Hyde Park High School - Aitchpe Yearbook (Chicago, IL)

 - Class of 1959

Page 1 of 180

 

Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection, 1959 Edition, Cover
Cover



Page 6, 1959 Edition, Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collectionPage 7, 1959 Edition, Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection
Pages 6 - 7

Page 10, 1959 Edition, Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collectionPage 11, 1959 Edition, Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection
Pages 10 - 11

Page 14, 1959 Edition, Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collectionPage 15, 1959 Edition, Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection
Pages 14 - 15

Page 8, 1959 Edition, Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collectionPage 9, 1959 Edition, Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection
Pages 8 - 9
Page 12, 1959 Edition, Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collectionPage 13, 1959 Edition, Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection
Pages 12 - 13
Page 16, 1959 Edition, Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collectionPage 17, 1959 Edition, Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection
Pages 16 - 17

Text from Pages 1 - 180 of the 1959 volume:

' IVV iff' X 1 f F MJ N 1 Vf , My ,, , Y ,fl x ' 5 My V Amid ' V WZ L 1 Q, JW 5 Lf' ' jj 4 .- , A 6 L,-' . fm 1 . V, , Wi? Triljrf' 5p,x4 I K w f A, J J 'ff J . f '!4 ' ' ' . . X A , 'J D- JCJ'!ff! Y ' ff .. f J !J!,lf'V:h, K J GMU V15 , ,. ,C . - A 1 ' pxdrf WX. fg 5 's X W ,V fi .J xx 4 9 If V r X E! 9 V, X ff? K f ' K Q' Z? 'W W , ' RN, YJ' JJ I' r ,Aj 1' . Sv W , SwL1i , X W 1 KK '52 ' ' ' X if UQ' ' G' Y 51 Vx S Q xii Q A . Sq Q EQ gligi ff -.J J ' Ass . . f x., 5' J v gi' -T Ns ff 0 QQ? f s x A Y' . . S -J wi fir . 'I' ' 3 ff S SSE N Ei Q M244 ,,b?1fwLfP.fj W . 5 7z4 ,ffrsgi,.f, AZ! Q N A - . -fm X3 ' E .JQv!yff,f,f.244f' jeffffwcff 'f l' ' - lazfa, h , ' a lf' a 'fa , A ' , . - wwf- , ffaffff , .uf-ix . M5-EZLTZ Vyf 0 -' Wav f ff MA gf Wygvm 71 W Q wG?x0fTpA,5f,Vf9PUL' '?Q,1f MQW xifgiewkfiff W , fy Web i iii X -5. .'+fHi, if -eil' R54 A 1 f f A M, X 1 1 X , , Q? Vi' ,ian f , 1 .my 1 5 , , Q , 1 4 E 1 v Q 4 1 3, L - ' 'bma- . 4 .wk -FW . ,,A.k,?51y'vjf,,T 4. W,M ,Lk wg? 1: W ' :Q 'QI k .':j',' ef Uv. ff.wqg':' s. m, ,Q-u., '- Q -,,,,..4 A ,QQ Y sW.f?f4 m g. fi ' 3 . .um t - Lf 911. lg3g3gi'.Vf,fi'1,1?,.4 gum A W ..4'?'h XV. ff M m 1 9 . we i .L I 'WG v! , 4 11 ,V 1 1 ' Jjkj E1 11 M 951: v j ,Z , Effijf l,4'W,,,,1 H :: '-4525 '- Mfg r - -l ..:r Jw ' , W . 1i'm.ics , Wi , ffi'f'lT ff 5? ' u f2', v Eff- wzjimfiff V -:Y .gif :iff 'fr lf , Q 1 153291 J' , ' 454 A .V Qf -5,1 4 . Af ' Q Q . 'sig x: ,Q Q 1 5 . Vw JVPJA QM Sf M xv my 5 WN f f f .-,- X. I, Q fh h 1 xf ff f 'Q ' if X!! ff J f I LL ' E f f , 15 . V l ,X f ' gi . --X -V 'Q r' f I x if my WW 'Y x The fl lf Ax X If x ,f , K' f MW , if 14 - , f Z! w his D - X - A - -N, - ,f 1 9 5 9 Ai1'Cl'IP9 X M K' X mf N W, xx N. :KU V9 .x X 1 , X KW Sf f 'QW WWW NYM TAX! ffm lx QJ J AN lk ' dp W f h XM VQ GUM ,LYMJCXJX 5 ,W 'Q 6220 Sfony W4 Hyde Park High Schoo , NU VJ Chicago Ill island Av enue f fy I . inois in fwfyfj y Vw GMA? 'mv M 5212. A 5 x My w wr L , A, , 4. . M My f x 3 i. www f 1 't :- 4 4 'H 41 I 1 1 X on tvlivj ilk Lit by ii I , I k ,in ,X ' H df' Li 1' r V I 4, 1 V AYJGEZQ C QQCQCJ on'ren'rs ee fe 2 C' ., A ,a fin ,J ca, We Learn Together . . . . 14 ,fftcy 1, 5: We-or fied, 'A We Are Individuals . . . .36 Lck Nag! 5 Q., CQ- 42:5 We Unite ln Friendship . . . . 90 Kiki WSF? 'nj .ggi '-1 eff? 523 tv? G' JC., it QAM? ff? Lf-12' bij-Q, 'ff'-39, X i CCC ., V75 7 1 Joan iiammersiey i Ediiors Renee Rein Eiimiwein Gwod Adviser he park i, .i i.1'.wrii 0 pinrv iw .imcix fir gwidf-w 7.ii,iw, k'e'miii C'i'Tw:i. Swiyi W'i!.n'w, iinyirixii' iniivi mn, .viii Un-mi.: .iwzfi-vi,-vi. - ...,,.. , wi, u V 'ng'f'- -A --.W 'KA ,.,.......,...,,-, ,m:...:z.'r......,,mA,,. M ,M -1, .. ,Q ' ' ' WM AM--L.--m,,,,mM ,M ,. . X: ,U-, , MW U W -I4-4'-0n.u.4...a-.,g..,.,...... , n 3-N. ,,,,,,,,, . ' 'H' W W . :mm . ' , L . , X H Y M- X, WN---..w1. M-ni up , L .47 ' .V I Q, I W.. w.MM.., WH In nk. .., ,,Mr,,,w V, W ,. , ,... .A..........M.l: . .W . NEWMW, N . Q25 BA N Y ,H 4 W ' ' W' wMfmy4yMk Tw, xwwx A W - ,311 ' ' Ja 2 M -5-My., W 'yah may -R.,,,t,. m - -. W , 1 ' 'gig - 1 W V A A t - 'UW .4 wwf. w yxlgfm, nm. 3,-3,,h,L A1 ,MV J --N-..s...,, N... , my K W ? Q s m 'K' 5 qv N- ' 1 E if ,' pw -.. ' ,+q m5fxa. Wk f Ui' 'N' 1 7 f A f 'Lag ' In ri ' H--.-. J i' Y Wm v , Q X wb' ' s- X- V X x JA -N M, L.. u f -. fn 1.691 - Q, , 51.1,- 'W Q mfffl ' fx I 1 L fl ' ,Q A lv 1. ,. ww , X xi R X N 41-', , V, I7 1-:S I . f -J ,.,. X ,,, V ...Q 5, M W W M HYDE PARK DEDICATES THIS 1959 AITCHPE Latin scholar and teacher whose students consistently win awards and honors agua lfllflfl C114 2 Miss Laurel Gillogly is eminently gualitied to lead her students in 'Latin. She attended Shimer College and the University ot W'is- consin where she received her BA. degree. She took post graduate courses at Middle- bury College in Vermont where students and teachers speak only French. Her studies were completed at the University ot Chicago where she toolc education courses. Aside trom her busy hours at school, Miss Gillogly has many outside interests. l-ter hob- bies include photography, stamp collecting, and the remodeling ot her summer home. She has visited torty-eight states, most ot Canada, and Mexico. She is presently Keeper ot Perm- anent Recordsu at Hyde Parlc. A favorite hobby ot Miss Gillogly is remodeling her summer home. Betore and atter views ot her heating system show a job well done. Contest winners have achieved outstanding recognition iqh the encouragement and devotion ot Miss Gillogly. meth Pitcher receives a tirst place award trom Miss giy while Carrie Dailey, Don Goldman, and Gerry Rizzer tor their pins. N9iQ'1bOI'S, HFVVX, UU'VYwp'fvfW, DUHQXFJU CMWVIU, Ki5l'0v'f'f' g 1 vor, ITJYTR Q bAYk'vfj7W, Rif,HQfd GVC1,ffWWGNd, RL'kjfI T kN'YffQ'ww PM Praff, Marwir- Wiisnn, Jars Rnsenbcrr, and Davie! K 1 min Weave ofwrw Mu cw? ff: 5. HUM rm Mme. HYDE PARK WELCOMES INTEGRATION IN SCHOOL AND COMMUNITY The Hyde ParIc communI+y meefs 'Io hear Mayor Daley speak af a ground breaking ceremony of 'Hne Hyde Park Kenwood proiecf. 1 , v , C . .w - I VNC' , s 1 ff ' ' 'L .' Q ' X I' an .D nt ti. id 1-il' 1' P ' 1 s'5' f 2' Q s , 'I G A N 4 xx V' ' .f sh . . is if Z. - - ' S. ' vfx x 4 ' Qt . ss Q .,' , Oo X 5 ' I I '9X . I4 - Q., 'a 'sf my :N 3' . , , x ' :A rg ' A , . . -Q A 3 ' ' 1.-1015 rf, in .,-52.2. ..'3 'T ' ' .A , L. . , 1,,,,,.n1. n W I. 9 'N-A ,' 'wiki ' -t Ev i!.h ILL? ' .. -. . 4' in A: LEM Y.p 'Ji1TJ' A ' .,,, q , 'A Q -A 'iff M ':.:ff-1 'mg-'ff M' .. 1, -1 ','1'r+.j ', F-5 I 4 '. b ,.-' 4 3 g: .A .A I f ,Q . T . 3' iq, v f'a5 D '13-'115i?'f f !l '1.5,s'l, 53 , . -fl! in - .tif l I M pf . . YH 1 1'-I , mu 'f ' +51 if . 3'-',.f.' 1 W QE 1 Lsf Q F. . I '.' ' ' , iv W. mi- ,Q V H A . , -rm ,W ,Q-:Hin liwa'.M'!2f-avian,-, M Aww- -' , X '-11 -ui 5 .A ' ' f, 'M 'X ' - ' 4 ' , ' -I-oilvd anim-, :...,...,., N ,.-. , H ,hm .... , , .W-Vli.bgg,3,g.5 ' ,: ' , f ' ' 1 -- .41-u-S ' m,.... ,W-, ,H V Y V . , vi . W. - ,, - , , ' I, ' ,.,5,,,n,..1':,y , -- 9 U., -HH X '- '2i....-71-1' ' ' X 'Mvh , -, ' - 'HN N i -1521 4vwfs-qu-.m,,,. wh , 1 ,W--3 ,, ., A, ,M,,iA,,1 g-g,,,,,,mgw4.5,,,,l,x.H3 . .V , ,,,,, , U . ,U A , K ,,. l WM ,w Y wr H Y ' M.. -' '- -:., k Y. V W--+ .N w-w...uqm,, ,, , ,. ' . , ' A ' -a-4-+ 4 '+ This is HYDE PARK High School IWACYG . +ll s i K . E We Arrive Early g x ' s QP nu... Sfudenis arriving in fhe morning are welcomed by Hyde Parlc's massive doors. Anollwer school clay beqins. The school comes lo life. The bell ririqs and an exciled, bust ling llwronq of Hyde Parkers fill llwe corridors. ajifll' , , A 1 Elixir, - rm . Qi xx :RT Q z f If ii: - hgh B WA,,,.. .. Q si'-I Qu.. 'f ,A 'wt-1. N9 1- ESX' yr. ' VC? 14 'QfIZ ' X +3 r P v Y 7 f Wi ,f , ,I mg, I., ' . , q fy X W f X? , X W , F Q - ' kfr' ,:.' .Q.: '. -'X A --X-- ,, - ,Mg A rw a -,- L 'fn if i 91 .- s 1 . V Y K ,. 'W G A we . X K ii V .fa k-f-. T W wg FF - '-- + K ,mx Q '-, ,QW - . i N+ ,. ' S i Us if x ' 1 1 s N .-215 ., 3 if :4 1... N I 'M W was ga i!sQ,L 1 ws 1 is Q QQ 2 ik. 'Q nr nm Sr 1 Lx if if nuff .,-ff If his ., .. , up n Q. ti ' , 4 14, , Q x 8 Y, yi , , .Q '1 'ww f --.Q ' ' Q f ' .' f 153 , . 3 '- -X as ' - g hh Il PW' e D X X, -W vi' 1 I., ' Q. X :R XKK mini XE 3, . I x i, .9 ' X xxx F Kia 'xX ll X.. - Q, ' Q 2 Q ww :Rfk M 71 'P wr? 3 BBE .-M N .. 4 .VL Nw' X Y -- DRE BE x. ,Z , 'I fvwffk , S 2 f. .2 Q, ,gg ,S W i f v 'sr X 1 Si H Q x i 3 2 . 3 5' ki U . . . WE LEARN TOGETHER 1e Gonnelly Library, Lewls Moore, Tipfrm, and Joann Van Duyse qaiherinq rnaierial for Hmerr lonq Y 105 WHICH are an Imporfani parf '10 FUQLLSL1 :'urr'irMum. Learning ine hard way is an experience for Shana Graff when she meefs Ernesf Joirnsorfs per snake face To face, I 7 - f-V, . Q4 vw. x ii xww X Q' jg X SUGIKW QW V' J. iw M Q55 .f ,f 9:63559 fy!!! xA 1 ' 4 ,ft -, . - . ,A ,fav ' Q 1 K s s5' ifi'-1 N Ja-I, dv' 9 Q Q ' Egg 'K aw' ' v'q 'WisffiQ X . ,res Miss Margaret Johnson Mr. George Triezenberg Miss Frieda Broolcs X t it t'rini iiuil in iliiiiiii- . l ini i n fXw.istanr Principal in charge ot administiatiiir Assistant Print ipal in charge ol giidance Dr. William A. Watters, Principal, And Staff Work Together Cn A New Curriculum To Benefit The Students In Our Community Clmiiging ionditions in the l-lyde Part: area neii: i,i, ilute ii constant evaluation and revision ot our curriculum. Numerous changes in the admin- lfilVilllOI1 .ind teaching statt were essential. Dr. Williiiin Vifiilerfs, Principal, and a director ot the Illinoif. Education Association, came to us trom lwrmiin ltigh School. Miss Margaret Johnson, liirmcr chairman ot the social studies depart- rnont, was promoted to A-.sistant Principal. Mr. W.illsvi' Dubvlc, tormer band director, became Ilia new placement counsellor. The change in boundary line trom 39th St. to 47th St. and new gi-.iilu ilion requirements pre-.ent new problems. l-lyde Parlcs students have wide interests and abilities. Giving them the best possible education is a challenge. We otter classes in tour or tive levels ot ditticulty in several departments. Special accelerated classes are provided tor those with high intelligence or special interest. Average, remedial and minimum essential classes are also included. Special worlr is provided tor those who are barelv educable. Our guidance department and reading clinic otter opportunities tor each group. lntegration is successtul at l-lyde Park be- cause students and teachers work harmoniously together without preiudice. Miss Theresa Lynch Mr. Walter Dubylx Miss Tillie Solfermoser fXitii,f,lniiii:t C uin.oll.'r Placement Counsellor Attendance Counsellor 5X guys How now brown cow, slowly reziles Adrienne King as Warren Bvillia adiiwli. lhe lape reiordor. Mrs, Cullinanl public speaking Ca, iiuli-n alleiiliiely li lhe oniinciarirrn ol earh syllable for 1 r'l'r1lar'ilvi iiiif if Sw. English Honor Players, Ji.dv Fosler and Carolyn Rodgers, quarrel .er inf-ii hay lriend Freeman Johnson, as ihev rehearse for a iwili iiriani r- ii 'Siindai Liisi Five Pesos. Miss Paine, direcior if ii fiiwsivd ful the realislic inierprelaliiin. Mrs Beafrice Kornhauser Eillllilslf Dlwpl, Cilfllllnrifl Four Years of English A mulii-Track curriculum in lhe English deparl- menl is Hyde Parks answer io lhe wide range of inf ieresls and abililies ol iis sludenis. ln acceleraled Classes, sruderiis are given ihe opporiuniiy lo make grealer slrides wiih original uniis. ln regular Classes, siudenis obiain a basis for advancemeni in reading, wriling, lislening and speaking. Remedial and min- imum essenlial classes give siudenls exlra lraining in reading 'ro increase lheir skills and rai-ae lheir reading grade level. Perhaps more inieresiing are classes in play produciion, iournalism and public speaking. English Honor, under The direciion of Miss Paine, offers praciicfe in Qharaclerizaiion and direfling. The his iory ol drama and lhe lheaier are parl ol This course. Public Speaking provides experience in wrii- ing and delivering informal lalks. Clear enuncialion and crifical lisiening are siressed. The iournalism class equips a sludenl io wriie copy for lhe Mhlyde- parker or The Aiichpe. Fair is foul and foul is llw vyl l ri Mr l ll viiirl ll il il 1 ir in--, i .i vm' lvll. Slum- Ulillglr lv 1 X ' Reqnired ' Mrs. Mrs. Mrs. Miss Mrs. Mrs. Miss Mrs. Mrs. Mrs. Mrs. Mr. Miss Miss Mrs. Mr. Charley Blacll Shirley Bloch Bernice Cohen, llyl y Jud ilh Cohen Frances Cullinan, S l Alia Farr Alice Filzpairiclc lrene Howard Elizabeih Hunier Molly Kamins Margare? Levin Warren Medford Rulh McGurlm, K Myra Paine, lvnrl ri ll r Sara Lucille Pridoly K Howard Sloan Miss Margarels Slurgcon Mr. Robnr? Weilzel sw K Life in Germany is explained in a colleclian ol colorlul piclures A Tale from Cervanles p a ides aler al l sun llial Rirhard lani and Janel Sperlrxln have assembled lor lheir Spanish pronunfialion Mrs Knzazzeh Sheila Goldn an and Car l German rlass la sludy. Forman lislen lo lvlelvii Sm lla rcr e Varied Language Program Adds Russian Mrs. Charlolle Kniazzelr, Depl. Chairman Mrs. Florence Alwaler Mrs. Emma Coade. B rvrv ls r'rwrvvr1 Mrs. Agnes Chadwicli Hyde Park is one ol lhe lew Chicago Public l-ligh Schools ollering lour years ol lour loreign languages. Lalin, Span- ish, French and German have been in lhe curriculum lor many years. Russian made ils bow in February ol l959. ll il ollered al all grade levels. By winning lop awards in slale and cily language conlesls, l-lyde Parlcers have demonslraled lhe gualily ol lheir Mrs. Rulh Donahue, 8B Chairman Miss Romana Fierro Miss Laurel Gillogly, Records Mrs. Enid Turner. Grade Adviser inslruclion as well as lhe guanlily ol courses. Pronuncialion ol any lan- guage is dillicull wilhoul adeguale audio eguiprnenl. Modern leaching aids such as recordings and film slrips make learning any language al l-lyde Park bolh inleresling and accurale. No rnaller which language is chosen, slu- denls can learn lo read, wrile and speak il elleclively. Praclical problems in Fssenlial Mafhemafics are To fhe rescue ol Jean Passovoy comes Mrs. made easy by Mrs. Mason when she shows Shull as Barry Schlessinger, l-larold Shapiro, lorry Todd. Sandra Pryor and Jelli Jones some Marcia Simon and Edison Malone fry This lrn lv. in rniilliplin alirin, College Algebra problem. Mathematics Always Necessary Mrs. Eleanor Anderson Miss Mary Brown Miss Rosemary Donegan Mr. Homer Franklin Mr. Herberf Helm, Jr. Math Honor Mrs. Eleanor Lewis Mr. Leo Macarow The malhemalics deparlrnenl offers a wide variely of courses suiled 'ro lhe sfudenrs inferesf and abilily. Basic and essenfial courses are inlended lor lhose sludenls who need an addilional review of arilhmefic and ifs applicalion To daily life. The fundamenlals of algebra and geomelry are covered in regular malh courses. For fhose sludenls wifh a sfronger 'rhan average inferesr in rnalh, Hyde Parlc offers a four year enriched sequence including advanced Mrs. Hilda Mason Mr. Charles McCar+hy, Program chairman Mr. Edward Oliver, Audio Visiial Mr. Charles Rhodes Mrs. Wilhelmina Sloan Mr. Alberl Soglin Miss Goldie T anen baum algebra, solid geomelry, college alge- bra and rrigonomefry. Junior and senior marh honor classes have become increasingly popular wilh our sfudenrs. The clubs slimulale ad- dilional inleresl in malhemarics as well as prepare irs members for compelifive examinalions. Lasl year our srudenls received lirsl, second and lhird places in The Wilson Malh Conlesl our of sixryfsix conleslanls. We have been al The 'rop lor 'rhe pasr sevenleen con- secufive years. ...:' I' ' J .... ' Mrs. Eva Shull Deparlrnenl chairman Sr. Malh Honor Hoping for perfec+ resulls, Joan l-lamniersley and Renee Rolli ask Rwad Colne-n lor pnenolplillwalein in order lo lesl llweir erperirnenl. The amoeba moves by Hs pseudopods is one ol llie ionclu ions reacln rd lx Slai ilNlf le ard Pd Cl a o al lilo ii s -, ,K -M, ire .r Qi na al ww y as lliey slar 'l pi iiriitiwg slnle, Science Grows Four years of science are oliered lo mludonlu .rl llydo Parlc. ln general science, Freshmen learn 'rlrme basic wrionlilii principles. ln biology, Soplionnores observe living llwingis im der rlie microscope and learn all aboul' life. In rlienni-,li-y .ind pliysics, upper classrnen discover llwe connpoailion ol rnaller and llie dislribulion of energy. Acceleraled classes lor lulure snieiiliwla permil wliuloiiiw lo advance rapidly and develop llieir own experimenlw. Regular classes rneel college enlrance requirornenl-.. Qlliffr classes require less scienrilic reading bul cover llio lmiiic lundarnenlals. Clwemisfry Honor, ll'1e Eleclrorzics Club and llie Con servarion Club meer regularly lor anyone vvlio vviwlieu mlm worlc. Year aller year our sludenls conlinue lo win iiwaixlw and lionors in cily and slale science iairs. llwe qualily .ind guanlily oi enlries creare a lougli problem for llwe iurlgrw. Miss Grace Peebles, Deplt Clvairman Mrs. Rufh Alper-l Miss Miriam Brennwasser, Siqma Mr, Glenn Bule Mrs. Hazel Conslanfinides Mr. Elmer Deahl Mrs. Lois Forwal+er Mr. Spurgeon Gaslrins, Slaqe Force ,y a ,P J u Ui If R M-fl x 4 J , lw J' il ,. X A x lf- Mrs. Slweila Jacques, Conservalion Club Mrs. Margare'r Julslrom, Grade Adviser Mrs. Celina Lislra, Boolcroom Miss Virginia Moore Mr. Edward Oliver Grade Advisor Eleclronics Club Miss Mary Florence O'Sl1ea Mr. Raymond Osirow, Chem l-lonor Mr. Andrew Perez, . 2, L.. jf .J A . , 5 F14-Q.iE?jj,ftgu .164 8 Russia, fl mu bw lu km Nw- -:mv .lanlfe T551-.Tr Marin Kmwk, Ja by lnicrnaficmaf Mfairs. -wa ky, W ' .Mr-Cf r. ,le-an H,x4,,v,M1. Cum whfdf-'M Haro WfJx'9rarf1mw+dw'.?..rhn:1 4ap sludy is i.iiiipi,lsiiry in Miss Kiirrivf, hi-,Tory Examinalion day in Wivrld Hislory does noi dis- liiw., Carol limi-. lin ali--. W4--.l Virginia lar may Maxine Epslein, Andrey Cappey or Barbara 4,iniiv Riillin. Ri-naiill Riilwiriwwii Mi. luv- l-l.ill whohavesnidiedrlieii-les1.onf.and are pref , X . , mil inl l nil Cliyl n pmefl vviih the riiihr answers. clivvi J. i ui ii ,i ii. U. S. History and Civics To Be Combined liss Margarei' Johnson, Uifpl. Ciilrii i'iw i in lr, James Cleary lrs. Grace Edgar liss Sadie Friedlander, ci iaifu do Aflvisoi' liss Maiel Kurrie, Ciiidi- f'Xdvii.i-r Ir. William Lechlenberg Ir. Alfredo Manaf The Social Sludies Deparlmenl pro- def. an opporlunily lor sludenls To be- nme afquainled wilh hislory, govern- enl and geography. A l959 graduale usl lalce one year each of Uniled 'ales Hislory and Civifs. Slale Law I95 -quires lhal before gradualion, a shi- enl musl pass an examinalion on lhe niled Slales and Illinois Conslilulions, ie Flag Code and lhe Declaralion of dependence. Sludenls enlering aller- inuary I958 musl lalce a year ol Uniled ales l-lislory and Civics Combined, a Mr. Viclor Rosenshine Miss Cafherine Shaughnessy Mr. Aaron Smilh, Eleclion Commission Sliidenl Coiinfil Miss Jo Ann Slephenson Mr. Lymann Webber Mr. Sylvesler Williams year in modern hislory or world geo- graphy, and a year oi an eleclive. New courses of sludy, new lexlbooks, new audio-visual, Classroom and library malerials are being adopled. Guesi speakers from governnnenl and neighbor- ing Universilies have addressed classes. Sludenr have visiied governmenl ol- lices and museums in conneclion wilh individual proiecls. Living in Chicago, especially in Hyde Parlc, provides 'reach- ers and sludenls wilh a weallh oi ma- lerial for underslanding how our world lives and works logelher. '19 i - sssgsxgg rw 1 ,,l 3335115 M' sb ., .MA .. Homemakers of iomorrow, Rose Woodward, Pauline A balanced cliel is served lc Mary Bryson, Dorislecn Lyfns and Evelyn Pills prepare blueberry mullins lor Calvin and Sarah Armslrnng in The loods Class by lhe bake saie. Making parly snafks al school helps Diane Brown. lhey believe llial a nulrilioin, meal is them prepare lo enlerlain al home. needed lor lunch. Home Economics Prepares Tomorrow's Woman Mrs. Helen Kmelly, Dr-pl. Chairman Miss Anila Anderson The Home Economics Deparlmenl gives a mullilude ol courses especially suiled lo young girls. Foods, a pracl- ical course, leaches correcl meal prep- aralion, nulrilion, budgeling and lable selling as well as social cusloms and eliguelle. For Those who wish lo de- velop skills in sewing, lhree semeslers Mrs, Pauline Niclxin Mrs. Dorolhy Swarlz ol Clolhing are ollered. l-lere lhe slu- denl sludies lexliles, buying and per- sonal grooming. l-lome lvlanagemenl is imporlanl lo every homemaker. A girl can learn inlerior decoraling, nu- lrilion, lamily relalions, child care, care ol lhe sick, and prepare her-sell lor marriage. A slilch in 'lime saves Flnssia Flelrher who ran run up a dress in a lilly. Susan l-lollis, Annie Spicer, Carol Shiraiwa and Sylvia Anderson are learning lo be lulure lashion experls in Mrs. Knnelly i. iliillnng nlass. N....,Nf s Nl' 5 TW M Q .Q . - 'iffff ,cgzggfi +- -was Fufure archifecis of America gel exceiienl rraining in mechanical Presenls in fhe malring will soon be iinished. when Samuel Davis and drallinq, Peler Piiusepp and Arlhiir Slreoler prepare plans lor iheir James Bonds go info aclion. Color and finish mxisl srill be planned drr-am lynn-,C, for lheir Hwhal nolsf' Technical Training Teaches Trades Mr. George Kasper Mr. Joseph Rafhnau Mr. Henry Simmons Hyde Parlc offers several courses valuable lo srudenrs plane ning ro follow a vocarion in The rechnical field. Each shop is equipped wirh hand Jrools and power machines so boys can learn by doing. The Prinrshop, Woodshop, and lndusrrial Arls Laborav rory are filled lo capaciry wilh boys eager lo learn. Wood, meral and plasric are available, Proof presses and power presses hum conlinuously. Fundamenial principles of engineering are raughl along wilh mechanical dralling on rhe drawing board. Original designs for machines and iurnirure win prizes. Type selling by hand in lhe Prinl Shop is slow and redioas, Srephen lvlc'Coniro, wnald VVowds, lnlarold Slovens and Sidney Thomas are slcilled craiismen. Mr. Maurice Gleason, Deparlmenr Chairman KU, 4 s s trys st- -.Y Ls. Accuracy and speed in using the ialcifator wiil be important to Linda htaugh and Good typists, Keiko laiii, Ethel Black and Teresa Burkec, learn l y llttlicd when tlify ut that lii t b th rt ct ke n tt lcd t the pg ' c impc ance t cpi g teir eyes on ,tO f. Business Education Trains For Better Positions Mrs. Anna Rosenberg, Dept. Chairman Mr. James Curtin Mr. Maurice Duggan Mrs. Dorothy G-erwin, Olliie Practno Sorviie Mrs. Ann McCahey Mr. Hamlin Moseley, Grade Adviser Miss Cordelia Olmsted Mrs. Katherine Parry Mrs. Fleta Petrie Qui' Business Education Department otters a variety ot courses tor students interested in the business world. Included are business training, ottice practice, bookkeeping, stenography and typing. Economic geography, commercial law, merchandis- ing and selling are also open to students in the department. All tundimentals ot business are adequately covered. Many types ot business machines are available trom typewriters and calculators to elaborate transcription equipment. Whether one plans to attend college or work in an ottice, some knowledge ot the business tield will be usetul. Typing and accounting are as important to all ot us as arithmetic. W' it X S , . . Els x si 9 . :r 451 .Aff 'E ' yf r' ESX. X' Q . .is that in - 1 C xg' I L. J - . I 5 'N .f 'lr'-vu I Praclice malces perfect Annie Dennis, Rose Riley Carl Davis and Donald Tanagi gel inh- llwe swing ol lhc rhylhm as lhe orcheslra reliearsci, lor lornorrovfs assembly. M ' Soundless music is played by Dagmar Tillishh and Barbara Rirhardswn as lhey learn Their A.B.C.'s on lhe piano keyboard. Thrills Us All Mr. Leonard Hursl, Depf. Chairman. Affappellas Mr. William Olive, Band Mr. Joseph Pilar, Orchesrra Miss Anifa Rufzlcy, Vocal Music Mrs. Lois Winrow, Girls' Chorus l'lyde Parlcs large music deparlmenl' ollers a wide yariely of acliyilies in bolh lhe vocal and in- slrumenlal fields. Regular music classes, where slu- denls learn lo read music, are required ol everyone. lnslrumenlal lraining in loand or orcheslra may be elecled. Junior and senior A'Cappella, iunior and senior girls' chorus, and a boys' chorus are open lo all who can carry a lune on a credil or non-credil basis. A peppy dance band enlivens Senior Varie eliesu and plays for school dances. The R.O.l.C. marching band bears our rhylhm al foolball games. Anyone inieresled in music has plenly ol opporlun- ily lo parlicipale. Miss Elaine lsaac, Deparfmenf Chairman Mrs. Geraldine Cordesman Mrs. Elizabefh Good, Aiirhpe Mr. Cornelius Johnson Miss Arlene Sheer Mrs. Audrey SmiTh DevelopmenT OT persanalily Through creaTive expression increases wiTh acTive parTicipaTion. Everyone aT l-lyde Park musT Talce one year oT arT To qraduaTe. Those who are nol' aTraid To express N Themselves wiTh diTTerenT arT mediums derive The mosl' beneTiT Trom The course. A beTTer under- sTanding oT The arT ThaT surrounds us Trom The design in an auTonnobile To The besT arrangemenT oT picTures in a noTeboolc comes wiTh learning while doing. Principles oT balance, proporTion, and emphasis are The same in a painTed picTure Self-porfrails are rouTine Tor Euqene Harrison who has won several arT awards. Arr Develops Personality as in The arranqemenT oT TurniTure in The home. Color Theory doesn'T vary when choosing cloThes or making a posTer. Four years OT arT may be Taken aT l-lyde Parlc by Those who show a parTicular inTeresT or de- sire To conTinue. Scholarships are available in arT schools Tor our graduaTes who wish TurTher sTudy. SixTy-seven sTudenls had Their arT worlc chosen by a iury To hang in The SouTh Side Regional SecTion oT The NaTional ScholasTic ArT 'Award Show aT VViebolTs. Snip, snip dons Albert Goodlow as he Gold Key Winner, William Dudley, is very An exhibil' of sTudenT work aTTracTs Gerry realm. n corruqaTod cily. proud of This honor. Rizzer's parenTs aT Open l-louse, -'- sys TX 'TQ S Physical Education For Boys Aboul lo lalre off, ihoma lzclc r John Spearman, David Skiii lr an Alan Garlinlcel gel ready l a Ii qi llying baslielbail game. as Varied Program Hyde Parlr oufiumps Soufh Shore lo gain a baslcei. Physical Educaiion is required of all boys every semesrer unless ihey eleci R.O.T.C. A varied program oi games, exercises, swimming and healih, direcied by experis, produces healihy minds and srrong bodies. Our compeiiiive ieams in Foolball, Baslfei- ball, Baseball, Traclc, and Swim are lcnown rhroughoui Chicago for Jrheir good sporls- manship and excellenr display oi ieamworlc. Our Varsily Baslcelball Team has won iour consecuiive Public League Souih Secrion championships and is looking forward To a repeal performance nexi year. Befween halves af lhe Smith Shore Fooiball Game Mr. Hasan and Mr, Long iaili ii over wifh Ernie Thompson, Senior. Mr. Henry Schulfz Deparimenl Chairm Mr. Ellio'H Hasan Mr. Roberl Long Mr. Lloyd Rohrlxe Mr. Chesfer Ziemba N'MNJM,.g...f .' ,,sf ', WATER, , s ' aginning swim mers, Clirisline Rx s P irouno, Marli-no Bulls and Lena i K iillips, lirsl lime llieir lear ol llio ' .M-,,,..-',,.v-f g alvr by -,pla-,liinq in llio devp end 'WW 4 'Y Mrs. Adah Maurer Deparlmenl Cliairniai Mrs. Miss Mrs. Mrs. Miss Mildred Dubyli Margarel Levin Gerlrude Harold Bealrice Marshall Donnis Thompson ip Physical Education For Girls Includes Required Swimming Under lhe able direclion ol our Physical Educalion slall, our girls receive excellenl' Training in all lypes ol gymnaslics. Swim- ming. a required subiecl for all freshmen and sophomores offers good praclice for beginners and adeguale compeiiiion lor lhe more experienced. A girl musl' be able lo swim across lhe pool before graduaiion. Cn lhe floor, The girls learn good sporls- manship while enioying baslcelball, volley- ball, and soclcer. Good heallh praclices are sludied in lhe heallh classes where physical lilness counls. :olr oul below! Theresa Davis may come Feel aparl? Theresa Davis won'+ pass wwn iirioxpocledly. lhis lesl, Up, up, up! Sue Dawson explores the heighls ol lhe girls' gym. -QW' , ,AW wif? X N X S1 Q X X Ms Q f X X . we R 1 if ,X is .W 'X 'SQ . A K 0 Q. sw AiTcl'1pe King For 1959 Hats Qff To You, David Boyd! You have achieved a posiTion oT populariTy, Tame and accomplishmenT as a resulT oT your Tine worlc aT l-lyde Parlc. Your Triends, classmaTes, and Teachers are proud To have you as a member oT The Senior Class. As a member oT The Traclc Team, you have helped your school win many honors. Your in- dividual success in The Tield oT gymnasTics has broughT honor and recogniTion To you and your school. AT The Y.lvl.C.A. your many Triends come Trom all neighborhoods To waTch you play basl4eT- ball. OUT in The Tield, you play baseball like a pro, pleasing all your Tans. Your membership in Boy's Chorus, Junior A'Cap- pella, and Senior Alcappella has secured you a place in The hearTs oT many. Your brown eyes and sTa+ely manner has made a hiT wiTh all The girls as well as The boys. Known as Casanova by many, you have a naTural way wiTh people. Dave, your success will noT leave you aT grad- uaTion. You are bound To carry Through aT The Uni- versiTy oT lllinois where you will undoubTedly be- come one oT The TinesT lawyers in The sTaTe, Tor selT- deTerminaTion is one oT your many asseTs. May This TiTle, which your Tellow subscribers have so approa priaTely awarded To you, never leave you. CongraT- ulaTions, Dave, you are Truly a lcing. Aifch pe Queen For 1959 Crchicls To You, .lan Rosenthal! Your radianr smile has won you scores of friends and your pleasanl disposilion has enlranced people wherever you have gone. Your inferesi and parli- cipafion in Sigma, Siudenl Council. and various ofher organizalions as Jr. Malh Honor and French Club, have earned lhe respecl and admiralion of your classmales. Oufsfanding service and leader- ship have been exemplified by you in every way. Success is bound +o follow you everywhere. ln col- lege, be if 'rhe Universily of Michigan or Norih- weslern. in your career in psychology. and in laier life, you are sure lo find happiness. Your fellow classmares have elecled you Airchpe Queen lo show lheir confidence and appreciafion for all ihal' you have accomplished. As 2B and 3B Secrelary. as Sigma Presideni and Secrerary. and as a member of fhe Prom Commil- lee, you have served your class well. Your voice in Senior A'Cappella and Junior A'Cappella, Too. has helped bring enioymem' 'ro many audiences. Your work as an Adiuslmenl Office Aid, Annual Agent member of The Annual Sraff, Senior Sponsor. Box Office Assislanf. and Hall Guard has earned you 'rwo Civic Awards. May you never cease 'io reign. Congrafulalions, Jan. You are fruly a Queen. Up +he ladder foward succesf climb Joan Budylc, Andrew Weiss man, Susan Schiillz, lvlarlen Ker nis, Ediih Newman, Jean Passo voy, Frances Asher, Pamela Darby Jean Hayashi, Joan Hammersley Raye Linda Farr, Barry Schlesinq er, Brenl Benson, Dan Kosman Richard Wexler, and Fred Hirsch Sfafe Scholarship Winners Frances Asher Brenl Benson Joan Budylc Pamela Darby Marcia Dillmann Raye Linda Farr Jan Grayson Joan Hammersley Jean Hayashi Lawrence Holloway Marlen Kernis Edilh Newman Jean Passovoy Barry Schlesinger Susan Schullz Lewis Weissman Richard Wexler Individuals Win Scholarships . . . National Merit Scholarship Joan Budylr io Radcliffe College. Additional Scholarships Bren? W. Benson io Wesleyan Universiiy Joan Budylr Pullman Foundaiion Scholarship lo Radcliffe College. Franklin Coleman lo De Pauw Universily, lo lvlillilcin Universily, io Norlhweslern Universily, and lo Auguslana College. Pamela Darby lo lhe Universily ol Chicago. Pullman Foundalion Scholar- ship lo Barnard College, and fhe Illinois Classical Conference Scholar- ship. Gale Duffell Chicago Boys' Club Scholarship lo Chicago Teacher's Colleqe. Raye Linda Farr lo lhe Uniyersily of Chicago, fo Barnard College, lhe Proctor and Gamble Scholarship +o Oberlin College, and lhe Junior Association of Commerce and lnduslry Scholarship. Belh Hanlrin Panhellenic Scholarship and lhe Pullman Foundalioi Scholarship lo lhe Universily of Illinois. Jean Kay Hayashi lo lhe Universily ol' Chicago, Joan Hammersley lvlayor's Youih Foundalion Scholarship io ihe Uni yersily ol Michigan. Carol Levy Scholaslic Nalional Arl Awards Scholarship lo Syracusi Uniyersily. Toni Robinson lhe Universily ol Chicaqo, lhe Pullman Foundaiioi Scholarship fo lhe Uniyersily of Chicago and 'ro Chaiham College. Gerald Rizzer lo Grinnell College, lo lhe Uniyersily ol Chicago, anc lhe Pullman Poundalion Scholarship. Renee Rolh lo lhe Universily of Chicago. Rulh Ann Sfewarf lo Wheaion College. Marcia Simon lo Washinglon Universily and lo Conneclicul College Barry M. Schlesinger lo lhe Universiiy of Chicago. Richard Wexler Pullman Foundalion Scholarship lo lhe Universily c Michigan. .