Harborfields High School - Harborlight Yearbook (Greenlawn, NY)

 - Class of 1985

Page 1 of 208

 

Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection, 1985 Edition, Cover
Cover



Page 6, 1985 Edition, Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collectionPage 7, 1985 Edition, Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection
Pages 6 - 7

Page 10, 1985 Edition, Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collectionPage 11, 1985 Edition, Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection
Pages 10 - 11

Page 14, 1985 Edition, Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collectionPage 15, 1985 Edition, Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection
Pages 14 - 15

Page 8, 1985 Edition, Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collectionPage 9, 1985 Edition, Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection
Pages 8 - 9
Page 12, 1985 Edition, Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collectionPage 13, 1985 Edition, Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection
Pages 12 - 13
Page 16, 1985 Edition, Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collectionPage 17, 1985 Edition, Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection
Pages 16 - 17

Text from Pages 1 - 208 of the 1985 volume:

, Q KA 'XXCICX Jimi X N ', , Q x Xfvp n ff .. fry ,fx 1 XX .fy Q , V x' f':,.: 'J Y. 'x Q Y nf Q05 ff! mf' QW X xr - Y 4- Rf Q A ,N f, . Wifi , QW I CQ FQ? 4,-F K fyiik 'Xi V' xdjf ,fy C - .6 . Cjxv K 5, P 1X xg Q Q mx X df, :H fyvsxg-..,.f'! NNN 5 K- K 2 - 6,3 X X' , wx X -XXX ,-1-'Jr-xg V! fx Xifffy QL' fi' 'JP OR Xqlx N W XV' fo - :A A if , A hx xx X AQ Q X CH N' - CZ Y , V. ,Nxt-.Aa s X1 it X KAXJ f-XX Q! E 6 X I 5' QR f fs uv lx, W MBJ A C ,J fl, X4 LAX f- W f L f f XA Q Q X OX ,-J x.1 ,J V RJR i-4! 'H inns-,EB I7 'QA 57 4 X X 5 ' N J Q W it wa M I K, V f 5 L :ALL sJ Ov, Q V x-XY, F 43727 ,Af CA .y NX PW' Qq 'K ACK W J f'-C' Y. . Q N' X CN K 'C SLU Xi XXX 6? fs X . x . hw' . N 7 'if'-1, 3 ' ,A 'x QL! IN V 1 .fxijx fv ' -'L ff' NJ' VL, X w K X-J UN V Fog 1,7 R X fykf LJ X ,, K X Kfj L-:X ,ff A 1 .CJ Q 412 b '47 N vfn 1 XKX A R , ny Lg VX QR ri 'C qfrk x..v Ks-,N-1 1,11 ggk, x X Y- QV 6 W 6 fx ,Aj XJ any KXPX X NNBX ff X f C, X - . WU' fwff S. . X A' - K Q ' wb-f X mx X ,wx vw -M Af X: 1 x V ,fn - N R14 f f - Qu, mv yffx f H 3 l Q -, DARK - I RJ , my x LX! X L! NK AX 7' ff' ggi , a' xxx Y Ui X X N ga ' yfxf- QQ V V xfwgfu My gi xx' ,QQX 4 N X - f if ij-J VN -H ' L , . xxx 4 . ,AQ xx xxx K w X kk!! J Qjfh A ' , 65 're 'QX y 'J ffxf-XJ yz'.X+f' ff q . HY 'NJ . d - 'Z ,XIX x CZ!! GA R JK ' X 1 Pr RL 5 , 5, -J Q tin I f OXO NK' ,x Cfxxfh x Q 'kjw ' JL LLA! A-Q Q , fx Cfdb 7 7' K, OH J X NJ N' ' - , 0 , ' .W ,LWJYIJ , HX ff Xl X if 3 ij ',' W 1' S' KX, 1- X0 fp f Nw . xl X I ff, 4 K JH! Q Q fbi ' P A ok , Q' x - ff ,-,Q X M -N fm C- L- KLIX-16 Cv ,M . 'SJ bn , K' X X XJR f 4 . , ,n X 1. ,, Lf . , . I if KU 50 ZX ,JS 0' yxff-1' -,UG , Gpgf f ' MjWL,fQ,'U' ' Q-Lg , E W KL Oh, ' F1 KJ' fffffjl YK-fx-X I ,r X' 1 Y Q na., - V U. , W mug AQ . . Q Q60 K-1 Vxfx ,Q X-jx M, ff - f f 3 , . ,Kp fl H, K XXF XQ. V ff if J ,f YNLQ Cf ff . 4 x fb MC ' M 59 fl ,V H S7156 W N-f A 1 K if xx, X CVKVLJ mm I I U J H gp 9 mf X KL M MQ -I f V' k Cf -XP X v KX 3 v '4 ' l'fLfQf'QL7 ,W X Vg, LLJ ,, C, ' 'A fx. v I NV , ,I ' I 'NWS v ' mv Kzkpxjl JE l QA lf' h I N pu Ubi, L I fl Y ,X N, JV? , 'L 'NIJ Q4 Ux- yf H A! ,xz yk IV W fx Q C47 U I X-3 'X kyxc xx! 5, IQ- f fx Ollvgq, V X ' tk x J N R W RI J 'v 1 V 'N M 'Enix X h Jy J Q05 A QW WH, 5951 Xfinj W A F -W W Q ui fu R 'f U K - fx J. xy sk G23 V mf mqh , .J r My Q ,I 0 ,V Q av N Ki N . V V X I I V 2 If , N . -I , 4 K I W xx 1, dx I-nw X K T J K H SMU' ' fxfWf M U vfwv USE! J Q' Wi 'NU-W fb Lf' J,N, X4 1 . . , ' wiv rg x XX X J' U V K V Jfuljk mi Y-. If U SJ Ji fqjxkwf' ,fy U X wap! . . Qqm f x - V .. RM JXUJ X F. .J 4 ir!!-Q: , nnrzuuzuxy E-1114, 'Khln1wsuln.' H'--an . g-351511 zma 5m3 , 'uiiv ' -1, , . ,, .. 3 QF? . - Ee 'FT ' . 3' .1 P- ,flwfe -J 4. f- . 4' -A 1 '1 1 ,+A ,f -,- ., .1,.', q2 50, -,rf 1 -y. ,'4-1 ,,w'-I-'ff UNL-?y, 'g,A,-,,,:'4. J- HW-5951 4?-15?5fi'ff sz .l1l7f'fg'9f'.4i -?ii?F?Yf'vrf17'?'3?7. 4'ef53'E?f2?'f?-Qigftfwfi-2i?5??'a'.?i1l7?5?5 ' ,fffh 5 , ,,,, .. I Opening 1 Dedication 10 Student Life 16 t Sports n People 74 Academics 126 Clubs and Activities 150 Ads and Community 184 4 xg: 10 ' IV 'W 1 J 0 ,muff gd,-W2 llifafvuff 01 Q ,M ,J I ff A 4 IP v -6 ,- 1 , J ,ff MQW W 151675, A jiufififfwn J Wim' 1 Z4 1 ., f f cw! fm sewfmc 1 Jewel? uwwf jim W, M We we WF 1 L ffl Jffffl 41,6 !Z92fzd7fJ W W my M Ze ALC! 415411 24664. 444, fjgiwgf ff. X 1 ,Eff V 1 H MW! 'QUCLWL Y X we , n W2 J A iifffff -J? of 1 fi ii? QM H40 '5 - Q1 63014 519 QqlJTgNDAi?DD0 p sffwfby' ye Q1 we 74 Wye UVM Lib WU-A'-f 1'aA fbccd-ad ...Table of Contents--,,,, MM' 38 I ,. , ,. K F 11112 AYWFJIZ HDZIBlKYl N-X . U4 Qv-fm YNQUQ qv dbSm?'TmD , WW Lwvvk SQQQMQ fowl fwwl A wpwwficjfw mmffagfdqggwwg gym ,ww ,mf WM CMQfgW'MUj Lfiww df f , md l WM !m'9 mm 2? iff ML Www cw M CVMQQKQELLLV Qawlf Qmtu Zim am Md Cbvffzlg . l T ' -' 'J'-rw 1. ,. v-.T - ex., . ,Vw , -xl--i-1-Emi I HAHBUHFIELDS HIGH SCHOOL Taylor Avenue Greenlawn, New York . 1 1740 TITLE PAGE 1 . HU !!! I ! ' f. .,X,X .- in :- I .g!,'A.! - 3.31 , A .,. -I-U EVERY PIECE OF WRITING REGARDLESS OF THE SUBJECT Musr HAVE Irs OPENING LINES In Y qff Uyf fqf They called my name over the loudspeaker! I almost had a heart attack. I made a beeline to Mr. Garvey's office and sat in the line up, waiting for my turn to talk to the assistant principal. You're out of line, Mr. Garvey was saying to me. This is the sixth day you've come to school late. You're really put- ting yourself on the line. But, Mr. Garvey, I offered my excuse, I've been up late every night working on Headlines, the theme of our yearbook! I even worked through the weekend, and I didn't get to go to the beach with my friends. My tan lines are practically gone! . . . How's that for an opening, Ronc? Not bad, guys. It has potential, but it needs more of an introduction to the theme of lines that will be carried throughout the book. Yeah, but Ronc, we don't want to give everything away. Let them read the book themelves. Well, I don't know . . . They'll love it Ronco, believe me, besides this has to be in. We have a deadline! Now just sign on the dotted line. I v -. r I 2 OPENING Christine DeCarlo and Chris Frisina take advantage of the warm weather and relax on the front lawn during a free period. While discussing plans for the upcom- ing weekend, students congregate in front of the band room. ........-'Z'-M-ISN Walking away from the job? Students leave school after finishing 9th period classes. And the next runner up is at the first pep rally, the Varsity Soccer team introduces the team for 1984. Picture perfect. The Marching Band and Drill team perform at the pep rally. OPENING 3 Blondes have more fun. Seniors Billy Bertram and Debbie Schmidt think of 4 A ideas for this year's yearbook. r Mike Mathis Vidal does my hair. Senio shows his school spirit and attends the n. first football game of the seaso fi Li fl 11w.,zi.mf,zf',.s-' f' 72 'PC4 '2fif:'f'Q'f ' 'ffjfi-'YC 54 , . :ff J-.4s164!f' , , ' A' -' -2ffw5f fzafazffxivyff-M f -.QM , , w zf ,1 ,,,,Q1V,V..,l.,5.,5V,.: M In N X 4 fl X ,. . ., , .....6,,,,,,.-.,1,:. n , sz, 1 f ,f f f ,Z , ,.,, , , ior Anne Looking onward, Sen Fredrick gets a kick out of the roof workers. INES OF COMMUNICATION What? When? Did you hear . . .? awesome! we talk and is e When are you free? See you Snatches of conversation create teachers and friends, lines of later. Can't talk now, have to a kaleidoscope of sound as we communication are woven homework. It's walk through the halls. And as forming the fabric of our lives. finish my 4 OPENING nv 'F h,.A M1663 wnyk .I A 4 Pwr-.-.. -4, Getting a kick out of it, junior, Dennis Madigan jokes with friends at the pep rally. .f 1, 1-4 -Bl Q 4 'on l'v Q4 4 jf, 0 -. 2'-' Y I C . K hw. 2 ': ,- V 'A uh A , 1 5, .,,. fam , , 4 3 461 - . '54 1 wi- ' 9 ,i-.5:,', - , 101123 . J - - - TE 'fm ' ?:'v::,L'SQ'5'S 24S+ ' ?51?!' 5' 'wlifwt' ?f'ii'i . f1fZ':Q1ff2J?gff'r5CW5fl5i3!t5fz50''3 fvGif7f4?'V W,-M , . ' 5' 'U' Q H fi it myf'2'?wf5'f'Wi rsfiwfyz4fmitawwwa'2f1wQwwfitffemmmff. ,i ,, . . 1 - - 'ft . V 1 , ev-i t 5 J A-Uk! lij.,nS5f1? ' ,If avi I 1447 f j- V'7Cafff,,27CfC'flQ'Ef',-1-V'33 J '7f',' ' 'IW' '7' X' ,'-. '-f-fm-451, ,ur fc-pg H .-,pg mfg, ' -1 51 exft- ' 'iv ,f , ' 1. -.,. , ,,,., ,,,. ,, ,, . , V E 1 ,Q X, , , Q3 1. we 4' V 1 Q, ' 'L' fd OPENING .kj :ly 4 . ' 'I'l'f',P:' J Q 2135 ll 1 nun M ,g ig Homework, meetings, sports practice, deadlines, jobs - all that on ,f-fft'3gg5:fr,g 555555551 top of going to classes! 1, '- 'fri' .5 . . . . . . ,y,i,gi,,,2,g59, , 5,!2g,g-.qqiftllii Timelines aren't always associated with just History class. ... -ipgw ,-4,4-,1 '-. ,,,, - , . .1K'T1'l.1,-f - . . i gi:-E ',,l?6.,S,, i,55, Every day. we unconsciously create a new timeline for 2 - - ' ourselves just by doing the things we normally do. V 'Q?f35'Q3ggg, ,,g',5.9'tf55., gl, Think about it the next time your history teacher ' asks you to make a timeline. Q 'f1f'i?5.:i'f,:'-ff-S1221 H' 1 1,111-1 rqfk,...,l V+ ., .J ,t ,Ji :K :YAY ,C P D., it lf-1'it-Q'f.',fP'32'Q, ' ' ' , '. Wg, , D N' H- 'l'Qs'p' K ' -':?i'f'5-97 L1 1 ,7 1' i f.:T9lflft'f,ii fiff-97356-.Tat:-wi-1 , -lf'if'?.Z'-inlliilgiiuf-,f,,a ' .. , -. X, A.. . 17, . r mf ' vq.,,',, ,A Mi., s Y 4 f, v Y .1 my EF' g's: -'- ' fi W.-, 1, . ,,-. N x, '+5f!fc -e-5 X X. l. Y A x 'w X X Keeping a grip on things, ASP students get carried away on a survival field trip. ' no an Q mg. 