEESEIQI '2515152E135Eg554255523E1E5f?53f555E5ErE:':' :5:gEQ2i322I5.5.5.2:3.5 -:5:52525252522252525232222212222:1:2:2. ,,g5-252552525.. -.-fff?:5:5:5:5:7:5:-:1:1:-:1.-. ..:2:2222222222222222222222i2122QZg2-2-I ..1:3:i:-:1:-:-:-.-.-.-.2.-. ,-.-22225221-2-2-2:2 '222522f5f522f5?f5f5f5f5 , 5:5:5Q5I5:5:5:5:5:,:g5:5g:5:5:5:5:5:5.5'5:5:5: .5.-:5:5:5:5:52:5:5:f: 5:3:2:2:ix32:2:2:I32323252g2g2g2g1gZg2gZgZg2gIg25152265Z5:5:525:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5-5 5 ' 25252gigigig55152515252515:5:5!525:5Z5qZ5:5Z5.5 :5:525:-:5:5:5:5:5:5:5f45:Q:5:5 515:515f12:1:2g2gIgZgISgIgZgZgI :5:5:5:S:5:5:5:5:5'- .5.5.5.5.5.5.5.5.5.5.5.5.5.5.5.+.5.5.5.5.5.5.55.5.5.5. 5.5.5.5. 5.555.5.5.5.54,5.5,5.5. 5.-15:-:-f:-15:-:-:1:-:13-:cc-'-:-:-1-'-:-:-:-:-:-. '1:-:-:-1-2-:-'-:-11:-L-:H-:-:-:-:+:-:-: -gl3I-2-24I'Z42-24-24-I-2-If-:-1-I-I-2257:-2-25.. 5:-:-:-:t-:-:-:-:1:1:-:-:-1-:-:- -:-:-:- 1'-:5:5:5:5 5'5'5' '3'5'5'53'5'5'5'5'5 .. .........,,., , ,,.,,,,,5,, .... . .. ...... N ...x ............ .... .. ................. .... . .. .. 5.5.g.-5.5.5.5.5.5.5,5.5.5.1.5.5.5.5. .5.5.5 .51515.5.5.5.-:1.-:-:-:-:-:-:1:1:1:-:':-:-:-:-'- -:-:-:-:-:-:-''-5.g.5,5.5.5,5.5,5.5 .5.5.515.55:1.5.-:-:wax-.-:-:-:1:5:-:-.-:-:-'-' -1-:-2+:-:1:5:-:1:-:-:-:c-:-:-:- ':-31:5 :-:-:-:-: 5:-:-:-'-: 2'2'2'2'1'I-2 -1 g:g.g:g5g5g5gf-- '--5:53-3:5:5:5:5.5.5:5:5:5:25:5:5:c55:5:5:-:-S:-:-:1:-: '-:-:-:-:-:-:5:5:5:5:5:5'5: '.5:5' ' :1:5:3:1:Z:3:2:2:1:' 'g2g3g2g:5I-I- 1:-1-:S-:515:5:535:5:5:5:5:5:5:2:2:2:2:232:1:-,- ,,I:Z3Igl:IgI52525255152-1-I5:5:5:5: .-:-:-:f-:-:-:-:- :-:-:-' 5:5:5:5 525.-. ..,f2:sr2:5:5:::2:1 '-1:2111 ,:5:s:5:z:f5:5:5:s2:?1:5:5:3:5?5z:5?5Ef 5151:3E12121E2E2E2E2E121S-.- . .:2:2:s:5z1:5:s:5:.. -' 25222E222E222E2E252E221E1ErE1E:E:g:?15:5:2:2:5 523:5232gf.g2g2g.g9g2g:gfg1g1--- E355 2:z:5:2:5 :3:z:s, 1.25132 515152. 5.5.5:5:-:-:-:-:5:5:5:5:5: -:-:-:-:-f:-:-:-:5'--- 1-:-:-:-:1 2'32gig.,'-2g2gIgIgIg.g1gIgI5:5.g , I-:-:-1-:Q-:1:-'22 .5.5Z5: 5:5255 5 jfjjljiifgljl'.'H'fjI:I'I .-:-:-:1:'1:-:-:-:-:-:-:-:5: .2-:1 :'.5:5:5:25:3:5:5:' -'3'I:5:5?'2'2'2'3' 5 5. ---- :Yi5:525251223151222:-:1:2.232222222222225222122222122f2212221222'5-.-IES., 5121523 5:5:5:5:5:5Q5:5:2:-, 222222Ef222222222 :5:5:5:1?:3:5:?' :7:5:5FR2:f:i:?:2:1:3:2:22222 2222122:f22322212I2222:I2222222 '2'21222 If-2.2-22 22232125 :i2221:if12f2 ' jf:I31112:21212:fzlff-2:2151-I-I-IE15I2I515I5'i5252515I:Z5j5:5:51515j51-:1:-511:55-5. 55.5:5.5.5:5:5:5:fg:5:5:5:5:5:541:5:5:5.5. -112121523252-'-' 5 5555 :5:5:5:5f:5:5:5.5. -'-:5:5:535:5:-1-:-:555:Q:2:2:1:2:1S:2:2:2:2:2:2:3:I:2:'.. -3-12525 151123111 5252512 :-:Q:5:ci:1:3:2 5 5. .... ' - - -- 5.5:5:5:5:5:5:5:5:Z5:5:5:5:5:5f:5:5:5g2g2g2g 235515232gg.gfgg553.5252ggIgk:5:5:55pi:5:515:5:5:5:5:Es515:5:515:5:5:fi:5:5:5:-:-:5:Q:5:5:5:5:515:55:5:5:5:5:5:53Q:5.5.5.5.5g2gQg2p2gJ121.g. 5C:fjIj2:I:2:I:IjI:155I:l:IEI:I1I:fEZ:' -2:5:Q5:5:Q:5:I211Qpgggfgmfgfggggfggg 5.1.,.5:5Igig1Q:5:5:515:45:5:5:5.5.5.5.5.5:5:5:5:5:5g5:5:5 5.5.1352 5:132:Qg2g5g5g5g5,5g5g2g1g2gQ 5.5.5:5:5:5:5:5g5g.g.g'.-.5.5.5:55.5.5.5.5,5.5.5 .5.5.5.5.-5.5.5.5.x.5.5.5.5:5.5 :5,5.5.5:5 -:-:5:5:5:5:-g:5.5:5:-1535353-5.5 ,.g:5.5. 5.5.5.5-.5.5.5.5.5,5-.5,5.5.5.5-.5.5.5.5.5.5.5.5.545:-'5:5:5:5 .-.5.5.5.25.5.5,5.5.5:5.5.5.5.5.5. 5.5.5.5.5.5.5.5.5.5.5.5.5.-4.5.555:5:5,5:5:5:5:5:5:5 ::::5:55:5:5:5:5:5:5:5:5:5:---5-.g.g:g.g.5 .5.5.5.5 .5.5.5.5,5.5.5.5.5.5.-.-1-. -'-'-2?:-:-1-:-:-:-25:5:5:-:523:-:5:f:5:5:57.5:5:5:5ff5:5:5:5:55:22:SHS-2?-:fr-:-:-:-f+:-:-:-:bg'i:515wx9!ff:-:5:5:- .... 5:5:5:5:3:-:3:5gi:5:5:TZ5:k5:1:5t5i:5'f5'53'5f'5'5'3' '5'1'--72'2'22i'2'?-2322-2222132 A 2.-.2222232Z5i325Z55:5:5:5 72525:5:313:55'2'2'3'2'755'2'2'2'2'2'5'52,.,...,.'-'- .'-105535:-:-11. -: 5:5:5:5:??'S2l5. ,.'5'.5.'5,'2i.35?'2: 5.5.5.5 .5.5.5.5.5.5.5.5.5.5,5.5.5,5.5,5.5.5,5,,5,.,.,5,. .:,.,:5.5.5.55.5.5 .5.5.5.5.5.5:5:5.5.5.5.5.5.5.5:5 ,5.5.5.5.5.5.5.5.5.5.5.5.5.5.5.5.5.5.5 .5.5.5 .5.5.5.5.5.5.5.5.5.5.5,5.5.5:5:5:5:1:5:5:5: ,5.5.5.5.5.5.--.5.5.5.5,5.5.5,5.5.5.5.5.- -5.5.5.5.5.5.5.5.5.5.5.56 5.5,5.5.5.5.5.5.5.5-:5:5:5:5.-.5.-:5:5:1:-:1:1:1.1.1.-.-.-.-:-:-:-:-' ,-:-:-:-:-:-: 1:-:-:1:-:1:-:-:5.-.-.5,-.-.-:1:-:1:k .gZgIgIg. '5Zgigigl515252-I-I-I-I-Z-25:-251511155:5:5:5y-15:-:-:5:- :-:-:E-:-:-:-:-:-:-:-:-:- :2:-g-:-:-32:-J-2g2'2gIg2'2gIg1325153513253-231:7555252325-152515:5:515:525:52525:5:5:5:-:-:52-:-:-: 55.5Ig2g1gZg.g. '-I3I5Ig:525Ig2gI515Z5Ig15.g 5.5.525252515:5:5I515:5:5:53:5:5:5I5:-:-:-:-:-:-3:-2:1:-:Z1:5:1:-:I:222:332:2:2:2:I:2:2:2:2:2QZg2g2gI31g2g2'3233535325252125IgZg15:5:5:5:5:5:5'L5: I52515f?2:Z2 ':5I52f5f53?55F132525:5:515:5:5:1:5351527324222252-:-:-:-:-:-2-21:-3-5222222221222222E25525I5?25:5Z5T5:5:Ef:T3:1:2:2-2-2'2:2:fF1'If??fE24?:P:1:1f2:2:4ifF2i212I2' '52f:5SS:5:i:-:' ':1:5:l:5:55:1S:E5:I:if:iz2:iz5zbliokiclzltfzi:SG:--M'.'.'f'2'222221?212121212'22-2-2-2221222i22i32i3222i4222i212I2I21f223'ki ' ' ' ' E525 5 .5.5,5.5. ------ -- 5 .5.5.5 5E5E5E5EE5E5E5E5:5 .. :2221255222222222 .-:.:4.Q:-:-:-1-gg,-.-.-.--'51-'5:-:-:,g.:.2.g:gL5:5Hi.5.5.5.5,55.5,5.5.5:5:5:5:-:-:1:1:-:-:-:-5:55:5:55:5:5:5:5.5.5:5:5q:5:5:5,5. .5.5ii.i:5:5-5 .5.5:5:52E35'l-55:5:5:5:5:5:5:5.5A .,.5.45x45c+.5:k5.5.5. . . . . . . . 163 -1 A A 7y:e -e t -4-f f rj? sf'?f t- l sifsgyxnayf me 17323836 mb E252 L s 451 4 y ,l li l il 'A ' 1 ff Qi, V Qi 'Q M ffl ' l l l l Zgafz 181111 Baseball has one of the most notalrle records of any sports for the last few years. Inter- est in baseball is intense. The number of men out for positions give an index of the feeling. Coach Horton was well supplied with good baseball material and he immediately set to work to round out a team. The squad representing Normal on the diamond was composed of Capt. Victor Lindquist, Bunk Young, XVayne Patton, Victor Jones, YVarp Barr, Maurice Graft, Vincent VVl1ite, Thurlow Myers. Fred Strange, Fred Graff, Don Allen, Floyd Drew, Cyril Miner, John Robin- son, Lawrence YVade, Nathan Mohar, and Carl XVoerner. Henri Mohar served as manager and trainer. Thurlow Myers, Bunk Young, Barr, and M. Graff were on the delivering staff while Lindquist, Strange and Vilade received. The season was opened with a practice game with Bradley. Normal had not yet found itself and received a drulrliing of 28-2. The schedule of games are as follows: April 16 Normal Lincoln . .... .... t 5 April 17 Normal Illinois Col. . .. . . . . ll April 00 Normal Charleston . . . . 4 May 4 Normal .... . . Vlfcsleyan . ..... . . 7 May 6 Normal Lincoln . ......... . . 5 May 14 Normal Northwestern Col. . . .. 8 May 18 Normal k Millikin . ...... . .- May 20 Normal -- Charleston . .- May 2-1 Normal - V'esleyan . . ..- l May 25 Normal .... .- Illinois Col. . .- 4 X' bgjl May 27 Normal .... ..- Bradley . .. .- R17 May Qo Normal .... - iviiinkm . .. - ld , LA 'W p I l 71X l il X 164 lp FQ 1 l pq D as-ff re e Q Qi QQ L L, 9195 r f ' -rv 'H A 1 N 'ff' 'iff' 'i fi fffwf Marks? . Q-Pi? 03+ Y 'ug l lL u gb .Q 'KW ,fx 153 EA RS Track i Good track material was abundant at Normal this year and the spring season witnessed more interest and enthusiasm for track and field than has probably ever before been seen on the campus. Coach Don Karnes, who had charge of the work, spent the wonderful spring afternoons and evenings bring- ing out the best efforts possible from the thinly-clad athletes. The team was captained by McCreight, holder of conference record on 220 yards low hurdles. The following men completed the squad: dashes- H. White, Hillman, Lynch, Basiield, Boyd, Coe and Husted, distant runs- Basting, Brotherton, Cockeral, Hewitt, Elson, Schutt, W. White and Robin- son, hurdles-McCreight, H. Dean and Vaughn, high and broad jumps- Nolder, Davidson, H. Dean, Vlfinegarner, and Harper, pole vault-Hamil- ton, Davidson and Glaeser, weights-Firley, Beur, Sapp and Wheeler. Nolder broke the conference record in the high jump in the Wesleyan- Normal meet May ISt and his new record again in the Eureka-Normal meet l May 15, reaching a height of 6 feet 326 inches. in , il VG, lb, I ig if 165 'QW 125 AAG' as A' fvfaiif V' fi ' ' 'Y MSYRNC? Q33 w I FQ L3 3 :6 XJ f -r- A EEFQJQDQQK wwf ' I EA The track schedule follows: April I7 Dual meet-Normal 26g Bradley 104. May I Dual meet-Normal 48g Vlfesleyan 83. May 7 Quadrangular meet-Normal 35M g Eureka .252 5 Lincoln 4Q Vlfesleyan 63. May I5 Dual 1llCCt-NO1'l11Hl 643 Eureka 67. May 21 State Meet. NCJ1'1Il3l'S new Cinder oval was worked and developed into a good track during the spring Season. No doubt later years will still add improvement. QE ff' fxl l D 166 Q1 'Ge . I. I .5 E ,. L.. -. r .... in. - r .,.. K I 5 6525555525225 x s ,. 'Z:Z:f:I .'5' 5.5.3. 2 s Q5:E:5:5:5:5:E: v ,... x x P 5:3:3:5:5:3:5:5 '.'.', Yf'! ?'1!'2'.'f.'.EK' .'!'.'.'.'.t'.'. .'. , f'T'T'??Y'T'T'I'f'T'T ,'I'Z'2'f'. I'f T'I'I'I'Z'IjZfffI 51253525222252E2E2:2E1:1:2:1:1:1:1: 7:3131523:-:-:-:-:-x-:-f52-:-:-:':-:-I-I-:-2:4 1 5:1:f:3:1:3:3:5:-,5'L-5'5i5f:fE:f53fff5ffff5ffi55 ' E15135iff753f757fjmkT55fifif?53f51:5f3f3f5ffff5if 1 ......,.....,......,.. .,..... -' :V1-'-I-:A:A54:-1-1-:-2-I-1-rc-:-1-:V:A:ri-:-:-:-:Si-:-:-:rz-:-: -.-.-,-..,g.g.3.3.3.-5.3.5.5-4.3.3. 3.3.5.5.3.g. -' 2712112211533i3S2114-:-'-'-:-:R+1-3:-:-I-:-1-:-:-: f .... 'i'3:1.5.3.3.1:i:-:-. .1:f6:1:-:-fl'i:1:5:3:1:1:1:f:1:3'3'i' . . . . , . 'No . ..... . ....... mg ..... ,.x.x3,..+, ...... ...... . . ,. . . . ..........,. A .- 5 .,.... 1' A, wax ...,.. .. .... .2 z,,..,.,...,...: ...,.. , .....,.. I :-:-14:-1-523'-:-1.15:-1' '6:A'-g-:-x-:-:-:-:-:-:-:4:4:-:f:-:-:-: 3:::3:5:5:5:::3:,3:3:5.3.g ' fzf22:2:3Q'1:f:Q:f:Q??Z1fIf:?f15353555353555155Ei51535lf?535323iz3:5:f:1:5:5:1:3:3:3:3:i:i:1 2-IC91'-I-Z-If-2-I'Z'Z-I'Z-Z'Z-If-242-I'-1-PPI-I-I-. X '-'-'-'-K- '-'-' - 4P'-'- '-'-' I :Eff I 2112522 I I I II 7:3:5:5:52.-13212315:3:3:1:-3515232513 X .......... Ilfffifilll II11122-1-I-I-Z-I-I-142-If .. .g,g.g.g.g.:.5.5 'Ez-:.:+:-Sz.. ,WI Z I . 3 .... 5 . ., ..., , .. .... . ..... 3,g.5,2.1. 4.1.1 ,.5.:.5,:.:.3.g.3. . 1 555555EfffE5Eff3F25IE1:2Elf151212133:55.1'.','5:.'.'555'.'.'.'.'.'.Tj . ................ I .4:l:,:l:,:-Z-I+. ' ' ' ' ' ' ' ' ''1'1+iii'3:32 -.-:-143-3-:E-14:-:-1-:-:-1-:Az-xl 3:3:3:Q:31f::::.. I :E5E5E5E5E55r5r' QE222E2E5E5ZjEgE5E A5gEgEgEgE , . x . . , ...... . , . . . . K-:-:V:-14:-1-:':-:-:-11:-3-:-g 53:22:21 Q:Q:2:Q:Q:Q:1'if:Q.Q.Q.Q'Q'Q'3:5:222:2:2IQ:-J'f:f:Q:f5Q5f5ffQfff ---.-ifE1E132E13515231515551Lifr525rfgE3 E3EgE5E25j1::5E5EgEgE55gE5E3EgEg:. 'fgE5E5E5E5Ef5g555E3EgEgE5igEgE5E3E :- 3-:-:bm-:-:-:vi-:,:-1 gf' .. ff...i..,,.. 5222252555555255525E55525E52555255555Ei555E525E5E5i5i:ff'5?5E5E5'5'5' ---5-ii?iiE552if2252if2fi25555ffE2E2i2i2?if52i25fE2i2ifE . '''5555555f35i555555535i5555555?if?55?5?5555555355555553 55555E5355E52Z3E?35E5E5E325255255555553555355555553555?55 i2i25fi.,:.. ' EEEQQQEQEQEQ.EQEQEQEQEfE5EQEQEQEfE?1:'fEEEQ5:QEfEQEQEQEQ'5'5'5 2555225552532522552Q532555agegag552gzg5555ggggggg52:sggg5g2:j,ggggga5z5zQ5,.1.1 E-5-f-:AZ-11:35 :3:325:311:3:3:i:713''.-!:f:34fQ:f:f:Q:Q:j: f:f:f:Q:f:3f:f:Q:f:3f.f.1.if'!:f:f:2:f:1:g:gigIg5 .3:3:1:i:f:1:i:f ' 4 1 ' ' fifZfE2EfEiESQEQEfEQE2EQEgE5EgE35g5fQgE5E5E5EEE55ErErff15EfEEEQEf5Q1?fQEQEQ52EEEQEZEQQQEQQESEEQEZEEEQSEESEQQE5253552 ' Q :A5555555555555i5555555555555555555525555255555555555555555555ff5E5f56253555552335555f5f5i5E5555555ZEfffgffff552555552552 E 2 Q:Q:Q:Q:Q:f1fQ5f::fi1:fkf:Q:f:fZf.jf -:...5:3:'5:E:f:Q:f:f:f:Q'' 2:13:1:gg:::::g:gZ:f:Q:f:f:Q:f:2 :Q:Q:f:f.'f:f:f:f:f:f:f: 3 - 225225525isS2?. 5555??iF?5??5iSf'I:iiiiiiiiiii'5255 55' 55 ' 555'EfEQEQEfEfE5EfEfEfEQE25EfEQE5EQEfEfE :a:z:s:5:z:z:e 3 1122'I-1g',g2g5gsg2g3gsgs ...1..sg5gsgsgf:ag5s2gz,,1. I5155'55515251,-51351515151511'A ' ,.A.4A gggzgagggzgggzgg, . .3,3.5:5:I:Q:Q:Q12:Q2f:Q1TQ:E:f:f:f:Q:Q:Q .f:f:f :2:f:Q:3i3.g.g. 54.5232131212:I:Q:f:f:Q:Q:5 ':QzQ:Q:Q:f:f:Q:2:Q:Q:f:Q1f:Q:Q :Q:f:Q:f:f:f:f:Q:f:f::: 1 ., E2EIEIE15122E22293222E3E5EgE5EgE5EgE5E5:4 IE5E5fEgE5E5E5EgE5EgE.... 5E5E5E5E5E5E?555:2:ErE1E1Er.EIE1E1ESEIEIEIE2Z122IiIQ2III452gE1EgE5E3EE3E5E5E3:5:5' 1E5EgE3E,,, -.-.-.153515i575I515'F535'Ffff1:3:313: 'v.-jf. :5:3:iI3I1I:I5I5I5. 52525151535 :ififififffifif 3fif357555355fif-ff-f'ff54f'?f5:3f3:3:3:I-:i:i:5:5:i'.i311:i11:1:5:3 1 535E5E555E55Ef52E5E535E5555555 'Q ' 2 E: -.-. 1.1.1 EQ525252525222-f1?EEEEQE5E5Q5Q515:5 55152525252525252525Q5Q5Q5Q5Q5:5:5:5:535Q5Q5Q5Q5Q5Q5252525i5Q5g,5355E523EEEEQ2E525Q525Q5Q5i55i52525Q5f5Q5Q5 1.1.1 .1.1.:5555555555Q515,5. 52 252E222ifisi2i5igiS5i5igig5355igi 'Z'I'EEE5E5i5ii5iiiii?iiaE5?Eiii?ii2ii5222222252i1E2i52i2i2if5222E:a5z5 ....A....,.. 5 :Q:5:55552555555555i5555555QE555i5'5'5' 55555555555555555,E555555555555Et2:25 5ag5522522Qsi5252ig:515525i5i5E5i52E555QQ2Q2Qg5g5g 2222525 ,HE2is55is52525fiiigffzgsisgegagaga I 55555aS22s22 E25?2255i2izQE5 2252252Q55sisisiiieisieiiizisEsiiziiegaigezezra , gagsgsgsgigega 55.1.1.1 .1.1.:.1.1.:.1.1. 1.1.5.E5555555555535i5i5i5E5i.1.1.1.:.1.i5i55555252555255f5iE35i5i5E5i5E5E?i555 55555E55555E5i5555E5i235E5i':i5i5E525E5E5i5E51515 55555555555f5Q5i252525i5E555555 15i5:515:5f5i5:?515f: 5555535551515 ,.,. .,... I . T:i:1:1:3:i:Q.i652.z5Q35gyi3:3:f:i:5:i: 1:1:155:5:2:smffgiiizgsgsgsfsgsgigfgsgsgf ' 5 E5E3E5E5E5E5E5E5E5 A ' 2222552552252555522225555225522522225151L:siz21Zg5i2E5E2EsS52z2Q2 ,15:Q12:21:iE52iii2?fi2:e:1:52a?f-3-in-:IS ?E52E5E2ESiiz:a:s 355535711 'Q'Q'Q:f:Q:Q:i -.5:Q:Q:f:' Szzzglizzgzfzf ' 115:-:fzi23:15:5237:1:Z:7:32595553:7:j1yf:f:f:2:Q:f:f:Q: 325322251213 .5 ..,.32255555222525252255222525Elf5T222:325EEEEiiEf5z352s5f1f1 ifE2332552251..Qi5'iii'5iie5?i?i55:QEEEEEEEEEEEEEESQEQE5SZ5'5f5' 3555i5Fg151i1:5Zf5.1E22152a25?2i2E5iiE?f5''225i5Q,,... ...HK-. .5.,.... z- --.---- 1 5A1A552222SQ525E2E22522225a2S:e2f.e5e2siS?f5 + 955555555555553555222255 'Qeiaiaiiiaisiysisiaisiz55g.'1is525z525252f .1535 Q15122535525Q555153555255555555'Ag525555g5I11ig5gi5555ggQP525EQiQE555525555552Q22552Q522QsQz52,,,i55sQ52a52i252i'Zg221'.g5i55z25g?f555gQgi55ag5jjf5 ,... E55555555EgEg3CgE5EgE5EgE5E5E15.I55E555E5E?sEgE5E5E3E3:gE5Z55' 555355EQEEEQEEEEEEEEEEEE: .55555:5:I:ffffIffi51:IIFfi5F'If555522532323524523EgE32gEgE5E5E555ErE5EgEgE5EgE53Q.525EIfjw---M.--w-N.fQ2F1if'55Ffi:Fi5Z3IfZIIf5I55E355253if55255E32:': 4.:::.E5EgEgg1:.:, . . . . . 5555E55ESi25551.fIiif1.:QEEEEEESESEEEEEEESESZf52ff'f,:gZii5i5i 52555g'g1f1f1f12fgg55555255552222255E:52i555i352i5Q3QzQg1i1f?1i1ffj1i2gfg-Qj5is55953sis543232121:3-Ijg5g551553:2:5:s:5:5:5:5:2:5:5:2:5:i 1 2592+-'E1E1Eii3E1E2E2E2E2E2 53252525225 51553522252322252525252225222E25QEQEQEEEQSQEQEQEQSQQEQEg?323E355555555555535EQEEEQEEEE5552255E523252555535555555325555535E355522255E25Q22EEEQE25Q52EQEQ52EEE2225252E252EQE2EQ225g:Q'5g55Eg.,,, E132123I:2:2gi:2:251:2:I:Ii:S:1:f:2:2:2:2:1:i:I:lg2:2:iz1:2:3:+:-:-:-:-:A:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:- 1-:-:-:-:-:gfcg:513:gr3Ig:515:gi552313252gtgigi121217:2:25:231:2:2:I:1:I11:I:5:?:2:2:2:5:2:555:5:?:5:3ze-:-:?:-:A:-1-:-1-:-:-:-:5:-:5:-1-:-:-1-:-:-:A:.:-:-:-14:-:-:-:-:-:-:-:-:-:4:-:5:- I I w...---.-.'.'.-.-.w...-.-.-.-.-.-.mag-w--aw.-Aw.,.w.-.-e.:-'MM'---oc-:Q-:cc-: -.-.-...M-M.-....,.......,.........,..............-..--.-.-.-.-.A.-.-.-.-------.----- -.ww-.V 167 x v .-,-.-.x.-.'.-.-.4.',-.3.g,3.3.5.3.3.3.: l ,l isis. fzf-ass 'ff'ff..1if f fs of S? OJ i 'JN QR! Aft .A .gf f' 'iff N QQ 0 Q3 1i1.l-3f..,c. me f7?Z3oX 7926 fl - Ji JTXJXVJT 'immli Lil. lv K, Mxxl KI 4 NN f Jog , 1 ' 'N ggi? l . I gg, IFJ l i i l l 1 W. A. A. MEMBERS Top 'I'0'lU-REINEKE, VVATTS, REINHAHT, SUPAN, FAGAN, ROBERTS, MCCITIJITOLTGH, SAGE, MILLER, A SHUMAKER, BICQUILKIN, RoB1soN, ADAMS, MITCHELL, MACKE, KOHLEY. Second T020-FOSTER, Hrfssl-JY, SIIUCK, ,fXLLEN, LvoNs, SMOGK, NEUMANN, STOECKLIN, NIE- MEYER., STUCKEY, MORTIILAXND, STIMPERT, NIARTINDALE, CARRITHERS. 1 Bottom 7'0'lU-HANSCJN, CUSTEII, BAUMAN, ASHFORD. COOSEY, GARVER, HLAX'AS, FRENCH, MAT- ' TEE, BEAN, DRUM, RALLY. l 1 A E. Q. Zi. This year several changes have been made in the constitution of the VVom- en's Athletic Association. The scholastic standing of its members was raised. Any girl who failed in a subject was not entitled to her full number of points. Another change concerned membership. Any girl of the school could be an , inactive member of NV. A. A. until she had won enough points to be an active member. She had all the privileges, except that of voting, that the active l members had. The point system was changed in such a way that it was harder l to earn points this year than it was in other years. The pin is given as the ig first award and then the letter. The highest award is honorary and is open to l , any Junior N women. This girl must have a good standing in her campus activities and her sports as well as in her class work. After a girl has been de- i cided on, her name shall be inscribed on the NV. A. A. Mortar Board. y XV. A. A. had a very successful social year. In September there was the Hike and Wfiener Roast. Later in the fall a matinee dance for all the girls of the school was given. Christmas time and Valentine time W. A. A. again entertained the I. S. N. U. girls with parties. -lust before the holidays the members of W. A. A. enjoyed a bobsled party which they will never forget. Among the most memorable dances of the year were the Hallowe'en and the St. Patriclis Masquerade. V X gag' . QN,f .lvl This fear some new sborts were added to the regular snorts of other PJ 751, 5 i ' as T years. They were archery, golf, and horse-back riding. Q f'N1l ' W IH 1 lj all .y A l l i fx, ly. for 168 z Ji . i f -g MA-A vg,3A, E l Q5 - ., L, -gf , , . . fff. 1.3 -T T M l N CW 357215 Msg, -Q js 9.91 I I E A YI HQ E! !7?Z3cfX EEL, L QW QI? ,ya QI? IM' I tu X! I Q IP lxx?xgI KU 6 EQ if-Q IKM II I I I I III, III I II I I' I I II I I I I ROSA STIMPERT, President , I I I I I I I I I i , I I I I EXECUTIVE BOARD I Top 1-ow-BOBB, CAREITHEES, BALLY, ROBISON, MISS NICIQINLEY, FRENCH, ALLEN, KOHLEY, LYONS, CUSTEE. gf Bottom-TOCK, HANSON, STOECKLIN, NIENIEYEPQ, NIILLEII, MCYQIIILICIN, NIATTER, SAGE. I I'. I .1 VD Z E I fm' 169 ITN I ik f , II N P0 A U 4 V , fwwf A F393 w 4 FJ , A r 1 'H lf, , ' 1 Q 5,2 4 4 N, PIN-600 POINTS W PIN WOMEN Top Hou'-VERA IIOLDHIDGE, FANNIE REINHART, ZEQLA DIXf3N, ESTHER BEAN, XVILMA MATTER, GRACE HANSON, DOROTIRIY STUCKEY. Second RON'-EVANGELINE CVSTER, ELIZABETH IQOIILEY, DELL CARRITHERS, LEOTA BOVVMAN, X-1, IIAZEL LYONS, THELMA ALLEN, LUCILE INIOIITHLAND, CRYSTAL PUCKETT. .ff W 1 Q, Bottom HON?-LYSTA GARVER, LUUISE ROBISON, ESTHER FRENCH, VVINIFRED BALLY, JOSEPHINE Q T ,A E fy CUOSEY, MARGARET HLAVAS, ROSA STIMPERT. , ' A 1 n I , I! r 4 fx 170 ' , f' ' K 124 so E. , A T' PN E Q5EQ me 172' 23896 'fm Z E ,A PQ Q 4 P E 54 bw 1 , , , w I 2 gf b'f -- A- -'77-Y fig I f if L ffqif? fy- ' ,V VA ff A ffv 175256336 3gx6U E26 2 , if X' 'e ' ' ' 'vt HQ ' QQ iff 435 Rf' X, X up ' I I, N Qlibamplnn Exams 1 A IRR Zn I Ag 'A A6 if RW A ,Q A 2 Top R010-I-ILAVAS, WATTS, BOWYER, I I I - MILLER, ROBISON. f Bottom-BALLY, FRENCH. CUSTER, A I A MCQITILKIN. ' , I W A M FRESHMEN HOCKEY W ? X M10 ' A j A A r I A A A HH N A Q Top ROM'-STOECKLIN, MCCULLOUGH, K SMOCK. w BOHOIIL-I'ILAVAS, GAHVER, HANSON. A 1 1 1 ? M A . , A I VOLLEY BALL P E A A E A If ' li 1 A Top Ifozu-STIMPERT, MCCULLOUGH, NEU- Q!! TI V MANN, BEAN, 1UATTER. YA ' ' Bottom-BUNAR, DIXON, SAGE. M44 - :Y wwf-1:1 M51 BASKET BALL TN M Q SOPHOMORE P2 x Aw A4 Alix ' RX A f , K FEV 172 'WRT 'IW ---A ,A fx- A? A 'ff-A A A A Q ' A- 12 3 NN 935 r QWQQSM fffwf WW W pg T01 ASHFUPD FAGAB, 1fOIILEY, ROBERTS, BEAN, CAmz1'1'1 IE1'Q bottom REIAEKI MARTINDALE, FOSTER, MORTHLAND, STUCKIY Zinteriur Bietns A , . X W A r xl? I f- J Q45 JY F 1 H fm 1 n Z , 'I :Nz 5, fi 6 Jw Xl W'- ,N if! ip if 2? l I 1 W IN N 1 l I V 1 N x 5 ' I Il' I N 2 ir: !Wl RN E L I I w Mg it lb M5 WM ! 1 MN kN 'PX 'T kj f Q 'fy Q 1 1' , S1 1 f1Q ff- 1720896 ffm 4 I 1 W 4 V 1 1 W ' 4 r 1 157 W , ,L wuu:g:::a:f-Jak-pw, , , av. ,, .,.., ,., . l rs -f - 4 , hz, In N . fi 'vs , gy ,.,, r , 1' , Q: 3 ' , . 1 if 1 ' 'P , ' 1. -- , ' vw., MW, W i 9 V . M-.M ,,.Mm,,' . . 3 L l . . Xb 3 1' 9 Sf' O G 3 ,Q x ,Q Qt. ' . 11 -g ' ,. -rpylurvgwz , ,g,JJ,,3,1! 3 , 0 v. ' ' 1 Q:iW2f2a22f- ,J S 5 ' i . f - 9 '- - I f . ,. ,Q - ,-,,,,v M, i fi E g mpg .. ,, f. 5513 2' 1530 . 5 w w img 2 '- 1 525, ir 75 , s . 4 ' ' 2 gif i. 2 ,ES I Is: 1 V ' lg - lf, 3 Z 1 5 - ' ' T . . X. U ! , ff BK 37 gm j i H Ti 1 QQ . f H7 Mm Y f3 2:f!'sf5 Oadi 'P' ---'gt .. ,, .Qs Q, 'l M. 17523595 ,926 A glcslcgysvaegwg 9 T' T ' ' ' Tl CF ng, gl li! N . y .P - 1 tr Ziaume Clllummg The annual Homecoming took place on October 3oth and 31st. The events were unusually interesting and attractive. The Jester Play Merton ofthe Movies, started the festivities and was a success from all points of view. Many remarks were heard on all sides to the effect that the Hobo Parade was the best ever. Cf course the Varsity Club carried away all the honor. namely the first prize. The Homecomers were not surprised for they agreed with the judges. Sad to say we lost the foot-ball game. The first homecoming game we ever lost. He hope next year to be able to prove that it was not because of poor playing but because of the crippled condition of our team. The success of Homecoming is due to the untiring efforts of Miss Cooper. Even now she is making ready for a bigger and greater Homecoming next year. So I. S. N. U. students, those of you who will leave us at the end of this year, come back next Qctober, a royal welcome will be awaiting you and may we all say, All hail Alma Mater true Loyalty we pledge to you XJ, Your sons and daughters i Ever honor your namej ki' l ll l l .3 y 6 A , s W X of -,- -. A E21 Q. - . 5 QS' l N n 1 If K 5 S I ,f ff 1 6 lf S 1 ff.- - x, Ar, 4 i FE 'M , 1 1 'I Q3 A Z 76 X me 17? 23595 W Kr Q53 , U K N 1 Wa 3 'MCM l l 4 if Q P l l A bla I 'IA ree 19:16 HGMECOMING LESAH j'oUE'rT There she is! There she is! See her? I knew she'd come! Where? I don't see her! VVhere is she ? There she is! Hell-o Hazel! I'm so glad to see you! How are you? So the girls went on until they reached rooming places and since the hosts had tickets for the Jester play to be given that night a general uproar issued forth from their room. Well hurry up! It's eight o'clock and it starts at eight Hfteen! Step on it! 'Tm comin'! Mercy! Can't a fellow ever draw a good breath? Not now! just come on! Finally they arrived at the auditorium all out of puffn as one girl said, and tried to make themselves comfortable. A I can't see!', cried one, lust look what I've got to look around! I wonder if any of the stage will be visible. Here! Trade seats with me! So they changed and the girls apparently settled for the evening. Pres- ently the curtain was drawn and a hush fell over the room as characters ap- peared upon the stage. Say isn't he good looking! VVho is he? I don't believe I've seen him before! You don't know? If I were you I'd make it my business to End out Monday. I think he's keenf, Uh, here's his name on the program! Uh I know him! He was in my science class! I didn't know he could look like that tho! Well clothes do make a difference! Great day! Such an outfit for anyone to wear! Look at her, kid! Ain't she a scream? I like the looks of that fellow. VVhat can they be waitin' on? XVe're here! Go on and let's see the rest! Conversation of this sort was kept up all during the play and, after the curtain was drawn the remarks grew more frequent if possible. VVell, when will my class meeting be? I want to meet everybody. ' It's been ages since I've seen any one I know! I can't miss a soul! When can I register? Now? Let's go down now! Oh, hell-o there! I've forgotten your name? Oh, yes where are you teaching? Come to see me sometime! Hope you come back here again before I leave! Will you go to the class meeting? Fine! I'll see you there then! Upon arriving home the girls stoutly maintained that homecoming came but once a year, kept the land-lady up half the night. The chatter continued until the girls retired, not to sleep but to lie awake talking. Early the next morning, Mildred, who was the first to awake, succeeded in arousing the rest of the household by pulling Hazel's nose, tickling Mary and splashing a cup of the coldest water available upon Hilda. Waffles where art thou? VVhy don't you go on and bring mine to me? I'll have mine in bed. 177 Q0 Y GS! P X . ' 1779595 1 5iroQga2t.c,-2012 9 I C6 Q! Nf , Remember when we had to cook them? I fig Do I? Remember how many slices of bacon you ate? 'Z iff 4, Yes, and I was sorry the next day too! Had a a good time eatin' 'em 1 Q After standing in line for a time, breakfast was served to them and they F I ' ate amid the happy disturbance of the dining room. Class meetings came next and each old and new acquaintance was dis- cussed thoroughly. Most thrilling of all, came the Hobo Parade and each float was eagerly awaited. Each seemed to be the best until the girls became breathless with excitement. Who do you think will get the prize? You do? Ch, I don't. I liked that other one! Bet you a doughnut! No, another wafHe! Don't mention waffles to me! Didn't I eat a dozen this morning? r Where's everybody goin'? but us? Ch, yes, field events! Rustle along here! We're missin' something! After the field events the girls again made their way home to refresh them- selves by eating lunch but they were so excited they could hardly eat. Later, at the football game their excitement was such that Hazel lost her gloves, and Mildred had her hat knocked off, but their enthusiasm still reigned supreme. Don't let him get that ball! Can't somebody do something? Run! You're not tied ! Well, did you ever! I can beat that myself-Honest! I never played in a game in my life but I know that I could not do any worse! Aw, hush up! They've not started seriously to work yet! See! I told l you so! Look at him go! Hurry! Somebody ought to yell! Rah! Rah! Rah! 1 Rah! I. S. N. U. Wasn't that great? Now, What do you think? Oh, we're gonna win! VVhere's the score? We're six points ahead! Yes, but the other sides got the ball! Stop him! Hurry up! He's gain- ing on you! Look out! I-Ieavens! He's gonna make a touchdown if they don't watch out! Why don't they hurry up and blow the whistle? Look quick! I haven't the heart! Did he go over the line? I-Ie did? That makes it a tie! W'ell, they didn't beat us anyway. That was a good game but I wanted us to win. Eight-thirty found our friends at the Felmley Gym getting ready to ex- ercise their toes while the orchestra was collecting in the south side of the hall. Ain't this fun! Gee, I like this floor! Who's that over there? Say, get off my foot! WIhy, can't I walk on your feet? You do! There's a difference ya know! I walk on the other side! Isn't this floor grand ? s I don't know, I havenlt tried it yet. Your feet move too rapidly! XJ I just get myself balanced on your toes and you jerk them out from I fy if under me! Do you think that's a nice way to treat me? fd! Eleven o'clock passed and twelve came all too soon but the girls again id , I found each other and started for the cloak room. I ji! Gosh, I'm tired, somebody hold my head! IQ, l w --mf Afv'xTiT L--. - L- - 7 ! i Qu at fi I S55 me 17729595 'W J VQ M W Qff W. UQgi.f 1 MLCX WI I 4' X3 N , 1 4, tff Z x, Q ,X S , f W gg, EQ I 5 V V X' J 3 4 5 W ggi 179 Da ww by , 54,53 pl 93 1 l 1' 5 S ffzoax - 5 Ei f 'X I l i FN? WVRIGHT CONTESTANTS The iBbiI:Erigbt Qluntest The sixty-fifth annual Plril-VV1-ight contest was held in the auditorium Thursday. evening, December 17, 1925. As usual much interest was shown in this annual event. The result Was a five to two decision in favor of the Philadelpliian society. PROGRAM Chorus . .... . . .................................,............ . . . ...... Gezbel Little Cotton Dolly, Varsity Glee Club Debate: Resolved that the United States should enter a NVorld Court, under the Coolidge plan. Atlirniative: Grace Wi.llianis, Christian Harpster-Phils. Negative: Marietta Moulton, J. Desnron Logsdon-VVriglits. Decision for Plmils Q .. Recess Oration 'fl . . . . . .... . ......... . ......... . ..... . . .America 's Contribution i NORA BRENNEMAN QWrightj Oration. . . . . . . ................. . ......... . .... America 's Greatest Task ROBERT N. BISHOP qPhilj Decision for Vv'1'iglrts Vocal Solo- Qaj At Dawningn ............................ ..... C adman. Qbj I must Down to Seas Again ................ ..... D ensmore P. A. JOHNSON Qwrightj Cab 'tWelcome Sweet WVind ....................... ..... C admann Cbb A Memory .............................. ..... G antz' LUCILE HALL QPhilsj Decision for the Pliils Extcmpore Speech-- French Petty QVV1'igl1tj5 Maurice Graft' fPliilQ Decision for the Phils Reading Ulf I were King .................................. .... M cCartl1y' DOROTHY UNDERXVOOD QW1-ightj 180 Q 'N' 172' D894 'W ,YVGJQBESQQFZ I 29 . ff ' 5 lk! Ei .y 1 l I lf ll Qi W 4 l l L l l PHIL CONTESTANTS The Music Master MILDRED HIXON CPhilj Decision for Phil l l Piano Solo- Impromptu .......................... HUGO PHEINHOLD VIOLE1l BLANCHARD QWrightj Sanati Pathetique Allegro-Beethoven l EVA WEEKLY CPhilj Decision for VVright l Chorus- MarjOry, Wake Up ! ................. .... C lzristiani VARSITY GLEE CLUB Decision of Judges-Phils favor 5 to 2 LITERARY JUDGES l PROF. J. O. I-IUFF ............................ U. Of I., Urbana T I PROP. O. D. MORRISON ......................... Eureka College MISS HOPE SUMMERS ............... Bradley Polytechnic, Peoria ll MUSIC IUDGES 'I+ MRS. MABLE JONES PITTS ............. .... B loomington :NJ M, W MISS MAY CHRISTIAN ...... . . . .. .... Bloomington I IQ, MRS. WILLIS HARWOOD .... .... B loomington l ' I 1 ZX R 4 S' lfxl, 181 4' . fffaex L? t I gy 1? tk, li 'Af jf ' 'g -QE nunher 5 Rap ,Q tg On February 18, 1857, an Act was passed by the State Legislature establishing a Normal A University, but the location was not decided. Hon. Jesse W. Fell, a prominent resident of McLean County was very anxious to have this school located near Bloomington, Illinois. Through the efforts of Mr. Fell, the Illinois State Normal University was located on its present site. Perhaps it will be of interest to many to know that Abraham Lincoln was appointed to handle the legal processes necessary to establish without a doubt the location of our own I. S. N. U. How many of you know that President Hovey, our Normal's first president became Gen- eral Hovey in the Civil War', and that the Normal Regiment, Company A, 33rd was composed of members of the Faculty and students of this institution? Read the inscription on the marble tablet placed on the wall of the room once occupied by Lieutenant Howell, and stop to think what I. S. N. U. means to you. Many anniversaries of Founder 's Day have passed, many feet have trod the steps you follow every day. Memories cling about these clustered walls that mean much and so in 1926 on February 18th we again celebrated Founder 's Day. In the address given by Mr. Elmer Cavins he reviewed thirty-tive years of our school's history. He called attention to the growth of the school and told of the various members who had bee11 here and those who are here now. Founders' Day means much to us as Mr. Cavins said, Interwoven with all are the senti- ments, friendships, and affections engendered and nurtured here, and deep-rooted in the hearts of I. S. N. U. students wherever they may be. OUR PRESIDENT'S BIRTHDAY Since the year 1906, it has been the custom to show our respect and our esteem for our beloved president, by presenting him upon the occasion of his birthday with a bouquet of red and white roses. symbolic of our school. One for each milestone that he has passed. This year, President Felmley spent the month of April in Arizona with his daughter Miss Mildred. Now it so happened that there was living in Tucson, Arizona, Mrs. George W. i Martin, who will be remembered at Normal as Fannie Emery, who had not forgotten the I custom, so she gathered twenty guests, all of whom with the exception of two who were rela- tives of President Felmley, were former residents of Normal and of whom the following: Lyndon Wilsoii, Mrs. Marjorie QBrandj Pearce, Mrs. Mildred tBrandj Wilson, Mrs. Fanny fEmeryj Martin, Mrs. Nelle QRicej Meyer, Mrs. Agnes CHanksj Guthrie, Miss Mina Hanks, and Mrs. Alice CQuinnj Hale were alumni of our I. S. N. U. After a delicious supper, the evening was spent in discussing reminiscences of old Normal. Dr. Felmley was presented with a beautiful souvenir of Arizona, made of native copper, which will not only remind him of the esteem in which former students hold him but also of the pleasant days spent in Arizona.. However the students of I. S. N. U. were not to be deprived of the pleasure of present- ing our president with the roses of red and white. So upon the morning of his first appear- ance at general assembly after we greeted him with our loyalty song, two students presented him with a large basket of roses. Flowers will bloom over and over again in poems, as in the summer fields, to the end of time, always old and always new. And thus will tender thought of our gracious and highly esteemed president repeat them- ,xqr selves in the hearts of all loyal students of the I. S. N. U. :F fd! Q n r I , y . Z, fy 182 tm l JWDGX se 0 ? V Qtlhhaarhs jllilehal Ctluntest The twenty-third annual Edwards Medal Contest was held on February 27. The com- petitors in oratory and their selections, under the direction of Mr. I. D. Taubeneck were as follows: HOur American Constitution . . . . .Jean Elynora Dinwiddie America's Greatest Task . . . . . . . . . . . .... ....... R obert N. Bishop H The Triumphant Triumvirate .......................................... Lillian O. Bahr Each of the orations was an original production. Mr. Bishop won first place and the Edwards Medal which entitled him to represent our Teachers' College in the intra-state con- test with Macomb. He again won first place which entitled him to represent Illinois in the inter-state contest where he placed third. The competitors in declamation, and their selections, under the direction of Miss Laura L. Stephens were: The Finger of God .. ..................... .... P ercival Wilde MILDRED H1XsoN 'The Valiant ..... .................... .... H a ll 8 Middlemas ' MARY BOBB t'Dust of the Roadu .......................................................... Goodman BERTHA GILM AN Miss Bobb won first place and the Edwards Medal which entitled her to represent our Teachers' College in the intra-state contest with Macomb. Miss Bobb again won first place against Macomb. The music for the program consisted of an instrumental trio by Rachael Brandicon, Wanda Neiswanger and Nathan Rosenbluth, and a violin solo by Nathan Rosenbluth accom- panied by Violet Blanchard. The judges were Ethel Gunn, Bloomington Conservatory of Music and Dramatic Arty Professor James J. Fiderlick, Department of Public Speaking, Illinois VVesleyan, and Pro- fessor S. K. McDowell, Superintendent of Schools, Bloomington. Stage setting was by Miss Frances Rentchler, of the Art Department, I. S. N. U. JO Us is as UQ5 Qf'A ' M. 17213595 ,916 92 , Qlfxtzmpurz Speaking The general topic for our extempore contests this year was: A Needed Realignment of Political Parties and Forces in the United States. In our intra-mural and intra-state contest ten subtopics were selected for discussion i and study. Each contestant was allowed one week to acquaint himself with these ten special phases of the general topic. Two hours before he was to speak the contestant was allowed to draw two topics and choose one of the two upon which to speak. In the inter-state contest ten subtopics were selected. No contestant knew the names of any of these subtopics. Five hours before he was to speak he drew two from this group of ten and chose one upon which to pre- pare his speech during the five hours. The animal A. Livingston Cup contest was held on March 5 in our gen- eral assembly. A. R. Grismer, Maurice Graff and Clarence Blair competed in this final contest. Mr. Graff was awarded first place. The judges were Gertrude Stevens, of the University High School faculty, Professor James Fiderlick, Department of Public Speaking, Illinois Wesleyan, and Superin- tendent Monroe Melton, Normal. Mr. Graff represented our Teachers College in the intra-state contest with Macomb, March I3 and again won first place. This made him repre- sentative of the state of Illinois in the inter-state contest. This contest was held on April 30 in which Mr. Graff placed fourth. Professor W. A. L. Beyer served as inter-state judge from Illinois. 