- llllunyglnills 6 'wg y c .. I iirsl Place in Biology qoes lo Ralph Liclclon al the Dislricl Science fair, Ihe Cily Fair and the Slale Fair. lislricl Science Fair Winners . . . Biology: Ralph Liclrlon, Isl Place: loberl Sroll, 2nd Place: Sleven Greene, 3rd Place, Chemislryz l-leidi Qpilr and Jay Kahn, Isl Place. Eleclronicsz Leland hleuberq and Ned iiock, Isl Plane. Malhemalicsz Edward Blum, Isl Place, Physics: Ted fonlilry, Loon Gammon, and Sidney Jones, Isl Place. rlalional Malhemalics Confesl Winners in Illinois . . . Individually: larry SIIIIUNIIIRIQYIQ 4lh Plane: Team of Three: Barry Schlesinqer, Sher nan Sillwi, Richard Wexler, Blh Place. . . And Honor Awards Dislricl Winners in lhe Illinois Slale Lalin Conlesl' . . . Fourfh Year: Pamela Darby, Isl Place, Third Year: Anne Meyer, Isf Place: Marlin Gross, 2nd Plano: lanra Vlficlr, 3rd Place. Second Year: Gerry Rizzer, Isl Place: Don Goldman and Mary lsien, lied 2nd Place, Firsl Year: Robe-rl Greenwald, I-xl Place: Ellen Zachariasen, 2nd Place: Judy l'lf1im, 3rd Place. Illinois High School Speech Conlesl .. . Radio Speech: Richard Vlfoxler, Isl Place in lhe Dislricl, Silver Knighl Nominees . . . Cilizenship, Raye Linda Farr: Music, Franklin Calc-man: Drama and Speech, Richard Wexler: Scholarship, .loan Budylr: Science, Daniel Kosman: Malhemalics, Barry Schlesinger: A Blue Ribbon and A Scholaslic Gold Key send Carol Levy on lhe road Toward an arl school scholarship. Social Science, Frances Asher: Arl, Carol Levy: Lileralure, Joan Hammersley: Journalism, Gerald Rizzer: Praclical Arls, Gale Dullell: Sporlsmanship, Conrad Worrill. Music Awards Cily Choral Compelilion: Boys' Chorus, S Ralinq: A'Cappella, S Ralinq: Girls' Chorus, E Ralinq, lnslru- menlal Solo Winners: Violin, Donald Brealcslone, Josephine Morris: Horn, Joseph Silller. Scholaslic Arl Awards . . . Gold Keys in lhe Dislriclz Laurie Allman, JoAnn Blakemore, Joni Cherbo, Paul Crossqrove, William Dudley, Euqene I-larrison, Susan James, Delores Jordan, Anila Lauria, Carol Levy, Charles Meir, Doris Waqner, Laura Wick, Milne Winfield. We IN KW' Delores Abbinglon Rose Adams Jerry Agee Carol Anderson Damon Anderson Trehwa Ashlon Domingo Aviles Arlona Bailey Bruce Baker Slanley Baker Marion Ballimare Mabelline Banks Anila Barnes Marlha Barnes Riilh Barney Roscoe Bass James Ballles Jimmie Beard Marshel Beason Cewall Berkley Tamara Bickham Leona Binham Carol Blackwell Jeraldine Blouin Emily Bowlin William Bowman Charles Boyd Willie Boyd Mary Boykin James Brackins Eslello Bradley Philip Bradley Linda Breeding Marlene Briggs Charles Brooks Gloria Brooks Paul Browning James Burger William Carler Bellye Cavin Belly Chambers Willie Charleslon Angela Charllon Carlos Chayer Rena Chesler Felicia Childress Sheila Chism Charles Clarlc Mildred Clarli Bernard Clepper Carola Coales John Colby Lois Colley Marvin Collins Clilliord Congress Freddie Cooley Ornealha Cooper Mary Corder Joseph Crawlord Alberl' Crosby Gu: Cumberlander' John Curry Johnnio Dawson Corinne Decker Roberl Dixon Allred Dolson Jeraldino Douglas Dlivi Douglas Vera Duke Kalhleen Dukes Ardella Dupree Gloria Easlman Ronald Ellis Rexino Ellison Beverly English A sparkling sleam lable rellecls lhe eager faces ol Toni Robinson's group ol visilinq eiqhlh grade sludenls, Tessa Evans Annie Filer Pamela Fisher Bernard Filzpalrick Waller Flowers Allen Frankenburger Donna Garlinglon E ' n em ine i more Alphonzo Glenn Porler Goosby Arnold Goss John Golllieb Harold Granl Alan Grayson Willio Grayson Earl Grillin Elhel Grillin Paula Grool Frederick Harper Joan Harris Verger Harris Wisleria Harris David Harlslield Fred Hashimolo Casey Hawkins Mary Hawkins William Hemphill Ann Henry Barbara Hicks Diane Higashida Franklin Hill lda Hill Thomas Hill Ulysses Hill Alan Hiller Gloria Hilchcock Bernadine Hobson Welcome Renee Hollman Viola Holiday Belly Holliday Vlfilliard Hooker Emma Horlon Jesse Hoiislon lidward Howard Fverla Hudson Jody Hnlr liens Kenl liirhi Michael lsacson Margarel lwanaqa Anila Jackson Anloinelle Jai kson Jerald Jackson Kennelh Jai kson Ora Jarkson Ronald Jan kson John James Palricia Janie-3 Brenda Jenkins flxrin Johns ,lil 1 Arielia Johnson Beniamin Johnson Frances Johnson Melvin Johnson Nellie Johnson Viola Johnson Cecilia Jones Hurberl Jono-, Malinda Jones Mary Ann Jones Many l'llen Jone- Ronald Jones Peler Jundel Joyce Kellar Michael Kelly Jerome Kidd Sludying lheir programs, Frances Johnson, Mary Newman, and Paula Grool wail lor lho meel ing lo begin. A peek inlo lhe Food Laboralory is ollered 2 nee Rolh's group as lhey lour lhe lhird l'oor corridors. Freshies y is Klein lochelle Knox 'lelen Kushida harles Langdon uida Leavell aye Lee Nillie Lee Xlorman Lehrer lohn Leiva Melvin Lesley lheodoro Lewis Nado Lewis Richard Libles Selly Loewenlhal vlary London 2 mniney Lowe :eraldino Lucas :lanley Madison Krneda Malone Jlichael Marlin lxdam Malermus rna McConnell alheiino McDowell luanila McGee hola McGee ein Meyer leanello Miles vlary Miles :wendolyn Miller Jlaxino Mins zzar Moali red Moore ieda Moore ohnsa Moorehead AcLesler Morris Villia Morris Jellie Moseley e arimplsu Zerri Neil Theresa Nelson Edgar Newell Shirley Newell Mary Newman Sladys Nichols Zbigniew Nilecki Gerald Oberman Shirlean Overall Harold Palm Angeline Palminlere Tyrone Parker Jacqueline Paxlon Allhia Perry Delrao Pelerson Earl Pellis Roy Phillips Eugene Pierce Sleyen Pillman Vernella Poellinelz Alice Ponder Marshall Pope Nancy Poslon Eleanor Powell Frances Prince William Ralclille Sluarl Rilkind Joseph Riley Janice Roberlson Donald Robinson lzaih Robinson Jacqueline Robinson 'John Robinson Vernell Robinson Lionel Rockymore Ellen Rolh Kennelh Sakry Philip Samuels A glimpse of Home Managemenl even inler- esls llee boys in Allice lfichholfs group ol prospeclive Freshies. Kennelh Sanlord Aaron Sargaenl David Sargenl Charles Scales Charlolle Scoll Theodore Scoll Ernesline Shead Janice Shorl Sharon Simpson Barbara Sims Brenda Smilh Charlolle Smilh Huervey Smilh. Michael Smilh Ned Smilh Solen Smilh Paul Soglin Karen Solomon Yvonne Sparks Kennelh Slanlord Elaine Slewarl Velma Slokes Wallila Slorey Carolyn Slyles Aila Swanson Jacqueline Swanson l-luberl Swarn Fannie Swindle Barbara Taylor Janice Taylor Rosalie Taylor Edward Thomas Yvonne Thomas l-lenry Toliver Bellye Townsend Freddie Turner , Helen Vails Dorolhy Veal Ronald Velasquez JoAnn Vincenl Margarel Wahlgren Jannella Walker Mary Walker Tillon Walker James Wallers Warren Wallon Ronald Washinglon Dorolhy Walkins Carllon Walls Roberla Wexler Lawrence While Erma Williams James Williams Kalhlyn Williams Kennelh Williams Novella Williams Ronald Williams Thurman Williams Allridiasl Willis Palricia Willis Aulray Wilson Carol Wilson lsaac Winlield Ronald Winn l-lenry Woikin Roger Wollheim Josephine Wong Adrienne Woods Renee Woods James Yarbrough John Young Diana Zullner M x is Wiiiff f'N X:'.A.: 3 ' F K r J I Er? ', X '-ff. 4 u Ei? 5 W .,.,. 1 92 My f by M ' A ff' N, Q 52 'N C K K E N fi as iw mu. ik 1- QQ ff' if sf xigkf' 'Q if X mm.,, . N Q S is-QQN 7 vs Q wg WMM NW ww v x f 9' X A Sgxfwfa xv EMS 4 ' xi x.. .Q X li P .eilj -1 3 Service Wi+h A Smile Even beginning Freshmen can be of greal value lo I-lyde Park if lhey will conlribule par? of lheir school day lo service organizalions. Working in The prinl shop, Tangee While learns 'ro operale 'rhe prinling press while he runs oil one ol ihe many forms needed in our complex school rouline work. DONEGAN IA Division Top Row: Richard Greene, James Lan, George Richards, Raul Dillmann, William Oslrinsky, Miss Rosemary Donegan. Fronf Row: Margarel Mal- lhews, June Presberry, Beverly Gibson, Annie Dennis. Sallie Kosky. Sheila Brown. Joann Dance Service Crganizafions Cpen To Frosh HELM IA Division Top Row: Eugene Washinglon, Billy Heinze, LEWIS IA Division Boloby Blond, Ronald I-lamaguchi, Tommy Seq- Top Row: Daniel Johnson, James Greenlee, John Cooper, all, Tom Morris, Warren Soble, Roberl Green- wald, Mr. I-lerberl I-Ielm. Second Row: La- Marr Ware, Virginia McEwan, Dagmar Till- isch, Margaref McWilliams, Mildred Harness, Evania Walker, Bonnolyn Blalock. Fronf Row: Pal Howell, Ozie Simmons, Rebecca John- son, Linda Helm, Anya Glass, Jeannie Sch- neider, Ingrid Friedman. Louis Wilson, Bruce Smilh, Moses Merrill, Mrs, Eleanor Lewis. Second Row: Ernesl Hirn, Clillord Brown, Devardy Cross, Harold Dillard, Larry lanzer, Jay Sommorlield, Jonalhan Wallon. Third Row: Leonlene Garnell, Marilyn O'Neal, Waller Morris, Calherine Schaffer, Thelma Morris, Carol Eichholz, Shirley Redmond, Audrey Pierce, Gloria Grillifh. Fronl Row: lilly Velora, Peggy Edidin, Dorolhy Jones, Leslie Kramer, Paulelfe Blond, Dolores Wilson, Linda Kabumolo, Irma Joiner, ' if 'ui 'Was R ' Q PEEBLES IA Division Top Row: Freddie Hill, Anqelo Wallace, Galewood Monroe, Millon Taylor, John Mcllablo, James Rohals, David Slcolniclc, Miss Grace Peelolv-I, Second Row: Flana Rose-nlhal, Pearlie Perlcins, Eleanor Cul- lins, Beverly Turner, Deharah Williams, Susan Balsam, Anne Draznin. Fronl Row: Gloria Nelson, Denise Whalley, Riia Moore, Sandra Ford, Bonnie Roluy, Paula Winqlifzld, Bonnie Koch. Temporarily Bewildered When Sylvia Jordan was a Preshie, our maize ol corridors was very puzzlinq. Direcrion signs placed here and There came lo her res' Cue. Now Sylvia can find lhe Girls' Gym wilhoul qefring losi. No One Gets Lost Af Hyde Park PILAT IA Division Top Row: Edqar LaBo'r, Melvin Mclnlosh, Horace Rolneris, Sandra Adams, Edward I-lollisfer, Con- lny Oqlelree, Dennis Reiss, Dave Proslen, Mr. Joseph Pilai, Second Row: Sylvia Jordan, Marsha Lee, Sharon Thomas, Elaine Chandler, Yvonne Killolt-rew, Sallie Baniel, Nanfy Walanabe. Fronf Row: Caroline Sioll, June Hayes, Carolyn While, Roxanne Robinson, Igdwina Johnson, Pauline Tana- qi, Joyce Yamamolo, ROHRKE IA Division Top Row: Clarence Owens, Jay Collon, John Lewis, Jon Lamln, Arrhiir Hahn, Harold Ralslon, Helmol Pari- ma, James Waddell, William Marsh, Ronald Murray, Willia Alexander, Mr. Lloyd Rohrlce. Second Row: Elizabelh Carler, Jeanelle Bass, Jill Gary, Ricardo Johnson, Marilyn While, Andrea Crawford, John Ivory, Michael Smilh, Fronf Row: Joan Laslcin, Roberla Nalls, Barbara Garner, Riilhie Jones, Lois Benson, Sandra Durden, Larry Nash. 5 1 x 5' -' - ,Q I Nil iss ' W Losi' In Discovery Readinq lor recrealion, sludious George Richards is inlriqued by Sherloclc Holmes and Dr. Walson's advenlures in lhe London foq. His reading rasles may chanqe, before he becomes a senior, 'ro a splil in The alom or lhe chemical compound in explosive T.N.T. Study Habits SMITH IA Division Top Row: Edward Wells, Edward Pills, Franlc Bon- ner, Charles Spearman, Jerry Winslon, Mrs. Audrey Smilh. Fronl Row: Olivia Allen, Yvonne Wallon, Thelma Washinqlon, Lula Lesler, Claudia Swanson. SIMMONS IA Division Top Row: Leonard Boone, Lee Wilkins, Jon Sfro sinslci, William Millcinlas, Raymond Williams, Mr. Henry Simmons. Second Row: Linda Blazelc, Mona Wilson, Georqia Childs, Rulh Anson. Fronf Row: Miki Komalsu, Jeanie Fisher, Mildred Hudson, Les- lie Nicholas, Nancy Shapiro, Donna Weinslein, Develop Early WEITZEL IA Division Top Row: Harrison Kimbrouqh, Roger Feldman, Harold Richards, Richard Niidelrnan, James Filch, Mr. Roberl Weifzel. Fronl Row: Bari Clay, Sandra Hollman, Norma Brailiord, Willene Brenl, Beverly Fullon, Glenn Miller. 5. mmm X eww min 6-Q4 SPN Book Worms Library aid lda Carler checks our books lo Bob Colman and Essie Tyler lo be read al home. Book reporls and hislory nore- baoks, keep lhem our nl mis- chiel ailer school. LONG 2B Division Top Row: Herberi Sievens, Chuck Loiiz, Michael Gershon, Clar ence Sealen, Mary Sullivan. Janef Simmons. Mr. Roberf Lanq. Second Row: Alice Williams, Joyce Wilson, Virginia Weimer, Barbara Wadford, Anne Cohen, Peqqy Kamp. Fronf Row: Linda Longfellow, Barbara Mosley, Sylvia Chambers, Sharon Jarobs. Sharon Wheeler, Pe-qi Slavish. Frequent Use Of Library Books MARSHALL 2B Division Top Row: Elwyn Lewis, Marlin Friedman, Leroy Cash, Ralph Lickion, Mrs, Bealrice Marshall, Fron+ Row: Earline Hughes, Marcia Preer, Myra Mayer, Susan Delano, Pxnnelie McFadden, OLIVE 2B Division Top Row: Thomas Towles, Sidney Jones, Barbara Hayes, Grace Crawley, Marvin Wells, Dwighf Berlha, Mr. William Oliye.Fron1 Row:Shirley Crm kell, Pai l-laugh, Karen Harrie, Lennie Redmond, Belly Anderson, Diane Neshida, Helen Nishio. Q - , irmilsimwamwuwm- 1 AF' AL? 1 kng.z M. OLMSTED 2B Division Top Row: Sleplicn Rilz, Slanley Hayes. Preslon Bowie, John Clialrnan, Alan Block, David Jacobson, Mir liael Marlin, Miss Cordelia Olmsled. Fronl Row: Willie Anderson, Marllia Napier, Miclwele Bern- slein, Rosalyn Perry, Sandra Bozeman, Tlieda Pear- son, Nanry lsroal. Red Leller Day Course bool: days always causes a mixliire ol anlicipalion and anxiely among sludenls al Hyde Park. Nellie Anlhony crosses lwer lingers as slwe peeps over Miss Tanenbaum's shoulder lo gel a glimpse ol her mark. Luck won'l raise lier rnarlr. Five weeks ol beller worlc ano liarder sliidyinq will be rewarded willi a coveled Sigma average. Improves Sophomore Course Books PARRY 2B Division Top Row: Elinor Powell, Eva Taylor. Henry Gleos, Kennelln Lnclrlwarl, Mrs. Kallnerine Parry. Fronl Row: Dorinda Sidney, Sliirlny Walker, Lillian Brillon, Sandra Bowdry, Marlene Gilmore, Helen Lee. SLOAN 2B Division Top Row: Micliael Blackwell, Gilberl Harrell, Rolnerl Dase, Ivory Jones, Palricia Lalimore,Josepl1 Dawson, Tlnornas Swope, Mr. Howard Sloan. Fronl Row: Joyce Carler, Pauline Lyons, Belly Marlin, Eileen Clwesurn, Palricia Calloway, Belly Blaclc- mon, Diane Raines. l - , in-uswm,ssi.ssi.. f 1 lIQl i 'I Geomeiry Made Easy Judy Margolis demonsfraies a praciical meihod of finding lhe surface area of a iruncaied cone lo Booker Morris, Judy Gendel and Jacqueline Slephens, with models made of wood, TANENBAUM 2B Division Top Row: Roberi Cuirighf, Arihur Sfreei- er, Roberi Morrow, Miss Goldie Tanem- baum. Froni' Row: Cheri Allen, Gerald Adams, Jimmie Shelfon, Leonard Mc- Pherson, Berlha Ward. The Tools Of Experience ANDERSON 2A Division Top Row: Raymond Jackson, Sarah Collins, Fred Piilman, Jack Tepliiz, Thomas Weizel, Warren Sloan, Mrs. Eleanore Anderson. Fronf Row: Florence Davis, Muriel Jefferson, Pau- line Williams, Marilyn Pino, lris Beller Nydia Raihan, Judy Goldsiein. DUGGAN 2A Division Top Row: Ellis Benneif, Ashlon I-larris, Jerome Moseley, Johnnie Sanders, Mr. Maurice Duggan, Froni' Row: Bar- bara l-larrell, Marlha 0'Kennard, Ar- lene Jaclcson, Virginia Lanier, Ernes- iino Sauls, Jean Rosser. I 1 , I 3 Q'?i2is 'Q' X.. ,QA i I is M MA iS? FIERRO 2A Division Top Row: Lanier Jiirineaclc, Harley Marlin, Eugene Sciirry, Wayne Kelly, Johnny Nance, RoberlWhi1iield, Miss Romana Fierro. Second Row: Barbara Tiirner, Siisie Hiilfner, Helen Henderson, Sally Snhapiro, Tobbe Dee. Fronf Row: Sandra Goree, Barbara Kiirlz, Naomi Erenberg, Bobbie Garner, Sylvia Mill-1, Panla Holisladl. The Finishing Touches Wifh a feeling of success, John Levy and Tonn Jones prepare fo add lhe Tinal touches lo Chrislmas presenls for lheir parenls, The know how will be valuable io bofh oi lhern when They go exploring in This big wide world. Produce The Finished Product FITZPATRICK 2A Division Top Row: Joyce Campbell, Roberl Green, Marvin Jefferson, lrwin Jafobs, Edward Benson, Theodore Taylor, Herberi Gerdy, Chrislopher Gaddy, Qiiong Lee, Leslie Rearns, Percy Taylor, Miss Alice Fifzppalrirlr. Second Row: Leona Reese, Ear- niie Hopson, Mary Simons, Carol Shiraiwa, Willamae Poinler, Virloria Phelps, Virginia Sroll, Annie Bolds. Fron+ Row: Toby Hayman, Rosie Scoir, Beverly Mallhews, Mamie Harris, Olivia Anderson, Elissa Blifsiein, MeiYYing Moy, Penny Fisher. Qs' ,pl . 'ERE HURST 2A Division Top Row: Bernie Price, Howard Levinson, George Hiiii, Slanley Perlrnuller, Geral- dine Bowers, Mr. Leonard Hursl. Second Row: Joycelyn Candili, Nellie Anfhony, Marlha Jenkins, Theresa Jones, Bonnie While. Fronl' Row: Brenda Graham, Rosine Taylor, Palricia Balmer, Ezella Boolh, Loreiia Isaac, Anna Chesler. I abr jr fl Chow Time Heipiui Ai decides Marfha O'Kennard wanfs slaw. Deisa Cooper, Fay Bergsironn. Clar- ence Parham and Donaid Gold- man 'rhink rneaf ioai is good. JACQUES ZA Division Top Row: Ansiin Moore, Bessie Cameron, Miiion Dauqherfy, Sandra Sykes, Cari Reed, Susan Jarnev, Jarnes Wiison, Mrs. Sheiia Jacques. Fronf Row: Jean Dawkins, Sarah Virqii, Caroiyn Sianiord, Vera Piifs, Biiiie Carr, Meiiiyn Price, Joan Aioxander. Relaxafion And Service KAMINS 2A Division Top Row: Aivin Spearman, Michaei Lxirie, Car- ios Guadaiupe, Frank Kahn, Anna Reid, Deiores Thompson, Beriha Long. Mrs. Moily Karnins. Froni Row: Annie Poinier, Carol Boyd, Carol Grizzard, Harriei Gourdine, Annie Harris, Joan Brown, Judiih Biack. KMETTY 2A Division Top Row: Arnoid Giai,-i, Lewis Enqei, Jerry Crown, Jan Reiirnan, Fronf Row: Eiia Harris, Warren Wiiiman, Ciarerice Parham, Ernesf Johnson, Don Gcwidman, Siephanie Griffin. ii' !!4 wi 'F fa issuer No Sour Notes When the Saints Come Marching ini' is not ditticrilt when Jerry Crown piays the cornet. Deiighted audiences await his performance in the semi- anniiai Pop Concert given by the band and orchestra at Hyde Parif. MAURER 2A Division Top Row: Cari Boatner, Eddie t-toward, Arthiir Hubbard, Wiibert Gitiispie, Richard Cotton, Marc Pois, Mrs. Adah Maurer. Second Row: Maxine Gowdy, Patricia Rochelie, Kathy Chartton, Eart Lemon, Aivarez Pidgeon. Front Row: 'ieitricda Goodioe, Janeit Morgan, t-teten Martin, Teiko iiichi Aiean Wiiii.s, Dorothy Stough- ter, Patricia Pettiis. A Few Extra Activities RHODES ZA Division Top Row: Herman Wiiiiamson, Gartand West, Mau- rice Abernathy, Alan Yanaii, John Martin, James Crawtord, Earnestine Crockett, Mr. Charies Rhodes. Second Row: Margaret Maytieid, Ariene Abrams, Misha I-tiii, Lesley Barnbaiim, Yoianda Schneemann, Dora Mitcheii, Sandra Buchanan. Front Row: Frane fine Ciark, Wilietta Mitcheli, Nettie Lockhart, Mary Mason, Barbara Barnes. Jeariine Sargent, Ruth Davis. RUUKY 2A Division Top Row: Edward Sittier, Ariand Qngman, Thomas Smith, Herman Dixon, Myra Siimraii, Diane Robin- son, Larry Lindauer, Thomas iotbert. Miss Anita Rritzicy. Second Row: Diane Ciontier, Hetyne Brody, Amanda Jackson. Joyce Morris, Aiberta Chapman, Charies Brazetton, Dywinna Frazier. Front Row: Shirley Dolce, Eva Canady, Peggy Gibbons, Conf stance Morris, Pat Bergstrom, Rath Phiitips, Cath' erine Cherry. 'W1L'Q'l , faoiigli in Q Q si . T' 'N . xa-zzz.. - f-:I -S x N5 7 A . xx ix ' Q. W v , ,ww X iw X X X f I T S :Mx w f f . X RF' ' . , H w - W 'M I -114 51 mx- Lf in-iigva: ,N Q 3 X. A , ..,,, X Y il . ff: Q R -- x ,. 5 ff - 'ix S5 5 R . ' ix f i t .- iw 5 .fix :if 2- :X 12-C-T' f X . Xgksigv .:. T- f, ' ' 1 X X . s , -. ti -x . . .4::':zI-.f- Q' ' X .K QE: Kgs? H M. . X 5 is Q 1 u :uni un. Q5 . Wwxxwfx A X, y A Sr xxx- X - xx 5- asm Junior Class Officers HUNTER 3B Division mea f Presidenl Arnold Kanler, Secrelary Ned Block, and Commissioner Barbara Simon meel loqelher lo plan a program lor lhe year. Hyde Park loyally and good sporlsman- ship will loe lhe lopic lor disciission al lhe nexl meelinq ol lhe Junior Class. Top Row: Bolo McCaiil, Anlhony Grillin, Roberl Todd, Frederick Reed, Bruce Joseph, Richard Moore, Mrs. Elizabelh Hiinler. Second Row: Michael Schwarlz, John Cody, Robe-rl Harris, La- Verne Dolson, Brenda Williams, Barbara Jackson. Fronl Row: Doris Moore, Doris Ciimberlander, Judy Harris, Renee hlinlon, Juidy Qendel Joann Fiiiimolo. Now We Are Upperclassmen PETRl E 3B Division Top Row: Theodore Alexander, David Neiyell, Sylvesler Moore, Aldiria McJimpson, Jo Walker, Delores Jordan, Charles Franklin, Mrs. Flela Pelrie. Second Row: Belly Williams, Janice Ewing, Janel Schwarlz, Belly Jones, Marla Johnson, Bernice Applelon, Grace l-lollins. Fronl Row: Vickie Wind- sor, Phyllis Howard, Palricia Jackson, Myrlis Brown, Deborah Podore, Sandra Johnson, Rose Pellis. SCHULTZ 3B Division Top Row: Shannon Wesl, Rirhard Granl, Mr. Henry Siihullz. Fronl Row: Peler Piiiisepp, Ida Bradley, lnez Gorin, Joan Hill, Carol Gross. eu f N 4 is ' f QQ 0 Sf' X 1 Ai. Q U Q X Q W x Ni Q xv K- M W X ...: - . - QQ X x SX- X 'A QQ A Q J M X S? 'N Aix 'M w X A H QM- Q , H A Za N gk . QW . i AX K igjl xfi ' W NA .4 X - kg XXV x. A as K NN-gf' jx f 4'55Q4. -' -N' A . - E x . W a xg If Q Li 42. A I r , 'QQ 90 'MQ' 4 ini .sk , I t X 4 1 sw X . - X A N , Q V N W , N W W .Q K V K A .. 1 4, . is S Ut Q: N as Q , M ff ' L ' ' X 'A . .-.F w X- if x ', gs Q:-' Sf as .. - ' Q Q se i 1 x- .s x. v x s x ' 0 S 8 Q , X Q g if wgsijw , M R ,I 3 N, L- A A . I ' ws. .. , X r'x 0 ' 1 fi, ' .-yqj .- . . K.,,Q-' Quvsf Q... , .f Qin V4.5 Y .2 .-........ SN' . gp gif 9 1 xy' Vs: 'z ., K .- ii' 'L , X3 5 1n,,,49g, ENN XS S K gg-ai We Wanl- a Touchdown! e Park will win, spurs our iooiball leam on io a vic- fory againsl Souih Shore when led by such enlhusiaslic cheer leaders as Barbara Sievenson and Janice Kanemoio. BRENNWASSER 3A Division Top Row: Jay Kahn, Louis Nelson, Ed Blum, Norman Bash, Elizabeth Pilcher, Jenny Dillrnann, Judy l-leim, Charlene Packer, Miss Miriam Brennwasser. Second Row: Waller Rappepori, Ned Block, Riihard lani, Evan Marlin, Ronald Weilz, Aaron Liichez, Fronl Row: Janel Kobrin, Gail Greenberg, Andria lfiqer, Sandra Turner, Charlene Sims, Sandra McClure, Jane Rosenberg. Well Chosen Words CULLINAN 3A Division Top Row: Roger Wendiord, Marlc Rosenihal, Wil, lie Kelly, Edward lelamplon, Michael Goldsmilh, Roberl Becker, William Wallcer, James Miichell, Ron l-lamu, Mrs. Frances Cullinan. Second Row: Marilyn Warren, Sirrena Fosier, Esielle Bonds, Judy Vaulx, Marilyn Zax, Milci Sams, lola Poinler. Fronl Row: Thelma Morgan, Vera Milsap, Gloria l-larringfon, Lorraine Terry, Jacqueline Dozier, Mary Merediih, Johnnie l-lallrnan, DUBYK 3A Division Top Row: Jeffery Thaxlon, David Rainey, Joseph McWilliams, Granville Ware, Eddie Jones, Willie Jones, Sieve lsenberq, Barbara l-laehnlein, Mrs. Mildred Dubyk. Second Row: Evelyn Mainzer, Elaine Weil, Bobbie Lay, Alberl Sullivan, Peler Golsis, Norman Piuovilz, George Jones. Fronf Row: Mary Mack, Sherry l-lunies, Mazell Curlis, Beverly Croclceli, Mary l-larris, Janice Leonard, Rose Woodard. 'QF M Qs x X . , M . X 8 .xfiigiggb gig si X . , ,. S X ' Sw 411 . iw 5 K x X -X gf .sf . ' ' N Q, A A vb X X k 1. , ' 5 swim . WSQM . 3, , , P -:.. + 'A' K' 1 aff,-.....,.::-1 .... . . M., x, L gn- . .. . .1 - ' 1- AS 1' f f -x..,. .: ' ':: ' f m i l .. QSM S Y x . N Q x K X 1 XX Nw . Q . 5 5 - 'Elf , 65 , E ff , fs 2 8 Y x 1 X 4 v G .x X . a g 31.55 XM- f x K H ' f 1 1 'P 1 ' v .f Q ... ..-my :W 5' 5 EM S? X - X' 'B -, M N335 gg at xisgibike .gfff 7 4, . , M... M .. sd ,ii-M311 ,.:,:4 ff' Q.. 'jf' Q W Q EX gag 15 :S K Q53 ix ix y X .... wx: K, 1 f W y 5 . X . K i affix fbi? Q S? K X Q ' .. iw' S LECHTENBERG 3A Division Some day ail iuniors become Top Row: Rudy Jrines, Roger Darby, Dnnnis Di: ker imporianr seniors .Edward son, Harry Keiler, Briire Gipwn, David Marmli, Toni Wisfful Con'fempla+ion Hampion and Ann Reiwiicii rnie Snoiion, Warren Evang, Second Row: Tiifwrna-, dream oi ina? rriomenroiis oc- Turner, Gienn Yarnarnoirv, Eiizabein Carier, An- casion when 'riwey wiii nave The dreiia Brazeiion, Mary Garreii, Froni Row: Tereua deiiqniiul problem of seierfr- Biirices, Caroiyn Sircinq Lynne Tiwrnaw, Giidriin Mc' inq ineir own picfures. Coy, Georgia McC.ie, irene Yamaya. Dreams Become Reality MEDFORD 3A Division O'SHEA 3A Division Top Row: Larry Haye, Howard Pearrnan Lois Top Row: Wacvdrow Yriiinq, Siiiarr Curry, Vera Edrneraon, Lazroiis Waikins, Rob- Dnrnbrnsicy, Roriaid Johnson, Bessie err Payne, Alian Srniiii, Mr. Warren Medford. Jones, Miss Fiorenre O'Slwoa. Fronf Fronf Row: Pxniia Presiey, Joan Donner, Row: Erneaiine Ficmyd, Wfindfi ivoy, Francine Aiion, Donna Davis, Wendyf Wiii, Sandra Davis, Barbara Howard, VVyn' Joan Greenwaid. Paiiierie Barnum. eiia fv1iiier,Gaii lfrik, any g X gy lffff' Q if W' if mmm .LQ 'Q A - 3 N. . N A A ps 3' W' ' N Q ' SQXQN M. Q S Q K . . ,. E Q.-.K , .z V19 ......: Mn' .TM s:.., . ,. D N QS aww g,M is Q . i ,N S yhe 'Q S K? ...M awk ,M- K x x 45' .F N Q im xxxq, .f W giant ix 1, K 1 .Q , jj,p-it ,1- eu, ii 4 2 lvl niuleiions 'lo ou+s+ancling sludenls, Raye Linda Farr and n Coleman. are exfended by Principal William Waffers. 49M.9W,W, AWN ga-vw-A-R' 01 17 IPS. ,FLW l ,QAM JUNE GRADUATES if f X X ffl' ICHARD WEXLER CONNIE MITCHELL RAYE LINDA FARR LARRY MEYER KAAREN COOPER Presidenf Vice-President Secrefary Treasurer Commissioner 3,4 U Senior: DlANE ADAMS Hydcwarknr Amxnl: G.A.A. CLYDE ANDREWS Corlcerl Dorlcfv 81 R.O.T.C, Bumls: ln-llvvrvmrv ln Fall ball 81 Trafk. THEAUTRY APPLETON . . . Pal' Claus Assl.: Hull Guarnl. SARAH ARMSTRONG G.A.A. ROBERT ARNOLD . . . Bob Slqma: Jr. Mallv Honor: Crwnllvr' Wfllmi Club: Cc servallon Club' Afllusfrmvnl Oll. Alfl: Clnss A-ml.: Lf-lln 'wan ln Swlrr, PL Tmclc. FRANCES ASHER , . . Hopoie Slqwm Pres. X1 SQL.: Tulor: Z Clvlc Awnrllf.: lA Cli Comm.: Sr: lvlnllw Honor: Sr. Xl Jr. A'C.mppvll.1: Hyfl Darker Block Cngvl.: Crcallvv Wrlllrwcz Clulu Pm Senfor Sponsor: Aflluslrrvcrnl Sr Pmqmm Oll. Aaal.: H. Guam. BETTY BAGSBY , . . Bools G.A.A.: Gym Assl.j Hull Gunrl. LUERAIN BAKER . . . Rainv Glrls' Clvoruij C A.A.: Moclffrn Dann' Clulvj Hull Crum NADINE BAKER . . . Belly Swdcnl Councll: Hydrvpurlrr-r Rvporlrrr X1 Alwnl: Lu Assl.: G.A.A.: Modern Dunne Clulv: Rlllr' Tculm: H. Guard. EUNICE BALDWIN . . . Dede Corlccrl Orclwcslra: Slrlnq Fnwmlvlf-Q Cf.A.A,: Gym Ana: Hall Gubrd. CHARLES BARNES . . . Roclr Varsllv Eoollmllj Hull Guurfl. ALBERT BATES . . . Nlclr Clwrrv Honor: Sr, A'Cnpp1'llu Quurlvl: Boya' Clworu Hall Guarfl. HARLENE BEALE . . . Didi Hydeparlcrfr Aqonl: G.A.A.: Pep Club: llqll Cluxml, JUDIETH BECKHAM . . . Plxie Gfrls' Chorus: Allnnflnmrr Oll. Alslj Cluue, Assl.: l9.A.A Pep Club: Hall Guixrrl. BRENT BENSON Sr. Mallv Honor: Class Assl.: Swlm Tr-nm: Hull Clunrr SANDRA BESLEY Slqmu: Clvlrw Honor: Sluflc-rvl Coumll: Annual Aqvn Hyderuarlrer AGCM B1 Block Cnpl.: Conwwullon Clul Hklory Club: Lbrary Alrl: Claw Assl.: Rml Crms Rf-p G.A.A. Pres.: SOO Club: Lcvllcrqlrl: Rlllc- Clulu: ll-3 Gunrrl. JOAN VIVIAN BLAKE . . . Small Fry Clvlc Award: Hlslory Club: lE.T.A.: Glrlxl Guwrus: Cflm ASSY: Lmvlvrsj Modern Dnrwr' fluls: Rlllv Clullg ll.: Guard. EUGENE BOSTON . . . Gene V3olball: Hall Guard. DAVID BOYD . . . Casanova Sr. 81 Jr. A'Coppella: Boys' Cllorus: Sr. X1 Jr. Tr.1c.lr. BILLIE RUTH BRANSFORD . . .William Sludcnl Councll: Spunlslw Club: Oll. Assl. Aifcllpe edlfcrs, Juan Hammer-,lcey and Renee Rollm prepare llve dummy lor llwe '59 yonrlwwln wlllw fare and precision. ad Organizations TRY BROOKSHlRE . . .Jo cparkvr Aqnnl: Mafron's Aicl: Losl 8: Found: G,A.A.: loin Danna Club: llall Quaid. LEN BROWN . . . Gracie s' Chorus: Malmn's Aid: Moda-rn Dance Club: Pop lv: llall Uuaril, S BROWN . . . ldv lun! Coumili Elvclion Cmvuuission Svc.: l-lisloiy nj Class Asst.: L3,A.A.: All, 31 Dol.: Loaders. IRLEY BROWN rnilarirv Oli, Aiil: C,Q,A.A.: Swim Lvallvr. XNETTE BRUCE. . . Jan ls' Cl'orus: Sc-nior Sponsor: Cu-ni-val Oli, Aid: Al- lamri- Oll, Assl,: Grailv Ailvisi-is' Aid: Class Asst: MA.: Pop Club: Hall Cwuaiil. 'AN BUDYK . . . Joanie ua Vvvp: Tulor: Z Civic: Awarils: Quill 81 Scroll: Malli Honor: Enqlisli Honor: llyilvparlwr Paqz- lfdilor: lr-nl Counuil: Hnslory Club Pros.: Fmmli Club Vofrrvg wall' Club Sim.: Consvrvalion Club: Crvalivv Wrilinq: uslluvnl Oll. Aiil: C1.A,A.: Rillv Club Pres. JRIS BURCHETT rua: l'.l.A.: Class Assl.: C-.A.A.: llall Cuavxl. DlTl'l BURNS . . . .lucly ll Liuirl - i . JNNA BURRELL . . . Red iss Ae.sl.2 L3.A.A. Di-l, ARTA BUTTENWIESFR misli Honor: Conccrl Banil: C,A.A,: Hall Guaizl. lFUS CALHOUN , . . Cal rlliall: Baslwlliall Xi Tiail: Tvams: llall Ouaiil, ENRY CALLOWAY . . . Bones ll Uuaiil. ELOIS CANTLOW . . . Lois 'ls' Clvorus: Class Assl.: Cyyrvi Oll. Aiil. JDREY CAPPY. . .Audie ilvpallwv Aqvvil: Allvlulanfnt Oil, Aicl: O.A.A.: Hall aiil. lEODORE CENTURY . . . Ted Maili Honor: Sr. 3. Jr. A'Camwlla: Boys' Chorus: 'Llronins Clulw: Lilriaiy Ainl: Audio Visual: Lala. Assl. DNI CHERBO . . . Joni plum-'s Dauqlilvis: 500 Club: lO0O Pl. Award: Hall ima: Annual Auvul: lrrvnrli Club: All:-mlancv Oil. Aid: liuslmonl Oil. Aiil: Pioqram Oll. Assl.: Losl Xi Found: A.A, Boaiil X Dial.: Clwvr Loader Capt: Pop Club: lard. ORMA CHRISTMAS. . .Chris inual Aslvnl: Gills' Cliorus: Claws Assl.: G.A.A.: llall iaril. ,IS ANN CLARK . . . Toolsie qlislx llonor: Consi-rvalion Club: Library Aicl: Class sl.: C.A,A.: Pop Club. AROL M. CLAY . . . Bunch ,ulvnl Council: l-lyilvparkr-r Aqvnll Spanish Club: Con- rl Oulu-slia: Sliiuq Elisumlwlo: Class Assi.: G.A.A. 'l, B- All.: Moilcrn Dancf' Club: Hall Guard. JCIUS CLAY ass Assl.: Track: llall iluaiil. gma officers, Jan Rmorillial, Hoppy !AX3l7t'l', and .imnuv Komcr, :lc-au up allvr a party. B was 4 fbi- A RK A R V4 'er' 1? arf 'Q.w..,,,X i ,is 'DGP' arm--1 E2-v an-of 8-EW ,Qui Hilmar Practice ISAIAH CLAYTON . . . Junior Hall Guard. ALAN COHEN Hall Guard. FRANKLIN COLEMAN . . . Liberace Slqma: 3A Class Comm.: Clvlc Award: Sludrrnl Couru Allclwoe Bus. Mar.: Conservallon Club: F.T.A.: Sr. X1 A'Caopclla Accompanlsl: Boys' Cllorus: Acljusrrru-nl C Aid: Senlor Sponsor: Lab. Assl.: R.O.T.C.: Hall Guan ANDREW COLLINS . . . Cool Baseball: Track 81 Voolball Teams. KAAREN COOPER . . . Miclzey Slqma: 4A Class Comm.: Sludonl Courwll: Sr. 81 . A'Cappolla: Glrls' Chorus: Aflonclarvcrr Oll. Aul: Gr eral Oll. Assl.: Class Assl.Q G.A.A. Dnl. X1 All.: Lvadf- BETTY JEAN COTTON . . . Lillle BH Syrnplwonv Orclwc-slra: Llbrary Alrl: G.A.A.: Lcvmlvrs: Pr Club: Modern Dance Club: llall Guard. CAROL CURREY Glrls' Cvorusj G.A.A. Board: Cvym Oll. Azul.: H. Guard. SAM DANIEL Sr. Maflw Honor: Cllcm Honor: Cons:-rvalron Club: Elr- rronics Club: Sr, Orclweslra. PAMELA GREY DARBY . . . Migl-My Mouse S7qma: 4B Class Pres.: Oulll X1 Scroll: Sr, 81 Jr. Ma Honor: Sludsnf Council Vcep: Hydcparlcr-r Pano Erlilc Conservallon Club: Crcallvc Wrlllncu Club: Confbrl Dance Bands: Lab. Assl.: G.A.A. ANNA DAVIS Hydeparkcr Aqenl: Spanlslw Club: Class Assl.j CLA., Dnl.: Hall Guard. SCOTTIE JEAN DAVIS G.A.A. Del.: Poo Club. VERA DAVIS Conccrl Band: Class Asslhj G.A.A.: Monlvrrw Danvc Clul GEORGE DAY R.O.T.C. AVERY E. DEE . . . Buzz Jr. Malh Honor: Sludcnf Councll: Hyflvgrarlwr Aman Elcclronlcs Club Vcvpq Concs-rf 81 R.O.T.C. Banrlsg Lal Assl.: Fire Guard: Rlllc Toam. ROSALYN E. DELANEY . . . Roz Glrls' Clrorus: G.A.A. CAROL DU BOIS Slqma: Annual Aqonll Enqllslw Honor: Srvarvlslr Clul Adluslrnenl Oli. Ald: Class Assl.: G.A.A.: Rllrr' Clul Hall Guard. BENNETT DUDLEY Luncr- Room Guard. GALE DUFFELL . . . Pele Concerl S- Dance Bands: Symphony Ornlvvslm: Class Assl Rllle Club. THERESA EAZELLE . . . Terry Chem Honor: Allcndancc Oll. Ald: Malron's Alclg Clos Assl.: l-lall Guard. Cl-IRISTEL EBEL . . . Chris G.A.A, Tlclrling flue lvorles, Gerry Rlzvor llvrills an unscor audlence. 1sures Success RIS EDWARDS . . . Teenie -mI.imv OII. AMIQ Lilwmry Aidj Chas AssI.Q G.A.A.j IDIIAIX. NEVA EDWARDS . . . Janny .5 AnsI,j k3,A,A.j lfxnIwu1 H.iII Gunvxi. CE EPHRIAM . . . Chicken lun? Cimimilg M.iImn's Aidg C,f.A.A.g HMI Gunrxi. XNCES ERMAN . . . Fran mg Quill Xi Sim!Ig Indo: CfImirm.1nj 2 Civic Awnrdsg X1 Ji. M.iIIi Ilwmxvl AIIIIIIIII SInIIj Hysivxmrlwr AQNII1 iIi Cilulvg Sn-nim Spnnsorg Lv:-vwml Xi Box Off. Assfg imm OH, Auig flaw AasI.g iif.A.A.j Hall Guard, .ORIS EVANS . . . Del IiNIv Ihrlicuvg L7.A.A.j II.iII CYu.iv.I. QDRA EVANS . . . Sandy img VIII-vii Ihmnvg Liiivls' CIvwiisj Pvuqniw O , Asf.I,g ,ivy AMI: loxI Zi Fmnndi CI.w, Axsfg Cff.A,A.g PPV I YNA FAERMARK img AIIvlnI.iriv OII. AMI: Pmczvavvi 8. Qfv.i.Iv A.Iv.wrs .Q k3.A.A.2 II.iII Lfimni, YE LINDA FARR . . . Raye vii: 'IA CFI.xxs Sm.g Junior, Sopivomow 81 Freshrrgn I5 I'vvs.g Civm Awmdj I',T.A. Adviaory CounciIq Sr. Iv Ihmuv Tu-.1-,.g Jr, MAIN Honor PIM. 81 Tvvasq Ein, Ihwrim Sm. X V1-vpg Sfuiiunf Council Truss.: Hyde-f wi SI.i'Ig Aumi.iI Am-nIg A'C.ipiwII,ig Sr. Ov-CIwsIr.ij num CIIIIX Svc. X1 Iv'r'.is.j Aniilmfrm-nI OW, Aiiig G.A.A. .RLISE FERGUSON . . . Lisle iw Sgvmixorj Cham A:,sI.g lf.A.A. IRRY FISHER M.aII' IIunm1 Sp.1nixIi Ihvnmg P,T.A. A-Ivisorv Com Ihxiury Cfliilvj II.nIl Clu.irII. .ROL FORMAN . . . Corky img Civil Awnrdj IIyIIeXp.ivIwr Biuvk CAM, X1 Aqvnfj im Svmwovj Sp,wixIi CIuIwg Avhiminmv OU. ARI: wuii O . AMLQ lihiss AaxI.j kf,A.A.1 IIJII Uu.ifiI. NELLA FOSTER . . .Jan IvnI LFoumiIj Aririu.iI Am-UIQ C3.A.A.j Gym OW. Axshj if:-vs. JRA6 FOSTER MMIII, B.isIu'IIuiII B1 Base-Iu.iII Imimxj IIAII ifimmi. XXINE FRANKLIN Ag lfoi1wvv.iIiwri CIuIu. RBARA FREEMOND . . . Barb lvmj Quiii X Scvulfj Tuhuv CImiv'vimHj 3 Civii AwnvpI5j Awnviig Ariliiml SIJII X. Aqvnfg Simniah Ciubg Senior -rw-,mf AIIulnIi1mv OII, Aidg PIOIIIJIII OII. AssI.j CISISS wig f:',f'X.fX. D.