'b You deserve a break today! So does everyone out on the terrace, one -of the legal smoking areas at HF. Coke is it! Sophomore Donna Piccolo enjoys a 5th period lunch with friends in the cafeteria. L ,aff if of WX 'V J W ww Qty W 9 Wg KVWW jf ly? Mig Q,Emv5JiXl' NR RW XV W W 'W f M OMQQ YU? Q A YA Q! SYN I pk, Q55 XGQOLD B Q! 06 J If Lf!! Ni Q gd Q WU wx ip N KJ 'av my ,L -on lillll HHN T' 4'f'l by , a 0 .iii , 2511531110 . ., L a f W5 '3 '91 K' Because he's always put us there, it's our turn to name Richard Taylor Since 1957, the second year of our district's existence, Richard Taylor has worked with the students -here. A teacher first, Mr. Taylor has been our principal for six years. In all that time, he has placed our educational and individual growth first in a long line of priorities. He understands that we need guidelines for behavior, but also that we need room for growth: to make deci- sions and take responsibility for them. We are all proud to have known him, and are sorry for those who will not have that opportunity. We dedicate this yearbook with all its fond memories to our principal, RICHARD TAYLOR. At the beginning of each school day Mr. Taylor can be found observing his student body going to classes. There's no place like home. This is a familiar sight to Mr. Taylor since he has driven to and from school for so many years. Principal Richard Taylor takes time from his busy schedule to pose for a picture. 10 DEDICATIUN ,kk :gf , 3.5 I, I , I lg F, ,, ff , , , J I tix ,v 'IC 4-:W -N. fs.. A ff W Q f , if 3 N55 f -, xfq'p. - Q -. .k , .1 -Ream.,-R - Lip,-N., . gf -A The ms: mainr event of the year, Homecoming begins as we rally on the Uwbwwbwibwvwwwww 0000000 410 . . , T ,...nllll Q V Q ' ' 0 ' 'llll 3 V , 4 -41 llI' A , , . G UUUUUUQQQUOGCCGUQQCUOUOCCUUQUOQUCEUUQCCUUUUQUQHUUQ yG000000000000600'000000000000iG00000Q60006660000 of G ellow and green streamers lined the once dim room. One by one lines of students filed into the cafeteria. Homecoming festivities for 1984 had started off with an exciting bonfire to introduce this year's football team, Varsity and Junior Varsity cheerleaders, Marching Band and Drill Team. The event went well, and the crowd screamed with delight as the Bayport Dummy was ripped into pieces then thrown onto the roaring fire by the Varsity football team. Once the fire died down, the spectators paraded into the cafeteria that had been transformed into a dance floor. Only a few brave souls danced to the first few songs, but soon the music brought the rest of us to our feet and the floor stayed jammed for the rest of the dance. The fatigue on some of our faces was evident as our Ill l 1 fudfnf Dancin' the night away, senior Maria Byrd enjoys music at the H o m e - coming dance. sweaty hair stuck to our foreheads, but we weren't about to stop. A walk outside or sitting out for a song was all we needed and then it was back to dancing. But all too soon the dance ended and people were heading home to make ready for yet another day of the Homecoming festivities. 12 STUDENT LIFE Let's Get Physical. That describes the clash between the Tornadoes and Bayport's Phantoms. The final score was 12-30. Hi af -Q 5 P A 3751 ,, , , 'W f ' R V x '90 4 . tina IL STUDENT LIFE I3 The class of 1985 won the float contest for the second year in a row, with their mascot, the Tornado. This year's theme was Fight the Phantoms. 'Student Council President Rich Capriola crowning Ruchel Ramos, Homecoming Queen, 1984. Y -ag-1 5 3 4 ,. . VSV: :..,1, U ' .. h mv gif 4. 4 Q -so ,. J: ,.. , . ,kv at fn. U' ' . . ' ' -- 1 gl .1 . 9 ' .Lu ' :I .- 2 .-k.'iQ-5:111 ff fl- -exif? :1-4.-,, . , .1 ' 1.3 I Y 329' .....,, , as z S.- , ' 9 , ,f i ttf-v i ' 9 . . , ,. . , X . aw t , ,t f, jf'---Q., : '-'hjim-19. N 9 1 , N A if-?mq ' 1- 0 '--a 1 L 'Y .W Before the crowning of the queen the While dancing to the beat of the music, Homecoming Court stands in anticipa- students enjoy the final hour of the tion to see who will win the title of Homecoming Dance. Homecoming Queen, 1984. I4 STUDENT LIFE In the foreground, the class of 1987's float, Phantom Busters and in the background, class of 1988's float Towering Tornadoes. QQFLQ .1 .iv Y V mfg Y... 4 Q '- l -- I f .1 Q 'Q 6 6: Q..p'Qii:y .Q O 6 ,X 1 W A ' r I A' l' g , . , I by 4 ,,. r ti' G' A MEMORABLE DAY ' . 'f 14.5 Homecoming 1984 . . . Saturday, October 13 . . . a line of events with memories we will cherish for the rest of our lives. Many students were awake by 6 am to put finishing touches on their floats, getting psyched for their class to win the contest. At 11:00ish, the completed floats were brought to the library for judg- ing. Marching band, drill team and color guard members had to be at school at 11:30 for a quick rehearsal before the parade. By 12:15 they were all back at the library getting into the line-up. The parade began promptl at 12:30. The line-up included floats from all four classes, plus Ofdfield and TIL: the colorguard, Drill team and Marching Band, IV and Varsity cheerleaders, the Oldfield cheerleaders and the Homecoming Court. Members of the court were: Maria Byrd, Ann Frederick, Shari Friedman, Iill Hickerson, Jackie Iones, Meg Kirschner, Cynthia Poulos, Lisa Racaniello and Ruchel Ramos. The Fire Department was also in the Parade. All participants arrived at school in time for the 1:30 football game against the Bayport Phantoms. The football game was loaded with both spirit and excitement. Although we lost 12 to 30, everyone who participated in the weekend's festivities had a great time. During halftime, the band, colorguard and Drill team performed their Hofstra show, which included Swing Low Sweet Chariot, Maniac, and Son of a Preacher Man. The winner of the float contest was announced at half-time. It was the Class of 85 with their float Fight the Phan- toms. Other floats included an adorable float from TIL, a float from Oldfield, the Class of 88's Towering Tornadoes, the Class of 87's Phantom Busters, and the class of 86's also Phantom Busters. After the game, it was time for the clean-up crews to go back to the float houses and dismantle the floats, and for dance- goers to go home and get ready. This year's Homecoming Dance was held at the Thatched Cot- tage, which is becoming a tradition. Ruchel Ramos was crowned queen. Everyone who attended had a super time, whether they were on the floor dancing to the DI's music or taking a walk out- side by the water to cool off. Homecoming 1984 was wa huge suc- cess and gave us a wonderful memory to treasure. ix :L Q V, M 5 9. , , 1 ' , , . , f' rw . if 1 , A w'Qfr g 3 My ' X x f V x , , xx f i - . ' - 9 V -,lx f il, s . . .ig , , .4 .I -. 1, . '- on . 1 ,.'. If N , , 9 , V W , f-.1 ,, N . R l -, ' f ', . L . . Q A ww . x K , . 2 ' 1 , , 1 , M ' . , I il lf J' .Tiff f' ll, .,:, x, .-', 9' I 1 .F V' 11, 2 l If . ' R A ' 'L' The marchi1ig'band, along with the floats, cheerleaders, and fire depart- ment march down Broadway to the festivities at the High School. xg , , 'f . In 'fl' A fi, ,.,, With their Rolls Royce at the shop, the riders of the Death Mobile enjoy the Homecoming festivities. The class of 1986's float, Phantom Busters, in the end zone of the football field, waiting to see if it'll be the winner. ' f ' 4 . ! I f -:-15:1 . x fififff . J, , ' ,if I, rv, ,H . V, it v ,V U J, I R f . N , ,t .. A ' ff- x A pi :- lfjizff 'E-F JQ STUDENT LIFE 15 1 3. 3 H1 ' - '-1. .- 4--1 . FK EJ' i . -f. . - ,. 4 X.. I5-.XM S.-.-,Qi - A Q .1. K , .wr Q, . . ..- vf-'qkxff uw , -. , . 1 .gift F, 1 ff , . - 'X' .- ,f .-V - S it-I .:, .52 ,gg . , ,. J...- 1. .a ' I Y l, 5 1 ' I g., th' Uri.-.A A l A K .4 . .. . L- , . , , , .. - - .- I . ,,,.-.A -- .... . -N Ah-qc f wr... , ,-L J 1, ., J Q , , 1 K 1 :S Q. 4 L Q ff I 1 E 1 L V' F r1.,..f:-3- -1 --JA. - lr .-y'-- -.-- 4: ' -:L r:-Q' --Q. --'bl' 5Q '?-'f- ' ' I ' -'. -1- 9- J-A -1. .- .,. . -,.l..,,,LJk,J,,,,C, H f - , ,M J, T fi ,Ny NH, 4,L5,+7--gd: ,'y-,,i.q1:g,,.f-.w-.-,-' ,, Fx x N ' ' . 1' -.JQHV '.-I 1 if 1 N I- I l ' . , .- -. ,-f,,S.-wh., . , 1 -. I 4-IKIY. .Q n - H 'Q' L -fy I ', 'L . 11 . . -' -1. -E' '-' . ' . if V4.7-f, . -'14 5. , Q-1, f3'g N VI- - 7- ,A - , ,. r- ' .fag f- , - ' .- 1-' V ', J- - :- . - A, .-rw. --A .f -'rgx -. '- . , -v,- f ' ' ..g'r ,A -' :-4 5.-.-3-'N 11+ -9 ,- . 1 .-. ' -. jf., K - g-'- ,. 4- .-. Y. 0 'Q 5 1 TQ X11.'j4X,' -1 . . .V , 1... .In .-N5,IJ-4,-gi, - ..f,.A.-,a,,5A U 1. f . ,- ' J.: .411-,'. ,Q .,,., ..- nf. . - - . ,Ah ...in .--g..fr-..'KJ- f 4,, -- ,, .,.-.,..,..,- . - --ef-.-.H . . 'N -, - - 15 . .fn-xg-Q.,'x :if ,E.N.--',-.5 ,z g.-ww: gg .. - . ' - 4 -- .Lf ---wa'--v'1 -- ,' - 1 ' . - -',,s.-'-nl f'--2.4 -'. f . .-34.15 -'-.az--ca - - '.. .f'.-L :' . ' -J -L-- , ,-- . -. A '.-' Quan- za - nd' 1- a-1-1 'f Q --1 4 A 3 ' ' J- ' g A . ,-,.1.g,. Q. .+,- --- :Tr ,:x. ,.9-nh: X-mn. f--, .1 -'W ,,-V ,. - , ' -W, A, - V A ,r--,.- .NI mf, -. ,fe .M -9--vb. ' .. .-- .-. . .- -f-.5-.f ,.- 1, 3-..' . 1 -Q--.. - , - df.,-i L - --L , . , 1 .-.JT ' .--,dl---. 4--f1.Kn.,' --xvia,--I . L - ,jg . -. I . U.:-.2-v,f ',-. - v j-, A- . up --31521: ,J .gk in .5 .fy M. 1-. ' -4- , . . .5 '4 53,7-' ,. f -,, ', 1,3 L '. IQ 'f-' Mel, .- 'pl ' ri x.:o.'f, H.'v'w '5,,Q.-I X-1 gf -.. 1. . . -, -'5-5, .I j., ff ' nic- , '.f .- ,gi 'J'-'Pg'-3f:'4f '-VL. -,.,J.'I'-- i1,?,Q,g-1'-' 11 'f9r'-24.1.-S .- ,. -.K 1 J I .-g. -' 1 1 . '-15:5 I + . .2 , QILQ f-1 Q-5,-' 1,-,,-' r-'.Q,'-A 1'-rf - -. .. , 5-. , x - ff' ,- 'T1-.- .'-Jfff. -1f f f.- Q -' , . p - - . V.. . .- . f .. - -. -' . - --.' ,,.- U -HL,-..u i, 25 ,.j1,-' -- .:: . . 3. -. ,'i-l'26g.-.flz , . 'f .M ' - h, M., .', V 1. :-' '- ' '.:L,., - .ks '5.y.,,-v'.,,,,-g- 2-.?-xg5r',3-.A il Q ' .15'fH,!-F' 1510- --, - M -, f -'- -.r. 1- v, -..-- -. - -- V.- .Y QV,-Ewe?-Al. 1 1-v hlxf. 323133. A f 5-,ug -4 A! rqavfx-Sv- qi , . ' - ---uv'--'rg .- -' fr i - E- 2' V V. K' 4-,AH '- ww'-Q Fr. , . M'f1'- xJ'T '!rP'uT -11-f5 .:'1rf'H -P aku... . XPP. 'JZ-25-I 'f --ff 'EW f'a g--1'-.-5'-.' , u r .- , f I, f l Is this the 1950's or punk? Senior Guido Tries is more conservative here than often, but in his California gear, always looks NOW. Sneakers are their own element of style these days, as senior Kurt McTaggert pauses to show off his moon-walking feet! Looking dramatic as usual, sophomore Ieanmarie Delzotto poses in her crazy glasses! Talking to a friend in between classes, sophomore Lainie Kushner displays various rubber rings, bracelets, earrings and a hair clip. It's fun! 2- , . A r F l I NEW WAVE OR PUNK FASHIONS, IN BOTH CLOTH-ING L I N E OR HAIR, ARE ALL THE RAGE. PUNK ISN'T JUST WHAT COLOR OF SHOES ONE HAS, OR THE BIZARRE CUT OF ONE'S HAIR, IT OF 0 U G HAS BECOME A . . . lr If one sees a student walking down the hall wearing rubber bracelets with earrings to match, neon colored apparel and perhaps 'fjgaf r-' some sort of tail one can only come to one conclusion - that stu- 13215 ,,.fir: dent is definitely up-to-date with the fads of 1985. 