7 VG? s Wi I Z Q 4, ,Xl 184 4 s 'if P ANR77 't' A A qt Q wax l womens ilnrercullegiate Eehating Among the women's intercollegiate debaters, everyone of the I6 who made the teams in the try out have participated in from one to five debates during the season. During this time they met the following colleges and uni- versities: Eureka, Augustana, Monmouth, Jacksonville, Illinois Wesleyan, Chicago Normal and Kalamazoo, Michigan. Those who have worked hard and faithfully and who represent every class from Freshman to Senior are: Captain Mary Schimmel. Captain Bertha Hill, Merietta Moulton, Captain Grace Williaiiis, Marie Getz, Captain Frieda Gipson, Captain Helen Kerr, Anne Maloney, Captain Ruth Henline, Marian Dean, Orvetta Myers, Mildred Scholz, Lucile Breeding, Isabel Davis, Theresa Quinn, and Grace Cox. They have debated some of our most vital questions, namely, Prohibition, Child Labor and Uniform Marriage and Divorce Laws. The movement away from decision debates tends in the end to elevate the standard and achievement in this persuasive art. Informality, freedom of expression, the discovery and discussion of truth and debating for the love of doing, are greater ends and all enhanced by the decisionless debates. The art of persuasion with so many inherent values does not need the external 185 s fi ,ff ,KJ l I A gi QL it df 6, 1 I i 1 me 17? 96395 W II5f5i?QwQZ'g V91 ' lr ig reward or stimulus of mere decisions which so often leads to formality, tech- l Q nicality and in some cases away from true sportsmanship. Many varied situa- gy gg tions were provided for the debaters. Perhaps the most difficult was that of 6 I I allowing them to prepare upon a given side of a debate to within four days of the debate and then of requiring them to change to the opposite side for the debate which was done in their dual debate with Illinois College. These debaters experienced both the decision and decisionless dedates. In one of the decision debates-the dual with Chicago Normal College, they won a Ioo per cent decision. The affirmative won a unanimous decision on the home floor against Chicago's negative and on the same day the negative team won a unanimous decision against Chicago's afhrmative on the Chicago floor. Even though they won approximately 70 per cent of their decision debates, the debaters state that they prefer the decisionless debates. I. D. Taubeneck and T. J. Lancaster coached the teams. The Index staff regrets- very much that three of the Senior debaters' 1 pictures came to lateito be included with the others. 'gl f, 'Q' jfxl 186 L l fb A M L g JCC 'O l i 4 1 TT-' iQfZ'?7VT 'T T Qs Tie jyggpgpg mi. ggf fi .QQ s lvl lf sl W X F: ll 1 I ' E l ll l l ll 1 it 1 I . ll jH?len'5 Zlntercullegiate Eehating gg The men's intercollegiate debating teams this year have been active. The policy of our debating season has been to get the greatest good to the greatest l l number, through the greatest number in action. The goal in mind has been 5. y not merely that of winning decisions, but of providing opportunity for begin- ners to work with our experienced debaters. A movement is on throughout the United States toward decisionless debates and in case decisions are rendered toward the single expert judge who l , . . . . . . l will offer his criticism after the debate. Uur teams have experienced no- y decision debates and different types of decision debates. In the decision de- bates they have won approximately 7o72f of the decisions. Our debaters have been stressing not formalism and mechanics of debating but the discovery E of truth and the ability to discuss it extemporaneously on the platform. ,l The twelve men who made the teams in the try out have each participated , T in from one to tive intercollegiate debates during the season. They are as ' I follows: Fred Graff, Clarence Blair, Forest Cockerell, Desmond Logsdon, Ll Vtfilliam Reaugh, French Petty, Robert Bishop, Elmer Pentecost, Ralph Weave1', Howard Wliite, Walker VVyman and Karl Zehren. l A l f lXRl is 187 ,TY 55? f fs to We gwivf f-at A 4132 s eil any 'Sag fn- 17529524 W SQYQEMQQW Q Qfil YS gl The colleges whom these men debated this year are: Iacksonville, 47 :B Eureka, Illinois Wlesleyan, Northwestern, Oshkosh, VVisconsin, Kalamazoo 1 4 and Olivet, Michigan. .Q NZCQI In the annual tri-state triangle among Wiscoiisin, Michigan and Illinois, each school participating, namely Oshkosh, Kalamazoo and I. S. N. U. won one debate and lost one, thus evening up the honors. Four of our debaters, Forest Cockerell and Fred Graff on the affirmative against Clarence Blair and Desmond Logsdon on the negative debated on the prohibition question on a community program in Heyworth. The vital question of The present status of Prohibition suggested by Mr. Beyer and submitted by our representative Coach Taubeneck at the Mid- West Conference of debate coaches was chosen by this conference and later by the Illinois Intercollegiate Debating League as the intercollegiate question for 1925-26. The question of Child Labor was also debated by the men. Professors Harper and Taubeneck were the coaches. Much valuable information was contributed by the faculty members in the Social Science De- partment. Cooperation from President Felmley and other faculty members added much to the encouragement and development of the young men. I XO, ,XJ ii fl l Ml ac 4 I if-Nl l Pl G r ia Cf 57' 1 3,15 s QQBMEQQ A fzzoax we giiemawlgg ,Q I , . 4 I I rd l l A l l Booth Tarkington's comedy, THE INTIMATE STRANGERS was pre- sented by the Freshman-Junior classes on April 231'Cl. This play which is Tarkington's contribution to the long list of plays on the subject of modern youth is one of his best pieces of dramatic writing. The subtle humor of the woman who has seen masculine failings and who plays age-old tricks to keep the man from knowing that she knows is contrasted with the breezy, flat- tering chatter of the young modern who lets him know all of her inmost thou hts on the sub'ect of man. J Annice Gaugh as the knowing spinster and NVilma Nelch as the breezy youngster presented two interesting characterizations to go down in the rec- y ord of the year's dramatic successes. THE CAST Isabelle Stewart . .. ............ .... A NNICE GAIIGII Florence Stewart. . . .... WILMA NELCTII Ellen Stewart . . . . . .GENEYIEVE SCOTT William Ames ..... ADRIAN Book JOHNNIE WHITE . . . . .GLEN CLINEBELL Mattie .......... ...... M AY OLIVER Henry . ....... . . .FRANK TANNEII y Station Agent .... .... G LEN TILBIIRY Stage Manager ..... ................ ...... R A LPII KOBER xr Property Manager .... .... R OSWVELL EATON lp t Business Manager ..... RAYMOND BURDICK l Q Assistant Bus. Manager . . .FRANK TANNER 'V sl e we fr A fr- xy i, v g :L QXQJ 1 i i, wwf 'LQ ,Q , Ry il ibm - lt 41 QS Varsity Club Week End 1 May the Seventh lg Nineteen Hundred Twenty-six btunt Svhutn PROGRAM Concert Program ........... .......... .... G o forth's Radio Orchestra ' Cinderella in Modern Dress .... .................. T he jesters An Harlequinade Dance ..... .... X 7Vomen's Athletic Association Mutabile Femina Semper ......... ............. L owell-Mason Club ii Fraternity Life ................... .... IX Ien's Physical Education Dept. f An Impression of the Four Seasons ............................ Art Club 5 Abraham, Isaac and Jacob at Sea ................... Faculty of I. S. N. U. ' Winner: Lowell-Mason Club Literary and Musical Contests ............ .... M ay 8 Chronicals of America Cpicturej .... .... M ay 8 Mothers' Day program .......... .... M ay 9 benim: imap The Seniors and Sophomores gave on Tuesday night June 8, Arms and the Man in three acts, by Bernard Shaw. The leading characters were as follows: Raina Pethoff ..... .......... L IARY BOBB Catherine Pethoff .... ..... H ANNAH GUNTHER Paul Petkoff ....... ....... F RENCH PETTY Sergins Sarahnoff . . . ....... CARL FIRLEY Louka . .......... ....... G OLDIE BAKER Nicalia . ............ . . .CHESTER DAVIDSON The Man, Bluntschli. . . ...... GLENN MEYERS A Russian officer ..... . . .RUSSEL THOMASON Q ly S ld ' li XA y 190 X il? 4?-AQ I-'II DVQS7 II AT C I 'J fb is H1640fi?:f?s.'i?5i1,glQf:5L1E.Jaw u- .pw imgjkpii 25522255Eamiiwmigfgfrwffs'-leg-522,15,,fJa'.u5.'qiiiw1:f:,3'.'.v.2::z:sff:i1smfs.. .. , , -'fag PPE -.L P,vfnidiiaee-Hfliwfsfvsffggak-.Qi'9:fa UL- ,gif , ss-we -155'-sus -U -ff-mmf -Jw 5'::m:s-'f:w':::usn..4mmf:-P...:3.'p'.:.w. -: f ff. rf' 1. - 'f :High- QN-iw,.gi:gg,F5,.QsQ,mw:,,f.ywpp,N..,,g.,.gW.Mg5,-qgw.bf,-as-ff:--Ni. v ,,,,,.v.Jv,.. , 'Q-L1.,..1., - ,- .H . L1 w.v.f:.:fQ,,up-,,mPA--'w-din:mf's:gq:ppf.11aff:e7-'ff-1-Lfwerngk.,-25515: FUQQQQI1:-g'5y-gal-V 'ff-2 rr. ,f:s:a.g11.:,-59:35, -- - f N H: -f f 5-I -1, wr, , 'fir ',1.:p,5-'gv--v -ww-,-H .',f.,,:,1.,.u!,..,.-.. ...V ,1 gp.-q,r,g , ,- ., ... f,-gf-gg V gg...-Q f ff.: -1:1 .f.f, uf ' .. , . . ,f,:-M. v.-:fr f , 1 ff szzgiywff .,-.-.a:,. -:.:,.LJ-, '-gifs-'ff-.-,. Q My-5,,+: , ff , 1H35z,:j,'. ,, fsvrprg-:'2wFE i1?fzsL:f1ffv-1:feasmfs-J--'fQs'.S9f5g1T.?.'5:.:1594,-P. ':'fH:'f'f '.'1:z1fff :wtf-,'-' ' 1-Y.-.-,1-,L-.'r I fL:'.,..' 1-: 12- '- f , .rsikow f3k'ff,:.z1G: ww Lf--' -1 -1 2 513555 'sb 'du,.:7uS2i:7T'11aiT J ' ,Rdivjjbi!PLii2'3Hn'r!Hj 11'5hG.,'51-'H-f 1:-:yuh - V.-,--, .Q ,JE : 1' ' 'Ii-vikfl Z. ' 'L 1 'f'1:-75'-DSJN ,-Ni' ff' ':'-'A-rf f-i iJ15:,w fy ' 'mJf.Q, , , ,-F3 , Til' ,517 j - vv .H . . .J:,Up,,5. WL.-.:f:,1:5fl?,fm --,af W ,wg 7gA.fF,1mp:-1,-,5,,,Q7.,f. Q,..f.,g...,, ,L 4.9, 'ff 1. .-Lu, ' J f 'f .- nf.',..,.,v' L. A, .N,,...:.. V, ,.z,....,QL5.. 4, , 1 14 r .- f T,:.'LiH-if5fr','iL'v 'K ff'-f'f13?'i2??'4:-.' . ' ,- EEZ Q-.wi'7'f-73? 3P5??1f .T3ii1B?w.',fiQUf.':1,1,L'L3f7i3:?lfU'y? ,3 f7+!S-'W F 'f55HMf'J'1-Jiffffir 5'i5s:,1:!'.'.i-Fda:Lfvf53:'i5fH.5E:.?J5E'2?''5iE:'f?F T'1f.'5'L'JL : 'iJT'f-'.13-if 1-L Sv: 5, ' T -LX: ':! ','7' . ---If ' ? '4'f 117.5 ,. TTL , 5 '5!X! '. 'H':'1!f'-145--' Jw-,-'f'1wE 'SW,-v..' 915273 V . YL, 2'3 '2-1:--v if-L11 RH: -15.1-ii' . .S nf J fe 1-,. I .wp 25 fi:-,f, 472.17ffg1,El5sfQ:L:1S1i.'.gaS4.4'.2aL ,'.:z.Q:'1',.f,,1f-,'- ,qv 7 ' 'Fix ' 4 ' N71-,, ' ' :Q-f-'Lk if 5, .1 yi 1 ' Qufhrflsaiesgg-sl-ws'-Q-?.ff'.f:gaL-.Fah:J::iu.r21'i.12: J'-..1:z.f J.. .ri f nd- 1- L1 , -1 Nw., 1 f :Zw ,. -f .- ,. ' .rf ' 5 . 111. SEKEQH.-:, aJ,., 1-,QL ' 1.1-.Lv fi-H131f1 'f-2i2i4f55Tf1'1ff-T ' Vi 5: ,,:J:,k,. ,.1'., ,3J'5'i', f-41:5-f4!', '1V2 we Lg ,gif -, , 1.Q7v ',:i.3-51,1S5,11?75F:T,21'I jj'.' 'f :W-gg ,J.f,., , ' 2591, 11q1p,'-.5g31,f5,-NffjgvgL-,final . if-73 t -I ' f -, -f - 1' . :,3,,,.'.,w,:.gq,,..,g, ' .2111 g ' gisiffi H12 2 1,ff.f'z,,'.xff:. F- '.fvf.e',-21?a,..'2 7' ' K '3 1!XLZ 'Hu-?., 3l j!:1if5 'flgiz , A., ,V-,iLm2l,,: is if Q V M.: 'g'2i::',f ga: ifpfii'-Jiri . -T' -lHS:7LQ:,Iiff,f-'37 X I I f....,.. ,. . N-2-.Jw T519 f visfayzi W ,. . .ir ssuridsv.'5.1-SHITJJJ5-5:1f,:Fg2:'Y5Fi71Gjfg:3:r1:, gig. Y- 5g3'b15:L'f-J5,:,Ef:i.c X313 g ,1 . .en1?41Lf','.'g-f -' L.:-1. ''.ff-11f55s'4'95Sif1':-'F?ff.!,f?5f7Effl'lf3E?53H5'jl -bf?-g-f'g-ge5'- -f'1,.q- f,-.-,',f.3.'iJ.3il'I':1f, 'J-?Q::?,1 .mf -.n.JWnf.n,..Q4-..Lf. -.f..:f:.-:W mffmw'-.,.f'...fQ fl-2 -- f- .. , -1 an11:af--:sis-'isaa.::,.g41dQgg.gz:5r1..f:,f.5v3. arf: ---::.-v-M. ..2:f.T f fwihilgii-:ss52?-H05525552521511L,iijiiiflri-Z -'if-'5-.1:.,'.'Q3Q.9.,i'3 TTF L Q 513'--v Z ,, . s.:i5,ffAh'r:i: 'fL'rx1:-:u 1 ,:'5g3.1.-if ' fa, ' '4',f-5ffU,+'f'f1:'-:JEWELE1?v:!21imtf.?3bf:12Lei: ' ...1'iM--.mf-42--4 , f. f , '-J .. ,w.W,.,1,,.n,.,,....d,,Qg5,.-Un. ... .,.a.f,,,,. ,. f. 1. .,.,. , , , J - , ' '2 '1'4vi'fv51f- u1'HrFM-1-iL:vSLf7?'FF:-Q.?'QE'L?F'f -H''fi -' ' ' V . T55-Y KT? ' ' -1 A ': . . ,gif ' 4f5'n1:l4f13:::-L-fm1.-,::--':.f:'.1l, w:i13:1:7 L-14 i'4'2H,'-'N- F' 1 J-I-lx? - ,- 'ir Jw- 1, -17 - F. 'L Ismvfzffgswnpzff.,vffv-fswf..1-T,.v,,uZv7v.I,Q,1f5g.-1 --r: 1:1-a-Lf.-2 --2471. fy QL . ' . Si1:EiH:.'usfJ67H?fQ'S?fiTEE? if .'fjbf'.l'f': Q- ' 465- '1f,'r:5'fFSF.-- ' ' . UC 1 V. ' fe1gQ'Z,i'Qi?S'ifiiifiiigijgilijfn1:1'Jfi-45S55Y.'fff,'1S2i1 'T.75s'1,1' ,X 51? . , -- l-1' few.-5152, ' f55dg:?Jsriedw'4g5silig?dYJP7:7PLT!if2'5f'E.2i1i2i'1,ggiiifn,gv-251951. ', r' 151512-iff f ' ff . 'I 1 '--1 - 5 Y ey'mfg-153gsfgighsssefam-Fr,ef.ls::M.5.:::f:..1gg,Eg..f- - we-if ,,:v f f , ' '-,, -. -1:Q,y,:i7Q,f32m 1.1, -:pam:?as'-.514vxffgfiiassffn,vga-dff15.1ff.5seff5+ eJ:..'Lr-L3i.....LJfif. ' '1 iff '13, .-IL. ':1'f'-42... ::JJ,'.'s- 5FF'.TT fA5:T '51165-1:-N-wil?-ffm.,r,J?:'J5Q,-' LTETI' X ' V' . 'ISI 'pPF355jfL,,f. ,, - , ?:iiF!E7?Ff5f?Qbi'fLfF'fL59'-if-+539:f'F'-Qiilki-'f,Qf'.1f5, .:f 7 f : ' f , ' - si,P:S: ,, . . 3Luh2!,wpEA51:'w3zii5gfgfvi:-ffvfpffls--rr'U.f.,,,-:Lt..fQp.,- :fy-1-1-w. 1 . . ,. ,, w-343519: 1:-fry-gh..f'gw U :ffgp1igpg.f,5mf?p?3gLiwy:,zzgygcflfsgiz: wif 3 - r , . 1 5 gg .affix A - ' : - N f f we- 'fi -w,Lvs'4.psFw ' 5 ,-ff. wa- ff' r 1 -,sibfaiv . . Tr' 'LW' , - f..-fyfsvimy?-'Q -Ja'-,:mLzsdwapvri-Q-.1-'--fm--f-f HJ- Q.f:.-.'-1-Nm-, -- :-. -, . 1 p . '-1-.v ,..,. QL .e--.Y f Q, w -2,4 fgffjvq. ' . r33i2i?FffffH'Ff in. ffdiigp - 451.11 ,Q .- V -f awww M3 f-1f'Q:.jf,,frf..1g'f 1 . K k 3:-ff s- 1, ., -f ! 1'Eff'f.f'S5-'fiTgirf3''F55xiii!F-'RkF?5H5!'f5Z2p:H'7Q::1.i:fffl,11 Iwi'-LQ1.'3': ff. WT 'Mil' l .1 W V -sdsfkdfsf?-Esaywii21?-111:51'L:.11fe1::.mw.wpC55fs..1uLffQm: .fg5.,Q,:L1 4-' f- 4 - ' Y - uf!-vSs:f?.-xseglil - S1-1. ' ' ' 515' i'ffh:-'-'f.-'- 1- A' 'S af-'-Mn5,y7Zd':Ng!ilhe'55,sgqg1?.mgs:g-1zffffxsw-wf:w,.fff-QL if .J 14:53, 1. .. ' . ': 1: .,-. , frm:-.f:fv:1f.e1 ., f.. -f' if waz 1 -f. '-.rsffp--fd-.::f .N .disgfff4-:snidereliefs?'risfggzffgggszaffgffww--fl-1 ,f f:-meg wg .. 1 . , ,Eff FFF' f'i:6lQ:ESi.1l-li:'fQLibEE:5!1J:EPair!! f 5-31755i'3l155iEii4'?T5SfL- , 'Q LQ- , ..- - f W .f J ' ' -M1'-s?.w?dScZ'5'm'uhi:Lf,2:4Paif:.'fdsnf5Q.5:5d54L12,ZiyiLir:E-sf:3raL'iaU5r:'.'.zQ25 .1113 J.. 1 U Y 4 .L f...1,.,,. . ,, .. . . uinviif-413'riffsa:Ls:2w2.aa1i'aSH'52Q-.gs,'nf:':..Q5f4-gvfnffie1..-. f::,:::e: gf- - ,. x f-C -if Lu '55E1' 1 ,: :ff'fif!f1 i-'.-niffw: Nan,-. UQEZLZ. f'f:YJfii15-f'5!3fZfL1f7' 'wlfqffl-:- Quang ,U 1 ' .' rl.JMSgyfpcvrfmlgrpmfi..Jain-gi we' 1-r-aff.- sag. fi:-51 - 41:14 :-qffskil,fysfcwmffkgigfessagwggw-fffywmsmfifb-L4:w2:'.f5q.i:i1 ,ffl 1' . wlfwffwfusbffqzdanuf.7.:I-'.:1-11fLQ,:4e3zaSz','5',,a2Q1fviff'.-H51 'vPif'Q,1f-:,5,'i31'.,12 ..'2.f,v 4 4 5--I: fn- -f-f:2'3y5.'gf-6.252535:77-pQ?!f7:i'ff!4ff:,,11':!r-T391:H5'?:F?S5 ' - ,-.-Lifzj, :FEE 34-. 1 wrggzfgg-s.fff.fg:5,w,-f.-Q:-wap, 1,.1:32232:-:9a:agia5L:eq:1g:pf -,few fl- . ' fi Hifi. igizyi-'J 121 ZF 1-j.'1 ,?YF.,:s5i1:1: :QL 1 .1 is , 1 'f' ' qi-' 'pi' f V .5 ?q ,i,ii?!1g1g1:-f , . f1l'l M ' .f:gii.ew1 , -1,5 gg-.3 w L ,J.. Q uw AQ U .ZA .L., V , 'flfu-Y 7156- .-f .1-IPF' '-fn., ' 'f!'2. , 'J W ' ' . f fx, ,:.g'g.Z,-51'-i-7 fffgvc .5 . f -......- 1 Y' P L I ' . '--M--. 7,7 X V- i S WFFF: ','- Eff, :'W5'!'L :1fi'1-:H 7l5L'if9I,,h'3,':: Will!-ff1'f'f,QTQ'1i.i95I A .V ' ' 'V , .V , , , f ' ' A -- -- . i1:ai7-Zim? 'F-'EC. ivT1 C' fr V ' ' Cf- ,-1752::P:iQF1f-fra:'-3542,'JPG-'J-1,'5fP: 'iff-l::,q'f376?:55'fSF:r'f555'fE, ? L .' fir 5 :J 3f:'.l'f:'5.'3Jf '4f:j':5.J ' ':1.b'fY.' - ' f k-f.f.r4i.-Qlgtr .-N ew -- ' f: f-, - 3 . V r'f'- 7-krs,5n'w.'I-, f 'p?'f,'.f .-s1L:5s'f931s,9afS:w:.'fgfJ'::f2M..f!-ff-fr:r:':., ,,-1,f!m1 ,f,w,. fwfr my - L .wav .. ' ' ' 'f Q1 ' if 2 , .Lr:i?1'H.-wf.f:,.bh.uj.v.,5,'s,1-377 - im!-isy. :EEHIH-1 '- .fr'15.1,5,.g.gIg!d:w.L15,155,-:-ff::sfgf 'm1:,!:f -J '::r.-ws: - 'aw' -' L11 -1 1+ -I f f5JE1' :'f W , -W, w wf I 1 . N 4- qx,3p.'E.-,'d., 5? Wai?-s, 'rsis!fU'91I3k!1sffffff f- - -t :f. ' , '4 f.f.:,.f!' ya: if ' -' Fi ' 71'EMyE5-5IlQifL':ffi'ffy1g5'avi. fihg ' 4' P H- -': '?--'kiwiffqlfs L'w5il5gnf?1 '.Hifi.51fV3Q1L'gfyL'?1,g -fs!-'ff-'E ' -'fm-, 7fi!!l'1?f-'J-Q' 'Y .fl f1 1 ' F 1T'ff- . ' - 1-2 .5 '- 77 I f-mzffsif r ' ., . . 'H-V. V ' - - f - . ff ' f-Fw?Ji7'S!fl1b??4E5f::rifgfiihf 1 E- ' , 'ifia 192' 4'f - '- 9' -Wiwfv: -f:2Iij5i ''b.'i- -ffffV'75 fi f!5-Guin .f, . ' , 'fi Jr' a-L: '-if '2?'.,'fi igifbv? i5,,,f2?l :gk ' 'ff:fw:5'gf.:y, ,Jms'Ji!f .'-zfgffw, ' -- ,:, -, N ' .- :J . Rig? ,, ,. . . ', .f A . ,Q sr i f f 1 ' -' x H, -, v ' ' bf fre- . H Lf. 1.5.3.1 , f ,. 'gZgi '4Lig1ie5iL?' 'ffiglfx ,. , 3gg1i?f'j LL JJQELQE. , g,'g!,2 . ' ff . '1 S:1? Y -,27i5.'f5-1' -iifwff .., 1 :L 'v .,. 'fx-Z,-51,-'-'HF-LWG5.'!L5:wiki: ...Au HI- wf'S1q'fg'J, f-j,:,.2j-:J f1jfif7V'- .- vw AI- 4 V -:I 5,-5,1 , f -. - ' '-,sf .f.,?:C 1':. ':ss.-5yf,.u,v:,51f,y-553'-g.. N' . -Eg, fgvlfg,-fy-xg 7g4.'f5f.,' w- 1-,Q-,'--M. Jugs: H ' 1- L' - , ' ' ' zii'7'C'fP'r1r 1' Jaw, EW- . f Jia l f' W5-Uf+'L , , -V. 'L 'f1'1' ',1:L 1'L.L ff7'f155 - -f-I-W.: 'ri-vf1ff1 '.mff,vf.-.1.. l-,'5T?T5gff '- , ' ' ' ' ' ,.1 i,f11:,:::- ' - f.C?V 1ni' '!5F'f Gb7- fi V W-1:2--.:., .1 'Y r-wg 1 V , , , ,. ' ..1-:,fsyf,?g:,sf'vs.1ff-- -- 1' -- ' ' ' - N 1-,.3,.: ' '1IiE':'PJf'5s: i7: f '---x.,,:gl ., Cf -1 . t f My .. . ' me . . 1 . vs i.J,fg,a - '- -- f . ,'- 'ff 1- , A l ms U s THe jyggjggg 1926 W5 fqfpl k!s,f,f.,e 5l1D Qbj3 055 ill M6551 if gil Qglll' Qlireeh V A l . . 1 15 Show us the Freshman who doesn't love his English, ll 15 ,gg Show us the Shakespeare Fan who doesn't love a pun, 5553 Show us just any guy who laughs at our humor. ffl And then, By Gee! VVe'll Feel That our task in life is done. A-A-A-M-E-N l , WHY-DoCToR! i T 3 Doc Linkins: That was a good joke you pulled at the banquet the other i night. ' Mr. Harper: Yes, I've had that one in my head for some time. Doc: Ah, aged in the wood, I see. Q HAIL The first spasm we hope you've read. L Now you're prepared to look ahead. l If something seems to you untrue, i E 1 just remember the others are getting it too. I l For while we like to use our guile. I Our chief desire is to make you smile. I Now we'll prove what we've just said. Yea, Normal! Look ahead. I TH: STAG AT EVE HAD DRUNK I l l l wx ,A 1 1+ Q 125 191 ag 'QE gg. it A'PflSQ'3T:TT 'ff' i l fifiQtQ7Mfi l 'Qi to at get 5 Qg me !7?2D8X '925 j w 05 l si' 'gl 3 .fin ,Wm 1- 1 Q: ' J X ' 4 i FJ? 51 -'Ti l C A Barber: I don't believe I recognize I A your face. ' I p johnny Rockenbach: No, it's all E lull healed up now! I it A gg? at TT li' Y C!! Friend of the departed: XVhat made Lovey Oleson jump in the river? Second Bereaved: I expect there was a woman at the bottom of it. MON DIEU! A man walking through a Scotch graveyard saw an epitaph, reading, Lord, She is Thinf' Shocked, he asked the caretaker to explain it. The caretaker explained that the stone had been so small that the sculptor did not have room to add the final letter, UE. SPEAKING GF VALENTINO- If a man insists on appearing in a show called, Cobra, he should ex- pect a little hissing. 'TIS TRUE, 'TIS TRUE Question: What part of the car causes the most damage? Ans.: The nut that holds the steering wheel. PATERNAL DEVOTION N Mr. Graff: Well, Dad, I'm a big gun at the University. QF Papa Graff : Yeah-Then someone must have been mutliing the reports i Q 2 we received. if A I 1 Kg 192 lg pl ' Ci fl ' Ti fd I A 'd -H e A Q 0s Max 'Q G+ P s s fr i T5ff7ifii ' 'Sl ?U ., W 1779595 'W .gif 3 lg Q ! L-Z1 gr 7 4 r , . , lL I is English iiaustnrp hp 1311155 Jflagg tg li I Q CVVith apologies to Miss Elagg's Rhetorical classesj M SCENE: Queen Elizabeth and Sir Walt saunter up the street. In his i hand is a copy of Perfect Behavior VVhen VVith a Queen. VValter: VVell, Liz,-how about takin' in a movie? We've got a couple of hours to kill. Queen Elizabeth: XValt! How many times have I got to tell you not to speak that way? Phrase your thoughts more delicately. Turn to page twenty-eight, and you'll see what you should have said. It runs something 1 like this: 'Do me the honor of being my companion at a performance of the cinema art, Your Gracious and Adorable Highness'. l Walt: I ain't much on this oily talkin', Liz, and besides I ain't got past i the chapter, yet, on 'How to undress in an upper berth'g but you know your old Vlfalt, don't you? tHe attempts a slight poke in the queenly ribsj Liz: VValtl Stop that! Haven't you read yet where it says 'Never poke a queen in the ribs on a west-bound or one-way street'?'l Wfalt: Gosh I'm sorry as Sin, Kid, but I got it mixed up with the rules under 'Perfect Behavior when with an I. S. N. U. Flapperf I'm really sorry, though, Queenief' M Liz: !'That's alright, Wlalt. Now you study your book good and hard. ! and we'll make you Grand High Lord Chamberlain of Etiquette, Deportment, Manners and Dispensation of Sewage. Then you won't have to run all over the United States planting colonies and tobacco. y QThey come to a muddy crossingj I Liz: Q, VValt! I can't cross here! I just paid 37.50 for these shoes, and I'll ruin them trying to cross this street! Walt: QGiving crossing a dirty lookj It's a darn shame, I tell you. Here I am, paying big taxes, and they don't even clean the streets!! I'll see l the mayor about this. It's an outrageli' Liz: Qshedding several royal tearsj I can't step into that, and I won't ! Walt: Cut the water-works, Kid. Let your old Walt show you some X4 real ettiket! tHe removes his coat, alias his Bennie, alias 32250, et cetera, :Pic T2 ' and throws it in puddlej Step on it, Qld Girl, step on it ! , VGA . r A y A+ lg , 193 x fi - -a - 1 ifiirjf ij r .igfsqmfs is U wif ff - -,,, Y 'QW raster JWDGX semi. sf W .128 ff i 1 . ii Liz: Cln a ragej Never speak to me again, You Uncouth Person! il fl B what riffht have vou the audacity to a - ear before a cueen in our shirt 4 , Y s . . PP 1 Y 1 Q sleeves? How dare you remove your coat in my presence! Doesn't it say, y E548 in bold-faced type, on page forty-five, 'never remove your coat or shoes in l the queen's presence? Leave me at once, you vulgar fanfaronadef' Wfalt: Csoliloquizing as he picks up the wreck, and shuflles awayj Well , now ain't that a hot way for Queenie to act! What are the kids in future years goin' to do without the gallant precedent of lValt Raleigh paving the streets with his VValk Upstairs and Save Bro? A i il f 4 , , cor oy fi Y f' iii' i nz, - 6111320 q N .1 rel: A ' v 1 mi ff, 1 4, l 2 194 fb J? lp ifT?'gfg,Ti,. f 'i' A s s Q ZlLQl14zfg2 X A 919 l .Qs w' fn. jyfgpggg ,926 V67 53, og Q I YQ. 'gy ,GJ 4 FX' The police Department of Normal announces that a new man has been li J ll? i added to the force, and is known as Giacomo Klopnitzsxokraintaolmonykweis- 4 4, Q kowiski. There is something arresting about this name! 6 f A We killed, joseph McBlather, In cold-blooded murder, we did, For he was a first time father And talked all the time of his kid! Patricia: Do you believe in Love at first sight? R. Kober: I should say not! Pat: Come back tomorrow night then. Frank Tanner: Maw was born in New York, Paw in San Francisco, and I was born in Texas. Ain't it funny how we all got together? Even the Holy Angels swear, Lectured my Bill Shakes, If not, what would St. Peter say To the boys who make mistakes? Did you know that Brisbane lives in California, and Hurst in New York? I supposed all along that they bunked together! Goldie Baker: Are you really a mind-reader, Professor ? Professor: YounglLady, I am. Goldie: Well,-I take it all back, if you'll forgive me, sir! 1 aff, I i I I wr: A 195 X l I I Q, -af - A.-r - ,cg G Z T Ae Q 33+ K I 1 i I ' ' 'l W T A'T I r+f?' A s s- 4 ggwswwwf fffwf alabama? I JNLJ 4, I XX g jg' We nominate for Grand Master of the Dumb-bells, the Goof who brought It 4 Q, a pail to court when he was asked to bail out a friend. E PHREAK PHILOSOFY The Frail that a man can marry for the asking, never gets asked! Wlien you hear of a man striking another man with his powder-puff you can be sure he ain't no man! In the spring, everything turns green, even your blue-serge suit. Some girls are like the letter V,'g they always follow UU. The good die youngg but who th'eek cares? The greatest cause of divorce in the United States, is marriage. Many people are shocked at the bare idea of telling the naked truth. The neighbors rose and placed our Phil Beneath this granite stone. They'd stood a lot from him until He bought a saxophone! i at l 7 W l if 196 y y Kiowa 1,Jm f vs o of T Qiifi me JWQGX ily 145 'Y lf!! EX COLLEGIATE D1CT1oNARY f y my ly Scotchman: A man who eats salted peanuts on his way to a friend's Eg house for a drink. Gptimist: One who sells traveling-bags on credit. Government: A bunch of laws which each man believed should be strictly enforced upon the other fellow. Gen. X. : A place where students COIHC to study or sleep: a class in mob- psychology or human nature: a grand Antique show. Gentleman: That portion of the human species which wears bifurcated costume: that element of uncertainty which makes a date worth while. Quack: Something that comes from a duck's throat and hands out pills. Spats: Something that is good for the ankles, and married people in- dulge in. Snake: Something that crawls on his stomach and steals his neighbor's wife. Dumb Waiter: Something you can pull up and down, and can serve you a nice, quiet meal. Belt: Something that keeps a guy's pants up, and knocks him down when he gets it in the back. Rat: Something that is always nibbling, and squeals to the Dean when you have more than three dates a week. Tail: Something that every shirt has, and no cow can be without. Hot Air: Something that comes from a radiator, and every sheik is i full of. Dogs: Something that hates burglars and tramps, and where our studies i go to. Walk: Something made of concrete: also the end of many a Perfect Date. Mug: Something to mix lather ing the human facial topography: a favorite front-porch exercise. The Ten Commandments: Ancient Daily Dozen: setting up exercises. A Good Wife: One who helps her husband with the house-work. il Censor: A guy that's so small that an ant could kick him in the face. tij-ij hi Rhetoricals: A modern Inquisitorial device: something unprepared for. id I w h l 4 y. ' KN 197 lv , D A 3,6 --r A vtsiff Mio: rf s r 1 I I WQGX Tfgsv ti if We if 4 PERFECT PQSITIONS 9 Lip-Stick Tester on Broadway. 1 4 Costume Designer for Flo Ziegfield. S in 'P Night-watchman in the House of David. Sub-Hero in Movies QLast Scenej. Mattress-tester. Dflice-Boy in an Art Studio. Revenue Officer. Bell-boy in a Scotch Hotel. Automobile salesman in a college town. Singing Instructor in a Deaf and Dumb school. Dean at Vassar ffrom our point of viewj. Mouse in Fell Hall. THE LECTURE CGURSE Ralph Carter: I sure envy that last singerll' Miss Garber: VVhy I thought her voice hideous! Carter: But think of her nerve? He who is blunt of speech makes the most cutting remarks. People of narrow minds are usually thick-headed. lx-A Teacher fexplaining the meaning of 'Kith and Kin'j: Now Archie, X w do you know the meaning of 'Kith'? Z, KG' 'Archie qblushingy: Yah, Mini. I I if-X! 198 i' 1 Z gl 25 l g qi at e A is Q52 Q LAFF THIS OFF: Professor: Smith, this is the third time you have looked on Jones' paper! Smith: Yes, sir,-he writes too illegibly for handy cribbingln Prof.: He does? Jones, you may report for special writing class! X Ralph Kober Qbeing very entertainingj : Have some candy. Ha! Ha l- Sweets for the sweet, you know! Pat: Thanks,-wonit you have some of these nuts. HERE COMES THE BRIDE He had a billious eye and ten thousand dollars. Her face was her fortune. So when they marched down the aisle everybody said: Here comes the Bribe and Gloom ! THGSE TRAFFIC LIGHTS Judge: So,-you're trying to tell this court that you thought the red light was green ! Doc. CWith all his native fluencyj : Why, yes,-that is, of course, er- -- it seems,-that is to say,- it would have been, but a- er -- Judge: Young man,- are you trying to show contempt for this court? Doc: Ye Gods, no,- I'm trying to hide it! MISTAKEN IDENTITY No, Vera,-the Index Staff is not a walking-stick! W li' :Q Q I l bf!! lg Y 'Q 199 Vx A A 1- H g A Ci Q Q35 I l U A ff i5Q 'Q i 17? 95335 W Z ! 1 , ,-is qF,,,,:4,,x bfw- V 1 xx. uf-YM-, - - - JAY - HN' X C? Fi 'Lf X5 x 1 f X3 if If , x K. A DP1? Q gg , N -- ,fo Qgy 37? Wm xv? V5 i T '3s2 r 11' X W I 1 1 L -- U Q ,, N wllg NVQ .w,l K? 'N Mm Mm U'N L Nw ' iiyp, U N 1'.x V+ H ww' :M lt ' WW '12-P' Sw Q MJ wif df M KSGUJQU5 Img., 3 v -x gm 1 IM' .3 1 , ,N , A Vi: eu-5 Wm WL ,ga Mm M11 Nl IZ3'z iw M31 lm C3-h,e5',7.Ef.H. if gix L 4 200 JU! Xb! N X af QA 3 A 1:-4 f -A -ff - K ff' ' fi , f-fx Z V, , , ,N fi-O x ' 'f TN - x PM Q gi1,3iPfefg:4,g,fZ.-ffk.rf ggi 6 W gym Via ?f X 11 172295324 1926 Xqocimaafg 9 0, , FIVE YEARS HENCE Just think,-Don Bohyer left her, as they stood there at the altar! Did his courage fail him P No, it returned! Nathan Rosenbluth: VVe1l I'll be hanged ! Governor: Yes, probably. Fred Graff: What happens to liars when they die? VVinegarner: Guess they lie stillf' Bob Bishop: QPutting on pair of riding breechesj: Yes, boys,-All of my people were great horsemen. Every time I put on these breeches, it reminds me of some incident. Now take for instance, the last time I had 'em on,-would you believe it-I rode a two thousand-dollar horse. Harry Fry: Wliy for Heavens Sake, Bob,-I never knew that the horses on the Merry-go-rounds cost that much! I I I 1 X. Z gl GIVE THIS A BRGADSIDE Once there was a Mister Vlfrongside, who knew a Mister Inside, So he knocked on Mr. Inside's door on the outside, and Mrs. Inside, came outside and asked Mr. VVrongside if he would come inside and talk to Mr. Inside, but Mr. Wrongside told Mrs. Inside to tell Mr. Inside to come Gutside, and talk to Mr. Wrongside outside, so Mrs. Inside went inside and told Mr. Inside that Mr. Wfrongside 3, wanted to talk to him outside, so may ZF! Mr. Inside went outside and talked to Mr. Wfrongside, and 6 l rw They went outside down the roadside along the gutterside, to . ikf the riverside and both committed suicide. I? 201 '55 i r f -ip -' -In - mg - ff' 17723595 'W' Q QQ is PRoFEssoR, How coULD YoU? 