-I. 81 AII. 500 CINDY RIIIO CILII3. .CHEL FRIEDLAND vim: LF xii Award: Sv. X .Ir A'C.iLiiwII.iQ Fv'DnfIi Ciubg ws--rv.iIimi CIUIXQ Bm OII. Aidg CI.1ss Asxfq Q3.A.A,, II Liwinui. NICE GARLINGTON NA. DBERT GARMISA . . , Bobbv rvmj B.in.Ij L-uII I1-.wij II.1Il ifunvxi, INNIE GARTNER . . . Bonbon limp IuIuv1 Civii AWAIIIQ AvwmmI Aqenfj Sr. S1 Jr. '.ip-in-II.xj Sinivvidv f'IIiIwg AIII-mimimf OII, A'.Ig Llvm-val . AMI: Chiu ASM.: L7.A.A.q IIAII Gimrd. AN ALICE GILLIAM , . . Book I:.' Ciimrnsg Pmqmm OII. AMI: AIIvmI.imv OW, Aidg Iv. AMI: Rumi Q-mv. Rr-LI. I1IeIic Irophies won by Cwmmd Wiwr'viiII .md Iwi: inmmhu. ure prizvd by Hyde Pink. Voting Is I MARJORIE GINSBUR6 . , . Marge Hyclonarlmr Block Caryl.: Spanish Club: Senior Spons Son OU. Asslg C.A.A.j R'lIc- Clulig Hall Qfuarll. SHEILA G-OLDBERG . . . Bubbles Junior Class Soc.: Sophornorr' Class Vf-ep: Sluilfwnl Co :fl Troas.: Sr. A'CappftlIa Bus. Mqr., Jr. A'Cappv Fic-nga Club: Class Assl.: C-.A.A.: Hall Guard. SHEILA GOLDMAN Sillma: Quill Xi Scroll: 2 Civic Awairls: 4B Class Vm QA Class Vccpj IA Class Comm.: Ari Award: Sluili Council: Annual Slall: Hydcparlmr Aqonl: Jr. AIC. polla: Crvafivrf Wrilincq: Snanisli Clulv: Corisrrval Club: Goricrol Oll, Aid: AH:-mlanfr' Oll. Aiil: Proqr Oli. Assl.: G.A.A. Dol.: Hall Guaril. LAWSON GOODWILL Enfilisli Honor. BARBARA GORETZKI . . . Bobbie Elofliori Cornrnission: Losf IL Founil: C3.A.A,g Hall Gun MARY A. GRANT . . . Shorly G.A.A, HERBERT GRAY . . . Chews Fooloall 81 Track Teams: Hall Cuarrl. JACQUELINE GREENE . . , Jaclcie ',3.A.A,j Lcallfais: Ilall Cuaril. STEVEN GREENE . . . Sieve Siorrm: 2 Civic Awards: Quill X Srrollj Tulor: HW Worker Paqv E'IiIor: Corisfarvalion Club Pros.: Frvri Club: Audlo Visual: Bookiooiii: Fifi' liuaril: R,O,T Honor Guard. RICHARD GREENWALD . . . Dickie S' mag Si. E1 Jr. Malh Honor: Clirwin Honor: Clicss Clu fl Class Assl.Z Basnbail 8 Bowliriq Tvains, LINDA LEE GRIFFIN Tjris' CForusj Class Assl. ROY GROOM Bama: Foolball Toiai. MARIE GUESS . . . Sisler Class Assl.: Clicwr Lciailrr. BARBARA HALL . . . Suueelrie Cirls' Chorus: Proaram Oli. Assl.: G.A,A.: Mollr Dany: Club: Hall Quarcl, JOAN HAMMERSLEY . . . Joanie Soma: 3 Ciifr Awards: 2 Quill Xi Scroll: IA Class Sm Jr, Mallw Horror: Sludcnl' Council: Ailclipo Erlilor-i Cale-': French Club: F.T.A.: Snnior Sponsor: Grnr-ral O Aid: Adiuslrrirril 81 Proqram Oll. Assl.: C3.A,A.: H Guorzl. BETH HANKIN Siqrnag Slufionl Council: Sr. Xi Jr. A'Caprwlla: Spam Clubj Arlen-lanno Off, Aid: Ciallr' Advisors' Aiil: Tre irf:i'i Assl: Class Assln C.A A PERRY HANSBERRY . . . EI Senior lun or Class Pros.: Srianisli Club: Sluilvnl Coumilj Sum Soorisor: Giarlf' Advise-rs' Asslg Class Assl.: Hall Ciuar ANNIE HARDAWAY . . . Ann Sr. 8 Jr. A'Canpf-lla: G.A.A.: Lsfaflr-rs: Gym Oli. Ass Hall Guard. BARBARA HARPER . . . Bobbie llydcparluri' Aqranl: Library Aid: Losl X1 liouiwlg Cla Assl.7 G.A.A.: Lcalvis: Hall Guard. EUGENE HARRISON . . . Gean Arr Award: Alrlapc Ari Eclilor: Sr. 31 Jr. A'CappoI Bus, Mcqr.: Boys' Cliorus: Hall Ouarcl. An official voling machine qivv-. Rulli Aim Slewa valuable oxporieme, as slice volrzs lor Imor :Ia ollicers. nerican Privilege JY HATFIELD um: CTU! Aw.uv.!g !!y!!n-pqvlwr A.wn!g Svrvfor Sxmrvmr mmm OU. Av.!.j L3.A.A.j !l.1!! k7u.1m!. NDA AN HAYASHI dmv! luvwvvvv.-.wwrv B.m!!g K3.A.A.g Hu!! Guard, vmj CIW. Awunlg Jv. Mn!!! !!m1ov'j Annual Anvnfj dh!!! lxmvwrvyg Clul1wv'v.x!!ovv C!!mj Smfur Sromwj wmv Adj f'vm1v.xvvv O!!, Axw!,j U,A.A.j R!'!C C!u!wj wmv'-. IX!!!-1!!!!'v-.Q Lvym OV. Push AN HAYWOOD My mr! 4-!..,!.4. w M- L .A DRVETTA HENDERSON . . .VeHa lu CM!! !!1!!ku1v!4AA AIL HERRMANN mug Cvxflv fXw.uv.!3 A'CR.1p!w!!.xj Svnhwr Spomwg Ad- !vuH!O' A! LAA Dfl !!1!!Qu1v! .RBARA HILL ED H!RSCH umj LW!-L Awqnig f!wm Honor PM-5.1 Sr. MAH' umj Amim V-.xml Pu'-.. X V+-wp: lub. Abshg Tvnuk an !CK HITOMI 'UA HOLLOWAY KA., My KMA, lf.n!wv ,g Mod:-vru D.m.v C!u!wg Cvym '. Ami. .WRENCE HOLLOWAY . . . Larry um: Auvmxu! Ain-vw! Amim V!-.u.1! !v:'.wu. X Vvvv RELDINE HOLMES ...Jim .M-L'.vr!wv B!!-.K Clwyd. X Am-ntj E!m!mu!.i f!u!vg wvx FMJQ M.u!vwu'-. AM: A!h'rn!.lmc- OH. Amh' l'!.1xx .!.g KLAA. Dwi. 24. Ai!.g Ha!! Lwmvwi. ROME HOPKINS .EDERICK HOPSON . . . Hop M:-vw! QRmm!!' !mwt!v!!g Bmkl-!!w.x!!j B.xwlm!!j HJ!! .HAL I ICHAEL HOVEY . . . Mike vm fhnw. DRINNE ELIZABETH HOWARD Be-H . . . Y .Mun Lfmvurv!!ss.!mnj UM!! C!voruxj Svnlor Spomov: LOST !mm!!j M.v!mrv'4. Ahh lF.A.A.g V!-zu Club: HA!! Gunni. ARY R. HUGHES . fX.A.g !!.1!! lmavd. . . Sunshine JTH HUGHES . . . Sweefie wiv!!! KXmmf!- 91 X Jf, A'C'.Hv1w!!.1' CE!.1sx Awfj NA. Dm! X. AH.: Pwp C'!u!xg kfvm 0!1. Asskj Hn!! .wil ILLIE HURSTON . Alun!! Twmv, JRETTA HUSBAND !C Qk!v.m1-.3 L'.A.A, B !! L-!n.vw!. lmpaign Day In 4-x . . Moon . . . Lorry onvdj Mu!!!-yn Damn' C!u!w Pv'CS.Q cwhmq !ul' Ru!!! !-!L,L1!!f'N .md xr!!-!!v 5w!ww w!wnvn'c'!vefww1'd up!m'!!mmCawwrw. YT UM ,Q .KX QS A'-V' 12 Study TRENE lMADA . . . Fuddydud 48 Clnss Swag TA flux-, Vrwpj Slmlf-lvl Cmlmlll Kwrl Tl Clone Twins. X1 Vlw:-j Cwfmlf' Aflwwm'-,l Aw-J' MA Dmg Pnl Cllry wwf l,,,,4,,,- Clwrhg l,.,,, ,xvk ,3 H bun'-1. CRYSTAL IZUMI . . . Chrys Swwmj l+,1f'r'xrl-'rw A-rfwlj in-,-, A+,-,l,j L',AA D DOO Clhlfj Nf'rl,.uw'K l5.n.1lvlf-wg l'f-yy lllulv ll,1ll mum KAREN JACKSOVN . . . Kay ., W- Awflf- , ml, C W..A, KLA- INN A,lg c , AK-my T.A,A,: Jw-U Vlflwg ll,-l' lr.. li 1, MARSHA JACKSON H 'la fx cxv1,K.. NEILVINIA JACOBS . . . Neil ?xAnlr0r'vk A'-ig I ,A A,j Hall fwmv l. MEDIA JEFFERSON . . . Fi-fi Rfvl CHDW Rfrwj C'.A A. Bmw lj luvl -,Q llwll C vll JANICE FAYETTE JENNINGS A'C,1mf'lI1g K'-1-vrww fTl,lwI l'lwmvl, Awllj flaws Al l 'v.A,A, THOMAS JENNINGS . . . Tommy lwvflrili llwll fvu Vll. BOBBY JOHNSON Leon B.x',kfXlLmllQ Swfmj lunlj ll.xll lswmvll, GlfRAl.DlNE JOHNSON . . . Gerry V-.A.A. Owl.: ll1ll L-nxwl, RITA JOHNSON . . . Rerc Qnsa Avij lF.A.A, BETTY JONES . . . Jean Fsm1,fi,A,A.g nw f-we BONNIE JONES . . . Queen rl, lf':ln'lv ' Afwwlj C lm,-, Awlg X-.A.A. ELEANORE EARLINE JONES . . , Ellie C xv, Amity L'A.A.1 lmw Iluxvll. JOHNNlE JONES Bwsk-'l!xxll. PATSY KEBO . . . Pal f-l1r'.ajCv'1 AvlufxArlwwlurmf-U'.Afl1g lllmx, A 7A,Aj mn 1 .V i. MARTEN KERNIS . . . Mar+y Lrvzllflw Holm' lr' x- ' CM . . Y Wm llmwv- lll, lwrllrlvfr A41 mm, Aw, msn C-Kam. ' SUZANNE KESNER . . . Sue I i,Qf'va Nifwzl 8 Tvuxsg Tulmg CK.. Awnm' lr M1 4 Bl L r l lmwwg 'pm xl nl Cwml lj lll lwplvlr-v U. ,1yll,AH Aflvnlj Sr ,am my Cxllllq Arlwn.i.mw CM, AU: .vm v,'.' rw 1. vu ll. 'lg fw. vu,- vw ,lx l K 1 Ai Ks A Pc1a O Ai All lr MU A Bnuulvncvvv- ff'.wK AKG.: C-.A A Q lvllvv Ulg N :Mm D.w,m1'ff1,. JOSEPHINE KESSLER . . . Jo f,z,'-Hg sl..afw cmmrlq llxl lv.1'lwv al,-f X. Al, U Siwrwmxl O , Asstg Clvvmlv A.lv'-,1vu' Aflj BKml.rm,r Uma Asst.: w,A.A.g Hall Kwuwl, DAISIE KING . . .Cljenlelle C'v.A A.j lmxlf-ml Vw' Clulxg Mr-lun llxufo Clldlw: ll, f 1 1 Bmw . ln his favorile posilion, RR llrwl VV1-M-r fmm l lvls Clvlfx exam. mproves Grades sms Knox . , . Knox I Q X II:'nII.1nfv OII. AI-IQ M.1Imn 9 AIIIQ k1.A.A.j HAII Lvunrd. ETTY GEAN KNOX . . . ForI' Knox 'Cx.1ppvII.xj OI'.fv IIIUCIIIP SNVICDQ M.xIron'S AIIIQ CIASS NM.: kk-.A.A,g Pvp CIuIwg Modwn Dumb CIub. ANIEL KOSMAN . . . Danny num: Sv, MMI: Hwnwrg CII:-nv Hwnovg Jr. MnIIw Honor -I-pj SIurIvuI Counwlj ImmIu CIuIwg Au-IIQ VIsuaI Trc-ns.p uuIImo Ij Lulu. A:.sI.j HAH L9u.nXI. ARRY KOSS v'vnI.xn CxII.I'j II.lII kvu.xvII. HODA KRICHILSKY mmf IYIMIIUI1 CXon1lnIssIonj AII7usIlnvnI OJ. AIIIQ Losr I.uun.Ig CIA-A As5I.j G.A.A. 4ICAH LANE . . . Mike IvIr Aw1vwI' CIII-In Hnnurg Svnfor Svonsorj AIIvn.:.1nrv III. AMI: I'voqv.1nv AI.Ig M.1Ivon's. AIIIQ O.A.A.j RHI:- nxnvg II.1II CUu.1vII. rNITA LAURIA 1.A.A. IIARY LAWRENCE . . . LiIIIe BH WI. Av..nwIg Annual Am-nIg M.mIvon'a AMIQ CIGSS AssI.j 'A.A. EVERLY LEE . . . Donifa IvIIvp.1vIvr Anlvnfg Class ARM.: L7.A.A.1 HJII Cunrd. AICHAEL LEROY Pqnmj InqII4.Iv Ihxnur Va-vp: Annu.1I Aqwnfg IISIQW Chbg mrk Ifxrnxg IIAII C3unuI, LETTY LEVERETTE muvvf OIIIII-xIv.1g C.A.A,j IInII GuarII. IETSY LEVIN Iqnm: UNI. Aw.nIIg Sr. X1 Jr. A'CAppvIIr1y Sp.1n'sn CIubg .IIvmIXxmv OH. AIIIQ Pvoqmln OII. AssI.j Lab. ASSIZQ V INA.: lI.III L3u.n-I, IAROL LEVY I-Irma: UNI.: Aw.1r.If JunIor CIJSQ Cornrnq QA Clnss Smit Iurh-nI L mImIIj FIIIIIIOI1 Culnrni-.sioni IIyIIvp.1rIrf-r SIMM Xnnu.II Am-nI2 Sv, 3: Jr. A'C.nvpvII.1g SvnIor Snonuovg A' vr1.I.xmv OH. AQsI,g CIAQQ AsQI,g C.A.A, Board: SOO 'Iubj II.1II Uu,xrII. 'AUL LIEBERMAN .Iqnmg In-m-v.uI OII. AIIIQ AVI:-r1rI.smv OIL Asxfq Book wmv' II.wII L'u.xv.I. VERRY DEAN LLOYD . . . Tea xI.Is.s ASQ.: IIVIII l3u.luI, -IANNAH LOEB . . . Hifi IvIIvpnvIwr Am-nfj Sr, K Jr. A'CnppPIInj Lfbrsnry AIII' '.A.A,j NvpIuvwW. Dmu1IwIn-mg IIAH Cbunvri. KATIE LOUIS... Kay Xunu.sI III IIyIIvpnvIwl AI1vnIg Clusf. AMI.: C.A.A.: HJII 'u.xv.I4 ELIZABETH LYNCH . . . Ann 'IIIH kfu.wvrI. EMILY LYONS . . . Bam urls. Av.I.g k3.A.A. DvI.g MQQII-rn Dame CIubg HQII wu.nII. NEIL MARBELL . . . Fred 'nqII5Iw IIQnw: CfonCvrI OrcIwsIrng SIrInq Lns0rnbIvg Cnvss f'IuIH' CLIAM. AssI.j IIAII liunni. Concern over Iheir program Iwrinq-3 MeIvIn SmIII1 and SI1vIIa GuIdman I0 II2 fur a InnIer0nve. St' 1-L. 6 'Cf 'lub Experiments CLARA MARSH CIVIQ Award: Sr, kffvls' Chorus: Mahon . AIrIj CIM Asshj i5.A.A.j 500 CIuLug Tmv1I:Iilm Club, MYRA MARTIN . . . Mouse S3qrrmj Srudcrrr COUHCIIQ Svniur Spronwrg Illvvnry ALI CIass Asshg C.A.A,g HAII Guard. MELISSE MASSE . . . Meesie COMM? Band X Orfjrwsfrni Corwsf-vv.1IIun Flulwg L3.A.A. PWC Ciub. WILBON McCLERKIN . . . Mac Dancf B.wn:Ig Srrnrriw CIubj HIsIory CILIIIQ Amifw Vfxuq A115 HAIR GUQVI. KAY SONIA McCLURE . . . Kafie Arf Award: ErrQIIsIv Horworg HVIII-parlff-r Arwnfg EIrv'I'or Corwvfss omg Siu-Ic'rvI Counr.IIg Chas As2I.j f3.A.A. Vwmu IOO0 PT. Award. BEVERLY MCGLAUN . EnqI?srv Honor: Hydvpnrk wk C..1ywI.j Chas A-mr. G,A.A.j HAH Gumlf. CHARLES M-:KINNON . . Bev Pr BI: E ALFONZA MCKINNOR . . . Drip Ewrsron Sfrcwfnvv. BETTY JEAN MESSER . . , B. J. Er1qIrsIw '-Iorwor Trvasg Spaniah CIuInj lrrmlv AIIVISMS' Afdj Afrvrvdnncfx Ori. ARI: C.A.A.g H.xII Crlmrri. LARRY MEYER . . . Lair Sfqrrng CIVIC Awnrdj 4A CInss Tru-ax.: Sr. 81 Jr. MMM Honorg Sr. A'Cnr1pr:IIag Jr. A'CnpgwII.1 Pmr,.g Bow' Crorusg 'Ivn:CparIfr'rg Sfudcfrvf Conncrlg Bam-Ir.xII Mm.: Tfrnrfsg Lcrrcrrrrmrwg Hail Guard. CONNIE MITCHELL. . . Nappy 4A C3355 Vcvnj Smnionr COUHQFII AnnlmI Am-mfg Ulvmrv Amy Cefmfrral Off. Afdj C.A.A.2 Lvmirrsg HMI l?u.urII. GEORGE MITCHELL . . . Mifch GNN-'JI OL. Ali. CHARLOTTE MOORE Dpbarmfl CIub: Gr-n0rnI OI: Arrig C'.A.A.j IIJII Crum I. HERBERT MOORE . . . Moe FQQIIQQII, Track X1 Swim Tf-sms. JEAN BEVERLY MORRIS. . . Bev Glris' Chomsg COVTSPTVOIIOII Clubg f3.A.A.g Mo1Ivrn Dance' Chlbq HJII Lvuarfi, JUNE MORRIS . . . Morrass Sigma: CMC Award: Jr. Mnrh Hfmorg Anmml K1 HyIIrv parker Aqf3rvTp F.T.A. Pmsj Frvrrrb Chnbj Svrwior Sponsor: SCrvernI OW. AIA: AI1QmInrv4v Om AMI: CIAGS AMI.: G.A.A.j Nvprunr-'s D.1uGIv?f'rs. CHARLES MOSLEY . . . Chuck Boukroorrfy HaII Cum-I. MARGUERITE MOTON Elfcrfon Ccrvwrjssromg M.1Ircw'w ALI: lw,I X1 Fournrlj G.A.A.j HAI! Gum-I. DONALD MURRAY . . . Don Hyrisparbfr Aqrnfg Jr. A'Cupp0IIAg Boys' Chorus: OIIIFP Pmdfcrr Svrvfcvg HAH Cxmrni. LILLIE MYLES . . . Lil Elfrcfrorw Commlssfong C3.A.A.g HJII Cju.xrI. Moon madness spmf. Danny KU-.marw Tru wrflr IM, RI'vy'.Iw mporIrnemI'. Test Ideas VIARILYN C. NASH . . . Mar 'B Class S4-ng IA Class Snug C.A.A D QOROTHY NEALY . . . Dol .A.A.g vw Cm.. EDITH NEWMAN llqnmj Sr. Mnllr llunorj Hynlvp. r Aqn I Comm Lund II: Orflu-slr.1g Slrinq Enwrnb Conssrwxllon Cub 'awp XI 'Irv.1:,.1 kHm'rvu.1rl Club: LIIH1 Iflmrll, IUDY HENRIETTA NEWMAN flvll Awarllj AVI Awnrnll Enqllslv Honor Hy lnpar O Rm-nlg SL-nlor Sponsorg Ormlm- Adu rs Assl Proqmm HEI, Alllp Allul1lI.xnfw Oll. Alslj Clues 11 v A nl f.A.A. ELIZABETH NORSWETHER . . Lnzzue ,lm-. AMI.: 4f.A.A.j Ilall Lwmrll. IEAN PASSOVOY . . . Jeanie Qlqnmq luluvg Cllr-nw Hrunmj Jr. M1 1 Honor Annum Mu-nlg Com c-rl Band 81 Orcilwslrw Cons: rx 1 n Club I 1ll L u1l I lookvomvg C3.A.A, AIl,j I. xr JACQUELYN TANYA PERRY I. Slqnmj AIIz'r1ll.1m1- Oll. ASsI.j Rl WALLACE FERRY . . . Wally 'rmlq Il.ull kluarll. ERMA LEE PETTY . . . Punnie 3.A.A.q Moll-'rn Dann- Club. MIKE PINKERT llqrvmj Sv. X1 Jr. M.1Il1 Honor: E mul- Mllrg Class Assl. NAALISSA PINKINS . . .Lou 3.A.A, -IOWARD PIZER . . . Howie .lqnmj Ilylln-p.1rlwr Blmk Cdplq Il1.l.xmm' Oil. Alllg ku-rvvml UH. CHRISTINE POOLE , . . Kris Law Asslg Lf.A.A. EUGENE PORTER. . . Lucky .mln AsxI.g Bmkvllwnllg Trunk: Coll H1 CO1 FANNIE PURDY . . . Llllle Bif flaw. Asn.: G.A.A.g P051 Club: H1 Gu1rL JOHN W. RANDALL . . . Johnny K'C.1ppollng Boys' Chorusg Comcrl Ordwcs F1 lv nsvlnlw 1. BARBARA REED . . . Babs ab. Assl.j C3.A.A. LAURA RICHARDSON . . . Laurabelle 'lvcllon Curnnulsslonj F.T.A.1 Olllu Pmcllcv S11 use os 9 Iounllg Claw Asslg U.A.A.g Pop Llub Modun Dump Tlnlr. BARBARA RILEY . . . Riley ?,A.A, SERRY RIZZER . . . Maeslro Slqnmg Onlll X1 Scrollg Latin Aw1m PT A Anlvlsorv foumilj Slmlvni Counfll Marilmll I acxmr Lr El for ilmlx C.1pl.Q Auornp.1nl:,l lm A'C.1pg1Il1 8: Boy: Clno :rvmlv Clulv PINS.: AIIC'mI.1mr' Oll All L1 1 kvnnrll, Maflw wizards, Barry Sclllnemq a Cl S Q lvur, pul Illelr lwarll. Imgvllu-r lv lrlw I an am Scholarships TODD ROBINSON . . . Man Sr. A'Cnprv0IIag Bmw' CIrorrrsj Comm? Or'.Irr ,Irr SM Errsf rrbI1'j HIsIorv CIIIIXQ Irmkg IIAII Clrmrrl. TONI ROBINSON Srfurrrng 'IuIor1 Srrrwrrfw Honor Srwij Sr. A'f1r ' I AIrIsIrrrrrrr OII A I Clrs AI IAA Lrlnrnry A141 . 1 .. an .Q E. '. . HQII Guard. RITA ROBY . . . Shorfy ErrfqIrsI' Horrcfj 4,r,A.A.j Pr-rr CIrrIrj Morirrrrr D.rrr C rI JEAN ROSENTHAL Srqrrm Prefs. X1 513115 3 CIVIQ Aw.1rrIsp 3B CI.1A.As Class Sccag STrrr1CrrICorInri7Ig Sr. X1 Jr. A'C.1rrpr'Il.1 Frrmh CIUIN Sfrrror Srrorrsorg AIIomI.1rrfrr OIL AMI. rrrcrrr O . AI:Ig Cr.A.A.g II.xII Cffrmr-I. RENEE LEE ROTH Srqrrral 2 QUIII 81 SUQIIQ 4 CWI: AwrrrrIsg Jr MIM Honor SPC. 'Irrxrsg SILHIPUI COur1ri'I Svz'.Irrur',.' YA r Vc-Op: IA CIASQ Vrwpj A4IcIrpv lrIrtor rrrCIrIIr1 Frrrr Ir CIIIDQ Sr'm'c Srronsrnrg P.T.A,g lrr'mIr- Arhrsr A Profgrnrrr OII. Arij Lara, ASSY.: C.A.A. Dr-I,j IIAII C rr1rI DOLORES SAKRY . . . Deedee Sdrrraj Hvdorrarkrwr A'1f'rrIj Proororrr OII. AIrIj AIIr ' AA IIrII LrIrrI amiw O' Ar'Iy CInss AMI.: Cr, . .Q . r. JAY SCHAPIRO. . . Red F'rqI.5Iw I-Iorrorj Jr, Mover I-Iorrorj AIIrfrrrI.rmw Or A 1 RI1If1 Irfwvrrj I-IJIJ Crrmrri. MARY SCHEIDER f3.A.A. BARRY SCHLESINGER Srfqrugxg Sr. MAIN Horror: Chvrrr IIor1or'Q Irrr-nrIr CIrrIr SITEVE QCHULSON Srrgrrmg br. X: Jr. MnIIr HonorQ CM-rrr Horror 9 rr ur' Sporrsory Cjradfr Arhrwrs' AMI: C,?crwmI OII. A SI los? F Fofrrrig Lab, Asaf. SUSAN Sgr-ruuz . . . susze Sq'rr,r1 QUII X1 Sc'roIIj Jr. MnIIr IIonorg Arrrrrn 1 I-IvfIr'rrarkf'r Aqrxnrg Frrrmjw CIuIrj Qrrorh- ArIvI', S1rr'or Sporrsorg Iosr Sr Porrmig CIAA.-, Ar.-J.: QKA. Irrrros Dauffrfsvrs. 5-ALLY scr-rwARTz A Q 1 Srqrrraq Convrrxnfrorr CIrrIwj bcrrrrarr C,Irrlrg L,In f3.A.A. yrcrcr SACEIWARTZ A I I Qrqrrmrj Lrvrg Aworrij EIPCIror1 Corxrrnrssrorrj S A Ca:'rr'rr'IInj IIr,rIf-parkvr Aorrmfy Frrrrrdr CIrIbg .aIIorr CIubj CIA-Qs A5513 C5.A.A.g IIAII CjrmrrI. NADINE THERESA SCOTT . . . Scoffie Corraurvnfhon CIrIIvg CD.A.A. Df'I.j IIJII C7rmrrI. LEROY SCURRY SI.rL1fJrrI Co:r1rrIg Sr. 81 Jr, A'Crrrrrrr-IInj Boyz V01-rug FOOIIDJIIQ Br1sIfOIImIIg I-I.rII C'vrr.1'rI. PATRICIA SELF . . . Pdf L'I'r.1W ALIQ CIxr,s AssI.g C3.A.A. HAROLD SHAPI RO SngrrrilSr,IVI.lI'IIIn1rrrs':lNrrrrrr'rIBrrrrIQArrrIIryVIrrrIA I Oe:rrvrirI OW. As5I.Q SrrrrrrIy Rmrrrrr AwsI.j II.rII Uris ANITA SEIULMAN Srcrwnj Crvrc Awnrug Srrrrirrnf CorrrrrIIj Sr. X1 .Ir A 1 pe-II,aj Frrrrrrr CIubg RIIIP CIrrIxg Lfbrnrv Arrig 4 A KAARON SIDNEY. . .Kay fumrirrrf Corm:!Ig Jr. MJIII Horror: IIyrIr'rrrrLwr A rrrI ,Ines AseI.g C1.A,A.j IIAII Qu::rI, SHHERMAN SILBER . . . SI1erm Srqrrmj Lnfrr Awnrdj Sr. MMM Horror' I'rf'r..g Jr M1 r Horror Vfrmrg Chrrrr I-Iorrorj SIrrrIe'rrr Corrrrc II: IIvIrp1r 39341. X Acwrrfj Corrcvff B.urr11 CIMA, AIM Q Crrrwx In xrrr Ifwrr-5 Truim: IIJII Lzrmrri. Don'I feed 'rhe animal, II yr-rr wfrrrr .rrrvrrrirr Ir rn Ifrby Spfevok Irc-IwIrr:I IIrf2 Irffo-rrrrffr'-. Imrr.. r r VIusT Be Earned DANNE SILYERTHORNE . . .Jqio Io-q LIIIIS QIIIIIIISQ CI.ISS ASM.: lI.A.A. DI-I.j IIAII .IIIIII. IARCIA SIMON . . . MoisI1 IIII.Ig I CSIIIII' Aw.IIIISj Sr. XI JI. MIIIII Hnnwj SI. XI . A'f.IIIIII'II.Ig IIx'II0II.II'IcI'I' BIOIII C.IIII,Z IIIIOIQ FITIIIQII IIIII SI-I. III III-.IA..j BoIvIIIImIIIg f'XI'I'III.IIIXv U . AAQ fXwfII,j LI.fX.fX.j II.III IIIIITIII. IENDA SMITH . . . Froggie IIIIIT III-.IIIIIIIIIN IIIII.IIy ATII' CLI.-, AMI. ITAA III I.II-I. AROLYN SMITH. . .Eyes IIII.Ig KIIIIS' CIIIMIISZ SUITIOI' SIIUIISOIQ CIJSS ASSI AJR.: I'I'II CIIIITQ RIIIIT In-IIIIIQ IIIIII QIII,I'II SLVINSMITI-I . . . Smmy I.Il XI SMIIIIIQ IIITIIISII IIOITOTQ AIIIIIIIII SMI X1 fmnmij IIIIITII, INIIIIII 81 R.O.I.L. BAIIII-,Q SITIIIIISII CI..II Tw-.IS,j III UIIIIIII. AQUL SMITH. . .Bu ISIN IuIsIII.IIIj II.III f1II.IIII. 'ILLIE SMITH . . . Bill TIIIITII II: R.O,I,C. BJVTIIIS. IONNE SMITH . . .vondse I I IIII-III KITIIIIIIIZ AIIMIIIIIIIIII OI'. Af-SI.: LIIIITII. AI.Ij .A A, Bu.II.I, DUI. 84 AII.j 500 C IIIITQ Pm' CIIIDQ IVIvIIT ' IIIII- CIIIIIQ II.III lIII,IIII, XULETTE SoLow k V IIII.Ig C.IvII' Aw.II'IIj 'IB CIIISS CIIIIIIII.g SIIIIIIIIII CQIIIIIJ If IIIIQIT CITIIIIIIISSIITITQ IIyIII'piII'IsuI' AqI'ITIg HUITJII CIIIITI TIII-ITII R TII-.ISIIIcI'S OII. ASSI.j C3.A.A, DIII. XI AIT.: III MIIIIIII. YRTLE SOMERSET . . .x Jeanie 5 sIIII'II BIIIIII XI OIIIII-SIIII' 4-.A.A,' MIIIIIIIII DIIIIIII KIIILI. DGVENR SPENCER' 1 X . ACIIIIIN-II.Ig BIIV- KIIIIIII--3 IXIII I- H.III Ig LHISS Afij IIII Row-,IIIIQ II.III MIIIIIII. DBY SPIEVAK II'I.IQ IIVIIIIIIIIIIAI BIIIII IIIIIIJ SIIIIIIII SIIIIIIANIIQ AIIIISI -III CTI. AIIIg III'.1sIIII'I'S ASSI.j LTIIIS-. ASSLQ L.'.A.A.j III K-IIIIII. JSAN STAVISH . . . S+9sIw 1III.Ig I'IvII Aw.IIIIQ Il:-IIIITII CSIIIIIIIIISSIIIIIQ SI. XI JI. YIIIIIII-IIIIQ UIIII-.I-I'v.IIion CIIIIIQ UITIIvI'.II O . ASSLQ AIT- IIIII-III OV. AIIIQ AIIvrIII.Im,cr OIF. AIIIQ fI.ISw ASSI.g AJS. DI-Ig I'I'p CIIIIIQ W.III'I BIIIIM. AROLD STEVENS . . . Sfeverino IIIIIIII UI,IIvSII.Ig SIIIIII1 ETISITIIIITII-I II.III LIIIIIII CHARD STEVENS . . . DICI K JI, MIIIII IIIIIIIIIQ L III-III IIIIITITIQ Q I' II I Ij AII'I...II IITIIIQ SLIIIIT IIITIII, JTI-I ANN STEWART Y IIIIIIQ IIIIIIIQ 7 CIVII Aw.IIIIA,g I.I A. AIS ww CIIIII. I IIIITIII LTII.IIIIII.IIIg YB CIIISS I'II-my SIIIIIIIIII CITIIIII I I c'S., vp XI Sm .' IIVIII-InIIIII'I RI'IIoIII'I' 81 ANTITNIQ SLMTIIISII CIUIW -S.: Colm-IvIIIIImII CIIIITQ Dvlmhr CIIIIQ SI-'IIT BQOSINIQ IIIIIII XXIII: SI. A'C.IpIII-IIIIQ CIIISS ASSLQ in-.A,A.g PMT II T. JELLEN STROSINSKI . . . Su1I IIII.Ij IIIIIIZITII CTITIIIIIII-,A,IITIIg SI-IIIIII SIT 'Img I'IaT'. I. A-,SI.j A'l'.IIIIII'II.Ij k'.A,A.j NIWIIIIII-I-I DI..I'Iw ,g III LIIINIII. ANDRA SUTTON AA. DNALD TANAGI . . . Don :III-II H.III-I XI OIIIII-SIIIIQ DIIIIQI' X R.O.T,C. B.ITI.IS. INICE TAYLOR I A H IIII.Ij Tuforj SII.IIIII.II CIIIIIZ SI-IIIIII Spmmorg LIIIIJW ANI: NA. e College Bullefin Board In .I II-IIIIIIII -,Imp Ivr ITII BIAISI vIIII- Impow III I-IIIII II :II IIIIIII'SIIIp. QI 'SS' QV' Qffy 5 ...- spill' 0 ,,,,I... ,,,.-f imp' im' Gm-'X S S 'W .,A- S1- School Spirit SONDRA TAYLOR . . . Sandi Cfrls' Clorusj Allnndanao Oll. Asslg ca.A.A.g Pup Club Morwrn Danni Club: Tuvnbllnqj Hall Cuarll. ROSA THIGPEN Sf. Clrls' Clvoru, PrCs.j Consvrvallon Clulwj lllslmy Club' G.A.A,g Modern Dancv Clubg Hall Guard. MERCEDES THOMAS . . . Merc Sonlof Slnonsorg Lllurary Alrlj Allrznllanmw Oll. AEI L5.A.A.j Poo Club: Hall Cuarll, AUGUSTA THOMPSON . . . Augie Sr,1an'slw Club: Llbrary Alcli Cnnrvral Oll. Asslg Class Assl.g G,A.A.g lvlodfrn Danniv Club: Hall Cruarll. BRENDA THOMPSON Allendanco Ol: Alulj Class Assl.g CL.A.A.g Hall Cruarll MAJOR THOMPSON . . . Bulclm Hall Guard. HARRY THOMSON . . .Tommy Boys' Cnorusg Clrnss Club: Baseball 81 Coll T1-arnsj llal Guard. JOSEPHINE THORNTON . . . Jo Allondanfff OU. Aklj G.A.A.j Mmlurn Daulr- Clul: Nfvplunefs Dauqlwlwsg Ll-arlcrs, SANDRA TIDWELL . . . Sandy Lbrarv Afd' Class Asslq O.A.A.g Pop Clulug Tumbllnr Clubj Hall Guard. GHERMON TUCKER , . . Tuclx Jr, Mallr Honor: Consort Orclwslrag Sr. A'Cappr-llag Boys Cnorusj R.O.T.C. Band: Sluclranl Council: Conscrvallo Clubj Class Asslg Hall Guard. BETTY JEAN TURNBO . . . Jeanie Class Assfg C1.A.A.g Hall Cuarfl. BETTY ANN TURNER . . . BH' C.A.A.g Lf-arlorsg Hall Guard. THERESA TURNER . . . Terry Quill Xl Scroll: Annual Slalf Xl Arqvvwlj Elmillon Curr rnlssfong Losl 81 Founclg Alluslmrnl Oll. Arllg Class Assl C-.A.A.j POV Club: Hall Guavnl. ANNE VANCE . . . Panda Annual 81 Hwlfpafkvr Aqvnlg O'lI.'r' Pmnlrlw Smurf Class Assl.g C.A.A,1 Lvanlvrsj llall Cuarll. RACHEL vARNApo Gcnnral OW, Al-lj C1,A.A. Dvl. X1 All.: Prm Clullg Nnp lumfs Dauqnlovsg Mollf-rn Damn Club, BARBARA VOLK . . . Bunny Slqnrng Spavislv Clubg Arljuslrnr-nl Off, Alllg Allvmlalu O'l. Assl.g Class Asslq Gnnvral Oll. Aillg C?.A.A.g Ha Ouawl. PAMELA VOTH . . .Pam Slqrnaj Tulorg Cvl. Awanlg Sr. 81 Jr. A'Calrpu-llaj Cor curl Orrlwc-slrag Slrlnq EVTSf YUl7lf': Conv-rvaflon Clul Gorman Club: Hydcparlccvr Am'-nl: Llbrary Aldj Aflius mon? Oli. Alqlp Program Assl.g O.A.A. Board: 500 Clul Pop Clubj Clvrfr Lvurlvrg Nnplllrlrrl Dallrzlrlvr-,Q lrfllvrlfr JOAN WALKER . . .Joannie Acljuslmcnl Oli. Ahlg Class Asslq C'.A.A. LEE VERN WALKER . . . L. V. Banclg Hall Guarrl. ROBERT WALKER . . . Pops Ha'l Cruarcl. Splrll Booslers, Slwclla Gfwlollucrq and Fulqrfno l'la rlscwn, slwuld bmnsl llwc 5,040 ln any flame. Hari Ln Ls V Ovdu Jw, mwvn Hwiv- Tr uk 8: ? L AA. v L Emu! J: 1 uv num mn 1 v Bmfk Hn!! Us A .ij Nvp- C1455 HM' I L sims' i Q e irouble 1 W my Huck G.A.A. Extra SYLVIA WILLIAMSON . . . Sylvesler Sludcnl Councilg I-Iydcparlccr Aqenfg Class AssI.j Pep Clubg Tunrbllnq Club. CAROL WILLIS . . . Tele Conservallon Clubg Class AssI.g G.A.A. Dcl.g Pep Club. ANNETTE WILSON . . . Ann Srudcnl Council: G.A.A. MAMIE WILSON Slqrnag Sludcnr Councllg I-Iydeparlcer Aqenlq Llbrary Aidg Adiusfrnenr OII. AssI.j Spanish Club: G.A.A. QUEENIE WILSON Class Assrq G.A.A. All.3 Hall Guard. MARTHA WONG Conservalion Clubg Class AssI.g G.A.A. RONALD D. WOODS Concefl Barrel: Track: I-Iall Guard. CONRAD WORRILL . . . Bird Map Asst: Foolbolly Baskcrballg Tracki Hall Guard. BIRDIE MAE WRIGHT . . . Bay Class Asslq G.A.A, AII.j Hall Guard. DUKE WRIGHT . . . I.iHIe Dulce Sfudenl Councllg Sr. A'CappeIlaj Boys' Chorus: Foolballg Traclcg Lcllerrnan. RALPH WYNN Concerl 81 R.O.T.C. Band: Hall Guard. ELLEN ZACHARIASEN . . . Zorro Slqmng Enqllslw I-Ionorg Sludenl Councllg Annual Aqenlg French Clulnp German Clubg Conscrvallon Clubg Program Off. Assl.g G.A.A.y NcpIune's Dauqlrrersg Hall Guard. Sisler slars loeam on Sandra Besley, G.A.A. presi denl, as slwe noles all Ilwe qyrn aellvllies lwr December. KJ 1 1960 JANUARY GRADUATES ROSE BROWN JANET ROGOFF JOANNA WILLIAMS DRUECILLA HANEY Presidenf Vice-Presidenf Secre+ary Commissioner -,,,...f +-uv 'fa January Graduate VIVIENNE ADAMS . . . Viclri Annual Aqcnlj Girls' Cliorusl Ollifrf Pmllimv Sr-rvifz Los! X1 Foundj G.A.A. JOYCE ALLEN . . . Fox G.A.A.g Hall Guam. ANNIE ANDREWS . . . Anna G.A.A.j PCD Clubg Hall Clunrll, JANET BAISDEN Library Aid, Class Assl.g G.A.A. WILLIAM M. BAITY foncrrl Band X1 Orclwnslmg R,O.l.C. 81 Dimmu Bumls. DELORIS BAKER. . . Deeclee G.A.A.g Hall Guard, LOUISE BAXTER . . . Lou Siqmag Concrrl Band: Consorvalion Club: Libmvy Aid Class Asfl.j G.A.A.g Psp Club, LILLIAN BEASON . . . Lillie Lillie G,A.A,j Modern Danrv Cluhg Hall Gunrcl. WILLIAM BELL . . . Billy Conccrl Orclwcslrng Slrinq Enswmblvj llyclvpuvlwr Aqnnl Hall Guard. Essis BERRYA G.A.A.j Hall Guam. RUTH BEY . . . Curly Eleclion Coirimissfoug Sgmnisli Clubl Lulu. Asalq LJ.A,A. 1 I Pep Clubg Hall Gum'-. CU RLEY BLEDSOE Elricliori Corrirrvissionl Sr. A'C-wmwlluj Ji. A'CQ.1mu-llc Prcsq Boys' Chorus: Bunrlg Hydvpurlcfvr A111-nl: Boolcroom Hall Guard. NORMAN BLEICHER Hall Guard. lim. SAUNDRA BOLTON. . . Sandy Annual Aqeulg G.A.A.1 P09 Clubj Moclvvn Dunn: Club XY 'lb' Hall Guard. MADISON BOOTH Sr, Afappellag Boys' Cliorusj Mlm Assl,g llnll Gunrfl x DELORES BROWN . . . Lois - B f 6-,A.A.q Hall Gum. ROSE BROWN . . . Bubbles 4B Class Pros.: Eloclion Comrnissiung Annual Acwnl Spanish Clubg Class Asst.: O.A.A.j Pup Clulug H.1llCfunrll ROSETTA BROWN . . . Rose Sludenl Councilj G-.A.A.p Hall Ounrfl. IDA BUCHANAN . . . Tiny Class Assl.g G.A.A. JOANNE BURDETTE . . . Joio G.A.A.j Ha'l Guard. K Deep snow Clllfjbllll lnoup Jam: S1 luulwll- iuduui-1, B JQQW li ' ' BE gi ' 1 A A' . sl uauums, I :owed Under NORA BU RWELL N NA., Mull-vu D.mlw ilulwg llull Lwmvll, ITRICIA CAMPBELL.. . . my V lvmg Iuqllxlv Illmmg Blulll-nl Cunmlli Ccvvwwmvvl ,N V, - . DYCE CARRIGAN my Anuwxl K Ilylll-pnvlwv Alywulj Blmlvwomg Cfllw. .IN x',A.A. INDRA CLARK . . . Sandman Ang mu iwmvxl, GNORA CLEMMONS . . . Slgqie wmv' Slwwmuvg L'.A.A.g SOO Cilulwg Class A-.-,I. LADYS CLOPTON vnvvl Or.ln ,Ir.x. LUNDRA COLE Inlvrl Bnnllg k'.A.A.j IH-Iv Clnll. :ROY CONLEY . . . Lee I Awnvllg Sv. li Jv. A'C.1ppwll.1g Bm! Clwwmj R.O,l.C ullj ll.mll L'u.xv.l. 'EVE CRAWFORD . . . Hlghpockels all wn.av.l, ESTHER DALE . . .Y A.A,g lm-.xllvvflj ll.all lwmml. UYLAND DANIEL. . . Guy ERNAL DAVISK. . . Benny ml:-vl Elm-I K Oulu-l.Iv,xg R.C7.l,CI, Bqnllg ll.xll Llmf.1 JRCEY DAVIS . . . Fruifsey Y I L 'Inv Ilunlnl- Svmilvj h,A.A. Dr-l.j llvp Clnlwj llwvlvl rm nlg Mullwvn Dum:-3 Rlllv llnmvq llnll L7lmul. JSANxDAWSON . . . Pepsi nllwnl fmImIlgAmm.1l Am-nlg Elms AssI.j O.A,A. Bova 'ng Cllr-uv lunlvvj lumlxlwml flulxi ppp lxlnlvl Mmlqwv ,wmv Ulnlul lI.1II Cvlnuvll. AROLYN DIXON . . . Tlny ills' Clvmw-. ESTER DOUGLAS . . . Dou IILLIE DRIVER. . . Bill ww' Clmrnsy H.1lI kllmlll. ARBARA DUHART . . . Dulmrl ll Cxlul I- I, UNIOUS EDLER LLICE EICHHOLZ . . . Dinah '-lI,u1 AJIU-.lvvwlwl OII, AssI.g Clay. AssI.j L3.A.A. BOJVII Dwl' BOO Lllulv' lm-Ilwvqlvl' IMI' fxlnlx' Nr 'Iv7'1 mxlllv Sf Ilxll Cumvl .I --..w.g. v.w. Vhen Clwrislmas comes again, qmdnullwn In ,lm vu Slrwclv .Ind Xl-wlm Mlllclnlm nlll lw- lnwl .avwnvul Ill IIIIIIUF. :bg llwwlmv Lmlwg lmlumry Ani: L,I.x5s Awhj k1.A,A,j Qxlul flllpnrx-'v Aw-UIQ C.umvvI Omlwalmj Blmnl Lnwrv-wlv, qvvmg lnlmg Clwll Awqvllp Esmy Awmllg Jv. Mall' num: lIy.lI-Lmvlwj Consvrvnllon Clnlwg Sg'.1n'w Clubs Ixlmv Ulnlwg Sv, Oulu-alnxj Slvluq Elly-mlwlut Allfavf Seniors Gafh ELEANOR EPPEN . . . ne CWIC Award' Hycivparkcr Aqfn A cn ance 81 Program OIHQK- ASI LMI AI AI G.A.A. AII.Q HQII Guard, JAMES WARREN EWING lm RICHARD FLEISCHER Duc A'Cappf-Nag Boys' Chorus. PHIL FRIEDMAN . . , Fearless FANNIE MAE GARMON Pam GWIS' Chofusj C.A.A. LEATRICE GHOLSTON ee Hvdcrwafkrr Am'nIg G.A.A. TAMMY GOGGINS . . Tam JOAN GRAHAM . . . C.A A,j Momffn Dumw CIII IIII L II WILLIAM GREEN . . . Sf. X Jr. AC.1rwoII.uj Boys CI AssI, DONALD HALPERIN . Smvmq Sfudf-nf COIIIMHIN LmIIg Tmckg HAII Gun -I. DRUECILLA HANEY . fiqrvm' IE Chas Comm' HAII Gund, ROSS HARANO Siqmnj Chem Honorg Sr. 8: J GP-'man CIubQ Proqmrvv OI' ss wr Team. LOUISE HARDAWAY . ou G.A.A. DOROTHY HEARD . . Do? Iydf'parkPr AQCVIIQ JI. ACIMI My In DJUQP Clubg RIIIO Tfxmvj I-I1II Gun GEORGE HEARON CIQSS AsaI.g HQII l3unffI. MYRON HELMER CELESTINE HEMPHILL TMO, Cmm Homo, HVI Frm-rv, C'ubg O,A.Ag II.xI WILLIE HENRY .In A'CaL'pCIIag Boys' Chorus Qc vw R O I C Bonds: CIAS5 AssI.g Honor BARBARA HILL. . . Babs IA Class Corurvyj Chvm H nov V parkrf BIor1k Cant: SMI ur S 0 ur sI L ROBERT HILL. . . Bobby COHCOPI 81 R.O.'I.C. Bam Ifwfbaug HQII Gunvi. A slip In IVIav'fwImII KnpI1ns fIrnIxIwI0 W I'IaIpelIn II'w IQQII. r Double Dribble xNDRA HUNT. . , Sandy uw A-I-.Ig k',A.A.j II.xII kk-NMII, AROARET I-ILJTCHINS . . . Peggy Q lvvuvl INIOIQ CWI. Awqvdg Jf. MJIII IIONOIQ Swwwv mm, kkullwvv.1IIuvv CINIHQ C'v'm'.1IIvv VVHIHQ1 DPIJAIL' :IQ L-vvvvmrv l'I.m Sm.: Svumr Sponsovj Cfuudv AAI I-1, XXIIQ kwvN'v.II UIQ f'x4.NI.j I'mm.w-' A-,nj QIJNN mfg L mm mu +,.,.I.I. ICHAEL IDENO . . , SI'1ibo N-INJII X. Swim If-.ww-.Q lllimrvmrv ATRICE JENKINS . . . Bea Vw Aw-.Ig i'.A.A.j I'r-xv KIINIJQ II.aII bum 1 IEEMAN JOHNSON . . . Free Bees IyI4.Iv IIUHHIQ Jr. A'C'.1pg-I-II.xQ Buy! lxIvOv..f,j II-,iv II..-1 fX.1vrwIQ If-IM-vzvmvvx HMM-IIw,uII bww' S. Imam mv., ATHERINE JOHNSON . . . 146+ MMA JONES . . . Jean AA, ww L mx. ELEN JONES ww-'I U'.Ivw,Ir.vg wA.A, IARY ANN JONES IJ A-,wI.g M.uImu'-, ANIQ Q .f'X,A.j Vw' CII IQ IIJII I-.I 1 XNESTINE JORDAN . . . B. J. IRAQ IWW KINIXQ II.vII kJu.IvXI, ARSHALL KAPLAN . . . Miich wmj fXuvm.II AI1:-rw'Q IIIJMHN ANIQ IIMKIIMIII B.x-IRMLJII Iv.v.I Imwv-.j II.vII L-NIIMI. IARY KENT A A j vI.mII I-N.N,I. ARL KEY . . . Key UNNAN KUBOSE mvml kwwrvmxm IINIJQ IIINJW ALI' III' AKAI! IIIII xmrxi. OYCE LANA LEVINE . . . Joycie Im--I Awi. ANDRA LEVISTON . sandy u-I:-NI luNvvwIj SINUNNII CNIIJQ l.uIw, AMI.: kf.A.A.j Pwr INI'. JILSON LEWIS . . . Boofs wx-.I KIImvN-H V011-.4'x.1Iuvv CIINIJ' CXWAI xl' W1 I vm' I IN vu, AAL ,'fv.1f.NN AA,-,Lg KOIQN xNI.N.1g HAI Lum' I. RUCE LOOMER .III MINI. ULALIA LUKE .A'LI.nrJp-I-II.ug AMN-,IrvvvrwI OV. Awig K-.A.A.j RI'Iv CQHIIX ATHLEEN LYDA . , . Kiisy I,u-Jw A-.wI.g k',!X,fX.j VIJII Lwmvli. Buick change arIIsIs. Mminnrw SImm-O .md Gram IIINIHII, IEINI prfvmy In IIN- wvnIur' Iu.Iwv' rmvrvw, fix if ,wi WST College Drear LINDA LYTHCKE . . . Lynn Soma: Tulor: Consnrvallon Club: Frr-nflv Club: Hlslor Club: Adluslmcrnl Oll. Alall G.A.A.: POV Club: Rlfl lraw DOROTHY MABRY . . . Dollie Llbrary Alcl: Gfadv Aclvlsvrs' Assl.g Class Assl,: C.A.P HELGA MATTHIES Slqrna: Jr. A'CapoFlla' Cfrls' Clrmrus: Hvllvparkr Aqcnl: Gerrnan Club: Class Assl.: G.A.A.Z Lf .1lCl'S, RANDOLA MclNTOSH . . . Randy Chem. Honor: Band: Llorary Aid: Cluss Assl.: C.A.A Hall Guard. VERSALINE MclNTOSH . . . Pennie 3.A.A. Delenale, JAMES McKlNNEY . . . Jimmie lrvlrarnurals. JOHN CLAYTON MILKINTAS Sqrna: Clwrrv Honor: Consr-rvaflon Clulu: Class Assr.: Hall Guarrl, PHYLLIS MOBLEY . . . Phil Glrls' Crorus: Class Assl.: G.A.A.g Lrvarlvr ARDELIA MORGAN . . . Barbara fludcnl Councll: Hydcparkcr Aqvrvl: Lab. Hall Guard, DONNA MURRAY . . . Donna Ree Slqrma: Spanish Honor: Proqram Assl. Guard. HORTENSE NASH . . . Killy Sludenl Council: Annual Agcnlg Llbrary Modern Dance Club: Loaders: Pep Clu GLORIETTE NEWBILL . . . Glo Elocllon Cornrrvlsslon: Class Assl.g C,A.A PETER OLSEN . . . Pele Sr. X1 Jr. Mall! Honor: Boolcrooru: Swurl Hall Guard. BlLLY OUTLAW . . . Bill Elvclfonlfs Club. EDDIE OWENS . . . Vic Elemenlary Slrlnqs. BETTYE S. PAYTON . . . Susie O. G,A.A. YVETTE PlERCE . . . Fals Lab. Assl.: L7,A.A.: Hall Guard. PAT PRATT . . . Palsi Proqrarn Assl. sg Hall Guard Amr.: G.A.A. C.A.A.: llal Al-lg G.A.A. lo: Hall Cruarnl Hall C7u.lr.l. Xl Cwoll Tr-arms Cfvlc Award: Annual 81 Hycleparkor Slall: Errrqllsll Horror Trees.: French Club: Drabalf' Club: Senior Sponsor Q.A.A,: Pep Club. FLOYD PRICE Boys' Chorus: Rlllo TYREE OUINN . Hall Guard. learn, . . Ty College clwolce could mean Suncev. or lallure lor Alllce Eiclwlwolz and Donna Murray. :an Soon Be True 1AMlE ANNETTE RALLINS IX .A,A.kB'w.x'.ij l'11'C'M1lwg M4 x r JW Cmnwl. ANDRA ROBERTS . . Sandy Lux Awuf, IERBERT ROCHELLE , Buzzard . Pu Jr. AC.