'S Bizarre dangling objects, flaunting themselves from behind locks of ff' hair are - believe it or not - earrings. There is no limit to what one can find in style, size, shape or color. The unique styles have become a way to express one's own individuality or image , ' Bright orange, yellow and green stream past in the hall. Neon col- H- ., , orin is o ularin an thin from sweaters to socks. -- 8 P P Y 8 Colored or braided tails are a new addition to heads of hair. Sophomore Ieanine Botsko commented, getting a tail when I did was If yy-,A f something really different, but now everyone's getting one. ..Qfjfk . - ' - .rw -, --S. -..-tfvzn-ru-v..' T' 1 N--rtrv-:V +. 1,31-7' ,vf-:'r-,-- 11- .nw '. - . 'J 'f'5J.4 ffg?f'f AT Sl.-. :4'fCfQ1 l'liif '2 fl ir' 5 .-5'2 -5 ,134-E'-nf fv ' -ff. L- .' 1 a 'V r 7 -.- va-,,.-4, -'gf--fn I .f A .i . .- - - - ' u 6, if ,V-.,: '- -,-. -..f ,..,.'ff f-pi PM ' gif-lg, 'Jw' ,S-,,.--, :-, ,j,.M. X fl-fu ' .f--f gvx If-'vi 'uf ,, . 2'1 tv W' if J it WW f -51 ff fi l1:':mm:J1:,:'f:f ffifff L5 if JK A few seniors enjoy the fresh air during a free period. Cindy Monahan stops to relax under a tree on her way to class. Gina M and Dana Spin- ner smile as they realize . the school day is coming to an end. S 3-.Z at 6. ,f- 'if T-4 'if'- :7 E? 'Pi' 1.-Qqqwx ' Simtel xzlbklfw .,..ff- Yiwu, L., .r lla iilfgfiiil 'I-T9 Q w.Lis.f2Q if we X x V l iQ.f ,f vs A l5:af'g.+l 'ffl W1 l.f?fTsff3Q 251' .- 'fi iii vw f' i 'L-ug! fVf15'J'li4f Q 55 M, tw ,4fQl3f52'f -we gl I.. . NX. , Fi fy, ALE i .xgl 1.a':'z 15, f1Qff5:52y flifliibik. '1-Q-ggfmi -Ligf2i'- A31-,fwfr ww 1-L'uj emi Maria Byrd does the smart thing, sleeps through a free period. Iohn Catapano and Stacey San Giovanni look picture perfect as they realize they will ap- pear in the yearbook. Iim Kremano walks out- side to class on a beautiful fall morning. 2 students enjoy the fan- tastic light beams on their way to their 9th per. class. 18 HANGOUTS as-3... 1...-..,.'-1 ---- -,T X ,ga fi E, Y, if ir? N: , J. Em:-N if wE'ifELi'i5':y ' A ,1,3Qg,.,-M1 1 X .. . M, s fs-Aw, A . . X 5 xx r . A 1 V 1 . X X Ja., -1 ,1 if i l Q -4. ,IQ 'N -ii? -M Patio, Cafeteria, I-Iallways and Lounge. If you needed a one-liner they'd be the N.. f,- ,u1,w,..,,gg1:,L-f,,:,L,L we-f.L 4, 1 Www ' r 5 ,k,YL.,. v Q' g -, t l',.Iol W 1 Hy ' N K ' 1 'L ' 4- ' ' .4 Lugz. ' R:f'..pQm-mf 5 1.9 w., -h ' ,g f ' K? we 7 . 1 w ' - ,Q lem .,,jIi1 V! K! r ..,,, l M Yfnigy V In P an . . , - x, .v Xu - 5 . 9 au . L-lj Z Kfwwiiif M, Jviff , 44 M 'wiv'-, Vp 1, .J N. 9 ' Ls 4 1:4 X N' 1 v ,Q- . fi I Q I I' f' -: . f 'U ,L ' 4 I ' 'f: fl' 5 , 3 Y r .,4 ,sh ,. ,. , ff , H M. QM e.:,.:k,'-,ff if'.,g,:,g.1q,.qa,': ?L,,afv4f1-fy 5, 4 ' 'r-, kwa! - . cwg ,ffV, , , 5 , , ,LQQWZTMZQM 'gfixgf Q1sJwv2l,mfL, K gg!! 4-ff' ' f '11 ifwa A--1:55532 I 9 ., a ,, ,WM Y' V :4P1':,:-?5'LLwf' ,. m1 W .5m.wff, fx: ,ww , - M. L. ,,,,,...4 m3r,,g...,,.m4- in ,M:pw-fy1.'f?T 3wai,,,:fm.4, ,.w,w.-W , X . , 1--g..rf,,.-ff? 'Lw',f'.' ,E wg .sM':' ' -' ' ,- , ,ff ffg..,w,,,3,.v,,1 ,wrw 1 - f M -A rf pMfa'.' w- M HANG-CUTS . . . Every school has its smok- ing areas, and at Harbor- fields the most popular smoking section is known as The Patio. Although the Patio serves as one of the few designated smoking areas, it also serves as a place for meeting friends before and during school, as a place for just hanging out. In the early morning, before the first period bell, you'll usually find a crowd of people on the Patio. They're not only smoking their cigarettes, but consum- ing cups of hot coffee to shake the last traces of fatigue, and prepare themselves for the oncoming day. The few minutes before the first bell is also a time to exchange greetings, as well as homework assignments and other bits of excitement that have occurred in the 4 x 2 .4 lack Vitteriti goes out to the terrace to talk with friends. juniors Sue Cavaliero, Sue Byrd and Connie Moore talk about the up- coming weekend. 20 HANGUUTS previous out-of-school hours. The Patio provides a sufficient amount of space and freedom for these ex- changes, and also for the needed social contact before settling down for classes. During the course of the school day, the Patio serves as a place for us to go during free periods to relax and con- verse with fellow students. This is also a time to discuss test results or some of the day's unpleasantries or frustrations, or just things In the warmer months, it is not uncommon to see some of the students lunching on one of the benches provided, talking over the day's events. You might catch such phrases as: I swear, I've had it with this school, or Did you hear. . .? Although the amount of people frequenting the Patio decreases in the winter, as soon as the spring weather sets in, so does the crowd. What better place than out- side to enjoy the fresh air? To those who feel the Patio serves only as a place to continue a habit - you couldn't be more incorrect. Our Patio serves as a needed social spot, where people can relate as well as relax!! As well as the Patio, there are many other places for a student to socialize. It could be a noisy cafeteria, a certain spot which is a cool place to hang out, or even a certain teacher's artroom. All of these factors could be some of the characteristics which reflect on the student body as a whole. One area that shows a lot of character and is largely overlooked, is the hallway. You might be thinking: The Hallway, come off of it! But, really, the hallways of a high school have definite cont'd on pg. 23 ,T -1,4 asf in i ' ' - ...- 'riff' Af -'1Wtf'P53?f1'f-'ifi fw .':.'w' 1 , '1'M'!f-1 .f ' .i, .. Lauren Gallager and Laura Ciafor- doni check out the Varsity football team at lunchtime. Which one do you want? What do you mean which one! , ,. . ww.. ,-- .--- - af-af-. fa Kim Marshall watches the rain fall from the cafeteria window wonder- ing when it's going to stop. Larry Fienstien reads the Decerrber issue of the Harbinger. HANG-OUTS 21 ' I xo 1,6 N X x Another lovely morning at school and only too many more to go! Hurry, run! three people walk swiftly through the freezing cold ice box. Sf? 1' Q? I ww,-uni ' V -av-' J 'Row l l 22 HANGOUTS Q l l -8, :Clk -3 r-'1 cont'd from pg 20 character!! To start off, where else would you hear the obnox- ious sound of slamming lockers at 7:30 a.m.? Where else would you witness mature teenagers throwing books at one another? Where else would you see an other- wise dignified student kick- ing her locker, or screaming profanities and holding his foot due to the fact that the damned thing Wouldn't open for the sixth day in a row? Lockers have a definite way of ruining a seemingly perfect day. It's positive that at one point you've asked a friend How was your day? and their reply was something like it stunk. To start off with, my locker was Dave Hernandez and Amy Florkoski enjoy the nice weather on the Patio. jammed lst per . . . Not all aspects of the hallway are negative, though. It's a great place to say What's up!! to your friends, passing from one class to another. It's kind of like a five minute social gathering, so to speak. It relieves the boredom of classes, at least for a few minutes, and gives the students a chance to breathe the air other than that of a classroom. So the next time you walk down the hall, look around at all the different people. Each one is different - each one is usually doing something different - yet it all seems to blend so well F reflecting at large the stu- dent body, in effect, show- ing definite character. Eloise Saltz talks on the phone while trying to avoid the Yearbook Photographer. Excuse me, do you have a Pass! a familiar line to all students trying to get to their lockers during class. HANG-UUTS Z3 . u I A l . 1 MY SISTER Th B' A l ' t Sofiolftoiiilsfif EILEEN The Harborfields Theater Company season was ushered in on November 15, 16, and 17 with My Sister Eileen. The show is the story of two sisters who leave their home in Ohio to make it big in New York City. Meg Kirschner played Eileen, sweet and innocent, with a flair for making new friends quickly, and also getting caught in sticky situations. Barbara Bruno was her older and wiser sister, Ruth, who was always able to come up with a quick and witty response to any situation. She also had a hard time keeping track of Eileen and the men who Eileen attracted. The girls take an apartment after being tricked into it by Mr. Appopolous fSteven Lanzaj. Marc Stein and Heather Gatley portrayed the Wreck and Helen, upstairs neighbors. As Ruth attempts to become a fine author, and Eileen sets out to become the greatest star on Broadway, they meet up with several other interesting characters. Charlie Norwesh was Bob Baker, a magazine editor who finds himself caught between the two sisters. Chris Iohnston was a fast-moving newspaper reporter who was interested in Eileen. The shy, awkward drugstore manager with a crush on Eileen was played by Ray Scott. Violet Shelton, a girl-about- town, Was brought to life by Shari Friedman. The play was filled with Brazilian cadets, a consul, a street vendor, and even the Domjan's real, live, little black poddle. Also featured were Chrissy Lawless as a prospective tenant, Ann Marie Finnie as the girls' mother, Iulia Harmon as Helen's mother, and Craig Fichtel as the handyman. Everyone involved in the play had a terrific time. Their hard work paid off, and, on November 15, My Sister Eileen opened as a great success. Above left, the Wreck The cast takes one of its The sisters examine the and Helen on their wed- many curtain calls after apartment while Mr. Ap- ding day. another successful popolous waits for an performance. answer. FALL PLAY Z5 ! ,gg,g, : lf F21 '2 Wave: A , 3 , ' X x . , M- wr' f ' ' . . J .x ' ' , ' , X 1' A Q f. vu, 1 - . I 1,0 --Z 1 1. 91.3 .- , ' 1 , 3, , ' -- .' .,f. ' dh- Nj' V655 'QI'-s. f -' . G e ..,, - rx ., f ' ' f --' ' 'A Kev W: ,ma L12 ' 7 I IT'-,P W- '...f3-.f fic- 'es 'few-V' n I 7 'M' 'H 'f ' f , Y. 1 , .,-1 'Q' V' ' - x 1 -5 l P7 I F Q f 15 V1 V 4 ', ' I ' 7 E . ' Q u. A I'1e'. 'I W - .J 4 ff-K .V , 1 - , hr, 'M .. 1 tmhhql .-1 . 5 'N -5 , V Y ,yy '- rr 0 Q-r, -e '--QW' Vaci-V 'Q 'f 5 1-.-:uk xr: fxffgfq 4 X 7-' 1 rs' N . f r f -' . f 'r' . if 1 .1 K fs - - Pew'-1 QL' nz, 71 'Wi 'rf 'S' ir ': U 'ln'-l 611. ' ' .. ' XX-' . , ' Z 7,1 , V 11 ,:,- - ., 5 .xr Mn v A ,,. , ., ,, 4 5 N ' I ,. - 1 ' A Fi cf- X. X' '.-'fjyli-q Q' .-n - ,,,,5, ,, , , 1?