'I 4 i' 1 l W Boys, here's a new one on the absent-minded professor: 1 4 A It seems that, on arriving home, his bitter halfn asked him where the R car was. X Dear me, gasps the Prof., Did I take the car out ? Why you certainly did, comes back his frau, with unneeded embellish- ments for so simple a question. My, myli' beams the Prof., I-Iow Odd! I remember now, that after I had gotten out of the car, I turned around to thank the gentleman who had given me the lift, and wondered where he had gone. Yea, verily, mused the Minister of the Gospel, There is a power even greater than Kings. And so saying, he slyly drew the Ace from his sleeve. A MATTER FOR REFLECTION Bah, exclaimed the grumpy old lady in the antique shop, I suppose this hideous portrait is what you call art! Excuse me 1T1ElCl31'Il,,, said the shop-keeper, That is only a mirror. My Gawd, exploded R. L., I'm in debt up to my eyes. And so say- ing he paid the last installment on his spectacles. Some fiend has just recently published a new dictionary containing five 1 xi thousand new words. Millions of pleading wrecks of husbands have written lg in to the publishers begging that the publication of this book be suppressed. I D l l j l 202 I K 93+ NT 5 VY -i Y ff' R ' is v rne 19:6 gv E9 FQ at ff r l l i fb 3 ALL is Losr 1 Q Q P64 Jerry Julius Jason Cann Never out of nighties ran This was simple you understand For he was Kleagle of the Ku Klux Klan. Now Cann resisted the female in vain For he finally fell for a maid named Goldstein But Cann because of his loved one's name Doubts of her creed did entertain. So down to a vender of second-hand wear Jerry Julius Cann did tear And to his query on his one great fear This news poured forth to his tortured ear. Reba Rebecca Rachel Goldstein Could never enter a klansman's domain For though she was fairest of all the roses Her father was Rabbi in the temple of Moses. Student: Mr. Peterson, will you give me your candid opinion of this drawing? Mr. Peterson: My good fellow, it's absolutely worthless! Student: Yes, I know, but I should like to have it, just the same. Miss Vantile-Chead on his armj : Your arm is so soft and comfort- able. Xl Roy Hovius: So's your head. J il l . i 1' AI ix ' L 203 IGI I in IYKQFII ' ff f . I YF' ZH? MgsQsxwe,fcit ffffw H errata, if EN y Qs 'fn ? Br-r-r-r-r-r-r-r-rl l 4 Gill . . . IW kr 1, Hesitating for a moment at the threshold, I finally decided to brave the El ,fm , AE perils of the darkness, and endeavor to solve the mysteries of the wierd figures that many people had seen in this place, flashing into vision and out again with phantom-like swiftness. Slowly, step by step, I proceeded between rows of unseen things that made slight hissing noises well-calculated to chill the blood l I of those who entered. Sidling to dark bulk I seated myself upon it and in- stantly became aware of an unseen something that clutched me with tenuous I tentacles! My blood froze in my veins! I endeavored to cry out, to flght p i against this thing, but was in a horror even to reach for it. Finally, though, I i xl summoning all my courage and knowledge of the wierd, I reached downward , and encountered a sticky, tenacious substance that baffled my every effort to tear it loose. Frantically I fought it, striving all the while to End my voice. Suddenly my voice returned to me, and turning to the hgure which hovered L on my left, I gasped: Say Guy, did you put that gum on this theater seat? i l Clarence 0.2 Do you smoke much? B. Young: Only when I'm lit up. , He: Love is blind. Neighbor ton phonej 1 VVe aren't. Sgt R52 TP' , ,i 0 ,Q 'Q FS 204 K M AYA- 'VANQ-ff ' f'ArS f 'A cQ-tl Q49 Us i 7kt, Q my l ll 5 il r L :F ip .a,ff'Q'??' c'-Oi? 'Q W 11779395 'W ?3i.fwiiQQS?? yt? fa K i all IRQ RESURRECTED RADIO :F l Professor I. C. Awll, radio expert, extraordinary, has kindly consented Lil this evening to give us an exhibition of his latest results in the field. The FQ! Egg? professor has long entertained a theory that as sound goes on forever, con- ggi fx versations carried on thousands of years ago might be picked up and listened to to, if only the proper receiving set could be invented. 1 The professor now comes to us after years of experimenting claiming A to have invented the needed machine. The professor's main reason now, for continuing his experiments is to hnd somewhere in History a conversation between a man and woman, where the man had the last word. Scoffers claim that he is insane, and that nowhere either in the present or past has man ac- y complished this. The Professor however has faith in his sex and so has dedi- T i T cated his life to this noble research, altho so far he has not succeeded in finding I a conversation where the male voice could even be heard. The Professor is ' now searching the Air of some 1900 yrs. ago, and the results of this we are about to listen in on now. Sh-h-h-h-h-h--Stand By g RYRXRXRXRX SKTZCVTUXM. . ?!!! ZZZZXXXXXtQktQ8z8zt'fWTp!?! i ?!l Why, hello there Antony! My word! Wlie1'e have you been? VVhy I ', haven't seen it seems for an Olympiad. S'blood, where-? l . How's yourself, kid. Well, now to tell the truth, I've been feelin' kinda I l dopey here lately. Say Cleo, I can't get over to see you all the time. VVhy . don't you call around at my villa once in a while ? Be yourself, Antony. How can a girl keep a gang of Egyptians at work . and kid along a gang of shieks and still have time to go huntin' all over Rome F i for you? XNell Cleo, Pll have to admit that Cleopatra is a pretty popular little Y frail, but if what you've been tellin' me is on the strait, I'd think you'd give y the best of these foul balls the air and stick to one papa. By the way, Cle, 1 f what's all this dirt Iyve been hearin' about you and this guy, Caesar. just 'E because he's my boss the big bum better get to thinkin' he's gonna two-time me. ' Why the big- , Now, Now, Mark don't say anything you'll be sorry for later. You don't wanta believe all this stuff that a lot of sour grape eaters shove your way. g XVhy, Markie, you know that you're the only one that really means a thing. I And, besides a girl has got to be popular. How are you gonna be popular if l A you don't keep these big butter and egg men from the Northwest pullin' for I you? A Applesauce, that's the same old line you've been handin' me all along. in . I'm tellin' you Cleo, there's gonna be hot times around Rome if I ever get gli, sore. I'll get my gang together and go after this Gaul chaserf' lp. Don't be a mark, Antony, forget your imagination and call around this evening. I'll get up one big feed for just the two of us. y 1 . T ii kj 205 f . fm. WN' f 5 Vic, Y' -r A rm- vfvra P -re Z7 TQ Di Q rn 1916 g?I 'egg Q All right, Cle we'll let it go this time. Say, I'll be on time tonight, alright. How about a show next month. They say there's gonna be a swell bill on Coliseum next month sometime. I'd sure like to take you just to show the rest of these guys about here who's the Candy kid with you. Aw-say Mark, don't try to drag me to another of those boresome coli- seum affairs. They're so monotonous and tame. Nothing like the shows my forefathers used to pull in little old Egypt. You Romans are satisfied with such tiresome affairs. And you're so soft hearted. Why at the last show you let ten of the three hundred people you were gonna have killed, go free just because they pulled some grandstand stunt or other. Believe me, when I go to see something, I want to see it. There wasn't any use lettin' those birds off. It would have made the show perfect to have included them. just think of the ecstasy of viewing such a masterpiece. Three hundred people slaught- ered to please Cleopatra. Ah-h-h It won't be that way this time Cle, I know the manager and I'll slip him a talent or so and we'll see the whole show. Well, I'll think it over Markie. Say, what's this I hear about your having a new car? Y ou mean my new Chariot, Ch, Girlie! Some boat. And you ought to see the team of lions I've got to pull it. And speed, they'll make fifteen miles an hour without straining themselves. I've got some keen new fads rigged up on it too, Cle. Spikes and knives on the wheels, swords sticking out at the sides, Cree! we oughta be able to get a pedestrian every mile. WO1l,t we look Ritzy in that rigout? Hot Perspiring Canine! Qh! Say, Antony, speaking of Lions, the Sultan sent me the cutest one for a pet the other day. It has the most cunning way of getting into some playful sort of mischief or other. just the other day my aunt called on me and I had to leave her for a few moments to talk to the ice-man. VVhen I returned there was Bonzo, I call him that, just finishing Auntie, and he seemed to be having an awful time when one of her sandals. Auntie look so funny I just had to laugh, and I thot it was a good joke until Bonzie got sick this morning. I wish Aunty had been more careful. She's so inconsiderate of Bonzo's welfare. And he has an awful appetite. I can hardly keep a servant, he uses them up so greedily, poor dear. VVhen you come over to- night bring one of your elephants, and we'll see if we can't get them to fight. It would be great sport and so amusing. All right, and say Cle, wear your best bracelet will you. You know, the one I gave you, the real narrow one with cut glass sets in it. I gotta run along, now. Old Caes' has been hearing some dope about a plot between some crooks, called Cassius and Brutus. He thinks they're after his scalp. I gotta investi- gate as he'd rather not risk it, himself. VVell, ta-ta girlie, Remember what I said about the bracelet. 206 WWAQX 'ff Q fd, I6 52X 722, CW. Q r 49 i WE woNDER What happens to the pieces when day breaks? if QT. ff Who got hurt when night fell, and who picked it up? What is it a shadow steals across a room? How the villain can hope to win with the author and public sentiment against him? Whether the plot always thickens when the hero puts his foot in it? How badly the heroine's hand was hurt when the hero asked for her hand and mother put her foot right down on it? Whether a man is hurt when he is struck with a thought, and, if so, what impression it makes? How does a man pass the night when it goes so fast and he is asleep in bed? Whether the hero and heroine always live happily ever after? What's funny about this? ? ? X ADVICE TO FRESHMEN i 4' ,hr Don't think a man is drunk because you see him with his collar on back- 7' wardsg he may be a minister! tgp 1 Ag 207 4515 E v Q-A rfro 7926 v A Q l I rr i 4' E l l w if I sap E I, f7?'f359f 1 V tile .fa if YE sons or HUMoR my ,7 ig, What would the humorists do without these over-worked pairs of twins- 'ogy Prohibition-and the inebriated one? ff? Coolidge-and economy? Divorce-and Alimony? Slick City Feller-and Innocent Rustic Maid? Banquet-and the long-winded speaker? The NVorld Court-and the League of Nations? Sophomore-and the Freshman? Absent-mindedness-and the professor? Matrimony--and the Mother-in-Law? Prince of VVales-and his horse? Pat-and Mike? He-and She? Pedestrian-and the doctor? Automobilist-and Traflic Cop? johnny-and the teacher, preacher, father, mother, ice-man or sister Qoptional D. Qs-1, Cunningham: VVhat were you doing in that accident down the road? Pete Sharp: Just scraping up an acquaintance ! iffy QL, is YA Q all i wwf M9 J Q :LAX A tg! +, SUCH IS FAMIL! 'F y Pete Sharp Clooking at bust of Socratesj Gosh! I wonder if I'l1 lose my Q 1 I looks when I become as old as he. l if Q She: scathingl -You'll be luck if ou do, lVI'dear. PC? 4 Y y Y 5 f ----- fx THRIFT A A Play in three thrilling acts Time: In the Fiscal Year 2026 Scene: I. S. N. U. and Surrounding Neighborhood CAST or CHARACTERS Oscar Oscillator .... ............. A n economical youth with an idea! , The Florist? ..... .... . . . ...................... An unknown The Professor ........................................ Any of several ACT I-SCENE: FLoR1sTS Snop Oscar: I'll take a dozen of those dandelions. : ACT II-SCENE: CLASSROOM AFTER CLASS 4 Professor: These beautiful flowers for ine! Oscar-Oscar-Qfalls dead A from shockj. I ACT III Q Oscar: Economy, thoughtfulness and beauty go hand in hand. CArranges dandelions on prof's chest for funeralj. I Curtain THE END QObviouslyj l SJ! XJ! Mr. Paliner: How did that actor you ate last night taste P W Miss Stevens: O, I dare Say he was good in parts. fvf T Qi, , . i A ,Q qu 209 ,FRN bf C S Riff ' we IQ? A SE' ef ev if SWQiEisEEE2EE2E21fefW1MJCm6FfEffEEXKiEZKSe We FQ . , 4Zf' , N T g . :yd J 'M SQRRW ' A 1777 sorzyf she Sdld tg zgffi K Q.: gf e,3wM, When ne begged for Cl me, MW Ar fbi- ck 1 ' ' 4, W Q ,Q 6 I woulcfgojut llmvenf Time NQVY There LS so !?7UCf7 to be done X 'XX X 'AK if 7qf7df f'V6 l7Q time forfung '7712 sorry , she lfgsped 4 53 r when X715 suit he would pres, r f 3306 f Xorg fora ffmje arthe werfd. e 1 But fhereis Qf6f7Qf of tfmef 61 X7 X And eshe puffed 17715 old fine fr '-- , X 777 Sorry! ' WJ QQQ3Qb iiii ff! I U 6 .--1 e ee,e Hr X Q J r TV772 sofi l ehe purredi 1 X Jee ydv QR when heuesffed her to wed, y XX IBM? 7 5lfl7,DOf CUNY mare up e f ,, , ' rr J XX X my f77!!7d . v Qi? W W 'lx SA Q Tree !'ve 5eddenedyQUr fffe fm imp Mfg M MM Qfnzplg rendgme wftfz strife- L' X 1 vggxgfifvn .s r 1 0,7 wonder ff me Cv jf 51, m e H when his heart X105 gene out M dr V 1, 3325 froefzoffzer who, ff!7O,Wlf1Q GM care , kr nl s my ff, Wx!! fee! 1056 e eff V V'l7rer5e5 gd-K4 H 1 of rqree , and ddmff: 75. Z2 L0wderf27f7!f, 7 '7 'm 50rr 'ibwrewfki 5 b - . ,Lame j if g Q n XA S' jg? 210 lg le ,,ee,fi eJ,efe 45Ga 4 fwfsx W ir 'gi bf ja is COLLEGE OF HIGHER CRIME lg Iii i Q CORRESPONDENCE SCHOOL FOR CRIMINALS WHO ASPIRE Q gi E4 Normal Representatives-Humorous Editors. ' IE Our Proof of Efficiency: Qur jokes have been the worst crimes on record and we are proud to say that we still live to try to start laughs on them at every opportunity. Our curriculum follows: I. Courses in porch climbing, pocket picking and Bond stealing. II. It was our school that put the Black in blackjacking. Our victims put the jack in it. III. Expert burgling taught in ten lessons. No experience necessary. Get theory in day timeg practice at night. Home work given if desired. IV. Our graduates all have criminal records which can be verified at police station. V. Expert cribbing, ponying, blufhng and special course in studying to those who desire it. Take your choice. VI. We make it easy for you to hold down the job of holding up. VII. Our students have held up some of the best citizens in this city. VIII. You will find our graduates featured on all the best newspapers ofthe country. See your name in headlines. NVonderful opportunities. Won't you grasp them. IX. Be a hero in a mystery magazine. Any intellectual crook with polish can do this. X. Special courses offered to those amateurs desiring to be town offi- cials, Police, or Prohibition officers. XI. Easy Money for Hard guys. Try us before the judge tries you. Our Slogan: The wrists of our grads. are never handcuffed. Canada is a land of opportunity to the crook who finds U. S. too crowded. Lock up your valuables, and we will call on you in order to go into this prop- osition more fully. XII. Our School Song: jail! jail! The C1ang's all here! Our School Yell Break their pocketbooks! X., Break their jaw! Treat the whole World, IW Raw l Raw ! Raw I C if N j I I K5 211 l my ii O USM V fy f ' J-ilgpx X CEDCQQQQ fl fC5D J N .....-91-:of-:1-1-:ef-:-:-xvrr-:-:oem-o:-:om-2-:-:-.-.-wv.ww -. 2. -. wmww. -.-M .w....v...,, ,.,,, ,, . . , . , 2 ' 2 ' 2 2 2 2 ' 2 2 2 2 2 2 2 2 'N' 5' 3'5 2 2 2 2 2 2 2 2 2 52 2 2 2 - - - 5 - - - - - - - - -.-.-3:-:'.-.At-:-3-:At 3-:c-:-:fer:-r:1-xv:4-1-:-:-:-:-:vc-wr:-rxwr1-:-1-1-,-.-.-.w,q.-.-.-,-,-W. f45:2E2E5E25222525252 E2E25525552225235523225525555EQZEQEQEQEQEQ5353555325535525Ef'5'1'f2E5555355555333535gEgE5SgEgE5:g2g2g22-' 5525535555 . I:E:IEIEIEI:I:I . ffffffffffft EQEEEQEEEQEQEQEQEQEQE L 38 ijlglgfglgl 222253555525552522222 'Z:I:I:E:E:E +'IE2f5522'f' 2-2-225532252222-:2 2E2E2E2E2E1E2E222E2E2E EEEEQEESEESEEESEEEQE .2E22222 , S S5525SE52932522525EiEEiEEiZ2i25?2:2:2:2:2:2:2:2:2:iSiEiE5EESi.2.2.2i2iEi5E.2.2 ,g2,2,,252.,,, ' 2:-52522E2E2E2E2E222fE2E255E52'3 'IfI1I:I2-w-'IZI:I2I2L.,.-..,...,,.2222'52'2'52223225 2.25i22fE2243E222E5E2E 5 5 52523S2Eg5E552gE2E555E525q fjfjfgf:I:I:::1:Z:f:Ij:I:I:Z:, :5:5:35:5:5:525:5:5:5:5:5:5:5:5:5:5:5 :545:5:55:5:5:5:5: 2 5 3.5525 . -:-:5:5:5:35:5:5:Eg:5:5:5:5: -:-:-1':-:-:f-2-:-:-:-:-:-:-:-:2 :-:-:-.-2-'-'-:-:-:-:-:-:-:-:-:-:-:-:2: -:-,5:-:ff-:-:-:-: .5.5:-.5.5. 5.5.5:5:x5:5:5.5. :-:-:5:5:5:5:5:5.5.5:5:5:5:-: 22525525:5.5.5:5:5:5:g5:5:5:5:5 :5:5:5 5 -:-:5:-:-:-:-:-:-:5:5:5:5:5i:5.5:5.5:5:5:5:5:5 .5:5.5.5:g.5.5.5.5 -.5,5.5.5.5.5.5,5,5,5. 5222525222225222E2E2g52E2E252BE2E22222 :2:23E1?2SE122E1E2E2E2E2 5'f:3:5:35:5:5:3' 22:1 2 ' ' 2 2525:-:-2 :5:5:5:g2g2,.5g2g2:212:22:2:2:1:5:3 :7:2:3:5:i:f:I:2:f:1: ':':I:I:I:I:I:.. ..:-:-:-:... X 42525 123255:3:S:3:3:5:5:3:52:5:f:5:3:3 :5:3:5:5:5:fi:7:5:5: :5:5:3:3S:5:i.. .:5:f:5:5:3:5:5:2:5.. 2-:-2-I-:-:-2-I-1-:-:5 -:5:5:5:5: 5:5:5:g:5q:52-:5:5:5:5.5 .5.5 -2-15:51-'5:5:2'-2 -:5:515:51-'5:5:5:5:5:5:5:5 5 5 5 5 5 7:11-ri: :Q:f:Q:5?:5:5:5:5: :-:2:5:5:5f35:5:5:5:5 ,5.5:5:5,5. -2-25:5:5:f3:5:5:5:5:5:-2- , 5 .5.5 5:5:5:5:5:5:5:5 E222E2E2E?52E2E2E2E-.- 2'2221525222E2E2E2 2f222E2SE2E2E2-2- 25i2:2E22E2E ' -.-.2E2E2E2E2E-.-. .-.-:2:2:2E2E2:2Ei2522232225 22525i2ES55ESi5ii5SE i2ESEEi?EEE22i:s: '2'2Ef55'2' 2 5225 2 1-1'ii525Ei2i5i?5S?5 5:5225525352255255222255522 :2:2E2:?f225E352251552522 13f2f2fif2E15 f1E2ii1 ' 'f1f322f2i2f1f23'5'7'5' f-.-. 15.5:5:2:35:5:5:5:5 :5:5:5:5:f2 :5:5:5:525:2:5:5:2 5 5: 5. 3.1.5.5 322212: E2E2E252Ei2E2E2E2E2gE2E2E2E2E25 2222Z2EQ2222E2E2.-. ..-E252 Z2E2E2E222E2.. . 1222222222 'I'I:IS:I:I-I- -2222- ....... -:-:-:-:-:-..:-:-:-:-:-:-:-:-:-.. -:-:-:-:--:-:-:-:-:-:-:- -:-:-:-: :-:5:-:-:-:-:-:-:-:2: -1- .52-:-:5 -:-:-:-:-:-:A:-:-:5:-.-.-.-:-:-:2:-.2. fflfififiu E7E7:Tf7f1:iQf?:1f3f3ff5:3:i:3: :Ct3:5:5:5:fi:3:5:2:5:1:3:5:3:1:5:3:5:3:3:2:3:3:5232523:3:72213:5:5:3:5:5:1:3:3:5:3:?:.. 5:3:C:5:f5:3:5j:5i:f:5:3:3 .3:fzf:f:5:3132515:53?13:7:f:2:515151317371-.5:5:2: 5:-15:5:5:iz-:-:-:T:2:5:i:f13:315:5:5:2:5:Y:1:5:2:5:5:5:-:- .-.3:2:i:5:7:5:3:3:i:5:5:7:5:5:1:5:5:5:2:7:.-.- .... . gfffffffiffff f252525222252E2525252f25252525252522, ..2E25252E2E2E252- '25252522252522252525252522-2252525252525222S522293352525225252225522522523525252525222235252525153522252E2E2525232225251523535252532.. .22225252535555325152552525525235252325252525252222 42542525252 -252-E-E25?2E2525252552525252552225-2-2 2-2-E2E25252525652955s92222222222222222522232222222222:2E15252E2352E25252 2-5252525252595'522E252E2322E2525552EG23525252525252525252Efi252522222222522252MW22225222222222222s2s2222ss22222z22222E4- .-.-5252E252222222222222222222222222222222s22:s2:zE3E3L322225252 5352525250 -525252532525252523225252525 . 2222222222227 .2:22-L:5232252E2222222225222225252E2E2E2:1EE2:2:2I2E2E2Z2E 'E2E2 'f'2'2'f'2' 'f'22E2E2EIE2E2E222E2E2EIE2E2f'f2i25 12512222 2:5252225222523222522122E2E2E2E252E2E252E2E2E2E2E2E2E2E2E2E22S2E2E2E2E 2E222E2E2?Ei2E222?E2E2E2E2E2E222E5E2E222222 '1222fiQ33E2E2i2EE2E2E-: 223223717252-.-. ':':I:Z-121:I:I:Z:I:I:Z:I:I:1.I:Z:C:I:I:I:iC:fA:. 25992222992-'5!5:3:3:i:2:3:1:5:7:3:5:-:7:3:3:3 ' 232522212323'3'32325'32523'52 ':':':':':':':':':I:I:I:Z: 7:7S:7I!Z2k3T5:7?5:7:3:7:3:7:2:5:33f3S3??Z7:-:f5Q:22:-:5:3Z7:2:-:- 'I'I'I'.'I'I'I-I-IA.. .AI-I-IAK-I-1-1-Iii-l'I'I'I'I'122-Eff' fl'1'I'1'I'.-I-SK-IOC-1'I-Z-I-I-I-Z-Z'I'I'I-I-I+I'Z-PI-Ii r -Zi -I'I'I-I-I'I'I'I'I'I'I-I-I'I'Z-If-i-I4Z-PIC-I'I'I-Z-I'I'I-.'.'.j-I-'4I'I'I'Z'.' I ?s'I'f'H'I'1'I-I' 'I-I'Z'I-I I-I-I+:-'-I-I'H-C-Z If X002-2'I'I-C'f'I-Z4-I 1 I'I'I'I-221-I-I'I-PI' 2I-I-I'I-I-I+Ii-I-I-I-Ii-I-I-Z'I-.-?6X'I'I-I-I :E -42-3:m:2f:s:a:s:z s:z:5:z:2:is:2:5:5:z:Q:z:e5s-:SQ:sswfEgf.52? 'ww .-:-:a:s:ss:2:sz:2:5:s:s '- :5 5. 5: :P:-:5:5:5.5.52-25:5:5:5:5:5:5:5:53-2e.5:5:5:5:5:5:5:5:5:5:5:5.5,g5s55rc0:-1-5:5102-3:5-r:5:5:5:5:5:5:5:5:5:5:5:5 :-:-:5:-:-:5:5:5:5 :5:5:5:5:5:5:5:5:522 :V :c NE-:-:-:-:-:-Q2-:-:-:-:-:-meFWHM-:-:ft1:-:-:-:-:-:-:-:-: :Az :-:-:-: :i .-.5:-cb.-225'-:ff:f:2:3:3:5:5:5:i:39s?2' .-:2:5:5:5:3:2F::35c52t55:ZZi2Stf!Z'48:3:5:5:5:5:f:?:3:f ' ' ' 3:-.5:c-:-:v:1:-.X-5:-:-:-:-:-:gg-:-.-.-5 :-:-:-:-:-:-:-:-:-sw-:-sz-x-me-:-:3-:-:-:2:-:-:-:-:-:-:-:- ' ' f'I'Z-Z'I'Z'Z 'I'C-I'. .'Z + ' .-I'I'I'I' 'PI'I-Z'.22'I'I'I'1'I'Z'XAKnWs 344-70122- 1'1'2'.'. : 2 .-:-:-:-:- . . :-:-:-:-:-:-: 2-.22-err:-:-:-:-:-:-:-:-:-:-:-:-:-:-:- :-:-:-:- . .-:-:-:-:-:- -2-:-:-:-rf-2-r3ssooaoc-:-:-:-:-:-:-:2:-:- :-: :-:-:-:-:-.-:-:-:-:-.-.-. .m'i4'2E2:5:z:s:ze:2:2-2 ..22:22:sr5:5125:s:5:f:s:a:s:a:1:.: 291252121132 27.5252 .-:!5:l:3:f:5:5:3:1 3:5:5:5:f23-13125:-:T'125:5i:5:512:i:5:5:f:5: :-:-:-:-:-:5:-:-:-:-:-:-:5:-:-:5:-:- .... 5.5:5:51225:Q:1:5:T2f:QT5fSt5:132.f5.5.5 s:T:?:3:7:5:2 .- :3:12'.-'-28:5:7:5'1:f:1:2:5:T .T:511:3:5S:-15:5:I:!PF'?3:-:-:f:5:-:f:5:f:52'2 :3:1:1:f:?:1:f:T:122:5:5:3:f:1:5:7:1:f:1:-:- :2:-:2:3:f:2:f:5:f:2:1:-:-:-:7:i:1:2:-:-:-.-.2.-.-. .2.-:1:5.-.1:1:3:1:i:3:1:i.-. .I:I:Ig2I:Z:Z:IS:I?:I:I:I' ' 'Q1:1:I1I:Z2:II:I:ffI:CjI:I:1:I:I:ZjI:Z:I-'-' 5 52121212-1'I'I'Z:I:Ii-I-22121-10122-I'I:1:I:I:I: :.:.:Z:2:2252:Z:I:Z:2:21152:ZQZZIQ1:2112:IQIQIQIII:IQ.52Zjljfjfjijlgfgijliljlzf:I:I:.5.- 12:12:21:-'gl:Z:.jI:Z2I:f:IjZggQi:I:Z:IjI:' - 2 - 2.-:-2-:-2-:-:-:-:-:-:-:-:-:-:-: 22 225:-:-1-2-2 2-4:5:-:-t-:- -:-:5:-:-ac4+r:-:-:-:-:-r:-rf:-:-:-:-:-zo:-:4-r-:-:-cc-:-:-:-asf:-a:-:-:-:-:- . .:-:Az-:-af.-:-:-:-:22-:-:-:-rg:-1-2-:-:Az-15:5 IS'.-Y'.21:2'I4Z'14'3It-I-Z'I'2'I'I'I'I 'I-122-I'I'I'I-2-f -I-IAI2I12'I-IQQITI-I'f'I'Z'I'f-I+I-I'Z'I- PI-I-Z'Z-I-I-I'I' 'Z-I'I'I'I'I-I-I-Z4-' 'Ii-52-Z 'I'I21-13-If-1-2 I.'I-1-2-I-561'Z'I'T3E'f5'2'1'I2I'22 2-:2:i:2:5:-:2:f:1:?:3.-:1:3:5:5:5:?:2:'2' '2'21:5:5:5:5:f 2 5:25:52-.1:f:2-.:5:5:5:?:3 ' :2:2:1:3:2:2:3:1:i:3:f:5' ..:I:Z:I:'. :3:3:5:i:52'.-:3:3:5:32 ':f:5:5:5232- I7:3:5:725:5:5:fZQ:25:f:E:5:f:5:f:'' :5:f:f:f:f:f:lf:5:f:f:5:f 5IQ:f:f:5:gf:2:f:5:Q:f:f:f:5 .5.5:f:Q:f:3:Q24:5:f:5:24:Q:f:f:5:fg!E:5:E523 222i5fiii525222222f5 2-- ...,2E252E25252., ..2E2522E3E3i525?f5i52352f'f' 2I2I22222I522I2I23fI2I222E2E53:52I223 :Q:Q:5:5:5:5:5:5g:f:5:5:5:5 55:5:5:5:5:5:55 5 :5:5:5:5 2,525:5:5:5:5:5:5:515:5:5.5.5:5:5:5:5i:5:5:5:5:35:5:5:52-2 :5:3:5:5:5.5:5:5:5:5:5:5:5:5:5515:55:52:5:5:5:5:5:5S!g:5:5:5:515:'2 Ffffifff3:3f3:7f3f5:5:7I E-:-:-E-3:-I-fi .-.-f5f5f3f5ff:3E7f-.- .:3:323f323ii2if5' 33243:2E327fff7E':7f7:3f7:'kf5:3f5:3 f5E3f5f3:3:5:3:5f2f1:5E7f3f1E7fiSf3:5f3f5:12'y:5f2:7:5:3:I' 2:5:3:2:3:' ' 5:f:5:5 ' ' ' ':3:5:1:3:5:' ' -.-:5:5:1:5:21fS:5:5:f:5 3z5:T:5:2123329:822t2:1:1:3:1:55:2:3:1:f333151125 12:5:7125:115115515531:55:225:1:5:5if3J:5:f:5:5: 5:55:52-15: -15: 515:51515:-:52:5:5:5:5:52 2 .512:5:Q:ff:3:2:Q:1:f:-:EEZ-:2:35:35:2:5:5:f:5:5:25:5:f:Q:f 5:1:5:f:5:5:f:5:5:5:5:5 5:5:5:5:-:5:5:5:5:5:5pog5:5:5:5:5: 'F:1:5:1:f21'1 :-:-:5:Y:3:315:5:T:f:i: I23E525zI:tfifzkff3922:1:5:i:551:f:f:1:f:!g:?:1:f:i: 2f5:5:5:25:1:1:5:i:- ':5:5:1:5?:5:1:3:C:5:b23:5:3:1:5 ' ' 352522222 '''2E2E2E2fE2E2E2E2E2E2E-,-. 2522252222222225222E222525222E252E2E125222222E2Ei1E22222222 -.-21E222E2222222E-.-' 2'f2E2Ei4E2E2SS:'2iE22E2E2E1 -.-2-2-22:-. 2 5:5:5: 5.5:-:5:-gg:-:5g,1:5:5:5.5. 2-2-2-:2-2-2-:-:-:-:-za':-:5:-:-:2:-:-:-:-.-:-:5:-:2: -:-:2:-:Ax-1-:-1-:-: 2-2-2-'5:-:5.5:-:5:5:5:5:-2-2 ,5.5:5:5:5:-:5:5:5.5.5 .-.-1-.Q -:-:-:-:-:-:-:-:-:-:-:-:-:2:-:-:-:-:-:-: '-'-:-:-:-:-:-:-:-:-:- .. -2-:-:-:-.c-:.c-:-:5:-:-:- X -:-:-:-:-:- :5:-:-:-:-:5:- FZZEIIZI -2'222:222g:2:2:2:2:2r. -:-:t- 2' 222E252E2E2?I222E2E22 ' 2E2E2E2SE2E2E2E2E..2:2E2:2:2: .:1:Z:I:I :f:k52-:i'S:3:3:3:5:5 3:5:1:1:1:3:1:1:1:' 1:5:3:5:i:Z?:5:1:5:f: 2525:5:7:-:2:i:?:1:1:7:f:5:2t5:7:2:5:.. igisgsgsg' EEEfEE?iEfIc?:E:iEIEE:IE2. 2-2-5555E5535555535535355525-.-235553525352525 ...25252E2E2.-, .-.-52E252E251E152.. ..525252525252522525222222222222222222222222222222222222222222 2222222555553555525255525iEEi:525252E22-2- 5.5:5:5:52 .5.5:5:5:5 15-5:gsp5:5:5:5:5:5:55 :2:i:1:3:3:1:3:ff:3:5:5:5:5:5:I:3:22:22.-.-.5.5.5f:5g2gQ:?:-.2.2.-:7:3:i:f:?:5:?:5:7:i:3.2.2...:1:i:2:2:f:1:f:2:5:i:1:5:f:5:Q:f:Q:1:5:Q:f:5:2:Q1Q:Q:5:5:E:2:2:Q:5:5:Ef:5:f:Q:5:5.5:E:5:5:f:5 53ff3:5:5:5:5:5 ,.'.5.5.5. 5.5.-.34 -+g4.3.5.5.g. -Z':22-:-rwQ.-:-:vb:-.-::+:-::-:-:-:':-.5.-.-.-.2.-.-.-.-:-2-2-2-2':-:fr-:4re-1-2-I-:-:-1-:-1:-:4-:4-A-c-:-.-:-2-A0N.94-M:f.5-M,N-x-.5.5:5.,5.,-.5.5.- 4.5. .5.5.5.5.5. q:5:5:5: 5.5.5gq:5:-:c5:5:5:5:5:5:5:5:5:5:22 -:-:21-:-FS.-.-:-:-2-:-:-1-1-12:-:t2'35g55-:-:-:-:-:-:-:5:5:5:55:55 :-:-155:51ti:-:-:2:-:-:-:-:2:f:-:-:-:yr-:-:5:5:5:5:5:5:5:5:3:5:5:5:5:5:5:5:e5g55:5:5:5:5:5:5:5:9ggag.,4c5a5zg2522:3:5:55259:-25:5:5.5,5 5-:5:5:5:5 5 5:5:-:-:-15925-Q:-15:-:-25:-2 2 I2i:3:3:313:1:?:?:1:1S:f:27'7:Y:Y5 ' . . . . .-.-.-rc-:-:c-:-: :-:-:-:5:?:f:f:t?f'5215359:-:lil:-:-:':-:-:-:-:-:-:-:v:-:-:-2-sale-we-ze-:4-aa-:-:-:-:-2-2-: 2 :-:-:5:52 2 '-2c-:c-:c-:-:f-:2:-:-:- . .... .. .- . . .c- .4 -:2:-:-:-:':- .2.-I-:-Z-2-:-Q:-24:-:-:A :-:-2-:-:-:-:5:-:-:-:':-: 1':-:-:-:':-:-:-2-:-:-:-:-:-:-:-:-S: ..... '. :- . -:-:-:-:-:-:-:2:-'-' ,.5.5.5.5.5.5 .5.5.5.5.55.5..5.5.5.5. - .... -. 5Q.3.5.5.5.5. 5.5.3.5.5.-4.45.-.-.5455 22-C-:-:-:-5'-2-: 2'22' 2' -:':5:-:5:-:2:-:-:-:-:-:- :-:-:-:-:-x-:- 2.'Qc:-f.-.-925:21-Z-: ff:-:-:-I-:-: ':-:2:-:S:-:'-if:5:-:-:- ' '13:3:5:fQ:k'f?:5:ff5:5:'22' :':':I:Z 25152235'9S'5:3:Q-.5:3:5:7:5:5:5:5:' ' 3.'f:1:i:1:i:3: 5.i:3.5:1:5:5: 1:5:5:5:i :f:3:f: 7:2:iS:1:7:1:f: IZI:I:I:I:Z5g':6.:I:f:I:C:I:Z2I: :55:5:5:5:5: :-:5:5:g5:5:5 5:5:5:5:5:5:5:5 A 5.5.5:5:-25. . ':I:tI:I:ZjZ: .-:-:5:5245:5:+T5:5:5:5:5: 3:2:1:5:5 :f:?:3:1:Ii:f:3Rk1Scf:5:5:f ....,. ' ' f:f:f:f:?:f:i:1:f:5:f ' ' 5.-.25-21112515222 IIIEEEEEZE 225zgsgs1is:afgs--Mg133g:g:'sgsgsgsgsgs:zgz:s.2.2 2-2-1-2-2-2-2-' -'2::s:s:z:'-'- 3ti:5:5:5: :T15:1:1:52kl:5:?'7:-:Y'5:P?Wf'f'f:?t5:7:7:5: 335222 5:2:2:1:2gS'F5:f99!'E92Q?3f:T:7:5:I:3:-:-:-:-. 7' ' ' ' ' ' ' Zi:1:5:3:5:2:2:1:-:- :.-f3E5:1fff5:15ff3:152- ' ' ' ' ' ' ' '5155252513:321:Tf1:5:3:3:3:1:1:5:1:1:5:f:1. . 5. 5555 . 5. 55555555 .5 i:5:5:2:7Q:f:5:5:lSf:3:7: f!0:6obb8:2X21:5P21S:5:5525225:7S:f:f:1:f:1:5:5:3:5:-:- :-:- -:-:-:-. 2. 'I-Z'I'1'I-.-I-'-.I-Z. Z'I'.'.'5MY-DSW'44-I'1'Z'I'.-.'.-.'.-.-Z'I'.'.'.'I-Z'I'I-.'.'.-.'.'.'.-.'.'.-. . .... . ......... 222222525 2E2E225E2525555f?5Si2EE2: 5525E2E222E22252522252E222E25232222522222if2E252225222552252S25222522222522222E2E2E2225252252522E2E22522E222522222:22- 2 .... Efffffffff I .5:25253:535553235555:3fiE5E5:3:3:3:5t3:i:5:1:3:3:i:5:1:3 :-:3f1:3f7f1E3:-:- e:Z:I:I:ZI. -2222222222222--'.2:222:22222:222:222:2:2522:2:2:22222:22222222222:22252525222525252E2S252E2E22222222222222222225252222222E2225222225252525222525222E222E222222222E2E2E252222222E2E2E2E2E2E2S1E2E252E2E2E2 I'I I I I 2 I I ' I ' I I I'I'I'I'I2E5'525152525252 35:52:52 :5:5:f:f:?'fQ:Qf:5:5:Q:5:'2'2'2':5:f:Q:5:f:'2'2'2'2'2 '2'2 '2'2':515:5:5:2:2:Q:2:Q2Y232i'i23212f'322'5'32323252523272325'723'5'7'5'523'52f23'5'3 P52 725'3:7:1:5:3:3:5:3:7:3:5:7:3:7:3:7: I5:QIf:2:f:f:5:f:525:225:2225If:f:?M924f:?i:3f:ff:f:f:5:f:f:ffg:f:f:f:2:E 5.551515121- 5:-:-: :5:5:5:5:-2+ 5.5:5:5:5:5:5:5:2 225:5:22 .5.5:5:5:5:5:-:-:5:5:5.5.5 5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5:5.5:5:5.5.5:5:5:5:5:5:5:5:5:5:5:5:5:5.-.5 .5.5:5:5:5:5:5: ' f222221212222I22I2I2122222a2a2s2s2z2a2a2gs22522222 22.1.1552 4-55525552525 2.-.5535352 . :-:-:-:-::-X-:-:-:-:-:- :-:-:-2 42-:-:-:-2 2 +I-I-If-I 3.3.5.3 -:-:f:3:Z5f .-:5:-:' ' F:-I-I+ . I'I'I'Z'2 .'.': . .-,-.-.5.5S:f:5:5:f:5 V . . . . . . . . . , . . . . I5.4:-I-z.:-25:5291525:-:.:... .- 1:5:3:5S:1:5:5:1:3:5:?S:1:-:-: - . . .55.5.5.5. 5555 x Ni'2'2'2'2'2'22E22222E22222E2E2E2E2:2: - -2sv.w:.-.-Q' 2 ' ' 2 . .-:-.-:5:2:i. , . . 5:5:5:5:g:5:5:5: -2-:5:5:5:5:5:5:5:5:5:5:5:5:-:-:5:5:5:5:5 5 ' ':5:T:7:3:3:3:5:-:- '25:f:'2'2 '25:5:7:f3ffSt5:373:77 -:-:5:1:t5:5:f:-: -:-:-:- '25:5:5:5:1:5:f:'2 ' 5252535g55Z52E55?g555555222 :3:?:5:5:1S:3:5:5:2:f -.-.-:-:i:5.-. :3:3:5:3i:3:1:f:i :I:I:Z:I:IS:2:IZI:IjI 'I'I:I:I-ZA' 2222 .....:........... E55 22 2222 ....:2 2222. 222' ' 'EEE 2222 ,.:2 55. ...2 ziiii' 213 r' fs fr YJ or ,ff-7 ref r - f W, fe 17? D596 W Q V lg .6 4 4 l l .R i M . Q fre Aliilemurnes NORMA HUSSEY Uh, to be at old Normal, At just this time of year. VVhen the birds seem to sing more sweetly And Springs fresh flowers appear. When the shadows all point westward, And the sun looks a little red, That's the time to spend on the campus In quiet, where nothing is said. 'Tis there they have the magnolia, And the rose crab-apple tree. Can you mention a tree so graceful Or any more lovely to see? 'Tis there that the old gray castle Lends dignity to the scene Where the vines twine all around it And make it look more serene. 'Tis there that the old main building Seems to tell us of time long past. And the old tower clock keeps saying, It's almost time for class. I must go back to old Normal At just this time of year, VVhen vivid persisting memories Make college days so dear. ww Aff gal 214 Ag 0 K -L JG Q 213' X X. f so fr ia , N g'iZ'jf?fs 1 sjswskieac 17?-91995 l mils QQ? S QBur Ctlinllege Q3 yu 1 4 1 1 i Our College, our College V y How joyously it rings! iQ A Right now a merry song we'll raise if! Cf bus life and han da s Y , .llY Y And all of fr1endsh1p's pleasant ways. In our own University. Your College, our College We love its very walls. We love the way the campus sweeps We love the way the ivy creeps We love the towered Clock that keeps W'atch o'er our University. Qur College, our College! Its Faculty and friends To all the students are so near I y They write the books we study here l Their hearts are large and it is clear They love their University! Our College, our College! You will be glad to find VVe're all Collegiate here, and so Support the school-O, tes, we know Our College is the place to go. Come to our University. HELEN HUNTER. Springtime at 36. 5. 332. UH. CARL Cook When sweet magnolia Haunts her blooms, And catalpa spreads her snowy plumes, And red-buds flushes in her love's distress Old Normal wears her springtime dress. When jay-birds haunt the campus oaks. And all the other campus folks, Hop or run or ily or sing, Qld Normal knows that it is spring. il Qld Normal! a majestic home, kgj fm! Vlfith work as well as mirth and fun, ll Ll VVhere bright frocked students dot the lawn, 9 X, And bell tower glistens in the sun. T i 'r ll xy' wg! 215 'V Q23 all f s me of t W is is 'Sl f7??9f3X 'W' ,T E512 mga T Q gil The Uliutner Giloth 1. lg! The great University Clock 1 4 Qi Booms forth the hours T, bfl High in the Tower its voice l ZS Thunders and echoes for miles VVhile young and old stop to listen. Swiftly it measures the days Departing-depacting. We long to keep them and hold them Close to our hearts, wings folded These days of adventurous study, Deep friendships, fine humor, Rare inspiration, unfoldment. Pliable, Youth filled, beautiful, This gay Panorama of Learning. The End is last sight of in laughter Until, thru the clear air the hours Are numbered by blows of the hammers And the great Clock strikes in the silence. HELEN HUNTER. illihe Sentinel ANNE MALONEY The light of evening softly falls, As lingeringly sinks the sun's last ray, From the stately pines the songster calls, A fond farewell to the parting day. A soft blue mist descends upon, The campus in this twilight hour, The students to their books have gone, To master the lessons within their power. And stately Old Man against the gloom, From its time-lit dame, Urges the stragglers with it's solemn tune, To retrace their steps toward home. Now from its belfry tower, The clock's clear tones waft nigh, The day is gone-it is the hour, X, When nature breathes a calm deep sigh. J, , 'Tis night, all nature is calmly sleeping, l T, ' Of hustle and bustle there is not a trace, fa For God and the star of time are keeping, ga Q Their watch calm and restful o'er the place. it FN' 'lp . D 216 6 lf s'f Av'XSi?7 f A r A af .gs wA ' M. 17723395 ,926 6 wWw5 at 5 l , lj 1, l Despair .7 jg 0, Thou to whom the Christians pray,- I 4 Thou Merciful and Mighty Power, W! CS Support me in this darkened hour! M ' The hand of persecution stay, fx j Nor pass me by! When those whose friendship long I sought Would pass me by with scorn and sneers, Their proud disdain my spirit sears! I count Earth's pleasures dearly bought, And long to die! O, Powers of Darkness, I conjure Thee from out Hades to my aid As hope Celestial seems to fade! Give me the hardness to endure And wrongs resent! If I may long in memory nurse The venom at me daily hurled By this, your boasted Christian world, And, rising up, fling back the curse, I die content! JACK SMITH. Qfter winter blaring HOMER HURST This is not spring-this is the winter of my life, When dreams and hopes are often crushed by jealousy and strife. These are the ice and sleet of living-living in a world Where Hags of youth are yet to be unfurled. I am in my college years-this is not youth. Youth comes only with appreciated truth- Knowledge that my life is just begun When with mate the race of life I rung When, with hearts of steel, guided by love, And strengthened by that goodly Power above We press on, to live our Spring in unrestrained bliss. Then, as Summer comes, to be replaced by Fall, I We shall not dread and fear the Everlasting Call, AJ, X But our hearts and souls with prayers and thanks only ring. K, VG! We have lived-we have enjoyed our Spring. I I l gg j ' 217 lg V PM n AH 'lg' fl i if fr KJ ' Ti',7 sift ' s W 1779896 W gf 53 .W iv f I ilillemurles Z! Qi, DALE SNELL 'Q M 'Twas twelve o'clock by my Elgin. Cl 53' The clock in the old church tower 'X Cast a spell of gloom upon us, As it slowly boomed the hour. My room, that had rung with laughter VVas cloaked in a silence deep. My favorite chair was occupied, He sat in a crumpled heap, Years back we were pals together, And the college that we held dear VVas the topic of our conversation, The times we held without peer. At last the silence was broken, His voice sounded hollow and weak, His face took a light so pathetic, I trembled to hear him speak, i I had a dream last night, he said I dreamed the team was backg Our trusty crew of lighting men VVere primed for fierce attack. The Green and VVhite of VVesleyan Were there to take the game, But the Red and VVhite of Normal VVere playing for the same. T The Felmley Gym., just newly built Was packed from wall to wall, The bleachers groaned beneath the weight Of school-marms from the hall. A cheering corps of eighty men Set up an awful roar, We yelled ourselves baldheadedg The team was on the floor. Fight, hght for Normal, every soul Stood up and cheered the team. I dwelt in Heaven for a ti1ne So real did it seem: I yelled, till I could yell no more And tho we lost the game, VVe stood behind them to the end And felt no sting of shame. gi I'd sell my soul to. live again 1? 