-mwN:' By mmf, ANET ROGOFF. . .Jan qumj fun Awqnlg 48 CM V 1 lufuv J Mx umm, HvJvp.1vlr'v' Amxnb Sg w M C N l l l x A 4 hw. A-AL' Buukummv- 4 AA QRACE KSAKUMA qrrmj Clwvvv llurmvg Hyirywvknv An C.sp5wU.1g in-:nh Cjub fx 1-H9 CWM Aflfg Cv.A.A.j P gs C ul CM C 11 RANKIE SANDERS . . SISf0I' hw. A-Mg C?.A.A. ULIA SANDERS . . . Slunny mt X rnuvnij Cv.A.A. UANITA SAXTON . . Nnfa ANECE SCHAFFER . Dlmplffs mum? C7nMwfv.vjSVvUn1 lu mi! CM A 0 C AA qwfmu ANE SCHAIBLE . . . Mum: CTU. Awmdj lu: Hahuv CSYUIQ fvvmh C' H1-mfnm 1- OH. ANQ Bun ,mmXAnmm'AmgbA 'nw'x D.mC1'wf1-rx, QAROLE SCHECTER nwm. CSurv.Cw.1Tmn Club Mm, CM-,x Aw.V.g Cv.A.A, QEVERLY SEYMOR . . .vvrvmml A-wnfi C'.A,A. IVERNARD SHAPIRO . mrvmg lvwshvvmru CSM-.C P1 C'CS.xmwfl.xj Buys' Qlmvu -AARIANNE .SHAPIRO tmiwlmi Cmmwl' ITA' Mn Mm C ul 9 X 1 wmv: Tvrnlwvvv-, Ami: CM A Y C AA P C' MH C3u.uv4f. LHARON SIMMONS Bunny SM-,L Av,i.g CS'.A.A.j Paw CMI HH C Us 1 -QAYWOOD SMITH . Prefsbuifon wmh Club: lxlwmvy AM Hu!! C uni IOSEPH SPAULDING oe .OUELLA STEVENSON ou 3 A A 1AYsoN smooe . , ay uu1lv.1Ng Half Cwu.xrJ. CARL TICLISCH w-vvvmrv Chnlw' ILM Cwnvri Dizzy sfeps cwxmo Von mm Wx w mm INN .uw mln- it'41V0il flw CHIUI qu! In kvr IC ru Janne Au Revolr DAVID TOWNSEND . . . Dave C0rwsPfv.1Yon CI1'INj C'cmIf'vI B mi SIII Ir'uI Dv, O 5 5 D B I S I .mg I.I A I QW' ffm' Inj www vw Q .w In war'-Q MARIE L TURNER F.T.A.j CQHJMI OvIIvfI,Iv'uj .II Ivv'.f IvIII A711 C5.A.A.j PMI Cum, LaJUNE VALENTINE . . . Bear ALGERIA VAUGHN . . . Kaf Owifhgfrw. ELLA WALKER CIN, Asdg CAA A.: II.xII CI,.xf I, JOANN WASHINGTON . . .Jo fvA.A.1 Pm CIIIIXg II.mII QIIIJII. THOMAS WASHINGTON . Tom fomLmII. JUDITH WEBB . . . Brig CHAN Assij IuA Ag Mn1Ivv'I Iiwnwv CKIIIIIQ II LILLIAN WEBB . . . LII LIIUIMV Ang f.A,A, ELIZABETH H. WILLIAMS . Lizzie Sham! CmmI'Ij Sf, X Jw. AT ' L1.A.A.j I-LIII L1-Imwi. LIZ ELIZABETH M. WILLIAMS . Qf.A.A. JOANNA WILLIAMS. . .Jg Sqfrrng 4B CIM: Swv.: 5II.IIwnI L,uImI.IQ Sgmvl I II m I A I I A I AA I I I I I I-Ix'.Ir-L'.1'I.c'v 114 'W 1 Irv, ws .Q xv Qunr 1 . II, LINNETTE WILLIAMS . . . Linny ' Y I C' I II 'I I I I fuss AsI.I.j Lw.A.A.g 'ww ,wwj .II -'LI rw . VERONICA WILLIAMS . . . Roni SIc1 mg Sv. X1 .I'. fXQk.vxr I,wj I'A,A, IMI. I Mozivn Dmzw Cf .IIx MELVIN WILLIS . . .Humper Bowl Chrvmvj B.w'IvIIIg IIIIII ffm I DONALD WOODS . . . Duck Basfwtm Ig IINI Cwm' 1. II. Senior pIanS, mw .MINI Ivy Slxgrmm C mn I Izrwq prwm lv II 1- ,, ,I IP IH X Ivq grmar, Congralulalions are in order as Mr. Triezenberq, Miss Brooks, Mr. McCarlhy, and Mrs, Julslrom award diplomas. Graduation Opens New Horizons Dressing back slage, Donald Azuma, Joe Keslnbaum, and Louise Dodson gel ready. Gradualion Day has linally come. Many lhoughls lind lheir way inlo lhe minds ol sen- iors as lhey make lheir linal adiuslmenls and lalce lheir places in lhe long procession. Gradu- alion Day is lhe lime lo leave behind lhe ele- valor passes, sleam healed loclcers, and lreshie lollies. Dissecled worms and geomelric: compas- ses are lhinqs ol lhe pasl. The midnighl oil burn- ed lor lrig and chemislry was nol wasled. Sens ior parlies, lhe prom, and gradualion will nol be lorgollen. ll is indeed a lime lor lears and a lime lor joy. ll is a lime lo leave loehind your childhood, lalce a deep lorealh, and lurn your las- sels wi+h a leelinq ol assurance lhal you are well prepared lo meel lhe lulure. Valediclorian, Judy' Bernslein, presenls lhe gradualion address lo lhe audience. N, uf ,I X f 'Q G W- AN . N 1291 Q L S+ Q W W s zigmil, e sjgagg 'H SXSW, MW ,. , iii ihee. and Margaref qual opporfunify. ichholz, Ronnie Mc- lnihd in song, Carolyn Rogers. Carol E McWilliams reioice fha? fhey all have x9-W WMM' 6 ll WWW r ,f2J2jgj ,jQ Q r W EM Mlffj ZW aww f igim 3 - 'fwwhlwwfwficiilglj lllll Q' ll lflfllwarfl glllll ll Wg P l E ?b .H 3 iff!! l lllllllll llbwjlslll ll ll Mr ll ww W Wlmwn lil hw Unifed in baffle. June Morris, Sheila Goldberg, Marcia Diffman, Joan Jan Rosenih Hammersley. Susan Schulh. Joan Budylc, Renee Rorh, and al can'f resisf fhe fresh snow. Chairman of College Day, Mr, Wiillr-i- Diihylc. confers wilh Mr, Maurice Yocurn, The rf-promeii' lalive lrom Chiraqo Tear lierv Cfillvge. On November 7, l958, Hyde Parlcs seniors viewed college lile 'rhrough chals charis, and slalislics presenled by rep- resenlalive from various schools, Siu' denls were given a chance lo compare curriculum reguiremenls and social life in rnany dillerenl places. Near-by schools sending represenlalives includ- ed 'rhe Ari' lnsiiluie ol Chicago, Chi' cago Junior and Teachers Colleges, Auguslana College, and lhe Universily ol Illinais. Harvard, Bryn lvlawr, lvl.l.l., Johns Hoplcins and Swarlhrnore repref senled lhe easlern schools. College Day For Seniors Only Represenlalive from Cornell College is sluniiwd lay llir queslions Joan Hammersley and Viclci Schwarlz ask. Unch iw wvivml lug .limi Clwilwu ln VVfii'i'0n 'wllm Mill Cullum Piiline Bulmnnun Lynn Un luesduy, December lb, 1958, lyde Purlcs. lunch room was ull dressed J lo enlerluin The molhers ol lhe senf ir cluss. Breulfinq The lradilion ol slricl- lla hen parlyf' sponsored by lhe sen- ir girls, lhis nllair inviled fhe molhers l our 'lbenu brumrnelsu as well. Aboul iree hundred couples allended. The New NYM Q s olhers enioyed renewing old ecquainl- wces while drinking punch and munch- Q X q cookies. Cur seniors, all declced oul L-s-cyl X Q : : N 31 hiqlw heels and neck lies inlroduced NNNN- V .s., .. ieir IT1Oll16Ff3. Background music was : ' irniwhod by l lyde Parlcls Slrinq Quarlel. -r r- Senior Mothers Entertainecl AT Class Tea ofhers ol Muiiqii- Ciri-.lwuriq and Bonnie Gnrlnei eniivy 4' ulli-ri1.wn .al Hyde pnrls. E e las? dance Md, MU, Bvm P5 amd Her Ivusbfmd among Hu: mvwm nsprvfg, 41':rad11yq3hf, An enchan+ed mirror sm?Nes on Shidey Hamiwxn and Rmqfxr Hur?-m. .lune Prol 1 ruu Prom King, Robefi Bermeff, LLOKEVFLIMV Hwavwlv. Kam-rw luyu and Barry We-I, Hwe qiff :md garrw?ic:u, ' X .. !f x h MX d H be ihe weailwer Hun? Larry Richards and Nnez Buffer- Prom Queen, ZeNa Hardaway, beams as Barry Weis5 and Karen Loye place an- di-rcmfirmcg with their dafm? Hwe crown upon Her need. 5 Gala Affair i f an ' Ar Q . wr 3 V ip g . y A ' r rw . re ouf hw .1 hwiu ru Mero, Mr. and Mn.. Mccarffwy qw The Grand March, Wed by ZeUa Hardaway and Bob Be-nneff, Wil f1HdCHO. fmhwwirwaiea a wwndorful evening, S in , ,-U Q g 3 3 z y S e W ' I MN .P M xr Q if in ,J V xrfw 5 Q g E?vff'?i An exhibif of +ex+iles shown bf Mrs. Kmelf and Mrs. Ander- ' W Y son, inlriques Mr. and Mrs. Melvin Goldman. A warm welcome was delivered by Mrs. Marshel Beason, ihe new P.T.A. president fith Faculty Luncheon and Open House. Fiddling wifh figures, Naihalia Liqhllool beluddles her parenis in ollice praclice. The annual Open l-louse al' l-lyde Parls proe des an opporlunily for parenls and leachers lo 2+ acquainled. The opening social hour finds leach- s in lheir rooms prepared lo discuss Their liHle arlinqff' Exhibils ol ouislandinq worlc are lealured. we rneelinq which followed in Loomis l-lall siarled ilh addresses by Mrs. Marshel Beason and Dr. filliam Wallers. English l-lonor Players, under lhe reclion ol Miss Myra Paine, presenled Two plays. 'Cappella Choir, The Girls' and Boys' Choruses, id lhe Concerl Band lilled in wilh musical num- ars and novellies. brary aid, Panic-l.: Allen, ll1ll'UdkMOfi lior parenis lo Mrs. fir'-,lim and Mrs. Craig. Officers . . . Presidenf, Yvonne Waslninqrong Vice- Presiden+, Liiiy Myies: Corresponding Secrefary, Iris Brown: Recording Secrefary, Marqarer Woods: Treasurer, Sandra Cooper: Sergeanf-af-Arms, Bar- bara Gorcrzkiq Sponsor, Mr. Aaron Srniih. Members . . . Top Row: Hayashi, Pauleiie Soiow, Haugii, Barbara Goreizlsi, Hauqin, Laura Richardson, Cooper, Margarei Woods, Min Minq Tanq, Barbara Simon, Joe Rosemarie Brown, Doroiby Wfwrd, Pr Iris Brown. Fronf Row: Riiiii Boy, Lind Marqiieriire Moron, Jerry Lazar, Sandi Liiiio Myiea, Mr, Aaron Smiriw. Election Commission Sponso Candidafes for 4A Commissioner, Candidaies for 4A Presidenf, Pameia Candidafes for 4A Veep, Rn? Kaaron Cooper and Marion Kernis, Darby, Sfeven Greene, Irene lrnada Hiiqiies, Connie Miiriueii, Jan Raiser are assi-,red by Dororiny Ward ai ine and Ricinard Wexier, line up ro speak Thai and iris Brown waii ini prcfwr Fiedion Asscmbiy. fo fiie vorers. Their quaiiiicariona. , Rita:-Qu v lk' :wu- imi'mU.il'2n QP iziiiifiuoh M EIX Eg: i my l ky! fx HEP ..--1 A voiing machine will noi puzzle Wilson Lewis when he crows up, beraiise he voied for his Class ofiipcrs al Hyde Park. :lass Cfficer Elections Volinq for Class officers ai Hyde Parlc is conducied lhe same manner as in naiional eleciions. The siudeni zciion Commission, sponsored by lvlr. Aaron Smilh, flees ihis possible by borrowing ciiy voiing machines nm lhe Chicago Elecfion Commissioners. A nominee for a class office musi be a siudeni in 'od siandinq wilh a high scholasiic average. To gel , name on ihe balloi, he musi submii a peiiiion signed lwenly-live regisiered Hyde Park voiers. He can esenf his qualiiicaiions ai an eleclion assembly. Voiers ,ssl reqisier before ihe campaign, be checked oii ai 2 polls, and vole secreily. In line fo vofe, Wanda Anderson and Palsy Haugh wail for Barbara Tiirner lo open The curiain and leave The voiinq boolh. Checking signafures, Rhoda Krichilslcy, Barbara Sievenson and Lillian Hauser, find ihal Alan Levin and Mike Kamerlinlm are reqislered io voie, 99 S , S Q W Student Council Members . . . Top Row: Sandra Besley, Iris Beller, Joel Shutro, Joan Budylc, Nadine Balmer, Sheila Goldman, Arnold Kanter, Sherman Silber Pamela Darby, Joan Hammersley, Crraceann Crawley. 2nd Row: Sylvia Williamson, Carol Atlcins, Allice Eichholz, Gerry Rizzer, Avery Dee, Franlclin Coleman larry Meyer, Richard Grant, Jan Grayson, Barry Schlesinger, Annie Dancy. 3rd Row: Sandra Davis, Cynthia MCC-hee, Patricia Calloway, Robert Barber, Robert Blond John t-tall, Anne Cohen, Paulette Solow, Pat Pratt, Kai-Fool: Chin. Front Row: Joan Lazaraus, Joyce lani, lreeilco liifhi, Sandra Cooper, Judy Weissman Barbara Greenberg, Nancy Israel, Barbara Simon, Marianne Shapiro. lrene lmada. Student Council Promote To promote the general weltare ot the studei body, l-lyde Parlcis Student Council acts as a gc between between the students and the administr. tion. Members are otten called upon to assist wit school visitors or spealc on our integrated communit' Composed ot two groups, a council-at-large, and a advisory council, the organization meets twice month. Council otticers, class otticers, division repre sentatives, representatives trom each school activitf and appointed advisers malce up the personel. A Student Council Scholarship is supported b money raised at the Faculty Volley Ball Game, th Faculty Stage Show, and a sale ot Go l-lyde Park bottons. Canned goods were distributed to need tamilies at Christmas time. Used eye-glasses were co lected and sent to Hong Kong tor the use ot childrer Officers . . . President, Maxine Epstein: Secretary, Renee Roth: Treasurer, Raye Linda Farr, Marshall, Richard Wexlerg Sponsor, Mr. Aaron Smith. ze Superman, Mr. Ziemba llies high lo relurn lhe ball Time cul lor Mr. Hasan lo eal lunch. Mr. Ziemba and Miss Mr. Helm. Marslon reprirnand lhe coach lor slapping lhe game. aculry Volley Ball Game his Easler bonnel, Mr. Helm will be lhe grandesl :nl in lhe game. Each year lhe Sluclenl Council spon- sors lhe Facully Volleyball Game lo raise money lor ils scholarship lund. Everyone has a good lime. The sludenls lilce lo lcnow lhal lheir leachers are human, and lhe leachers lilce lo lel lheir hair down and dress up lilce lcids again. The game is a conlesl belween lhe guys and lhe gals. Winning by eilher learn is clillicull because obslacles such as old shoes, shaving cream, and buclcels ol waler gel in lhe way. Prepare lo launch, shouls Mr. Hasan as he keeps lhe salellile earlh bound unlil lhe counl down. Believe il or nol, Mr. Hasan, in his balhing suil will lalce on anyone who lrighlens Mrs. Dubylc. General Gffice Aides Have Varied Duties The busy beavers who assisl The clerks in The General Office every day earn service poinls while gaining valuable experience. Their dulies vary from acling as receplionisis lo running errands. Looking up programs, sorling and delivering incoming mail, slamp- ing oulgoing mail, and keeping The files in order are only some oi Their assignmenis. The Treasurer's Aides issue receipis and roll pennies. Everyone is kepi very busy doing all kinds of odd iobs. ww Main Office Aides . . . Top Row: Ma Simons, Judilh Webb, Edward Benson, Ven Edmerson, Howard Pizer, Wendy l.ewi Howard Weiss, Pairicia M4iCoo. 2nd Row Frances Frman, Caroline While, Mariann Shapiro, Peggy Kamp, June Morris, Lesle Barnbaum, Anne Cohen, Toby Spievak. Frol Row: Mariorie Ginsburg, June Kiinhida, Ne omi Erenberg, Pai Prall, Sandra Cooper, Ba bara Simon, Carol Forman, Judy Weisxmai Valuable experience is gained by Ann Cohei Fay Bergslrom, Barbara Kurlz, l-lelyne Brody George Milchell, and June Kiishida as lhc help Mrs. Sheridan and Mrs. Nelson. Checking balances is made ea-,ier lor Mrs Nelson wilh Carol Forman, Marjorie Gina biirg, and Suzanne Kenner as asaislanls. Treasurer's Aides, Marianne Shapiro, Panleflr Solow, Toby Spievak, Pal McCoo, and Peggy Kamp gel a lesson in bookkeeping lrvin Mit, Rosa G-oldsberry. 'fendance Aides . . . Top Row: llene Bar isli, ,loan Cree-nwnld, Jean McNamara, lyifi VVilliam:,on, Charlene Paclner, Anifa essley, Maflie Alslon, Donna Dayi-., lnez Brin. 2nd Row: Graccann Crawley, Pauleffe oody, lidward l-lamplon, Jay Sfhapiro, fins Clay, Carlo Jones, Joyse Wilson, islm Hill. Fronf Row: Gudriin Micoy, iiali Lane, Diane Nishida, Brenda 'lhornpf n, Jani-l Bale., Carol Grow. dccfor's reporf niiisl be iliiw Iced by Mrs. ,irpliy and Mis-. Siilloimoser before fliey n aclmif any one whn has been silk very iffer nof be lafe again warns Sally Koslcy she llilfldfi lnrdy cardf. lo Sharon Wood, fAnn Krnyill, .lnycu Vlfilson and Pauleffe only lor llif' lliird liniv. 'fenclance Aides . . . Top Row: Tobbe Dee, eila Griill, Peggy Fdidin, Bonnie Malkin, blwiv lm-, Sliaron Wluiwd, Lois Benson, ida Heini, Marcia Dislenfield. 2nd Row: anvllo Bruce-, Arnold Knnlor, Roberl Bar' r, Sondra liiylor, Carol Afkinfw, Sadye- rald McSpadden, Gerald Ploflcin, Peggy imp. Fronf Row: Jo Ann Kravifz, Sallie isliy, fxrlllur l-lahn, Vi-ra hdrnerson, Judy iwnmii, Palsy Kebo. AQ Attendance Office Aides Are Indispensable. Hyde Parlcs Piffendance Office, commonly called II7, is one of fhe busiesl places in fhe school. Sfudenfs and parenfs come and go from seven in fhe morning unfil nearly four in fhe affernoon. Mary is lafe fo school and can'f gef info class wifhouf a pinlc card. Johnny has been home siclq for more fhan fhree days and needs a reinsfafemenf slip. Susie has a headache and wanfs fo go home. ln bad weafher buses are lafe, and long lines form, hopeful of an excused fardy card. Bofh Miss Solfermoser, affendance counsellor, and Mrs. Murphy, fruanf officer, are lcepf busy all day wifh fhe affendance problems of nearly fhree fhousand sfudenfs. Efficienf Affendance Office Aides assisf wifh fhe worlc of handling fhis endless procession of people wifh problems. Their main iob is checking fardy cards fo see if fhey are properly filled ouf, sfarnped, and recorded. Ofhers acf as messengers when sfudenfs are needed for conferences. V7 Grade Advisers' Aides . . . Baci: Row: Susan Schullz, Anncelyne Whilalxer, Billie Bransir-rd, Carolyn Smilh, Sue Slrosinski, Correan Barber, Roberl Blond, Franklin Coleman. Fronl Row: Pegi Slavish, Reyna Faermarlc, Rosc- R? oy, Delrrew Malhes. Grade Advisers . . . Mrs. Margarel Julslrom, Miss Maiel Kurrie, lvlrs. Enid Turner, Miss Rulh McGurl4, lvlrsc Sara Priddy, Mr, Hamlin Moseley, Program Personnel Back Row: Barbara Greenberg, Joy hlalfield, Brilvlwif- Lay Dr-lwiem Salcry. Fronl Row: Mr. Charles Mccarlhy, Torn Mad dr-n Pal Blanr hard, Jean Gilliam. Grade Advisers' Office The Grade Advisers give a specie counseling service lo lnlyde Park by assisl ing sludenls wilh lheir personal problems Queslions aboul program sequences, grac ualion requirernenls, and school rules ani regulalions are answered every day. The acl as liason officers belvveen lhe divisio leacher and lhe principals office in mal lers of discipline. They also inlerview a parenls who visil lhe school. Assisling lher are a corps of aides who acl as receplior isls and run errands lhroughoul lhe schoo ,ai 3 J wa Program Office Perpelual molion characlerizes lhe Pro gram Office rouline. Mr. Charles Mc Carlhy, program direclor, and his corp of able sludenl assislanls hardly find lime lo brealhe al lhe beginning and al lhe end of each semesler. Every sludenl ir lhe school musl be filled wilh a schedule before lhe semesler closes. Grades come in and many programs need revision. Ther classes musl be equalized and more pro grams musl be changed. By lhe lime lhe school is running srnoolhly, il is lime lc make plans for lhe nexl semesler's maslei schedule. Round and round in a circle goef lhe slaff worlcing on a iob lhal never ends N X Adiusfmenf Office Hyde Park's Adiusfnnenf Office under fhe direcfion of Miss Theresa Lynch now has lhe assisfance of fhree special service feachers, Mrs. Charline Casfori, Mrs. Rosel- le lsenberg, and Mrs. Esfher Zemans. l-lere, affer a series of educafional fesfs, each sfu- denf is classified according fo his abilify and inferesfs so fhaf he may derive fhe mosf benefif from his years af l-lyde Park. A psychologisf works fhrough fhis office on cases where emofional upsefs are caus- ing poor adiusfmenf in school. Sfudenf aides assisf fhe office by running errands. doing clerical work, and procforing fesfs. Adiusfmenf Aides . . . Back Row: Anya Glass, Leslie Shonfield, Elissa Blifsfein, ' xjgarbara Valk, Beverly Kurlz, and Jeaneffe Toda. Fronf Row: Cliff Rosensfein, .,,,l JAVL, af Blanchard, Marie Wheelock, Frances Srnifh, Meillyn Price, Beffy Messer. .gm 11' ,.',V .1 N.. Special Service Counseling Mrs. Charline Casfori Mrs. Roselle lsenberg Mrs. Esfher Zemans Placemenf Counselor, Mr. Walfer Dupyk, Adiusfmenf Counselor, Miss Theresa Lynch, helps Franklin Coleman make a decision, discusses sequences wifh a new enlry. Placemenf Office The Placemenl Office, under fhe direc- fion of Mr. Walfer Dubyk, has fwo nnain funclions. The firsf is fo assisf seniors in fhe selecfion of colleges or permanenf iobs affer graduafion. The second is fo find suifable placemenf for underclassmen who wish fo work affer school or on Safurday. The office keeps a file of recornmendafions and work hisfories for ready reference. Mr. Dulayk is always ready fo help anyone wifh applicafion blanks or scholarship problems. 5 Library Experts The Hyde Park Library houses over l0,000 books, 75 currenl magazines, and IOOO pamphlels ol one kind or anolher. Keep- ing lhe records lor such a large colleclion requires lhe assislance ol 4 leachers and 67 sludenl aides. While earning service poinls, each aid gels valuable experience as a librarian. The work is rolaled so each one has a chance lo serve al lhe check-oul desk, lhe allendance desk, or lhe reference seclion. Shelves are assigned lo each aid lor periodic checking so lhe books are kepl in good order lor easy relerence. Library Aides . . . Top Row: Palsy Kebo, Jean- elle Toda, Keiko Tajii, Janice Miller, Horlense Nash, Marie Turner, Toby Hayman, Harriel Gourdine, Sandra Bozeman. 2nd Row: Sandra Falk, Jean Pollack, Faye Highlower, Janel Rogoll, Belly Collon, Conslance Bozeman, Ross Harano, Sandra Besley, Yvonne Smilh. 3rd Row: Charlelle Marlin, Johnella Woods, Vernon Sanders, Joan Crawlord, Roberl Scoll, Lonnie Hicks, Elinor Powell, Bobbie Lee. Fronl Row: ln- grid Friedman, Paula Hollsladl, Joann Fuiimolo, Nancy Shapiro. Top Row: Palricia Baker, Barbara Wadlord, Shirley Creighlon, Linda Horila, John Burger, Pamela Allen, Linda Reed, Carrie Whilen, Mari- lyn While, Sallie Baniel, Sandra Tidwell, Pamela Volh. 2nd Row: Danny Friedlander, Palricia Sell, Karen Jackson, Roberl Raz, Iris Clark, Louise Baxler, Belly Williams, Fred Graves, Barbara Harper, lda Carler, Maxine Gowdy, Elizabelh Williams, Roscoe Jasper. 3rd Row: Lelia Wal kins, Michele Bernslein, LaVelle Johnson, Jerry Todd, Booker Morrris, David Rainy, Aucgusla Thompson, Carol Alkins, Alan Levin, Peler Puusepp. Fronl Row: Mary Tsien, lola Poinler, Rulh Anson, Carrie Jordan. Librarians, Mrs. Wilhelmina Craig, Mrs. Mildred Henry, Miss Fred erika Marslon, and Mrs. Arla Marshall, rnusl read accounl books as well as library books. .4.4...a Office Praclice Service, sponsored by Mrs, Dorolhy Gerwin, is a volunlary service orqanizalion. Aboul lwenly sludenls, usually responsible juniors or seniors devole one period a day lo lype, mimeo- graph, slencil, duplicale, or lile malerial lor lhe :enlral ollices or lacully. l-lyde Parlc should lhanlc all lhe aides lor lheir ellicienl worlc. iaclr Row: Adrianne Hansberry, Johnnie Marlcs, June Prine, loberl Gholslon, l.aJune Valenline, Vivienne Adams. Fronl low: Wardell Brulon, Shirlee Harnillon, Warren Berlha, Mrs, Dorolhy Gerwin. The Boolcroom, under lhe supervision ol Mrs. :oade and Mrs. Lislca, is hidden away behind lhe foodshop. Shelved here are lhe piles ol boolcs hal Hyde Parlc's lhree lhousand sludenls rnusl use ach semesler. Boolcroom aides help lceep lraclc ol II lhe books and lake care ol lhe shelves. Back Row: Pal Calloway, Julielle Miclcle, Janel Simmons, Bal Thomas, l-luqh l-lunler, Myrlis Brown, Alan Laslcin, Fronl Row: Judy Newman, Mrs. Liska, Sandra Johnson, Joyce Carriqan. Train Better Businessmen M xx mm General Business Club, newly or- ganized by Mr. Curlin, consisls ol aboul lwenly-six members. ll was lormed lor lhe purpose ol acquainl- ing sludenls wilh lhe business world oulside lhe school. Presidenl. Belly Kern, has planned several lield lrips including one lo lhe Board ol Trade, and lhe Federal Reserve Banlc. Slanding: Marlhenia Meqqinson, Mallie Alslon, Milne Goldsrnilh, John Clarke, Fred Graves, Diane Kirk, Sealed: Ida Bradley, Vera Edmerson, Charlyne Donaldson, Anna Chesler, Belly Kern, Anila Malhes, yigff V . , E ,W v ,M ,s . If-ff Egfr' Q' J ,f iiffgff iz, ff ffiff The Ma+ron's Office is a resling place for any girl in need of firsr aid. Under The guidance of Mrs. Julia Carr, lhe marron's aides may pun' a cool clofh on an aching head or sew up a rip in a lorn blouse. Many and varied are 'rheir dulies in rhis quief corner of Hyde Park. The Ma+ron's Aides, Virgie Nerrer, Helen Brown, Grace Hollins, Rilza Ferguson, Kafhryn Craig. Mary Jones, Jereldene Holmes, Paulelle Barnum, Micah Lane, Alice Ephriam, and Mary Lawrence gel' a lesson in lirsf aid from Mrs. Carr, Verline Mclinighi plays fhe vicfim. A Headache Cr Lost Book A Service Aid Will Help You The Los'l' and Found, localeol in 'rhe rear of Smilh Hall coniains many curious and inleresling arlicles Thar have been lei? be- hind around fhe school. Nobody seems +o wanl lhem. If you have losl a shoe or your harmonica, fry lhe los? and found. Who knows. you mighr find if. The Los? X: Found Aides, Elizaloelh Norswelher, Marie Golslon, Charles McKinnon, Marguerile Molon, Julia Sanders, Rhoda Krichilslcy, Barbara Gorelzlci, Yvonne Smilh, Myra Marlin, Alfreda Bogard, and Barbara Howard wail' lo serve you. 5 The Audio-Visual Crew, under lhe di- 'eclion of Mr. Oliver, runs lhe schools arge and valuable collecjrion of audio- fisual machines. The boys will deliver and uperaie a sound proieclor or lape record- er for any class af any lime. Service poinls are awarded on a descending scale. Each Joy siaris wilh 200. Every complainl sub- racls poinls. IOO poinfs and you're ou+. lop Row: Wilbcsii Mc,Clerkin, Lewis Engle, Roy Morrow, Jark lepliiz, Jim Slaver, Tommy Loflon, .con Cammon, Edward l-lamplon, Arlhur Hubbard. Ind Row: James Eufrell, Clarence Parham, Roberl lar, Frank McGee, Ronnie Saddler, Warren Evans, :loyd Price. Fronf Row: Mr, Oliver, Kennefh Iwan- xqa, Frank Jackson, Sieve Lang. Technical Experts Run Mechanical Equipment W... The Sfage Force, under rhe direclion of Mr. Gaskins, is behind ihe scenes a+ every assembly or evening performance. Wifhouf ir, lhe microphone mighl whislle or rhe lighls grow dim. Much of rhe success of any ac- livily in Loomis hall depends upon experls whose brains and brawn are al your service day or nighl. Lined up for inspeciion are Ernesl l-leinze, Dick Sfevens, Waller Allen, Billy Heinze, Mike Goldsmilh, Richard Levin, Ronald Enlzminger, Ralph Licklon, John Slevens, and David Skolnick. 9 Spanish Honor Officers: Mamie Wilson, Presidenig Louis Wilson Sec.-Treas.: Mrs. Charlolle Kniazzeh, Sponsor, Members . . . Back Row: Harry Fisher, Charlene Packer, Gail Greenberg, Louis Nelson, Ruil Siewarl. Fronl' Row: Toni Robinson, Donna Mur- ray, Joanna Williams, Marla Buffenwieser, Faye Highlower, Mrs. Kniazzeh. ! Language Clubs Everyone speaks Spanish in Poco a Poco, The Span- ish Honor Club al' l-lycle Park. Juniors and seniors wilh a+ leasl rwo years of high school Spanish may join. The members acquire a language fluency anol learn abour lhe culfure of our Spanish speaking neighbors while They enlerlain lhemselves playing Spanish Bingo or yisil Span- ish reslauranls. Le Cercle Francais is l-lycle Park's oldesl language club. This year lhe members sludied French ariisis and visiiecl Jrhe Chicago Ari' lnslilule +o see French painiings. Recordings of French songs and s+ories help +o acquire a real Parisianne accenl. Singing French songs and acling in French dramas make lhe meelings boih popular ancl enierlaining for all. French Club Officers: Gerry Rizzer, Presidenrg Joan Buclyk, Vice-President Marcia Difrman, Sec.-Treas.g Mrs, Florence Alwaler, Sponsor. Members . . . Sfanding: Jan Rosenfhal, Susan Schulrz, Renee Rolh, Ellen Zachariasen, June Morris, Barbara Dennis, Anya Barfh, Barry Schlee singer, Gerry Rizzer. Seared: Sheila Goldberg, Jane Schaible, Joan Hammersley, Frances Erman, Marcia Dirlman, Joan Buclyk. English Honor Players fficers: Vifarrfin BerTha, President icliael Leroy, Vice-President Kennelh eb, Secrefaryg Belly Jean Messer, Treas- erg Miss Myra Paine, Sponsor. embers Top Row: lris Clark, isepli Harris, Freeman Johnson, Beverly orris, Neil Marbell, Alan Levin, Sonia rClure. 2nd Row: BeTTy Messer, Ken' illi Livb, Miihael Leroy, Warren Berlha, 'illiam Dudley, Miss Paine. Fronf Row: :dy Newman, Rila Roby, Irene lmada. Q ' yi, Help Unite Nations English Honor is l'lyde Park's dramaTic club. Under Miss ,fines direclion, aspiring young lhespians can learn The do's 1d don'Ts. STudenTs learn To overcome shyness, gain poise 1d charm, and improve Their dicfion. Members also work ehind The scenes learning seT designing, choreography, and irecTing. Plays presenTed This year included The Cop and ne fXnThem and The One l-lundred Pound Bank NoTe. 'Spechen Sie Deulschf' If you do, you're likely To aTTend The meeTings ol The German Club, GemuTlichkeiTsverein. MeeTf ing Twice a monlh under The direcTion oT Mrs. Enid Turner, The German Club visiTs The German secTion of Chicago or lislens To recordings in German. The arT, music, and hisTory ol The German speaking people are inTeresTing Topics Tor discussion which, OT course, are conduclred in German. German Club fficers: Raye Linda Farr, Presiclenlg Mrs. iid Turner, Sponsor. embers . . . Shanding: Clnrislel Ebel, Neil inemolo, Karl Tillisch, Richard Tani, EcliTh ..-... ewman. Sealed: Raye Linda Farr, Glenn inahara, Mrs. Turner, Ned Black, Ar? ,lsr if L1 Conservation Club Enioys Biology Officers: Slevon Greene, Presiclenfg Jane Snhaible, Secrelaryg Mrs. Sheila Jacques, Sponsor. The Conservalion Club, under lhe direclion ol Mrs. Sheila Jacques is inleresled in increasing The knowledge ol ihe worlds nalural resources Closely relaled lo Biology, lhe group sludies conservalion wilh hilces movies, and visiling professors keeping lhem lousy. Top Row: Reber? Raz, Allice Eichholz, Dave Townsend, Jim Slaver, Sylvia Parlcs, Vera Edmerson, Peler Lewis, Sally Schwarlz, led Cenliiry, David Neiveli. 2nd Row: Gerry Rizzer, David Schill- man, Leslie Turner. Edison Malone, William Collins, Boolcer Henderson, John Millcinias, Clillon Madin. Fronf Row: Sarah Collins, Laura Wiclc, Edilh Newman, Sleven Greene, Mrs. Jacques, Jane Schaible, Barbara Dennis. Fronl' Row: Susan Delano, Joan Blalce, l-larriei Gourdinow Mi-ie dilh Darley, Mosella Nelson, Marlha Wong, Paula l-lollsiadl. Zncl Row: Mary Simons, Peggy Kamp, Peggy Hulchens. Joan Biidylc, Carol Schecler, Grace Salcuma, Winilred Mason, Richard Slovene, Top Row: John Slevens, Carol Willis, Pamela Darby, Jean Passovoy, Sandra Besley, Ralph Licldon, Kennelh lwanaga, Linda Lylhclce. iq 'ANY was icTronics Club . . . Presiclenf, boil Rav, Sponsor, Mr. Fdward ivvr, Sfandingz Ronald Miller, An 'nv Cirillin, Pi-lor Lewis, Sam Dan , Ti-d Cvnliiry, Seafedl Janice, L07 is, .loan Dawkiriw, Jviil Kew-I lVlr. iver, Roberl RAT, Electronic And Chem Clubs Blast CH The Elecfronics Club came inTo being in SepTember, l958, Ten a group oT elecTrical enThusiasTs asked Mr. Oliver To spon- r Their group. Roberl' Raz was elecTed presidenT and led The nys in making bells ThaT rang and radios ThaT worked. OT iecial inTeresT This semesTer is The mechanical operaTion oT ecTronic apparaTus. The members probe inTo inTernal work- gs of elecTronic devices and Tind ouT iusT whaT makes Them zrliorm correcTly. Chem Honor was new in February, l958. ExperimenTing under The direcTion oT lvlr. OsTrow, Their sponsor, The members have successfully avoided blowing OTT The roof or causing an earThguake. They have gained knowledge, however, which will help in college boards and give Them a broader knowledge oT chemisTry Than can be obTained in class sessions. Field Trips and illusTraTed programs add inTeresT To The meeTings. 1em Officers: President Fred Hirsch: Vice- Back Row: Je-TT Kessel, Dannv Kosman, Jav Kahn, Norman Bash, Ed Blum, Barry Schlesinger, Brenda egidenl, John MilkinTas: Treasurer, Richard Thompson, Mike PinkerT, Micah Lane. Doris Bi.rcheTT. FronT Row: Mr. OsTrow, Aaron Lifchez, evans: Seirelarv, Sandra Beslev. Ross Harano, John lvlilkinTas, Fred Hirsch, Dick STevens, Sandra Besley, Ted CenTurv, RoberT Raz. ca. Senior and Junior Math Honor For 'rhe pasl sevenleen years Senior Malh Honor sludenls have won lop honors in lhe Wilson Malh Conlesl and have rafed high in nalional compeiilion. Under The supervision of Mrs. Shull, lhese malh enlhusiasls are inlroduced lo higher malhemaiics. Problems in Analyiic Geomeiry and Calculus give ihern a good ifoundalion for college enlrance, scholarship exarninalions, or nalional, slale, and cily malh conlesls. Junior Malh Honor, sponsored by Mr. Herberi Helm, is offered fo Juniors inieresled in marhemalics who have a NG or loelier average in malh. Allhough lhey donli receive any credil or service poinls, lhe members find lheir experiences worfhvvhile and inlriguing. To slimulale a lceen inreresl, The club covers various concepls and phases of Trigonomelry, Solid Geomelry, and College Algebra. V Top Row: Dicl Slevens, Ted Cenfury, Heidi Spill, Andy Weissman Jams Waller Fred Hirsch, Barry Schlesinger, Annie Danny. Sam Daniel, Milf Pinlnerl, Second Row: Stephen Fawkes, Harold Shapiro, Slove Snhulscwr Danny Knsman, Jurgen Cooley, Richard Kelrhum, Brenl Benson Larr Meyer. Fronf Row: Edilh Newman, Frances Asher, Jan Grayson She-rrna Silber, Mrs. Shull, Raye Fari, Marfia Simon Kaiehnolc Chin, Today's Brains Top Row: Andria Eiger, Aaron Liiclnez Roberi Raz, Caroline Mason, Rnnali Weilz. Richard Sax, Elizabelh Pilcher, Jane? Kobrin, Susan Salrn, Jane Rosen berq, Anne Meyer, Second Row: Sieve lsenberq, Richard Tani. Ed Blum Ja Kahn, Alvin Masiov, Jeli Pan, Roberl Becker, Alan Cohen. Fronf Row: Pele Koch-Weser, James Lazarus Laura Wiclc, Joan Lazarus, Mr. Herberl Helnr 'va an :tors Many a befuddled l-l yde rlcer has been helped To see e lighl by The TuToring pro- am. Sponsored by Sigma and secTed by Frances Erman and rbara Freemond, sTudenTs inf resTed in helping oThers are signed To Those needing exTra aTrucTion. The TuTors musT be ps in The subiecT They Teach. Will Be Tomorrow's Leaders uiure Teachers if America Sharing experiences wiTh Their eachers, The l'lyde Parlc chapTer T FTA. has sTimulaTeol an ea- er qroup oT sTudenTs To enTer me Tield oT educaTion. Through TeresTinq programs arranged y Mrs. Kamins, Their sponsor, ie members have had The opf orTuniTy To discuss Their prob' me. wiTh boTh elemenTary and qh school Teachers and Thus ecide which level To explore. Top Row: Barbara Howard, tra Les Hooker, Earnestinv Russell, A nette Pierce Dallas Mrffree, Mir ael Collins, Karen Tabritius,Bru da Thompson, Lillie House. Se ond Row: Gherman Tux ke Thomas Swoope, Saundra Co' Loretta Husband, Harri-, Ashto Jackie Stephens Kirk Kirkwo Shirley Doke, Velma Allen, Fro Row: Stephen MrConico, Anr Chester, Shirley Mason, Ra-,nt Downs, Rebecia Johnson, Sylv Mills, Jeanetta MLBeth, Top Row: Marsha Lee. Nadi: Baker, Willie Jones, Bessie Jane Jimmie Gee, Karen Jackson, Ba bara Harper, Adelia Allen. Ma W W xxx, A ine Gowdy. Second Row: Le Webster, Ellen Zachariasen, Linn Simmons, Maggie Suggs, Cha 'ette Martin, Diane Kirk, Ann Andrews, Georgia Bell. Front Rov Patricia MCCOO, John Hall, Sai dra Davis, Sam Jackson, Lawrenc Laveta, Tyrone Brown, Cynth McGhee. Hall Guards Protect Property Typical Hall Guard, Osrar Bone cannot understand why Ruth Joni and Thelma Morris are scarec Atter all, they have a pass. Hall Guards have a big responsi- bility. Sponsored by a committee ot teachers, their iob ot assuring the sate- ty and security ot lite and property must not be taken lightly. They must always be on the alert tor tire, thett and rnisbehavior. Seated inconspiciu- au-,ly throughout the building, the hall guards watch the coming and going ot guests, students, and teachers. No stu- dent is allowed at a locker during a class period, nor may he walk through the halls without a teacherls pass. Guests must have a pass issued in the ottice.Strangers who do not belong are easily spotted and shawn the nearest exit. A good hall guard keeps a clean, orderly corridor at all times. -ll.. Klrlllllllsilli nf .JL-... Top Row: Ernie Thompson, Reg nald Williams, Leighton Jarksor Granville Ware. John Kent, Thr autry Appleton, Thomas Jenninq Robert Walker, Klaus Busch, Ar qelo Wallace. Second Row: Ec ward Hampton, Herbert Grax Steve Crawtord, Donald Murrai Harrison Cole, James William' Curtis Davis, Donald Green, Dor ald Smith, Robert Turner, Le Pearson. Front Row: Y-Esther Dall Mary Brookshire, Carl Boatnei Edgar Mcltlaskell, Ronald Woodr Betty Turner, Barbara Dennis, Hu ella Robinson, Signora Clemmone Nuts' 'l1a+ happens when you heal plaslic7 Cnr' Raed, Slanley lnduslrial Arls Club, orqanized This year by lvlr. Ralhnau, is composed mr llml Cl'l 'll 'i Dwwllll Bmllla' Whllam llm' of boys who excel in lhe lechnical held. They meel aller school 'ro work llnir Slrrrvlvr and Alwrixv Cook walih a dernonslralion hy + . 