-'ruff ,, A 41. so 'we-1 - vfw' 1 f su. 1 .3 5,1,,.,,,t am? 5 4 ' V Ugg ff 1'-r ' , ', 1 , 1, V ' , , '.' gy f - 9 ,i 3 '1 . ' ' x, V' E' b , , 6, U Q g . , , ' . Y YE KU 17 A 4 ff? , ' H' 0'1 .la 'ff 5 'YA lv ' ' 5 - .., -- ' ' ' HL-f 1'--' M--M ' ik j W 1 f I, ff. wif' xl ,I l, , , . , ,- f, , f ,f f , A-f' - ff A v 1 . . v 1 . 1 ,K 1. ' A f ff r 9 if 4 4 1 gf 1 vgfq fi aw wg we wg 'Y my 9 YJ 9 gf HW H Yf YI J yy 1 73' y, Q V f Q A Q Q Q .Q ,Q TJ' ,,., f,'f1,i9 1 ' - ' '4 ' gif .7'f 'f 'Af' ' ' ' rffff , VV .'AV 4.1-,Q 1 ':.,'. 3 ,I,,'.' ' Zll 1, ll' 7 , A -' 4, gk. 5, V- 41 4, Wk! ' ' kwa-1 ,,erf5'f5mffT,':.f, k'E'g.f'f:: ,, fy fd- '4'ff,4fw,.ff.f:-'O 4' 4 iff, 1 00 14, Y'-9 2---sv, 5 1 lV'l lg 'ur Iliivai 1 4, ..f ' ' if ww? ,, 42 P- it -lg Glued to the school's T V all day Friday everyone watched H 0 F S T B A Thursday, October 18th at 10:15 P.M., on the Hofstra University Field, the familiar introductory drum roll of the Harborfields Marching Band sounded. Dramatically rushing foward they executed their first piece, Swing Low, Sweet Chariot, immediately captivating the 15 other bands. Maniac was then performed by the Drill Team with precision and neatness, and was accompanied by particularly tricky movements. The kickline members weren't the only ones to engross the crowd with difficult moves. As Son of a Preacher Man was performed, the Band members themselves exhibited a twisting and winding march. From pinwheels to backward marching, the stadium atmosphere was seized with a tremendous surge of energy and vigor. Mr. Domencetti was extremely pleased with his band's performance at Hofstra. And the Band members admit that the audience was just not rocking until the Tornadoes emerged. There is no doubt that the Tornado Marching Band and Drill Team are two marvels that play a strong part in giv- ing Harborfields High School its deep sense of pride and honor. , I U , if , . f ,, lf f 2 lx' 3 3 f ,Qlfp zi,.fZAlI . 53, l ' - 'L sz , .2 1. i , Q I, ,it C A. MRF cr ,P gg Drill Team members talk among themselves before the Homecoming parade begins. Hats off to the Marching Band! Walking a fine line. Long hours of summer practice prepare the Mar- ching Band for their upcoming season and Hofstra. I If 12 3' HUFSTRA 27 This is what I have to say to that! says Charlie Norwesh and Mike Mathis. Fugues, fugues and more fugues. Ami Weissberg, Cybele Kamhi, and Lisa Rothfeld practice their parts on their Woodwinds before the performance. l Harborfields has one of the finest music programs on Long Island. Every Fall and Spring the Choir, Orchestra, Stage Band, Wind Ensemble and Symphonic Band perform concerts for enjoy- ment. Choir and Band meet in class during the day as does Or- chestra. Stage Band rehearses on Wednesday nights. The winter concerts for 1984-85 were December 18, and February 7. The spr- ing concerts will be held May 3, and 17. The Wind Ensemble and Symphonic Band will perform a Pops Concert on May 31 p this con- cert is outdoors and popcorn and juice is served to the audience during the concert. It is very well received just as all the other con- certs are. 28 WINTER CONCERTS i 3 I u , . '- Q . ' ,. ' Q Q is . 2 W f if.: -13.5-.' ' ' my' 1 Il bac! S 1. 7 ' 131- ' l . IJO ' 0' O . . , I , .. . . .sp , :Y , A , y o A Y 0 ' V 2' I' ' ' Q . v' I 0 . 1 . , . 0 s 0 n I ,o - .f I. u ,. - . .. Q D , , . . , - ?,.: .'g:,:0..,'..o Q . 1 r.. N W nm.-.H v.-usu.u.l rx. r.'.aq.g.. Y- H m 1 Mr. Domencetti is time conscious both musically and scholastically. We, of the band, thank him. Turn the page! No, you turn the page! WINTER CONCERTS Z9 ON FEBRUARY 1st AND 2nd DESPITE THE SNOW WE PUT ON THE SHOW AND DISPLAYED OUR LMW f M The lights went dim and the auditorium was silent. From off stage, like a bunch of crazy lunes, ran in the three mc's, Rick Gouse, Steve Lanza and Stu Rosenburg! They announced the acts very humorously both nights of the Talent Show. Opening the show were Chrissy Lawless, Sharon Tashman and Steve Lanza with Rocky Mountain High. The acts ranged from singing to dan- cing. Two bands performed - Purgatory on Friday, and the Blues Unit on Saturday. The Senior Air Band played Hot for Teacher both nights, and Mr. Andrew Atkins baffled and amused us with a magic act to top all magic acts. Both nights were a great success! PROGRAM PART 1 Chrissy Lawless, Sharon Tashman Qvocalsj ...... Rocky Mountain High Steve Lanza Cguitaristj Brigid McDermott fvocalistj ........ Against All Odds Christine Dore Caccompanistj Elena Schachter Qdancej .......,...........,..., Ballet Charlie Norwesh, Susan Harbach fduetj . . . I don't need anything but you Debbie Tention, Kurt Knox fvocal duetj .... All of You Air Band iPhil Clementi, Larry Feinstein, Billy Bertram, Chris Alfierip jean-Marie Delzotto tvocalistj . . . l've never been to me Christine Dore Caccompanistj Heather Gatley, Shana Catandella ,..,....,.. jazz Dance Mr. Andrew Atkins .........,..........,.,. Magic Act INTERMISSION Dixie Land Band ....,.,......,.. Steve Lanza fsemi-saxj Ray Lewis Ctrombonej Mike Lee Cpercussionj jay Best ftrombonej Rick Gouse fbassj George McKee ftrumpetj PART II Doug Venuti, Alan Williams,jet'f McMillan . .Barbershop triplet Sharon Tashman fvocalistj ............ ,.,. ' 'I-louses Christine Dore faccompanistj Trombophones fdixie land bandj ...,....,....,.... jazz Susan Hatbach Qvocalistj ...,. Killing me softly with his son Chrgstine Dore taccompanistj julia Harmon lvocalistj ...,.,,... Blowin' in the wind Steve Lanza fguitaristj Purgatory ..,....,....,,......,........... Rock Band Bob Ferraris Cbassj john Alberti Cguitarj josh Lefkon Qlead vocal, guitarj Alex Ryley fpercussionj Blues Unit ..................,..... Rhythm 'n' Blues Ray Lewis, Mark Brummer, Todd Brummer Your masters of ceremony are Steve Lanza, Rick Gouse, and Stuart Rosenberg. 30 TALENT SHOW Purgatory rocks the auditorium Friday night. The Mc's Rick Gouse, Steve Lanza, and Stu Rosenberg entertain the audience. And believe me they were entertaining! E - ff i ,ya V 1 6 5 , 'I If I 1 4 , 1, 5' t f A Alif iN xx 'ffl S-i fl ! Starting from the top Oh NO! Not the trombophones! Those of us in band remember them well. Mr. Atkins, show us your magic! Sing it Iean-Marie! It's not against all odds that Brigid can sing fantastically. Well, it's better than mud in your eye Stu! Doug Veneutti, Ieff Macmillian, Jim Kremans and Alan Williams enter- tain us with their great voices. TALENT SHOW 31 Underclassmen buy j Saniors to he thair SLAVES Fon A DAY What do I hear for this Senior? Do I hear one-dollar? Seniors stood on desks, one at a time, as under-classmen gathered around three and four deep to bid for one day's control of a senior. The money was raised for Stu- dent Council. Bids were anywhere from one dollar to twenty-one dollars or more. The auction went on for two hours, and many seniors were sold and a lot of money was raised. The next day was the actual Slave Day. Seniors who were sold as slaves were permitted to leave class five minutes early in order to meet their master at their classroom, and go to class five minutes late. Things that the under-classmen had their slaves do ranged from just carrying their books to class for them to carrying them to class. No senior was total y abused and they said it was fun and a great way to raise money. Senior Slave Day just might be back next year and the years to come. Auctioned slaves accept their certificate of slavery. T A good crowd turned out for the Senior Slave Auction. Many of them with S20 or more dollars in their pocket, ready to bid. 32 SLAVE DAY l 'Y Seniors waiting to be auctioned off stayed together next to the auction table. Being auctioned also means having take the jokes and fun that auctioneel Tim McCallan makes, as Senior Todd Davis found out. Part of the crowd on the Sophomores' side cheers during Sophomore Nancy Hughes won't deny one of the most exciting Powder that there is a lot of work to be done for P11ffS GVBT- decorating before the game. Preliminary work, good sportsmanship, and lots of fun make up the recipe for success in POWDER PUFF Here at Harborfields, Powder Puff has grown to be one of the biggest events of the year. What started 16 years ago as a basketball game for girls in dif- ferent grades, has become an extravaganza with costumes, scenery, skits and dances . . . li. Va . ali., POWDER PUFF 33 HAT IT'S ALL B0 This year, Powder Puff took place on Saturday, March 2, with a competitive battle between the Sophomore and Senior classes. The Seniors won both the game and the entire competi- tion with an overall score of 1716 to the Sophomores' 716. The competition begins with preliminary playoff games on dates prior to that of the big game between the 9th, 10th, and 11th grade classes. The winner of that tournament then goes on to play the Seniors in Powder Puff. The class of 1987 won this tour- nament for the second year in a row. Both teams then choose themes, which are worth 3 points in the competition, for the ultimate game. The Seniors chose Seniors Take a Bite Out of Crime and the Sophomores chose Sophomores Through the Holidays. One member of each class is chosen to design a cover for the program. Lorna Libert did the Seniors' and won 2 points in the competition for the Senior class. Another part of the competition is ticket sales, worth 2 points. Whichever class sells the most tickets by a certain time wins this aspect of the competition. The Seniors also won this. Other parts of the competition include: costumes, worth 3 points, decorations, worth 5 points, sportsmanship, worth 2 points, cheers, worth 3 points, and the game, worth 5 points. The entire competition was very close. If the Sophomores had won the game, Powder Puff would have been a tie. The Girls Athletic Council has sponsored this event for the past 26 years. The money raised goes toward summer camp for the school's athletes. Dr. Wilcox has run Powder Puff. Thanks to her, Powder Puff has been one of the most fun, exciting, and successful occasions of the school year. gyms.-1 ...al Senior Chris Iohnston describes one of the cases in one of the seniors' cour- troom skits. Senior girls dance to Holding Out for a Hero. 34 POWDER PUFF .4 'wg ,- , . , 'f Wy 9-wrfffwwu 4 ? .. Z Left, senior basketball team member Linda Zimmerman goes for a basket. Right, senior Sheila Blue stops sophomore Tracy Hackeling from scor- ing a basket. 