7 I Those days long smce gone byg ,ZQ 'KQN It seems 'twas only yesterday Z 7, So quickly time doth fly. Q, u 'X i I X A 218 l I 523 T JG - ' r rf 'izfifzfsh s mi ' , ' A ,AA,,A mmjjj ..... 2:2123-. 15EgE55'5j'j5gEg5gEgEfj j5151511gl'5g1'5''QIQQQIQ' '' ' ' j515gEg5gEg5'I''fjl''j''5555223555353E531'5r5g5gEgEgE5E5gEg51EgE1Eijij ,.I.A5...515352E'5f5f5'5'E,.,jigE1.,,.1E35253EgE151E122E1Egi2Z15251355523552155igi55551E5515'5'5'5' 3 -:5 . '-2: . ' 143:-:-' -.gzg-25:-:-1-:-23:-fx?-13:-:li-:gif-1:1-2: -' 5-12:-1-:-:-1-FR 2 ' A 4 2:-: . - - 32'-. -. '23 +1 2'f2:-:2:2:Z2:cY'-:1:1:-:2:-:2:2:k2:-:ivy ' 1:- ':2:l:f:2:2:2:2?' 1 k -: - ' -11212:-:-z-. ..4:P-:-:- .... -' . :2:-:-:-5:2112-1:-:-:-:-:-:Q:2:-it-.-:2.: , .- :-: -:-:-:-:-:-:-:-Q 1 Q -5' 1 'N 2-Ziff -. . -If-211-I-Z-Z'.. I .. 'Iv I ..-If-. .-' 'I-I-' I'C'I'I-1:1-Cf'1-C'C'I-Ivf-I-22' . . .QQ-1-Z'I'C5f'I N 415233113 '-.2-.Q:3:3:::3:5:1:::3: -' Q: '- ' 22'-iffi'-iv'-:'-14-'-:-55- - -' -Ny-:-.sf 'Q 5 .2 ...WWA w:cu:-:xv -21422:-'- 2 L53 4 K 'L 1 X -. N.. ff.. fiffflfiff- 2:':- :A35'f7:ff '5T'7'7 iff'--' 3 1'35:7:?:f:'.?i:'T:f:f . 7:T:T:f:27:3:3F:275:T:7:7:3 :A CV? -. - . .- ,- .- - K ff 5 5 -2i3s2se512fsssff1f222sszi.:. s. iff? - ' -V'-4 - III221E2E2E151E1E2E2ErE25 irif.-f'--Eff-525, .gf-I-j- - , . A , 32352555151f'5,,,.j -:2.2::,,551'-E 5'.gEg.' .-:iff i-12:2:2:2:2:2:2:2:2:f:2:1:fi:kZ:2:-'5 --.2:k,. .- Z5-:5322:55:gg:5:3:::3:::,15.j152222125-2.2t5:2:-:3:23:-:-:3:-:-:- . Q .g:g,-.3 3::.3:1.-33:4 .5:P'g: --:-.3.,5.-:gzgzgn,-.g:-.3.,:5.1:-:::-:-::.-.1:-I..--' '- .,... .Ezsrgfiffigiff53525526555555 5-:3:Izfzizizifgtzggif-13:3:2:-153:52:Ziff7i3fff5f?ffff37f551:Eff:ffffffff?f?ff:fff .: 235212:Q:Q352:21212:25:f:f:2:2:5'ff'Qf'1.1.f.Q.5433:I:::5:5231::f:f:Q'-:::f'ff:f:Q: :g:I:2:1::.3 3.3:1:2f:f 'fifz23:53:::1:ffEff5fff:ffffffE:'f.f fff:2fQ:AA5 fffffffffffgf'5:fffff:35'f:f.3,g:::E :3.2.!i3.A.i'-'T:fT:2ff2:7:E:i: ...:..'.':'E55fE:' 151515252 57f55E52E55EA ' 5' E2E2'.2E2E2:'1E2E2Z2Z2E2E2E2Z2E25 .2I.-:-:-. 9E2E2S2E2f52E2S2E 22212E2:CE2EE2???fffE'SI'5'5252E2E2Z25'If .'E2S2:. ' 5:2E1E1E15'5 '''lfiiif-12121215555522255 L: ' ' '2 . !5255555553255253Ss5252E2?-5 5115-5.52. 5252951559gs?12?f51:51Z:Z:Z:':Z1I15:51f222Esfs:5.'QSQEQS'522733-'1 3I5.5:2:5izisEs22Sgz2sis2225225522223E222235522552252225555523252222225225222E525522325S52532255555525225225555252225s55iS25s225e2sEsE2:1:-.,.'f5f15121Ef:1:2.5i1 55555555525525255532255 5 .i5izif.5s '5 222 12:2:-:-:-'-'-'-:2:-:-:-:2:-. :H 3 . -1 rc-:-aa:-:-:Q I 315: :5 ,5.3:-j,:g:-'j.3.5:1: '-:g:1:3:::1:1:3.g.3:g:1:3:5:3:3:::5:3:::3:1:-:-:-'-'-: j,,-.huqcpggfpgtgqe-5-gg:jjjjf-N:-rg:::::3:.5:-'5:3:3:3:g:5',:5:5:::f:g:3:5 :3:g:3::.:., ,5.5:3':3:g,g 2:-.5:g:--. '-:gg-3 Q -:3 ' 251212353 5355555351: .-:3:T 53. I 512: '.-:T:3:5:1:5:1?'123:1:33522:123552125:5:3:5:7:5'i3?ff f:5:3:5:5:3:5251352325?g3E??57f3f':7:?i2J55'3:7:7:1453:5:3:fZ3:3:3:51-:315:3:?:3:3?5', 1:3:i:-. 3 : :3 :P2:3:3'f3'kT:3:73:213s: ?'3'f .-'F iii.: - l:T:-, ....,. - . . UU.. . .. .,. ,... ...f.. ... ....A..... ............... A ..,............ . ...............,.............. . , ....,.,..,.,..,....,.. .. , ..x.,. ,.,.. J .. . - 1324 i:3:5:3:3:35:3.' : 12:2 435274'f:1:3:?:3:3:23?Q:E521:f:i'3:3: 5' '.-:5:3:i:3:2:5:f:5:5:i:3:.5:312:1:i:3:5I72531793233:ii5:3:iz31?:5:1:3:313:5:5:i:i:1:5:3:i:f:3:?:i:335:7513:3151252225:fi2:222:2:iz2:515:3:iz3:2Zgfflfffkafziti235:35:3:5:3:5:5t3:3:3:5:3:5:2. . 'fg3g33:1:t3'3:1:1:3:5-:1:42 ' 5.3293 :?'- :-' ::f:1:1:2f25:f:2a.-.Q 5:5512-1 . 152s:5f:2':3:s:23:5:ss:55:s:s?9- I 1 '1-rr21525f5r5 252E152525152E152515151555:5255151E252525r5rErE2ErE2E25rE251Er51' -'-'-'A'-'A'-'A'-'A'-'-'A'-'Q 1-If-1-1+If-1+-1-151:11:1:2:5:sssa:2:2:2:2:2:5152:55:.ev'diss:s:1fs:f:5:2:5:2:5:2:2:s5:5.. . -1 -fear15:z2:'i:5:1:E:2:3:25f:2ff . 42:35. .212 -. -- , -4f-----A ------ . 2 ..,. 9 ' -:-:- :-. .-x-:-S2S'3:Q,:2:3f'-r- h.gg5:5-:3:3:3:g3z3:2:::5:5:3:-' ,315:-'-'-'313:53:3:::5:::3'-'-'-'-'-' 3:3:zzz:::2:2:-:-:-:-1523:5:3:2:3:3:3:525552:24,1'2:2:3:2:3:5:3:::2:2:2:,, 2,-1:22-135-git-:4-1-'ZZ :-:-: -:-:- 1- :2:-:-:-12:4 ff:f:f5f55Egf5f5f ,.3:f:f:fjfgfkfzf:Q:fy..3:::f:Q:Q:f :2:3:1:3:2:2:2:2: :f:f:Q:f:f: :Q:f:f:f:212:32:Q:fif:5:553222:Q:f:f:f:f?Q2f5Q:f:f:5.3 52:25 Eff: Qgfffffff -':- :-:-:-:-:2, 2:-.. ' . 2 5 - .-:-:-1-1-:-:-:-:-:-:-:-.-:-:-:-''.-:-:-:-12:-12:-:A -:-:2:-:-:-:-:-:-:-:-:-:-:-. :-:-:-:-:-:-:-:-:2:-:-:-:-.'-:-:-:-:-:-'-:.-:2:-:-:-:-:-:-:-.o,g5,-,.. vw:-z . ' :gg -:-:3:-:-:-:2:- ' E-2-E-ZE2E2ElE2E22Cgi'f 252E2E2E1E2E2f?E9 5''.'.'Lf-:4 -122221352E2E2i2E2E2E2E2E25'I.2:2E2E2E2E2E2E2E1' E2E2E222EiE2S25 2522222121-: 2E2E2E2H2E222Z1E2E2:. 325225522IfiE222E22If1E122E2:YS3:1:-:-.-.'.2 -'A- -.-.-.2:2:2 ?2E2:2E'E'f'5'f :::3:3:f:f:Q:3:3:1:2:l Sf 2:f:2:2:f:2:3 'ZP ':f:f:3j,:Q:Q:2:2121ftgf:i:f:f:Q:Q:if,3:f:2:f:2:2:f:Q:f:f:f:2 -.,,.-.,,:f:f:Q:f:f:235151223 3'3'3'5'i'i'f'?'i'f'i'i'- Q4:3:QI2:212:251229221Q:f:39:2:f2:f:f:1 2- I f:f:f:f:f:f 152321525 :-:2:2:-:2:-5:-1-:-:-:-:-:-:E-: -1-12:-1-1 .-: .-:-:-:-: .2:-:-:2:-:-:2:-:-:-:-:22:-:- .2:-:-:-:-:-:-:-:-:-:-:-:-:2 2:2:-:-:-:2:2:-:-:-:-wx-' -' -:2: '-:-:-:-:Q-:Q-12.-:-1-:-:-:TR-Q:-: .2:2:- 32:-:-:-:-22:-2:21-:-1-:-:2:2: ,, :5:1:3:5:3:3 3'3'1'3:l:3:3:'d: i:5:2:f:3 III: T:5:1:i:T:-.Q- :3:313:3:T:3:3:5:5:1:i:f:3:3'1-12:3:2:2:i:5:f:3:3:3:5:f:i:2:3 3:i:2:1:2:2:i:5:2 1- ' :- fi: i:i:3: '2:5:3:TS:3:I:3:i:1:1:i:3:3?1S: :317:-7-. 2:2: 2:?:2:2:2':3:3:i:-:-:-:-:-:- 1 35' 2':':':':':'z5k2:k1:i:I5:1:2: 3:3:2:i:i 1:23 '5:1:5:5:3:3Zjitiijzfritf:22353Eg:-1.353232:22E:f:f:f:f:Q:f:f:Q:f:f:f:f -.gr 3.3.3 113135:-,ig:2:3:3:3:3:1:i:i:3:3:1f,52g-.2..2:1:f:2:1:- :iz 3:2:?:1:2?l:3:l:kk1:3:I:iZ1 52:51:25 352535555215 ifffifififlfififff ffififf 5 5' 'fTf1:If3fZ5E2:i1i23f3f3:l:2:f35ff5:5 .-:3:3:115:5:3:izi:5:i:3:3:f:f:i:5:5:1: :5:2:3:3:f:2:- 3.-:3:5:3:5:i:f:3:f.. 3132... 535355532if?:-:Z5325235I53235fiif:?f3:7SQf3fj?f7f?4 if 5ifIfffiI-.3f357fi535i53f5f3:7f5 ki:52113.-.-.7:?:f:3:3:?: Y:7:5:3:3:3:5:3:1:? :3:5:3:5: 2 :5 :f:15'Yf:3Z1:i:3:i:3111213:3:lS .-:3:3:1:5:3:3:5:5:i:1:3:3:1:i:1:i:3:5'3'2' :3'1'3:1:3:? .i -.2:3:i:i:3:3:I:3:?:3:3 4:3:3:5:f:i: :5Z5:215:53252351-:3:3:3:3:1:-:S-:Ziff :2: 212:2:2:3ii:2 4:5?f2:2:5:7:3 '-:-:-:-:-:-:-:-:-:2:-:-: -:c-:-:2:-:-:+:- :-1-:-13:3 1 -:I-3465:3:5-x3:::1:3:3:3:5 .:3:5:5:5:5:3:5:zz:z3:3:::3:3:3:::5:3:5: :::3:3:2:33- .3:f533:3:::?2Q5'c-, :3:3:3:g:::1 55:53:312:f:5:2:3:3:g:5:5:3:g:3:2:5:-:-'5 3 . -:-:-:-:-5:-:-'f-:-:-:-:2:-5'- - - 155535555 555E5E5E555E5555555E5E5E52SE555552555555555 55555555555555525525555252555555555555355'5'5'5'5'5'5'5'52555 5572553255: 55525555535555555245-'fE555E55553555 5255355E25?I555E5555555BS5'K55525 52-725252225'5'5555E2E5'55-'E 2515: :3f1fg1:1:-1-:ffi:if121525553:if353Ef?:i535355f1f1f :-:2:-5255 ' '52 -:29'51f2E1E2Z2ZIE2:2:2: '''13:5:2:e:s:5sQf:5:2:5:2:5gg::5. 1' 211111. 151. 32:21-:-:XII 2:-12: . :-:--:-:-:2:-'- '2:-:-:-:-'212:-:-:-'-.-'.2:-'-:-:2:-:-:- 2 '-:2:2:-:2:-:- :-:-:-:-:-:-:-.'-:2r:-:-' ' ' ' H-22:-: -I-Iii:I:I:Zj.5zIlI:I1gI:IgZ:fjigwllgfjgsjl1QI:I1IjZ:I:Q3E C A 5:2:1:5:s:5 'Z2EfE .255555522552525532552222E252525355i?'i:z55Si?5Sz5 I-Z-.GH ...., x ...... ..,. . ., 5' ' -1-1-1-:-:-:-:-x:-:-:+:x2Q,'E-:-:-:+:-:-- '5:i:1:E:f:E ' f:f:f:2'.Q:f:f:Q:f:3:Q:3:Q'-tiff',f:f:Q:f:Q 3:3:5:323:3:3:g:3:3:55:323:323:3:g1323:12:15:31::5:3:gz5:5:1:5:5:313:3:5:3:g: k ,2 555555555552 25151:r555Z5E5E5555553555553553555555?5i2E5E55555S5E '5E555E5' -522555E555555525i5E5E5 522E2E522E525E52335535525E2E5E2E5E5E5E5?'fE2Ef 5555555535 FE.. 535353 f5f3f5f353:5w:155f3Fififffiggfifffffgzffffffffffffff , A-4AA EE525235525EE:5:EEE2IEIEIE1EEEEEEEE23:5SRA54E51:5it5:2fi?ESES::EEEfEEEE5fEE5f5fE5 213, 5253 42252:ff2fff2:fff:5:25fff: 55553fff35ifQfi3535ff5f3f3:3f7f35i:3:3S3:f: 1f3fif7f3ff:5:3:3:5 '?:3:?:3 i :i:1:5:1:1:1:1:3:1:5:3:2i:3:3:1:f:3:-2232:-12: z:2:-:-:-:-:-:- -:-1-:-:-:-2-3-:-1-'-SQ:-32:-:-:-if-:-'l'9:3:3:-:1''RN2:I:3:2:':i:-13:itfbff'-:-:-2-:-:-' 2:-: : ' 5 .23-:-1-:-:2:-:-:-:-31:2 :3:3:3:3:-:f:i3:-:3:3:i:3'Ki:Z3:- :5:Z3:3:2:3:1:2:3:2:l:2.- 'I5f'I'I'I-I-I I'I-I-Zt'I'Z-141-2-If-I-1+K-If-1-I-Z-1-2'I'I'Z'f-3C'f-I-I-If-f'I . Z-I-I-1-I-I-I-I-241-I-I-I'I-If-'Q-2112-?F? 5Z-Ilksjflf EZ-I'IS5Iv'i-I-I'Z-.'. ' I-I- . . -1- . I-I-I-2'I-I'I'I-I-Ii-I' -If-I-If-I-I '-f-f-'APf:1'I-I-1-f- I Nfl I 1 C I I 2 I I ' E'f'I-I'I'I5f- -I-Ii-291-PZ-PI-IAI'I'Icf+Ii-C4254242'li-I'PDI-2'2-I'I'I'I'f' 'Z-2-PZ-1-Ii-I-'-I'f-I-I-I-I-I-I2ik9I'f5I'I-I-2-Q5I'ffmIgglC5I'Z5I-I-2556-C-I5I'1', C- .-Iii-I-f-C '-'-' ' .... I I I I I 5 1-I-I-I-I-1-I-gli-It-I-I-I-I-I-I-I-I -IC-I-1-1-151-I-1'1-lx' 15E55555555355555555555555fE555i55555555555552555353555525555553E5555Z55555E5E5E555E5E5 5122555355E555255555555if555555355252511555?E5E55525252513Zi5i55Ci!I551355352555555551513552555E522:-.'55E52555E555Er.r.r 5'5'5'5'3' l 53555553E5555555535535553555555552551 :E5E52235555352535Z2E5EgE2E3E2EfEfE5EfE3Ef 'r5555535735iE555?55E5E55555E5 E52535555525555555355553455E555255515521:1r5r55E55:ffI5jiQ5135-5ri5535525E55555E522E:5551Q5152325Ei5E3E5E55?S,i55E5E5E555 ' . I 55Z55553E3?35E?fZ :-:-:-: -:-:-:-:-:-ze-I+:-:-:-Q-12:-1 :-:-:-:-:-:2:-:-:2:-:-':-t-:-::-:-: -:-:-:-:-:-:2:5:fg.1:3:3:3:3:g:-' 3:3:2:-Q.5.31313:gg15:13313:-'-'U'-'H'-'-:2:-:2:-:3:gg:iz511:5:I:2.j-:5:5:3.j-:-25:31, '5I:ZjZg' .3,3.:. 2'-'2:5:5:::3:5:g :f--:g:5:3.g:3:2:3:5. -:gi-25:-13:-:3:5:QS:5 25525255 5ffE5E5EfE3ifEffEEfS2Ef5Ef? 225332522325EfE5Ef22f5?E5E25iE: ' 525552525E255522E22IS2E2235123f-.-:2E2i23iJ5252E222E25'f EE EE E'E'E'E'E2 2S?22E2E2S222E2E2E E252EIS152fi:iff2E1f2E1S1f1i2E2E2EfE 'f31'252E2E2SE2 3:2:2:f:2:3:3:Q:Q:215:Q:2i3:g:f:2:2:Q:Q:2:2: ---2:E:E:E:2:?:E:E:E:2:2:ESEIii-,212rE23E:i22rE5?2r22'322:2242IE22:fI232182:2:2gg?2:2:QI2:2:g,gT?f:fQ:f:E:E:2:32:, 3: ::::: 'Q:f:j:j:Q:j:f:j:Q:j: rf:Q:f:fzf:f:Q:3E:3:f:f:f:f:f:f:f:f: 3525552519255 Nfif3fTf1E35?53f1E3E5f2f2 :2E2?2E2 52E2E2E 2E2E2:-:-:-:ec-r-:iffE2 '2'2'122E2Z1225.2?2E1E2EIE2E2EISE?2f'5iE2?2EfiIE2E2EIE221' -:Qf1E152EfI5j5'5725'452f1Q .f'2E122E1E2E222f12ii. '2f2E1fiE2E1f2: - 522-3-Z-E2 :NEIEIEQQIEIEIEQE E2E2E2E2E2E2EIE-.'E32f 'Jlff-E22 2E'4.'5E2S5E35f222f- 552525555'2'EEEEEEEEEZIEEEEEQEEEEEEE 52525552555555I5f5EfEfEf:2.-: ...5Z2ZE EEE2E222I5EfEfE22 ...55522325EfE2E2EfE5Z5E5E5E5E5E3ZfE5E31i5fE3EfE5ig55 'A'A ' S5S5fifiiiiiiQi5E5E5f5E5EiQi QsiiiiisiiiiiiiisgQEQEEQESEQQQEQEQEE EfE5EfEfEfEfZ5f552Q55EfEQEfE2f5EfEfEfE5EfQEQE5n 555552552s52555g.51j3f 'ffff1Q55255252Q52Si5255?ie35525555i555,5 ,5,5,5,5,5 ,'.' i55555 2525522525555 '5555iiiQiiiiiiigiiiiiiiiiiiiii 55i 7'3i.f-.Ea 31353515 1315131222: 232' :f:E:Q:3:3:f:f:fLQc1:1:f:3:3:3 Q:2:21212:f:5f:Q:f:3'?'Q:QI22.f.Q'i:Q:gfQ:f:Q:f:f:f:f :fzfxffzfz 4f'3:1:3'Q:3 A:Q:Qzf:Q:Q:Q32:2:3ff:f:f:Q:f:f:2i:f:2 :f:f:f :f:Q:f:f:Q:f:' :5.:,5.:.U . .5:if '::3:3 '23f3:2:f:Q:f:f:Q:f:f:21Q:2 f :i f 555 5- 552555552522255159552555335525555255555355555355:5251555555555255525255252555552iiiifii.. - '52 5555252 5i55255z.E.i.f22 5E?E555i55 25i5E5E?i5ii f2E2E2f2:2:1: ' 22:2-2 .iff ' E1E1E2E2E2E2Z2E2E2E22-:1:- 212121212122 3f15f5:i E3f5f3f3f3f3f 2E1Z2i2E2E25'-X '5?'22E'7iIE252--12QQ2'ffl-lf-'-2.2-':15 ,.2..- 3222222222222 502222222 E12-.-.2.2E2E2 '5 '525' 21212121E2fb:2E2Eff2f1f2E222f 2' . '2 ifffgffffffff :ggiE2'jf-12522:-13:5252251512222E25122ff555f::1:2: 5'5'5f222gEfE.'IEg32EQEQEQEQEQEIQEQEQEQEI'.5:3.,1-I-.gzgz -1315 ,3 IE- 225225225 ffffffffffffifgffff :QSf52E5f15 ,-.,. 5'-5f2E2E5E2E3E2 P 2225222522fE2Ef22EfE252EfE2EfEf 5:4 525 E 5553555555555555f5555555 '--55534 55555515251555555555'ff?5555555555555555515-Q-Q-555555555r.1551E25555555?f555E555'5555555f55' 555555f555555?55f5Er555555-55555551555 5 ,- 5' '15 . . 55552555552252.152222225:gig:gfeigigfigigigigiggigigi qagi252i2..,z5zga5:f: 'j'1'gig252555EQEQEQSQEQESEQSQQQEQ sgagi' .,:.1gE3g5 -5 215' -.2:525525555325555335E55g55Eg533Eg5555E1Eg555 5555555535552553555515.:555g5g555551Qyfg5gEg5:'525r55255555555353:Z5,xg5355535g5 ,g',:55gE15:::5 5jEj5jEj. E:5j5j5j5Z5rE15rE1. 'rE1E'5 5 fffiffffffffig 5555 255555 fffiffffffijfff2525252252525 , ,. 53522 gig 'I 2E2f2E2E2EZiE1?I5252f152252235:-5325555225522 'Q:5:5E253E2SQE222EQE2E22:'E2E2f If1E2Ei22EII?'iL22E2f1E222f-'g,5,Lj25E2E2S2E2E2E1E25 53535253515 535153355fiififififfififiz- 5 2:2:i1f2SfE1E2f2f25f-2-f2'.2E'5'5'5 -i2i -'-Q-.-12222222 55215152 3 2' 23555555555555555555351351555?5rEiE1E:Er5r5:5r5 555355515553555rE555E155'5E35555 515r5f?5'i5r555555555EiiE2Qr5555ZQ5f5 '' :5:5:3:s?221f3.5:1'425ff51Es?2E2E2?5E5:5....1'-iI 5'5 235255355 55553555555355r5r55E5555355E555E5 555- 55555 i5252525s5s5a ' AA45555.-:rE3E5EfE2EfE5EfE 2525: 2' 222222252512:5151555-Q5Eff22525252?s2z2s?s21':i5:1:s2s2 ' :5:5:5:s:a:s fEfE5'5'5' .52555E32552f55S5555f5555E2E5EfE 52553 -ifisiif 1555555555553 .. 71.1-.255 f5E5E5E3555E555355555555555555355 1552 5-5555535555552555155f'555555555553555' 53555555552 5'Q5555Q5555535555555553555155555555555555r5r51' 555555555355 '55255:5:E555 fifErf 2252525 55 ' 5222523555555222525225235225222222 QEQE55 1:fEf2fQfE5E52E2I25I5 'f,2:g:2E55 i2?iS25EfS3f225E2:5EfE2: ' 2232222222221 'QEIE 22252 -12222 'IEQEQEZEZEQEQEQE '4 4 E252252222222222QEQEQEQEEEQEQEQEQEQ 4. '::: fr- :-:-:2:-:-:-:g:g:g:1:g::1g:3:g:3:-:-:- -22:-23:-' ,5:3:3:5:-:2:-: :-:-:-:-. ' . A. .- j,,3:3tjp,53:3:3:3.5.. ...::rP3r::5:3:-' -:3:5:5:3:3: :Z:I:I:I:I 53:31-:-:-'-'-'h' 3:3131325:3:Z:::3:5:3:3:3:3:1:::3:5:5Iggg,-Y:3:3:3:3:3:3 fffifgfifgfiiffffffifff525252525 515-5-5-5255 WEQEQE-Q? Q3??5gEfEgE5555533E35gigEl225r5151ErEgEg555g5g5,j 55. 5'555'f 'EffEffff:25Q:f:2.4f,:g:5:Q:2ff5f. 55553 5Eg5353555ggirE25555E55gE5E55gE555E3Q3555555E5ig53igE3i555E5 21512125-....,.5i5522 iii. 5 5225222525522 . 225'5252232E225252222525225252222:2:2:5:5:5525252522'ii3.,i5i525i5i52. 5252525252i225S2E25z:2:z52E5i225 55555 :Q:3:252255222255625953255Ei5635355535553Eizfiii- 'iE2E2E25'5'5'EfE2E2E1E2Q fTf35?f5f3f3E5f3E3f?f5: ..... 2122222151222-z-.-: 2 -Iii. JI-:2E1E2ESISEIEIEIE222222222E222522222E222Elf?'-r2E2E2E2E2f2E2E2ffZ2E2E2f2E1:1:2. 3:5255355fi5353A'f553f3f3:3f?f3fT 5222222223222.fE2E2E2E2E2Ei:2?:f:2f1: 'f2E23E2SE2E2EiE2E1E2. 555525 5325E5E555E555i552555E5E5555r 5:5E555E55555555555i2f5-'5555.,.,: ,.,fZ51555555555515555E525525525555555EQE5EQE555555Q' 55555555555555555152555252551Q.,5g5555E5E5EQ55Zf'f55555QEf5555EfEQ55555g. 55555553555 5225253555555 'f2f5?55E55i5552555552f5 g522is5si2i5i255i2i. E2E'E'E'f'E'S'E'I:2TE7E2f222E25CE.gEIZ2: '2E2S222E2E222E2E2E2E2:2 :2:2:2f2E2f2f2f1f?5SS'f-1222225222E222E252E2E222E222225222E2:2:-:-:-:iz252E221212221E12IE2E252E22222E122SIE22252E2E2E2E2E2E2E222E1E25 '5f'L:2E22222225222251 .2.2.IE2Eff2SfEk3 '52E22IE252212252E2E2fE2?E25iiii3SiEx :2 ':5:3t5:7f5:i75t3:-:3:iI- 3:3:1ZfZ3'iZ7:51?5:-. 3252313231323 E- I51:23212:2Zilizifiziiliiiifliii'.1211:2: I5131:2:lffiiiifl:I:Z:I:Z:1tI:I:1:Z:Z- ZZ3Z:Z:I:Z:Z:Z3ZZZ1Z:Z: N.':?:5:3:3:3:3:i:3:3:i:3:1:3 :1:3:3:1:3:i:' :Q9g93:3:5:?:1 ':3:3:i:1:2'1:2:1:1:2:2:2:1:E:2 5 5 I 5 5 2252.55-5-3355255555555 E555E5E55555'Sf55 -E5E555E5555525555555i555553E5E55' 155253352 5355555255525555555E55555E5E5555555Egf555'5Z51'2'1515Z1552. '3555555E5E355555555555555E3E5 . . . 55E5E5E5E553?555E555553E5???iE53'EE5E5E5555 f555555555E555E5 ,1.2.f.2,2. 551535 '2 ,QQEQEQEQEQEQ52Ef:fEQE222225522552-:QA 3.53:::::51::1:513:5:2:1::.2.3.2.3:g2:1:fg3fj 5If?E525252222f2E2E5EfE2E2E2E2f2E -5225222525 I2222E222212252E2E222E2E2E2Z2E2E25 .-:212E2E2f2E2E2E2E2E2E252E2:Q252E2E2E2E2E2E2f2S2E2E2EIf 22222522222325332QQQIQQQEQEQEQREQZQEQE' -fjI j 'lSffE I .,.. 5' '- ---- I-I'I-Ii' If-I-2+ ' ,-I'I'I-I'I'f'I-I-1-If-I-I'I-. '51-1-I-I-I-I-I-I-I-I-I-? .-. .4 ' .' :::::: '- 2:1: , Z '1-fl . E2E222E25 '5'f'52?52. E222E22122222222E122222122E22222E222222221SIEISI2252212222:-z2:21-z-:2:-1-:-.ll 52E2:2. 'f'5'f1E-.' '52.-:I:ini2222:2:1:2cl:IES?12252225221225152EIS22252212222221-.-fi2E2E222E1E2E2E2E2E25'5 :-:-:2E222222IE?2-5?E22fE2E1f1E1E??2'z'52515IEI3 -f-I-. .1222 EgE5Eg53E55g53EgS5,.,g.,iif+3S 5.522221-1555 2515gEg53S555E53g5gi5Eg55E55323335135E3E5EgE55gE5E35gE3552555355255353555555555g555gE1E151EgE151Er55E15rE55f5rEr555rE5515r5153515153515rE2555g51Eg555lE2E15g51E5355333555512 '515r5 ,Z2.25::1: 335535323535gg5Q?155ErEg5g5gE55gEg5 :555::15f 535525 ,5 r5g E:3:E5E5E353E55g5555g3551.15z5E5E55535: -55, 523533555555355555555555 ZigiiijfgE35553553535555535555255353555325555:5:3:53E55:5E5E3E5:E33EEE3:55325:EEEE355:33:335552532353:535553513:533ggzgE5E3E5:3E3:3:5:3:g:5:353 53555555 ' ' ' 5.I.:5355555gg5.,555g5:515gQp5,gfg5g5- - 5351- 5555355555 5r5,1:5r5q,. 55 if555555335f55555f55555555f3f 5553355355: '555E5 - 75255555435555E35E5E::3E5EEE5'-25515. A'EEEEE2LIES535253552535353553355555255525'I2525E5E55'5QS55553555525255535555555225533535553552E555E5E3E255E5E5E1'- '- '5'-'-5 -5-'-'-5-' 12E2f:5555Z5E3E555'E IizifEfgfgfggffifgifizzl 212. .5EfE5E5 ffi 22 5355555555555555555g5559g5555E5E5E55 5555 '2-511:5252225QEQEQEQSQEQEEESEQFESEE? 525525525 ES222552252i2iSE5E2E?i252i?52ESEEESESEEEEEE.EEEEESEEEEEEZEESSESEE '35 E 25 'f555555555555?f33E?55555355255 5255553152555555E5E5E5Ei5fi355E5f5I51fE5E535f55Ef??:f:-. 55:55ff55555555E2E5E55 E5E5E5E3Sff'-ifE5555325355325555555523E5E5E5ZfEfE5E3EfE35ES3'fF':5:555:Q'I5Q1.- 5252525522 55555555r5rE5E535555555553553555255r5r515i5T'Zr5S55Z5.2' 2555555 -l4fi5E5f525E555?55 V. f'7'2'E:Q:f:E:Q:Q1f:Q :f:f:f:f:Q:3'Z'-QZQQISQV TIQZQSK:QIf:Q:fIf:h3:f:2:Q:f:Q:Q:f:Q:f:f:Q:f:3:g.3,2,3.g.1..' -12129232-:5'3'2'i'1'3'3'i'3'i'3 ' ' .2:5:-115125:2:-:i:3:2:f1f:i 'ff:f:l'Q5:2:f:1' 51225:2:23212:f:ftf:if-:QE:fgfizf:Q:f:f:f:3gL4:f:f:Q:f:f: 5.2 IE.. ..':. 25iii5255- E2E2EIE2E2E2: : 51f2Ef?:-'- C5252522222E1222252525522523522252512222352E221f2E2Z2E5E2E22YE5f :-:525225525252552:-125222:Cz2:2:2:2f2E2E2E2E2E2E5Ef55. E5E2E2E5E5E5EfE2E5552525252525555 2222212152: 535' :2f1f2E2E1522ISI222119522252225222533622E25 f'f:-551'' E2 522222222EYi2:f:2i2E2ffE252E' - I55535553:35,5I5QQQEQEQEQEQEQZQEZEEZEQ E55gE5EgiE2f25j-,5,IjI'.'. .'I'SFjf3323E3it2:QS5E5E553E5iEg55fNgE3E55gE3E5EgE5255355352523235gEgEgEgE3EgE5E5EgEgE5E5'.5E55555E3515rE2515152522152EIEIEIEIEIEIEIEI5'5'5'5'5'f 5'5252E2E2E1f 2:2 .IE2E15252E2E25Zf5E1:2Ef2QlE1E1E2E15 55'Z.2- A.:EgE52gigE3E5:g:3:515?gE5El51E15 1:i:3:3:?:3:i:i:7:1:3:1:V:7:f:3:f:7:3:3:7:f: i:3:1:T -21215: -' -. i:3C5:3:1:7:3 .3:711:i:7:5:5133f 'i'C:3:f:f:f:f:Q:Q:f:f:E:f:f:f:f:f:f:f:f:f .f:f:2:f:f:ffffffif2ff:ff2:f5'3'5'5'5'5':'5'5 ,'A.1:fff:Qff5ff.'?5:'f:QfffffQfffQ??g..53fQf35 '-f.ff,f:,3i3:3:3::.:.5.3.fQ'3'?:2:f:f:f:fE'3'7'f57'- 5E552ff2'55':ZfE2ffEf3fEz5E5E5E5:255fi5f 5555525 3525225 -:2 'F:EE553332355325EEEE:.gKLi:E:I-jjA':I'.-Z '2125222225252EI52E2EiS2E2f2E2E -2222522252222 3222212222 ........ 25 5252E2E2E2E2E2E2E2f' .2:7fT5i5' ' ' ' ' 'A'53:-. 5225221521 'E2E2 1:3:i:3:-.-.2: :5:3: 1:1:2:l'l'I '-:-:2: 2:2:2.'2:3:?: -. -1- .2S3Ig'X:2.' 8' '5:5:f:2:1:3:6 fT:i:2:i:i:5:if3V 1:-.-.' 5'i:3:3:3:3:f:5 :5:3:3. .' ..'.1: 2'2'1:3'3 : ':Y:i:3:3:?:' .-:i:f:3:i:f .-:e'5E:i:5:1:7:1:i: .3:3:3:3:i if 511151 31211.--2.-.2 w1E251E2EIE2f,..2f2f2 222122:-15221315.21 -f'lt-52-5592 5 'iz I-.2:-:2Z1S2E2E2?E35222222221:-:ll-.51 5323555 5352557.-52535295''-:1f2f3:-Q?2f1f2f3E3f3E3fif2:195' 425' '5'f.-2:- :IEIEI Efffkfggfsifrift :2 -i3:3:g:5:3:g:g:g:g:1:g: 525'-335-:if 3:5:3:3:f5,y -. . 5:5 .Q '-:ff:5:g:5:-:-:-1-geo:-:-:2:21-:QQ'2:-:-:-:-:-:-I-:Q-:-I-5:22:-:-:-:-:-:-: -12:-I-1-:-1 23:-:-:-:-1-1-' . .3:- 3 :-' ,.x g,g .3:3,::5:-4:53 'zzz-:3.5:3:::3:51 5 5222222 Efifiiifi 5- 5555522253555 -5? 555555555555555i:Qs5??5???EE5i5?5EE5Es:'555525i5i5ES5:5..55f555f: 1 i5' . ?f-.. -:5 1452 f '.5:sf'ii?4 25' -v.- . - - -. -. . -. -.. ---4 K. , -. .. N- 3. 55555525555 ,4 535555 1 .gE5iQZQ, izg fif'-,gf 555 gig--ISS:'QESEEESQSQQSQQEQQ5325225251if5325525E2Es515E2?I1iii .?1.,,,..5151525225221511ai?1513111..245525252553zisiiizisiagiiisisi52z53g5Z152iQ2z?',5eE3i2 1,555 1 15' 5 15555 ggi' 55515 5.1 32 22222222512 225552 25252 EIE25' -z 'E2E2EIf 52'2'-12.-.-.-.Q-z :-:25'5 '.-1-2222: 'E2E2-2:-.-II 25'52'2:2:-2-T5252522312225522535255225255525555352555255523255525E55G55522EEEQEEEEZQEEEEEfEf:2iE2f2E2E2Z2E2E' 'f2E222f2E2f:iE2EI5'5'f5 11:15:32 x'..2:f 'f2EI' ' 12' 3- 22 25553525555 . -- -15, 5552525355535-15552IQIQ151j1j.:.,.,Q.Q::51515',1:5g555555',5f55:E55- :QIQIQZf1fIQ1jZQ-153555: 1155.Qi5'f55555f55f5Q5555555555E?ig5555555E555'53fQE5E55555E555E'rE55555E5E5E5E3'55555555255555255555555555?Q55552E5EQEg5:i55E3f55f2 fZQ.Q515: 5 3i-sfwffffj 3:55-52 15152 .. ''AIFQ51-r2r5255f5ffIfIQ::5555f 213555.52 32 22215222522 21-1-1 225 2E2E222E2ff 52E22f:-z-:-lf-f-I-IQ-fQ2.2:2:2:1ff515 f-:2:fE2E55'52f.2f1f2E2E2f2E2E2E2E2E222: Ei:-: -.-:1E2E2:I:-:2f2I'IZSSEHEEEEEEEEEEZEEEQI:2E525E2E5E5E3if5E2E2E5E2E55?g5EfSf215525232'EIEIE222225255525'5'5'I'IifI?2:2E2Ei. 5'f222'.-:-:2:2:2:2:IEIEIEIEISI.1221225 5353:-.:'5553f5f3f1:3fif3:1555 ''Z-.-2231 .-S5551 22 . :':': -- ws 5555255252215 :-?s?s?:sf1 . ..5sis..21255EQ255?zS2i3sEE1Ss55Ezf5aS5.. ' . QQSEQESEE 2fi22i2235EiiSEiSiia:5 . 5:5 1. .252iS2iEs:Q5.. N 'f ag if-25 15521, 522 525252525252 515252-152-1 1 2 251255151 2 1-1515155355555-1-1152-5552555512535332555525555251-25-'555Ev5f55f5:rES55555?2555255535555535E53551353-.I..53E55555553535555i555r55555r5r,.-.-...-,ziiiiij . . , . .-5-11.25-.5Ef5E25552..5i555E55i5?E555E5E5f5539: 2E2:255525E5ES551EiE5f3 Sim-51. 5555525 1225-.. , 1 22232221272 4:2255 ' ' 5 Ji:-12:-:As :5:2:E:E:i:E6f- '-'- :-25:-:js 219 l ' r l Qs' Q. X, f 'S F ffffwf Kawai? . Wg The Genesis uf tba Zlnhex The first volume of the Index was published on Commencement week 1892. The authors conceived the idea of publishing the book about six weeks before their graduation. A young lady who was a member of the Junior Class received a copy of an Annual published at Purdue University early in May of that year and one evening the book chanced to fall into the hands of one of the authors of the WJ wa 7 v pl Index. It was the first book of its kind he had ever seen and he was carried y away with the idea of producing a similar one. i The book was borrowed and the next morning the three Editors looked it over critically and decided to undertake the task. The first step, of course, was to get an estimate of the cost of publica- tion, which they found would be in the neighborhood of seven hundred dol- lars. The amount did not seem to be prohibitive so they set to work at once to secure subscriptions and sell advertising. A week or ten days work along this line produced enough contracts to insure the cost of publication and then a feverish two or three weeks followed in getting the material for the book together. Owen Reeves, jr., then a bank clerk in Bloomington, had achieved a local reputation as a cartoonist, and his co-operation was secured as well as several students of the University who had talent along the same line. Mem- bers of the faculty were prevailed upon to write articlesg photographs were collected, and the whole thing was hastily thrown together and placed in the A hands of the printer. In the meantime, the days were fast slipping by and the Editors spent several sleepless nights because of the fear that the book 1 would not be off the press before Commencement Day. On the day before i Commencement a considerable number of students who were not members of X4 the graduating class left for their homes. Most of them had subscribed for XJ copiesof the book but no one had paid for a single copy and the Editors feared wi Q , 220 MXN :Egg -A unit A g gg Gt fs is S UJESQQA fffoox that unless delivery could be made and the money collected before the Student Body left the campus that the sales could never be made. Frantic appeals to the printer resulted in the iirst consignment of the book being delivered on the campus on the morning of Commencement Day. About three or four hundred copies of the book were delivered and paid for before the day was over. The advertising contracts which amounted to several hundred dollars were sufficient to make up the balance necessary to pay costs of publication so that no money was lost on the venture. It has been a source of gratification to the Editors of the original Index to know that their efforts have been followed by classes which have graduated since 1892, and that to-day the Index is a Well established publication which compares favorably with the Annuals which are published by many of the larger Universities throughout the country. H. S. Hicks, CFirst Editorj 221 to 14 A 1 I x I 1 1 l S MN , g g U- YM p G A QE' l l I l W 17729895 W 55 30.253 T . Jw sg .y IAA i1Ebzre's a Enrm in the Ifaeart uf 1Brairie 'flank ,f 4 :Q Quiet and soft the December snow was whirling through the atmosphere, QQ Z4-Q and just as rapidly the fancies were tumbling through my mind. As I looked 141 from the window, the flakes of snow formed into the outlines of a red brick building, and memories and faces of the past were present. For an hour, I these thoughts crowded into my memory, and were very insistent. q I The quiet drawing room and hall became a bustling and noisy confusion, q with girls dropping traveling bags and rushing with outstretched arms to greet some one. Not all, however, were greeting friends. Quiet little girls were standing in inconspicuous corners, wearing strained expressions upon their youthful faces. In a few minutes, the noisy greetings were over, and l these happy enthusiastic girls turned to those who needed no band of green I to proclaim that they were freshmen, and included the newcomers in the f group. The freshmen were shown to their rooms-the first adjustment in a I new life was over, and they almost belonged Laughter and tears floated i through my memory, as old friends were greeted, and home ties temporarily I severed. Then the great day when the freshies received their final degree of initiation into dormitory life floats before me. You belong now, really be- long. How quickly all of this passes by, and a stately white-haired woman a smaller one by her side, is leading us to the dining room, where all is chatter and song. Happy Birthday to you sounds very faintly from the distance. I The strains of I-Iappy Birthday pass right on to Remember and , Thanks For the Buggy Ride. Girls float before me. Their feet scarcely ,, i touch the floor as they step to the rhythm of the music. I seem to see a foot i ii emphatically keeping time as the music is played. Immediately, the drawing and dining rooms are cleared of the furniture, l and a transformed group of girls appear. It is a huge bouquet of sweet-peas I before me-all of the beautiful pastel shades of these lovely Howers are re- Mi flected in girls dresses. Orchestra music fioats somewhere around my mind, i then Home, Sweet Home comes distinctly to my ears. Strange to say, i but there are figures of men in this group. ii These bustling memories suddenly become quiet. No one remains in the :FJ 'hi drawing room after dinner, corridors are quiet before seven o'clock, there are A ii FQ if I 222 A WL ' f ie..- -- I if kk. Q 93 fffwf 1+ Q I, no sh's of the proctor's heard. I cannot tell whether the time is the Monday night before rhetoricals, or whether it is test week. There are a thousand things trying to crowd into my mind now. Alarm clocks are shrieking, door bells are buzzing, telephones are shrilly calling, and even the vvhirring of the vacuum cleaner is heard. A long line passes before me, What can it all be? There are sleepy eyes in the group, but there are also smiling lips. Why, it is the Saturday morning line waiting for Chloe's pancakes. I believe I saw a pancake rise just then. What can be happening in the office? The office is not large enough to hold all of the girls, although they seem to think it is. Oh! The mail is in. This is the tie to home, and my fancy again recalls traveling cases and embraces. This time everyone is in the group and the embraces are farewells. There is no laughter now, only tears. Say farewell, girls, and, perhaps, we shall meet again in fancy, if not in reality. Q B VN P5 I as glfiii' 'gigf awe f 1926 1lgtE? Q9 0 0 i 9 W ca 5 l 1 gl A 1 l l E Q I The Eanherer In the morn of his life, With his work just begun, A shadow came over his heart,- A wound past all healing, His life blood congealingg So that he from his friends drew apart. He roamed o'er the seas From Sumatra to Spain, Alone, of ambition bereft. For peace long he hunted, Yet always confronted By the memory he thought he had left. Years passed-long, lone years While he wandered about With the scars of his grief on his soul, Till far, far from home,- Neglected, alone,- The Grim Reaper at last took His toll. The wanderer at last Has gone to his rest, And thus is his epitaph writ: He ne'er found that treasure- Earth's loftiest pleasure, For he was a social misHt! Yet I wonder if he Has oblivion found, As he lies in the tomb cold and wet. If the soul never dies, He must still see these eyes Of the girl that he tried to forget. JACK SMITH. Qi 224 me 17729594 wb N19 l T l l 4 5 Gin Bear 35. 9. SB. TH. t 12' Qi, BLANCHE CLEVELAND A,-X Softly the evening shadows gather To close a chapter in our life here, Sweetly perfumed with fragrance of rose Those happy memories we hold so dear. Each building, tree and flower Brings back things to remember. Days of mingled gold and gray Like April and November. What has our Alma Mater meant Throughout the days of our work here? Studies, learning, joyous pleasure And many friends true and sincere. But most of all we value highest Qpportunities school has given, So we may better and nobler live Those ideals for which we've striven. What is the prospect of your future Does it lie open to us in vain? Do we know such a word as failure ls there anything we cannot gain? May we always wear the colors Qf our own I. S. N. U. Inspiring each alumnus Better and greater work to do! Then in the years that come and go Each doing the work of his heart, Our dear school will be proud to claim That we were once of it a part. a . 4, VE f Z , 225 A I 1 l l p l fN EL --as A --e . grvifwxxo Ea Us VZQCXQ is 'safrg ' M- 17229524 W QQQQ-W CE ll I ii Qr IA A,..