1, f h b d . h p yy U NU Q Nymmm ,MNHQLM md My Impplw Rammxx Spun on ex ra prolec S, some o w ic wi e enlere in conlesls suc as l o ,ii i Y is , 1 . K A i I i- .il lliv lnrlnilnnl Ari-, Clnlsl one sponsored by lhe Ford Foundalion. Men Only In Chess And Industrial Clubs. bilizers, Oli-n San.rliara Ronald We-ilz, Waller Hrar, NLR .ill xlllll1l'll Clwlwy, ,lay Kahn, Neil Kanernolo, Michael liW.n-ly, llvlnml l'.irlnm and Mr, lvlanarvw wallh Barry ixlr-simii-ig Kr-nm-lli lwanaqa. Richard lani and Dick Slevenfa ullli- il will a-was lho hoard, Winners will he Conleslanl lhv noxl diwlriil meel. The Chess Club is lhe ldaclc bone ol l-lyde Parlcls Chess Team which meels lwice a weelc in friendly compelilion, Lasl year lclyde Parlds learn reached The quarler finals againsl Von Sleuban High School. This years leam composed ol Kennelh lwanaga, Diclc Slevens, John Sleyens, Michael Schwarlz and Don Goldman will enler lhe cily compelilion. W-or gf E M sg...- Presiol Change! Cum Wcurrill girl-. rlmnqr-d liiii man lil rnumrny nw Cwri Forman, lrr-ne lnmdii fin Karen Cooper gli iriuri and round and rr-und, First 4B Sock Hop A Big Success Mofher and daughier dance? ll's only Raye Farr and her inolher doing lhe lirlci Pciki. Everyone agreed lhal lhe H48 Firslw was a grand success. Inspired by lhe senior class oi- iicers, various commiilees in diiierenl divisions planned and execuied lhe arrangemenis. The decoraiion commiilee worked hard lo Turn lhe looys gym inlo a lairyland wilh balloons and slreamers. The sleering cornrnirlee direcled by Mrs. Cohen, planned games which were fun I for bolh sludenls and leachers. The dance band swayed wilh lhe rhylhrns of lhe l-lolci-polci, lhe Mexican Hal Dance, and rhe Bunny l-lop. The senior class has eslablished a precedenl for orhers lo follow. Swing and sway lhe Wilhwn McClerlcii way. His music rnalres r-veryone wan 'o danre. Pu? your lei? hand in bul lake ii Cul. Mary Hughes, Mardell Brulon, Beverly Morris, Precariously perched on her ladder, Mamie Wilfmr liiine lnmila Vurline Milfnighr, and lfihy Spievalc will need bcvlli hands lor Their deuialea The Boys Gym lor The leslival wilh hal dipir rnas in June. lons and crepe paper. 'Eli WN if XX. mlm 5- I .,... M ..... K I ,gf 'uc' W, m,..,LL ,Me 4, av' . QX.Xx. A ,,. Modeling as a profosslon seomu brighf when prerfy Draffsmen are w H pa4d D an rom hn Mlm. Hanley ialkh abou? ir. Tec oufhne fhe prereg e Future Problems Solved On Careers Day Careers Dayx' is a special program planned for The 2A Through 4A sfudenfs 1+ Hyde Park fo infroduce rhem +o fhe farious occupalrions and services which +hey nay pursue upon graduarion from high ,chooI. lnviraiions were exjrended fo peopfe -rom all walks of life 'ro acf as counsellors. Sfudenfs were given Jrhe opporfuniry +o ,eloci The conferences fo visif. The rneefings consisfed of guesfion and Nurses are needed. Miss Corrine Tanner shows our Coffee break befween conferences qwes M155 Lynch and Mr Trwezenberg a chance out whai H Makes. fo rank 1 fhe spea s J wi? Y as ,.-90 Q 1 X Xp . ': IT: ' f as wg, WSL 2 55, , K . ., 4 'am VW jim xxvx sg- Wk Sf: NK Xl D ABQ. yi ' -with-12' 62,9-gxjxfqu X vi, :N Rgrx, Ax' .n2'.f,' af-i?Qgx'55. xX'gz1f3, EXW' 1 1- Aff: 292 ,Lg , . . jfs NVQ' . - . ,fix Q -mndllkf Nga fiwfii g:'Qiy- ,ZF ' qu 5:51. 'saw Sig? iii? .1-C' ' x f, ,. xi 5 .- Eggs. ax Wm . K, . S x .. Q 1 Y X F -V.-. 'f W wg. :pa 'www iw-Ssifss WS - 7 X syib - f -L If x lx -. e4 X ,., ,gg tr!-Mi, V' 4 ' ' ' - ' A I W X o - - ,A tfle . I ,A Q-, X Xvs gf , xkv Nd f. , ., . ev -'J N1 Kiwis K. . . . WE SHARE TALENTS AND HONORS Clolhing Classes hold a fashion show for fhe P.T.A. Barbara l-laehnlein models fhe iumper she made. Naiional Merii Scholarship semi-linalisfs, Danny Kosman, Joan Budylr and Barry Schlesinger dream of becoming winners. 3 X if Sigma Seniors . . . Top Row: Marria Simon, Myra Marlin Parmfa Darby, Joy l-laflield, Gail Herrmann, Rachel Friodland, Bonnie Garlnr-r Renee Rolh, Toni Robinson, Joni Cherbo Franiof, Erman. Second Row: Sz.-.an Schullz, Viclci Schwarlz, Sheila Goldman Fred l-lirsch, Gerry River, Sally Schwarlz, Barry Schlesinger Jurro Morris Raye Linda liarr. Third Row: Rnlh Ann Slevvarl, Fdilh Newman, Joan Budylc, Jan Ro-senllial, France, Asher Sivanne Kesner Joan Hammersley, Pamela Valli, Fronl Row: Belii lrlanlqin, Carol Forman Sire Slavish Doris Brrchell Jean Hayashi, Adio Miller Palsy Kebo Barbara lireernond. Sigma Epsilon Honor Society Fall Officers . . . Presidenl, Jan Rosenlhalg Vice-Presiclenl, Spring Officers . . . Presidenl, Par Alai- Vice-Presiclenl, Sazanrw Kei. .V ir' B dylf' Secrelary, Franfes Asher: Treasurer, Suzanne ncr: Secrelary, Jane Rrifrnborfi- Treasurer, Pizribi-lli Pilihor: Sponsor, Mi . lsr' Sponsor, Mi Miriam Erennwavsor. Miriam Brennwasser. Membership in Sigma Epsilon, lhe oldesl high school honor sociely in lhe counlry, is a covered honor. To become one ol lhose selecled, a sludenlr musl have received an E average in his maior subiecls and nor less lhan HG in any minor ihe previous semesler. Sigma has a lively program of service and lun. ihe annual l-lallovveen and Chrislmas parries are enioyed by all. Many siudenls visiled The Ari lnsrilule of Chicago where lhey saw lhe Orienlal exhibil. The semi-annual lag day raises money for a scholarship for some luclcy Sigma senior. Srudenrs needing help scholaslically in any parlicular subiecl may apply 'ro Sigma lor a lulor. Qnce a year Sigma expresses ils apprecialion lo lhe laculry by in' viling lhem lo rea. Members assisl lhe P.T.A. by selling flowers al Open l-louse. They also acl as guides for lhe Fresh- men Qrieniaiion Program. i 1 I gma Juniors Top Row: Pal Carnpbo wi llaranw, lhwqqy Hlilnlicwii-. Dwrina Davis iyfv Ri-inilz, llolvn Maurer, Ainwid Kanloi, , imlwlh Pilclwr, Jiicly lloini, ,lane-l Kobrir' arvlino Mawwii, lvlarlin Gro-its, Wcendy Wil, ' zconcl Row: Rwlwrl Ra7, Richard lani Leland Q-iilvriuq, Carwl Srlw.-lm, Grain Salcizrna Ed i uni, Nwrrimn Bash, ,lwhn lvlilldrilaw, Alice chliulz, Rulwrl Bmlcor, Alan Cohen Jane? ale-4, Bailmra Slevnn-iwii, Third Row: Bornie hillmvi, Gail Ciirfwrilwfei'q. hlrrd Bhyli, lrwiix Ne' ii Gi-wllrvy Ki 'xyxy vl, Jarnf-w lailcilllfi Linda Lylh m, .hiari Crm-iiwalrl, Janice? Karioinulw. Fronl' ow: ,Ivan lafiiiiiti, Cmnl Giulia., Si,-yan Salrri anna lVli,i'rfxy, Joyce Cariiqan, Laura Wiik .ilhy Slavvi, Jam- Siliailwlv, .Irina Ri-:.o'iherf!, igma Sophomores and Freshmen Top ow: Allen Slossrnann, Gloria Davie Johr' lm-ycriw, lla-iw Barrnat-h, lwluy l-layman Ken- rlh Iwanaqa, Roqsr Price, Peqqy Gibbons, -iwini liroiilworq, .loan Hill. Second Row: Myra layi-r, ine-qqy Kamp, Slanhey Perlrniiller Don mlclman. Clare-nro Parham, Rinhard Collon, wan l'3awleins, Anne Cwhen, Carol Shiraiwa. hird Row! Sandra Johnwn, Joyce lani, Richard rranl, Bwlu Salvalh, Lewis Enqol, Carolyn Sian wrd, Harriel Gwiirdine. Fronf Row: .hidy Gen- vl, Silvan Delano, Sharon Wheeler Palricria Mlm, lclvh-ii Ninliiw, Pe-qi Slavish. lecognizes Scholastic Achievement we scholarship fund qelf, mivllivi' qiiailei bid Befh Hanliin Pal Canwpheil Back scrafchers. Belh l-lanlsin, Rulh Ann Slewerl, ancl Raye ian llnyawlii, and Jiinu Morrie zilill have more lane if se l. Farr play name hinqo in a novel manner. lj AN i :s '1Sis1yii,3 Nwl I We-wi y y y Z 5 Q f -. -E z ,.,, 5 i - - ' 5 I f 'EW' J ,..,. xi: Av., A ,:, I ' i ifiyia - , -W f 1 - -'--'.,1 -' Q ,R ., gi '-5:f.. 1 .- -ri K, -all ay My S .:.,.. A f K S. is ff , 5 A X 5 2 ,Q Q 2 K Qmwm S6 wi ' I X ..,Nx I is law e HN 3 AHen'fion, harlv, Sql. Rosenherq lllll Plc, Birge, lsenberg, Niclcin, Farr, Bi Ar' :iw ,H-.N l i'C iDierwCl. Faculty Stage Show lnspeclion by Jay Shapiro reveali, all soris ol Corilraband in Miss Pelrie's ' ' 22 gif? v V . if f 2 X N xx! an X pi yi ,- .xi . N X 5 T iii-il? N is l 4 1 is 1 , in-1.1, 'fa ., 'fir H ie in W 1 a B Q . 3 r ,iz We my ,.,,. E S s Gerwiri and possession 124 xg 5 i 1 1' N --.fi N 'F' me, xr Muay N We 'Q An Oscar lor Miss Rulzlcy if Sayonara goo-, well Lillle lcnown ralenls and remarlcalole Cos- lumes are unveiled each spring af lhe Facul- ly Slage Show. Pushed by rhe Sludenl Council, ihe laculry really lels ils hair down and goes all oul To raise money for Hyde Parks Scholarship Fund. Mr. Qsirow in his Nsacgl? urealed by 'Chrisaimas Fiorefl Miss Pelrie in her oyeriurned lamp ahade, lhe nor so well Trained army in sloppy socks are all parl ol lhe lun. Solos and recilalions, good aciing and had, weird gerfups and fancy props malce a show lhar is indeed dillerenr. For lorly minules The audience can giggle and laugh, whoop or holler. The Faculiy Sfage Show is a once a year muki on every sludenlsi agenda. 2 Fa gas x v . '- Q X , .,..g X - + -2551 .- X Eunning for Osirow, Mr. Hdvn umm dwwvx 1 f Vin-v Yann M91-1. Has Talent lx X S 5 L. Y' xg x ' Zi?-. 2 . - 2 f 5 N , A ., Magnified chewing gum Irmfovforefz WMM Mr, -lwn-.4-nk da M WOr'xl-nl! Of Uwe' A NIYHK G, :efching indeed in Mr. Ozmww In Mi-, r A xvoafiww fav fvm-if im Cfufufrw1n'. Iwrf' 31' 4-A ,RA .4 an w QF' ,. 5' ff E. Maxx ly x 4 rg.- wf' aw .ffm gl wr: 'N 1 6-uew'Q' Altchpe Presents Its Staff For llne lirsl lime, lull color piclures are included. For llwe lirsl lime, llwe book conlains a General Index and a Personal Index. For llwe lirsl lime, we have a plaslic cover lo prolecl and beaulily our yearbook's cover. More pages have been add- ed and all llwis has been done willioul increasing llrie price ol llwe book. We lwope you like your I959 Ailclnpef' 1 Annual Agenls . . . Top Row: Carol Boyd, Frankie Fiillon, Lynne 'iiina'-, Pamela Allen, Marllwa Q'Kennard. Anila Pressley, Caroline Scoll, Geral dine Bowers, Sandra Besloy, Roborla Wexler. Second Row: Hnolla Robin- son, Allice Eiclwlnolz, Micliael lsacson, Robe-rl Turner, William Dudley, Wall- er Rappeporl, Charles Loilz, Riiliard Libles, Sylvia Parks. Third Row: Kii Narimalsii, Alice Boolln, Joan Alex ander, Lillie House, Mary Boll, Shir ley Doke, Marilyn Pino, Rnber1Green Wald. Fronf Row: Mary Lawrence, Bonnie Koch, Rose Pellis, Carol Levy, Ella Wynn, Linda Lyllicke, Bonnie Garlner, Nancy Sliapiro. Hydeparker Staff Ediior-in-Chief . . . Fall . . . Nanfi Srhulson Spring . . . Gerry Rizzer Managing Edilor . . . Fall . . . Gerry River Spring .... lean Budylr Page Edilors . . . Fall . . . Joan Budylc, Slevnn Greene lr! Mallin, Richard Wexler, Sherman Silber. Spring . . . Sleven Greene, Raye Farr, Sherman Silber Richard Wexler. Ediforial Assisianrs . . . Fall . . . Ned Bloflr, Raye Farr, Joar Lazarus, Kennerh Liab, Claudine Whilalcer, Wendy Will Spring . . . Joan Lazarus, Laura Wirlq, Alliie Fichholz Wendy Will, Joel Shulro. Circula+ion Manager . . . Larry Meyer Phofographers . . . Rirhard Corian, Ralph Licldon Ari' Edifor . . . Jean Pailaek Adverfising Manager . . . Bob Cornis Sponsor . . . Mrs, Bernife Cohen Fall Edirors, Nanci Sehulson and Gerry Rizzer, cherln over an issue wirh Mrs. Cohen helore ifs disfribulion. The Hydeparker Gets The Spot News The l-lydeparlcer is your newspaper. Published Twice a monrh, your paper has won narional honors lor irs general design and news coverage. lr gels all rhe news while il is slill fresh. Slu- denls have a ehanee lo venr rheir personal opinions on pro- vocarive guesrions in lhe edirorial seelion, display lheir erearive poerry and wriring rhroughoul rhe paper, and read rheir divi- sion gossip in prinl. Clulo doings and lerlers fo rhe ediror rnalce inleresring reading. lnlerviews wirh guesrs and lefrers from graduales lceep you informed on imporranl nnallers. Announcemenrs oi eleelions and honors appear hrsr in rhe l-lydeparlcer. A complele sporls page gives news of lhe garnes and inleresling side lines of The players. The enlire paper, eomplere wirh phorographs, news, and earloons, expresses lhe personalily ol Hyde Parlc. Planning 'rhe nexi issue, Eleven Greene 'K lra Ma lin, Ru hard Wexlrar, Ralph Lick' lin, Rif hard G' llnn, Joan l-lill, Sher- man Silber .han Bhdylc, and Raye Farr if Flrifidfl lo ihanqe llve layfiul. MAM9g,.f. eporfers Sfanding: Marilyn l-loifman, iilwael Smiilm, Leslie Kramer, Allen Sfessman, ian Greenwald, Toby l-layman, Nanny Wa- nalwe, Sieve Baruclw, Kennelli Lieb, Allice Cliliolz, Joel Sliulru, Wendy Will, Sealed: wid Pruslen, Ann Draznin, Carol Gross, Carol -yy, Sloyen Sliufro, Necl Bloclc, Joan ecvllrey Kessel, Peqi Slavislw. Lazarus, rporlers . . . Slanding: Sue Hullner, Lesley rnlwaum, Jean Pwllack, lria Beller, Vivian alnil, Mary Wiasler, Andria Eiqer, Laura iclc, .loan Alexander, Eliasa Blilslein, Alice Milli. Sealed: Lesilie Slwonlield, Bob Cornis, ni Daniel, Ricliard Sax, Jean Schneider. Judi ire. acl: Capiains . . , Top Row: Peggy Gibbons, 'endy Will, Kalliy Slayer, Andria Eiqer, arria Simon, Frame-5 Asher. Second Row: Cliard Sax, Clnarlea Middleion, Gerry Riz- r, Suzanne Kesner, Janet Kobrin, Fronf Row: arioriu Ginsburq, Carol Forman, recne, Riilward Granl, Joan Lazarue genfs . . . Top Row: Ilene Barmaeli, laaliinqlun, Wynefla Miller, Susan arfia Dislvnfield, Joanna Williams, yer:-, Eileen Clwisum, Joy l-lallield. rw: Mary Sorrell, Marie Golsion, auqliier, Freeman Jolineon, Roberl Sleven Sek palia Sailwuliz, Donella Second Clwesier Be-Clcer, 'iarlone PaLlxer, Belly Turner. Third Row: loria Simms, Siqrid Swanson, Grace Salcuma, iclwen Cooley, Garland Wesl, Georqe Calel, irluara Olsen, Froni Row: Carol Gross, Sliaron ilieeler, Carole Ymluda, Judy Newman, Char' we Donaldson, Myrlia Brown, Dyanne Deis. 'Y' Z 22- 'K' '325a,,, fa-Q.. Wfgv. M - X, lu.- M ,,,,, ,W V N4 'E' Q if U ll ax- E2 E . My if , fs ,,, X 3 ,W 3 lc 'KS' M 'I?!5E: g5', E:. .S Q E f, -3 , - 'KJ 'Q ,Jive ' ' ,Qwiiitii x ' - :num ? 1 llifggiig, -wtexnnsh: M' L 'Qillti W 1 2 ' . xii Q Q wx NXXQN N vw 4' N , 'il sf 15 SI lin, VN ik? .-3' , iimlnssln ..,. W X X Q t ig nu , M- U, sf 1, . .axis . 2 .- ' 91 - ' ' f X 'It'. -. 34 ,fwxg ' U --k-: 5 Eiixiggk ....,, X 'W '29 ' i ,i I Y I silk mga X 5 Sa E- ssay N if DEE? A 5 N ' Raw Q , 9 55 4 xx S3455 H f A at N ew ' 5 45 digg!! K Q X S E T li 1 nf - we 4'-5. iw Y' A e 5' Q1 kk iv b' 3 S A ,.. . W .ff in . . xv S Qi' rf ww if X 1 va 'Y 'X Wim. if -5. X . s ,l, T? The Mixed QuarTeT, Carolyn Brown, Ken Lielx, Carole Travis, and James HunTer .ang Willi A Song ln My HearT al The Choral COnferT. H Q i . 2 The Senior A'Cappella Choir helps inTegraTe Hyde Park High School wiTh The communiTy by giv- ing concerTs ouTside The school. This year The choir sang Tor The LEA. aT The Sherman HoTel and aT The Museum OT Science and ln- dusTry. They also sang aT various churches and synagogues. LasT spring The group enjoyed making iTs TirsT long-playing record. IT was a greaT success and quickly sold many copies. Sr. A'CappelIa . . . Top Row: Tom ShelTon, Al Jefferson, Leroy Sc Duke WrighT, Bob Walker, Bill Green, John Randall, Roger Wend Dave Boyd, Franklin Coleman, Herb Rochelle. Second Row: Ross Ha Todd Robinson, Bonnie GarTner, Cynlhia McGhee, Veronica Williams, Herrmann, Carole Travis, Eli7al1eTh Williams, Carol Howell, Ca Rodgers. Maxine Dennis, Wendy Lewis. Fronf Row? RuTh Hughes. Gendel, AniTa Shulrnan, Carol Levy, Pam Voih, Doris Land, Beisy L Marcia Simon, Hannah Loeb, Wendy Will. A'Cappel Jr. A'Cappelia Top Row: Joe Brazelion, Daniel Goldman, Reynolds, Donald Murray, Glen Eldridge, Lorenzo King, LeighTon son, Leroy Conley, Leslie Turner. Second Row: Danella Myers, C Davis. Diane Robinson Helen Maurer, Palricia Blake, Fvelyn Blair, T' Robinson, JudiTh Nance, From' Row: Laurie Allman, Susan Salm, l BooTln, Mamie Harris, Carolyn Troll, Andy Troll, Beverly KurTz, Gene Lir Q 5 , gf i ....i :.-' i'-. i , ' Q .' Nxialws W fW 4, MW . ff W ffl 1 -S i el A'CappeIla . . .Top Row: Madison Boolh, Gerry Rizzer, Regi Williams, lrliinlnr, Dave Maybell, Crvadel Jones, Charles Middlelon, Eugene rrison, Ron Friclie, Curley Bledsoe. Second Row: Annie Hardaway, lu Knoino, Baila Haelinlein, Sandra George, Carolyn Brown, Rachel :dland Ann Rviwilnh, Donna Davis, Jan Kobrin, Ken Lieb, Ted Cenfury. ni Row: Mr. Hursl, Jan Rosenlhal, Vicki Schwarlz, Toni Robinson, iiannv Shapiro, Joan Greenwald, Sue Sfavish, Kaaren Cooper, Barb ion, Bath Hanlqin. Aa kes Recording A'CappeIla . . . Top Row: Roborl Smilh, James Hunfer, Roy Balmer, iiiol Garrc-ll, lireeinon Johnson, Leon Cannrnon, James Reynolds, Her- n Wollf., Frank Ja-kson. Second Row: Sue Slrosinski, Caxrol ljiqmell, lqa Maflhies, Barlmra Pasrlial, Eulalie Luke, Nellie Anlhony, Marcia icr, Cynlliia McGhee, Froni Row: Mr. Leonard Hursl, Sheila Graff, llofla Milcholl, Milci Sams, Bonnie Mallcin, Virginia Weimer, lleen move, Judy Gendcl. e is s 3 2 Q The Junior A'Cappella Choir gives our younger vocalisls a chance To rrain for Sr. A'Cappella. Joinrly, fhey sing in Spring and Fall Music Feslivals and al various assemblies. The besl from each choir are chosen each year lo sing as a combined group in lhe Chicago High School Music Com- peiilion. l-lyde Park received a superior raring in I958 in comp- elilion wilh olher Chicago High Schools. 3 The Male Qua r1'e+, Cnnlury, Willicairi Maybe-ll harmonize Concerl, Roger Spencer, Ted Green, and David lor ns ai lho Choral Tweet +wee+. 1wee+ on fire piecoio ioois idiin Newman accompanied by Miss Ruizky. Concert Band Direcfor, W. D. Olive Fiufes: Ediiiw Newman, Anne Meyer, Vera Davis, Theresa Davis, Ruilw Friediander, Oboe: Jean Passavoy. Bassoon: Annceiyne Whiraker. Clarinefs: David Townsend, Pameia Darby, John Cody,TnOn'1as Wefzei, Warren Wiilirnan, Saiiie Baniei, Peier Koen-Wesser, Michael Belden, Wiiiiarn Trigg, Gaie Dnifeli, Mary Merediiii, Melissa Masse, Ronaid Liiiy, Arnifa Carmicnaei, Louise Baader, Mary Jei- Verson, VVaHer Bynes, Saxaphones: Ronaid Woods, Myriie Sornersef, Boniiacio Rivera, Nicnoias Rob- eris, James Tlwornfon, Sfudenf Director, David Townsend Horns: Joseph Siifier, Alien Smiiii, Cimrie-, Siew arf, Corners: Wiiiiarn Coliins, Ciyde Andrews, Haroid Snapiro, Anfiieny Wiflax, Tins Urian. Trump- efsz Sfeven Snufro, Lewis Fnqie, Ernest I-iirn, Ririi- ard Green. Barifonesz Wiiiie Slime, Wiiiifv Smith, Frank Diiiay, Frederick Randaii, Ciyde Ciayion. Trombones: James Jenkins, Arfniir Miiiie-rier, Fwd Snare. Tubes: Nberf Goodiew, Bunce Nasir, Ray mend Grimes, Nici: Haii, Drums: Diwnaid Tanaqi, Carl Davis, Bernai Davis, Wiiberf Spearman. Tym- pani: Wiiiiani Baify. k' Concert Orchestra Director, Joseph Pilar Firsl Violins: Josephine Morris, Joyne Carriqan, Helen Maurer, Sandra Pryor, Donald Breakslone, David Noivell, Alqeria Vauqhn, Anna Barlh, Mei Yinii Moy, Belly Waqner. Second Violins: Pear- iie Nlfilliains, Txzrvey Davis, Janice Schaller, l-lelen Jones, Roherl Miles, Bernadine Reed, Eunice Bald- win, Belly Cnllori, Todd Robinson, John Randall, lela We-lvsler, William Woo, Hallie l-lenry, Terrel Bii lcliani. Second Violins: Palricia Thomas, Gloria Harrinq' ton, Mary Brock, Sadyaerald lvlrSpadden. Violas: ldilli Newman, Carol Clay, Edison Malone, Sharon lliizior, ,Axlliie Eirhholz, Merrilyn Manqrurn, Marie lhrnei, Kallierine Curry, Censlance Bozeman. Cel- Concertmistress, Josephine Morris los: Laura Mahon, Vicloria Phelps, Gwendolyn Bennell, Rose Pellis, Rosa Dancy, Veronica Ram- sey, Reherl Sfell. Basses: John Golliday, Don Goldman, Biirlce Nash, Chesler Slanqhler. Piano: Barbara Walson. Joyce Wilson. Fluies: Anne Meyer, Theresa Davis, Nora Norlh, Oboe: Jean Passovoy, Clarinels: David Tewnserid, Waller Bynes, Melisse Masse. Bassoon: Anncelyne While alcer. Saxaphone: Myrlle Sornersel. Horns: Joseph Siliier, Charles Slewarl. Trumpels: William Col lins, Frederiflc Randall, Gherrnon Tucker, Anlhony Willpux. Trombone: James Jenkins, Percussion: Donald Tanaqi, Carl Davis, Bernal Davis, Rosemary Riley, Annie Dennis. X A S- ,. Q S' i -,,,s.,,,., R5 5, YD if am ,T5 ' ,- f 1:: : J ,..'. 2 L 1 as .'.' as 4' . ,IEE 'I In ,,,x.,b. I .,,. ,,:, , ., . A A ,..,..,.: ..,: . , A .- .:,- X32 zntt xg Th e Girls' Quinlel, Jean Gilliam, Sandra Evans, Rosa lliiiipen liali laggerl and Joan Blake enlerlain al lhe Cl lrrrwl Cor' erl. ......4-.i..4 Girls' Chorus Girls' Chorus was divided in lhe lall ol i958 inlo Senior Girls' Chorus, direcled by Miss Lois Winrow, and Junior Girls' Chorus, direcled by Miss Anila Rulzky, lo permil a larger number ol girls lo parlicipale. The sen- ior chorus enlers inlo cily music compelilions and awards swealer emblems lor service and excellence. Bolh choruses sing in our evening Choral Concerls, given lwice a year and al various assemblies. .file K 136 ' Senior Girls' Chorus Officers . .. Presidenl, Ru-.a 'lhiqpenq Vice-Presidenl, Sondra Odenq Secrelary, Joan Blake, l-larriel Jackson: Treasurer, Barbara l-lall: Sergeanl-al-Arms, Sandra Evans. Top Row: Olivia MiCoy, Brenda Gra- ham, Brenda Cloiise, Joann Van Duyse, Maxine Gowdy, Annelle Pierce, Carol Boyd, Jackie Slephens, Beverly Mallhows, Annie Giles. Second Row: Bobbie Lay, Harriel Jackson, Diane Robinson, Joan Crawford, Belly Wagner, Karen Jack son, Sandra Taylor, Sandra Evans, Sondra Oden. Fronl Row: Palricia Pellus, Bar- bara l-lall, liah Taqgerl, Lovie Lindsey, Keiko iaiii, Jeanelle Walker Joan Blake, Mrs. Lois Winrow. Junior Girls' Chorus Officers . . . Presidenl, Con-,lance Mor ris: Vice-Presidunl, Olivia Young: Sec- relary, Jackie Husband, Ann Koiyurni, Thelma Morgan: Treasurer, Pal Baker, Bobbie Garner. Top Row: Vickie Windsor, Olivia Ywiinq, Barbara Richardson, Sliirley Crockell, Jean Dawkins, Annelle Davis, Annie Wrighl, Doris Jordan, Gloria Gross, Fannie Garmon, Second Row: Anila Murray, Ella Harris, Phyllis l-loward, Marlha Jenkins, Ruby Eeallierslone, Chery' Callell, Barbara Jack-lon, Bobbie Garner. Grareann Crawley, Bonnie Janel Lewis, Slephanie Grilliii, While. Jonelle Washinglon, Mary Wissler. Fronl Row: Jeannie Schneider, Marlene Reese, Ann Koizumi, Helen Nishia, Sharon Wheeler, Susan Delano, Joanne Jai kson, Jacqueline Husband, Sylvia Chambers, Palricia Baker, Olivia Anderson, Joyi ilyn Candill, Sherlon Turner. ioys' Chorus . . .Top Row: Jaclc lep il7, llniry Wlilli-i', Rulwerl Morrow, Dun 'Xviclvi-wiv, Willialvi Bollun, Jerome Muse- Q. Dy, lalvlair Vlfalo, Willirr Anderson, Ellis lonz-ri, Second Row: Michael Blailrwell, Solonmn Polk, Boolu-r Mnoris, Wils,iiii ', Ei: :'1 3 ,ewis, Cliarlof. Slowarl, Williz: Driver 'anderson Williams. Herman Williamsrin, Willie Ke-lly. Third Row: Mr. Hursl, Sam ir-I Raynor, Rohurl Dase, Fallon Mc- Dowi-ll, llicwn Rayiiald-,, Millon Dauqli- rrly, Carlo Joni-s, llioresa Davis, pianf ul. Fronl Row: Arihic Julien, Kirlc Kirlc oy, lJVCf-lOl1 Bowie, Roborl Wliillield I :liailvs Franlxiin. Ronald Donner. Q S X c sc 3 s o Boys' Chorus and Dance Band Entertain. lance Band . . . Top Row: Wil am Baily, Tony Willox, Clyde xndrews. Jolin Golliday, Roger pencor, George Johnson, Arlhur flicliennr, Bill lroller. Fronl Row: Villuon MiClorlcin, Ralph Liik wn, Gain Dhllnl, Pamela Darby 4elvin Smith, John Cody. David ownsend. The Boys' Chorus of lilly-live voices parlicipales in lhe Fall and Spring Music Feslivals al l-lyde Park and gives concerls al com- munily churches. Their reperloire consisls ol numerous spiriluals and numbers lrom Broadway Musicals. They have mainlained an oulsland- ing srandard ol performance in annual cilywide compelilion re- ceiving 'Superiorl' rarings lor sevf eral years. The Dance Band furnishes lhe music for l-lyde Parlcs Senior Vari- elies and for olher school dances and enlerlainmenls. They bear our lhe rhylhm ol Rock an' Roll wilh lhe grealesl ol ease. David Town- send, lhe sludenl direclor. can malre his saxophone wail along wilh lhe besl, Wilbon McClerlcin and Ralph Liclclon, pianisls, can Tickle lhe ivories as soloisls or swing along wirh 'rhe band. Sfudenf Direcfor David Townsend i Q V I - T T is 4, .. Tx l S sf Q Sfring Ensemble Personnel . . . Gwendolyn Bennell, Terrell Biclcham, Con- slanfe Bozeman, Donald Brealcslone, Carol Clay, Belly Collon, Rosa Dancy Eurcey Davis, Sharon Dozier, John Golliday, Gloria Harringion, Helen Jones, Merrilyn Manqrum. Roberl Miles, Josephine Morris, Mei- Ying Moy, Burlce Nash, Rose Pellis, Rose Riley, Roberl Scoll, Lela Websler, Poarlio Vlfilliams, Joyce Wilson. The Sfring Ensemble, sponsored by Mr. Joseph Pilal, is une usual because il plays wilhoul a visible direclor when il enlerlains al PTA. and Teacher meelings. This group of lwenlyfrhree slue denls has a reperloire including a wide variely from 'rhe serious Baroque lo gay show music. They play al elemenlary schools. English l lonor Plays, or dances wilh a variely ol slringed inslru- menls. String Ensemble Ancl R.O.T.C. Bancl Are Active R.O.T,C. Band Personnel . . . Top Row: William Baily, Billie Troller, James Ji-nlcins, Clyde Claylor, Louis Tidwell, Niclc Hall, Clilion Eddie, Edward Benson, Donald Tanagi, Henry Simon, Lawrence Walson, Bernal Davis. Eronl Row: Vlfilliam Trigg, Roberl Scoll, Boniiacio Rivera, Willie Henry, David Townsend, Ghermon Tucker, Michael Samson, Charles Slewarl, Riilifiid Greene, Arilluiny Willcvx. The R.O.T.C. Band is an aclivily ollered lo boys lor civic poinls or in place ol gym. Sgl. Spencer direcls lhe mililary as- pecl ol lheir lraining and Mr. Slaszalc, lhe music for lhese lhirly- one boys. They lead lhe 'Field when our lroops have Federal ln- speclion in June. They march on Armed Eorces Day and in lhe Memorial Day Parade. The band also can be heard al loolball games and assemblies. f sw ' The Cop And The Anfhe-m linds Kenneth Lieh on park lrunili plciyinq lhrv pail ol n bum, The Enqlfsh Honor Players under The di- eclion of Miss Myra Paine have presenled ine plays lo Hyde Park audiences lhis ear. OiHenry's 'ilhe Cop and lhe An- hern' slarrinq Ke-nnelh Lieb and supporred by Josephine Harris and Belly Jean Mes- ,wr wwf. parl of lhe lnll P.l.fX. Open House uroqrarn. Michael Leroy and Neil Marbell ,eaclcd lhe casl ol The Million Dollar lank lNlole hy Mark Twain, given lhe same iiqhl. 'ihoolbnllsi' enlerfained lhe spring FTA. eveninq nneeling on April 9'rh. Qlher plays presenled in lhe lilrle rhea- er for sludenl audiences included Jose- nhine Niqqlios Sunday Cosls Five Pesos, 'games Barrie's mysiery Shall We Join lhe aches? and John Galsworlhys 'iSlrile.'l Dn The liqhler side were A Girl in Every 'osfw by James Fuller, 'Nobody Sleepsw ny Guernesey Le Pelley, and 'iCharlie's Xunlm by Brandon Thomas. English Honor Goes On Stage The Million Dollar Bank No+e linds Mirhac-l Leroy Yryinq fo use lw null- lo pay lri-, Clark lor his dinner. Waifing for fhe bus, Kennelh Lieb lhinks he has a pick up in Belly Jean Messer. Charlie's Aun+ proves lo be lhe life of lhe parry inslead ol' a qood chaperone, f,r-w M Liquid Gas made by Heidi Spilz and Jay Kahn won a firsi place in Chemisiry. if 1-M x 'wmwwm Winners in lhe Dislricl Science Fair held a' Hyde Park on March IO+h showed slcill anc originaliiy in preparing lheir exhibiis. In Biology Ralph Licldon had raised mice oi many shades lo show generic influences. ln Chemisiry, l-leid Spilz and Jay Kahn produced liquid gas. lr Elecironics, Leland Neuberg and Ned Blocl demonsiraied open circuiis. ln Malhemaiics Edward Blum loolc firsi place wilh his Mall Phenomenon. ln Physics, Ted Cenlury preseni ed Elec+rosJra+ic Linear Accelerarionu and Leor WM- Cammon and Sidney Jones collaboraled on 6 high aliiiude roclcer, N-.. . QV 1 5 gags Hyparaellipiic ln'fini'rum caused Sam Daniel io build ihis Tower of Babel, Wizards Exhibit Ar Science Fair High Al+i+ude Roclref made by Leffn Cammon Elecfrosfaiic Linear Accelerafion has Ted Ceniary Open Circuifs aren'l fniiin-,iiiq iii Pam Darhi :way Hlvlaxl ell any momenl. aliachinq Tubes. and ,loan Budylx. N L,A, .N - X il A. - e QB Jne, l-leidi Spilz foes oil. we is Prepared lo launch, Rayda l-lealh and Rulh Bellelheim l rehearse lor lheir appearance on Mars. 1 fi ....,e,... H 35' f sem Q 253.1313 A ,Si N 54-QALLUU VATER sa gi-J : e ..xA K X Q Nine-if hw? x i S 1 ,-.- I -- - g ' S . T,-L, se5ef-elkfss-i?f' c- f- ' M' Milllnaf, -KFl 'i,,Q.c.: ! i' Neptune's Daughters presents Two, Helen Maurer foes, loo. Our Of This World . On April I5, Neplunes Daughlers pre- ,enled A Science Ficlion Fanlasy eniilled 'Oul Ol This World. Direcled by Mrs. vlaurer, lhe group Turned lhe swimming nool inlo a space ship which lraveled 'ro 'he ouler reaches. Weird cosiurnes and .lrange lormalions depicled olher planels vhere men are Marlians and women have :ish lails. No fabulous gems were found on Salurn nor flying saucers on Jupiler bul lhe 3.T.A. enjoyed an evening away from lhe :lull earlh. The spinning ring of Salurn revolves wilh Laura Wick, Pegi Slavish, Jane Schaible, Joan Hill, Susan Salm, Sally Shapiro, and Anila Talungan forming a slar. 141 fa NSuM,Do, 6 N-omkwoilwbmd H 3fYvvR,q, WH Mm 1 Jll0OMM'7y CWA QWUBMMMAMQ df . . , WE COMPETE IN ATHLETICS Touchdown! Hyde Park! Touchdown! S G.A.A. Board .. . Top Row: Bob bie Garner, Pat Baker, Anncelyne Whitaker, Elizabeth Pitcher, Merri lyn Manqrum, Anna Reid, Paulette Moody, Mary Brookshire, Loretta l-lus band. Second Raw: Miss Thompson, Marvinia Randolph. Lovie Lindsey Sandra Besley, Sonia McClure, Siq- rid Swanson, Susan Dawson. Front Row: Pamela Voth, Lillian Beason, lrene lmada, Dyanne Deis, Sandra Davis. Girls' Athletic Association Is School's Largest Club Every girl at l-lyde Park is a member ot C-B.A.A. Membership dues are included in the gym tee. Activities include Modern Dancing, Leaders, Pep Club, Tumbling, Ad- vanced Gym, Swim Meet, Track Meet, Volleyball, Tennis, Badminton, Basketball and Sottball. The C-5.A.A. Board includes G.A.A. Otticers and representatives trom each activ- ity and attiliated organization. Committees plan activities and special events. The Board issues a pamphlet ot activities ottered and the dates ot each. G.A.A. Delegates meet twice a month, once with the Board. They report to their gym class results ot the Board meetings. G,A,A. Awards include membership in the SOO Club, G.A.A. Letters, and tinally the Chevron. For the 500 Club members, a girl must have proticiency and gym grades ot E or bring a medical and dental report, and participate in tour lOth period activities. Letters are awarded to girls with HE or S in gym tor tour semesters who participate in tour more IOth period activities. The Chevron, the highest award, is presented to a Lettergirl who also participates in two more activities. if i 53 t i' G.A.A. Otticers . . . President Sandra Besley. Vice-President Sonia McClure, Secretary Susan Dawson, Treasurer Sigrid Swanson, Spon- sor Miss Thompson. G.A.A. Delegates . . . Top Row: Sandra Davis, April Arnold, Judy Vaulx, Veronica Williams, Carol Wil- lis, Pat Baker, Constance Morris, Irene lmada, Judi Shire. Second Row: Lovie Lindsey, Virginia Scott, Kath erine Curry, Patricia Blake, Eileen Chisum, June Price, Barbara Johnson, Gloria Byrd. Front Row: Brenda Aus- tin. Carol Atkins, Vera Milsap, Anna Reid, Miss Thompson. .eaders Top Row: Mrs, Maurer, tlaudyno Wliilralror', .larlrie Slephens, 'err-wa Birilre-r, Juni' Tri-rlei, MaxineWl1iTe, Uolriro-. clrirdan. Second Row: Frankie Qrrrrclvrw, Halqa Mallhies, ParrleTTe Moody, irrriirine Allen, Tleanor Pawall, Belly Turner, .l a n O T Sr'l1warl7, Jar queline Frveiw, lrnia love, linda McCluslroy, Xnnr-Tie Rirlmrdwn, Third Row: Srrsan lanrrw, Carolyn Hanson, Bobbie Lee, Torrulliy Wilson, Mamie Harris linda lririla, Sandra Bexley, Olivia Williams, fafiu louis, Barbara STevenson, Tiah Tag- if-rl. FronT Row: June RoberT-von, Rose narie Cullvy, Beliy Collloii, Roselia 'winq, Velma Allen lris Brown, MyrTis lruvvn, .llrne clellfvrson, Carol Oliver, Mary Williams. QP Leaders, Advanced Gym Build Stars For Tomorrow V - rl .L B Tumblers, Hrirlr-rise Nash, Sondra Oden, Elizabelh Williams, lnanne Burdvllo, Cfloria Wells, Sandra George, EliZabeTl'1 Xlor-,woflrurg Carol Wa:.hinqTon, Mary Broolrshire, Yvonne Sniitlr, Mary Jones, and Joonell Means mounT The charioT. Rdvanced Gym . . . Top Row: Miss Thompson, Mary Brrwlcnliiro, Bobbie Lay, vlarrilyn Mangrum, Bessie Jones, Bessie Cameron, Joanne BirrdelTe, Verdella :nrlir-, Joyce Campbell, l-Tuolla Robin- ,on, Barbara Andi-rs. Second Row: Son- lra Oden, Carol Wasliinglon, Bobbie fwonro, Ruby Turner, Joan Dawlcins, ,uisline Blounl, Bernadinez Adams, Alber- een luras, Marvinia Randolph, Dyanno Deis, Sandra Georqo. Third Row: Eliza- .wTlr Williams, Mary Jones, Joenell vlvans, l'Torlons0 Nasli, Mamie Rallins, fvunno Smiili, Lovie Lindsey, Delores doclqe, Jacqueline Dixon, FlizabeTh Nors- velher, Tala Poiriirw, Carol Grizzard. irinl Row: lillian Buason, Penny Fisher, :aldrin Jordan, Jrinell Morgan, JudiTli The Leaders are a selecred group oT ouTsTanding Junior and Senior girls who wish To learn The arTs oT reTereeing and Teaching a gym class. They meeT TirsT period daily Tor insTrucTion in Teaching Techniques and Then spend an- olher period acTually coaching a class. Their special uniTorm consisTs oT a whiTe blouse, navy blue shorTs, and a whisrle. They have auThoriTy on The Tloor To direcT The acTiviTy. Mrs. Maurer is The sponsor oT The group and The oT- Ticers are Olivia Williams, Francine Allen, BeTTy CoTTon, and Jackie STevens. The Advanced Gym Class under The direcTion oT Miss Thompson meeTs every ninTh period Tor pracTice. This group combined wiTh The Advanced Swim, on March 24Th, in a specTacular drill To enTerTain The audience be- Tween halves aT The Championship Basl4eTball Game beTween The Public School Champs and The CaTholic League aT The Chicago STadium. The Tumbling Club, really parT oT Advanced Gym, displays TormaTions or Turns carf wheels aT boTh l:ooTball and BaslceTloall games. IT is direcTed by Miss Thompson and Their President Mamie Rallins. Nilliarni., Goin- Linloid, JaneT Bales, Saundra Colo, Gloria Wells, PaTricia laclr-ron, Jaiqueline Husband. 