70 t. Sophomore cheerleader Anthony Shade as a Fourth of Iuly firework helps cheer the Sophomore Sweethearts on. Sophomore emcee Doug Mashkuri in- troduces the first scene of the sophomores' skits. QQ, -K ffl is. . X... is., Senior basketball team members Pam Bailey and Linda Zimmerman do the Jailhouse Rock. The senior cheerleaders during one of their many life-threatening cheers. Seniors Adam Golden and Larry Feins- tein shoot sophomore Vinny Pan- nietieri in the opening of the senior skits. 3 3 4 9 1 W- , ' - . - ,: .,.' ' ' ' - Q'0eaff' l',,x,l 40 Y ' AZ' 3 'N .. is We 3 ' 'J ' P . ,- Ll f I 1 , kit S' , v ,. W2 . 1 ' un! my I X if ' 'Q if 5 i , The sophomore girls celebrate while dancing to Holiday. get . f 5 A 1 3 19 l - ' fy X if f ,n ff, , , gg' 1eA .JE -X Lani Sophomore basketball team members doing their dance. POWDER PUFF 35 Lx I 1 K f - -V 4'1 4 f'ff .iW 'Q' f .' - k,f',,,!': HMT, if 9 . W W, ,QQ wygy 1' if , , ' 2' 1 V if 21 21 55 w A eseeeai V ' vbff1 .?ff1efv-Wnff f ' , - 6 f 114' A4 ' 5QQq?7fW I f f M y fv 5-:-,za '1 1 , f , 4lfnQf': P ',F,fffWz ' ff l fr?WEQ?'w ' Zfi?'f1 ,- ': Qmygg ' ifijif ' i gr -why? If inffygg , ,, -. 'Qi'-' 1 ? 4 351, , . 'Y 'rl ' ' ,.,., .y.akh.i Above left, Ienny Dore as Dream Laurey in the Dream Sequence. Above, Laurey listens as Curly tells Aunt Eller who he's taking to the Box Social. 36 OKLAHOMA! ' V ,JPY fn . in Fl W A t GQ A f . Uv X , ' 'Q l AHL 'Q-L ., X 'i '-, , ' . 1 Q Eg., , . X :, Y at if - Q nn A i . J -13 V I 'QL lil, lt A ,f 1 M. , s f- J '- -- . A ef- A M ---a ' if The men's chorus sings how It's a scandal how a man gets a woman to- day, and Curly asks Iud what he uses his gun for. 524 P-Q, fi :if .Q -, js. 3125113 V L, , ,aff .2 c . , is 1 'fu- Wifi? ,ff T419 31 1 We 2 W ' f F Of if I ,K rig. 1 W 1 45? iff' iv 5 4 ? 1 1 lv X4 , W' f Zz , f f I 1 2' x X. 1 w ---r-,ww l 1 ' E Az fl 5 lf? 2 A X . . .1 , AX A 1 I xy-Pg l 1 g . 1 'Z-it l . Curly and Laurey on their wedding day. Ado Annie just can't say No! On this beautiful morning Curly tells Aunt Eller how he has a feeling that everything's going his way. The dancers dance a hoe-down in The Farmer and the Cowman during the box social. 3l -1 I OKLAHDMA. just as the wind comes sweepin' down the plain Many weeks of rehearsal time, hard work, and fun came to a successful ending on March 15th, 16th, and 17th, as the Theater Company presented their annual musical. This year, they per- formed Rogers' and I-Iammerstein's Oklahoma! The show takes place just after the turn of the century in the In- dian Territories, soon to be named the State of Oklahoma. Lead roles included: Senior Doug Venuti as Curly and Iunior Stacey SanGiovanni as his girlfriend, Laurey, Iunior Sharon Tashman as Aunt Eller, Senior Chrissy Lawless as Ado Annie, Senior lim Howard as Will, and Senior Jim Kremens as Ali Hakim the ped- dlar. Senior Ray Lewis played Jud, Senior Alan Williams played Andrew Carnes, Senior Ieff McMillan played Ike Skidmore, Iunior Chris Springer played Fred, a farmer, and Iunior Charlie Norwesh played Slim, a cowman. Sophomore Ienny Dore danced as Dream Laurey in the Dream Ballet. Besides these leads, there were many chorus members and dancers to help make the show a success. The show wouldn't have been so successful without the direc- tion of Mrs. Springer, the vocal direction of Mr. Czina, the choreography of Patti Gerdik Dohn, the orchestra conductor, Mr. Talluto, the accompanist, Christine Dore, and the costuming of Mrs. Fichtel. Chris Griffith and Iohn Tartaglione painted the backdrop and Debbie Sperling and Renee Mesard were stage managers. The set builders and painters, the tech crew, the publicity and ticket committees, and the playbill editors also worked extremely hard for this show. Without all of these backstage committees, big show like 0klahoma! can never be a success. Although many rehearsals were long and sometimes frustrating, all of that hard work payed off the nights of the per- formances. The cast, crew, and orchestra woke up and lit up to put on one of the best shows that Harborfields has ever seen. 149' ou. . Ali Hakim tells Laurey how much he The entire cast sings the finale sees she has grown since he last saw her Oklahoma! as Aunt Eller and Ado Annie look on. Will tells Ado Annie it's All 'er Nuthin'. OKLAHOMA' 37 xv 3 . I ' Off? I I I I' ,,.f-jy,g My X' ,.1-MIX A. .V H I'5':Z?TR V c, 3 I 38 SPORTS DIVISION 'x 'I 'III SPORTS , A ,g I? f W I, fa, .V , N I ' ..,g,5?Aw . ,,g.4.,,4x ,W ,WM If L new 'I v I fx WI ef , AM.-wr' x I I ww I ,wyf if 9 55 Z Zig W fm ,f A fi WJ WQQQZW W-aw - ww' 5 f 3236! AQ., nl ep, . Runners wait for the starting gun in the 600. Amy Weisberg came in 2nd, Stephanie Colia was 3rd. Congratulations, girls! Going for a field goal, the I.V. team scores again. The traditional bonfire and pep rally begin the 1984-85 sports season. 'ff ' 15 I WC- MM lyjifww fr, ZW fa If !..r 1 ,, 'iff f A 1 ff ,W ff QW' X af 'if WY' I fa aw Mafia 1 543521, Wav QL W i 4 AQJZ' 7 Z? ,aff J iffffiigg , ff f,2f?Wf2 f ff ef af 4' g WL? Mya? I 2' ,ff 1 , L44 , J W W .f,j.1'f, 'flu 5 ,yy f ,ffqwykz X' , 7 f ff- 0 I - jrlf Mfnffw of yi4,,4f,4fatfWwW, , I af Wx X, lf, -zfiffr wlfqy A U , 1 A-we gs?-fa, an 53 gaigga ' fx, ,L ia YM, ff: ,, . . Ma A f2wif:',i1,S5?tZfa9 . - - -- , .. I. . I, .M .. vfzfxfrtiq - , ,f , ,. aS,:w-ft, MMM-2 Wfffwll SS? - It S in ,,,, . ,N,.i,..r,-te- ,QQTMML Spectators look earns the winnin Glenn. A m M, 32: 1 li? f f til:-' -i'1'f2'f - it -ixwxg' e Q ' Uniqgqg,A.yf1u',?'fa ,1: ': e K- ' - :Wilt kwa 'Q on tensely as H.F. g point against inute later the stands SPORTS DIVISION 39 AR ITY LaCROSSE 4th Row C. Iackman, G. Lawrence, R. Suris, M. Case, C. Johnston 3rd Row: M. O'Shaughnessy, I. Paradise, S. Sabatino, R Suris T Millon. 2nd Row: I. Barra, C. Daniels, I. Slippen, D. Keenan I Adrian, P. Godfrey. 1st Row: C. Albuquerque, R. Lynch M McGowan, I.Woodcock, T. Davis. VIWUQ I if l Varsity LaCrosse -- Scoreboard SCOREBOARD Huntington Babylon West Islip Rocky Point Commack N. Walt Whitman Cold Spring Har. Deer Park Comsewo ue Kings PSHE St. johns W. Babylon East Islip Bay Shore Hills West Deer Park Comsewoiue Kings Par Northport Copiague During the first play of the bame, the two teams try to get the ball. Harborfields huddles to get psyched to ,G 40 VAHSITY LaCROSSE A I-Iarborfields and Deer Park player kick up the dirt while battl ing for the ball Harborfields receives the ball and quickly runs US to SCOIE. ww':4fa..- -gf f LaCROSSE ..zs..g.T 'T .. ' f ' I . ,. A V-as - S. C Lange C Satterlee N Ames C Sorrentino, M. Sarcona, C. Schuh C Fisher M Feinstein C Silveri, G. Visich, K. Walsh, E. Friedman K Baker M Goldfeder B Conroy, A. Stanford, S. Nad- boy B Slamm G Rohloff B Miltner I. Donovan, A. Pukke,I. Vit- Far left, just before Deer Park scores a goal, Har- borfields manages to steal the ball away. Left, 'our lacrosse games never lack in action, as this picture shows it. Ir, Varsity LaCrosse H.F. vs Huntington H.F. vs West Islip HF, vs Rocky Point H.F. vs Commack N. H.F. vs St. H.F. vs Anthony's H.F. vs Deer Park H.F. vs C. Islip H.F. vs Comsewogue H.F. vs Kings Park H.F. vs W.Babylon H.F. vs East Islip H.F. vs Bay Shore H,F. vs Hills West H.F. vs Deer Park H.F. vs C. Islip H.F. vs Comsewogue HF. vs Kings Park H.F. vs Northport Copiague lm ft HL. all L., Xl ,QE I-I ml gn-l?' yi I Q , if 11.7 ll Risk C. Galasso, M. DeRisi, M. Malone, M. Lombardozzi, A. Balkan, S. Neal, K. Kemp, I. Zweibel, P. Bakel, A. Muckenburger, I. Lefkowitz, I. Silverman, B. Kennedy, B. Lobosco, B. Koppy, M. Guttman. IV Baseball Scoreboard HF vs Commack South HF vs St. Anthony's HF vs Copiague HF vs St,Anthony's HF vs Copiague HF vs Amityville HF vs john Glenn HF vs Amityville HF vs Iohn Glenn HF vs Islip HF vs John Glenn HF vs Islip HF vs St, Anthony's HF vs Commack Sou HF vs Babylon HF vs Commack South HF vs Babylon HF vs Babylon . . BASEBALL J.V.BASEBALL!LaCROSSE 41 And that's a strike! Varsity Baseball Scoreboard HF vs St. Anthony's HF vs St. Anthony's HF vs. Wyandanch HF vs Wyandanch HF vs Wyandanch HF vs Amityville HF vs Amityville HF vs Islip I-IF vs Islip HF vs Islip HF vs Commack South HF vs Commack South HF vs Commack South HF vs Copiague HF vs Copiague HF vs Copiague HF vs john Glenn HF vs john Glenn HF vs john Glenn HF vs Sl. Anthony's HF vs Babylon HF vs Babylon HF vs Babylon 'S J' 'li' Q - .N jk ,ll .. i is GI . -L 9 iso . Row 1, Left: L. Salice, J. Bockrath, D. Prisco, K. Kemp, C. Aliperti, T. Cook. Row 2: K. Stack, T. Intemann, I. DeRisi, D. Venuti, C. Alfieri, L. Feinstein. Row 3: M. Cody, B. Forte, C. l' Q --k, , W 5 . ' 8' 4, 9 .qpqo Lanzillotti, I. Catapano, C. Einsel, K. Hart. 5 W ' ' I ' H' I . 'Fr VABSITY BASEBALL 42 VABSITY BASEBALL 2 ,l,, 5 fi? H of ......,.......,,. -.,....,,..,,, Q, ii 9 l - . - S. .-l QI 5. x ' ,C ' Doug Venutti up at bat for Harborfields. Hand out to catch the ball and one foot onthe base, he's called out! And that's strike three HF. Better luck next time. PARENT MESSAGES Message: Congratulations to you and your class! We'll miss the gang, the activities, and even the parties. We now you'll have success in college. Love, Mom and Dad VARSITY DFTB LL V. Collins, S. Walter, D. Merdon, K Scheliro, C. Poulos, S. Blue, V. Alveo, N. Heller, I. Neder, D. Bookbinder, I. Ward, S. Collins, L. Zimmerman, L. Byrona. li? 2?AgvZ.lf,Zh. I . . l sCoREBoARD Varsity Softball Scoreboard HF vs Cold Spring HF vs Harbor HF vs Northport HF vs Smithtown East HF vs Amityville HF vs Amityville HF vs Amityville HF vs Islip HF vs Islip HF vs Islip HF vs Commack South HF vs Commack South HF vs Commack South HF vs Copiague HF vs Copiague HF vs Copiacgue HF vs john lenn HF vs john Glenn HF vs john Glenn HF vs Babylon HF vs Babylon Babylon f r' -'una-1 Doug Venutti tries to steal a base Larry, get out there and play some while watching his teammate ball! swing. James Bockrath pitches a fast ball to the opposing team. VARSITY SOFTBALL 43 To the Class of 1985 - May all your hopes and aspirations be fulfilled. The Ricciardi Family PARENT MESSAGES Shari Cohen We are so proud of you and what you have achieved. Congratulations! We wish you good health, happiness and success in your future. Love Mom, Dad, and Lisa Jacqueline Jones, All the best life can offer as you travel through the universe. Love, The Woodseys: Papa Bear, Bearess, Sam- my Ieanne, Ronnie Lou and Nana VA ITY OLLEYB LL