-N iw l P X l l I l The btingiest Man in Qlutnn BY LESAH JOUETT How much are them cookies? asked the little bent man as he walked to the counter. The clerk replied that they were fifteen cents a dozen. VVell, said Mr. Smith, I'll take two of them. No, I won't neither! Millie don't need none. She eats too much sweet stuff any how. I'll jest take one. The clerk smiled, picked a cookie from the tray, put it in a sack and handed it to the old man. After a time Mr. Smith succeeded in finding a nickel and handed it to the clerk while he stood nibbling his cookie. Upon receiving his change, Mr. Smith counted it carefully, put it in his pocket, walked to the door, looked in either direction, and finally started up the street. Now, he muttered to himself, I guess I won't need to get no lunch so I'll go up and get that material the old woman wants. A walk of a block brought him to a dry goods store and he stepped gin- gerly inside and told the lady behind the counter that he wanted to see some calico. The old woman has too much clothes now but she's got it in her head that she needs a new outfit for Easter. This here thing of having to rig up on Easter is all foolishness. This way please, said the young lady, and she led the way to the calico counter at the back of the store. I-Iere's something pretty. The pattern is very becoming and we have it in several different colors. It's awful light looking. Ain't you got nothin' in black? This'll get dirty awful quick won't it P The clerk admitted that it would but assured him that the colors would wash well. Yes, replied the old man, but that rubbin' on boards is awful hard on stuff if it's got to be done so often. How much is this? Twenty cents a yard? Looks like war prices! Ain't ye got nothing cheaper P 226 if in fx .ff If Q . in Ci ll P NYZJCX K se Q V . gp 4 S No, replied the clerk, This is the cheapest we have. 1' 'Q Well I guess I'l1 take four yards of this. l 4 A The material was measured, wrapped and laid beside the old man while Q he wrote a check to pay for his purchase. Again outside, Mr. Smith shaded his eyes and looked toward the sun. Reckon I've got time yet to go and price pump handles now. Don't think I'll get one to-day tho. If the old lady had been more careful of the other'n I bought I wouldn't need none. Don't believe I'll even look at them to-day. If I got one Millie'd just break it. As long as she's gotta pull the water up she ain't gonna use so much water and the well's gettin' kinda low. She ain't get nothin' to do so she might as well draw it up for a spell longer. I'l1 teach her to be more careful of the next handle I buy anyway. Upon arriving home Mr. Smith fed his horse two ears of corn, put his buggy away, gathered up his purchases and went to the house. There, Millie, There's your goods. Cost me twenty cents a yard! See if you can't take care of this so you won't be needin' another next Easter. l i I an J J? 31 G 'Q 93' :SI me 17723896 1926 Mg? .5 SFX - I 52' The Wish nf a Passing Saul l X RUTH LoU1sE FULLENWILER I wish to lne abam the years Ixe spent in idle dreamlnb To see the beaut1es of this earth And learn its sonb and meaninb. I wish to travel o er again The paths which I haxe trod And note the thinbs which I have missed That were biven us bv God. Id love to sit and watch the birds That Hy up in the skv To watch the movements of their wing.- As they bo sailinb by. Id watch the stars and moon bv nib The sun in the early morning Id visit every pool and brook And End what Ive been vvlntln . Id read the handbook of the world Id learn each form and feature Close close to Mother Nature. I I as H ' J ffht, , ,C - g I'd live, and live and learn each ,day x..f'y N X N I Q, 9 228 Qt S l :E M fffwf sf gi Q l 1 7 l QS Qlfhening from 029111 jllilain BY RALPH W. KOBER From my perch in Old lVIain's tower, I look down on each leafy bower And cozy campus nookg From my aerie haven of seclusion I peer stealthily into the Hitting pages Of Normal's open book. Ah,-what do I see there Written with the hnger of Time, Tracing each sentence line by line? He writes a various message, Each page with a meaning all its own, But all in all sublime. Behind the castle's ruddy silhouette I can see the tennis player's Hashing formg Down in Bossy Park the baseball men Are trying hard to imitate the big ten. Too, I marvel at the seekers of knowledge, Early at the library and forlorn. Over all, the sunset's flame Seems to set a radiance unsurpassed, As I look and marvel to the last, When night is here and eventide gone I'll always remember-evening from Old Main. VGA: l ' l A wfxl I D 229 A 'AJ IYFNYZ' 'J 'I I ' I wg 'll ca lk! Q sa 1 I sl is I I 4 rn. 1926 Fgkkgp- QQ 010 Sf We . l X QE Z pa ea f x Ziaitting the Grail GRACE WATTS When one has been trudging along thru weeks of dreary winter what is a more refreshing thought than that of hitting the trail? A pine-scented woods with a dusky road leading into the heart of it and you with the best pal in the world by your side! Doesn't it make your heart thrill and your eyes brighter as you think of it? COITIC on! Pack your kit, sling a blanket- roll on your shoulder and come with me along the sunset trail. VVe shall start about mid-afternoon. Then the sun will have begun its downward journey and we shall be able to follow it to the end of the trail! If we walk briskly, we shall arrive at PINE-KNOLL in time to see it sink behind the line of hills beyond us. Then we will build us a roaring fire, spread out the blankets, and empty our kits. After we have partaken of the most satisfying of meals, we will throw a few big sticks of wood on the fire and stretch ourselves before it. ' Ch! the depth and strength of a friendship formed about a camp fire. The confidences that are given and the whole-souled love for fellow man that arises! As we lie and talk together in the glow of the fire light, a great peace comes to us and all the troubles and cares are forgotten. The moon begins its ascent and soon the trees glisten in the silvery light. We lie talking until the Hames begin to Hicker and die down. We gather up our blankets, put out the fire, and start down the trail that will lead us back again. Isn't the load lightened and haven't trouble and care disappeared? We return with a sense of great strength to do great things! Aren't we all better for hitting the trail once in a while when cares lie too heavy upon us? Things assume their correct proportions again and life seems less of a task. 230 i is, A no i y C5 if mv Q C5 QW ll 9 r 0-gi 1 ll lub!! :XY P Y + -Q I P N Q Qauahrille flliallzr EVELYN Dolzs Brooks Truman, the floor-manager and caller of old fashioned quad- rilles, is the queerest and most interesting person I know. When it is time for the dance to begin he swings around on one heel, kicks up one foot, and mo- tions to several couples as he shouts, One, two, three, four, Hll up the floor. After every one is in place he gives the fiddle a call Let'er go Gallagher, let's have the music! He is a gaunt man over six feet tall. He has very long legs and his feet seem to be large enough to fill a number twelve shoe. His , black suit is a contrast to the grayish white hue of his face. His eyes are black and snappy, peering out like eagle eyes from under the tuft of gray hair. His large nose is inclined to be hooked. His mouth is very large and the gold in his teeth glitters as he opens his mouth to shout, All jump up and never come down. Swing your pardner 'round and 'round. First couple balance and first couple swing and on to the next. Two old gents and the elbow swing and your opposite pard with the turkey wing. Four hands circle half around, do--do and gents go low, right and left and on you go. By the time he has called this far in the quadrille the color has come to his cheeks and he is living again the times when he took his best girl by the arm and danced the merry dance. Then, on he goes with a stronger bass voice and he taps his foot and rhymes his call to the time of the fiddle. His characteristic happy-go-lucky nature is reflected in the dancing of the couples he calls and he leads the whole crowd into a roit of mirth, hilaritv, jollity and noisy gaity. N Vol to il 17 gl I 'PXP 4 QQ g A A-J, 231 JJ A g 9- Qdislfil S? Qi M A,-X 'W 17? 29595 'QM ,-566519352 if Memories IRENE DANKENBRING My memory carries me backward To those wonderful nights in June. When I saw you in all your glory, Lit up by the golden faced moon. Like a jewel among the rocks You lay so shimmering and blueg Like a fairy with silvery locks You dance in the moon's bright hue. Ranier in all its grandeur Is shadowed upon its breast, While Paradise Valley beneath you Lies in its mountainy nest. The glittering stars in the heavens Like diamonds upon you 'gleam And the pinetrees about your edges Add to your solemn mien. Yo11're not the only lake l've seen Amidst a mountain setting But you're the only one, I Ween That I'll not be forgetting. l I I Q . 23? 7 gi .ff S 2 - ,L at 'QR,,ij95 C57?C 17729594 1 5seriQt.sfQtQ 3 5 if ei re Ei .Zi Zlust like Ziaim 'Q gags BY MARY' REED I-IEGER 6 Mrs. Beck was a poorly dressed woman. Even her four children had on not more than was needed. She was getting the evening meal in a dimly lighted kitchen. Children, come get washed, for soon your father will be home. You know he will be very displeased if you are not tidy. Baby, pick up your toys so when father comes in he won't stumble over them. These and many other remarks were uttered by her during the time she was getting the meal. Oh, yes! She must make a strict account of how she had spent the dollar he had given her in the morning-twenty-five cents for potatoes, fifteen cents for the news boy, forty cents for steak, two cents for a screw for the door latch, ten cents to an old lady, Oh! how could he scold her for that-and eight cents left. Yes, that balanced all right. Ten minutes more and he would be coming in for his supper. She put his slippers out for him, hung a clean towel in place of the one which was slightly soiled by the children that day, looked at the table to see if everything was on, then went to the kitchen to smooth her hair back from her tired brow. There was a footstep on the porch now. The door opens and in comes Mr. Beck. Drat the luck! There's one of the kid's toys under my feet again. It's a pity you can't make 'em pick up their toys before I come home. VVhen I was a boy I had to be in bed before my father came home. I-Iuh! Ain't got those kids fed either, have you? During this time Mr. Beck was proceeding from the front door to the kitchen with the groceries which he, himself, had purchased so that there wouldn't be so much money wasted on unnecessary purchases. He removed his coat, did not put on his slippers, but washed and sat down to eat. T VVhere is the account of the money I gave you this morning? Huh? i Forty cents for steak for one meal, too much money for this little bit, ten cents to an old lady, too extravagant again. You must think I'm made of money i the way you give it way. Is this all you have left of the dollar? Its a mighty T good thing I didn't give you any more. When he could think of no more to say he proceeded to eat his meal in R9 silence occasionally using his knife instead of his fork to lift the food to his 45? Q mouth. 1 lp. Q Q f, l 1. 19 233 56 . I ,U ,pug ,AMI A ' N A7 i 17729595 if ,gg ii, lf' 4 l l illibe lamb 'ilahp 4 4. 'Q' BY IXdARY KENDALL 1 Al gg This particular type of landlady, I am thinking of, is Well exemplified in L Mrs. ............ She keeps roomers, not with any idea of making it pleas- ant and homelike for them, but only for the money she receives. Cn account of this she keeps a very close watch on the amount of water used and also the time the light is turned out each night. Her general appearance shows that she thinks only of money and other people's business. She is a very cold in- different sort of person. One can almost feel her sharp brown eyes piercing through him. Her stinginess is well displayed in the living room. Strips of carpet are laid over her good rug. Her overstuffed furniture is always covered so that you cannot see the color of it. She takes many unnecessary responsibilities upon herself. This is done merely through curiosity. One of her greatest tasks is to find out whom our letters are from. She almost breaks her neck to get the mail as soon as the l postman leaves it. In her quick way she discerns the usual ones and examines those that have writing on that is strange to her eyes. Later, by means of con- versing with us, she finds out all she can about the letters. Our callers, both in person and by phone, are of great interest to her. When any of us have a caller she beats us to the door and asks him in. By doing this she gets a good look at him and finds out which one of the girls is going out for the evening. l Those that call by phone are always asked if they care to leave their messages or phone numbers. As a result of her curiosity, she assumes the task of in- specting our rooms. She always drops in at the most opportune times. Once. just as I was comfortably located on a dresser pounding a nail in the wall, she stepped in. Despite her many disagreeable qualities, she is very kind at times. All of her energy is used in caring for any of us if we happen to be ill. She will wait on us and prepare any kind of food that we desire. If one listens to her talk of her various ills and troubles, she is very eager to please him. I have heard her tell of her last operation, appendicitis, at least one dozen times. About twice a week she receives a letter from her daughter telling the cunning actions of her twin grand-daughters. Of course all this is told to us over and over again. The landlady, in spite of her occasional kind deeds, is a very disagreeable XJ, person. Her curiosity overbalances the good things that she does for us. If J, ka there is anything a person dislikes, it is one who tries to Hnd out the business tl ' i of other people. As this is very characteristic of landladies, I dislike them z AZ very much. A l my 234 ll l E c , - -. ,s . I J 'Q Q3 is X 5NfQ?Z 17723836 N Y' .A Qi W x,-X 192 'lliheh hp the bibs uf the Baan BY MAME HOBART Who was he? No one really knew. For many years he had lived in his small store selling such articles as pencils, paper, ink, and soap. He always kept plenty of candy, as candy was his best seller. He might have made more money had his store been along the main road, but perhaps he preferred the quiet lane on the outskirts of the town. l In the evenings the children of the neighborhood scrambled into the tiny store, eager to exchange their pennies for gumdrops, chocolate animals, and T Y peppermint sticks. The old man patiently waited on them, laughing as if he remembered the joy of bits of candy, in his own childhood days. The old hands trembled as they sacked the candy, they were ambitious old hands. His friendly face beamed with pleasure as he dropped an extra piece of candy into little John's sack. VVhen business was slack or when the day was over, he spent his moments in the neat little room at the back of the store, his gray head bent over a dolly for little crippled Ann or a kite for Tom. His twinkling gray eyes shone with pride when he had finished the work. Sometimes he sunk into a comfortable li chair and looked through a large album. Many times he would laugh, but , more often he would wipe tears from his eyes, as he lived again with the familiar faces of the past. Perhaps the sweet girl with the large eyes was 1 his wife, who had died years ago. Suddenly he would give the precious book if a loving pat, close it, and rise as if he had been dreaming too long. Thus the old man lived by the side of the road busy and happy a true friend to man. 1 V i A J l, 7 -I J T ,gaky 235 is f7f'2363X so ra ,, g',, ji' ,d I k. w R! . I is I 9-'1 l I I rd -I ggi The QEIU School Iiauuse j li BY FRANCIS NELSON iff' It was just a common country school, yet to me, it is a school of golden memories. Many a time in bitter cold or extreme heat have I trod the path that leads to this little white school house. I As I neared it one afternoon, after many years of absence, I seemed again the child of those carefree days. I found many a scratch on the outside wall I and a chip out of the old stone porch. As I opened the door and stepped into the hall, I unconsciously walked to the hook where I had always hung my E wraps, the old brown coat and wool cap and scarf. A few more steps and 2 I came to the bench where my dinner pail stood. How we had scrambled E to the bench to see who could find his pail first! Also, I thought of the many I times we had played Blindman's Buff and other games in this hall when the weather was not fit to play outside. i Then inside the schoolroom. Yes, there in the front was the platform if with the teacher's desk, where he always stood to say our Friday afternoon piecesg and there to the right was the old book case. I lingered over the old worn books, stained with age that I had fairly worshipped as a child. I wandered to the rows of double seats. Yes, there was the one I had occupied for several years, and there were the old scratches that I had made, mingled with fresher ones. I remembered the old double seats where we girls had practiced lying on our stomachs and had gone through motions of swimming lessons when the teacher's back was turned. Back in the corner was the same old stove with the queer jacket where we had so often warmed ourselves. How often too, had I helped sweep the floor or wash the blackboards. There was the old waste basket where so many wads of gum had to be taken and where the notes had to be thrown when we were not successful in concealing them from the teacher. If the basket could talk how many incidents it could tell. And there was the old clock on the wall on which I had learned to tell time. What a habit it had of running fast during recesses and how slowly it would go during schooltime especially the last half hour of mornings and afternoons. 93' It was just an old white schoolhouse, yet, how separated and aloof it is WG, from all others to me-my school of childhood memories. dw A A , D 236 QW. fffmx 033 W gf kj it The Saurmal Qliuzeh if l The Normal Co-ed is an individual member of that half of the human Q 'Q' species which is primarily interested, if normal,.in men, collegiate Cave-men, FQ? E44 sheiks, he-Happers, and individuals who wear sailor pants. Although a mem- . A ber of the human species, she is wont, if she is at all normal, to be decidedly inhuman, at times, in her treatment of men. The Normal Co-ed has a strong literary bent, being especially given to fiction. It has been a wonder to people of all ages that she can create elaborate excuses at a moment's notice, which so nearly approximate perfection as to deceive the most keenly penetrating mind. Many a time have I been thrown into a state of the deepest grief on asking for a vveek-end date to be told that it will be necessary that she go home because her Aunt Hattibel is seriously ill. The Normal Co-ed is the perpetuator Cas well as perpetratorl of college traditions, even as her big sister out in the world is the conservator of social values throughout the ages. It is useless for we men to kid ourselves into thinking that we have anything to do with keeping college traditionsg-we simply do what the co-eds expect of us. l The Normal Co-ed is directly responsible for at least fifty percent of the poorly-prepared lessons and bluffing in class, and indirectly responsible for the other fifty percent of the same. This proposition is incontrovertible and needs no further proof. The Normal Co-ed is an object of beauty. She wears but little in the way of clothing, but wears that little well. It is not to be supposed for an instant that our clothing manufacturers are in imminent peril because of her ' abbreviated clothing. Perhaps the general supposition is that our great mills may eventually have to go out of business as dresses continue to be worn higher Qand lowerj. It must be remembered, however, that while she may wear less at one time, the Normal Co-ed amply makes up for it by requiring a larger assortment of clothing than formerly. The Normal Co-ed is a master at the art of make-up. One look at her delicately penciled eye-brows, her symmetrically fried hair, or checks of a fragile coral hue, is infinitely more convincing than all the words in the dic- tionary. Yet we need not wonder that she has become an adept in this art, when we note that the school catalog lists a course in color-practis. VVe are led to believe that the co-ed takes a deep and sinister pleasure in Make-Up. It often seems that she picks a quarrel for no other purpose than to enjoy this i W exquisite pleasure. ,NJN ,bg ld lit 237 T14 J g, . p lm, 9 a g JG Z1 Q. SHE' rl: M. 17323535 W 05 .UV i Q The Normal Co-ed is versatile Qperhaps loquacious is a better name for i ,P itj. She can talk for hours at a time without exhaustion. She enjoys the 4, W distinction of being able to get more out of a few words than the most learned i lg professor. She does not need hundreds of different words to express differ- 6 ent shades of meaning as he does, she brings out different shades of meaning by supplementing the same word with various shrugs of the shoulders, facial contortions, or gestures. In fact, the Normal Co-ed rarely uses more than seventy-five different words. Of this number the most used are: rotten, aw- ful, sure, great, sorry, Hat-tire, wow, nice, vile, dumb, gi'me, heavy-date, and i so's-y'r-ol'-man! il The Normal Co-ed is, finally, a necessity. Who of us would give a-well, would care about going to college if it were not for her! Even though she is responsible for all the heart-aches we experience, yet she is likewise respon- , sible for all the joy that comes to us. What would Miller Park mean to us if i it were not for her! What tender memories would cluster about all the nooks and crannies of the campus and about all the school dances, parties, and even the school movies without her! As we look back in future years to the good times we've had here, somewhere, somehow, a Normal Co-ed will fit into the scene! R. R. L. CJACK SMITHD. I id l 1 i 1 at S l Q 238 , ' PJ i 5' ' , A Q 1 ig! Y lk' Q 93, Frances Mantle Edwin Sharp ' 1 ' T wu- aw 11 x mm I' ml: llll u f, 1 I ....... .. ...luu llllll' - H wql lll lllqu--n!Illl M L M M WH!!! H! f l 1 P wa , u m lffiiiiv-W ' hsmn 1 i m11nEi5ZZ2T' III -I lll u ll Ill' mm- l:..., 'Qmm p nm um, lump' Z ' L ..f . ' X I 'Q 17? DSX 19261- -QQBKCQQILM sage sg? ii Q I if 1, Eg' gi iwg illlinuis State Jlaigb bnbuul Behating league ' ' gy, I Q AUsPIcEs PUBLIC SPEAKING DEPARTMENT, ILLINOIS STATE NORMAL LINIVERSITY The Illinois State High School Debating League had a total active mem- bership this year of 6o high schools, distributed over the entire state from jo Daviess and Stephenson counties on the north to Williaiiison and Saline counties on the south, from Edgar and Clark on the east to Hancock on the west. The League organized in IQ23-24 beginning with 36 schools. It has strengthened and developed an increasing interest in this very valuable extra- curricular activity in our high schools throughout the state. This developing interest has been due to the leadership of our local Teachers College. with the splendid co-operation among its faculty members, together with the ex- cellent spirit and co-operation of the faculty of the Illinois Wfesleyan Univer- sity and the executives and coaches of the high schools of the state of Illinois. It was necessary to add the seventh district to the League this year. The District winners were Carthage, Edgewood, Newton, Pekin, Princeton, River- side, and Springfield high schools, each of which was awarded a beautiful banner. Each of these high schools sent two teams to compete in the State finals at state headquarters, Normal, Illinois, on Saturday morning, May 8. The awards are as follows: First-Silver loving cup-Pekin and Springfield tied. Second-Small silver loving cup-loser of tie decision. Third-Riverside with only one decision less. Each of the sixty high schools did exceptionally well debating. The membership for 1925-26 includes Arcola, Austin-Chicago, Bloomington, Bridgeport, Carthage, Casey, Cicero, Cuba, Dakota, Downers Grove, Downs, Dwight, East Dubuque, East Peoria, Edgewood, Effingham, Elmhurst, Eureka, Franklin, Freeport, Gilman, Greenville, Harrisburg, Hurst, Jacksonville, Law- renceville, Lewiston, Lexington, Loda, Mackinaw, Macomb, Marshall, Minier. Morton, Mt. Carmel, Mt. Morris, Mt. Olive, Newton, Normal Community, Normal University, Qakland. Dblong, Paris, Pekin, Polo, Princeton, Rantoul, Riverside, Robinson, Rochelle, Sandwich, Sparland, Springfield, Spring Val- ,gf ley, Tremont, Victoria, Washingtoii, Wenona, VVoodhull, Westfield. lf' IQ 7' . I i ib f 242 lg, l Y - -- X'- Yfy- -- - - I H 1 -,wrt K' vu , RT-Q. 5 3 3 ' ff . 7 9 J ' . L 4 .. 9 . , n 'Q '. 3, N, Q V . ,I , 5 -bfi.. 1 -,i q . gsm .U 15? .J .: si- ,1-'y,'d,!: I - y 'fM,gaf12.gyag5gigvgZfEiZ.g?ff'm.. :- - 4 H.?.fsi.i.'.-19.1. 5- mv , L .ffm fl., 1 if bd P ,, ,,9Zy,5i, I -Jr, ,-6? 5fiZ.,sgf,, egg ksj g,,j,:Ay?Lajff,,,, AM -1.4 -l'.ps,wgw,.fg my -,'-fw.:,dg-H. n,n,.pzQg1,. yu--Jfiw ww. . wh nm -.:QJr14 ,G.-'bv.x,Qz4D .Q-w.f.1,.4?.n -,nv ?W,4,.q:fw5ag?....,4f1f.Qgwza.'Lq4s42ff4w4ff1sfsQa??m, . jfifigiwxiwyfiggimfzywqggfgi.Af1wA'Af L. 7.0, . :Z Q. V M1754 51- 1.f..,,,.,,Z,1,. My fl A 1375 aerig 'rj 'ug-Lg, rg- vivifififsiffngifpgfjqud -.f.1.5,'I'. .' :Nipi:q4,4'g,:,,.',.'.,-'S V. .5', 34 14.2 A . . 3.1.22 . Sgr. 14 :giig'.wQ4faqff,1 1' 511.12 ',..'1gwz, l.e4w4g.,.Wmg4v,55AH4ffZA2 f i5l4.f:3nSLwmeayw:f,W-h.Mf.1fz.fgs.,,, mjlifzdmggisqwswzwiwhggnffzb iLf',L.41.5f,,.ff..f,.Q,f.J.,?L1f.,gW m,a:A9f4m..,nwA?N.L Zbzaaflygfl ffig,,vQr,?,,5 :'ryfw9Uw:Fp,1Lf .-fP5555fg1 u45.-Hdeww5L,wjlassef5- fwfrg'f.wfSw9wezUwg,44u vw. s-wwgfpfnms Gum-Llwg,,'52.141u'.1pU,,dw.n,Zf,.u,.7:MT gi wf5nivMAwz,1zmsNiPz,a,,zwJ1ifwz'wSw,wg fu P F' ',L' F!f'.f'!1 qf'F Pr ywfisiugi ,' inn 9' -:?,Fd:L Y- fn.-'WS-'f 'Hf6f:rf5f5d2:f':i3 ,A,1'-ff'-,.'-'Q'i,Lw.1w,Jff,1',fLifl ff!17Pf 4S-flfffff. :-131475 5,f:fI5f!,'!:r!2'!f':'P!:ifr?Nwq ..,4- .?n,y,-H-,W WW 7-. 5.....,q..,.,.fSf.'i74. LW... . e..U..,..1.,,,,P., ,, ...f V.. nm.-LM... ..d. ..,..,d..,.,.,f....,, Bigagviggqiw ,ggigpgfvfzlqlfm Wwaba ,nf4'f4 ,J2w'w4w4H4HwmsaNm? 'T ,, . . Lgnupga1fwg,Z,1.-f.,1-.PANHRA...--,,......,,.-,:,,,wp-4,1 .bw .,E,G,. ,. . ,. , .pd ...F 1-,,.. , f,r-nw, n . .155-,,4+ ..1. f,m.vQ-1wr1.,.,, H-MQ,--5, f .gf ..Le.f.g1f,,,mL my A-Q 11. '4 -- f,w.42W,,,z1nMNjQ4ff . wv4wfwA'.u4 ggi -' wi -.4fg,J5 5j. swf - viamgff, 41 xg, rw: iv7,1D f.N,wn f.,wf..1,fU sf-wf?ZEfi?W 4W:QLgmg.fDf455Rr?:J ax 4,Afq..4f474 A 7'H1Uz 'HFj,h9 f'lJnH A 'A UW.H6A,fAf.4M W2?215fi25w?5???f'?1g2fIfis3ZQ5g,f:4zQ-eg..523Q.wf,n4Q,AAA gjt,A4.W:w . f, ,gw..q.n.7,.1m5'1L,giyqfbqggvqfvnhlzv:wwwmy lqwa fz,.,5J3:w53vgioi1gWQw,,.'M w Af- A A 'ff 1. -f 44 13,1 4'1fsze..fgf'1-. 5?Qwgigyifgsiszvff,ilzrfiifgzwg,z:.zdfWL44 4 4 3 ' - q , ,M.2NQ,J1,E4A 9.52-.i?7T,Af.'?f'44i1i1aw131Zs.,M . ' f A 123Jljfifzfzimfaf1.f4iAW?ffW.g.,4,an 9 1 Q 4 4 4 55,401.44m4sgZffgQ1zi21fg1.vg.,.g.g:ww,, -. , wp4Lf1..'f. A..11.,1M:, w:.wN '3n.4 .-F'cf.f'wpaHwwff 4' -' N A f ,w'fff.q4gjffwLn Grzwf, r f' . -A 4'vfS',:x,,'.,,pw,,m.'.'3.',5 y,.'4y,f'ff4'fgLm51G',T:'fgw-w,4414gQ4g 4 N1WHU255m,h,fN2 zwmgfi-51G?5:ags2::J,Ei1gjmy ' 4 ' A215 X 4 ' if?'.Ai'3A?ifS1.i4Lfizffw'1:A -. , wN1q4f,Qf+'g jqvifsQfsiizigZ?3',w'liu15:viIixZ1545i'5 ' 'Y -', M Q ' 11214231.11fZ141W5Mzi4919 R' .L'f,fw.fiMU'5'h' .,.pp'swy1,,v,uw,f5. -.:q5wq,,4,-ps--'d,1.-,ig 2 4:1 . rf.-f,-.pm..f,15j':,W.af: C 4 fi .4 ,.:,'f.-fs-fsiwhfvs-eff. .ff:.:,5,3',.H fmf.-.fr-f-1:-fq4..1 -.f,ff7-,..,4,-'WQHLQ5 5.f:4wL4,wn .gk A,-ne,-. 11vii,.Zfsgf915fffflbgbnbggcgvfqgziiqvag,,zL,7g4.g5p 4 4 A 13 Q4 iw, .M.f4w:wgC13,fx.Nggf'fwwJyuflffga '- ' Q 4 ,N :P -f' ' 1 . . .J 1- 3332 . M1L.41..i:.U.lwWML. 1.4444z:g:'fwg+.A1...f'Mf?m54:?., N., 1 gssffwwmgfmqlqgrvfgm. .. , sag , . 41L1f.T1NHSt'fn'4H'4'-fa?P54 gfygglaygzg-grim,h:.'91ffr'?' - WELS-'13 I JA-34 ., Jzigggjf-',,LgfLfhn:' f,51f2fGn?'Z.2j2g:A5aL+132e43agn2i'y1,533QQ1gLf2z?z5vi1i , 9 W PQ4 H '.ML4.7iy.Agf..f 'a15.r.gE?q2?4i1Z.f35wzQi1fgggfwlmiwiihf . ' . A 5 0.12 , if ., 345525,,-ngqzjgigf.ssis4f.f,p2g,415mAw.gl - - ' . , '2,5,i . ,..37 'AcH?e4if.ff.w1..ff..:54pmQfzffgwf gwywwifawzf':iEi4114.w . ' 4 - 4 Wy,-H ik! ff 5512151 iiiT-PZF'55?32U 1W.e,vii-.1-'Ziff .L.L1wH.4,Lq,nj:wwz:,H.,54,g , . . 5 945' f uk YM? Mfg--31v,1:vafw..41-935, gfVgqggfzgffg114,fQfZ,'1,VA TEH?q,Q,Q4'Lqi.f4'L::d1mw:MaQggivvgyqgi',lgwfkwQ3 X 1 , f, , -- 5-Ai-jjiiyiff ,-,fin f f3M4gf.3L,.guf 1: ,,5,,g,r,gg5zLu125fWlfagnJ,,,q,,g gfgmm-gv,L44L1,w,.. 4 - 14 .yf.,.g.gmw, .,. -15. , , 1,z,i , Hin ,:.. I, fd.-Lk.,L.L,P,J,f4Lfnml -,f.,f:-'fur415:1:wE.5-f.1g,f,.4 'rfvwf 2.15.:JEL-S,0,:5.?7b.,g5-:fgPf,g3,,5y1.14.-'.wmS,.11,1WN 4 3. .- z :H-1,-1,-'g-1g,g.eg 44.4.4 f --g- r - -,g I-.-1 -14 1 . W., H,,1,,M7k1-4m .rip-:si xfws W, dw fgisfngjfmgisgg-.X'-.', 1-mhrfiplmpbu s4yya,y,w:91. n,!s.idf: ' 2 L ,- 1b. 5-:Q k..5.:gJ--, L1 Q5 w -- -.1 .. ,,d51Q4,Qdf.:fwh,-in-Lwf44 .5 .mf'J-uf.--dwg.-I-,v .ww .H-0-w.if.2a..53tW,f1,5a1L,L54w-wo9:24wwf- 1 f my - N.nfffw,wf-.mf,,v.,g,Lg'.',fwgmf w24g3qaZffm2Hz5fQqi:iJ1Qfs..5QQQggZg21iLfwgfs.f3a4:NM 2. H1-,aggyif -I W g,5wN'N...ni.N2.,5. 54gfiiwgfswdawlwpgaMwj4iS53PQ.g:g1.EgUgs4 . 4 4' ,..3iz1v-A' 4 .f f 'A'L.J,L.2s:jp1u1,r,,h1gHL144 A 2 A 3.55129,5545ig1.g.f?fifQiM21E 1 ,4 4 ,M,.-mH1wfMs'2..4.1 Q 4 1 3 peg 'f-,21.?1Agf1, Rzhgxi QmL,.H4J?N4, ngg.,ff7yv5lg11-'5L1w.gw..,53Sf -.. 2 ,.r- ,,-41-4:.1.g,.m:,,..:p , .. ,,-,gud -..,f-Mgdwffff fnvjfwvgw,g,-kggL,w..L5,1f ..f,f.zf,.f1g I ' My s1,dvL'9sig-Q1j.151ii152w. - ' . ..'f1' ,mf- ffF 4 P 4 -. . If 1592! KMQQNZWNI , i- . 4,5 'rg 5 .1q,gfmALz5Nffggmgww Q,gi.ffJL11sWi,51Q5.m5,c2, 4 ,gf A ,gfez fwQ,'g4v fi. ,f '4m,4 - 41'1:1:s'e1f.q'14v.5w11z '. . 4 -. 4g1iA:v : rp: - H15 ,, MSW Q4 4Z:.,:115'54af4:1,N11h1f' ' A 4' 5 .9511 Qu' 4Mw1,cf,,pW A 1 fi. H5 '.fgJ2i 4.31. 1? A .- iw.. 'ja 5 if Q5 ,vl,w wi -M? ,QM vwnfligywww E 1 .. v4 5 1 -A . .I4 4 a vid -rv 451,.p'!r4Mf,yf fgwllfww ' ffQY,i31W?.f:52ff--- .. 1'-1 41. 1 1 '.,:V:mp-sfgvlg-f,4.f:fsfspg ,. 544y,. ,!' we rm-,-. f1,J2,,r5f wlfkf-' Q f .4 . 5 1. ,U 4 ' 'ag 1- -mf ,zulu ' 4 ' ' . . .1 45, W .w, , GF, 2w .zf' sA1ffY,510qw,a, .g - 4 1-511' - w g z ,- 1 if Me? LqJ,AHL1u..uNU., Q 3 .5 'i,ESmf' 1 , i1 , E . m u g Aplmwu f sw. 1 in -.mar .fwfn5'v ,1,'W.. 4 -A mzwwww wi,3a:f',s-' .s' zzekflssfa- wi'-2 Y W- V1 m W A . 0 . L,vwJMvnfL,7' 4: 'Nw--' Mijn HMIJNANNN E . A W , wgfgfkj ' TQ f9. J,,Nv3 . 4: 1 il QSSMM X :w! g,3i,Z, my -545545. :E-5.,55f,f,1.Hg,n,gx7:S'EL5mv,-,J5,,h.rl '1 ,wr , 4' .5 , w .-,Jew Q . nhgganw a,w Qg2a4151z'a2gaZ5gz QM a1.MNwR1NV i5G g?Z5gg9 5j1 r'5vfi9Z9!5 5219?jmaW' 9 H ' A Nqmhgy:Jtf3.,55,zq'Fm ?' 4Q,?s132A'f555ff? f.f1' li11Wi??P4 !,giezf- iwfmiffff Mfg' .4,gfv,NQLJH1 l5Lf'evszi:Z4Huff ea ,ysfgffpn ,I nf lwlm. y vm-,6,w1,4? -gy: '1, L', LN,Llvf-41,54 eg f. P I 54,9 ,.,+',,lmyfiw,,, wA1.Mfx.s.1a., ,g74fi-..-k,..'z:Tmg41lg4L,4,f,M 4 4' -.-+4 4-S . ..'4:q4' . ', -. .w ' , 4 4' ' ' H441-44-4fff,H.,',jg,-in ' -I A 1'!'w1!IIw!?y'f '1f:'F711wl 'Z 15.454 Wmlflg 1izzfcwl.'rU3'57gfeiwihw4 f -. '1 4. -'W' :1'.'. 1.r w 'QwMl.' WM f V1-uff'q P , wp' - 1-:.'-w.1'..4Lhzfmwqq vw:4w.-fbfwbi,-.5-rj'-f. F-:ms-fmmsf-,f.gd- --fffgfS fi' 1gg 42gfl 'f, U7w55gg+.,,.1whf15 Mgisfqfiqv . X?.mfg.sf-Ujwgffifwi 'A ' .. 1:e'.'3. 1 ' 1 ' -wwf. 52 li - W ,.g5yi.7, 14525 FHM iw ., K f , Aflii . www Www Mw'1'f. .j,M,.v,ug,gff. A 1 ii 4 - 2 g ' Y W-A44 W M 4 .m.f.4'1.w,w..L ' ', 5 ,W '- , QAA-:' -' 1p ,2fWj'1'EQ5 Q ,A ww W 3245.24-1 Q.LAi1v?h,,j.Nf,j'1,j. ' 'W ' ' 41313. 5. A? ' . Ef'1'.'4 VM f 'fa'- 3 -Afwdf'i. 'sJ44fqf-J' is A 1 ' ABQ! gm -1: A111'4E TE A A A Aw! v - Awwffw.11.Jy'3.g1wLqLGH, was . 4. r, naw fly'-'ma-.m,L?.ndf.avg-twang'J .i - X ' . '-.,- ' wwf.f:si1,,Lff3,g,,14,iL472,045 sp7iPay1Qw5'H?i-i 3 H it iff.. .W .f4Nihqy,f,3M7Lf1j:u1wjf A: -- ' 'Aw 4 .A ., 35 4 A3 . A wi., 5 I '2' 4g , :M 4, 4 I - gr I .,,,.4gmwNw-,w4,,14mff... ' A 444A.4wi:? ni f A pf 51 A 2 f ff . . I Q-, 1 A . V KIM '- 2 5. ' Mr- A ' ' A A 4 44- , 1Qf22:4i91zPfw1wf2fflfglzwf 4 .wi ff4,g,i2wg293j5.w+,1agQg2f,ZgyQgg3U egggiag-3f5sf7145f,5..i:zg.d3z1-5 4 -.. ,MJ ff7w3v vg-Qiswsw ' ff 4 ,- 7..2,3a,:1se,p,fwLwSmaaa4'lwf4wg NM , , ,,t,. ,, .muy 94,11 ,,,,.g..d.,, wh. ,. .. ..Q,F.,vQ .L .,,g,g.W.m. UL-Nqr ' l, ' f prawn?mL,,31w,m4ffs.g,gw5gi,g.44s4..5g. . ' ' ' ' 4. --,. . v 3 'J,g'2fg54g13gf..jg.5g,,i'T?Q31X1f3g?1g3f,f4gL.Hg513 ' -. 4 -M., ,hnfzgfsgg 1- ,n5Ef51sm.g,cpwgfipf . 4, iq , .a , J2fyi,mg..53ifz'sg3:511eizggi. -. . f ll .. 4.4'5i4-m,w.v-gg: AM ff as - . , muh H , 'mn Q .MW 2 Ng' ,W 5 -..ll S., X 5 mm I ' ' w. c ' .W 2 ' mm W I . 5, 'Wm M S 4-,1 E .X 3 H, .XLM 1 l 'A KM F . 