1 r K K A V iii? Coaches, Mi Ha-,an and Mrs. Dubylr, linlc up wiTh The Cheer Leader The Cheer Leaders hoist The Waql'in Wlieel, ours Tor anollier year Caplaiiw, lieno lmada and Joni Cherbo. The Pep Club supplies our Cheer Leaders. These vivacious gids prachce dihgenhy learning The cheers and Then Try ouT To becorne C:heer Leaders The C5raduaTing Clheer Leaders choose Their successors on The basis oT poise, pep, abiliTy, and appearance. These whiTe sweaTer pepsTers will always be Tound ouT in TronT aT every maior sporT. Mrs. Dubylc, Their coach, awards a leTTer To Those who have been ouTsTandinq Tor aT leasf one year. Ohl! Marvinia Randolph and San dia Davis qo up in The air over The SouTh Seflion BaslceTball TiTle. Hyde Perl: Will Win! Sandra Davis, lrene lmada and Marvinili Randolph lead our ioyous cheers. Cheer Leaders And Pep Club Sound Off. Top Row: Joan Dawkins, Sadyeqerald McSpadden, Karen Harris, Marielle llridqes, Sonya Malone, Bessie Jones, Vera Edmerson, Joanne BurdeTTe, Theresa Burles, Allice Pichholz, Jonleah Hoplcins, JaneT Schwarlz, l'larrieT Jailrson, Barbara SmiTh, Theodosia Sanders. Second Row: LaVerne Thomp- -ion, Marlha O'Kennard, Norma l-lolliday, Edna Calloway, Jean Dawlcins, Mary Jones, Bobbie lny, Jaclxie STephens, Nancy WaTanabe, Yvonne Ray, Mallie Alslfwn, Third Row: Carol Grizzard, Velora Lilly, Joycelyn CandiTT, Conslance Bozeman, Luisline Blounl, PaTricia Rochelle, Annie Groom, Bobbin Lee, Theda Pearson, MaTTe Russell, Jacqueline Barron. Fronf Row: Barbara Sleven-,on, Marvinia Randolph, Janice Kanemolo, Helen Maurer, Irene lmada, Grace Salcuma, Sandra Davis, Pamela VoTh, Dyanne Deis. D Top Row: Micah Lane, Marcia Preer, Donna Davis, Lynne Thomas, Cynlhia McGhee, Annie Giles, PaTricia ScoTT, Judy Vaulx, JaneT Bales, Sally Srha- piro, Carolyn Abrams, Marilyn Pino, Donna Murray. Second Row: Marlha Thompson, Marilyn Reynolds, KaThleen Lyda, Delores l-lndqfe, Elissa Blil+,Tein, lola Poinler, Velma Allen, PaTricia Baker, Bobbie Garner, Carolyn Slanlord, Fila Wynn, Bernice Cunninqharn. Third Row: Belly Anderson, Rulh An-ion, Barbara Black, Jean Rosser, Sylvia Mills, Frances Thomas, Anne Draznin, Joann Fuiir'noTo, Ann Koizumi Pliklri Kprnalsu, Joyne YamamuTo. FronT Row: Barbara STevenscin, Marvinia Randolph, Janice Kanemolo, Helen Maurer, lrene lmada, Grace Slauma, Sandra Davis, Pamela VoTh, Dyanne Deis. viodern Dance Club . . . Lefl Row: Julia Holloway, Arsenia Jones, Barbara Klakloy, Marion Vxfilliams, Annolle Davis, Karen Harris, Palricia Baker. Second low Helen Nimhio, Annie Groom, Sara Hunler, Anila Murray. Calherine jlmrry, Mary Bryson, Jocelyn Candill, Janell Morgan. Third Row: June Kushi- la, Dolores Hodge, Barbara Roby, Jean Rosser, Donna Davis, Rose Simmons, Sondra Oden. Righ+ Row: Bobbie Koonce Barbara Black, Chrisfine Greene, ,V lldfl BTOOIKS. The Modern Dance Club ol sixly girls meels once a weelc lenlh Jeriod. Five girls, Lorella Husband, presidenl' ol The group, and -illian Beason, Palricia Balcer, June Kushida, and Janell Morgan each The olhers Techniques and pallerns. The group danced al he G.A.A. awards assembly and al The spring P.T.A. evening neeling. Miss Thompson is Their sponsor. Modern Dance And Modern Dance Leaders . . . Top Row: Pal Baker, Mazell Curlis, Shirley Dolce, LaVerne Thompson, Lorella Husband, Janell Morqan. Second Row: Maxine Edwards, Berlha Jones, June Price. Third Row: Bobbie Lee, Dyanne Deis, Belly Collon. Froni: Lillian Season. Nep'rune's Daughters Enchant Hyde Park Neplunes Daughlers, sponsored by Mrs. Maurer, con- isls of lwenly-five advanced swimmers who are inleresled n synchronized swimming and waler ballel. Their ryhlhmic nallerns and graceful movemenls in The pool are a form nf acrobalic dancing. Once a year They produce a musical :xlravaganza in lhe pool where, wilh soil lighls and gay nusic, They swim in Tormarion, The l959 officers are -leidi Spill, Barbara Haehnlein, and Karen Pearl. lepfune's Daughiers . . . Top Row: Nancy Walanabe, Carol Eich- olz, Heidi Spill, Palriria Butler, Theodosia Sanders, Barbara laelinlein Mary Wissler, Marilyn Hoifman, Zonnie Lindauer. Sec- nd Row: Nora Norlh, Virginia Weimer, Carol Shirawa, Jackie loplmns, Karon Pearl, Fronl Row: Anne Draznin, Jean Schneider, wqrid Friedman, Peggy Edidin, Linda Kabumolo, Meredifh Darby. , I ,,. - .-nc Q 7 , . -, lf Q51 f ff lg SA K M A Q, 'Egg-1 -ww ' -R if f if as A izxilitl-J 3 A, f:.,. 1 f use :., . .,.,. 4 W xi we J g Q, ' f 5 F 1 8 S .. ,, -.f 43 as 1 .N QS, ' 1' Q, 3 A L 4 42 -f 36 gas, xxx: X Q 5 lim! 1-' ff 1 . ' N A -ki Q, 3 as iw ., v v i 553: , is X 1. M gawk X, W. Q Y Q it f- .rw 52, KLM A 4 4 'W-fd ' X h J f B6 Q28 2 ff- ' R v f 'Q V B 1, S 5 if T , W ffiizwe W 3 'UQ' ? - 1 ' A-' 'F ' L ' ' i 1 ' A W - is v - 8 A , 5, L uf ,,:. 1 : .-..-. 3 if 2 ,Es .. rggvl ? .' W ' 1 yrs.. Z., :I 5-- 'N' mu gf? 2 Nea. , L5 15 Q gg? k ' xi 1 . 35 ?.,,g5..:f --325 Q ,fw k kk .g..,.l ' M . p ,MQW .,,: SA 1 - P, Q 1 1 gg? 3. 5 'Vw Q if 5 X am? M -Ji if Q' is D Pm :Q -fied' W fx A ff M X ., if-N1 fr-H . 'W if ig S.. . A 1 1 Xxx X , ' MN 995 - M - b 5 E Wax K, WV 5 Qxainv- X X, av is 1? S 2. QW - SX f Af wiv' . 73 QQ 17 ' if .U 51 E 70? is S 13W 79 ,, 47 495 43 ,,,. , i , I A ..... , Q t . S . K A - N K' K . 18 E1 15 9 53 f-61 V if X Sk 5 ' if wx -vi 3 3 . SY ff K, i is V -v Q49 'Jn :N 35? 'ei -4:95-50 Q5 adv 3 Q t 1 , ' .W .. Q .t ,, a . . g , -X.. , 5--...W Q, S uf...-...s +....,,5 S fin' !1 gf fs 43 i Gfi: g fi 66 6 , S K X- iq J 3 A :K lil. 'Kia 5 A. B I f -M 0 1, 9 ff' 4 gg? Q X 3 f U1 - , i ff if F I ff M Y I kr 'L A fy re R' ih 'f'i: a-:'L i'saW X K A 1 4. Q- Sf X Q Lf Q A W-.wx Varsity Basketball Hyde Paik za it -flx ,Q-i Hyde PM Vi criiyiii Hyde Pink S3 M. .hwy Hyar Psi ss vsrim iayaft Pailr si hlGVDK'l t-tydc Pail .67 Hyde Park. 77 l-tyde Park , 52 t-lyde Park 58 Hyde Parlr 65 Hyde Pail 68 l-lim ti Weziytn ot Sftllill Slimm- Calisriicil C.V.S. Br wen . 50 1:0 4? bl we bl 42 41? 48 gy bb Top Row: Rudy Jones, Janie, lriitiull, ,lvriy Esters, Rulus Caihoun, Robert tlaiiiu, ,lumen Lazarus. Second Row: Hwilw onrad Wrirrill, Bobby Jaliiii, 1-rl Ruclis-llv fin timid ttiwp cn, Mr, Chester Ziemba. Front Row: Rii li ard lngiam, Reginald Williamu, Lniqlitiiii Jaclc-yon, A'viri Bevii, John l-tal South Section Champs, Fourth Consecutive Time Once again the blue and white clad Varsity Bas- lsetball Team won the South Section League Title, this time with a pertect record ot no losses in league play. Four times in row this has happened. ln l956, with a 9-2 record, they drove all the way to the title game. The next season they lasted until the semitinals. Last year they were ousted in the tirst round by Englewood. This year Cooley's 6'6 center was too tall tor our 5'l I average and lcnoclced us out in the tirst playott game. Our team telt the loss ot Arthur l-lyrams and Spurag Foster atter graduation in January, but Rutus Calhoun, Captain, held the team on top with his twenty-tive point average score per game. Time Out for a bawl out tram Team Captain, Riitus Cath-ii,n Coach Ziemba. is high point man. All on the ball. Alvin Beyil gets it. X marlcs the spot on Conrad Worrill. Tip ln by Conrad Wiiii'iil mme J. Frosh-Soph Basketball i mai- mi 34 i fx,1Q ,af , . 20 'lydo P Kxl' li 33 Carver ,, ..,. 3I Hyde Parlr 59 Mosman Parlc .. 28 Hyde llarls 55 P kxl' lc a'1' ... ... 2I Hydv Pail 4I Harper ,.. Zl llydn' Parln 46 lli r v cli 28 Hyde Parli 59 Wc4,liiwll ,. . , 20 llydv Parlr 53 Soulli Sliore 38 Ilydi- Pail 44 Caluniel .. ,, QI llydo Pnrln 45 C.V,S. ... ... 58 llydo Pixilx 43 Bowen . .. I4 Frosh-Soph: Arlliur Broadway, Rich- ard Goodman, Richard lnqram, Har- ri-. Aslilon, Slaiiley Redmond, Euqenv Siiirry, lvliiliaol Armslronq, lvlillon Dauqluerly, James Willianis, Alvarez Pidqvon, Thomas Wel7el, Mr. Chesler Xllfllllla. Frosh-Soph Are Second Place Winners Hyde Parlcs Frosh-Soph Baslcelball Team lcepl up our lonq record of successes on lhe courl by placing second in lhe Soulh Seclion Public League and winning The lirsl game againsl Wells in lhe Playoffs. They compiled, in League Play, a lolal ol len wins lo one loss which was aqainsl C.V.S., a much laller learn. They wenl down in lhe Playoffs 'ro Crane, a long slandinq rival. These Prosh- Soph boys when added lo our Varsily Squad nexl year should produce a comloinalion lhal' will be hard lo beal. Baslcelball Managers: llowaid Pizer, Evan Marlin, Jack Teplifz, Rii hand WcWxler', Jolli KO:-wel. Leapin Lena, is Richard Goodman, Spiri+Boos1ers whoop if up as excifemenl increases ree on one ball but no ne ha l ll x 52 Drill Team from Advanced Cv aT The Chicago Stadium. Hyde Park Enferfains AT City Championship Game The Girls' Gym DeparTmenT aT l-lyde Parlc was honored by being inviTed To perTorm beTween halves aT The Championship BaslceTball Game beTween The Public School Champs and The CaTholic Winners. DirecTed by Miss Thompson, The Advanced Gym Class and The Advanced Swim Class combined inTo a drill Team. They used whiTe volleyballs in a rhy- Thmic drill which was perTormed wiTh grace and precision. The PlayoTTs Toward The Championship Baslceil ball Game soon leTT Hyde Parlc behind. The VarsiTy losT Their TirsT game To Cooley. The Frosh-Soph Team wenT one beTTer by deTeaTing Wells buT wenT down To Crane aTTer a hoT baTTle. Where - did ThaT ball go? Elbow dance or Superman, can This be FI B ers q championship baskelbail? QGTS The ball lop Row: Alvin Bevil, Fred Hopson, Donald WiTherspoon, Andrew Collins, Ton Jackson, Howard Pearman. FronT Row: Philip l-lall, WalTer Balcer, Bill lochen Cooley, Huey MCG-ee, l-lerberT STevens, l-lerman Wells. Second Row: McCarThy, Glenn YamamoTo, Michael ldeno. Vlr. SchulTz, Samuel Davis, John Gray, Donald Woods, Willie l'lursTon, Leigh! Snow Delays Spring Sports Sei To win, Sherman Silber pracTices his back wand. The Tennis Team composed of Rich- ard Wexler, capTain, Sherman Silber, Larry Meyer, Richard Sax, Alvin Laslcin and Jim Waller hopes To beTTer lasT year's record of Third place in The SouTh SecTion. Fenger and Lalce View will be Their ToughesT opponenTs. The iirsT maTch againsl The Lab. School was close wiTh l-lyde Parlc winning Three of The Tive games. Baseball pracTice was considerably cur- Tailed by cold weaTher accompanied by snow and rain. All buT one of The pracTice games was canceled leaving a green Team To Tace C.V.S. in The lirsT league game. 0Ther games were scheduled in close succession aT Parlcer, Calumet and WesTcoTT giving The Team a chance To warm up To The Tinal games of The season aTTer spring vacaTion. John Gray, in- Tield capTain, has a Team wiTh Ten velrerans and eleven new comers To Till in The diamond. Sliding home, Willie HursTon caTches l.eighTon Jaclc- son wiThouT The ball. Calcher, Willie l-lursTon waTches The ball sail ouT of sighT. 15 -Kwai 23? ii ..- The Brees? Sfroke has George Calef blowinq bubbles ol' loam. Varsiiy Swim . . . Top Row: Mr. Roberl Long, Barry Schlesinger, David Townsend, Tyrone Johnson, Ned Block, Joel Chesller, Robert Arnold, Wayne Fujiwara, Peier Koch-We-ser. Froni Row: Michael Bolden, Michael ldeno, Ross Harano, Marlin Gross, Arnold Kanfer. Pool Closed For Repairs. Swim Teams Lose. For many weelcs, Hyde Parlcs pool was closed for repairs. The Swim Teams had no place To praciice. When ihe pool was opened, Jrhe ieams sank io 'rhe boiiom as lar as meel scores weni. Beiier luclc nexi year. A few boys lcepi The reams from drowning. David Townsend and Peier Koch-Weser we-ni info ihe Siale High School Meer and came oui elevenih and eighieenih, respeciively, in ihe hundred yard breasl sirolce. lvlr. Long, The coach, hopes for more good swimmers nexi year. Hyde Park I9 Fenger 49 Hyde Parlc 24 Morgan Parlc 52 Hyde Parlc 23 C.V.S. 36 Hyde Park 2l Souih Shore 55 Hyde Park 28 Bowen 47 Hyde Park I2 Fenger '55 Hyde Park I2 C.V.5. 64 Hyde Parlf 23 Bowen 56 Frosh-Soph Swim Team . . . Top Row: Andy Bozeman, George Calef, George Richards, Le- land Neuloerq, Alan Cohen, Glenn Yamamolo, Richard Tani, Barry Schlesinger, Mr. Roberi Long. Fronl Row: John Cody, Joel Shiifra, James Wilson, Richard Carlson. Harold Dilv lard. Glenn Sunahara. ,,..-- Througlw The air wiih 'Phe greafesl' of ease, fly Wayne Fuiiwara and David Neivell. Track Teams Place In City Meet lydo Park 64 Lindbloom lyde Park 33 Universily High lyde Park P3 Dunbar lyde Park 65 Lindbloom lyde Park ol Hammond lyde Park I3 Dunbar fify Meer . . . H80 yd. Relay, Erdi oO '7 uiwli, fllli' MT yd, low l'lurdl0-Q, ?nd1 O liiili llurdlo-,, lvlli. '.V.A. Scores , , , Duke Wriqlrl, 43 lf?q Rab rl llwiiiipsiiii, fllj Wiillaiis Pi-iry, 22' R1-hi rigmni, Pil' liiwnifin ,liilini,iun, la lf4. 25 This year Hyde Park Track under lhe 25 supervision ol Mr, Hasan, was on 'rhe 71 beam because we had such a iasl leam. I5 The Seniors made a lhird and lourlh in lf, lhe cily meer, while lhe Juniors scored 54 a second and lillh over lhe hurdles. The yd. Senior Team was really hor wilh Conrad yd, Woiai'ill and lhe lumps he golf. Nexl year, we predicl, bolh reams will lead lhe my Soulh Seclion and bring back honors lo oroi e lheir aiieclion. Top Row: Slerlinq Nichols, Phillip Hall, Roberl Mor- row Richard Goodman, Claude Lee, Jesse Wade, Gilberi Harrell. William Lyons, Slanley Perlmuller. Second Row: William Bradley. Ned Smilh. Dallas Mc Cree, Waller Allen, Glenn Miller, Nick Roberls, Booker Morris, Georqe Edwards, Huberl Harrell, Third Row: Slanley Hayes, Leon Milchell, Ricardo Johnson, Eman- uel Butler, Roberl Green, Herberl Moore, Willie Hur- slon, Nalhaniel Smiley. Fourlh Row: Roberl Thompson, Cnrlis Davis, Herman Wells, Huey McGee, Nick Hall, Earl Key, Darrell Chalman, Arlhur Broadway, James Hunler. Fronf Row: Richard Smirh, John Hall, Richard lnqram, Clyde Andrews, Duke Wriqhl, Freeman John- son, Wa'ly Perry, Chesler Slauqhier. Praclicing, David Skolnick goes over lhe lnw hurdle. Long legs are an asset In lryinq o.il lor lhe Track Team. 155 R O T C Color Guard Presents The Flag The members oT The Color Guard OT The Reserve OTTicers lraining Corps are chosen Tor Their characTer, miliTary sTaTure, and abIliTy To accepT responsibiliTy. These boys proudly presenT The Tlags OT our counTry and our school aT all imporTanT assem- blies and miliTary TormaTions. They Teel honored To be members oT This valuable uniT. The flag passes in review as Mr. Triezenberq, Sql. Barker, and The Federal lnspedors sTand aT aTTenTior1. 'QQ R.O.T.C. Officers . . . Top Row: Leo Alhas, Charles lvliddlelon, Creadel Jones, Franklin Coleman, Lawrence Holloway, Jay Schapiro, Rolnerl lvliles, Fronl Row: Avery Dee, Sql. Richard Bushrio, Sleven Greene, Sql. Franlc Spencer, John Milkinlas. R.O.T.C. Cadets Win Medals The American Legion Auxiliary Medal is being awarded lo Floyd Price. Awards . . . Efficiency Medal: Edison Malone, Leonard McPher- on, William Baily, Billy Qullaw. Nealesl Cadet Booker Morris, Ioqer Wendlord, Jerry Tood. Marksmanship: Avery Dee. Recruilingz ohn lvlillcinlas. Spanish American War: Ramon Rivera. Tribune Gold Medal: Leo Alhas, Roy Morrow, Ronald Rabens, Joseph Harris, Rich- ird Johnson. Tribune Silver Medal: Leroy Cash, Clillon Maclin. Veler- ins of Foreign Wars: Lawrence Holloway, Charles lvliddlelon. Daugh- 'ers of +he American Revolulion: Jerry Lazar. American Legion: Edward Chrislie, Sleven Greene, Jay Schapiro, Floyd Price. M lhe Federal lnspeclion, Avery Dee adds another medal on his chesl. V I7 ,, -Q1 ,QV A -Qu W , 16, I EM 4 .nf .Q ' 'ff ff ' ff , Y ,f if y 'vm Ne. Mfff -if X v Q I , W o N ni V J W . ' 0 4 4 L B 3: n W ' ' A ' V' ,, -W - s E A .. ua? 4 if .sf 2, xi' F9 w r ui, 2 5 M ,if 1 iii: - 5: fgj?gw M 0 o if fwfr' ,Wg V1 'V' , F 5 0 4 Q fy, E I 1 - . R25 - ,, -Sf, ww 1 H K' 5 J' 3, W , ' 1 'D Y vp V v Y w?gE?,,f 1 1' ,W Y A M iv' ' X T ' 2 w . N Q 4: , X? I A A Y A' 1' Y A y ,QQTY ,rg u Q .R . W U W U- .vr E , Ein 2? ig? H A Q? Q' 't,. .wfl gg I . . I I Q 4 W: , v Q ' fix: 2 f ii f R HK Q x If xv J REL gi 1, 4 if f, Q 1. gf? ' . 'V M11 triad M A 55 ' 2 ii A 'ii ff ' A x ,W is ' A ' . if , , A ' . Q 1 A . - . , , 4 Q t 2, 4 H ,W 1 1 , f W 4 v ' Q f Q ' 1 . . . ' v f' Y . 4 T K ,vs v h - f 1 s,L' K ..,.. X ' X Y:- 1 . K i ., A X 1 a . , 1 . y , . . 7 . y A ' ' , Y ax Q A W. we ' 1' 'Ex y wig? vm X 'JFK b wvgi W gf! it ' ,. 1 Q l x Q n , A M Q i K, 7, , x K Q 'X ' x , 1 ' . S 5 x 4 X X 'T , 'L Q X? A S ' aw as V- Q, a 1 K Q 5 f .Nlwf ' Q 2 at gi as gi '35 J i ' QFWY Q if W Y Yrs 8 af R Q YY 5 T1 K 3. y I Q fi, 1, ' W V S Pi 'R Q- .Hb - , - wx Xxx K -Q 'I X hr' T' '- R ii is in - f 3 fr ' E' li Tl Shih 1 S 5 X X 5 I' X ' V- 3 W Q W .Va fe, yy Yfxg V 4 . ' f Q ' , 3? ' .iz , . 4 .V J ,KN V X' it ff X11 , .YY . V Y ' Q ?l it f ,M ' WMS' 'GI if I M V! 5 .Qy'J ,Xf.9 .YT.1.,y,.gg - QQ , f :if , .Q My 5' ,i D W , V- . We xii - S , . 2, in 'K 9 ul S v A Lfwixs ly Sf K X X K i Sk My X fUh,g.45i g f fQ Q f Xz wyg XL f'f fff Qf Qwr Wi is 1wwf M A l KN .K ,U A :E X 3 Sf 1 blk qv - :E X 'Q Nz .4 in MW' 355591 wagix. 5, n M3230 - ' - ' 1-, .. K H- f - - f- f ,-.M Y, - w Us--Ms yrf: -rw., 'n' ' . ' vw' , ' W qi' - ' ' I wig. Af , f '. if'Jk - -so ,Q Aurora 1 jg if Www Zifwjffi ?MjW f4i5f JJ fffjff Q6 CQJZMMN af' W QW W! WWKCM Q3 Wag? VFD QQ? ms? R as 94- W M Zkwzgfea A . ' , DEN . g ' Qfjfv , qwlrcl E634-o 56 WJ ' MSW ffmfw h -f 1 . , ,1 .J V CQ k . . f ' 1 ' 41, 1',f- 'H' wr. A V 2-f: 2 - :N 5, xy., rw . S 35 ',, . ,, I .Li. .. ,,,.,,,,,,,.. mf.-G '- ' V - if wax ix 322 Q 7 AUTOGRAPHS V42 S2 fW: QX, l41 5 M125 iff fm Zi jg??kFJ QiiijZ2fEEQJiX'fixvQf3 ,ACfv'St3fki,1Qi! 64iZf2gq53 A . 1 EE VXOUWQ ZZ' v QM pwyw liuigx ' , QQQJ ' WUWWW E?5?2' 'W ' j Q KW! izfwf W if S sQ3Krk7L!fN5f'A3 .A2gZZQZ???a?W Iggy' w5giQfQDS ff if A52 if 'J if F E W W, 55, Q5 Ito, QW N459 S 503WWi QW' 25555 My vjfkff. gjffgkf wg My wwf? g, . ' gfgr . J XQf 4 Wg? ' 1viA .g,fwga::- , , H HJ -- -wwbfwwxsmpgwdawwfffwwwwqwwfpffwswfvwifwf'-y,Q'HWwnQw4M --14 '1f . -' , H si.: . z. , 'gfgf .. Qywwv A Z K . , 'U 4- Ewffwe AUTOGRAPHS Why' .paw . Q ' j x fw74J A D Jw X Wcww S le ,D ' V fo 'an my Www M1 WWW 445 ' 'E -M V '. 1' ff . h My ' A 0 , '71 MQ Aff 1 X, 412,51 r ':j 5QAf'iMJ , f2fZ6yL?71ZZ7 1 Laffzizc-Jtfjy , ,.,4.4.,ff1nwffi f L':M7d?.V7fk' PM U ,, w KSQ , 014f.A:4fv..zL ?x,kfif2, If-4,1 i 1 dew Qvwl airy JOE A J ' : 5 4 i fr'-447 .Xia flzuf flffw ,gt 4' I' Z' M L MQW '60 wok M45 'J 'J ' '- flvml, I ' I ' 4 ' fi ' ' R WM ' J' .D , -. . pvc- .L 9' M -' fn-2 ,Gr- ' lllllflav-'ll 7 W W0 t 1f'f',0ff 6 Jhqmj j M J+61,Wff,f4 Jwwf g fdi QWZ - Wfjyw ' f , , 55 , , , , J Q ' A i 2 A'Cappella ......... . . Adiusfmenf Officef .... Advanced Gym ..... . . Aifchpe Sfaff ..... Alperf Division .... . . Anderson Division . . . Arf Deparfmenl' ..... Assisianf Principals .. Affendance Office . Afwafer Division .. Audio-Visual Crew Baseball .......... . . Baslcefball ....... Black Division .... . . Boolrroom .....,. Boys' Chorus .... Boys' Gym ...... Brennwasser Division Brown Division .... Careers Day ..... Cheer Leaders ..... Chemisfry Honor Chess Team .. . Cohen Division .,....... College Day ............. l32-I33 IO5 I45 I26-I27 45 52 33 I7 IO3 49 I09 I53 I50-I52 IO7 I37 ...34 60 44 II9 I46 II3 II7 45 . . . 92 Commercial Deparfmenf ...... 30-3I Concerf Band .......... Concerl' Orchesfra .... Conservafion Club .... Consfanfinides Division .. Cordesman Division . .. Cullinan Division .... Dance Band ........ I34 I35 II2 45 49 .....60 I37 Day af Hyde Parlr .. I0-I3 Deahl Division .... ..... 4 5 Dedicafion ...... .... 4 -5 Donegan Division .. 46 Drill Team ....... .... I 52 Dubylr Division .... 60 Abbingfon. Delores .. .... 42 Abernafhy, Maurice ... ... 56 Abrams, Arlene ..... ..... 5 6 Abrams, Carolyn ... .... I46 Adams Bernadine .. . 59. I45 Adams. Diane ...,. ..... 6 6 Adams Gerald .... .,... 5 2 Adams. James I58 Adams Rose .... ..... 4 2 Adams Sandra .... ....- 4 7 Adams. Vivienne 82. IO7 Agee, Jerry ,.... ...,...... 4 2 Agoos. Gerry .........,........ 49 Alexander. Joan ...... 54, I27. Alexander, Theodore ....... Alexander, Willie .... .... Alexander. Yvonne .... .. Allen. Adelia ........ .... Allen. Allen. Allen. Allen. Allen. Pamela ..... 55. 97. Allen. Velma ........ II6. Allen. Vernon Allen. Walfer ............ Alperi. Mrs. Rufh ......... Alsfon, Maffie .. 6l. IO3. Alfman. Laurie . .. . . . Cherl ....... .... Francine . . ..... . . Joyce ............. Olivia ............. I29 58 47 57 49 . .II6 52 .62, I45 82 48 IO6, I27 I45, I46 I58 I09, I55 . 25.45 IO7. I26. I46 4I. I32 GENERAL INDEX Duggan Division Edgar Division .. Elecfion Commission Elecfronics Club . 52 . . . 57 98-99 lI3 I8-I9 English Deparfmenf' .... English Honor Players . .. English Honor Producfions ...... I39 Faculfy Sfage Show ..... Faculfy Volleyball Game ....... IOI Fashion Show .... I24-l25 I2I Fierro Division ....... 53 Fifzpafriclr Division .. ..... 53 Foofball .......... ... l48-I49 Foreign Languages .. .... 20-2I Forwalfer Division ... .. . . . 6I French Club ....... ...... I IO Freshies ........ .... 4 2-43 F.T.A. ...... II5 G.A.A. ............,... .... I 44 Gaslrins Division ......... 6I General Business Club ........ IO7 General Office Aides .... . . . lO2 German Club ....... .... I I I Girls' Chorus ......... .... I 36 Girls' Gym ............. ..... 3 5 Grade Advisers' Office .. .... IO4 Graduafion .......... ..... 8 9 Hall Guards ........ .... I I6 Hanlev Division . Helm Division .. Home Economics Hunfer Division .. Hursl' Division .. Hydeparlrer Sfaff l.A.L. Club .... ln Memoriam .. Isaac Division .. lsenberg Division Jacques Division l5Q..s3'.i.L.Lsl.i' f f f 57 46 28 58 53 I28-I29 II7 I72 6I 44 ... 54 January Graduafes .. June Graduafes June Prom .......... Junior Mafh Honor Kamins Division ..... King Division ...... Kmeffy Division Leaders .......,...... Lechfenberg Division .. Levin Division ...... Lewis Division . .. Library ..... Long. Division . . . Losf 8: Found ..... Lunchroom Sfaff ...... , . .... Macarow Division .............. Mainfenance Deparfmenf ,..... Manaf Division ........... ... ....8I-B8 ....62-80 ...94-95 .. II4 54 ...38 ...54 ...I45 ...62 ...49 ...46 .. IO6 50 IO8 I60 55 I60 55 Marshall Division ........ ..... 5 0 Mason Division ................ 55 Mafhemafics Deparfmenf Ma+ron's Office ..... Medford Division .... Modern Dance Club ... Music Deparfmenf .... Nepfune's Daughfers . Office Pracfice Service Olive Division ..... Olmsfed Division Open House .... O'Shea Division .... Parry Division . .. Peebles Division Pep Club ..... .. Pefrie Division ...... Pilaf Division ......... Placemenf Counseling Planer Division .... .... Princiip-J ...... 22-23 I08 ...62 I47 32 I47 IO7 ...5O 5I 97 62 5I 47 I46 58 47 IO5 63 I6 Program Office F.T.A. ......... . Oueen ......... Rohrlre Division . R.O.T.C.. ........ . . R.O.T.C. Band ...... Scholarship Winners Schulfz Division .,....... Science Deparfmenl' .... Science Fair .......... Senior Sock Hop .... Senior Mafh Honor . Senior Mofhers' Tea Senior Variefies ..... . . Sigma Epsilon ..,.. .. Simmons Division .. ... Sloan Divisions ........... Smifh Divisions ,......... Social Sfudies Deparfmenf . Spanish Honor ..,....... Special Service Teachers . Sfage Force ....,........ Sfephenson Division ..... Sfring Ensemble Sfudenl' Council .... Sfurgeon Division . .. Subiecf Awards Swarfz Division .... Swim Team ..... . . Tanenbaum Division ..... Technical Deparfmenf Tennis ............... Thompson Division ... Track Team ....... Treasurer's Office . Tufors .......... Wafer Ballef .... PERSONAL INDEX Anders. Barbara ...... Anderson. Mrs. Anifa .....,. Anderson. Beffy ........... Anderson. Carol ..... .. . Anderson. Damon ... .... Anderson, Don ,..... ... I45 . 28, 97 50, I46 42 42 I37. I58 .23, 52 I48 53, I36 57 28 .55. 99 50, I37 82. II6 I37. I55 IO6. I46 53, I33 58 66 II6 Anderson. Mrs. Eleanor ... Anderson, Joe ..... ... Anderson, Olivia .,.. Anderson, Pafricia . Anderson, Sylvia .... . . . Anderson. Wanda ......... Anderson. Willie .......... Andrews. Annie ........... Andrews, Clyde 66, I34. Anson. Rufh .......,.. 48, Anfhony. Neffie ....... 5l. Applefon. Bernice .......... Applefon, Theaufry ........ Armsfrong, Michael ........ Armsfrong. Sarah Arnold. April .... Arnold. Roberl' .. Arroyo, Manuel .. Arfus. David .............. Asher. Frances .. 40. 4I. 66 I l5. Ashfon. Harris ............ Ashfon Trehwa 49, l5I . 28. 66 55, I44 66, I54 55, I58 I58 67. II4. I22. I29 II6. I5I . ............... 42 Afkins. Carol .. 44. 49, IOO. IO3. IO6, I4-9 Aflas, Leo .................... I57 Afwafer. Mrs. Florence .... 2I Ausfin. Brenda ... ... I44 Aviles, Domingo ... ... 42 Azuma, Donald .... 89 B Baba. Billy ........ .. . 55 Badal, Jerry ..., 37 Bagsby, Beffy .... .... 6 6 Bailey, Arlena ................. 42 Barmash, Ilene .... 55, IO3 Barnba um. Lesley Barnes, Anifa .... Barnes, Barbara Barnes. Charles .. Barnes. Marfha .. Barney. Rufh .... Barnum, Pauleffe Barron, Jacqueline Barfh, Anna .... Baruch, Sfeve . .. Bash. Norman Basin. Jewell .... Bass. Jeaneffe 56 37 60, 63 Baisden, Janef ................ 82 Baify, William .... 82. I34, l37, l358. I 7 Balcer Bruce . ...... 42, 43 Balrer Deloris ......... 82 Baker Luerain .....,... 66 Balmer Nadine ........ 66, IOO, II6 Balrer Pafricia IO6, I36, I44, I46. I47 Balmer. Roy ............ . I33 Baker. Sfenley ..... 42 Baker, Walfer ... ..... . . 6. Baldwin. Eunice .... Balsam, Susan . .. Balfimore. Marion Balfimore. Tommy .... ...66. I35 ......47 45 .47 IO6 Baniel. Sallie .,...... . . I34 Banks, Mabelline ........... 42 Barber, Correan .............. IO4 Barber. Roberf ...... . 45. IOO. IO3 Bares. Pafricia .... ...,....... 4 9 Barlow. Roberf .... 63 Bass, Roscoe ....,....... Bafes. Alberf ......,..... Bafes. Janef .... IO3. I23 Baffles, James Baxfer. Louise Beale. Harlene .......... Beard. Jimmie Beason. Lillian ,... Beason. Marshel ......... Beason, Mrs. Marshel Becker, Roberf .... 60, II4 Beclrham. Judiefh ........ Bell. Georgia . . . .. Bell. Mary .... ...... Bell. Pafricia Bell. William Beller. Iris ........ 52. Benneff. Bob ............ Benneff. Ellis ' 'MEF' 1 i 'i I44 IOO Eva .................. Benneff. Gwendolyn ...... I35. I38 Benson. Brenf ...... 40. 66. II4. I3l Benson. Edward ....... 53. I02. l38 Benson. Lois .............. 47. IO3 Bergsfrom. Fay ...... II. 54. 56, IO2 Berkley. Cewall ................ 42 Bernsfein. Judy ......,......... 89 Bernsfein. Michele . .. 5I, IO6 Berry. Essie .................... 82 55 Bersh. Klares ......... Berfha. Dwighf ............ 50. II7 Berfha. Warren .... l8. 93. IO7. III Besley. Sandra .. 66. 80. IOO. IO6. II2. II3, I27. I44. I45 Beffs. Marlene ....... ...... 3 5. 49 Beffs. William ................ 59 Bevil. Alvin ..... .... I 50. I53 Bey. Rufh ........ ...... 8 2. 98 Bickham. Tamara . . ......... 42 Bickham. Terrell . . 59. l35. I38 Binham. Leona ...... ......... 4 2 Black. Barbara ........ 59. I46. I47 Black. Mrs. Charley ....,... I9. 44 Black. Efhel ......,....... .... 3 I Black. Harold ...... I59 Black. Judifh ....... Blaclcmon. Beffy ..... Blackwell. Carol ...... 54 Blackwell. Michael ..... . . Blair. Evelyn ......... Blake. Joan ......,..., Blake. Joseph ..... . Blake. Pafricia ....... Blakemore. Jo Ann 5I ..,...42.43 5I I37 l59 I32 'alsfiiii las .........-+5 l32. I44 Blakley. Barbara ..... ........ I 47 Blalock. Bonnolyn .... ......... 4 6 Blanchard. Pal' ........ 44. I04. IO5 Blazek. Linda ... . ...... . . , 48 Bledsoe. Curley ...... ..... 8 2. I33 Bleicher, Norman .... .,....... 8 2 Blifsfein. Elissa .... 53 l05. I29. I46 Bloch. Mrs. Shirley ....... .. I9 Block. Alan .................... 5l Block. Ned .. 4I. 59. 60. III. I23. I28. I29, l40. l54 Blond. Bobby .......... 46. I00. IO4 Blond. Pauleffe ............... 46 Blouin, Jereldene .............. 42 Blounf. Luisfine ....... 63. I45. I46 Blum. Edward .. 4I, 60. II3, II4. I23. I40 Boafner. Carl .............. 56. II6 Bogard. Alfreda .. ..... 6I. IO8 Bohannon. Earline .............. 93 Bolden, Michael ....... 63. I34. I54 Calvin. Cameron. Bessie Cammo Campbell. Joyce Campbell. Pal' ............. . Canady. Dorisfeen ...... . ....... 54. n. Leon .... 4I. IO9. I33. 53, 83 Candiff. Joycelyn .. 53 Canflow, Deloris 28 I45 I40 I45 I23 56 I46. I47 67 Coffon. Richard .... 37, 56. I23. I28 Craig. Kafheryn ........... 97. I08 Craig. Mrs. Wilhelmina ........ IO6 Crawford. Andrea ..... ........ 4 7 Crawford, James ....... .. 56 Crawford. Joan .... .... I 06. I36 Crawford. Joseph . . . ....... . . 42 Crawford. Sfeve .......... 83. ll8 Crawley. Graceann .. 50, IOO. IO3. I36 Creighfon. Shirley ............. IO6 Crockeff. Beverly ...,. ...... 6 0 Crockefr. Earnesfine ............ 56 Crockeff. Shirley ..... 50. I36 Crosby. Alberf ..... ..... 4 2 Cross. Devardy .... .. 46 Crossgrove. Paul ............ 4l. 45 Crown. Jerry .............. 54. 56 Cullinan, Mrs. Frances .... I8. I9. 60 Cullins. Eleanor ............ . , . . 47 Cumberlander. Doris .. ....... 58 Cumberlander. Gus ... .. . 42. I58 Cunningham. Bernice 55. I46 Currey, Carol .... Currey. Rosalind .... Curry. John .......... Curry. Kafherine ...... 68 . 57 ...,42. I58 6I. l35. I44 62 Curry. Lois .....,............. Curfin. Mr. James ............ 30 Curfis. Mazell ...... 60. I47 Cufrighf, Roberf ... .. . .. 52 D Cappy. Audrey ...... . 27. 67 Carlie. Verdella .... . .. I45 Carlson. Richard .... I54 Carmichael. Arnifa ... ... I34 Carr. Billie .......... .... 5 4 Carr. Mrs. Julia .............. I08 Carrigan. Joyce .. 83. IO7 I23. I35 Chesfer. Rena ............. . . .. 42 Chesfler. Joel ......... ..... I 54 Childress. Felicia ... . . . . 42 Childs, Delores ... .... 45 Childs. Georgia .... .... 4 8 Chin. Kai-Fook .... IOO. II4 Chism, Sheila .. .. .... 42 Chisum. Eileen .,...... I29. I44 Chrisfie, Edward ..... I56. I57. l59 Chrisfmas. Norma .............. 67 Clark. Charles ............. 42. I58 Clark. Francine ................ 56 Clark. Iris ........ 67. IO6. lll. I39 Clark. Mildred ................ 42 Clark. Sandra .................. 83 Clark. Mr. Charles . .. I6O Clarke, John ..... .......... I 07 Clay. Bari .... ............... 4 8 Clay. Carol ........ II. 67. l35. I38 Clay. Lucius ,.... ........ 6 7. IO3 Clayfon. Isaiah ...... . 27. 68 Clayfor. Clyde .... .... I 34. I38 Cleary. Jane ....... ......... 2 7 Clemmons. Signora .... 83. 88. II6 Clepper. Bernard ....... .. 42 Cliffon. Eddie .... ...... I 38 Cliffon. Gerard .... ..... 3 Clopfon, Gladys .... .... 8 3 Clouse. Brenda ... ... I36 Cloufier. Diane ..... .... 5 6 Cloade. Mrs. Emma .... ........ 