I. Bruno, K. Flanagan, C. Shanahan, K. Gregory, M. Benitt, S. Gentzlinger, E. Ersboll, M. White, I. Hecker, D. O'Shea, T. 0'l-Iara, K. Curry, K. DeGroot. SCOREBOARD Scoreboard HF vs Islip HF vs Smith E. HF vs Glenn HF vs lslip HF vs Wyanclanch HF vs Babylon HF vs Commack S. HF vs Amityville HF vs Copiague HF vs Glenn HF vs Islip HF vs Wyandanch HF vs Babylon HF vs Commack S. HF vs Amityville HF vs Copiague 44 VAHSITY VOLLEYBALL ,... Et i and at Y' .v-nous... 1 my Michele Benitt and Ienine Bruno really get into some of the team's practice sessions. Michele Benitt jumps for a ball that Karen Gregory has passed over the net. Coach Miss Kuch goes over impor- tant plays with the team. PARENT MESSAGES Caryn Ann Kalisky Christina Creamer Dearest Caryn, May your future be as bright Wishing you health and success today and Doug Smith and as beautiful as you are today. We will always. May you find as much happiness in Congratulations, Doug. Well Done. always love you - your life, as you have brought into mine. Love, Mom and Dad Mom, Dad and Alan Love Mom BOYS TENN 9-- 1 itll u- Q49 '1! S. Kirkpatrick, S. Wohleking, D. Perino, M. Frederick, C. Stiller, E. Hannon, I. Perino, M. Lee, R. Mooney, B. Procida, D. Friedank, M. Oates, D. Sperfer, M. Kirschner. SCOREBOARD Boy's Tennis Scoreboard North ort john glenn Commack South Shoreham Wading River Islip Halt' Hollow Hills West Bell Port Port jefferson john Glenn Commack South I l' s ip Shoreham Wading River Bell Port Port jefferson As the tennis team practices their swings are improved upon. He's really showing his stuff! Iust wait till the game. We watch as the ball is served. .I BUYS' TENNIS 45 ,,..1--' SCOREBOARD Badminton Scoreboard Half Hollow Hills West Commack North Commack South Whitman Half Hollow Hills West Smithtown East Lindenhurst Patchogue Patchogue Miller Place Whitman Smithtown West Smithtown East Lindenhurst Miller I'lace!Commaclc South Smithtown West 3rd K Buswelller, I Hickerson, S Wohleking, I. Fox, K. Denu. 2nd I Balkan, M Weis, L Sheere, K Walsh M. Flanagan. lst: D. O Connor T Comnmellis K Soci L We1sch,H. McQuade. BADMI TO 1 Marife Ramos serves the birdi9 during practice. The team gets ready for a match. Sharon Smith prepares to return 8 serve. GIRLS TRACK 41 .4 cw-WUI: I. Allen, 1. Berg, T, Berliner, M. Calarmuri, S. Calia, I. Campbell, K. Grot- ty, I. Curcio, T. Dixon, E. Donnelly, M. Emmons, A. Frederick, 5. Fried- man, L. Fusaro, l.. Gallagher, R. Gerard, I. Gerwick, P. Gradel, I. Haeni, A. Hilsky, N. Hughes, K, Kane, S. Kennedy, T. Kleina, I. Maloney, K. Mar- shall, L. Mann, P. Morotti, R. O'Brian, K. Palmer, D. Raguso, C. Suchan, T. Smith, S. Tyska, R. Turner, N. Vitkovitch, A. Weissberg, C. Williams, n- A. Kotel SCOREBOARD Boys Track Scoreboard HF vs lglip HF vs john Glenn HF vs Hauppauge HF vs St. Anthony's HF vs Babylon HF vs Copiague HF vs Commack South HF V5 AmilYVlH9 HF vs Bay Shore BOYS TRACK X . .. v. PF ': we! X 1 B. Bertsch, F. Berwind, B. Braun, O. Burke, S. Burke, I. Busco, C. DeFour,j Donovan, K. Gantt, S. Gardner, C. Hudson, B. Hughes, I. lager, M Iensen, D. Krantz, R. Leggio, I. McMillan, I. McQueeney, D. Meagher, N Mehta, M. Montaigne, C. Norwesh, J. O'Brien, C. Danagioto oulos, M Ricciardi, D. Reichhold, R. Ronda, R. Scola, R. Shellhas, lvfSlear, K. Stevens, W. Thomas, R. Vebele SCOREBOARD Girls Track Scoreboard HF vs Smithtown HF vs East HF vs Patchogue HF vs Deer Park HF vs Ward Melville HF vs Islip HF vs Bay Shore HF vs Port jefferson HF vs Copia ue HF vs john glenn HF vs Gloversville HF vs Amityville HF vs St. Anthony's HF vs Commack South Plainedge BOYSXGIRLS TRACK 47 GOLF X -.. ,f.-.ieQaf2.i:f- - .--,,. f'Brgegs.A-- .V. VOLLEYBALL M. Kupka, j. Garner, C. Gennarelli, M. McDonald, j. Leary. Commack South Hauppauge North Babylon West Melville Walt Wittman Kings Park Lin enhurst SCOREBOARD Golf Scorebo ard john Glenn Smithtown East Walt Wittman Half Hollow Hills East Northport Northport Walt Wittman S. Catandella, A. Baptista, R. Fenderson, A. Roemer, C. Kamhi, K. Herbst, L. Thomas, P. Stevens, M. Harris, D. Croke, A. Sochi, M. Lynch, M. Huelin, K. Knoop, K. West ,,, , SCOREBOARD j.V. Volleyball lsli Smlih E. Glenn Islip Wyandanch Babylon Commack S. Amityville Copiague Glenn Islip Wyandanch Babylon Commack S. Amityville Copiague l l .V. SOFTBALL if' A 2 J VV, mm' . l 2 I ig. i 225' ,I W ' Q., 29 9 2 1 '7' F l Q .af ' S. Harris .A-.ef 1 ' A. Salmirs, K. Palmieri, L. Fox, K. Morrison, Cam-pofranco, M. Nathan, S. Brown E. Pooler, T. Florkoski, L. , G. KuShI16I', V. Steets, C. Oakland, D. Piccolo, C. Pooley, SCOREBOARD j.V. Softball Scoreboard Commack South Copiague Copia ue john glenn john Glenn john Glenn Babylon Babylon i 1 12 Vi 152 14 ' f ,vii 4 1 2 1 A 3 MSS: is 48 GOLF!J.V. VOLLEYBALL!.I.V. SOFTBALL L Q iii iii Team - Soon to be the Both teams stand, ready for the rebound. Feint! That is definitely not a good direction for the pass. --.. 5 I., Mvsffz -1 With an outstanding year, the I.V. Basketball team is following in the footsteps of the Varsity NEXT I LI E This year's junior Varsity team displayed a lot of talent and aggressiveness in recording a fine league record of 10 wins and 4 losses and 12-6 overall. During one stretch the Tor- nadoes put together a winning streak of 7 games while beating every league opponent at least once. The team was led by co-captain Derrick Robinson, who averaged 13.3 points per game, highlighted with 26 points vs. Islip, 24 vs. Glenn, and 21 vs. Wyandanch. Strong support was contributed by William Thomas, who averaged 10.9 points per game Q22 vs. Amityvillej and Iohn Donovan, who averaged 10.1 points per game Q22 vs. Wyandanch, 20 vs. Amityville, 20 vs. Babylonj. William also tied for the team lead in assists C421 and steals C755 with co-captain Mike Gutt- man. Iohn Donovan led the team in offensive and defensive rebounds with Mike Guttman finishing second in both categories. The team's success was due to a complete team effort with contributions from every team member. Congratulations on a fine season. First Row: William Thomas, Mike Guttman, Derreck Robinson, Keith Waring, Adam Balkan, Andrew Mueckenberger. Second Row: Iohn Donovan, Quinn Hughes, Kevin Greiner, Scott Neal, Richard Suns, Mike Lombardo, Chris Galasso. Not Shown: Dean Soteropoulous. Scoreboard H.F. 31-57 HHH East H.F. 37-32 Northport i x-LF. 44-53 ward Melville H.F. 37-34 Commack South H.F. 56-48 HHH West H.F. 54-49 john Glenn H.F. 56-46 Babylon H.F. 53-51 Copiague H.F. 59-44 Islip H,F. 57-47 Wyandanch H.F. 67-68 Amityville H.F. 48-51 Babylon H.F. 47-58 Copiague H.F. 75-64 Islip I-LF. 81-69 Wyandanch W H.F. 73-51 Amityville ,M ,p , 5 H.F. 61-63 John Glenn , , fgf H.F. - Commack South wins: 12 - losses: 6 Commack takes a shot, but Harbor- fields is there to steal. JV! BASKETBALL 49 With players at the all-county and all-league levels we're in the playoffs guided by The Coach of the Year! , Varsity Basketball is definitely The Commack South win clinched it: Harborfields Varsity Basketball team was in the playoff tournament for Suffolk County! We beat Patchogue in the first round by one outrageous point! C51-501. The quarterfinals were a sell-out and we never played better, demolishing Huntington 68-47. As this goes to press we meet Centereach in the semi-finals. Here are some personal victories for this year's team: Ray Alburg, Roger Morgan and Bryan Myles made all league. Ray Alburg also made All-county. And Coach joe Mayer was voted Coach of the Year in League five. Congratulations to all for an awesome season. HANDS UP, H.F., HANDS UP! 'W- Sink that ball, ' ! Number 52, Q Book a , eaps up to the bas et for opoints. Scoreboard , HF 40 HHH 38 1 HF 54 Commack N. 37 HF 60 Ward Melville 39 HF 63 Commack S. 35 HF 44 H.H.H.West 50 HF 67 John Glenn 42 HF 47 Babylon 39 HF 54 Copiagaue 40 HF 69 Islip 51 , HF 72 Wyandanch 73 HF 85 Amityville 53 HF 64 Babylon 35 HF 76 Copiague 60 HF 71 Islip 51 HF 59 Wyandanch 74 HF 64 Amityville 58 HF 65 Iohn Glenn 43 HF 64 Commack S. 43 wins 15 losses 3 Varsity Basketball Back Row: Keith Bookhard, Mike Cody, Darren Prisco, John Quinlan, Matt Quinlan, Ty Gronbach, Ion lager, Harry Williams. Front Row: Kelvin MacMillan, Ramon Alburg, Roger Morgan, Bryan Myles. 50 VARSITY BOYS' BASKETBALL Senior Ray Alburg races down the court to grab a rebound. When Roger shoots, people get out of the way. 2 Don't let him score H.F.! I W l l asf:- v, ,,,4,,M.,..,.,...m he ffrf q,.A .X , W V IA .A 5' -an 35 A --A Lili ' V- ,.. . ,.... A V' M 1 gf ..-.-.-.--nknmnw'nn'vf 'f'f'f9 '.'-ff ..f1l-fl,,, VARSITY BUYS' BASKETBALL 51 Scoreboard Girls Basketball HF 44-30 Walt Whitman HF 32-39 HHH East HF 40-37 Kings Park HF 40-30 Commack N. HF 37-11 Commack S. HF 31-33 john Glenn HF 49-27 Babylon HF 51-30 Copiague HF 30-45 Islip HF 30-40 Amityville HF 44-32 Babylon HF 38-66 Wyandanch HF 39-32 Copiague HF 40-42 Islip HF 34-49 Wyandanch HF 47-54 Amityville HF 46-34 john Glenn HF 35-25 Commack S. wins: 10 - losses: 8 :..BlfffH4l , -V . Hpneuwrlfwf Girls Varsity Basketball First Row: Sondra Walter, Karen Roberts, Iill Blackman, Linda Zimmer- mann. Second Row: Pamela Bailey, Christine Suchan, Rachel Fender- son, Tracy Hackeling. Not Shown: Trisha DosSantos, Bridget O'Driscoll. E ' A I rapt' Girls' Varsity Basketball The girls' basketball team had a big turnaround this year. Coached by William Hennessy and led by Sondra Walters and Linda Zimmerman, the team was much improved. The players consisted of seven sophomores, one junior and three seniors Ctwo of whic h are all-league playersl. This year was dil ferent from any other year in the past. The girls' varsity team had a chance to be in the playoffs, but, due to complications, the team had to pull out. Because of a change in leagues, Harborfields had to come up against State finalist Wyandanch, twice. The team was 7 wins and 7 losses. The outlook for next year is positive, since many of the girls are going to attend a summer camp. Senior Sondra Walters will continue her basketball career in college. We are all looking forward to an even more successful season next year and a second chance to be in the playoffs. 52 GIRLS' VARSITY BASKETBALL - 51,1 ...l, I , .04 ns' - During a time-out, Coach Hennessy gives the team some strategy. 14 . r, . ,.- - hav- ' Nl . 