3 ... -,,,. xv' , E 'X K D .ww 3 ff' 5 my .WN x J 5 X, 2 362 Y I , f X, X Q h g Xl! '? A 5 fi, fi C gxwzx 1 XQ1f gi ,I XX sg C 'Q X Xa, 1, VYYVV K k-W ,VV X' ! lk K fir KV'-If C JZ- Lx! Xfffg Q ,, XXX lx S fy AVYY xr ',,f-flfy ' YG, Q7 .T EENHUHE 243 X 'sxsfeskaiel Imax Eifemlsfw 0 D Q N f l l 1 +1 5 Qi t4 f' 'N Vg' Q 125 A IDA OCHS, Normal KK I Thalian, Unadilla, Treas- urer, winter term, '25-'26, G. A. A., Senior Follies, '22-'23, '24-'25, '25-'26, Tennis Association, '23-'2-L. I'm a reasonable sort of Iurnzan being-I takes my kicks with a smile 5 bothers nobody what don't bother me-oaynse I admires that style. PAUL SPAFFORD, Normal KK Unadilla, Treasurer, winter term, '24-'25, President fall term, '24, Hi-Y, President, fall term, '25, Class Presi- dent, '25-'26, Class Treas- urer, '24-'25, Apportion- ment Board, Inter-society Contest, '25-'26, Senior F o l l i e s , Commencement Speaker. He knows how to joke-to be serious, too 7? GWENDOLYN THOMAS, Normal K4 Senior Follies '25-'26, Sal- utatorian. Her deeds speak much stronger than word of pen. OSWALD RIEDEL, Millstadt I wonder when he talks. EVERETT QUINN, Shirley Rostrum, Hi-Y, Odeon, Athletic Board, '25- '26, Sec- retary, '25-'26, Football, '24, Captain, '25, Senior Follies, ' ' Tweedles , ' ' As- sociate High School Editor Index. A good shot at anything he tries. Doais JONES, Bloomington Unadilla, President, spring term, '26, ' 'She has two eyes so soft and blue, take care. She gives a, side gla-nee and spies you, beware, beware. ELDON KAUFMAN, Concferville b His sense ts more than com- mon. ADALINE BUSHEE, Normal Unadilla, Treasurer, fall term, '25, Girls Glee Club, G. A. A., Latin Club, I. S. N. U. Orchestra, I. S. N. U. Band, Senior Follies, '22- '23, '23-'24, '24-'25, Chair- man of Committee, '25- '26, Gypsy Rover, Miss Cherry Blossom, ' ' ' ' The Wisliing Well, ' 'The Isle of Chance, ' ' Inter-society Contest. Like radinrn, a source of 'in- erhafustible energy. ' ' ereorff.. BY ,FF fs If W' ' WP K' f 'lj D' S 'H' 17723595 'W - M U l gf ' a ' ' twat e Q Q41 I 4' R LUCILE A. OTTO, Normal ll ,' Thalian, President, winter 4 ' 'Q' term, '25- '26, Unadilla, Sec- xg retary, fall term, '24g Class I 4 CS Vice-president, ' 2 4-' 2 5, fx A Class Secretary, '23-'24, Girls Glee Club, Senior ARTHUR GLASGOW, Normal Follies, Gypsy ROVQ1-57' Good scholarship seasoned Miss Cherry Blgssomgff wtth wit and good ll'l0'lIlO'7'. H The VVishing Well g Deg- lamation,'255 Debate Team, '25-'26g Class Speaker. UT.et as have many Zlke her, just friendly, kind, sincere. MINNIE BAsT1No, Bloomington ROBERT B. BARBER, Normal Tllaliang Unadilla, Presi- Hi-Y Club, Reporter, '25- dffntt fall tmma '25, Treas- '26. urer, spring term, '26, Hts motto : He will make it G' A S6fC1'QtffQ',,g25'7iq5 ,mg to be not only good, S6I1101'FOll1GS, -fr .43 .9- 70 but good for something. '6' U As a rule 6 U6'l'1l071G has hts faults, here is an exception. HELEN BURROUGHS, Normal Tllalian, Vice-president, spring terln, '26, Odeon, President, spring term, '25g MAXIN11 STOTLER, Hudson senior Follies, '22-'23, ,23- Ohe yolt are happy to have '24, '24-'25, '25-'26g met. 'tGypsy Roverng Miss Cherry Blossom 5 ' ' 4 ' The Wlisllillg VVell: Varsity Stunt Show, '23-'24. Smiles away sorrow, casts away care. l MAURICE MCELHINEY, Normal Hi-Y, Secretary, Winter term, '25-'26, Treasurer, spring term, '25, Odeon, JOHN LA FIEF, Pinkstalf BOY? Glee Club? S911i01' Rostrumg Business Man- ffglllffsi KKGQTY Rovers ager Senior Follies, '25-'26. rel-ry ossom ' H - ,, , ., H Hvvishing Wel15,, Hlgle A quiet man, and true. of Chance. Happy-go-lucky, fair, and free, Notlmtg th the world can bother me. i..1 :X-xy' T7 , , mr 1 V I 1 l , I, l l 'I 4, 245 ,fN l .fp L-,,LDj7fA APN? -at e of NQ4 fb. W-,lx , 1 i A i D Q37 EES JP! le! O. ff' 17329595 'W' 012 W We IIAZEL STOTLER, Hudson Curly lock, aufrly lock, wilt H1010 be 7l1l7l.6':?,, CHESTER HICGUIRE, Towanda Odeong Boys Glee Clubg Gypsy Rovergw Miss Cherry Blossomg The VVishing VVeHg H The Isle Of Chance. Him all aclmirc, all pay Mm 'l'C'l7C'7'6 l1'C6 cluf. ' ' ALICE BELL, Chicago Senior Folliesg Typing Con- test, '25g Sho1'tha.nd Con- test, '253 H. S. Index Typist. No, slr, I do my sleeping at imma. BEULAH KINSER, Casner ' ' I have a heart with room for C'l'C'I'-If joy. ' ' I LONNIE BLAIR, Ellsworth Unadilla, Vice-president 7 winter term, '25-'26g H1- Y, President, spring term '26, Life is such a ,lil-'7'7'1l.H FLORENCE E. BANE, Normal My Tlzouglzts are my com- pfrnl071.S. ' ' LOUISE RAMSEY, Hudson The brain contains ten thou sand cellsj In each some active fancy dwells. ' ' FLOYD O. SOHWENN, Normal 7 RfJSt1'Ull15 Hi-Y3 Senior Fol- lies. KJ I I 1 6 :V Q E M A A y y ACS 1 1 , e it F, Z1 DOROTHY RINGLER, Normal Unaclilla, Secretary, spring term, '26, Inter-society COI1tGSt. That'S what I '7'll6fl'llt to say. JOHN SHINE11, Hudson. Rostrum, Senior Follies, Track, '25. Good nature and good sense m ust ever join. ' ' HANNAH KILLIAN, Normal Unadilla Tall and SM-nz mid precisely neat, she trips along on dainty feet. 17? 29896 as HAROLD A. AOKERMAN, Sibley Rostrum, President, winter term, '25-'26, Hi-Y, Presi- llent winter term, '25-'26, Vice-president, fall term, '25, Treasurer, spring term, '26, Unaflilla, Senior Fol- lies, '25-'26, Debate Team, Captain Negative, '25-'26, Football, '2-l, '25. HI am what I am. AILEEN BHOWNING, Normal Thalian, Unaclilla, Presi- clent, winter term, '25-'26, Vice-presiflent, fall term, '25, G. A. A., Secretary, '2-l- '25, President, '25- '26, Class Vice-president, '23- '2-lg Senior Follies, '23- '24, Student Council. She performs hm' dutfies, but tlzereis always ttnie for frm. CLYDE BEAN, Normal Hi-Y, Secretary, fall term, '25, Boys Glee Club, Gypsy Rover, Miss Cherry Blossom, HThe Wisliiiig VVell, Isle Of Chance. 'fTl1c deed I intend to do is great, but what tt is yet I know not. 'Z l l WALTER MOIIGAN, Normal l Hi-Y , Vice-president, win- ter term, '25-'26, Secre- tary, spring term, '26, Ros- VAMPERDELL JOHNSON trum, Vice-president, win- DOQLIN CMRS.D, Chigago ifAg,1iEZt'n1b6i25' ,265 SQH101' Our only brrtde. He does not Cf0'lI1'7Ilflll.CI suc- cfssg he does more-he de- serves tt. RJ . Nil IX-'X V I l WGA. 0 ll . , at F19 Lg l ,. , C , A 'l LP ' r 77S-X 'Oi to 0, GN - - to Q, +I.-2 -P .Y X fs is is 5 C is we Year' ff A S9 Q MQ ,AAA 1 we eifi. its i, Q A Q l RQ i g' ' MARY JANE POLLOOK, , ,I 'Q' Bloomington , l . . . 5 r halian Vice-president fall l H T, .' , . -' C ff- MMI Nome ESi.?2,s.,'ii1,n?d?Sl2f'55f'5ii1?Zi ' I 7 I- S- N- U- Q1'CheSU'a'r I' tary, fall term, '24, Jest- li. Band, Bashetbal , ers, Sec,.eta,.y, 125-126, Glee H5' '6' Club, Secretary-Treasurer, A certain little boy 'wore cute 725-7263 HTWe9d1eS5H Sen- little curls. ior Follies, '24-'26, The Wishino' Well, Isle of Chance? High Sehool Edi- tor Index, Varsity Stunt IDABELLNE HARWOOD, Normal Show, 7269 Latin 01,111 Thalian, President, spring ffB00tS,H with ffymddiesff term, '26, Jesters, Odeon, gaioye. Treasurer, fall term, '24, Recording Secretary, winter BYRON G- HALL-AM, Nflfmal term, '24-'25, G, A. Rostrum,Vice-president,fall ViCQ-p1'E'S1dGDf, '24 20? term, '24- '25, H1-Y, Presi- HTweedles, Senior Fol- dent, Wintel' term, '24-'25, lies, '23-'24, '24-'25, '25- Treasurer, winter term, '23- '26g Varsity Stunt Show, '24, Unadilla, President, '26, spring term, '25, Athletic uS,,,,6,Ft p,,,.S0,,,,,my Board of Control, '23'24, Full of rasoalityf' Tennis Association, 25, Vice-president class of '25, CLINTON A. DENNIS JR. Cheerleader, '24-'25' Senior N,,,.,,,,,1 ' ' Follies, '24- '25, 525-'26, Odeon, President, spring ,E1g2fic3H'e0' Snapshot Edl' term, '26, Secretary, winter X' i . term, v24-v25: G199 Club, f'Caesar was ambitious. '211 GYPSY EOVQTN' HELEN MANTLE, Bloomington Stage Manager, Tweed- , , 103,57 725, C1,ee,.1eade,.7 724- Thalian, Secretary, spring '25, Senior Follies, '22- TGIII11, '26, Gr. A. A., Un- 7237 723-721, 724-225, 725- Hdllla, S6C1'Q'E2,1'y, fall lZ61'1Tl, 726' '25, Vice-president, spring 4' 'Tis or slzafme to be good 'Glfbfj ' ' , 73 1 Q ' 7 L cause it is so commorzi. ?V1SS5Onz:l,I,l Hgishing e ' re s e 0 MARY LOU NORRIS, Normal Chanee, Senior Follies, Thalian, Odeon, President, '22-'23, '23-'24, '24 257 fall term, '24, Jester-sg '25 25- G. A. A., Girls Glee Club, 'flier eyes can say more than ' ' The Wisliiiig Well, ' ' rvords. ' ' Tweedlesg Senior Fol- lies, 722-723, 723-724, 124- J. EARL RADER, Carloek '25, '25-'26, Debating Rostrum, Hi-Y, Senior Fol- Team, '25-'26, High School lies, '25-'26, Football, '25, Vidette Editor. Varsity Basketball Manager, '25- Stunt Show, '26, '26, Gentle and quiet-riot very, '4Fa,riners are the fofzmidatioii Arid at times quite contrary. of civilization. xg, ,xi-xx ll 7 Qi l ' , 1 4' i I X 'Lx' FN' 4' , w QD A aim 1,QQ.,wEg , . ,X 2 93 a fffwf l is 'r Sb nl' p W JAMES THOMSON, Normal i Rostrum, President, spring 1 term, '26, Hi-Y, Class Treasurer, '24-'25, '25-'26, Senior Follies, '25-'26, County Meet Typing and Shorthand, '25 , High School Athletic Editor Vi- dette, Class Speaker. A future Whois T177zo. VIRGINIA VVEBER, Bloomington Girls Glee Club, G. A. A., Orchestra, Senior Follies, '23-25, Gypsy Rover, 4' The Isle of Chance , Art Association, '25-'26. Good 'n.atured, generous, jolly and clever, Her tongue like the brooklet runs out forever. RAY E. CADE, Bloomington Baseball, '23, Glee Club, '2I. My cares shall not be long, I know just how to mend INIARY RUTH SAGE, Normal Thalian, President, fall term, '25, Treasurer, spring term, '25, Odeon, Treasurer, spring term, '23, G. A. A., Vice-president, '25- '26, Jesters, Latin Club, De- bate Team '25-'26, Captain of Affirmative, Valedietor- ian, I. S. N. U. Orchestra, Senior Follies, '22-'23, '23- '2-L, '25- '26, ' ' Tweedles 3 ' ' Varsity Stunt Show, '26. f' 'Twill false tl brave mon to marry suclz 0 good flcbater. LOREN F. KING, Carlock. Rostrum, Odeon, Treasurer, spring term, '25, Hi Y, Senior Follies, '25-'26, Class Speaker. One of the foremost hounds ln. the pursuit of lfnowl- cflge. ' ' FRANCES J OHNSON, Bloomington Thalian, Odeon, Treasurer, fall term, '25, G. A. A., Girls Glee Club? Cherry Blossom, The Isle of Chance , ' ' Senior Follies, 'Z We t1,6,,,,,H '23-'24, '24-'25, '25-'26, Debating Team, '25-'26. Els str-mglft ns un. arrow, 'll-llllfllll' as the best. Gite lzfr cz chance and sleo'll do the rest. fxyzf' it '. A Q fe, oy r I E' 4 21 ,I ,r I ', 249 ' I IFJ 4' fr not 'E' It er lk ,Y 1 C ggg QQ! pf-'S :F L Q if'F A A 5 Q fVQQ A me 17723836 we seg fi Q30 Q rfxyfx v. A .. ,A-ss- Qs.. , - , Q tg, , 4pk.x, 4 ' ' l 'Rl c Y - Q -+ I l -i -KLA - F i. :F i l - Q 1' II 'I ' 'Qt A . ll A r r di 3 l B1 iii' A 5-N , lg, ?'I 1-L U' Ev fl' f i , . , ml. ..,. W, ,D Z., I Q x N IIHII1 TQ ,.,,,,gum,Im CZ r Z--5 4, 'H X YY Y fb ff FIC X as 4 if-J f- 5 X ft NFMAQ-'ECM ,L ffii? QQ Q 5 53- SJ X-+1 5 e 5 yi sg Z , 621'-2 f D X QQ- I-'2 '57 River Source Course Remarks Esther Adams Normal Foreign Language The head is a lamp unto thy feet Winstom Adams Normal Foreign Language Little, but right there! Beatrice Baird Bloomington Foreign Language Of such are the Kingdom of Heaven l Frederic Barber Normal Foreign Language VVhat he remembers he seems to have forgot Isabel Basting Bloomington Home Economics The geometry shark Isabel Boso Normal Foreign Language Coming when the spirit moves her Elizabeth Bright Normal Commercial Name's Bright-Nuff said Grace Brown Keri-ick Foreign Language One who should succeed p Helen Burns Normal Connnercial Me and the boy friend , I Ruth Burroughs Normal Foreign Language Helen, Mother said for you to come home and wash the dishes Carrol Cade Bloomington Foreign Language A freshman 's discovery Alvin Darling Normal Commercial Cur school supporter Ruth Detwiler Congerville Commercial A Congerville belle Lucile Dobbs Normal Home Economics A star in a clear sky Vllilliam Dunk Normal Manual Training Our future limelight Myrtle Eades Bloomington Commercial The class artist Charles Eaton Mackinaw Agriculture He never iiunked, I reckon he never t'knowed how Marjorie Eaton Mackinaw Home Economics In thy face I see a map of honor, truth, and loyalty Lola Hall Normal Foreign Language Art is the right hand of nature Margaret Hall Normal Commercial She comes and goes, but she's always welcome Hazel Hilton Bloomington Home Economics H They were unique in the moonlight Richard Johnson Normal Commercial A slave I am to Cleda's charm rx-qi Clara Kepner Normal Commercial Budded on earth to live in heaven -fy, 7 I Lucille Kimler Carlock Commercial A cheerful lass, a pretty lass, a friend , Q MQ, sincere and true Q 7 Ralph Kingery Normal Manual Training Coach, you're getting too persnickity gl , ' V , l f'Nl I A, K L - A A- L g 'I , 'A' A ' ' 'Kyiv NX 'L 6 Us A is - f -A- ' TK 7 X- ' 'I AN Qt w Qf THe 177236395 W, gtimfleg-ea rg W WA i wr - it JY- .'4t-- .- -. A 4' 2P' 1 1 'l A - v u 'r WU W5 River Source Course Remarks y Lloyd Koehler McNabb Manual Training A professional vender of hot air Orville Langhoff Normal Commercial A mysterious man NVilliam Lott Normal Manual Training XVanted-an underground tunnel to the station store Beatrice Martin Normal Foreign Language Her feet are never still Lowell Martin Normal Foreign Language Not deaf, just dumb Mary E. Myers Normal Foreign Language Is she finieky? Look him over I Milton Mathew Ashland Agriculture Now I don 't want any one to watch l me while I practice I Karl Mays Bloomington Agriculture A little fat rascal Earl Mishler Carloek Manual Training Explosives come in small packages Fred Muhl Normal Foreign Language She who sings drives away sorrow Francis Nelson Normal Commercial Too wise to be handsome Jack Penrith Bloomington Foreign Language 'tYou he good or I'll beat your ears l down I Marie Reddel Towanda Commercial A heart with room for every one Elizabeth Schroder Normal Home Economics Quiet but happy Richard Reding Normal Commercial Is he talking again or yet? Karl Schuth Bloomington Commercial The world shows little of its great I men but they are all dead y VVarren Starkey Normal Manual Training Greater men than I have lived but- Mildred Strange Bloomington A good toiler Alvin Tomlinson Normal Manual Training The good die young-I feel sick i myself Katherine Turner Normal Foreign Language Next year 's valedictorian x.f'y Bernalillo Williams Bloomington Foreign Language And still the wonder grew that one :Lf I I small head could carry all she knew yi, ,ki Roland Zook Bloomington Commercial Another from the suburb to the south IQ ' s r li A , 251 X I lm Q 'M 1 gi A A e? I TVYFKTYA I ' e gg l fi '11 ya 63 Q, its 'si JWDGX Siietimsf te 3 V 1 r -NI VM' Iwi lug I lx rllisl lx, li! ,Nr l IME lim Q24 JXX ' I Nlljl, AL A xg f lily' ,I , H I Ili nl . I l I Ai y rm lr r l ni J My lg ri M i - I I lil l -All Ml ly! 'W' Til ii' lyn HL ff Ll.-:J l'l.ll to F ind fe Name Nickname Favorite Song Arlene Ackerman Arlie The Lightning Express Charles Allen Chuck How ya gonna Keep 'em down on th' Farm? Stacy Armstrong Stace Arkansas Traveler Lena Arnold Lerner The Maid is Not Twenty Yet U Mildred Baltz Skeezix When I VVas a Dandy Ralph Bates Skinny The Little Ford Rambles Right Along I Madlyn Bishop Pete Angry Fern Blair Skinny Put Away Like a Golden Ray of Sunshine Edward Brown Ed What Do VVe Care if its One O'clock Williani Bush YVilly XVhere's My VVandering Boy Tonight? Margaret Bushee Tub Lonely Little VVall-iiower Ruby Carver Galoshes Brighten the Corner Where You Are Ivan Christ Ike Me an' Pop an' Mother Hortense Clark Horty Tin-roof Blues Cleda Denler Stubliy I Ain't Nobody 's Darling Catherine Dennis Kadie I XVish I NVas in Peoria Esther Dillon Dutch W'hy Couldn't it be Poor Little Ned Pinin' Just for You Jessie Fisher Jess Pinin' Just for You Viola Glover Peggy I NVill Be Da' George Goff Porky Oh, How He Radiates Radio Maurine Hanson Swede A NVoman Gets Tired of One Man All the Time John Hogan Johnny Collegiate Gail Howell Howl Mournful Man Elinore Johnson Fat Dear Old Lady Mary Kelley Irish A Little Bunch of Shamroeks x,.4 Adolph Klein Ellsworth Let Me Call You Sweetheart lp Fei-nsLuster Fern Sweet Georgia Brown Vat, Pauline Masters Tilly Sleepy Time Gal ? Edmund McCormick Mac A California Poppy for Me A 252 ' Q' 'WL - I -- I G fffwf ,Q l N l A ff l f gf 3 1 'N ' i L N7 N If 3 2 056 isa W. 154 ray Es l I l I ILL, N Naine Nickname Favorite Song Mildred Mead Midge Save Your Sorrow for Tomorrow l Ruth Moore Boots Away Back Home y Richard Muhl Siefie Alice, lVhy Turn Me Down? 'Lauren Nelson Cleda Nitzel Cleder My Bonnie Lies Over the Ocean Clara Belle Pepple Shorty Five Foot Two Eyes of Blue Alice Peterson Prof. I Love Me f Lindley Phillips Collegiate lle's a New Kind of Man il Ruth Powell Red Little Annie Roonie il Wilbur Reece Hank Somewhere a Bird is Cooing Rachel Rich Skinny O Kathrina Jessie Reiinan Jessica A Voice With a Smile Glendora Ross Fat XYhere the Rainbow Ends 1 Helen Roth Heavy I XVish I Wlas in Ellsworth Anna Shroeder Becky Last Rose of Sunnner y Lucille Shinner Lucy I'in Sitting on the Top of the XVorld Robert Starky Bob Jingle Bells l l, Roy E. Taylor, Jr. June Indian Love Song I ll VVilliani Thomason Pinkney I Adore You I Adolph Valanis Tony Old Picture-inaker ll Charles Vilehb Charlie Pullman Porter Blues M Carl VVhitehouse Bud Let It Rain, Let It Pour i ii Yu' Alice Mayre XVilson Mary Normandy th Marjorie VVilson Marg XVhispering' lv A Marie VVOrnica Specks Some One Loves You After All ll fy rDeceased. it C A HQ 253 lm l D Llxtf A 5 'Sl ff' 172' 23894 feb 5568! Q03 SE ' 2 l X NSN K6 llliinfirlunqflllllili I I 1 Q I mlm fl, ff, W ,, ,,,,, M ef 1. W e 4 ,fx Il I 'I g XXX M ill' lllllllli'-i lllillilldh lllmlllmm our-2 'v -'-- X r n -. C f im., llln Qkn .. 'll . WWWWZ ummm, .fm fy is 45 1 f ig! ' r fw W .Es f if fi! , - l X l l HEI - AHYHII lg lk'll p l I III nl mmn-up II. . i LAM El ' f l.'I li illllnmzn .-,1 7 Ill. MN ll Aldrich, Helen--Quiet and sweet. Anderson, Lenora---Another girl from the country. Aekley, Helen-Our seamstress. Baird, Betty-Quiet, honest. Betty. Barger, Thomas- A chip off the old block. Bean, Emily-HC Marjorie, wait for me. Beyer, XVilliam-Specialty, making trouble. Bright, Merle-A, sheik from the sticks. Basting, Fern--So bashful. ' Brennan. Thomas-A sheik from the wide-open spaces. Conley, Marjorie-' ' Shrimp. ' ' Cline, A. D.-Apple Dumpling Cline. Clark, Marjorie-' 4 Jerry. ' ' Crisler, Herbert- Aw, so 's your old man. Darling, Doi-renee-Our freshman athlete. l Denzer, Marian-Silence does not indicate lack of wisdom. Duesing. Howard-Our fat basketball player. Doyle, Glenn-4'The algebra shark. Fagerburg, YYalter-Slight, but amusing. Fagerburg, Bernadine-''XYhere's my Carrol gone?l' Foster, Dorothy--A good, all-round girl-we like u. Fitzhenry, lllildred-Very serious minded. Graves, Harold-' ' Chip. ' ' Grubb, Norman--'tI'll be long in this world if I die tomorrow. Holt, Duane-The girls haven 't found him yet. Harwood, Ned-Little, but mighty. Horn, Lewis-Better late than never. Holley, Roberts-Our poet. 1 A Vw Johnson, Lynetta-Always right-absolutely. CJ!! l , Johnson, Loren- Duck. , A Kane, Peter-A real cheer leader. N' 2 ' Z, Kelly, Paul-Future all star half-back. TQ, 1 K ,g l 254 ly D Ci for 'rosie 'H e ' e Q Q0 LSZN. ,Q 9191 ffzoox FQCQTQJQY W Q I l Vs- 1 5-41 M 1175+ r ' in Kuhn, Alice-' ' Sir Richard. Kimball, Mara Helen-The dancer. Lott, Ruth McHenry, Zilda Two of a kind. Meadows, Lillian-A good all-round girl. 3.IQl'1Q'lt?l', Fern-I want what I want when I want it. Meeee, Janice-This really isn't as well as I usually do. Morgan, Hannabelle- Do we like her? VVe'll say So. Morgan, XVIIIJUI'-Olll' farmer lad. O'Bl'lQ11, Everett-Red-headed Irishnian. Oehs, 1IlCll89li Tll1'0G thousand dueatsf Oh, my! Orendorff, Robert-The mischief maker. Price, Dorothy- It's a beautiful thing to live. Patton, Ruth-' 'Algebra sharkf, Quinn, Helen- Dr, Know-It-All. Reddel. Edith-The world loves a quiet girl. Sweeney, Eloise-Rachel Rieh's side kick. Stotler. Dorothy- Can she talk? Satterfreld, Marie-One is bound to like her. Sinnnons, Pauline-A modest miss. Swearingin, Bernadine-The girl without fault. Thompson. Chester- How could they get along without nie? Troyer, Howard-The reliable freshman. Tatman, James- I don 't know. Do you? YVilson, IVillian1-- Aw, gee whiz, teacher. NVeber, Alice-The little girl always on the Ngo! YValke1', Ruth- XYhen do you use--'ouglrt' and when 'had ougl1t'?l' L 255 Sfx r Y '- il if fwiri Y , f 'stgwlel fffwf 5H6.cTZQf0wtf51 13 . . Q x t I i , 1 ,S ZBun't 'fist the Qiulurs jfall ,f , l Hereis to old U. High! 4 4 Q She is the best of all, 4 l M So let her colors Hy, E ' E And may they never fall! When Mr. Pringle gets up to speak, Be quiet, hear his call, You for knowledge ought to seek, Or by chance the colors fall. When the team goes down the floor, Always with the ball, They will have the bigger score- Don't let the colors fall! U. High spirit has run high, As all alumni will recall, So at the game let out that cry, Don't let the Colors fall! Here's to old U. High, She is the best of all, So let her colors Hy, And may they never fall! F. BARBER, ,27 My Tribute He1'e's to our principal, So manly and true, VVho loves all his students If right they will do. Here's to the critics, And teachers as well. Who work with the students, And to them many things tell. Here's to the students So young and so gay, Yet eager to learn, Each, his own way. XJ Here's to U. High, ,W The school as a whole, hi Working for better standards, ml l . , l And a higher goal. , Z HAZEL L. HILTON, ,27 Q , 1 i . 9 i KX 256 il , A ,. - -is G f, ,.. . F U vw - fs is XX 1 1 1 V f MF' Jw 'WT' Xi , P 4 af J M K4 1 , I i W 1 L , ,f , X444 Z S W T-'X XX L5 gil -gpg l fxif ! XX 3 I X f' ,f A 1 X, 7 N ff X' 'E XE! jf! I7 , K . -1 M K? YN Q Y Q x , N F A Q HH WNEZZWHUIUWEQ fix W DH' 'Ill-la W ' ffffwf -eagerly fi l I Q l l SE mljt Etna Iiaunhrzh ' 4 . 1 1 1 Q1 Hafk the bell, hark the bell, 1 MS How the bell thundered. Into the study hall Poured the two hundred. Silence, the gavel bawled. Program today, Pringle called. All in their regular seats Sat the two hundred. Program today, he said. Was there a one dismayed? Not tho the pupils knew Some one would blunder. Their's not to make reply, Their's but to study and sigh. Sat the two hundred. Stephens and Hamilton to right of him, Barger and Johnson to left of him, Pupils in front of him, Listened and wondered. Tortured by speech and song, Bravely they bore it long. There in the study hall Waiting the closing bell, Sat the two hundred. When can the memory fade? Oh, the endurance displayed! All the school wondered. Honor the courage displayed, Honor the part they played, Noble two hundred. L. M. B., '27 1 J' 1 Mr. Barger in physics class. All big violimsts carry their own pianos. Z , 4. 1 ,f'Nl 253 1, l 5 -ge a .Se JA g g g g y SQL l1 QJQ G5 AP SHE fffwf Sopranos Esther Ada1ns Mildred Baltz Emily Bean Ruth Burroughs Marjory Conley Hazel Hilton Robetta Holley Sccozzals' Madelyn Bishop Adaline Bushee Hortense Clark Cleda Denler Viola Glover Elinor Johnson Helen Mantle Beatrice Martin Ruth MOOfC Alice Peterson Lillian Meadows Ruth POWC11 Mary -lane Pollock Mary Myers Bernalillo VVilliams Gertrude Scott Fern Mercier Alice Wfilson Pauline Simmons Prcsidclzt . . ............ .... B ERNAD1LLo W'1LL1,xMs Sccrczfary . . .... llf'lARY DIANE POLLOCK Librarian . . .... RUTH POWELL Pianist . . ......................... CATHERINE D12NN1s Director . . ........................ Miss -lEss1E CARTER The Girls Glee Club this year upheld the high standard set in past years. The weekly rehearsals, the operetta, and preparation for singing in Assembly kept us pleasantly busy. At Christmas time the Club went caroling, taking the Christmas spirit into Various institutions of the two cities. In the spring term the Girls and Boys Glee Clubs gave a party. A group of twelve girls was selected from the Girls Glee Club to sing in the district contest. 4 4 i CE 1 4 :Z W :fe QQ S frfoax - GLEMFQQ ,9 a y CE 4 I Q 1 ,LS llitsa 'fiaurean Litsa Laurean held many entertaining and beneficial meetings during the past year. Our work was carried on under the leadership of Mary Myers for the fall term, Beatrice Baird for the winter term, and Beatrice Martin for the spring term. In the fall term we had our annual wiener roast, and in the winter term we had a real frolic at Bernalillo VVilliams' house. VVe are looking forward with great pleasure to our banquet, which is also an annual affair. Socnzw ROLL - .4 Beatrice Baird Mildred Baltz Thomas Barger Fern Blair Elizabeth Bright Wfilliam Bush Mary Kelly Lucille Kimbler Beatrice Martin Lowell Martin Richard Muhl Mary Myers 260 VVilbur Reece Elizabeth Schroeder Lucille Shiner Alice M. Wilsoii Marjorie Wilson Bernalillo Williains P5 ci ksrmtsit fe I i l , 3 R i I ' ff' 17529896 'W . ,VGDQTZZXZ Firsz' Tenor A. D. Cline Herbert Crisler Billy W'ilson Thomas Barger Sccozzd Tenor lVilbur Reece Peter Kane Harold Graves Ralph Kingery P7'L'SZ.lfCllf Librariazz Sccrcfnrbv Dirccfor . . 180295 Else Cllluh First Bass Carl XVhitehouse Earl Mishler llflaurice Mclllhiney Alvin Tomlinson Clyde Bean Lowell Martin Chester McGuire Duane Holt Roland Zook OFFICERS Scmzm' Bass Roy Taylor Richard Muhl Carl Schuth Ralph Bates XVilliam Bush Roy Xxfhittington Ewart Sneath EWART SNEATH A. D. CLINE XVILBUR REECE Miss CARTER The club sang once in Assembly this year. ln the spring term a joint party of Girls and Boys Glee Clubs was held. gl Miss H. to group of boys waiting for their leader: Ida said for me to PJ' 7 , hold you here until she comes. tj? Mel One of the boys, approaching with hands outstretched: Take me first, Q 7, Miss Hamilton. Q 22 R 'f'Nl 261 li 2 T jg -ff - a an A ai Q Q3 S C f MEMBERS CE 1 l A W 'oi rg Q51 ,fx Qbirls Qtbletit Qssuciatiun The Girls Athletic Association has accomplished a great deal this year. The members have been very successful in their attempts to raise the stand- ards of G. A. A. The association purchased archery equipment, and the new sport was found to be very interesting. Many enjoyable social functions were held, such as bob-sled parties, spreads, kid parties, and hikes. A great deal of the success of this year is due to our sponsor, Miss Mos- beck. Aileen Browning proved to be a very capable president, and she had the full support of the other officers: Ruth Sage, Vice-president, Minnie Basting, Secretary, and Esther Adams, Treasurer. Esther Adams Beatrice Baird Betty Baird Fern Blair Minnie Basting Fern Basting Emily Bean Mildred Baltz Isabel Basting Isabel Ross Aileen Browning Margaret Bushee Adaline Bushee Ruby Carner Hortense Clark Marjorie Clark Marjorie Conley Esther Dillon Marion Denzer Marjorie VVilson Mildred Fitzhenry Isabelle Harwood Hazel Hilton Elinore johnson Frances johnson Lynetta johnson Mara Helen Kimbell Alice Kuhn Helen Mantle Mildred Mead 262 Janice Meece Hannabelle Morgan Cleda Nitzel Ida Ochs Clarabelle Pepple Alice Peterson Louise Ramsey Glendora Ross Ruth Sage Lucile Shiner Helen Quinn Alice Mayra Wilson Alice Vlfeber Bernadine Swearingen Katharine Turner Roberta Holley 51 A j kj lj r . 4' as l bf if Ci 'qi D l WQDGX ,Q , Qi - ' to y E 7--aa A - y ,Q I Gbahan Esther Adams Catherine Dennis Mary Lou Norris Minnie Basting Esther Dillon Ida Dchs Elizabeth Bright Idabelle Harwood Lucile Otto J Aileen Browning Frances Johnson Alice Peterson l A Helen Burroughs Helen Mantle Mary Jane Pollock Margaret Bushee Beatrice Martin Ruth Sage l Mary Myers Katherine Turner The Thalian Debating Society completed the fourth year of its existence with a satisfactory record. A large part of its success was due to the efforts of the presidents: Ruth Sage, fall termg Lucile Otto, winter termg and ldabelle Harwood, spring term. In the fall term the society enjoyed a barn dance at the University Farm, and held their annual dance in the gymnasium. In the winter term they held an initiation and Christmas party at the home of Katherine Turner. The fourth annual banquet, which was held late in the spring, proved to be a very enjoyable affair. Thalian has many reasons to be proud this year, having among other l NEW things placed six members on the state debating team, and still retained the fi-lj? I ' 1 5 McCormick cup. im MGA? lg rf it ja .X VQP i l gQ 263 JV? , 7, ,YE E E rn, p 'ss 'WTT'f.5Ff f , 'rf -'E r w wwf 2252 Q all l o P I Cx T BM A E448 ' l QBheun Society Qdeon Literary Society has maintained an unusually high standard of literary work throughout the year. During the winter term, Qdeon challenged , Litsa Laurean and Unadilla societies to participate in a literary contest. Litsa Laurean not accepting, Unadilla and Odeon were left to vie for the honors. The score was a tie, each side winning two points. The winners for Odeon were Hazel Hilton in declamation, and Margaret Bushee in instrumental music. The three capable presidents for the year were Carrol Cade, fall term, Hazel Hilton, winter term, and Clinton Dennis, the spring term. The following have been members this year: Esther Adams Mildred Mead Esther Dillon Isabel Boso Eleanor Noble Marjorie Eaton Margaret Bushee julia Parker Hazel Hilton Carrol Cade Gertrude Scott Lloyd Koehler l Clinton Dennis Delvin Bergstrom Ruth Moore Charles Eaton Ruth Burroughs Chester McGuire .XA Maurine Hanson Hortense Clark Everett Quinn ,f 'N Frances Johnson Catherine Dennis Roy Taylor K lg I 'QA Q T 1 , l 2 4 4 l fb 6 'tl 'emawsirw de iw -Qlffciw - es is ff- fmbex mb ocfgiirgii 35 CE E a 'ev' 3f?i:!.9 The Hi-Y Club has completed a very prosperous year under the capable leadership of their presidents and their sponsor, Mr. Luedde. The presidents for the year were Paul Spafford, fall termg Harold Ackerman, Winter termg Lonnie Blair, spring term. The programs for the year were very interesting and helpful. In the fall term the boys enjoyed a roast at Floyd Schwenn's home. The banquet and over-night hike will be held the spring' term. +R! ta + 4 S RoLL Harold Ackerman Alvin Tarling Winston Adams Byrom Hallam Fred Barber Richard Johnson Robert Barber Loren Kinof Clyde Bean Grville Laiilghoff Lonnie Blair Lowell Martin Carroll Cade Maurice McElhiney ' Walter Morgan Alvin Tomlinson Everett Quinn james Thomson X., Earl Rader VVallace Wiley :XJ N Floyd Schwenn Roland Zook K, iQ Paul Spafford fi -g fill 265 4. 525 gg f ' 247' A 'A o tr' V Ziwvffcsm Q is if Q ' T17 ff r 1 W 17? 9595 'W ZH? 1.11 , u . .7 l I Q Lg' W ta A I Bnstrum burietp The Rostrum Society has had a very successful year, financially and otherwise. The presidents of the society this year were: fall term, Jack Penrithg winter term, Harold Ackerman, spring term, James Thomson. In the fall term the members and their friends enjoyed a theatre party. In the winter term there occurred the annual Rostrum dance, which proved very successful. In the spring term the members of Rostrum held their annual banquet. IWEMBERSHIP ROLL -Iack Penrith Earl Rader Roy Whittington Floyd Schwenn James Thomson Byron Hallam John Shiner Everett Quinn john Ross Loren King Carrol Cade Karl Schuth Harold Ackerman John LaFief sql Ewart Sneath Wallace Wiley R55 ?? Maurice McElhiney Walter Morgan A I I I l Qi EA A QD All ' o T x2Tf'f'Ai A I 17222024 9 Ui, UNSW Q I.,-X i ,-,,. ,-. ......, A A A ,-,.......-... Zltblztic Baath The Athletic Board of University High School is a body composed of five school representatives elected by the separate classes and two faculty rep- resentatives. They award letters, pass upon bills for athletic equipment, and boost school athletics in every way possible. Faculty Rejv1'c'sc1ztafiz'Cs . . . . . . . Frcslzmain Reprcsvlzfatiw .... . . . Soplzomore RCP7CS67ZfGf7iif6 furzim' R e p1'6sc1izfazfiife ..... .... Seuioa' RCp1'c'sc1i1zfa1'ii1Cs . . . R. VV. PRINGLE CoAcH FRANK R. JOHNSON, Clzairman .JAMES TATMAN CARL WHITEHOUSE JACK PENRITH JOHN Ross, Treasurer EVERETT QUINN, Secretary eng Q , H7 vii 9 l l 1 S l I 1 , 1, y 5 1 1 I F i jx M gl 267 ig , t lS57 A-3 A A-p y fffwf at Ya We li U1 lg Tllinahilla y Unadilla Society has passed another most successful year of literary l work. During the fall term eleven students entered the society. Minnie Basting guided the society during the fall term. Throughout, the programs consisted of general topics. During the winter term Unadilla was led by Aileen Browning. The nature of the work was the same as that of the preceding term. Doris jones presided during the spring term. For this period a new plan for programs was followed. Talks on etiquette, debates, and one-act plays were given. Unaclilla tied with Odeon in the contest held early in the winter term, Adaline Bushee in original essay and Paul Spafford in prepared talk winning for Unadilla. Un February the nineteenth, Unadilla held their annual banquet at the Village Inn. Patriotic decorations were used. The society will probably hold a picnic in the sprin Harold Ackerman Minnie Basting Madelyn Bishop Lonnie Blair MEMBERS Cleda Denler Byron Hallam Elinore johnson Doris Jones Cleda Nitzel Lucile Otto Clarabelle Pepple Ruth Powell Q' Aileen Browning Hannah Killian Dorothy Ringler VG, Adaline Bushee Helen Mantle Paul Spafford ld 3 Ruby Carver Milton Mathew yi l ff, 5 'I 'ZA 268 is l D A A G , Xfef' r Af A7 'AA f r lin Memoriam April 6. Lauren Eugene Nelson, 21 member of the sophomore Class, went to his eternal sleep. Tho Lauren had been with us only 21 short time, having entered school in blanuary, he was recognized as El good studentg and his quiet, retiring manner and pleasing smile were bringing him friends. In los- ing him, University High School lost a promising member, one whom any school might well be proud to Claim. 269 ?f9 QiQf ffff 17729896 1926 55 QQ ,. ,U 4 Wk! J s tf 4 M fx M 11 'N N i 1 r Ni I 1 fi ,S 5 f7?'