2 I Bolds. Annie .... .. ........... 53 Coafes. Carola ..............,. 42 Cody. John ...,.. 58. I34. I37. l54 Cohen. Alan .. 6I. 68. II4. I23. I54 Cohen, Anne .. Il. 50. I00. I02. I23 Cohen. Mrs. Bernice .... I9, 96. I28 Cohen. Miss Judifh .......... I9. 45 Cohen. Ronald ..... .... 2 4. 63 Colby. John ..... ......... 4 2 Cole. Harrison .. ...... II6. I58 Cole. Saundra ........ 83. II6. I45 Coleman. Franklin .. 4I. 64. 68. I00. I04. I26. l32. l57 Coleman. Janel' ....... . ........ 44 Colley. Lois ................... 42 Collins. Andrew ....... 68. I4-9. I53 Collins. Caroline .............. I3O Collins. Marvin ....... .. 42 Collins. Michael .............. II6 Collins, Sarah .............. 52. lI2 Collins. William ...... II2. I34. l35 Colmon. Bob .............. 50. I58 Comer. Joyce ................. 44 I58 Congress. Clifford ......... 42. Conley. Leroy ............. 83. I32 Consfanfinides. Mrs. Hazel .. 25. 45 Cook. Alonzo ............ II7. I58 Dailey. Carrie ...... ..,..... 5 Dale. Y-Esfher .. 83. II6 Dancer, Joann .. ....... 46 Dancy. Annie ... .... IOO. I I4 Dancy. Rosa ............. l35. l38 Daniel, Guyland ............... 83 Daniel. Sam .. 68. II3, II4. I29. I40 Dapke. Carole ................ 44 Darby. Meredifh .......... II2. I47 Darby. Pamela .. 40, 4l, 68, 98. IOO. II2. I22. I34. I37. l40 Darby. Roger .................. 62 Dase, Roberf .............. 5I. I37 Daugherfy. Milfon . .... 54. I37. l5I Davis. Anna ............. ...... 6 8 Davis, Anneffe ........... I37. I47 Davis. Bernarl ..... 83. I34. l35. I38 Davis. Carl .................. l35 Davis. Carol ............ 32. 45. I34 Davis. Curfis .. 63. II6. I49. I53. l55 Davis. Donna .. 62. IO3. I23. I33 I46 I32. . . I47 Davis. Florence ................ 52 Davis. Furcey .... 83. I35. I38 Davis. Gloria . ...... 49. I23 Davis. Jeff .... ......... 4 9 Davis. Rufh . .. ............. .. 56 Davis. Samuel ................. 29 Davis. Sandra .. 3. 62. l00, II6. I44 Davis, Scoffie .................. 68 Davis. Theresa .... 35. I34. I35, I37 Davis. Vera ........,....... 68. I34 Davis. Willie ................ I59 Dawkins. Jean .... 54. I23. I37. I46 Dawkins. Joan ........ II3, I45. I46 Bolfon. Jennifer ... ......... . . 6I Bolfon. Saundra . ........... 82 Bolfon. William ...... II7. I37. l59 Bonds. Esfelle . .. ......... . . 60 Bonds. James ... ....... .. 29 Bonner. Frank ... ....43 Boone. Alfred .... .....,.. I 58 Boone. Leonard ......... .. 48 Boofh. Alice .... .... 4 9. I27. I29 Boofh. Ezella .... .,..,.. 5 3. I32 Boofh. Madison . .,... 82. I33 Boruck. Sfeven . ...... 44 Bosky. Sally .... .... 4 6 Bosfon. Charles . . . .... ,. 45 Bosfon. Eugene .... 66. 93 Bowdry. Sandra .... .. 5I Bowers. Geraldine 53. I27 Bowie. Presfon .. 54. I37 Bowlin. Emily ..... . ..... 42 Bowman. John ...... ..... I 59 Bowman. Priscilla ....... .. 59 Bowman. William ......... 42. I58 Boyd. Carol .......... 54. I27. I36 Boyd. Charles ... ......... . . 42 Boyd. David .... .... 3 8. 66. l32 Boyd. Willie .... ......... 4 2 Boykin. Mary ....... ......... 4 2 Bozeman. Andrew ............. I54 Bozeman. Consfance .. 6I. IO6. I35. l38. I46 Bozeman. Sandra ..... SI. IO6 Brackins. James .. .... 42 Bradford. Edna ... .. . 44 Bradley. Esfelle .. . ...... .. 42 Bradley. Ida .... 58. IO7 Bradley, Phillip ....... .. 42 Bradley. William .... .... I 49. I55 Brailford. Norma .... ........ 4 8 Bransford. Billie .... 66. IO4 Brazelfon. Andrella ... . . . . . 62 Brazelfon. Charles .............. 56 Brazelfon. Joe .......... .. 63. I32 Breaksfone, Donald .. 4I. 45. l35. I38 Breeding. Linda ................ 42 Brennwasser. Miss Miriam .. 25. 60. I22 Brenf. Sandra .......... .... 5 5 Brenf. Willene .. ..... 48 Brewer. Thomas ..... .. . 44. I58 Bridges. Herberf . .. ... . . 82 Bridges, Lillie .... .... 5 9 Briggs. Marlene . ..... 42 Briffon. Lillian .... ....... 5 I Broadway, Arfhur . ISI. l55 Brock. Mary .... ...... I 35 Brody, Befsy ...... ........... 6 I Brody, Helyne .......... II. 56. IO2 Brooks. Charles ................ 42 Brooks. Miss Frieda ...... I7. 89. 94 Brooks. Gloria ................. 42 Brooks, Linda ................. I47 Brookshire. Mary .. 67 II4. II6. I45 Brown. Carolyn ...... ... I32. I33 Brown. Clifford ...... ...... 4 6 Brown. Consfance ... .... 63 Brown. Corfez .... .... I 48 Brown. Delores ..... . . 82 Brown. Diane ..... 28. 49 Brown. Helen ....... 67. lO8 Brown. Iris .... 67. 98. I45 Brown. Janef ... ....... . . 49 Brown. Joan ..... ....... 5 4 Brown. Lynn ................... 93 Brown. Miss Mary ...... 23. 44. I24 Brown, Myrfis .. 55. 58. IO7. I29. I45 Brown. Rose ................ 8I. 82 Brown. Rosemarie .............. 98 Brown. Roseffa . . . . . . . 82 Brown. Sheila ... .... 46 Brown. Shirley .... . .,...... 67 Brown. Tyrone ............. 6l, II6 Brown. Waddell ...... I3I. I56. l59 Browning. Paul .... - 'I ........... 42 Bruce. Jeaneffe ..... 67. IO3 Brufon. Mardell .... IO7. IIB Bryson. Mary 28. 6I. I47 Buchanan. Ida .... . ........ 82 Buchanan. Minnie .............. 57 Buchanan. Sandra .............. 56 Budylt. Joan .. 40, 4l. 67. 77. 9l. IOO. IIO. II2. Il5. l20. I22. I28. I40 Burcheff. Doris .....,.. 67. II3. I22 Burdeffe. Joanne ...... 82. I45. I46 Burger. James ................. 42 Burger. John .............. 57. IO6 Burkes. Teresa ..... 3l. 62. I45. I46 Burnes. Judifh ......... . . ....,. 67 Burrell. Donna .. ............. 67 Burwell, Elnora ....... .. 83 Busch. Klaus ....... .... I I6. I58 Bushno. Richard .... ...... I 57 Bufe. Mr. Glenn .. ...... 25 Bufler. Emanuel .. ... l55 Bufler. Pafricia ...... ....., I 47 Buffenwieser. Marfa . .. ... 67. IIO Bufferman. Inez ..... ..... 9 5. I3O Bynes. Walfer .... .... I 34. I35 Byrd. Gloria ........ ....... I 44 Caldwell. Leroy ..... ....... I 59 Calef. George .. .... I29, l54 Calhoun, Rufus ..... 67. I50 Calloway. Edna 24. 59. I46 Calloway. Henry .............. 67 Calloway. Paficia ...... 5l. IOO. IO7 Cooley. Freddie .. ....... 42 Cooley. Jochen ..... 63. I29 Cooley. Jurgen . .... II4, II7 Cooper. Delsa .............. 54. 55 Cooper. John .................. 46 Cooper. Kaaren . 65. 68.98. II8. I33 Cooper. Orneafha ............. 42 Cooper. Sandra ....... 98. I00. I02 Crorder. Mary ................ 42 Cordesman. Mrs. Geraldine .. 33. 49 Cornis. Bob .......... 6I. I28. I29 Coffen. Jay .....,............ 47 Coffon. Belly .. 68. IO6. l35. l38. I45, I47 Coffon. Mel ...... .. 93 Dawson. Johnnie ..... ......,.. 4 2 Dawson. Joseph ... ......... .. 5I Dawson. Susan .... 35. 83. I44 Day. George ..... ......... 6 8 Deahl. Mr. Elmer ..... .. 25 Dean, Charles .... 59. I48 Decker. Corrinne ............. 42 Dedreaux. Beffy ................ 44 Dee. Avery ...... 68. IOO. I57. I58 Dee. Tobbe .......... ..... 5 3. IO3 Deis. Dyanne . I29. I44. I45. I46. I47 Delaney. Rosalyn .............. 68 Delano. Susan .... 50. II2. I23. I36 Dennis. Annie .......... 32. 46. I35 Dennis. Barbara 57. IIO. II2. II6 Dennis. Maxine ............... I32 Dickerson. Dennis ... .... 62 Diffay, Frank ..... ......,. I 34 Dillard, Harold ........ 46, l54, I59 Disfenfield, Marcia 45, I03, I29 Diffmann, Jenny .. Diffmann, Marcia 40,9I. Ewing. James ... Ewing, Janice .. Ewing, Roseffa L I I0 Diffmann, Paul ..... ......... 4 6 Doke, Shirley .... 56, II6, I27, Dombrosky, Sfuarf .............. Dixon, Carolyn ...... .. 83 Dixon, Herman ..... .... 5 6 Dixon. Jacqueline .... . . . I45 Dixon, Roberf ................. 42 Dodson, Louise .,...,..,..,.... 89 I47 62 Donahue, Mrs. Rufh ............ 2I Donaldson, Charlyne ...... IO7, I29 Donegan. Miss Rosemary .,.. 23. 46 Donner, Joan .................. 62 Donner, Ronald ........... I37, I59 Dofson, Alfred ..... .... 4 2 Dofson, LaVerne ..... .... 5 8 Douglas. Jeral-dine ... .... 42 Douglas, Lesfer ..... .... 8 3 Douglas, Olivi ....... .... 4 2 Douglas, Raymond ... ... I59 Downs, Rossffa .... . . . I I6 Dozier, Jacquelyn .............. 60 Dozier, Sharon ........... I35, I38 i Draznin, Anne .... 47, I29, I46, I47 83 I37 3 Driver, Willie ............. , Drucker, Donna ................ 63 DuBois, Carol ....,............. 68 Dubyk, Mrs. Mildred ,. 35, 60, l0l I46 Mr. Walfer ......,.. . I7, 92 Dubyk. Dudley, Benneff Dudley, William .. 33, 4I, 63, III. I27 Duffell, Gale ...... 4I, 68, I34, I37 Duggan, Mr. Maurice ........ 30. 52 Duharf. Barbara ................ Duke. Vera ........ .... 83 42 Dukes, Kafhleen .... .... 4 2 Dupree, Ardella .... 42 Durden. Sandra 47 Easfman, Gloria .... ...... 4 2 Eazelle. Theresa 68 Ebel, Chrisfel ....... sa. iii Eddie, Cliffon ..............,. I59 Edgar, Mrs. Grace .......... 27, 57 Edidin, Peggy .... 46, IO3, l26, I47 F Fabrifius, Karen Faermark, Royna . Falk, Sandra ......... Farr, Mrs. Alfa ........ I9, II8 4I 64 65 69 Farr, Raye .. 40, III, II4, II8 I22 I Fawkes, Sfephen Feafhersfone, Ruby Feldman, Roger Fergerson, Rifza ... Ferguson, Carlise .. Fierro, Miss Romana Fifer, Annie ....... Figuerra, Gilberfo . . Fisher, Harry ..... Fisher, Jeanie .,. Fisher, Pamela Fisher, Penny ...... Fifch, James ........ ....84 58 55, I45 44, II6 69, IO4 IO6 ,I24 . . .I00. . . 23. l28, I3l II4 I36 48 I08 69 2I, 53 42 69, 57 IIO 48 42 53, I45 48 Fifzpafrick, Miss Alice .. I9, Fifzpafrick, Bernard .... . . . Fleefwood, Homer Fleischer, Richard Flefcher, Flossia Flefcher, Tyrone . . . Flowers, Walfer Floyd, Ernesfine 53 42,43 45 84 ...28 I58 .. .........., 62 Floyd, William ... ... 25, 44, I59 Foran, Erike .... .......... 4 5 Foran, Walfer .. ............. II7 Ford, Sandra .................. 47 Forman, Carol ... 2I, 69, I02, I I5, I I8 I20, I22, I29 Forwalfer, Mrs Lois . ...... 26, 6I Fosfer, Janella ...... ........ 6 9 Fosfer. Judy ..... ..... I 8 Fosfer, June .... ..... I 45 Fosfer, Sirrena ..... .,...... 6 0 Fosfer, Spurag ...... .... 6 9, I49 Frankenburger, Allen . 42 Edler, Jumous ......,.......... 83 Edmerson, Vera .. 62, I02, IO3, IO7, II2, I46 Edwards, Doris ................ 69 Edwards. Geneva .............. 69 Edwards, George .......... 63, I55 Edwards, Maxine .............. I47 Eichholz, Allice .. Il, 43, 83. 86, IOO, II2, I23, I27, l28, I29. I35, I46 Fichholz, Carole ........ 46. 90, I47 Eiger. Andria .. 60, 63, II4, II5, I29 Eldridge, Glen ................ I32 Ellegood, Larry ......,......... 55 Ellis, Ronald ... ,,,, 42 Ellison, Rexine ................. 42 Elumn, Alberf ,.......,....... I59 Engel, Lewis ....,. 54, IO9, I23, I34 English. Beverly ..............., 42 Enfzminger, Ronald ..... I3. I09 Ephriam, Alice ..... 69. lO8 Eppen, Eleanor . ,. ...... .. 84 Epsfein, Maxine .... 27. IOO Erenberg, Harrief .............. 63 Erenberg. Naomi ...... 53, I02, I23 Erman, Frances .. 69, I02, IIO, II5, l22, l26. I30 Esfers. Jerry .... ............ I 50 Evans, Deloris .... .......... 6 9 Evans, Jonafhan .... ..... I 58 Evans, Sandra .... ..... 6 9. I36 Evans, Tessa ....... .. 42 Evans, Waurren 62. IO9, I59 Franklin, Charles .... Franklin, Mr. Homer ........... Franklin, Maxine . .. Frazier, Dywinna .... 58, I37 23 69 56 Freemond, Barbara .. 69, I I5, l22, l26 Friche, Ronald .............. I33 Friedland, Rachel .. 69, II5, l22, I30, L I33 Friedlander, Danny ..... ..., I O6 Friedlander, Rufh ........ ... I34 Friedlander, Miss Sadie ........ 27 Friedman, Marfin ............., 50 Friedman, Phil .........,...... 84 Friedman, Ingrid ...... 46, IO6, I47 Frifkin, Paulefie .. ......... I30 Fuiimofo, Joann .. 58, I06, I46 Fuiiwara, Wayne ...... . I54 Fuller, Gloria ...... .......... 5 9 Fulfon, Beverly ................. 48 Fulfon, Frankie .,............. I27 Fufrell, James .. 63, IO9, I49, I5O, I53 Gaddy, Chrisfopher ,... .... 5 3 Gaines, Johnnie ,..... .... 4 5 Garfinlcel, Alan ..... .... 3 4 Garlingfon, Donna .. ... 42, 43 Garlingfon, Janice ... .... 69 Garmisa, Billy ...... ...... 2 5 Garmisa, Roberi' ...... .. 69 Garmon, Fannie .......... 84, I36 Garner, Barbara ..... .......... 4 7 Garner, Bobbie ,. 53, I27, I36. I44. I46 Garneff, Leonfene ............. 46 Garreff, Mary Garreff, Pafricia Garreff, Simuel ...... Garfner, Bonnie .. 69 Gary, Jill ........... Gaskins, Mr. Spurgeon Gafewood, Monroe ............ 62, I29 45 I33, I59 ,93, II5, I22. I32 . ......... 47 25. bl I59 Gee, Jimmie ................. II6 Gendel, Judy .. 52, 58, I I5, I23, I32, I33 George, Sandra .... I33, I45 Gerdy, Herberf ..,.. ........ 5 3 Gershon, Michael ............. 50 Gerfler, Fern ................ I30 Gerwin, Mrs. Dorofhy .. 30, 97, IO7, I24 Gholsfon, Leafrice ...... .. 84 Gholsfon, Polly .... ........ 5 9 Gholsfon, Roberf ...,......... IO7 Gibbons, Peggy ....,.. 56, I23, I29 Gibbs, John ....... ........ I 59 Gibbs, Michele .... .......... 4 5 Gibson, Beverly ,............... 46 Giles, Annie ........,. 55, I36, I46 Gilliam, Jean ..... 69, IO4, II5, I36 Gray, Annie .... Gray, Gail .... .. Gray, Herberf ... .... . . .. Grayson, Alan ... ...... ,... Grayson, Jan ......... 40, I00. Grayson, Willie .... Green, Donald ..... Green, Gwendolyn Green, Jesse ...... .. 42. 59 57 70 42 I I4 I58 I I6 30 I59 I55 I33 IO4 I23 44 I47 49 I45 I38 Gillispie, Wilberf .......... 56, I59 Gillman, Edward ...... ...... 4 2 Gillogly, Miss Laurel .... 5, 2I Gilmore, Clemenfine .. .... 42 Gilmore, Ileen ....... ... I33 Gilmore, Jennice .. 63 Gilmore, Marlene .. .......... 5l Gindry, Joseph .............. I58 Ginsburg, Mariorie .. 70, 93, I02, I I5, I29 Gipson, Bruce . ..... 62, I59 Glass, Anya ....... .... 4 6, I05 Glass, Arnold ....,... .... 5 4, I48 Gleason, Mr. Maurice .. ...... 29 Glees, Henry ..,..... ,... 5 I Glees, Pafricia ..... .. . 59 Glenn, Alphonso .... 42 Glenn, Rochelle .... ..... 6 3 Goqqins, Tammy ... ... . 84 Golab, Angela ... .. . . 45 Gold, Diana ..... ........... 44 Goldberg, John ................ 6I Goldberg, Sheila .. 70, 78, 9I, IIO, I30 Goldman, Daniel ........,..... I32 Goldman, Donald ,. 5, 4I, 54, I23, I35 Goldman, Mr. 81 Mrs. Melvin .... 97 Goldman, Sheila .. 2I, 70, 73, IOO, I22, I26 Goldsberry, Mrs. Rosa ........ I02 Goldsmifh, Michael .... 60, IO7, I09 Goldsfein, Judy ..........,.... 52 Golliday, John .. l35, I37, I38, I49 Golsfon, Marie ..,..... 59, I08, I29 Good, Mrs. Elizabefh .... 3, 33, I27 Gooden, Richard ..... I5l, I53, I55 Goodloe, Telfrieda ............ 56 Goodlow, Alberf ...... 33, I34, I49 Goodwill, Lawson . .......... 70 Goosby, Porfer .... ........ 4 2 Goosley, Laurence ............. 45 Goree, Sandra ................. 53 Gorefzki, Barbara Gorin, Douglas . . .... 70, 98, I08 7,44 Gorin, Inez .... 58, IO3 Goss, Arnold ... .... .. 42 Gofflieb, John ......... .. 42 Gofsis, Pefer .........,........ 60 Gourdine, Harrief .. 37, 54, IO6, II2, I37 I23, Gowdy, Maxine . II, 56, IO6, II6, I36 Graff, Sheila .......... Graham, Brenda ........... Graham, Joan Gra nf, Harold I5, I03. I33 53. I36 84 Granf. Mary .................. 70 Granf, Richard .. 58, IO0, II5, I23, I29, I59 Graves. Fred ....... IO6, IO7 Graves. Gloria . 59 Green. Roberf ..... .... 5 3, Green, William ......,. 84, I32, Greenberg, Barbara I00, Greenberg, Gail .. 60 IIO, II5, Greenberg, Sonya ..... ...... Greene, Christine .... .. 35, Greene, Donald ..... ...... Greene. Jacqueline .. .. 70, Greene, Richard ...... I34, Greene, Sfeven .. 4I 98. IIO. II2, I29, l57 Greenlee, James .......... 46, I59 Greenwald, Joan .. 62, IO3 I23, I29, I33 Greenwald, Richard .......... 7, 70 Greenwald, Roberl' ..... 4I, 46, I27 Griffin, Anfhony ...... 58, II3, I58 Griffin, Earl ....... ..... 4 2, I58 Griffin, E'Ihel ...... ...... 4 2 Griffin. Linda ....... ........ 7 0 Griffin, Sfephanie .... ..,. 5 4, I36 Griffifh, Gloria .... ...... 4 6 Griffifh, Mary ....... ........ 6 3 Grimes, Raymond ............. I34 Grizzard, Carol ........ 54, I45, I46 Groom, Annie ........ 63, I46. I47 Groom, Roy ......,....... 70, I49 Groof, Paula .................. 42 Gross, Carol ...... 58, IO3, I23, I29 Gross, Gloria ............ I29. I36 Gross, Marfin ...... 5, 4I, I23, l54 Guadalupe, Carlos ............ 54 Guess, Marie .... ...... ..... 7 0 Gulley, Rosemarie . I45 H Haehnlein, Barbara .. 60, I2I, I33, I47 Hahn, Arfhur ..... ...... 4 7, IO3 Hall, Barbara ....,..... 27, 70. I36 Hall, DeQuincy ................ 63 Hall. John ....... IOO, II6, I50, I55 Hall, Nick ....... II7, I34, I38, Hall, Phillip ...,.......... l53. Hall, Raymond ................ Hallman, Johnnie . .... . Halperin, Cheryl ... ...... 44 Halperin, Donald .... ..... 8 4, I49 Hamaguchi. Ronald ..... 36, 37, 46 Hamilfon, Shirley ....... 30. 94, IO7 Hammersley, Joan .. 3, 24, 40, 4I, 66, 70, 9I, 92, II5 I 55 I 55 I 58 60 I00. IIO, . I22, I27 Hampfon, Edward ,. 60, 62, IO3, I09, II6 Hamu, Ron ...,................ 60 Haney, Druecilla ............ 8l, 84 Hanlrin, Befh .... 70. I22. I23. I33 Hanley. Miss Grace ............ 35 Hansberry, Adrianne ..... ... IO7 Hansberry, Perry .............. 70 Hanson, Carolyn .............. I45 Harano. Ross .. 84, IO6. II3, I23, I32 I54 Hardaway, Annie .......... 70, I33 Hardaway, Louise ,... ...... 8 4 Hardaway, Zella ... . . ,, 95 Harley, Marfin ..... ....... I 58 Harness, Mildred . . . ........ . . 46 Harper, Barbara ....... 70, IO6, II6 Harper, Frederick .... ........ 4 2 Harrell, Barbara .... ...... 5 2 Harrell, Gilberf ..... ...... 5 I, I55 Harrell, Huberf ............... I55 Harringfon, Gloria .,.. 60, I35, I38 Harringfon. Guy ...... 44 ii.m.a.a.s..sz.E.2:.,am..-..f,.., .Jasc 4,..n,. -.. wa-. ,, .2 .,-.Q-,L.....1...,, ... .. :.-.,xqa.s.u......-.,,..a.s.,. A arris arris Annie Ashfon . . arris Ella .... 54, arris Jo ...... ...,.. 4 5. arris Joan .......,.....,..,. arris Joseph ...,.., lll. l57. arris Judy .... ...,........ arris. Karen .... 50. I46, arris Leroy .... .......... arris Mamie .,..., .. 53. l32. arris. Mary ..,, ...,....... arris, arris. Roberl ..,...,. 58. . arris. Verger ... ....,.. .... arris, Wisleria ... .,,,... . . .. arrison. Arfhur arrison. Eugene arfsfield. David Rila ..,............ . .. 33. 4l. I-49 54 52 I36 l39 42 I59 58 I47 I59 l45 60 49 I50 42 42 6l 70. 78. l26. I33 I58 42, asan. Mr. Ellioff ...,. 34. IOI. I46 ashimofo. Fred .......,,..... 42 affield. JOV .. 3l. 7l, IO4. I22. I29 au h Linda ........, 3l. 7l. 98 9 1 ' augh. Pal ....,......., 50. 98, 99 auser. Lillian .. .....,... 99 awkins. Casey ...,....,....,.. 42 awkins. Mary ................ 42 ayashi. Jean .. 26. 40. 7l. 98, l22. l23 aye, Larry ...............,.. . 62 ayes. Barbara . . . ....... .. 50 ayes June .... ........... 4 7 eyes. Slanley ...,.... Sl, II7, IFE ayes. Terrence .........,..,. I58 ayman. Toby .... 53. I06. I23, I29 aywood. Jean ..,............. 7I eard. Dorofhy ............... 84 earon. George .,.. ..,...... 8 4 aim. Judy ......, 4l, 60. l23 aim. Linda .... ..... 4 6. IO3 einze. Billy ........,..,.. 46. IO3 einze. Ernesf ............. 59. IO9 elm. Mr. Herberl .. 23. 46. IOI. II4. l25 elmer. Mvron ...... ..,..,... 8 4 emohill. Celesline ......... 20. 84 emohill, William ..,.......,. 42 enderson. Booker .... 59. lI2. I59 enderson. Helen .....,,...,., 53 anderson. Norvelfa ......,,.,. 7l enry. Ann .......... .... 4 2 enry. Hallie .......... .. . l35 enry. Mrs. Mildred .... .... I 06 enry. Willie ......... ... 84. l38 errmann. Gail ,... .... 7 I. V72 ickmon, Russell .... 55. IFR icks. Barbara .... ......... 42 icks Lonnie ..... ,.,...,... I 06 iaashida. Diane .............,. 42 iohfower. Faye ...... 6l, IO6 l'0 ill. Barbara ...... ....,... 7 I. 84 ill. Freddie .... ..... 4 7. I58 ill. Franklin ......,........... 42 ill. Ida ........,..... ...,... 4 2 ill. Joan ...... 22. 37. 58. I23. l4I ill. Misha .............,,. 56. IO3 ill. Roberf ...........,....... 84 ill. Thomas .... ....... 4 2 ill. Ulysses 42. I58 iller. Alan ..... ..... 4 2 inlon. Renee .... .... 5 8 infon. Roberl ............... I59 irn. Ernesl .......,.....,. 46. I34 Iirscln. Fred .. 40. 7l. II3. II4, I72 ifchcock. Gloria ............,. 42 ilomi. Jack ............,..... 7l iura. Belly ....... ......... 6 I lobson, Bernadine ..,....,..... 42 lodge. Delores ...... I45. I46. I47 lodqes, Marieffe ........,.... I46 loffman. Marilyn ..... 45. I29. I47 loffman. Renee ............... 42 loffman. Roselle loffman. Sandra loffsfadl. Paula ....... 53. . logan. Lillian .... ........ loliday. Viola .... ....... ..55 IO6 ll2 l6O 42 Holliday. Belly Holliday. Norma .. Hollins. Grace .. Hollis. Susan ...... Hollisler. Edward . Holloway. Julia ... Holloway. Lawrence Holmes. Jereldene Hooker, Frances .. Hooker. Willard ,. Hopkins. Jerome .. Hopkins, Jonleah .... ,...,.5.8. .57. . fi..fffl'ii' .....4o.7i ....7I. Hopson. Earnice ....,.......... Hopson. Frederick .... 7I. I49. Horila, Linda .. 36. 37. 55. IO6. Horlon. Emma ..,..... Horlon. Roger ............... House. Lillie .... Housfon. Jesse Hovey. Michael .. 59, II6. bi. nos. Howard. Barbara ...... Howard. Corinne . Howard. Eddie ..... Howard. Edward .... Howard. Mrs. Irene Howard. Phyliss ... Howell. Carol ... 58 63.l32 .....44 42 Howell. Pal ....... .......... Hubbard. Arlhur .. ,.... 56. Hubble. Susan .... Hudson. Everla ..... ..... Hudson. Mildred Huff, George ..... Hughes, Earline ... 'fsi Hughes. Mary ..... . ..... 7l'. ll I8 Hughes. Rulh .......... 7I. 98. l32 Humes. Sherry ............,.... 60 Hunl. Sandra .........,........ 85 Hunler, Mrs. Elizabefh ....,. I9. 58 IO7. I59 Hunler. Hugh ............ Hunler. James .. l32. I33. I48. Hunler. Sara ................. Hursl, Mr. Leonard . 32. 53, I33. Hurslon, Willie .. 7l, I49, l53. Husband, Jacqueline .. 55. I36. Husband, Lorella ...... 7l. II6. Hulchens. Judy ... Hulchings. John ...,.......... Hufchins. Margarel .... 85. ll2, 53, Hullner, Susie ............. 85. ldeno. Michael .... Iiichi. Kenl ................... liichi. Teiko ..........,. I2. 56. lmada. Irene .. 72. 98, IOO. III. I42. I44. Ingram. Richard .. 59. I50. l5l. Isaac. Miss Elaine ........ 33. Isaac. Lorella ..............,... 42, 96. 60, lshino, Ronald ................ Isaacson. Michael ......... lsenberg. Mrs. Roselle .. 44. lsenberg, Sleve , ......... .. Israel. Nancy ... ... 44, 5l. Ivey. Wanda .... .......... . . . Ivor John ..... y. .......... 47. lwanaga. Kennelh ., 59, IO9. II7. lwanaga. Margarel ............ Izumi. Cryslal ...... . . . J Jackson. Amanda ... .... Jackson. Anifa ...... .... Jackson. Anloinelle .. ...,. Jackson. Arlene ..... ....... Jackson. Barbara .... , .... 58. Jackson. Beverly ..... ......... Jackson, Frank ........ 59, IO9. Jackson. Harriel .... 59. 63. I36. Jackson. Jerald ... ....... ... . Jones. George .... ...... 6 O. I59 Jones. Helen .... 85. I35. I38 Jones Herberf .. ........... 42 Jones Ivory .... ......... 5 l Jones. Jeff ...... ..... 2 3. 63, I49 Jones Johnnie .. ....... ..... 7 2 Jones Melinda .. ......,..... 42 Jones Mary .. 42 85, l08. I45. I46 Jones Ronald .......... .. 42 Jones Rudy ..... ........ 6 2. I50 Jones. Rufh . .. ..... 47, II6 Jones. Sidney 4I, 50, l4O Jones. Theresa .... ......... 5 3 Jones, Tom ..... ......... 5 3 Jones. Vicfor .. .......... I59 Jones. Willie .... ........ 6 O. II6 Jordan. Carrie .. .... 59. IO6. l45 Jordan, Delores 4l. 58. l45 Jordan. Doris .... ..... 4 9, I36 Jordan. Ernesline . 85 Jordan, Sylvia .... .... 4 7 Joseph. Bruce .....,. .. .... 58 Judkins, Yolanda .............. l3I Julien. Archie ................ I37 Julsfrom. Mrs. Margarel .. 25. 89. IO4 Jundel. Peler ....... .. .... 42 Jurineack, Lanier ... 53 K Kabumolo. Linda .... 46. I47 Kahn. Donna .................. 63 Kahn. Frank ...... 54 Kahn. Jay .. 4I. 60. II3. II4. II7, l40 Kaiser. Belly .................. 44 Kaiser. Connie . .... Kamerlink. Mike ........, ...... 9 9 Kamins, Mrs. Molly ......... I9. 54 Kamp. Peggy .. 50. IO2. IO3. ll2, l23 Kanemofo. Janice .. 60. 6l. I23. I46 Kanemolo. Neil .......... l I l. I I7 Kanler, Arnold .. 58, 6l. IOO. I23. Kaplan. Marshall ....... 84. 85. Kasper M r. George IO3. l54 I49 29 Kebo. Palsy zo, 72, loa. l06...I22 43 Jackson, Joanne ............... I36 Jackson. Joe ................. I48 Jackson, Karen 72. IO6. II6. I36 Jackson. Kennefh .............. 42 Jackson. Leighlon .. 6l. I I6, l32. I49, I50. l53 Jackson. Marsha .. . ......... . 72 Jackson. Ora ..... ......... 4 2 Jackson, Palricia .... 58. l45 Jackson. aymond ... ..... 52 Jackson, Ronald ... .... 42 Jackson. Sam ... .. I I6 Jackson. Thomas .. .... 34 Jacobs. Irwin ...... .. . 53 Jacobs. Neilvinia ... ..... .. 72 Jacobs. Sharon ..... ......... 5 0 Jacobson. David ............... Sl Jacques. Mrs. Sheila .... 25. 54. ll2 James. Ellis .................., I37 James. John ........ ....... 4 2 James. Michael ....... .. 55 James. Palricia .. ...,...... . 42 James. Susan ..... 4I. 54. l45 Jasper. Roscoe ...... .... I 06. I59 Jefferson. Alberl .... ...... I 32 Jefferson. Brenda ... ...... 3 Jefferson. June ... .... l45 Jefferson. Marvin 53. I58 Jefferson. Mary ..... 63. I34 Jefferson, Media ... ..... 72 Jefferson, Melvin ... ... I59 Jefferson. Muriel .,.. .... 5 2 Jenes. Carlo ...... ..., 4 9 Jenkins. Bealrice .............. 85 Jenkins. Brenda .......,........ 42 Jenkins. James ..,. 63. I34, I35. l38 Jenkins. Marlha ........... 53, I36 Jennings, Janice .............., 72 Jennings, Thomas ..... 72. II6. I49 Jennings. Zellena . ........... 55 Johnson, Ann ..... ......... 4 2 Johnson. Barbara .... ... I44 Johnson. Beniamin .... ..... 4 2 Johnson. Bobby ....... 72. I50 Johnson. Charles ............... 59 Johnson, Mr. Cornelius ..... 33. l25 Johnson. Daniel .......... 46. I59 Johnson. Edwin .,..... ....., l 59 Johnson. Edwina ....... 47 Johnson. Ernesl .. . 54, I59 Johnson. Felfon ........,....... 6l Johnson. Frances .............. 42 Johnson, Freeman .. I8. 85. Ill, I29. l33. I55 Johnson. George .............. I37 Johnson. Geraldine ... ..... 72 Johnson. Herman ... .. . ., 3 Johnson, Kafherine . ... 85 Johnson, LaVelle .............. IO6 Johnson. Miss Margarel ...,. I7. 27 Johnson. Marla ......., 37. 58. l3l Johnson. Melvin ...... 42. I58 Johnson. Nellie ... ..... .. 42 Johnson, Orcelia ... ....,.. .. 42 Johnson, Rebecca .... 46, II6 Johnson. Ricardo .. 47. I55 Johnson. Rila ..........,....... 72 Johnson, Ronald .......... 62. I58 Johnson. Sandra .. 37. 55, 58. IO7. l23 Johnson. Tyrone ....,. l54. I56. I59 Johnson. Viola .... ........... 4 2 Johnson. William ... ....... .. 63 Joiner. Irma ...... ,.... 4 6 Jones. Arsenia ...........,. 55. I47 Jones. Berfha ......... ........ I 47 Jones. Bessie ..... 62. II6. I45. I46 Jones, Belly ............... 58, 72 Jones. Bonnie ... ........... .. 72 Jones. Carlo .... .... I 03. I37 Jones. Cecilia ...... . 42 Jones, Clara ..... ........ 6 3 Jones, Creadel ... ... l33, l57 Jones. Dorolhy .... ....... 4 6 Jones. Eddie ..., ,,,, 6 0 Jones. Eleanor ,. ,,,. 72 Jones. Emma 85 Kellar. Joyce .................. Keller. Harry ...... ..... 6 2. I59 Kelly. Michael .... .... 4 3. I58 Kelly. Wayne . .. .,,,, ,, 53 Kelly. Willie .... 60. I37 Kenf.John Ilb Kenl. Mary .... ........... 8 5 Kern, Belly ........ 57. IO7 Kernis. Marlin ....... 26. 40. 72. 98 Kesner. Suzanne .. 67. 72. IO2. IIS. l22. I29 Kessel. Jeff .. 20. 6I. II3. I23. I29, l5l Kessler. Josephine .............. 72 Keslnbaum. Joe ... .... 89 Kefchum. Richard ..... . II4 Key. Earl .,....... 85. I55 Kidd, Jerome 43. I58 Kidd. Karl .... ..... 5 9 Kiek. Diane ..... 6l Killebrew. Yvonne . ..,, 47 Kimbrough, Harrison 48 King, Adrienne . .. ... I8 King. Daisie .... ,..,,,, 7 2 King. Lorenzo ...,,,, , I32 Kirk. Diane ........ ...... I 07, II6 Klrkline. Pamela ............... 45 Kirksey. Kirk .... .. II6, I37, I59 Kifover. Brel ...... ........... 5 7 Klein. Phyllis ...... Kmelly, Mrs. Helen 43 28. 97 IIO Kniazzeh. Mrs. Charlolle .... 2I, Knox. Bellie ...... 73 Knox. Belly ........... ..,. 7 3 Knox. Rochelle ................. 43 Kobrin. Janel .. 60. II4. I23, I29. I33 Koch, Koch-Weser, Peter .. . II4. I34, Koizumi, Ann ...,,..... 44, I36, Komatsu, Niki . ............ 48. Koonce, Barbara ...., I33. I45, Bonnie ...... l3, 47, I26, I27 I54 I46 I46 I47 Kornhauser. Mrs. Beatrice ....... I8 Kosky. Sally .................. Kosman. Daniel .. 7. 36, 37. 40, Koss. Barry .................... Kramer. Leslie ...,........ 46, Krawitz. Joann ............. 63, Krichilslcy, Rhoda .. 73. 99. IO8. Kril. Gail ......,.............. Kubose. Sunnan ................ IO3 4I. 73, 74, II3. II4, l20 73 l29 IO3 II5 62 85 Kurrie, Miss Maiel .... 27, IO4 Kurtz, Barbara ..... ...... 5 3, I02 Kurtz, Beverly .... 44, I05. l32 Kurtz, Clarice .... ...... 6 I. II5 Kushida. Helen . ........ 43 Kushida. June ..... I02, I47 Kuziel, Emil .......... ....... 4 9 L LaBot. Edgar , ..... LaFeIl. Eddie Lamb. Jon .................... Land. Doris Lane, Micah , , . . Lang. Steve ........... 63. IO9, 'ffii ' lbs' 'sbs' i ii Morris, Malone, Sonya ................ 27. 55 Langdon, Charles Lanier, Virginia .. ,..... .. Lanlon. Randall .... ...... Laslrin. Alan Laslcin, Joan ....6l, 47 l59 47 I 32 I46 I59 43 52 I 59 I07 Latimore, Patricia .... ..... 5 I Lau, James ....... ...... 4 6 Lauria, Anita ...... 4I. 73 Laveta, Lawrence .... ....... I I6 Lawrence, Helen .,............ 44 Lawrence. Mary ....... 73 IOB I27 I45 Lay, Bobbie ...... 60. no-if isef Laycock, Michael .............. Lazar, Jerry . . 98 I56 I57 6I , ,l59 Lazarus. James .. 63. II3, II4. I23, l50 Lazarus, Joan .. 6l, IOO, II4, I23, I28. l29 Leavell, Linda ................. 43 Lechtenberg, Mr. William ...... 27 Lee. Beverly ................... 73 Lee, Bobbie . . IO3, IO6, I45. I46, I47 Lee Claude .................. l55 Lee Faye .................... 43 Lee, Helen ..... ,. 5I Lee Marsha .... 47, II6 Lea Quong ....4 -- 53 Lee Willie ...... . . . Lehrer, Norman Leiva, John Lemon, Earl Leonard, Janice ..,............ Leroy, Michael Leshin, Barbara 73, III, Lesley. Melvin Lester, Lula . .. Leverette, Betty Levin, Alan ...... .. 6I, 99. I06. 12, 73, Levin. Betsy ..... ...... Levin, Mrs. Margaret .... I9. 49. 43 43 43 56 60 I39 I3O 43 48 73 I I I l32 5I Levine, Joyce .................. 85 Levinson. Howard .... ....... 5 3 Levinson. Stuart ................ 63 Leviston, Sandra ............... 85 Levy, Carol .. 4l, 73. I27. l29, l32 Levy. John ....,............... 53 Levy, Michael ................. 55 Lewin. Richard .... 55. I09 Lewis, Allred ...... ...... I 60 Lewis, Betty ......... ..... 5 7 Lewis, Mrs. Eleanor .... 23. 46 Lewis, Elwyn ......... ..... 5 0 Lewis, Janet .. ....... I36 Lewis, John .. ....... 44, 47 Lewis, Peter .... 57. II2, II3 Lewis, Theodore .... ..... 4 3 Lewis, Wade ..... 43, I58 Lewis, Walter .... ..... I 48, I49 Lewis. Wendy ... ... I02, l32 Lewis. William ........... I48, l59 Lewis. Wilson ..... 85, 99, I37, l59 Libles, Richard ........... 43. I27 Liclrlon, Ralph .... 4I. 50. IO9, II2. I37, I4-0 Lieb, Kenneth .. lll, I28, l29, l32. I33, I39 Lieberman. Paul .......... ..... 7 3 Litchez. Aaron ........ 60 I I3, II4 Lightfoot. Nathalie ............ 97 Lilly, Ronald ....... 45, I34 Lilly, Velora ..... I46 Lindauer. Jill .... ...,.. 4 5 Lindauer. Larry .... .... 5 6, I58 Lindauer. Zonnie ...., ..... l 47 Linder, Nancy ......... ...... 4 9 Lindsey, Lovie .... 63., I44, I45 Lintord, Gene ......... I32, I45 Liska, Mrs. Celina .... .... 2 5, IO7 Livingston. Earnestine Lloyd, Terry ..,.... Lockhart, Kenneth 73 .....5I Lockhart, Nellie ... .... 56 Loeb. Hannah .... . .. .... 73, I32 Loewenthal, Betty .... ....... 4 3 Lollon. Tildia ...... . 59, bl Lolton. Tommy .... IO9 Loitz, Charles .... .... 5 0, I27 London, Mary .... ..... 4 3 Long. Bertha ...... .......... 5 4 Long. Mr. Robert ...... 34, 50, l54 Longfellow, Linda .............. 50 Loomer, Bruce ..... ..... 8 5 Louis, Katie ..... 73, I45 Love, lrma ..... 63, I45 Lowe, Romney .,. ,.... 43 Loye, Karen ....... 94. 95 Lozada. Guillermo .... ..... 4 5 Lucas, Alberteen .... 6I, I45 Lucas, Geraldine .... .... 4 3 Lulxe, Eulalia ...... 85. I33 Lurie, Michael ... .. . .. 54 Lyda, Kathleen .... 85, I46 Lynch, Elizabeth . .. ...... .. 73 Lynch. Miss Theresa .... I7, 96, II9 Lyons, Emily ....... ........ 7 3 Lyons. Pauline ......... . 28, 5I Lyons, William ................ l55 Lythcke, Linda .. 86, II2. II5, I23, I27 M Mabry, Dorothy ........... Macarow, Mr. Leo ...... 23 Mack, Mary ....... Madden, Tom ... Madin. Clilton ..... Madison. Stanley .... Mahon, Laura ............. Mainzer, Evelyn ..... Malkin, Bonnie .... elf ibsf 'l'2'3',' Mallnn, lra ........... Malone, Arneda ....... Malone, Edison .. II, Manat. Mr. Alfredo ......... Mangrum, Marva .......... nas. ii Mangrum, Merrilyn .. Marbell, Neil ......... Margolis, Judy .... . Marks, Johnnie .. Marsh, Clara .... Marsh, David .... Marsh, William ....... Marshall, Mrs. Arta Marshall, Mrs. Beatrice ...., Marston. Miss Frederilca Martin, Betty .......... . 23. II2. I 86 . 55, I I7 60 IO4 II2 43 I35 60 I33 I28 43 35. I57 I46 II 8, I44. I45 73, III. I39 52 IO7 74 62 i 47. I58 I06 35. 50 97, IOI. I06 5I Ir .ii Martin, Charlotte ..,... 49, IO6, II6 Martin, Ernest ..... ......... l 58 Martin, Evan .... 