'ai lump high for the ball, Harborfields! Warming up for a game, Sondra Walter goes for a lay-up. This calls for a toss up, GirI's Junior Varsity Basketball On Its Way Up . . The 1984-1985 J.V. Girls' Basketball Team triumphs over Wyandanch, a previous- ly unbeaten team. We all worked very hard to over- -.nal come them after we were beaten in our first game against them 33-54. The more difficult our opponents were, the harder we played to beat them. Our final record was 9 Wins to 5 losses, with most of our Wins com- ing late in the season. The captains of the team are Cin- dy Williams and Andre Roemer. Although our team is young, we have several seasoned players who will be trying out for the Empire State games this summer. We are already great, so just wait until we make it to varsity! Girls IV Basketball First Row: Dana Bookbinder, Stacy Collins, Cindy Williams, Theresa Dixon, Sonja Stewart, Eloise Callejo, Amando Robbins. Second Row: Sookmin Harris fmanagerj, Chris Cancemi, Diana Croke, Kara Forte, Andrea Roemer, Mindi Harris, Althea Burke, Michelle Burke, Ingra Iones, Laurie Geoghan, jennifer McDonald, Kristen Morrison, Tanya Harewood Cmanagerj. ' ' .Lg 1 A, .- N .n- .: I. 1 ff-'yr1: f,-.-1' :hy ' ' 5,-255 ,,-'iw iafifi The J.V. team stretches out before every game. Racing down the court, the IV girls basketball team shows they are as good as the Varsity. i Althea Burke passes the ball to her teammate for an assist. HF 25 Commack South 19 HF 26 john Glenn 20 HF Z5 Babylon 31 HF 28 Copiague 18 HF 27 Islip 31 HF 37 Amityville 39 HF 30 Babylon 27 HF 33 Wyandanch 54 HF 25 Copiague 23 HF 36 Islip 23 HF 32 Wyandanch 21 HF 35 Amityville 43 HF 39 John Glenn 28 HF 30 Commack South 22 GIRLS' J.V. BASKETBALL 53 I 54 GIRLS BOWLI mix f I ' l GIRLS' ARSITY BGWLING The Varsity Girls' Bowling Team used this year as a building year for themselves. The team lost all of their matches, not because they didn't try, but because they were an inexperienced team with only one bowler remaining from last year's team. The team, like the boys' team, had one practice per week, with at least two matches. They participated in a Holiday tournament in December. The girls tried hard for the dura- tion of the season, but, because of their lack of experience, they were unable to keep up with the other teams in the league. They did break a record, though. In all the years that there has been a girls' bowling league, there has never been a team that hadn't won a game. Our team managed to do just that! The coach, Mr. Mugavin, is hoping for a more successful season next year, with a more experienced team. Marife Ramos gives a few tips on how to hold a bowling ball. just throw your bags over there and lets get down to bowling. Varsity Girls Bowling Marife Ramos, Mollie Weis, Eloise Saltz, Cheryl Gunar NG 1 tm af nerr vi Varsity Boys Bowling First Row: Rob Mooney, Dan McCann, David Sperber, Travis Reynolds. Second Row: Mitch Goldberg, Ieff Nunes, Lenny Paris. Scoreboard HF 7 Huntington 4 - ' HF 8 Smithtown W. 3 --J,-mm, HF 0 Smithtown E. 11 'fits' HF 11 Central Islip 0 HF 8 Northport 3 ' , Q HF 0 Whitman 11 ix HF 0 Huntington ll '3' HF 8 smnhiown w. 3 HF 3 smiihmwn E. 8 ' ' 3' HF 3 Whitman 8 HF 11 Central Islip 0 HF 6 Northport 5 HF 5 Huntington 6 HF 3 Smithtown W. 8 HF 1'A Smithtown E. 9'6 HF 0 Northport 11 HF 0 Whitman 11 W 7 - L 10 PI USTERS! The Varsity Boys' Bowling Team, otherwise known as the Harborfields Pin Buster, finished the season with an overall record of 7-10. Although the team only finished in sixth place out of seven teams, the team still worked hard and the spirit was there right up until the end. The team had a very rigorous schedule, with one practice until 5:00 and at least two matches, lasting about three hours each, per Week. During the practices, the boys bowled ap- proximately three games against each other. Their coach, Mr. Hartling, helped them with what they were doing wrong. Many of the matches were very competitive, with the team losing many games by five pins or less. The team par- ticipated in a Singles-Doubles Tournament on Ianuary 21 at Sayville and, the Conference Team Tournament in the beginning of February. With the team's high bowler being a freshman, CTravis Reynolds with a 167 averagej, the team hopes for a more suc- cessful season next year, with at least as much spirit and sportsmanship as this year. And it look likes another strike for Mitch Goldberg, Let's see if we can figure out how to get this spare. BUYS BOWLING 55 AND BOYS WINTER TRACK Scoreboard Commack 54 Kin s Park HHlTi Whitman 55 HF 50 HF 60 43 HF 73 32 HF 50 HF 40 Northport 65 Won 2 - Lost 3 GIRLS VARSITY GIRLS WINTER TRACK - First Row: jennifer Gerweckf Ellen Donnelly, Leslie Hilgeman, Suzanne Kenna-dl, Lisa Fusaro, Rosemary O'Brien, Kristina Palmer. Second Row: Vicki Alves, Beatrix leina, Peggy Cradel, Stephanie Calla, Pam Murrutt, Ann Frederick. Third Row: Ami Weissber , A lison Hillsky, jennifer Campbell, Stacey Tyska, Marlena Emmons. Not Shown: Karen Rane, Shari Friedman, Rosanne Gerard, Janice Haeni, Nancy Hughes, Kathy Madden, Kristin Maher, Rosemary Meehan, Cathy Nichols. I . an -K imma ,1 l l In a dash for the finish line, Ellen Donnelly passes the sideliners in the 600. The Solitary runner, Ann Frederick, Let me at 'em! Runners Rosemary shows her form in another winning O'Brien and Jenny Campbell get set race. to run the 55 meter race against Nor thport. Ienny came in 3rd. 56 GIRLS WINTER TRACK WINTER TRACK - GIRLS Many people think that all winter track is is standing out- side in shorts and a tee shirt in the freezing cold, running on a track. Well, winter track's not all fun and games, but we've had our share of snowball fights. The invitationals also helped make the season interesting. Our invitational at Yale was a 2-day track meet, so we stayed overnight in a hotel. The meets at Farmingdale College were indoors. Everyone brought their pillows and blankets and hung out in the mid- dle of the track, where they could rest until they had to run. The track is rubber and short and it makes running there unusual. Our captains were Shari Friedman and Anne Frederick. Some of the runners that had a winning season were Jenny Campbell, Shari Friedman, Nancy Hughs, Stephanie Calia, and Anne Frederick. Allison Hilsky always placed in the walk and was seated 4th in the conferences and also made it to county's. Gur two shotputters - Janice Haeni and Lisa Fusaro, also had excellent season. Janice has the school record and Lisa, who is a freshman, is very close. Both Janice and Lisa are in the county championships. All in all, we had a really fun season. Quite a few athletes went to the conferences and to the county's. The underclassmen are looking forward to a winning season next year. Coach Mike McCarthy gives some pointers to Arioch Griffiths as they waitin the center of the track at Far- mingdale. It's the last run of the season, and an Invitational. Scoreboard H.F. 38 HHH. 63 H.F. 48 Deer Park 57 H.F. 46 Commack N. 59 H.F. 47 Walt Whitman 58 Xflial-ALJ Wii55hfE1ii'iiei1HLEg seklilma'RHl5Z'cHQfi5Qi5LSI1f,'islEHli3R'E2ff2hfliS1SZi3E Uebele, Kenny Gantt, Bemie raun, Brett Hughes, Nero Mehta. Third Row: Russell Ronda, Russe 1 Leggio, Araioch Griffiths, Pat O'Connor, Jim O'Brien, Steve Burke, Mike Jensen, Charlie Hudson. No! Shown: James Busco, John Mc-Queeney, Cliff Panagiotopoulos, Larry Salice, Rich Schellhas. Despite their losing record the boys track team had a very respectable season. In addition to the dual meets, the team took part in the Centerreach Christmas Relays. The class meets at Farmingdale Community College, the Yale Invita- tional and the Suffolk Coaches Relays. The team performed well at these and the conference and county championships, with Russell Leggio and John McQueeney making all-league. They were also the captains of the team. Some meets are indoors, which is nice when it's cold and rainy outdoors. BUYS WINTER TRACK 57 .X l f H -11 1 u is-4' -F250 . L-FN 3 ,. 5 Dibbles ln Action - Tim McCa1lan is working his opponent down. . n I ' -1 A l ,414 rw l 1 1 1 l L-wh if 449 First Row: john Henrikson, Mike Friedman, Brad Trotta, Tim McCallan, Carl Einsel, Robert Rodler, Dave Conklin, Tony Millon. Second Row: Kenny Harris, Chris Fisher, Vito Pizzonia, Dave Hernandez, Rodney Hunter, Derrick Williams, Tom Kean, Matt Kupka, Bob LoBosco, Mitch Herman. Third Row: Dave Gibb, Scott Muscatello, Gus Schue, Brent Procida, jeff Shade, Eric Friedman, Mark Albertson, Chris Hawkins, Greg Jones, Keith Walsh. Not Shown: Adam Golden, Ioe Panettieri, Scott Nadboy, Keith Peterson. ff!- f pg iaggegg 3 fe, ..,Q::'-fl: D A JJ mi A 1, ,JJQJQ SCOREBOARD QQ ,U ' L K b A ,fp , HF 18 Bayshore 32 V Q L. ,H 4.-' Q ff ffl .1 if H. HF 14 Commack so. 36 . ,Q - 4 , Y fy , fgw--U' HF 44 I.Glenn 12 'Q-1 Q J' lf ffA'lQl 42 s fx HF 23 Bayport 47 QA FEL ' of V re 'fee HF 33 Copiague 21 Ly Q, uw 4f2Q,f ef 1.1 U ,--y,, l HF 42 HHH East 14 rRNA., I gkjf f' 2 fc' fl-Y , HF 19 w. Islip 38 N ,1 fxs, 1 -1 Cr! ,A xg HF 22 William Floyd 34 if N Q 4 ! F sf' HF 45 Wyandanch 10 gf XQXQY ' 'ff 4, P- x LVQF' HF 8 Port jeff. 43 f F 4 2, ' HF 23 whllman 30 Li fa,-lx ,Q V! l ---- VE, HF 33 Babylon 28 ff .1 -J ,K HF 16 HHH wesl 34 'L XC. lk i ' HF 33 Hampton Bays 20 Q-f f HF 37 HHH East 24 , F ,pl my HF 33 Islip 15 ' K, f we HF 30 Amityville 21 ff -'H .. ' ' HF 9 Huntington 48 58 WRESTLING l 'J Rudney's favorite position, a Potential Cradle. Tom Kean doin' what he does best - pinning his opponent as the Ref watches carefully. ' A. 4 4 1 V 4 X' Y' in V by ln., lv I I, I ' g ff ' 4, ly!! f if f if 1 ml gy!! 5? Boys J.V. and Varsity Wrestling F Scoreboard HF 47 Bayshore HF 15 Commack So. HF 42 john Glenn HF 12 Bayport HF 39 Copiague HF 21 HHH East HF 48 W. Floyd HF 6 Port Jeff HF 44 Whitman HF 30 Babylon HF 32 Islip HF 33 Amityville HF 27 Huntington WON 7 LOST 7 Wrestling is considered controlled violence. There are a lot of restrictions and it's fairly easy to get a penalty. It's impor- tant to concentrate and act at the same time. I.V. and Varsity practiced every day after school together and went to meets together, which made them get very close, like a family. These are the Harborfields' wrestlers that went on to the counties. Michael Friedman came in 1st in the league V tournament at 91 lbs. Eric Freidman took 4th place in the 91 lb. weight class. David Gibb took lst place in the 105 lb. weight class. Tom Kean, in the 112 lb. class, came in first. And Robby Rodler placed 3rd in the 167 lb. weight class. Some others who placed well were: Tim McCallan, at 172 lbs., placed 4th, Carlton Einsel placed 4th in the 155 lb. weight class. And Dave Hermandey placed 4th in the 148 lb. weight class. Harborfields placed third in the league tournament. Special thanks to Coach Szakoli and Mr. Hoops. Robby Rodler, deciding what his next move will be. Y R- No whispering allowed! Kenny Harris shares a quiet moment with his opponent. Gus Schue holding his own - has anybody seen my contact? WRESTLING 59 Fall S IIOTLS OO FALL SPORTS IELO HOCKEY -FOOTBALL - GYMNASTIOS - SOOO EH -TENNIS fl 'v i'z.J'i , '- bf 'A A ' 4 of-f 4- fr,-1 4' than -.