?55X QQ E Z 1 V 4 W m' :Z r Q? u J 1 1 rw' 271 1, Q WJ CQ X 579' Jipxffffg i E C-fpfkiifp QQ 4 fQ M N .X F Q f I l V QR f, If A I q I .54-BD 4 ru I- f V X, .f Ik Munn WV WK f HL HL H , W fffwf to Pigskin Bays The football team had a successful season, winning a majority of its games. At the beginning of the season there were only three letter men: Everett Quinn, Harold Ackerman, and Roy Vlfhittington, all line men. The :ft rest had a record of little or no experience. The greenness of the material was heartbreaking, although they were called together the first of September. By fighting like soldiers in their last trench they held the f1fteen-pound- per-man heavier team from Decatur to an 18- to O score. Then when the Eureka team was trounced and sent home on the tail end of a 20 to 6 score, critics announced that johnson had a lighting team. They also remarked that Pontiac had a hghting team and a little more experience, in other words, a victory would result for Pontiac. But Kingery placed a place kick squarely between the goal posts. Then Ackerman saved the day by picking up a blocked punt and running twenty yards, the nearest Pontiac got to our goal posts. Next we lost the heart-breaker of the season to Clinton, 6 to O, on a blocked punt. Time and time again we were within the shadow of Clinton's goal posts only to lose the ball on fumbles. Then we hit Normal High, who, with the best team in fifteen years, beat us I8 to O with two earned touch- downs and the sad old story, a blocked punt. After this, Coach began looking for a punter. He found him. Against Peoria Manual, Muhl consistently out- punted his opponent, in spite of the fact that the held was a sea of mud and the ball like the famous greased pigskin, he fumbled not once. The sadder old story, a blocked punt for a touchdown costing us another game, was not his fault. Then U. High beat Lincoln 8 to 6 by superior headwork and fight, and nary a blocked punt. Muhl got off two seventy-yard punts. The nine- teenth of November, nineteenth hundred twenty-five, Roy VVhittington gave Bloomington a dose of U. High's jinx. It was strong-so strong, in fact, that Wfhittington made two touchdowns and blocked four punts, quite a total for one day's work. And his teammates ably assisted him, even though Bonny of B. H. S. made a seventy-yard run for a touchdown. Then we bumped up against Vifashington on Turkey Day and tuned them down to I2 to O. Again Vtfhittington blocked a punt. Wfiley, Kingery, and Ackerman showed a real brand of football. Besides the letter men, James Thomson, Williaiii Dunk, Floyd Schwen, Arthur Britt, and the Manager, john Ross, deserve mention for their fine work. which helped make the work of the team a success. Decatur . ............... Higfi Eureka . . . Hign l Pontiac . .. High Clinton. . . . High Normal . .... Higfa Peoria Manual High X-qi Lincoln . .... High VG, Bloomington . . . . . Higfi l Washiiigton . . . . . . High I Z I Q, YM., Y or --f r A6977 Memra 1 A S..f U P l l V I 9 29 . S Q f7?'?95X Q COACH FRANK R. JOHNSON Johnson, a ,graduate of Oregon Agricul- tural College, formerly turned out iighting teams at Danvers, Illinois. Although a new man at the coaching game, he placed the accent on iight, a thing of which older heads might take notice. No team out- fought a U. High team. ' I Half-back EVERETT qT1e1ocKsj QUINN, Capt. On defensive play Thocks was one of the best ends in this part of the state. He also showed wonderful ability as captain of the team. He played the game for all he was worth, and was an unusually Valuable man to his team in every respect. Left End ROY QWIIIFFLEPROOFD WHITTINGTON A veteran of three years, Roy played his greatest game this yearg and to say this means something, for Roy is always great. Roy was chosen as the best tackle in the state by many critics. He was unanimous choice for all-star tackle. Right Tackle l HAROLD CWARHORSED ACKERMAN Another Veteran who was truly a war- horse. The opponents were always howling about the big guard spoiling so many plays. Vllarhorse was the most consistent player On the team. Left Guard rx f' .1 5 1 ,g D 1 Gs mmsdts IZ W l 6 FDA M M 7? so 'L vA gi W 7A 9 j Q 19 3 J UV A Q 1 W ' L Xi pl 1 y l l ll X J ' 1 N i X 1 ll JACK CRUNTD PENRITH, Captain-elect RALPH CAWKNVARDD KINGERY Jack, the niidget who made monkeys of his Ralph was green at the game. But he did larger opponents, was quarter-back. He can three things, carried the ball through the keep his head in tight places and will make line, ran interference perfectly, and made an ideal leader for next year 's team. every tackle that came into his territory. In I I- other words, he was the very man for the Qumtel back full-back position. Full-back V 4 J. EARL QPOD HUSTLERD RADER WALLACE QWALLIED WILEY X-A Earl was shifted around a great deal. By Wallace was a neat passer and good ball ' the end of the season he played half-back. carrier. He played his best football in the fxef' V i He relieved Kingery of some line plunging latter half of the season. Wallace will be i Q, and ran interference like a battering ram. lost to us next year and he will be missed l , Earl is experienced, and fearless of any- terribly. lp thing in football. Half-back li It Half-back 'X rw' 1, JD fl 52 L , - l cc fi 'm 'H E '91 A .. L- , , Q3 39 f7?'?359C 9 F Q if EN X4 is Z l 1 l r FRED CFRITZQ MUHL U. High had a hoodoo-that is, until Fritz did the punting. In the first four games we had at least one punt blocked in every game near our goal. Fred had only one punt blocked in the next four games, and it was not his fault. Fred also held up his end of the line play. Left Tackle DELVVIN QREAL SILKD BERGSTROM Delwin started slowly, but improved by leaps and bounds. He was injured in the Pontiac game, but in a few days was back in harness, game in spite of a displaced rib. Delwin was a bearcat on defense. Right Guard pp, l in 1 4 WINSTON CTINYD ADAMS Another midget who cuts his opponents down to his own size by hitting low and hard. Adams, by his speed and grit and willingness to train, is one of the most prom- ising men for next year's team. Center KARL QCARLO3 SCHUTH df Carlo was a beautiful snagger of forward passes. His height made him a tough boy l to get around on those long-end runs. He 'v could also wrap his body around a tackle 5 1' and make a fine opening for the ball carrier. 4. 277 6 l Za fsiblgiii , - . fwex Svburt Svhuts, 'flung Shuts, Baskets Prospects seemed fair for a winning season in basketball this year. By the end of the season the harvest was a whirlwind. The Wlesleyan Invita- tional closed the best season since IQI8. For the fighting, U. High boys won second place in the County Tournament, first in the District, fourth in the Sectional, and a majority of their scheduled games. In the early days of December, the team, with one man, Berg, knowing the percentage style of play, set out to learn it. This difficult system, coupled with the short pass, soon began hauling in the bacon. The first slab, however, fell on us, 25 to 23, Leroy doing the damage in the last thirty seconds of play. Deer Creek and Lexington fell in short order. Then Lincoln spilled our bud-- ding hopes 21 to 14. After being exposed to a victory over Atlanta, and an- other defeat by the Alumni, they pulled a big surprise. Peoria Central, sup- posedly a ten-point better team, beat us one point in an overtime period. In this game Jack shone and Shueth was plenty warm. In the twin-city series, Bloomington beat us by a basket in the last min- ute of play, 27 to 25. Then Normal beat us 18 to 15, Berg being out of the game. In the County Tourney, January 27, 28, 29, U. High showed fine form by disposing of Danvers, Downs, Lexington in good order. In the Hnals, with Normal as an opponent, the first half was fast and furious. Finally Normal got too hot, beating us 29 to 9. Immediately afterwards we met Bloomington again. Fresh from a great victory over Normal, they had a live-point blanket thrown over them, I7 to I2 being the damper. Then Normal handed us an- other dose, 23 to 13. and won the city series. In the District Tournament U. High was given a fighting chance. By the most consistent work in the tourney they went through the finals. Shuth, as usual, was hot in the games. Penrith, VVhittington, and Berg made the all- star teams. U. High went to the Sectional, where they beat the much touted Beason team, 25 to 24. Danville, the next victim, lost, I5 to 14. After leading Tremont by four points for the first half, U. High lost, 20 to 13. In the game for third place Peoria Manual beat us 44 to 23. U. High was called the hard- est fighting team in the Sectional. Dur hard-fighting guard, Roy Whittington, placed on second all-star team. In the Wesleyan Invitational, the team won from Westiield, 24 to 23, but lost to Peoria Manual, winner of the Tournament, 34 to 21. After this the word finis seems fitting. But besides the letter men, three other boys- Karl Shuth and two freshmen, Dorrence Darling and james Tatman-all de- serve credit for the successful season. 278 gfgsaasxsaaiat 17796395 may BASKET BALL SCHEDULE Leroy . ................. 25 Hig Deer Creek . . . . .17 Hig Lexington . . .. 8 Hig Lincoln . . . . .21 Hig Atlanta . .... . . . I3 Hig Alumni . ..... . . .35 Hig Peoria Central . . . . .23 Hig Leroy. ...... .. 6 Hig Bloomington . . . . .27 Hig Normal. ...17 Hig Carlock . . .. . . 7 Hig St. Mary's ... .. 7 Hig Danvers . . . . 9 Hig Downs . . . . . 9 Hig Lexington . . . . . I4 Hig Normal . . . . .29 Hig Lexington . . . . .13 Hig Decatur . . . . . . .22 Hig Decatur . .... . . .22 Hig Bloomington . . . . . I5 Hig Normal . .... . . .23 Hig De Land .. . . . .19 Hig Leroy . .. .. 9 Hig Bellflower . . . . . I7 Hig Downs . ...... . . 3 Hig Arrowsmith . . . . . . IQ Hig Beason . .... . . .24 Hig Danville. . . . .14 Hig Tremont . ...... . . .18 Hig Peoria Manual . . . . . .44 U. Hig Westfield . ...... . . .16 U. Higi. . . Peoria Manual . . . . . .34 U. High. . . Opponents . . . ...... 479 U. High. . . CAPTAIN JACK A little man is our Captain Jack- You could put him in a number-three saekg He's little, hut mighty, and oh, so good In the little game played on the old hardwood. He's fast and shifty, and a pretty good eye. He keeps on going and doesn't ask why. Go get your man and keep him downg Do that and their team will look like a clown. He has big' feet and wavy hairg But it bothers not Jack when he's 'in there'. As our coming season is drawing near, VVe have nothing to fear, for he'll surely be here 279 3 . ree 7926 FZ is i 1 l i I l .QM Vi A ,--X SJ, M7 1 W l T 2 .Qld S JACK CRUNTD PENRITH, Capt. Jack is the best guard in this part of the state. He was picked on the County and District first all-star team. Cool headed, quick thinking, and a leader in other re- spects, Jack made a perfect captain. He will be with us next year. Gum-d ROY QWH11vFLEPaooFj WHITTINGTON Roy played his fourth year of basketball. The erities said VVhittington was only a good guard incapable of making baskets. Coach told Roy to sneak down for a basket occa- sionally, and that was exactly what Roy did. Roy placed on the County, District, and Sec- tional all-star tives. Guard RALPH CHARLES QAWKWARDQ KINGERY, Captain-elect Ralph is level headed, and knows basket ball from A to the wizard degree. He will fill Captain Penrith's shoes in fine style. Ralph loves basketball Cand chocolate be- tween halvesj. Ivo!-vvard lVlELVIN CEZRAD BERG Melvin played great basketball in spite of a bad injury early in the season. A power on defense, and owning the best basket eye on the squad, he will be missed terribly next year. Melvin was Captain of the District all-star team. Forward I 4 1. l Ci 1 i l 5 X Q35 7770 1926 'J i Q r l y , 4 kj 14 4' A WILLIAM CARISTOCHATICD DUNK ROLAND QROLLIED ZooK XVillie caused many a guard to look silly Roland began to develop toward the end as he rushed Willie on his right side, only of the season. At the Sectional in Peoria to see the ball shake the net with a left- he dribbled eompletely through the powerful hand shot. Willie was also a hard fighter, Peoria-Manual outnt, and also dropped in one who will make them all sit up and take four others-just a hint of what he will do notice next year. next year. Center Forward v S.f , IX-f' in X X Q' ARTHUR QARTD BRITT WALLACE CWALLIEJ XVILEY dl l L Arthur learned his first basketball at Arm- As general utility man, YVallace showed , i ington. It must be a basketball town, for what he may be in future basketball. Hav- I ly I Art is a real guardg seldom if ever did an ing to play in so many places handicapped y il 1, opponent sneak away for a basket. him somewhat. Another handicap for U. y ,fbi Guard High next year is that Wallace is a senior. 4, L D Guard ' p A - 281 A 6 tTfi g A' Q 'X A- A A gr 4 L Q13 fwfsx .29 V' We iff' ' .0 it Elubnsun V If Coaching the team in all the sports, gf On to victory he takes them. ,lg Answering all the questions they ask, C 'iff Courteous to all he knows, Honesty, he teaches to all the teams. Just in all the games they play, Owning the art of leadership. He tries to do better each day. Nobody knows the times he is tried, Surely he will win his way. Oh, a famous name his will beg No one doubts, just wait and see. E. M., ,27. l l l ' Qbur Subs In the making of our brave and gallant teams we must remember that there are those who work as hard and train as faithfully as those of the regular team, helping to make our teams what they are. Bruises, bumps, and hardships are their lotg yet, as they lack in brawn, brains, or skill, they are unable to make the team. VVho work the plays into the teams, and trains the team into perfect con- dition and perfect running order? The coach, with the assistance of the subs.', If it were not for the subs it could not be done. But what do they receive for their faithfulness and their hard work? Almost nothing. VVhile the team, and three or four of the more efhcient l'subs are getting good dinners and all the glory, the rest stay at home, nurs- ing their bruises and never getting into the limelight. Some of them do not even get the praise of the school in general. VVe do not realize how discouraged those subs feel at times. So, in order to give them a small part of what they deserve, let's give three , cheers for those hardworking subs,,' who help make our winning teams. W. A., '27. Z!lZbntks Here's to old Socks, our captain so strong, Who plays the game hard to help us along, When we are defeated, he's there with a smile, But he's planning to beat the next team all the while. XM, He is a good leader, so loyal and true, :mf iw Yet all the time he's depending on youg it lVQl He hails from a town by the name of Shirley. ii, So come, boys, let's give Socks a loud ringing three. Kg 1 X , l tl K., 27. ix i D 282 , G ' s i '7 Tpifjsf as so ' V I I ' w ' , .1111 f I 1 f f - H Mf fig HQ E' e'! 7. Mft Q X X f K X X I 1 EVEN U iam 283 Z 17222624 9 M Q3 I I X ff 1 hw f,-Zi N f-N N N1 3 x A. 4 X N H 1 y. i I 514 I 17,7 ' f W 5 w Q I 284 QlU 3T2f M A llfflliw W A W ,A K Y A Q 1703836 192 S a lxt 1 lg A 1 l 47 4, i a , F I l l AQ ef' 5 4 4 5-N I l li l i l . . , . . , illihe Elumur 1913195 Under the direction of Miss Louise Stephens, dramatic teacher of the Illinois State Normal University, the juniors of '27 presented three one-act plays. The first play, The T1'y.9ti1z.g Place, by Booth Tarkington, is a comedy. The second play, Two Crooks and a Lady. is a melodrama, and the third play, The Bifrtlzday of the Infaottn, is a. tragedy. The characters presented their parts in a finished manner, which showed the superb coach- ing of Miss Stephens. l The entire class cooperated with the players, and it is to them that a great deal of credit for the success of the plays is given. Practically every member of the class took part, either in the cast or on a committee. , l CAST or CHARACTERS ' ' The Trysting Place ' ' Lancelot Briggs .. ....... ............... C ARROLL CADE. Mrs. Curtis .... .... M ARY MYERS Jesse Briggs .. . .... RUTH. Btuutonciis Rupert Smith .. .... RICHARD REDING Mrs. Briggs .... BEATRICE BAIRD Mr. Ingoldsby .... .... R ICIIARD .ToHNsoN Mysterious Voice .. .... ORVILLE LANGIIOFF Two Crooks and a Lady Mrs. Simms-Vane .. .... ESTIIER ADAMS Miller, the Hawk. . . . . . CAI-moi, CADE Lucille . ......... .. LUCILLE DOBBS Mrs. Jones ..... .... I TUCILLE KILIBLER- Policeman . .......... .. ALVIN TOMLINSON The Birthday of the Infantaw Infanta . ............ .... B EATRICE MARTIN I XJ, Fantastic . ............. .... M ILTON MATI-IEW ,X A i l Chamberlain . ............ .... L LOYD KOIILER , , 'ik' Duchess of Abberquergue. .. . . BERNALILLO VVILLIAMS Q A , Musician . ............... .... I SABEL Boso W Juggler . .............. .... A ILEEN BROVVNING 7 l Page . ...... .... H AZEL HILTON l, AI Attendant . . ..... .... M ARGARET HALL lx l l fbi' 285 l l , wi .9 YV A al Q 912 N 1 .E ig Q 17755595 30? vig? Z 1 tx 1 r f X w n p . I Y X N 5 , i U me 17? DSX 'rt Q n Q, J f-if wi lg' , S, + 4 Qf 015132 Senior jfullies Wg . lfsa The Senior Class presented the Follies of 1926 on February the twelfth. They were very successful. They started out with a bang, when the freshmen presented The Yes- terday ofthe Class of '26. A large part of the Freshman Class took part, and portrayed the actions of a number of the well known seniors of 1926. The Rostrum's A Radio Party was a very clever stunt, in which most of the Club took part. The outstanding features were a short vocal program from station WLS, sung by Roy VVhittington and Ralph Kingerey, repre- senting Ford and Glenn of that station, who later entertained the Rostrum in person on the stage, and a very painstaking balancing stunt, by Ewart Sneath. The Qdeon presented the Black and NVhite Revue, featuring an instru- mental quartette composed of Catherine and Clinton Dennis, Isabel Boso, ard Margaret Bushee, and several vocal duets by Julia Parker and Ruth Burroughs. Both were very entertaining. The Thalian next presented a very unique stunt, called Literary ln- digestionf' in which Mary Jane Pollock couldn't understand her literature. Pretty soon the characters of popular literature, themselves, appeared, one by one, and paid her a visit. When her friends returned from a show, they de- cided she had literary indigestion, as she did not know who her literary friends were. The Hi-Y Club acted an interesting stunt, A Night in the Delta Decka Cards Fraternity. jokes were exchanged, each member being chalked up for several jokes, white mule Qin the form of milk, howeverj, was served for refreshments, and a freshman was initiated in the stunt. Last, but by no means least, the Senior Class presented a one-act play, Rosalie, which appealed to the audience very much. Clinton Dennis, Frances Johnson, and Adaline Bushee made up the cast. A man and his wife had a terrible time overcoming the stubborness of their maid, when a man of high society was expected for tea. The following made the Follies a success: John La Fief, Business Man- ager, Paul Spafford, Frances johnson, Everette Quinn, Byron Hallam, Adaline Bushee, Ruth Sage, and James Thomson. Q it r Z 287 ,ix 23 A jg? VQR A gif il T 'fs R-'R' R s'- rf SWNQJ WZJGX Esorimsali .Q T ca gl XXXW u 1' , l ii Q T 4 at R OPERETTA Cn Monday, March hfteenth, The Isle of Chance, a delightfully melodi- Ous Operetta, was artistically presented in the auditorium, by the Girls and Boys Glee Clubs, under the able direction of Miss Jessie Carter. In addition to the tuneful singing and capable acting for which our operettas are famous, there were many beautiful dances by the chorus Of Follies, the Spirits of the Fountain, and other groups. THE CAST Greed CKing of the Isle of Chancej ......... .... R ALPH KINGERY One-a-grouch . .... ROY VVHITTINGTON Ford Wliat's the Use .............. .... I ROY TAYLOR Captain of the Good Ship Ease. . . .... CARL SCHUTH Despair . .................... .... C HESTER MCGUIRE Simpelita . ...... MARY MYERS Lady Frivolous . . . MARJORIE VVILSON First Folly . . . HAZEL HILTON Second Folly .... MARGARET BUSHEE Third Folly ....... RUTH BURROUGHS Follies, Spirits of the Fountain, Sailors, Shadows, Z, Survivors from the good Ship Ease. i 8 i i Qi I ,-Nfl 288 ,S li Til ,Q 0 as 937, me 17629826 1926 ifFi'f5ZQ. www? .3 Al 43, if err 'hi T td l l E l I l Eehating University High School's affirmative team this year was composed of I Elizabeth Bright, Catherine Turner, Ruth Sage, and Ruth VValker, alternate. The first debate of the year was between U. High's affirmative and Normal y High's negative. This year the state debate question was Resolved that the proposed Child Labor Amendment to the United States Constitution should i be adopted by the states. The affirmative team was successful in winning all three judges' decisions. At the same time U. High's negative team, com- posed of l.ucile Qtto, Mary Lou Norris, Harold Ackerman, and Frances John- i son, alternate, was equally successful in winning all three judges' decisions in J a debate with Gillman High School at Gillman. l The next series of debates did not prove to be so victorious for U. High. L Again the contest was a triangular debate, with our negative team meeting Dwight here, and our affirmative team meeting Springfield High at the Capitol City. The affirmative lost, 3-O, and the negative lost by a vote of 2-I. XJ! Although the season has not been a great success as far as victories are 'LJ 7 i concerned, the debaters-as well as the coach, Mr. Robert N. Bishop, to whom ' 'I Qi much credit is due-feel greatly repaid for their work. l , 76 it s I i 5 289 ,x , - , ..,.. sw ia is 1 f get -rr -- I -' A- . - 2 A 'S fffwf xrstizte-52? gy :KJ I 9 S The Bear 5 Biups anh burrows l 4 4 , 1 1 Sept. 1 Football practice starts. The boys decide that six days of this make y ' Q one week Qweakj. gy Sept. I4 We register. Sept. I5 School opens. Mr. Barger tells seniors of all his peculiarities, in- cluding Physics. Sept. 22 Freshmen are informed of trials and tribulations in store for them. Oct. 3 Decatur finds U. High is not a set-up. Whittington decides that gum is the best thing not to chew when a freshman offers it to him. Oct. 8 U. High shows Eureka three touchdowns to Eureka's one to think over. Oct. I7 All U. High treks up to Pontiac to see the blood flow. It did--3 to O. Oct. 23 Normal High knocks us for three touchdowns, 18 to o. Oct. 30 As usual, Clinton blocks a punt and gets victory, 6 to O. Nov. 7 Peoria Manual's big beef beats us, 6 to o. Thalian has a big barn dance. Nov. I4 Lincoln discovers that a fumble over the goal line is not a touch- back, the final damage in favor of U. High being 8 to 6. Nov. 21 VVhittington goes through Bloomington High, blocking four punts and lugging the pigskin over twice for a score of I4 to Bonny and Co's 6. Rostrum boys take their best to the Maj. Nov. 26 Whittington blocks a punt, Muhl and Penrith get touchdowns, VVashington gets o. Lucile Otto says a Chevrolet cannot be wrecked. Qlt already is a wreck. Ib Nov. 30 Football boys enjoy a real feed, take in a show, and elect jack Penrith captain for 1926, all in one night. Dec. 4 Thalians hold their annual dance. Dec. 17-18 Inter-society contest. Deadlock, Odeon and Unadilla. Dec. 18 We leave school until next year. jan. 8 We again start poring over books. X4 Jan. 26 Rostrum dances to many tunes in their annual dance. Juniors ex- XJ, ZX pose their stage talent in three one-act plays. All say Very good E, Kei acting. LQ, ? gl 5' 290 MJD PD H 'l gg if H55-P? Nxt if f ' Ji 120 is my Eff WM ffl d rf N 'kj , jan. 27, 28, 29. County Tournament. VVe walk through to the finals, then lf! Q! Normal walks through us, 29 to 9. Z' lb. Feb. 3 We show Bloomington what a team looks like, 20 to 15. ' 4lI gg Feb. I2 Seniors hold their Follies, which prove a big success. Q3 L Feb. I7 Dur old friends Normal High hand us another defeat, 23 to I3. lg Feb. 20 Juniors hold a dance. Mar. 4, 5, 6 District Tournament. A passenger train QU. Highj passes through the District and on to the Sectional. Mar. 9 Alice Bell receives certificate for membership in Grder of Gregg Artists for skill in shorthand. All honor to Alice. Mar. II, I2, I3 Sectional Tournament. We go through to fourth place. James Thomson shows real school spirit, but pays heavily. QCost, I credit.j Mar. 18, 19, 20 VVesleyan Invitational. Wfe win a game and lose a game. Mar. 26 The Easter recess starts. Everybody wears a winter overcoat and thinks what a fine Christmas-like vacation he is having. April 6 Students return to finish with fiying colors. April 7 Death of Lauren Eugene Nelson, a sophomore. April 8 The most brilliant members of our class get the recognition they deserve: Ruth Sage, valedictoriang Gwendolyn Thomas, saluta- toriang Loren King, Adaline Bushee, and james Thomson, honor- able mention. April 9 james Thomson and Paul Spafford are chosen by the class to speak at Commencement. April I4 Loren King and Lucile Otto are announced as faculty choice for commencement speakers. Helen and Ruth were comparing their progress in the study of the Catechism. How far are you, Ruth? asked Helen. 'Tve got to original sin, said Ruth, How far are you? 'KI P said Helen, Why, I'm way past redemption. First Girl: Dear me, I never saw Ruth Moore look so pale. Second Girl: Neither did Ig she probably came to school in the rain without an umbrella. When johnny Ross was a very small boy he went to visit his uncle in the country. After-fwatching his uncle milk he was asked, at the supper table, if he wanted a glass of milk. my 7 'T He immediately replied that he didn't want any milk from that dirty old fy Qi cow, he wanted Snow and Palmer's milk. QQN 7 I fi ' 291 I l 1. 25 ' tg .fl -' I ri2 -fe A A 91 Gi ff .. Q3 1 f :5 o A TA' iff? Nr' s 'H T9 eamfieaf. fwex if . ra ,ot , fo Ziautn UH. laugh Ent Zlts fllulurs ji ? l ln the far-away past, before U. High had school colors and when travel- 1 'Qi' ing in any kind of conveyance was thought an extravagance, the football boys g ,gy would walk to their rival's grounds. C 'QQ Une Saturday, as the boys with a few of the loyal students were trudging along to a neighboring town, they were very much discouraged because the team they were to play was very strong and had not lost a game that season. Some of the group, thinking to cheer the boys, gathered armfuls of goldenrod and waved it as they sang their school songs. lt seemed to have a wonderful effect on the whole crowd, for they started singing. VVhen they reached the field, the boys felt as if they could do anything. As the team played, their rooters cheered and waved the green and gold banners gathered by the road- side. And the team fought their best and won with a high score... VVhen they returned home the boys gave all of the credit of winning to the goldenrod because it had encouraged them. So after that the green and the gold were established as the colors of U. High. M. E., ,27. UH. 391531 U. High's fame will live forever ON pennant, loving cup, and shieldg A sIngle glory will they yield. As eVer, green and gold will Hy Her Envied colors there on high, A coveR made below the sky Wliich Spells success for our U. High. VVe feel In us much power revealed, Wliicli letTing us a scepter wield, Gives glorY, dying never. Lad and lass sI-Ie'll still inspire 'Till this High Is what they desire. Place for learninG-, where students try, It is the school tHey call U. High. K. T., '27, Zlumars just right! just right! U. High Juniors, full of might. Now consider how in flight, lf the critics is in sight, Qur notes and candy we wrap up tight, l it-Q4 Ready always to recite. fi-ji VIN So salute the Juniors, always right. im it B. w., ,27. 51 i ll i 1 39' 292 'riff-gfli Q es li ll Z4 hall at U. High. The song they are singing sounds vaguely familiar. Sud- denly the words come to me: Show me the way to go home. How familiar is that scene, and how familiar the song. The picture fades slowly from my vision, and another appears-a tall boy on the U. High platform saying slowly yet forcefully, What's the matter with you folks? VVhere's that old U. High spirit? That figure fades and another takes its place. It is a little man in spectacles. His chin is tilted high in air and he looks up one row and then down another. Qccasionally he drops his chin and looks at a large piece of pasteboard in front of him. Another figure appears at his side. She clears her throat and gives a speech strangely familiar. The Modern History Class which meets in room twenty-seven will bring their map books todayf' Then a man with graying hair stands. g'If there are no further announce- ments -Suddenly a Mr. Pringle l is heard from the front of the freshman section. I wish all the freshmen would hurry and pay their dues as I should like to get my books audited. Again the scene shifts. In the back of the room is a group of girls chat- ting. while nearby stands a boy balancing a chair on his chin as if it were noth- ing at all. Once more the scene changes. U. High is holding a pep meeting, and Coach is making a speech. I catch the last line. Oh! that's the drying room-they're too green to burn! Q Iiaigb-bcbuul Zim T'was the night before a test, And all through the house Not a creature was stirring- Just that darned pest. Up where the midnight oil burned in his den The high-school him sat pushing his pen. The books on his desk were piled to the ceiling, And over their pages his bright eyes were stealing. IVhile cramming knowledge into his brain He accompanied his work with this refrain: IVhere Can VVe Go Tonight, Dear Jane? And he finally decided his efforts were vain. I studied and studied, I'll tell that dame, If I Hunk this test I deserve no blame. And so, till the light in his den grew dim, Sat the ever-plodding high-school him. M. E. M., ,27. i cf'v r'-qrzpm 0 Q wQ,Xi V CYP-4 I 93.0 I ' 25 Pl 1 D-wfgyj -Q5 Essaf fD',jQ,, Wf---N I'-4mk4m Qin: serie Uhgguwi .imifo N:-09? fb-as EUS rcmlfii-4 53.135- fb u l'-I 'D Hmmm 1? r-1-r-:CQ-A mcng fp:-I-3E'? 3x U D,-4,21 N Q 5:5260 5 'N O fe ev EI SD 0 -. O Q- Q5 P-4-. O5 X -M NH. uv. u -.2 gqn -5' 2. 'ii 'ci I3 n-3 ET 913 ... 30 P3 5 Se ffl. o OO 1: ETH? 'J' Ogg T 532 . Ui QQ id ff-I 'DO I Ei. 75 1 ic Qi? , lg l 'Q - A -ffdg fQUg if I l Qd gg is i Coil M Fl 791' xy' N? Q dl 1322 Q 293 Q, Ea f A l fe QJQNQJXM - e e yr v rv , JWDGX 'eb sb i r ,S QBur Basketball Zlleam 7 i J ,L , A iine player we have in Vllilliam Dunk, l 4 Qi And in his studies he doesn't flunkg ,KM ,Syl Whether at home, at school, at play, 6 VVe find him smiling all the day. fx I Melvin Berg is so fine and trim, He always sinks the ball right ing He plays real ball, and he 's full of pep- l l For this he 's established a wonderful rep, h Vllhen Ralph gets out on the hardwood floor, He sure brings up old U. High's score, And as a forward he can 't be beat, For he sweeps the enemy right off their feet. Another great player is Mr. Roy. lVe've never had another boy VVho could guard so well as our hVl1lJElfIl1lgfO11, 4 The husky lad from Bloomington. Long and lanky, tall and slim, Our Karlo's got a lot of vim, l He finds an opening, and goes right through, He has the right spirit, that is true. l Roland ls dribbling is certainly fine-- Just watch him break through the enemy 's line, He's small, but fast, and furious, too, VVe expect great things, Mr.'Zook, of you. And now comes Penrith, cream of them all. Oh, how he handles that basketball, And his iioor work's the best we've ever seen, He 's a great hand to the Gold and Green. p Here 's to our team-the team that can fight, And shows the whole world that U. High 's all right, . A team that honors and graces its school, l And lives up to every sportsmanship rule. l R. R., '27, 3 5 The bbutnhutnn t Now l've got you right where l want you, snapped ,lack Jones, the , most notorious man in Dusty Flat, a small cattle town in the heart of Bad Lands. t l The speaker gazed steadily into the eyes of his antagnoist, who looked t, uneasy, as if he were trying to get out of the trap that he had so carelessly il entered. lt had come to a showdown between these two mighty men. The f t small, dingy, ill-lighted tavern was packed with spectators who were eager l, , to see the fray. , gg-A Iack's opponent, seeing that he was caught, but unwilling to give up, said, X I g, ' l see that you have got me in a tight place, but l'll give up to no man, and i J QQ.: with that he made his last desperate move, and jack jumped his three and ld 7 only kings on the checker board. N., ,27. 41 i X . , , lx ? 