60. ISI Martin. Harley 53 Martin, Helen .... ..... g ..... , . 56 Martin, John .................. 56 Martin, Michael ........ 43, 5I. l59 Marlin, Myra .... 74, IO8. II2 Maslov, Alvin .. ...,..... II4 Mason, Caroline . .. 6l. II4. I23 Mason. Eleanor .... .......... 44 Mason, Mrs. Hilda . .. .... 23. 55 Mason. Mary ...... ........ 5 6 Mason, Shirley ..... ...... 4 9, II6 Mason, Winilred ,............. l I2 Masse. Melisse ........ 74, I34, I35 Matermus, Adam ............... 43 Mathes. Anita ..... .... 5 7. IO7 Malhes. Delores ..... . IO4 Mathews. Presse ..... . I58 Mathies, Ronald ....... l59 Matthews, Beverly ......... 53. Matthews. Margaret ........... Matlhies. Helga ....... Maurer. Mrs. Adah .. 34, 35, 56 Maurer, Helen ........ Maybell, David .... Mayer, Myra ........ Maytield, Clare ....... Maytield, Margaret McBeth, Franitta ..... McBeth, Jeanetla .... I36 .46 86, I33, I45 . I45 I23, I35. I46 I33 50. I23 44 56 63 II6 McCahey, Miss Ann ............ 30 McCarthy, Mr. Charles .. 23. 89, 95, IO4 McCaul, Bob .................. 58 McClerkin, Wilbon .. 74, IO9, Il8, l37 McClure, Sandra .............. McClure. Sonia ...... . 60 74. III. I44 I45 McCluslcy. Linda .............. McConico, Stephen .... 29, II6. I48 McConnell. Erna .............. McCoo, Patricia ...... McCoy, Gudrun . McCoy, Olivia ... 59. I02. .43 II6 62, IO3 I36 l55 McCree, Dallas ....... 49, II6, McCue. Georgia .. McDowell. Catherine . McDowell. Felton .... 62 43 I37 McEwan, Virginia .............. 46 McFadden. Annette ........... I49 McGee, Huey .... 90, McGee, Juanita ............... . 50 , I53. I55 43 43 McGee, Viola ................. McGahee, Frank ........ ...... McGhee, Cynthia .... IO9 63, IOO, II6. I32. I33. I46 McGlaun, Beverly ............. McGurlr, Miss Ruth McHasl:ell, Edgar .... Mclnlosh. Melvin .... Mclntosh, Randola II6. .74 I9, IO4 I58 47 Mclntosh, Versaline .... ... McJimpson, Aldina .... McKinney. James .... McKinnon. Charles .... McKinnon, Dorothy McKinnor, Allonza .. McKnight, Verline McNabb, John ................ McNamara, Jean .,............ McPherson. Leonard .. McSpadden, Sadyegeral McWho rler, Donna McWilliams. Joseph .. McWilliams, Margaret Joenell ...... Medford, Mr. Warren Means, 86 86 58 86 74, I08 6I IO8. 74 II8 47 IO3 52, I56, I57, I58. I59 d .. 63. IO3. I35. I46 59 .. ..... 60 46. 90 .. .... I45 I9,62 Megginson. Marthenia ...... 57, IO7 Meir, Charles ......... ....... 4 I Meredith, Mary ........... 60, I34 Merritt. Moses ................ 46 Messer. Betty .... 74, I05. III, I39 Metcalf, Nathaniel . Meyer. Ann .. 5, 4I, Meyer, Fern ...... Meyer, Larry .. 65, 74, Michener, Arthur ......... I34. Miclrle. Juliette .... Middleton, Charles Miles, Jeanette .... Miles. Mary ....... Miles. R Millcintas, John .. Millcintas, William Miller, Ache ....... Miller, Glenn ...... obert ........ 83. is bl. II4. I34 l31 IOO, II4, I21 I3' 55, IO' 63, I29, I33 I56. l5' ......42,4I I35 I38 . .l5' 86, II2, II3 I23. l5' 48. l51 l2I .....48. IS! Miller. Gwendolyn . ....... 41 Miller, Janice .. ...... ,... 5 7. I0l Miller, Ronald ..... ..... l I3, l5' Miller, Wynetta ........... 62, I2' Mills, Sylvia ..... 53, II6. l4i Milsap, Vera .. ...... 60. l41 Mins. Maxine ...... .. 4' Minter, Beverly .... ......... 6 ' Mitchell, Connie ........ 65, 74, 91 Mitchell, Dora .... ........ 5 1 Mitchell. George .. .... 74, I02 Mitchell, James ..... .. 61 Mitchell, Leon ..... .... I 51 Mitchell, Ronald .. ...... l51 Mitchell, Willetta .. ... 56. I3 Moali, lzzat ....... ..... 4 I Mobley. Phyllis ................ 8. Monroe. Gatewoocl ............. 4 Moody, Paulette .. 63, IO3, I44, I4: Moore, Austin ................ 51 Moore. Charlotte .............. 71 Moore. Doris .... ..... 5 1 Moore, Earl ....... .... I 5' Moore, Edward .... .... I 41 Moore, Fred .... ......... 4 I Moore, Freda ......... . 42 Moore, Herbert ....... 74, I49. I5l Moore, Lewis ...... ..... . . l5. 4' Moore, Richard ....... .. 51 Moore, Rila ........ . . . 4' Moore, Sylvester ...... 51 Moore. Miss Virginia .... .. . 2! Moorehead, Kohnsa ..... ..... 4 I Morgan. Ardelia .............. Morgan, Janell .. 49, 56, I3O, Morgan, Thelma .............. Morris, Beverly ........ 74. Ill Morris. Booker .. 52, 57. I06. I48, l55, I56, I57 Morris. Constance ......... 56 Morris, Josephine .. 4I, 63, I35 Morris. Joyce ................ Morris, June .. 74, 9l, I02, llO, l22 Morris, McLester .............. Morris, Roy ..... ...... Morris. Thelma ... .... 46 Tom ..... .... 81 I45 I4T . 61 III I37 I5' I44 l3l 51 II5 I27 42 I4i III I5E Morris, Walter .... 46. 44 4. Morris, Willie ................. 1 Morrow, Robert ....... 52, I37. ISE Morrow, Roy .......... 6l, IO9. I57 Moseley, Forestine .............. 57 Moseley, Mr. Hamlin ...... 30, IO4 Moseley, Nellie ...... ....... 4 3 Mosley, Barbara .............. 5C Mosley, Charles ................ 74 Mosley, Jerome .. 52. I37. I58, I59 Moton. Marguerite ..... 74, 98. IOS Moy. Mei-Ying ........ 53, I35, I38 Munclre, Chris ................ l59 Murphy. Mrs. Edith ............ IO3 Murray, Anila ..... 55. I36, I47 Murray, Donald ........ 74, 86, l32 Murray, Donna .... 86. IIO, I23. I46 Murray. Ronald .... Mustitul, Maurine .. Myers, Donella .... Myles. Lillie . .... 47 .. .. ....... 55 I29. l32 74.98 ..-ex miami-1 .. N alls, Roberfa .,.. ance, John .... ance, Judy .... apier, Marfha .. 25.47 53. I3I 6l, I32 5I arimafsu. Kei .. ..,. 43, I27 ash, Bruce ........ . I34 ssh, Burke 63, I35, l38 ash, Horfense .. .... 86, IO6, I45 ssh. Larry ..,... .......... 4 7 ssh, Marilyn ....... .....,... 7 5 aaly. Dorofhy ......... 75 ableff, Margaref ............. 57 ail, Zerri .................... 43 aivelf, David ....,... 58, II2, I35 alder. Byron ......,. . l59 alson, Gloria ,.... .....,... 4 7 alson, Mrs. Irene ............ lO2 alson, Louis ........ 60, IIO, l23 alson. Mosella ... ........ . I I2 alson, Theresa .... ......... 4 3 ashide, Diane ...... 50 Parker, Donald ..... ,... ....... 5 9 Parker, Tyrone . . . Parkls, Sylvia .......... 57, II2, I27 Parrish, Julius .................. 44 Parry, Mrs. Kalherine 30.5l Parfma, Helmuf ............ 47, II7 Paschal, Barbara . ............. I33 23 Passovoy. Jean .... Payne, Roberf Payfon, Beffye .... Payfon, Jacqueline Peake, Jim ...... Pearl, Karen ...... Pearman, Howard .. Pearson. Lee ...... Pearson, Theda .... Peebles, Miss Grace Perez, Mr. Andrew . Perkins, Mary ..... Perkins, Pearlie ..., Perlmuffer, Sfanley . Perry, Alfhia ...... Perry, Jacquelyn . .. Perry, Rosalyn .40, 75, II2, l34,l35 62 42,86 43 l48, I49 I47 .. ..... 62,l53 ., ....... II6 5I, I46 25,47,96 .........23,25 .. ........ 63 47 53, l23, I49, I55 ...,.43 75 5l Perry, Wallace .. ..,. 75, I55 Peferson, Delrae . .. ..,...... .. 43 Pefrie, Mrs. Flefa ...... 30. 58. I24 Peffis, Earl ................ 43. l58 Peffis, Rose .... Il. 58, I27 I35, l38 Peffus, Pafricia .. 25, 37, 56, I23, I36 Peffy, Erma ................... 75 Phelps, Vicforia ....,....... 53, I35 Phillip, Charlie ..... ...... I 59 Phillips, Lena ..., ..... 3 5 Phillips, Roy .... ..... 4 3 Phillips, Rufh .... ....... 5 6 Pidgeon, Alvarez . ..... 56, ISI Pierce, Anneffe . .... II6. I36 Pierce, Audrey .... ..,.... 4 6 Pierce. Eugene .... ........ 4 3 Pierce, Yveffe ,............... 86 Pilaf, Mr. Joseph ....... 32, 47, I35 Pinkerf, Mike .,........ 75, II3, II4 Pinkus, Malissa . Pino, James .... Pino, Marilyn ...... Pifcher, Elizabefh 75 63 I46 52, I27, 5. 60, II4, I22. I23 I44 Price, Roger .............. 55, I23 Priddy, Mrs. Sara Lucille .... I9, I04 Prince, Frances ................ 43 Prcsfen, David ............ 47, I29 Pryor, Sandra ..... 23, 55, I35 Purdy, Fannie .................. 75 Puusepp, Pefer .... 29, 58, l06, l58 Quinn. Tyree ...... ... 86 R Raines, Diane ...... ......... 5 I Rainey, David .... 60, IO6 Rainey, Eric ........ . l59 Rallins, Mamie .. .... 27, 87, I45 Ralsfon, Harold ......... .. 47 Ramsey, Veronica .. ......,. I35 Randall, Frederick ........ I34, I35 Randall, John ......... 75, I32. I35 Randolph, Marvinia .. I44, I45, I46 Ranson, William .......... I56, l59 Rappeporf, Walfer .. .... 60, I27 Rafcliffe, William ... ..... .. 43 Rafhan, Nydia ........ ....... 5 2 Rafhnau, Mr. Joseph ...... 29, II7 Ray, Alexis .................... 45 Ray, Yvonne .......,....,..... I46 Raynor, Samuel ............... I37 Rez, Roberl' .. 63, IO6, IO9, II2, II3, II4, l23 Reams. Leslie ............ 53, I58 Redmond, Lennie .. ....... 50 Redmond. Shirley .,.. ...., 4 6 Redmond, Sfanley ... .... l5I Reed, Barbara ..... ..... 7 5 Reed, Bernadine , .... . I35 Reed, Carl ........ 54, II7 Reed, Frederick .... ..... ' 58 Reed, Linda ..... .... I 06 Reese, Leona ..,. ..... 5 3 Reese. Marlene ...... . I36 Reid, Anna ...,. .... 5 4. I44 Reinifz. Joyce .... 63, l23 Reiss, Dennis .... ............ 4 7 Reifman, Jan .................. 54 Reiwifch, Ann ...... 6l, 62, I3l, I33 Reynolds, James .............. I33 Reynolds, John ...... ........ I 32 Reynolds, Marilyn .....,.... 49, I46 Reynolds. Theon ...... I37 Robinson, Toni .. 7, 42. 76, IIO, Robinson, Vernell Roby, Barbara ..... ..... , Roby, Bonnie .... ....... . . 76 Roby, Rifa . ....... ...... , Rochelle, Herberf ...... 87. I32. Rochelle, Pafricia .......... 56, Rockymore, Lionel .......... . . Rodgers. Carolyn ....... I8, Rogoff. Janef ...... I9, 8I, 87, Rohafs, James ....,....... 47, I22, I33 43 I47 47 I I I I5O I46 43 I32 IO6 I59 Rohrke, Mr. Lloyd .......... 34, 47 f '46,' i 26, 'I 54 sfherland, Marcia ,..,........ 49 sffer, Virgie ................ IO8 suberg. Leland .. 37, 4l, bl, l23, I40, l54 swbill, Glorieffe ,............ 86 swell, Edgar .............,... 43 swell, Shirley .....,.......... 43 swman, Edifh .. 40, 75, Ill, II2, I I4, l22, I34, I35 swman, Judy .... 75, IO3, IO7, III, l29 iwman. Mary ..... 42, 43 cholas, Lassie . . . .,... . . 48 chols. Gladys ....,. .. 43 chols. Sferling .......... 55. I55 ckin, Mrs. Pauline ...... 28, ,I24 shida, Diane ................ IO3 shio. Helen .. 50, l23. I36. I44, I47 Iecki. Zbigniew ....... ..... 4 3 x, Donald .................. l58 irman, Amos ............... I49 zrswefher, Elizabefh .. 75, l08, l45 irfh, Nora .............. I35, I47 idelman, Richard ............ 48 norman. Gerald .............. 43 Ien, Sondra ,... 63, I36, l45, I47 gan. Sfuarf .................. 6I awa Jerr .......... 44 Rhodes, Mr. Charles .. Richards, George .. 46 .,...45, 23 56 3 , y ....... glefree, Conley ,......... .... 4 7 Kennard, Marfha .. ive, Mr. William .... 52, 54. I27. I46 32, 50 76 46, Preer, Marcia iver, Carol ................. I45 Iver, Mr. Edward .. 23. 25, IO9. I I3 rnsfed, Miss Cordelia ...... 30, 5l sen, Barbara ............ 44, I 29 86 sen, Pefer ........ ....... Neal, Marilyn ...... ..... gman, Arland ............ .. Shea, Miss Florence frinsky, William ............. frow, Mr. Raymond .. 23. 25. II3, I25 46 56 25, 62 46 flaw, Billy .......... 86, I57, I58 erall. Shirlean ... fans. Clarence fens, Eddie ...... P 47 ...86 Piffman, Fred .... ............. 5 2 Piffman, Sfeven .. ..... 43 Piffs, Edward .... .. . 48 Piffs, Evelyn ....... .. 28 Piffs, Vera ...... .,........ 5 4 Pivovifz, Norman .............. 60 Pizer, Howard ......... 75, l02, I5I Planer, Mrs. Helen ......... I9, 63 Plofkin, Gerald .,.. ,... 6 3. IO3 Podore, Deborah . . . Poellineh, Verneffa Poinfer, Annie ..... Poinfer, lola ...... Poinfer, Willamae .. Pois. Marc ........ Polk, Solomon . .. Pollack, Jack .... Pollack, Jean ...... Ponder, Alice . .. Poole, Chrisfine :ker, Charlene .. ne, Miss Myra .. 60, IO3, IIO, l29 IB. I9. Ill 44 lols. Walfraud .... ......... m, Harold ...... minfere, Angeline I, Jeff .,........ 'ham, Clarence .. 43 43 59, II4 54, IO9, l23 Pope, Kennefh .. Pope, Marshall . Porfer, Eugene .... Posfon, Nancy .. Powell, Eleanor .. Powell, Elinor Powers, Linda . .. Praff, Paf ...... Presberry, June . Preskill, Liz ..... Pressley. Anila .. Price Bernard .. Price, Floyd . .. Price, June .... Price, Meillyn . .. . ....... 58 43 54 60. IO6, I45, I46 53 56 I48 44 .. IO6, l28, I29 43 75 ...57 ...43 75 43 Sl. IO6, l45 86, IOO, I02, I26 50, I33, I46 46 62. IO3, I27 53, l48 86, IO9, I57 .. IO7, I44, I47 54, lO5 Richards, Harold ..... Richards, Larry ....... Richardson, Anneffe .. 48 95 6I, l45 Richardson, Barbara ....... 32. I36 Richardson, Laura ....... 30. 75. 98 Richmond, Ofha . .. ....... .. 55 Rifkind, Sfuarf ..,. ....... 4 3 Riley, Barbara ................. 75 Riley, Joseph .................. 43 Riley, Rose ...... 32, IO4, I35, l38 Rifz, Sfephen .....,............ 5l Rivera, Bonifacio ...... 49, I34, I38 Rizzer, Gerry .. 5, 4I, 68, 75, I00, IIO, II2, I22, l2B, I29, I33 Roloerfs, Horace ............... 47 Roberfs. Nicholas ...... 49, I34, I55 Roberfs, Rhea ..... .......... 4 9 Roberfs, Sandra ... ,..... .. 87 Roberfson, Janice .. .......... 43 Roberfson, June .......... 63, I45 Robinson, Diane ....... 56, I32. I36 Robinson, Donald ........,. 43, I58 Robinson, Huella . II6, I27, I32. l45 Robinson, Isaiah ................ 43 Robinson, Jacqueline ....,...... 43 Robinson, John ...... ..... 4 3 Robinson, Renaull' .... ....... 2 7 Robinson. Roscoe .... II7, I59 Robinson, Roxanne ............. 47 Robinson, Todd ....,.. 76, I32. I35 Rollins, Florence ............... 59 Rosenberg, Mrs. Ann ....... 30, I24 Rosenberg, Jane .. 7. 60, 63. II4, I22, I23 Rosenshine. Mr. Vicfor ......... 27 Rosensfein, Cliff .......... 45. I05 Rosenfhal, Elana ........,...... 47 Rosenfhal, Jan .. 26. 39, 67. 76, 9l, 98. IIO, II5, I22 Rosenfhal, Mark .............. 60 Rosser. Jean .......... 52, I46, I47 Rofh, Ellen .................... 43 Rofh, Renee .. 3, 24. 43. 66, 76. 9I. IOO, IIO, II5, l22, I27 Roudez. Joseph ............... I49 Rush, Linda ....... 57 Russell, Earnesfine ... .... II6 Russell, Maffie ............ I46 Rufzky, Miss Anifa I56 Sabafh, Bob ...... I23 Saddler, Ronnie . .. IO9 Sakry. Dolores ............ IO4 Sakry, Kennefh ................ 43 Sakuma. Grace .. 85, 87, II2, II5, I23, l29, I46 Salrn. Susan .. 6l, II4, I23, l32, l4l Sams, Miki .... ............ 6 0. I33 Samson, Michael .............. l38 Samuels, Philip .... ........ 4 3 Sanders, Frankie .... .... 8 7, l45 Sanders, Johnnie .. ....... 52 Sanders, Julia ...... ,. . . 87, l08 Sanders, Theodosia ....... I46, I47 Sanders, Vernon ..... IO6, I27 Sandifer, Craig .... ...... 5 9 Sargeanf. Aaron . . . . . . . 43 Sargenf, Arron .... .. 44 Sargenf, David ...... ........ 4 3 Sargenf, Jearlene .............. 56 Sauls. Ernesfine ................ 52 Sax, Richard ..... .... 6 3, II4, I29 Saxfon, Juanife .... .........,. 8 7 Scafes, Charles ...... ......... 4 3 Schaffer, Cefherine ........... 46 Schaffer, Janice .. .' ........ 87. I35 Schaible, Jane .... 82, 87, IWW II2, l23, I4I Schapiro, Jay .... 76, I24, lar. I58 Schapiro. Sally ........ 53. l4l, I46 Schechfer, Carol .. 87. II2, II5, l23 Scheider, Mary ............... Schlesinger, Barry .. 23, 40, 4I, 75, 76, IOO, I IO. I I3, I I4. II7. l20. 22, 54 Schiffman. David ...... ........ I I2 Schneemann. Yolanda .......... 56 Schneider. Jean .. 46, l29. I36, I47 Schroeder, Judifh .............. 55 Schulson, Nanci .......... l28, l3l Schulson, Sieve ........... 76, II4 Schulfz. Mr. Henry .......... 34. 58 Schulfz, Susan .. 40, 76, 9l, IO4, IIO, l22, I26, I29 Schwarfz. Bob ........... ...... 5 7 Schwarfz, Janef ....... 58. I45, I46 Schwarfz, Michael ...... 27, 58, II7 Schwerfz, Sally .....,. 76, II2, l22 Schwarfz, Vicki .. 76, 92, II5, Scoff, Caroline ...... ...... 4 7, l22, I33 I27 Tyler, Essie ....... Thornron, 5:3 ' A 1 T Taggarl. Tiah ....,.,. 61, 136, 145 Taiii, Keiko ........ 31, 63, 106. 136 Tallungan. Anila .,............ 141 Tanagi. Donald .... 32. 77, 134. 135, 138 Tanagi. Pauline Tanenbaum. Miss G Tang, Min-Ming .. Tani. Joyce ........... Tani, Richard .... oldie .. 23.51.52 37,49,98 55,100,123 21,60.111.114, Scofr, Charloire .............. 43 Scorf. Nadine ................ 76 Scarf, Parricia ............. 55, 146 scoff, Roberl .... 41. 106, 135. 138 Scorl. Rosie ..............,... 53 ScoH', Sara'Ha ....,............ 45 Sco'H'. Theodore .... 43, 158 SCOH. Virginia .. . .. . 53, 144 Scurry, Eugene . 53, 151 Scurry. Leroy ,..,. .... 7 6. 132 Sealon. Clarence .... .. 50 Seqallj Tommy .... .,.... 4 6 Self, Pafricia ..... 76, 106 Sewell, Herman ................ 59 Seymor, Beverly ............... 87 Shapiro, Bernard ......... ,,... 8 7 Shapiro, Harold '. .. 23. 76. 114, 134 126, 137 Smilh, Michael ... ... 43. 47, 129 Smifh, Millon .. ........... 159 Smilh, Ned .... ... 43, 148. 155 Smirh, Raoul ......... .. 77 Smilh, Richard 63, 149, 155 Smiih, Roberl .... ......... 1 33 Smirh, Solen .,................ 43 Smirh, Thomas .....,...... 56, 148 Smilh, Willie .............. 77, 134 Smilh, Yvonne ,... 77, 106, 108, 145 Soble, Warren ...,............ 46 Soglin, Mr. Alberf ............. 23 Soglin, Paul ......,.. ...... 4 3 Solfermoser, Miss Tillie ,.... 17, IO3 Solomon, Karen ................ 43 Solow. Paulerre .... 71, 77. 98. 100. 102 Somerser, Myrrle ...... 77. 134, 135 Sommerfield, Jay ... ....... .. 46 Sparks. Yvonne ..... ....,... 4 3 Spaulding. Joseph .... .... 8 7 Spear, Carol ...... 130 Spearman, Alvin ... .... 54 Spearman, Charles .. .... 48 Spearman. John ..... .... 3 4 Spearman, Wilberl ... ... 134 Spencer, Frank .,... ......... 1 57 Spencer. Phillip ......,...,,.. 149 Spencer, Roger ...... 77, 133, 137 Sperlock, Jane+ ................ 21 Spicer, Annie .................. 28 Spievak, Toby ,..... 76. 77, 102, 118 Spill. Heidi .... 41, 114, 140, 141 - 147 Slamps, Lawrence .............. 49 Sranford. Carolyn ..... 54, 123, 146 Sfanford, Kennefh .............. 43 Sraver, Jim .............. 109, 112 Sraver. Karhy ...... 7. 63, 123, 129 Sfavish, Pegi .... 50. 104, 123, 129. 141 Sravish, Susan ......... 77. 122, 133 Srephens, Jackie ..,,.......... 146 Slephens, Jacqueline .. 52, 63, 116, 136, 147 Slephenson, Miss Jo Ann .... 27, 63 Slernleldr, Olva ...,.......... 158 Sfessman, Allen ....,..... 123. 129 Srevens, Harold ,........... 29. 77 Srevens, Herberr .,............ 50 Srevens, John .... Sfevens, Richard .,,. Sfevenson. Barbara Srevenson, Louella Slewarl, Charles . Sfewarl. Elaine .. Slewarf, Rulh .,.. 70, 77. 110. 123 Slokes. Velma . Slone, Willie ........,........ Srorey, Wallila Sfreerer, Arlhur .... Slrode, Jayson Srrong, Carolyn Slrosinski. Jon . ..,......,. 83. Shapiro. Marianne .... 85, 87, 100. 102, 133 Shapiro, Nancy .. 13, 48, 106, 126. 127 Share. Fred ...............,,. 134 Shaughnessy. Miss Carherine .... 27 Shead, Ernesline ........ ..., 4 3 Sheer, Miss Arlene ..... ..., 3 3 Shelfon, Jimmie .... ...... 5 2 Shelron. Tommie ... ... 62, 132 Shepard, Roberr .............. 159 Sheridan. Mrs. Joeen ,.,....... 102 Shiraiwa, Carol .... 28. 53 '73 147 Shire. Judi ..........,. 45, 129, 144 Shon1ie'd. Leslie ...... 55, 105, 179 Shorr, Janice ..........,....... 43 Shufro, Joel .. 49, 55. 100. 128 '29 154 Shufro. Sfeven ......,..... 129. 134 Shull, Mrs. Eva ... 73. 114 Shulman, Anifa ........... 76. 132 Sidney, Dorinda ............., ' 5' Sidney, Kaaron ................ 76 Silber, Sherman .... 41. 75 76 'N' 1 14. 178 Silverfhorne. Joanne ............ 77 Simmons. Mr. Henry ........ 79. 48 Simmons. Janer ....... .... 5 0 W Simmons. Linnie .... ... 63, 116 Simmons. Ozia ..,... 46 Simmons, Rose .... ......,... 1 47 Simmons. Sharon .........,.... 87 Simon. Barbara ..,. 58 63 98 100. 102. 133 Simon, Henry .......,.... 138, 159 Simon. Marcia .... 23, 77, 4 1'7 129. 132 Simons, Marv ..... 53. 102, 112 Simpson. Sharon .....,... 43 Sims., Allan . . . ..... ., 148 Sims, Barbara .. .... 43 Sims. Charlene . ........... '30 Si'Hler. Edward ...... . . . . . . . 56 Si'1'+ler. Joseph ..... 4' 63 '34 '35 Skolnick, David ......,. 34 47 '09 Slaughfer. Chesrer .... 59 '29 '35 - 14g irc Slaughrer, Dorolhv .....,...... 56 Sloan, Mr. Howard ... ... 19, 5' Sloan, Warren ....... .... 5 7 Sloan, Mrs. Wilhelmina ...... 23 59 Smiley, Nalhaniel ............ '55 Smi'rh Mr. Aaron ...... 27. 98. 100 Smifh, Alberl' ...... ....,.... l 59 Smi1'h Allan . . . ,a .. .. . 62. 134 Smi1'h Mrs. Audrey '., 33. 48 Smifh Barbara ....... 55, 57 '46 Smi1'h Brenda .... ...... 4 3. 77 Smilh Bruce ..... ......, 4 6 Smilh Carolyn ..... .... 7 7. 104 Smifh CharloHe . .. .,.. . . 43 Smirh Chesler .... .. 59 Smirh. Donald .... .. 116. 158 Smifh Frances .... ,.... 1 05 Smilh, Haywood . .. ..,. . . 87 Smifh Mrs. Helen .. 35. 57 Smirh Huervey ..... .... 4 3 Smiih Joseph ................ 159 Smifh. Melvin .... 13. 21. 73. 77, 59. 109, 112. 123 77, 109. 113. 114, 117 60, 99, 123. 145, 146 44. 134. 135. 137, 138 122. ,131 43 134 43 29. 52. 117, 158 87 Sfrosinski. Sue .... 77. 104, 127, 133 Sfurgeon, Miss Margarel ...,.... 19 Sryles, Carolyn ................ 43 Suggs, Maggie ............... 116 Sullivan, Alberl ..., ... 60, 131 Sullivan, Mary ..........,..... 50 Sumrall, Myra .......,......... 56 Sunahara, Glenn .. 45. 111, 117, 154 Surlon, Sandra ................ 77 Swanson, Anila ..... .... 4 3 Swanson. Claudia .,.. Swanson, Jacqueline 49 . ...... 43 117. 123. 154 46 Tenzer, Larry . ....... Taylor. Barbara . ........,. 43 Taylor, Eva ..... ........ 5 1 Taylor, Janice .... 26, 43, 77 Taylor. Millon . . ....,,.. 47 Taylor, Percy ...,......,....... 53 Taylor, Rosalie .........,...... 43 Taylor. Rosaline ........ ,....... 5 3 Taylor, Sondra .... 78. 103, 115, 136 Taylor, Theodore .............. 53 Teague, Karen ................ 57 Tennyson, Lois ................ 44 Teplirz, Jack ..,... 52. 109, 137. 151 Terry. Lorraine ...,... Thaxlon. Jeffery .. Thigpen, Rosa Thomas. Barbara .... Thomas, Edward .... Thomas, Frances Thomas. John .... Thomas. Lynne ... ., Thomas. Mercedes . Thomas, Parricia .. Thomas. Sharon ... Thomas, Sidney ...... Thomas, Yvonne ...... Thompson,'Augus+a . .. Thompson, Brenda . 78 Thompson. Daisy ...., Thompson. Delores Thompson, Miss Donnis Thompson. Ernie ..... Thompson, LaVerne .. Thompson, Maior .... Thompson, Marfha .. Thompson. Roberr .... Thomson. Harry .... Jim ..... Thornfon, Josephine Tidwell, Louis .... Tidwell, Sandra ... Swanson, Sigrid ,... Swarn. Huber? ....,.. Swarfz, Mrs. Dororhy ...... Swindle, Fannie ........ ...... 4 3 Swoope, Thomas . Sykes, Sandra .. 129, 144 43, 158 28. 59 51, 116 .1 ...,. 54 . ......... 60 60 x 78. 136 36.37 43 49, 146 63 .62.127.146 78 107. 135 ......47 29 78. 106 .103,113,116 59 .. ........ 54 ..35,59.144, 145 . 34. 116,149 146, I47 78 146 ..149,155 7,78 134 78 138 78. 106 Turner, Beverly .... Turner, Mrs. Enid .. Turner, Freddie .... Turner, Leslie .... Turner. Marie .... Turner. Roberl' . . . Turner, Ruby . Turner. Sandra Turner, Sherlon . .. Turner, Theresa ,. Turner. Thomas ... U Upsher, Doris ... Urian, Tifo ... ... V Vails, Helen ...... Valenrine, LaJune .. Vance, Anne ...... Van Duyse, Joann .. Varnado. Rachel .. Vaughn, Algeria Vaughn. Louis .... Vaulx, Judy ....,.. Veal. Dorolhy ..... Velasquez, Richard . Velasquez. Ronald .. Veldra, Lilly ...... Veul, Melvin ..... Vincenf. Jo Ann .. Virgil. Sarah .. Vogelsang. Marion , Volk, Barbara ..... Vorh. Pamela .... 7 Waddell. James ... Wade. Jesse ..... Wadford, Barbara Wagner, Berry ..... Wagner. Doris .... Wahlgren, Margarer Walker, Adean .... Walker, Ella ....... Walker, Evania Walker, Harry Walker, Janice .... Walker, Janelle ... Walker. Jeanefre ... Walker. Joan ..... Walker, Learlene .. Walker, Lee ...... Walker, iif ii. 'id-4, M. .. aa, 106, .. 59. ins. Qfffffis. ia, vs, sz. . ..., 44 ' 1 sf bil iid. QQ1'A6.' 114, sl 'idsf iii 144. shi . . . nas '.'. sf 'iii . sa Mary ................. Walker. Roberl .... Walker, Shirley ,... Walker, Tilron ... Walker, William Wallace, Angelo ., Waller, James ... Walsh. Tom ..... Walrers. James .. Walfon. Janice .... Walfon, Jonafhan . . Walfon, Melvyn Walron. Warren ,.. Walron, Yvonne .... Wand. Marlene .... Ward, Berfha ...... Ward. Dorofhy Ward, Marlene Ware, Granville ..: Ware. LaMarr ... Tillisch, Dagmar .. ...... 32. 46 Tillisch. Karl . . . ....... 87. 111 Tipron, Gail .... .. 13, 15, 61. 126 Toda. Jeaneire 59, 105, 106 Todd, Beulah ........... .. 61 Todd, Jerry ......,... 106, 157, 158 Todd, Roberl .... ............ 5 8 Todd, Terry ...... .......... 2 3 Tolberr. Thomas .... ........ 5 6 Toliver, Henry 43, 158 Tosres. June ..... ...... 5 5 Towles, Thomas .... .... 5 0 Towns, Bernard ..........,,.., 158 Townsend. Befrye .............. 43 Townsend, David ,. 88. 112, 134, 135. 137, 138. 154 Travis. Carole .,........ 27. 61, 132 Triezenberg, Mr. George .... 17, 89, 119, 156 Trigg, William ............ 134, 138 Troll, Andy .... ..... 1 32 Troll. Carolyn .. .,.,... 132 Troller. Billie .. .. 137. 138 Truiillo. Lupe ...... .. 61 Tsein, Mary .............. 41. 106 Tucker. Barbara ............... 49 Tucker, Gherman .. 78, 116, 135, 138 Turnbo, Berry ,................. 78 Turner, Andrew ..... ........ 4 4 Turner, Barbara .. ...... 53, 99 Turner, Belly 78, 116. 129 Warren, Marilyn Washingfon. Carol Washinglon Eugene Washingron Flora . . Washingron Joann Washinglon Jonelle .,.'78,116 33.7, Tis flfiir .lfbbl ....46 63, . f. . ,, MHA H H V 5 V' 3 l . V . Ar V m i ,. , V , . . -ww . ,. - H. W U. F ,A N , Q , N. X, , , . ,Q i 'ashinglon, Ronald 'ashinglon, Secpolia 'ashinglon. Thelma . 'ashin lon, Thomas . 'alanagbe, Nancy Dorolhy . . . allrins. allrins, Lazrous .. Lelia . .. . i i allrins. alson, Barbara . .. .. ..... 43 .. ,... I29 47,I29,I46. I47 42,43 62 63, IO6 I35 Whealon, Samuel ..,... Wheeler, Sharon .. 24, Wheeloclc. Marie ..,.......... Whilalcer. Anncelyne .. Whila lrer, Claudyne While, ' While. Carolyn .... While, John ........ . Bonnie . .... ,.. 79 I 50, I23, 29. I36 . I05 79, I04, I34, I35, I44 79. I28, I45 53, I36 . 47, 79, l02 I58 I58 IO6 Williams, Olivia ... ..... Williams. Pauline ......... Williams, Pearlie .,..., 79, Williams, Raymond ........ Williams, Reginald ..,. II6 Williams, Ronald ......... Williams, Sonya ........... Williams. Mr. Sylvesler Williams , Thurman .,...,. Williams, Veronica .. 87. 88 Woo, William .. Wood. Merry Wood, Sharon ... Wood. Susan .... Woodard, Rose Woods, Adrianne Woods, Belly . . . 57, I35 I27 IO3 ...-....45 28,60 .....43 Woods, Donald .,.. ....... 8 6 6l lO6 Woods. Johnella Woods. Margarel ........ ......98 43 alson. Larry ..... .... I 58 While, Lawrence .... .... 4 3, Williamson, Herman ...... Woods, Renee . ....... ...... . alson, Lawrence .... I38 While, Marilyn .... .... 4 7, Williamson, Sylvia ..,.. 80, Woods. Ronald .... 29, 80, l'l6 I34 alson, Michael .... 79 While. Maxine .... 46. 6I Willis, Alean .... .. ...... Worrill, Conrad .. 4l. 69, 80, II8, alson. Richard ...... ..... 4 9 While, Nancy .,.. ..... 7 9 Willis, Alfridiasl ...... I49, l50, l52 allers. Dr. William ........ I6, 64 While, Tangee ..., 46, 63 Willis, Carol .... .... 8 0, Wrighl, Annie ............ 55, I36 alls, Carllon ..........,,..., 43 Whilen, Carrie .... .,.. 5 7. IO6 Willis, Melvin .. ...,,..,. Wrighl, Calherine ............ 45 ebb, Judilh ........,,,.. 85, l02 Whilen, Vivian ,...........,... 79 Willis, Palricia .. ....... Wrlglif. Duke - 80. l32. l48. I49 l55 ebber, Mr.. Lyrnann ......... 27 Whillield. Benny ............... 79 Willman, Warren ., ,... 54 Wynn, Ella ........ 55, I27, I46 ebsler, Lela .. 79. IIS. II6, I35, Whillield, Roberl ..... 53, I37, l59 Wilson, Annelle ,,,,,, Wynn, Ralph .............. 80 'F I38 Wiclc, Laura .. 4l, 6l, ll2, II4, l23, Wilson, Aulray ..,. ehmhol, Nancy .. ....,... 45 l28. l29, l4l Wilgqn, C i- l H eil, Elaine ' ,.... ' ........ , .... 60 Widuschelr, Magda ............ 63 Wilson, Dollocseg ,, ,,,, Y eimer. Virginia .... 8, 50. I33, I47 Willrins, Lee ,...........,... .. 48 Wilson, Dorolhy ..,.....,.. 63 einslein, Donna ..........,... 48 Will, Wendy .. 62. l28, I29. l32 Wil50n, Jai-nes ,,,,,,,,,,,, 54, Yememefe' Glenn . -hhi 62 '54 eisberq. Sherwin ............ 63 Williams, Alice ..,..,...,.,.,.. 50 Wilson, Joyce 50, I03. I35 Yai-nainafa, Joyce H 47 146 eiss. Barry ...... ...,... 9 4, 95 Williams, Anderson .,...,. I37 Wilggnl Louis M ,,,,,,,,,,,,,, Yemeye' Irene 62 eiss Howard ...... ...., 7 9, l02 Williams, Belly 58, IO6 Wilson, Mamie ,. ...... 7, BO. Yanali, Alan . ,. 56 eissman, Andrew .. 40, 79, II4 Williams, Brenda . ..... 58 Wi!5on, Mona H, ,,,,,,,,, Yarbrough' James 'H ---H 43 eissman. Judy ,.....,... I0O, IO2 Williams, Deborah 47 Wilggnl Queenie ,,,,,, Yesukewe' Key vlg. IIIAA ' 57 eifz. Ronald ....,... 60, I I4. I I7 Williams, Dolores .... .....,... 5 7 Wilson. William ,H ,,,,,,, Yeshidel Cerele In 'H' 45' l2Q ailzel. Mr. Roberl . ...., I9, 48 Williams. Eddie ............... I59 Windsor, Vickie , ,,,, 58. Yeung' Edgii, Uv.. .... 5 7 e::s, Edward ......,.,..,.... 'ig Williams. Elizabelh 88. IO6, M3125 Winfield. Isaac H ,,,..- Yeung' John '..- .uhl 4 3 e S. one ................ ' W' I' 'd. M'k .... ..., Y . OI' ' ...,. .... I 36 ells. Herman .. I33, I49, l53. l55 Williams, Erma ..,..... 43 Wiiidlzeld, Raiila .. ..., Ygiiliig, Whvdgli-ow ,, 62 ells. Marvin .,............... 50 Williams. Frederick ..... ,.. 79 Winn' Ra,-,aid -,-. D... q endford, Roger 60. l32. l56. Williams, George ............. l59 Win,-aw' Mrs. Lois H 32. 157, iss Williams, James .. 77. II6, Isl Wi,,,i,,,,, J,,,,y ,,,, ,,,, 4 8, Z snker, Leslie .... ......... 7 9 Williams, Joanna .. ai. as, IIQ, l29 W,,,s,,,,,, gem ,,,,e,,,,,,,,,A Q, ssl, Bevery ., ....... 44 Williams. Judilh ............. , l45 W' l IM l,--. 4 IZQ4 '36 Z h EH 4' Ho es+. Garland .-.... .... 5 6. '29 williams. Kefhlvn . 43 wiiiZf.po.fllH..0ia .......... 23-' 25525. Q .'...1.89f.....'ici ggslslflf-L':,'::s - ' -I'3-4: ' lg? Williams, Kennelh .. . 43 Willox, Anlhony . , I34, I35, I37, emensl Mrs, Eefher '.'...... 96 exleri Richard i. 4O. 4l. 65, 72. Williams' Linneile ' 88 Woikln' Henry ' ' Zlemb MV Chesler '- 341 lol' '50- 79' Q8' mo' 'Za' '51 Williams, Marcea , 55. I47 Wollheim, Roger Lee .,.., ex. 43 l5I exler, Roberla .... .... 4 3, I27 Williams, Marvin .... .... I 59 Wong, Joseph ...... .... Vs ..... 4 3 ' ivian ..... ........ I 29 hallay, Denise ...., 47 Williams. Novella . .... 42, 43 Wonq, Marlha .... A Q.. BO. II Zullner, Diana .. 43 Sv 4' 96 9 0-' XP- Of' v' 53- G0 65 0 ' ' OP f Prinling Produclion by ox gg , Pholography lhroughoul lhe book by NORMAN KING co. 5 'ee Roor srupios - F 32'0 Gfove ,, e 228 s. Wabash Ave. ' BBVWYYM lll- 4, 5 Chicago, Ill. I 48.0 l fx 'ZEN Sigh. -mi- A ln Memoriam Mrs. Alicia Cody . The Doors Close On A Year As The school year comes lo a close, l-lyde Park loolcs back on a season ol accornplishmenls. Reor- ganizalion allowed each sludenl lo vvorl4 according lo his abilily. The addilion of Russian and new clubs lo lhe program gave fresh opporlunilies. Side loy wide, sludenls wilh dillerenl backgrounds have hon- ored l'-lyde Parlc, On A Career The year of I958-I959 also concluded a leach' ing career, Mrs. Allicia Codyls dealh in service leaves behind an oulslanding record ol achievenfuenl in lhe l-lonwe Economics Deparlrnenl al l-lydo Prirlc. l-ler name conlinues wilh us in her lwo children: John, a l-lyde Parlc Junior, and Elizabelh, who will become a sludenl here soon. Zee A ww! M'WZZZ2Z9 if . 1 .f f q ' . 2'f1,,17:.? 'I .vjw-F :M 5 xmdmgxh I l Jwff J 4 4+ ZZ gxlpqit I 'I ' 'pw LE in -'Zo ' , , , .J ,,,L Q' ' 4W 25 Z2 0 6650666 7 e Z: -f fdvtvdapfji M6666 me vofff2Z, 4 fi F4 5 5 z 3 3 5 5 u 5 1 5 EILZLP , ifQf1'1,of , PV QWZUZ' QQ 24,612 A 04,425 JDJ A, , 42i2.Z77lg1,Q W LVM, f fl, M 2 1M7Q tkyuj 652' Zihgx f, 1 Q6 WULQ f , LZLHL, f'?'V14LfA2, 'WJ' v YL 9 kb fw Mi ,J JZ' fffgfwv Av-ML flag 2 Jae ' , O Q ' ff. I' h Q D . , X fEF,.H f l 6' j'QQ,,Mf-fiw GL l Q S A ,,fff,6i,!C,, .,. 1 JI. . l,,f,l'7g, 1 ,- ,lf ' ,fl ' fgfgqfggf X QBMQ HMM 'XXV' Af d .. ,A WM mb I . I L Bwvw fi-UNI ' ' ,. f5A4VVf1 aw: 69 GFTVNQJVXI L b Q f Cf- - - -. rv.,-.:..T...n.: .., Q S53 fa '93 ix i-Q+- Ex FN E S32 f 2 2 S f 'sg SJW? Q f J ei Mr Q, lmfq' Qbfw ,f2?2?l1:fl2 Wligfi Q3 la, qkt ia


Suggestions in the Hyde Park High School - Aitchpe Yearbook (Chicago, IL) collection:

Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection, 1953 Edition, Page 1

1953

Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection, 1954 Edition, Page 1

1954

Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection, 1955 Edition, Page 1

1955

Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection, 1957 Edition, Page 1

1957

Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection, 1960 Edition, Page 1

1960

Hyde Park High School - Aitchpe Yearbook (Chicago, IL) online collection, 1968 Edition, Page 1

1968


Searching for more yearbooks in Illinois?
Try looking in the e-Yearbook.com online Illinois yearbook catalog.



1985 Edition online 1970 Edition online 1972 Edition online 1965 Edition online 1983 Edition online 1983 Edition online
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.