1 3 , .gl L i 2 i ' l key at i 0i jf!AfM if c QNX Q4 N r. -- ,endings A SHS N r ' ff QQ .Wt,7,,g-,. A V , Q me 1779836 'QM flr'53ff W W T 1- f- -4 4-As,1,X.. ,IA , Q 1 eqf' QBur Jfresbmen WX, 1 :F l Those silly little freshmen, 4 Q ' ' Running in the hall, , They seem to have no respect Q QA For upper classmen 'tall. li lfA X They Whisper in the study hall, And throw paper wads enough. i But as Mr. Pringle says, 'fThat is small-town stud. We must, tho, give them credit y For spirit and for pep, For when it comes to yelling, f They 'Ve established quite a rep, They yell at all athletic games. CYou all know what that meansj, For U. High has been noted For supporting all our teams. O11 Thursdays they must wear Inside out the coat and vest, For the freshmen must be 'stinguished From the faculty and the rest. There comes a day for freshies, A time when there must be felt The swat of a dependable paddle, Or the sting of a senior 's belt. Of course we're all broad minded, And can see their side too, For we were once restricted , p By seniors and their rule. C. C., '27. l l jllilp Ramp Bay QAPOLOGIES TO A RAINY DAYHJ , The room is cold and dark and dreary, l I've pondered till my brain is weary, The rain still beats on my Window pane, I try to study, but all in vain- The room is dark and dreary. The room is cold and dark and dreary, y My hands are cold and my eyes grow teary, My thoughts will cling to that old exam, T For which I'm trying my best to cram, i While the room is dark and dreary. T Come on, old pal, my roommate said, l 'tYour teacher knows what's in that head, XJ No use in trying to fool her more- , ,N4l She 's seen you too many times before. IR-59 im And my heart was sad and dreary. my ilfgif E. A., f27. Q , 7 XD it Q 21' lg QI! 295 l 1 3 'N G gg.. -vi g --,. AA Y L 'fi SWZQQM Wd' T l ' T Ziff .V .. sr as re I r -f -f'.f vi e A-A' -'A A ' ' f7?'?95X i ' i 1 Q at 20 ut 1 o .' ,fy U High above the ever-increasing tumult sat a personage. His calm, benevolent, kindly 1 4, Qi face showed traces of weariness from watching the roar around him, and he sought some , 45 fi cessation from the ever loudly rising sounds. 6 5-A Just then, above the hustle and bustle, hurry and flurry and chatter, above all these there clearly sounded a bell. VVas this bell not indicative of some solemn event? Was it not the messenger which would stop the unseeming noise? Certainly it was what the worthy per- sonage from his height was expecting. And the effect, ah yes, the effect on all this tumultuous mob was increased hurrying which seemed to resemble the flight of many mice when the cat 's bell is heard. But gradually, gradu- ally, the noise ceasedg then the kindly personage viewed below him a hall evenly distributed with the silent remnants of the tumultuous throng of a moment ago. It was twenty minutes of ten in the morning, and Mr. Pringle viewed the members Of University High School wow assembled for General Ex. K. T., '27. Eiga wants l QAPOLOGIES TO HTHE BELLSHD i See the river with its waves, l Rippling waves! VVhat extent of rock and shore their constant motion laves! How they leap and run from sight, On their bed of trackless sand! YVhile the moonbeams shed their light On the wandering fowls in flight To a shelter on the land, WVatching their play, play, play, Through the night as well as day, And the differentiation of the caverns and the caves Made by waves, waves, waves, waves, waves, waves, waves- By the tearing and the wearing of the waves. l LOLA HALL, '27. what TH. laugh Spirit Just what is that U. High spirit? VVe hear about it from the time we enter as freshmen until we leave as seniors. Our cheer leader and our coach use the term frequently. It seems to be something that is displayed at games, something that the team cannot win without. But what is lt? I After three years of wondering, I have reached the conclusion that is that never-say-die spirit displayed at U. High, the spirit that makes us good losers as well as winners. It is the spirit that brings success. It is the spirit of cooperation, good-fellowship, and fairness. It is obtained through working together. YVith one common purpose, to win glory and fame for our school, to be fair and square, to make U. High the best of all schools, it is not hard X-A for U. High students to display this spirit. VVe feel it, live it, it is a part of our school. AJ, Here's to that U. High spirit. Long may it live. May the students to come have the Q same high ideals and school spirit as those of other days. May the U. High spirit never die. Q7 , E. B., '27. J . J Kg ZA 296 I, l 1 ' ul UW VV Q M Q Eli gi ff. 1979535 1926 ea Ciba Return uf the Martian As I alighted from the Inter-Planetary Express one pleasant May day in 1950, I discovered that the landing had been made near the gate of a circus. A circus! I hadnt seen such a thing for ten years, for they don't have them on Mars. So I decided, in my joyous excitement at returning to earth, to see the performance. I bought a ticket and upon looking closely at the man who sold it to me found that it was my old classmate, Arthur Glasgow. VVhen I told him who I was, he seemed surprised, as he said he had heard I was a confirmed Martian, and he had never expected to see me again. He called the gateman, whom I saw to be Maurice McElhinney, and said, 'tShow our old classmate around. Then to me, 'KI think you'll find several members of U. High's class of '26. As we entered the grounds, the first thing I saw was the fat. lady's tent. Entering, I was told, in the inimitable McElhiney way, that the tubby specimen of womanhood I beheld was Hannah Killian. After I had recovered from my surprise and greeted her, we passed on to the snake charmer's booth, where I discovered Leola Hahn to be the attraction. Next we entered the 'tbig top , where John Shiner was putting some trained seals thru their paces. The famous athletes, Chester Mclfluire and Oswald Reidel, then performed, then two very funny clowns came forward, and my diminutive guide informed me that they were Everett Quinn and Eldon Kauffman. Suddenly a familiar voice spoke, and Mickey whispered in awe-struck tones, The Secretary of Education. I turned to behold VValter Morgan, now a. sartorially perfect man of the world. After we exchanged greetings, Mr. Morgan asked if he might take me to dinner at the Coolidge Hotel. I consented, and after thanking my guide, we stepped into the Secretary 's Rolls-Rough, which I noticed was driven by Robert Barber. VVe soon arrived at the hotel, and on entering the dining room were escorted to a table by John Ross, whose fame as a restaurateur is national, according to Mr. Morgan. After an excellent dinner, Mr. Morgan escorted me to the VVhite House, where he presented me to the President and his wife, whom, to my astonishment and delight, I found to be Lonnie Blair and Ida Cchs. Since the President was soon called away by his social secretary, Ray Cade, Ida and I decided to go to the theatre. Cn summons, VVallace VViley drove the presidential Fierce-Sparrow to the porte-cochere, and we whisked down town. As we entered the theatre we were rudely pushed aside by two loud-mouthed men whom we saw to be Loren King and John La Fief. Almost as soon as we had gained our seats, the curtain rose on the first act of the Revue of Revuesf' Ida told me who the various members of the cast were. Floyd Schwenn, the idol of the day, led in a chorus of singing and dancing girls, and was called back three times. Gertrude Scott and John Ross then did a revival of the quaint old Charleston, which nearly brought the house down. The comedians, Paul Spafford and Eleanor Noble, presented one of their famous skits. After an in- termission, Virginia Welaei' gave her much lauded Dance of Seven Veils. Delwin Bergstrom 's VVindmill was reminiscent of the old days in If High Assembly. The whole cast then joined in a grand finale, during which we left, as Ida had promised Frances Johnson she would stop for her. I learned that Frances was at the deaf and dumb asylum giving her famous speech The Art of Conversatiionfi She told us on the way home that she had a Wonderful re- ception, and no one interrupted her. 297 A JN 'Q r 1 VJI if YJ ' I f 7 vfaf C fzzzbax H33 if W Q L' , 4 I was then driven back to my hotel, where I met Aileen Browning. We had ft tx f dinner together and I learned that she had just published her tenth book of ' L , poetry. After dinner we visited the opera, where the celebrated basso, Clinton 1 4 Dennis, and coloratura soprano, Beulah Kinser, were singing in Idabelle Har- ,S 4 wood's latest composition, Salla Bluff. We left the opera for the famous C f, Club Rader, presided over by the suave Earl and his wife, Marie Hahn. Hither, Aileen 's husband, Jimmie Thomson, the millionaire airplane manufacturer, and his friend, Melvin Berg, the Chief Justice of U. S. Supreme Court, took us, and I'm ashamed to say we had quite a wild time. VVhen I finally tumbled in at the palatial Thomson mansion, I slept till noon. At one-thirty I left for Normal. As I walked up the station platform to my Pullman, I happened to glance at the engineer, who lo and behold was Arthur Britt. If I had not been so eager to get back to dear old Norm, I should have refused to ride on a train driven by such a reckless driver as Art of the old days would have been, but I later learned he was the best I had ever known. I bought a magazine and started to read about the famous Alice Bell, and it l didn't take long to connect her up with the Alice who was brave enough to Sass Mr. Barger. I turned the wrong page and encountered an article by the famous movie grandmother, Mildred Strange. She declined, in this article to commit herself on the subject of her rumored engagement to the wealthy l cattle rancher, Harold Peter. Cn going into the dining car, I was served a delicious meal by none other than Euart Sneath, who had thus made use of his art of balancing. I went to sleep early. Next morning I found the train in good old Illinois. In the Morning Sun, a paper edited by Harold Ackerman, I discovered that the governor, Ruth Sage, was to visit I. S. N. U. to hold a conference about a new swimming pool with the president of that institution, Helen Burroughs. As the train pulled into Normal, now a thriving city of which Helen Mantle was mayor, I was met by Mary Lou Norris, now married to Roy Whittington, and a grandmother. She was just the same old Mary Lou. We soon arrived in the business district, in which predominated a large building bearing the in- scription, Hallam and Son, Publishers to the Whole VVorld. VVe then proceeded to the home of Helen Burroughs. There her secretary, Adaline Bushee, admitted us to the drawing room, where a delightful reception for the governor was in progress. In the receiving line were Miss Burroughs, Clyde Bean, Principal of U. High , Doris Jones, eminent research worker, Maxine Stotler, Head of the Physical Education Department, and Vamperdell Johnson I Doolin, Head of the Language Department. Among the famous personages pres- ent, to add to the evening's enjoyment, were Florence Bane, Olympic diver, Gwendolyn Thomas, world-renowned singer, Minnie Basting, power behind VVall Street, Louise Ramsey, President of Community Players, Hazel Stotler, magazine writer, Dorothy Ringler and Lucille Otto, musical comedy queens. These last gave a hilarious demonstration of some of the steps picturing a study hour at U. High, and then, for fear some dignities would be offended, they were offset by the old folk song Show Me the Way to Go Home, sung by Miss Thom-as. I was so pleased and touched that I definitely decided, then and there, that Mars should see no more of me, and that I should remain on the earth, XJ where I could see the dear old pals of my high-school days. RJ? rel: Q P rw A 2 px K 6 298 A - . . ,Mg :DQ A g 1 ,ti 5 l 1' so-J Sh' ln, -wi SC' ,fr . AUP, i 't- 19, i'-so its in uiiw ' ,- 'I .-.L J, Q P YQ RlEMllNllSCENClE illemory hrighlens o'er the pasf, As when the sun concealed Behind some cloud that near ns hangs, Shines on a distant held. --LONGFELLOW Perhaps it is Well that human nature deplores the present and glorities the past. In idle moments it is comforting to permit the mind to shine hack on distant fields of pleasant experiences Thus, this memory hook will serve you and prove the source of real future pleasure. For Stafford combines these elements with the artistry, the quality and the workmanship which entitle it to bear the phrase . . . Engraved by Stafford STAFFORD ENGRAVING COMPANY Educational Engravinv Division Stafford Building l Indianapolis --fri? ,Qnf W FQ il ' '37i5lT'5g9 'Q ,fqyfuf 'L J N., lIN BABYLONM The Street Crier was in his element in historic Babylon three thousand years ago. Written matter was of no avail on the illiterf ate massesg wherefore traders hawked their Wares unto a purchasing public. What a contrast to our American civilizaf tion! Our Widely scattered millions now read the ancient crier's evolutionized message at approximately the same moment. The ad' vancement in our public educational system has made it possible to harness this tremendous force now known as Advertising. We pride ourselves that our mental equip' ment enables us to patronize advertisers and by so doing we contribute to the economic greatness of America. .X Vu Q 'pal Efiki This insert is prints-d on CK AND XVIIITE Coated Book made hy DILL X CULLINS CO. if:i,.f lsli THe 1926 A if af, lg BLGOMINGTON PARRET Sc GO. ici: CREAM oo. PM Qggggfjxfldmg Allen A Silk Hose QUALITY Seasonable Neckwear ICE CREAM Knickers, Underwear VVash Goods, Silks K Notions, etc. SERVE IT AND YOU PLEAYSE ALL Phone 358 VVe specialize in Fancy Groceries for Picnics ck Parties PARRET LQ CO. Phone Xour Orders ' eat u QQQ, to E13-Joy , Moore Bros. Sc Stretch .1 gliamous for 120 DEQ 0 s V Gb' X9 Quality Groceries g 'f'f1B'0o 108 E' Beaufort Street Phone 5573 206 N. East St. Bloomington, Illinois GQEI.ZER'S Electric Shop Society Brand Clothes Radio Knox Hats Emery Shirts and Evwyflzifzg Elc'f'frirzzl gl aff iff the sfyle-we have it MQJ i u Gray, Trimble 8: Follick Electric Co S ' 112-114 Main St., Bloomington 107 East Front street l jx La 4 299 F21 12 L0 Z K ' fin rx Qu X XNTJQ ,, Tfie A 2 Sk K J , ,4.iff'f -S - r iiggxgf TT 17523036 IQ 6 03 'W T' ca I 1 I 1 i , I E I I I I l QQ 7 I ll SUCCESS IS ACHIEVED TH ROUGH SERVICE . If 4 YI F The principles that guide large companies to success are those which determine IQ the success of the individual-for business organizations are human. Iii To those students who are about to enter the business world or continue their pl studies in higher instituticns of learning, the value of cooperation and service to their fellow men is of greatest value. lg The electrical industry is barely 35 years old. Yet, think of its present day l magnitude-its future possibilities. On what was it built? Not on necessity. i It was built by the untiring efforts of men who devised ways to harness this force lg I for the benefit of mankind. li Today, electricity is used in some way in the production of everything we l wear, eat or use. Not only should thought be given to the pioneers of electrical development but I V also to the companies which produce electricity with its convenience, comfort and I , economy. Their interests have always been and always will be those ofthe public. E On such service as this is success deserved. pl I . . gi, Illinois ' POWER and LIGHT ., Corporation ll . The Jewelry Gift Shop BISCIIOII Market Watches, Jewelry and Novelty Gifts l I Special price: fo Jtzzdenfs on repair work ll Downstairs at P. O. Normal, Ill. DEJLERS IN IWEJTS if C. H. COEN ll, Kinloch 5518 118 N. Street Drug, and 3005 ? L l , Bef! Line Fozmmifz Pens l I Normal, Illinois , , . P. O. Corner, Normal, Illinois l 1 1 . I T H E H Q U S E I . of l , ' I Ku enheimer Good Clothes lc M 'IX-ff ag MGBERLY Sf KLENNER -K WCS. III N. Main lfji 7 BLOOMINGTUN gg 1 lf, I X ,La A-'S 'v'sif7f YYAA f A H -P l . cQ7f0g 93+ I W P ,NJ QSVQ.NNX55,X me 17? 236396 1926 i 'I V I R TZ: J. H. SCOTT Q A IES Studio of F ine Portraiture Official Staff Portrait Photographer 73 PHoNE 1922-54 420 UNITY BLDG N 316 T 1 i 1 i l I JWZDGX was S ii f ll i ghj BURKLUND'S INC. LEMME FIX YoUR sHoEs A Q JEVVELERS 81 SILVERSMITHS H- H. LEMME prop yy TTT The store of high quality Jewelry Via at popular prices -- y 'W cclflj wild! fl7Z6y ,Yfly if ij df 119 NQRTH ST. BURKLUND'S NORMAL, ILL. l Broadway Garage Co., Inc. CLARENCE A- BURNER E Distributors Attended the University A RICKENBACKER CARS at one time, but now he does nothing but General Repairing and .Accessories P R T N T T N G Exide Storage Battery Station NORMAL, - - ILLINOIS y Hildebrandt s Drug ,i I 1 QD 1 , ,iff H 5' i i Store 1 fimvi I Headquarters for l I !,,,,. I, KODAKS 'lllll' EE The Bw! Built Yivpewriter in fha IVor!d EJSTMJN SUPPLIES We recommend the ROYAL DEVELOPING AND ALL lvlgigfgdsl PRINTING Repigflfldilt l and Sold Send LIS Your Orders SPECIAL STUDENT PRICES V PAXTON TYPEWRITER my y COMPANY iffy 'E' 120 Noffh Sffeef Normal, Ulifw 108 North Moo, Bloomington, niiooio Q ,fl i l fxv l, l nigga G oMi j7f5g is QE, Y '7 1759595 13? 053 431 349 NJ ,RV K F W 4 WZ Bantagraph ,px I I I Printing 8: btatlnnerp umpanp ESTABLISHED 1846 Zglnumingtun, Zillinuis ..'2 f? 'fi!iW 7'fg'5' Hfiflz,A1 ,. V w.n. M y 134' wail? . ' af an . wlreufslss f , -Q ' ----' .f'f,. f ZL rif f' fPRINTING Q CBINDING Q LITHOGRAPHING ENGRAVING Q5 OFFICE SUPPLIES f . g?i'R?'iL'T5?1'S CPr1nters of THE INDEX D EE , and other Q41 X-A school publications m l md, vw SFZIAALTFY ' Q, AND sERvlcE Q V l 303 4 Tj? X Q' 'Q . J WU 16 , Yu , , QQ BQ fb Q31 'SWYQQXRJQM ffzoox W rg WV f - - 1- - -X- Ls.. .A L I I 4 in I txx ' :SEQ 9' ' 0 'ga 'ol P El 1111115 is .5 A I 5 lm-X Evtatv nrmal Hniuvraiig NORMAL, ILLINOIS The oldest normal school in the Mississippi Valley, affords excellent advantages to young people who wish to prepare for teaching. Its equipment is ampleg its annual income exceeds :l43tl0,000, its regular faculty numbers eight-nine. Its enrolment of col- lege students for the last year was 41581. The attendance in fall and winter exceeds 1260. ' , The Following Programs ar Provided for l926-27 l. A two-year curriculum for graduates of high schools with full four-year courses in four forms to meet the needs of upper grade teachers, of lower grade teachers, of kindergarten-primary teachers, and of country school teachers. A two-year special curriculum for teachers of Physical Education A two-year special curriculum for teachers of Music ' A two-year special curriculum for teachers of Commercial Branches A two-year special curriculum for teachers of Manual Training A two-year special curriculum for teachers of Agriculture A two-year special curriculum for teachers of Art and Design A two-year special curriculum in Home Economics The seven foregoing curriculums ar based upon four years of high-school work and lead to a special diploma and qualify the holder for the special teachers' cer- titicate granted hy the school laws of Illinois. Students without full high-school preparation may make up the missing work at Normal as explained lmelow. A four-year Teachers College curriculum for high-school teachers leading to the degree of Bachelor of Education A four-year curriculum in Home Economics to meet the requirements of the Smith- I Hughes Act. Q A four-year curriculum for principals and supervisors of elementary schools A foursyear curriculum for principals of village and community high schools A onesyear curriculum for college graduates The degree of Bachelor of Education is awarded to students who complete any of the tive foregoing curriculums. Five four-year high-school curriculums in Agriculture, in Manual Training, in Home Economics, in Commercial Branches, and for students who wish to study extensivly Foren Languages and ltlathematics to meet the customary college entrance require- X-! ments. These live programs ar for graduates of the eighth grade and lead to the ' 0' diploma of the University High School. tif' ku it I For Catalog Address DAVID FELMLEY, Presldent, Normal, Illinois P Y I 1 304 xx fx? 1, I l ifieteftsxccfsds r i V 'SS -S S F iXf77Z,?fS A S ' 'QQRMQQC fffwf gt ,Q '+ C D PARRET -7 if y ' ' Honesty , l p l l QI Men,SiFumiShingS Has ever been acclaimed the best my A pollcy. Whether or no-It IS the one We have followed since com- Expert Shoe Repairing Shoes ing to B100mlUgt0n and bUYlng this store three and one half years l ago. Come and see what you 1 NORMALJLUN015 think of the progress We have i made. l -HARDWARE- Dry Goods -Notions Womcn's and Childrcnfs l Ready-to-Wear G. RC2ld Sc Bro. Millinefy - 1 1 Reliable Since 1858 M East Side Square Bloomington, Ill. S West Side Square McReynolds-Getty Co. Thank You l y Cl th l't O es of Qua I y We take this method of l acknowledging the many YOUIIQ MCH,S Grade courtesiesextendedus by the officials Hfld Sfl1ClCIlfS Sport Coats of the Illinois State Nor- mal University which we assure all concerned are Stetson Hats thoroughly appreciated. Excelloe Shirts E W. B. READ at oo. V Q7 307 N. Main St. Bloomington, Ill. Bloomington, - - Illinois lm I A, sos 1 Q' 1 y 'fxl l PD jg' ' c c e 'rvfgwgj ' at f Q4 S+ 174 ft' JWQGX W I 4 Ei OUR BESTUBOOSTERH fy , is OUR OLD CUSTOMER CN' The reason we got so many new customers is because l we serve our old customers so wellthey feel lik recommending this bank to their friends. ,,-X No matter whether you keep a balance of ten dollars or ten thousand, our service is the same. PROMPT, ACCURATE, EFFICIENT and COURTEOUS YOU WILL LIKE THIS BANK Why Not Open an Account Today? NORMAL STATE BANK The Bank of Friendly Service Deliciour Fountain Drinks Light Lunches GOODIE GARDEN Whitman's BOX Candy Appearance Counts The young man who wears clothes well--who keeps himself Ht outwardly as well as inwardly--has a smart eye to his future. Adler Collegian Clothes They keep you looking your best ULBRICH Sc KRAFT 114 Center Street Sheets, afeteria Always A BETTER PLACE TO EAT Our service to students cannot be equaled BOARD BY THE WEEK Enjoy Our Private J. C. Douglas Sc Son We specialiy feature Silk Hosiery carrying brands of national reputation such as Phoenix Your Patronage is Solicited KINCVS BARBER SHOP Pleasing You Means yi Dining Room Success For Us VGA: ON NORTH STREET UPTOWN A T I 4 fl 306 fi QQCC Tfrfasffi -To it T 'ig 'Q sw 17329894 we Qx The Logical Place to Buy Gas Appliances IQ A Complete Line of Gas Ranges i EA Wiflz or Wifhoul Oven Heat Regulafors fx Wm 'c'clc G Carers 4 ,:-- - ef .f za-aff. APPIIHHCCS .LZ1 , S 81 P PURE DAIRY PRODUCTS l Throughout all Central Illinois-Always in the lead l Snow 8: Palmer Go. VVashington at Oak Bloomington, Illinois Quezlity Above All HERFF -J ON ES COMPANY Designers and Manufacturers l of l i SCHOOL AND COLLEGE JEWELRY INDIANAPOLIS Qi Official Jewelers to l ILLINOIS STATE NORMAL COLLEGE A n It Q l l 2 307 v ai is 3 ' 'wife fog f A 15 Cl U12 is 9121 U me 17? DSX 1926 www-Q 9 Q l P S YoUR owN if, 1 STORE gi First in Serfvice laboring unceasingly , to give you perfect Br0adWay Cafe service and to. make your shopping a pleasure. Always the first to show the new modes in ap- parel. o o V . South Side Square First in Quality 402 Broadway NORMAL Miller Printing Company PHoNE 903 i, , Bloomington XX Illinois Books, Stationery and School Supplies 7 G R IM S Publishers ofthe Ridley Geographies and Refer- , - . ence Notebooks, VVesthoFf Music Series, Outline Alam at 7mr6H0n Maps, Branom Geography Tests, and many other geographical Helps. Books for Libraries. NMA ..DiStinCtiVe Styles for the Jllzzil orderrprompllvflfed. l1'riteforratr1!ogue. i 1' Mi h . 'r , fi? U' W 0 Mo1tN1oHT so MoKN1oHT UQ lf ,Q Normal, Illinois lg up if A 308 X ffm' ig l Qi A' A 'Y' l f' Y if 'S S ' +91 2sJ7ff,. Bl, oiifaesmxio is I A I ,NJ I fffwf Qs 033 lil 7 V 1' , ' , li I is AR I F O I O HOB, as A l Portraits of Quality l I l I View and Group Photographers for this year's INDEX l Bloomington, Ill. Normal, Illinois 313 N. Main St. Phone 1776 Opposite Station Store I Q . . I First National Bank 7 t Costello 8: O'Malley OF NORMAL, ILLINOIS Oldest Bank in Town CLUTHING HATS AND Students' Accounts Solicited FURNISHINGS FUR KEEN'S Barber Shop YOUNG MEN 5 Barbers 5 Only UNION Shop in Town Clean-Sanitary-Up-to-date Lg ' Our motto is to please you R25 317 North Main Street Under the Normal , Bloomington, Illinois Post Office ' at tl fx 41' I SO: 17729595 rg Qutugrapbs 'Q Q 2. QQ E JE, . A- 17723836 is Zlutugrapbs A Nw I fi? I r wax QF E, Qutugrapbs M Q S 4 w ZX Fw N r 1 P 1 l , E M Z A D W A G sa Z9 1 5 3 Wil L X g Z .R FN Jn, SLB A JG fmaax J 5K6vcTZLiQ2Qf2 9 CE Ea Qutugrapijf M fy C-N '57 'if' Q UZ me ,926 E 17? DSX 053 gf QUIUQYHIJBKA Z 1 E Z E 4 .L as QL A Qfgy fffznax H ggc.,W0ifQ QS Qutngrapbs Q ED LQ tl 17222024 Q fl Q S Zlutugrapbs 4 Q22 E5 il Q Z, K me 17723896 7926 Qutngrapbs jg Q J L klavvfffgim fi 1770824 J K6gTMMQff? 2m 1, , Qutngrapbs .+ 5 .5 Q A Y' gg lg DM - Ah x A A G ZLQDWJQFQXQ ' Q F VQ' M. j77QJ5X 1926 9 Q Qutngrapbs .7 W Ag Q 0 I 3 I mf 3 Q E Z Q fwax Qutugrapijs ' 4. 'K N I 4 fT Q' ' Q 9 N 1 U WWQHK fv Q 4 A 35 f, 1 .. 1 gig . -Qs ,5 ,, aw .., '- Y ... . we IN., New VT., I .gl - , Vg, f if 'nf' ., f an 1 1319323 7 nj, ' ,ga-' I ,. . . Li , 1 V Vw . 4 . ' ' ' 44: 'Tl 4 ' : 4 . 7 4r5f',J?- i. ,I -- fs - i 1 ,, 7,1-'v V A , 4 ,.. A 'QIWJFI .4 ' f 9 'Q' ' -J 5-6. . A 4, -1 , -f , . ,'4. wif, .i- fb . . ,..- Y . w. J .AA v ,R '41, n-ff, 4 K 1 -1 av. 1 .- 1 ,ay F, Aiggzgz F' 1' Rf Fx? .3 W , fs, L 'Ziff :Fm 4- A .,r- ' ', ' ' ' ' AJ, ,, ,f ',4 fr- f - ?,A,, 5 1 A .- Hs. X ,,L.Y,34E-5.13-iy5:.l, - V 92 .gen 1 Q95 'fflrv :TW ,ig 'gTi':,,4.' QA Q ..g,,ai ' '45 . , ' -' -17 ...',?'vf1 . V ., , -mfg - ,V ,, , n nfl P V, PM 1 :ig ' Q - '- ,, Q f 1 V . - P as 5,5 ' A 1 1.-. ,Q , W V! ,' ,. '.'Z' :., rx' ' , V f'- ,gs,,:m. 5.-vi .- - . K Q - rg, rg V ., ff ' ' QQ ' f'ff.SIef I ' y ff' 'L 1 . 1' , Y-In . L '4' iff, , - V V' Zr mff H mx. Q6-'V' ' ,jf ,f ', ' P II- ti - V . . - , J n fr ' -N .,, .fi QI ' Stu 'arg-'l..A.x F. gr , b-'via . 'kirffg' -' 1-Q J - Q, -'Jgl ,P :,l,. . V 'IES . . , 1 1 f'L' 1 ,av . , 1 '.'lWl-. ,QL .,.' ' . ' ' -1 . b ez ' fri- '- 45x Hi:-5.5 Y '.' . my rg- X 1.55 'X:.,4XX'.,, ' .X f.X, - . ..f,' fr ' f I '.,' ' ' fy! ' '..' K ' X Xa, 9' V x , 'Q XQX,.X X X X 9 A 1 .-1, v , X ,qi .- -X , ' 1 7 , ,V .wx . Q--'f'1,!'-1522 . - 1.71. 4, ' F inf 5: Q 44 Q usa- X3 1 ...vw , 1. ' Q Q.,- . , W? : A, mv 1 . .X QQXX.g,X1Xi XXX. . :gg .q:,.f'jf!', ', I ,X X-.xiii X: XXX Q. Q 3 X. XX:-X' 1 -1 K1 X 1' , X Q . ' -,ga ..X. ' XX: ' 1 -M . X X 4,132 1 Xj,r - 1 3- QXXQ.Q,X. Q,-.xi.,.QXLX3N 35 2 Ap., ' 1 . 1 QQ. A gg. -1 . .V LA... f N, Q--Wig rs--W v, . .Q . fn u 'g s,j.,,.-. ,. AQ ,M-3-K 'mr' 1: .Q ,, 4 f -fu- V ix ... 1 ' .' ,X X QT' X- ,. . XXQX MX X -QXQE4,,:- . -fXCMXX.:eX'fiq,QX.aQ XX Q 53 , Qi,-ta, 5,-Q XQ . - if fig' 511K sl, - . ' Jn . 'Q 1 , ,. .gk bv -1, 6.1, . . 1 . gp Q.. 1 .4-F'.5.4 1. ' -,153 'ff-f:v'.:' 1 ' 3- 'FPQY' ' -V' L. .. 'ii ' 'w' ' ,i' 215 wa,-.-. . Q . pf. .f.X1:'.'w5 '1,,',,,Q1.5 -'fha 'L '. Q, Q. :Xj f '. 21, 1 . '- - .. 'Ur' 1-ANI' ,g -'4'-11: Q N- Qt,,?! Q f 1. M12-' 1 - -,' . . 1 . f 2f1.f:1x:f'.111rff . ' - Q.. ' 1. 1 . .1 1- . XQ1 ,f 1f X Q Q'-Q-. .jd 3 . ' X 5. K-g,Lf.f2?,9, - J Q neg 31, ,,X5.3. . 1' ' I g A 5 -6 'M-E U if C' ' f5w: 1 , 771 . ' 'S . 1.3 ' V V -4-' A ,'-. , ' -'fn' .fm -' J 133' V :j 'I .A 4:'f.33'ge4Q :1 , '-'. 'ff X A - '41 'fgijfiy YQ. ' - ' ii.. ,1 E2 i .. - 4. , ' ' 1,5 I ' , ff' 'W-921' ,Q ' 31 'z . , . fvv V 'A ,. ,inn .,1ft.vr,,f 5, 4: .. ffgf.. , - 1 -. J ' H W - - -' 451 - . 'Lg1'.-V . Q , N'-H ,.,f'1-.'E.42 9f.' h.,..q,.f Qld V, rw .- .Q -...Q .XF Q .- X . XX.: , XX X... X5 QQFXQ ug-1 'N - , ' 1.-J., -.v'9 f-..X if .2 , 518 ' ,.'. T1?v'1,f,'fAr , .- -- 1 1 Q L1 133' ,Q , IQ? 41' H' ',-fs. XXXX XX X QXQXX . .XQXXXXXX , 1,-.-of ..X .Mag X-X,,,X.XXX -Q ,--I ' I z..-' L '- . ,, ':1wsf1,.1 S ' 'ff ' U . ' X.,, -. 1 N23 -1-' 'Q .--XX.fni',.Xfg ' 1 .w 1.4 , ,- Q-fy., ,. , ,Q 1:.'.- XXVXA XX QQ ,Y .f QQX1 -- ,,.QX .Q 'Q ,v'fign.- 1. -X ,Q A, Q ,X X. . X 4, '?1X,Q,.fIl5' .. . .1l1:.1X',9 v ...f 1 ,- 'fr 1 - 1 - 2 ' . . . - . 14 - 14 ' ?1. 1 .' . Q ,Q XX . X , . X ,. tn. jg X L-1:2 Q, ' ggi J l-YQ 1. 'Q' A N41 ' Avgffl' L 5-F-if - W5 W . - 1 V1. 1 11 1 'f ' ' lf: , W' mfg' .'-,gy H 1 Q 'Sv .1.-LMQQT f,,,. - . ' fp' ' 'K 31 . 'JJ ' fx 7 JIU' 23,4 . ' Av' X .. QQ f.g'f,' X ll-ffr' 1 . ' ' 1' ' Q ' ' h .fffff I fl Q1 7 J ., . X X X X Q. X 1 . .. .er Y A . '- Qi. .X,QX . -X . XX 2,,,QX51...XX J-'1 .fr V- ' ' Huw T 6H'?'S'-ni5 f94Tfg:- .1 .5 13. 'R ,u .,- . ,-4.-1., -- 4. ' '. ' 1 'F ,2',:. 1 'Qf, '5Q'1'JQ- 'fi ff' ' M' .'f','f',1:1a..fm1iJ1'22 . X ' 1 QIT ,53 f Zig: Q. Xf ' -' sq. X-X1 1 ' - 1 .XiX:. -.5j'..,,-..1fX . ,,X X if.-X fl, ,r M . , 1.. .' an .- -..11 - wg. my ,- 'QQQWF1 ,1 .' ' uw ,pq is, ' rg: .1 Q' 'AL'.:f.l 'E -Qu. '- 'T ?iE'KQ?f'Xf55: ff ' Q X X ,X XX-X.XQ.- XX I 1X ly-, X, , .- I, 'f 2 1-' 5114, ' E151 ,-1 'Qs' -'rf-by . 1 4 1 'wi ' -.-S11 ., fu-11-.11: . . '11 ' I . I 1 ,V IT .1 f ' - 51.15 .5 ' -- 5 'j?.aC'K a .11 X v 1 .1 1 1 ..X X XQ XX -T ,VX : X 1 X ,X:'H .f-. -QELQ. Q Q.. -' K- 1Q..'X.'-. Q '-.65 , Q34 . -Ffa., njff + -. XX .,Q,','f2,ifXjva 'X -':,E1' 1 1 1 241 . .1 ' 'ff 1. . . . - . . V .M b ' f:..?'P'ff.f- ' Y 1 s 1. A ' . 1 .gr 5 . ,XX - , f 35 4. i A-- 11. x1 auf . Q v- .s., Q X .. 1... 4 . -.,. 4. . . .. xQ . -7 - 'X ' Q' '.','f1-141 ,..,5Q. ' .11-1 9 A .xl ' '15 xv QM-4 Y W- 'T. A . A315 .L , , T. y ' ' Qa 'K2' Q 411' . ..57.Z1.f .-,zvxr-X5gi.:,f:, 'l J' i-.,11-J: , -. :M-1z,1 1:2 : .. 1- 14' L - .,,,- Si.-' X X . .. . . X,X,Q XFX-, XXX QX QQ Q. XQX,XX.,?X . Pa. 222' 1-w ds , 1. .'N5':z'1XQ . ,X . Q , , .-Q-,V .. ' . rx 1' 's. 2 -. ML k . ... , . . - !- '1.'h'J 1 11 1 1 . I T U. . ' V1 . ' s 'H 1 2 v 4 , 1' . . .ff .- . . J -n .-X 'A Q X X.QX ,-,f QQX .XFN S' - . r ' . - . , , , -1. .inf X 1 , - 1 f X IL' 'V 'J ', 4 I - .Ar 1 ' , 7'7 . 431 fr- .lf 1-'fu . ,Q-Q .,..x. Q . . r 'f'-A .f,..e . ' 4 4 w - . Q . -x Q1..X.1X 0. . rd., X .X ff 1. - 1 ' SI' KL.. XX 5 . ,. .W. WHY! L' il'-'I lXYEXf'L.T -11' Y-A! QIHWW RBI. ,f-9 ,,.- . 'ix-? ,'.Kff'.ni N . ,Q . n .v H -L. 'tw i f M. Alf , 9 , 'W'f -N--,il .mf I - 4 1 . J t. if T ii ,, A L If .I if. .2f.9'rf. -4 . ' Q :,' , '. , ,, , rf -,, I ' ,.9, g4,'ffQ5,.--:mx .5 .I P ,gif ! ,film ', - . Q 3:-N -KI - 'A 'sw Fifi-jj gk' 'I ' I Aff ,- ,s , fw- muy, .funn -fM U.g - , :' wh.. '- I ',,F'..' -7-14. 4, ni., su- .,- wVWf-3afiW1fVWVy ,5' . . . VJJN, 1,-X-2 L1 ,Ti yjfbi , Q K. - Arif , 3. 1. , hiv 1' f ' '. W V . Q.- -. ,g, Q, . . - ,A , if .vs g HM n, m ,V ' w 1 5 9 -:MA -f 1 1' -. x I I lb N A rx . -' .1 K 1 5,5 750.3 ,L . 3-, N : 51:1 5, . re, I L I l 151' ..2w 5f1f' ,'1'pf::.114r.: 4 ' r 9-.15 . -Lb., ,. 271 I ag fig' lu ' ,- '. . ,, U , . . . Y, ,, .g ,e A 4 , ,. , qfqi,-j: 41 ,5 I 1 175, X 1 , 4., 1 Q '9' I '.'?i2g,.f' . . ' .1 Jr,W.mA.x .f , 1' .wvbt I . .4 .. if 5iEd'?'f,'1 P. YL 3 . .QV-5' X-r f'v1.. - Q -f. wi V' ', 741, f ' 1 f ., -: 1 T A A g Aw ' , K.. '.' 4- hu- 135 up Q '- 29 Fu .1'jQ x gs, b- 'BJSNIE1 1. -fl. . ' ,,' . 'ww f .- ' ' ,. tgggs. , V. 4 V ' L V . i '1'fi!2?73.. L , . 4. uv ' 1 1-fe' A 1 :Q ...Arr .via N114 7. Y, -,gf ,A : 4. . .. '. ' 'Q- ff .n . f.,. I? Hy. mfr . l'1Q'N'n: D ,Will 1 X 4 1 .12 fil - . 5 .. ,,, ii' Y f .. Y. 1-.,, ,, , . ,:Sf. N i.'54 -1. hr- L... 1 if wif 7 I I. I I- ug iigffx' ' H' ' ,sf , , 5 . ' ' . 'Zff . . ': sr'- : v ,IA-yi, 4 .3 . I kts, . ,wi . .- LV' ' ' .--PW' f ,.'-'L V ., ,A ,L 'fill A. .. 11 ' j.. ' -ff a ' .1-il .2 1.-. H .?-' .fw- .V 1 - ' Tw V. .,.,. ,Jax 5 ' .J3' 4 , 'Q . -TY, .qv -. , , , ,H if - Ln' -' I- af 'fi ,W . - 'I' v N . 'w v Q 1 'A ,X . - I-ps, P if ' X . -'Y' ' lin , . ' ' 1731 f r. -1555 -- 1 ' '-if .1 .- y-.- - up c . ' any , L, - , Nt, . 7, ,' yi K f. ' 'Q ,.:. . . , ' I 1 ' ' -f-55,311 . ff'-' . f' - ', ' 4 L1 ' IU-1' Q. , 'mviy . . X I, Q ' 1 '- , V 4 , fp-ff. f , Q . wi -' J' . ,. v V . Q .',1'. ' 'pf-1-ag: ln ff-w ' 3- .. I! Tfv:.4i .gc , .A .4 n...,' ' 1 - 9 - ' 4. , .4 . Q--. - -s rv 1.-r'-'. '. -v ',. 1 my 3 C .-

”

Suggestions in the Illinois State Normal University - Index Yearbook (Normal, IL) collection:

Illinois State Normal University - Index Yearbook (Normal, IL) online collection, 1921 Edition, Page 1

1921

 Illinois State Normal University - Index Yearbook (Normal, IL) online collection, 1922 Edition, Page 1

1922

 Illinois State Normal University - Index Yearbook (Normal, IL) online collection, 1923 Edition, Page 1

1923

 Illinois State Normal University - Index Yearbook (Normal, IL) online collection, 1928 Edition, Page 1

1928

 Illinois State Normal University - Index Yearbook (Normal, IL) online collection, 1929 Edition, Page 1

1929

 Illinois State Normal University - Index Yearbook (Normal, IL) online collection, 1931 Edition, Page 1

1931

Searching for more yearbooks in Illinois?
Try looking in the e-Yearbook.com online Illinois yearbook catalog.



1985 Edition online 1970 Edition online 1972 Edition online 1965 Edition online 1983 Edition online 1983 Edition online
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.
 E-Yearbook Home  Quick Search  Advanced Search  Quick Browse