-'T ' l.: . , J- F fs. V44:.i?,,, Jig, , .afgvyulf 5, I' -if Av ,qi 4? 'T- .',Q2 K' I 47,1 iovlfvw -Tw,w.A-Tw.: V , 4 A , '- .twig A - T ,. at Agfa?-4 , L.- f- I V 1- if, '1 '5 -- '-iff ff' .-Li, 1,1 1' ' K gag-'-, ,aan , - . , Y , , ' a ,,,,,-.fr-g3.f '. fg'f 'f . 2, .fe-, , . , - ,.:f:m.- ' an f 4 L , T, . ' L, ' '1 -, O r. - ,,,, - ' ' -4-.. ,z 'a 5 53 , '23 , lj ' 5 -velff' ' ' ET ' I 1 3-Mt, ', f- - 1 i 1 . , 7 H ' ' 1' - 3 iyzaijfif 4 -V -,.feQQF -..1 'vi '--1 ' -'W - - he 'YJ' 1,5 if Q , 1 :,1, -- ' af' , nf . ' '- 5 ' .1- :W aa tw ' ' f' P 11 '- f- f f , 'V if .-K' ,TZ-,,',t,, A - 1 4' ,a lg, ' Q' , rf' 72,5495 , ,Q , 'fl W ' . '- ' ' T f Q: ui? ' .f V Lf 715455 2 f .4 , , ,, 1 - f , L' - L H TMS ,wg U a n ,,,, 1 , - -ra: ,n w 1 5 . 14 vga. at aa, , aa V 1 , -.e in I . , ' 'N ,s .ff ' .-gh, lf. , J 'fu - 7 w . ' . ' ' '- - , , , .f Q 5 ff ie V T, , aaofwgpt' T ' 33- Q1 L -,.V , -L r ' YW ' 1 .-W-w'f .V 7. W I- 13 ff egg Eiga, ' A'-I+ ' ' ' wi.. HJ ' , t,' 1 ' , :1,,.- ga , 1 4-f--P ' f ., 1. as .. W V, ' if 'T S ? 4, 7-P, A-U A- , Mi' .' 1 -- -' Tffv. -1 'Ht fi ,-fad, -as ja 4, V- ' A I ,- I 4 ,ilv 1,--s , - -. Q fm V . 21' - ,, A , 4, 1.3-j -4 1,-5-fav V. fr an -1 an 1 , ,, 1 'A - ft 'L i VA J, I L 1, , ,. I bi, ,152 sn, .,,,,,,. ,..,,, Q ,i ,X ' Q , 2-' f.'v iw 5,0 ' 1,,. f , ,- fc mi-2, . V ' - , :A ' ' '- 2 ,, wr - 1' At ij gp. ,A , .7 Y .M ,V v js Y, X , -N' A-, 1 '- .. 'ff ' '. ,f ' . .gf 1 ,, - Q --1-wg, 4, . - -1. f a i' 1 'W - f K, as la A ' L ' fa . -'x-'ff A-F' - 4 Q4 71 .- K U, ,HV 2. ,3'lZfQ,41 .V f .- , Lf? f f Ling, -f A 4 , Qi.. 'ff-5' Y. of Q, - A if , . - ,W . 4 , D- 3,-' -. ,, . , , ,ffm LJ - -7. :H-63.5 E. '- We-Q gi? will .,, . . , If-V tx ,- . -' ew ., , ,, - A., f V, Y, ', 1-' K f I, -sk 1' E. : 4 '41 .I vi ff i , '- J 1 W N-T: ., 5 K - ,. V3 V, l a i . - Sa ' 'S ' -Q 2 '- V V V -F ' H- ' ' . 1, ' '. ,- ,f . . a . ., f Jax' 15- - 5 e -f'-1'-4?4'5'Qi?' -1. ' ,, , , ,, O T as J? W as t -If A rs- jrv t P - . ,N 9 aff: - - L ,fie-v--uf. 1 --T uf-,l1!'.-35,5 'J f 'J-cw ,. I 37'i'f-' 'XQ L: '- , 'T' if iii' X 'Q ' I l '- -'-- -zvween..-'sf Q - -1- cw , 7 , ,, ,Q l ,, 5 V, A P - - -V tw.. -A I .. ' i--' ' - 'K '-Q. -fig'-2 wig?-'r':7a4rl.' Zn, , W ' ' . I .,,, I YQ 't Field p ayers take their positions at the start of a game. Hockey l Off the corner. Junior Katie Walsh places the ball right where she wants it with great form besides! What a . a Score! We win over Glenn 7-6 ' excit' in the most ing game of the season. game' What l l n VA1ib1i1i if GYMNASTICS usecs. U,-on N1 aslgathi des- - ne xx. 'oe Books, Ogamvbawxsxo? wvxgbkx Xe90ZO'YxeXw 'N' 'ma x.0e Q30 yd. -Wx? I Q09 na G0GaexV1 . - 3996 C0553 316. GY gin OHMXXQKN Get C,aW?a,,,Y5 . N369 S . . 101.20 coreboard HF H-E vs' 144.2 1 10220 VS 5 Pon 113 - 13.19 lgefferso .10 Vs Ocky n i HF I1 'I20-00 Point HH 115.35 vs lol-,H J 11 Q30 vs' 128.7 Cleft'-I 151.5 1040.1 Vs-1123.9 gf-11POH H F I .15 Vs- 1752 Caypon F I9 5 OP H 48 S fue ,VI H W P h if N 9,03 e R f . 'l -Al 1250 Vs,' I 763 5 ayvfa 9 -F 121 8 vs. 121-5 0 Bal' gne .F I Vs' 131 Haas! ' 119-0 '0 EHS? 'On VS. 131.0 Sflam on 2 , 0,8 The gymnastic team sits and wins Wf am watches as each gymnast S S reveals her talents. tn? 1 PM gift' lem rls team this season. Pat Zaweski coached our gi She was very supportive. We worked very hard due to Ms. ZaWeski's Willingness to spend time above and beyond the call of duty. s not show our effort, we t to do really well in Although our record doe are a young team and expec years to come. One member of our team, Laurie Moon, made conferences, finishing fourth on the uneven bars. In counties, she came in tenth. This is quite an achievement for such a young gymnast! wffaiie oe aan Nftche e . sei ' 5 Benz -n ' f . r Q... Q . 'l . Q M' 1 'Sl 1 A' ' iii i' '54 . X. K .fi 1 X-' N ' V, , :ji els B0 8- Counfgys ...of . X. -, 'X 5 - , .19 corqboard .-HT' A lf 1: ' lf. 1 .Ss f., I-. .iq v . , 1 V . .Wai X J . if HR 1141 V: gshp b-' K 1 Q' -1 Hp 571, ab! Q f Q Q. 9- 0- H-. 15 s.Am,Vo1-, 35 ,AN 4 Y y . XX .V K ... .H 25 Ls. ltyvine dc? 1231- V f -1. 'E 'Y l ' . Q , j . .- 15-Tl - A105 ' ' kiss. . C1?p '3Ue 'off'-if X ' tx- 1 - 51, W1,,s:4 'nfnacks 45 6-Q ,tx . W. , ' 1 i- Girl N losses, ' 31 gif! - l .i 1 . it , ' H.r S: ' I 1 f-9 A is H. ' 25 fig...g. Q-f 1 ' Fl, It ,Q ix , I E 20 cf- Babno Lf. 4 -'-' n Fted ISLE 30 ' gzmptoz 32 . ,' ix Q l berg'M1kel99ieNiaher, Hi 20 JS' Banjo 37 'e..:j,!f5 is if x 1 . W EEPE. K0 py, Nnlwexsy Gadel. Knigdy. Leslie ' ' 25 vss' 151111 rt 25 ,X i h zxerxer,Kef'Qfl,m igredfickggfxiih. Sue Ken wi,,s.4 Be' Porf 37 H :ii .. w as Back Row:x?:a1,13ddleg8w1iennedYf Sue N loses 1 30 f U - - I V EMBER5 an Ms. Mar First ROW- ' 1-EAM MCGOW 5 Braun. UNTRY Mike 1 Begme ,Y n , . CRYEJNSIE-'x,fCgha,y: lgigfgxmmerma B9 ' Gm-at I Rogeann Hageman. CROSS COUNTRYAND evmnnsncs 61 g a Tennis Front Row, Left to right: Diana Croke, Kristen West, Nina Heller, Karen Denu, Iill Neder, Jean Maloney. Row 2, Left to right: Sue Sullivan, Shari Cohen, Lisa Pagano, Eileen Fox, Rachel Tenderson, Iodi Balkan, Christine Boyer, Iill Hicker- son, Coach Mangan. SCOREBOARD H.F. 1-6 HHH East H.F. O-7 Commack N. H.F. 2-5 Northport H.F. 2-5 lslip H.F. 6-1 Islip H.F. 4-3 Bellport H.F. 5-2 Bellport H.F. 5-2 Miller Place H.F. 3-4 Commack S. H.F. 3-4 Commack S. H.F. 3-4 East Hampton H.F. 3-4 Port jeff, H.F. 4-3 Smithtown W H.F. 4Vz-216 Miller Place H.F. 5-2 Port jeff wins: 7 - losses: 8 62 VARSITY GIRLS TENNIS A HIGH RANKING ALWAYS MEANS FIRST CLASS SERVICE The girls Varsity tennis team finished their season this year with a second place title in League V. Coach Louis Mangan was happy with the tennis season which runs from August through October. The team also came in second place in the East Hampton Invitational. The League record is 6-4. Senior captains Lisa Pagano and Eileen Fox along with their twelve other teammates practiced every day and had a lot of matches on Saturday afternoon. The team's toughest opponent was Commack South. But next year they plan to beat them. Good Work Varsity tennis. Before their matches, the girls relax at the Shoreham Conferences. En garde! Sophomore Sue Sullivan and Senior Shari Cohen celebrate after winning their matches at the East Hampton Invitational. Preparing for her court appearance, Junior lean Maloney grabs her water bottle. I in-N.. I ' 4 ww .1 yi -'Agua 4 W 1....,,,', .ff-ff 49' J-I , , , I I L A I I I s ' ' 1 4 I Mills I ITAL. B Heads up! Senior Ilene Fox serves to her opponent at the East Hampton Invitational. Coach Louise Mangan makes sure the girls are ready to go an away match. VARSITY GIRLS TENNIS 63 The IV Soccer program at Harborfields was very suc- cessful this year, Head Coach, Mr. Iohn O'Hara, kept a very disciplined team throughout the 1984 season. The team won ten games and lost four which is considered very good in League days occurred either once or twice a week for about two months. Players looked forward to playing arch rivals such as Iohn Glenn, Commack South, and Amityville. The soccer program at Har- borfields deserves alot of credit . . BOYS SUCCER V competition. The team prepared for each game with practices every day after school from 3 to 5 o clock. The players built up their skills in the game considerably. Game and is very exciting for anyone wanting to play soccer. Y-eKis,Siff'lN RO F1-es lima ,jfow 1: DZ BOYS SOC Sw 17617 cel' 5-xl gas bail ei - e, An ',Co QSNCQ' v eov992,?Va'2?2fl Labgllfswwi '19 CYKV PSV Lange, gre-nyelf on Sage! , Gate as aefl T Y nuke iioioyet . Ci MCQVQ 1 X . bei' .SXCXM eillai glll I I Sag gcgtgew Ggxce,-:ics YY 921:29 Nlcoai Gigi L31 X C335 ' 99- vlgxev E Ol iotema' S sow av W el Fresh SC 171611 Soc-C I-4 Oreboard Gr 5-1 1-2 3-2 2-3 2-3 E. N0 N- Bdlevjue Wa1,rliZ:fVo0d fiandlewggnan La-VTE d X losses: 6 POF! HF HF HF HF HF HF HF HF I-2 1-3 Wif1s:2 er5cot2boai CC . to o sl- 'saullm ak X xggngzvxxye W QXQY' 0 ,L , yi 1 l2Q,l.2,iav-Nix 7. Wlwknma YK X v42i:xGe,tn O V9 x05- X Xggmmac YK x Sl 'ei s. H? K5 cgygignvixed i-W vlwgkosx T T - . ,ice egg Osxgeioge Delvou Kirsch Kruflt aB, neff P Z' Bren endan Beetel' I a ffSCh,ch1f'b1H R'Pefef t P1-Odd r u Co - - 1SA4U1'1'a-Qfijg Ronggn, Tasso M f d f ,-,- sr - :L ron M An dre egafis 64 JV AND FHESHMAN SOCCER etg W , , Ch . , gat, Robe I'V1ngeS- F15 Haye FRE H N SOCCER It R0 S, R Iltneri K: 3: Br1.a1?vV 2: Edge uh Walsh gills Hug:-3ca1-es M roach Tom S5551 Ch-Zi. p Onnor f f . 1 ,- . A . f. gf rf f 4 7, f Y ,' ,ff fav , 0, .Af jfly.lQa ll!-.,Ul,?, I ggy-c ,fav -4.1 fp f - ,vga - f I L ' H lv ., ,. 55 1 X 1 ' , 'ii . J f' ' f' - , L f 5--. - -.-'Q A . :4 ff ' lik-D V7 Playelrs stand on sideline in a prac- Q73 !J'j,,vgg,y Qfwf, 9 -3,49 X-fled X'- ff' ' f li fticefor upcoming game against Half 4 E f ,J A ,V . , S' f. A p , .f 4, , f, A fx 1 . WWF' Tw , 'l is at ff if, ,Q f- fi 1 ,- it 'tklzlollow 1-11115. 7,4 ,I -1 ,f A : ff 1 as-f f . af J - . . I A A Q WSJ ,f f 4, - . an -Q ,A .19 f 1' fe firm ff' Qgff' Xfire Nei' Q gi ,- J 1.1 - ' ' S ei- 79 HF runs a twenty-four blast up the middle. Q,.7 ,df ltanialh . . - ., , mzf:'..c,1.::P - ' ' ' I V 1 'JI 5 I ' L ,'f,,,L' 1 G . if lk F1 ' f7fZ':?- 4' I .V , . V., ,, ,, if V ay' , - I' ,, mhz Ms-ff I 'Tin-1.9, A 'r ', 1 ' .,W, ,, I 1 , '.'1i ,-va ' V, .... v- f-X, , J . .. , , H - 1 , ' i,ii -ufM!l'4!'??l ' A 3 , -. . ' - f ,W ff w-vpn' ,, f,Q,gs,..,,p.g,.i ff '-W , if - - YQ- .,-aff, ,,,,:'ff:2' 'w,.,T, - . .:., W A -1 .M f . 'f . .t,.-,vfazwr .,-mtg. Q ff-' Piioll XLYING F SLOW START TO A . 1 , ia ' A , S . Qfff' ff? . . , . f Leif f ww vsswcq 2 X '--'- FIIH After a slow start to a season that looked pretty grim after the third straight loss, the I.V. foot- ball team rallied in a big way. Coach Gary Aumiller's HF scores against Glenn. psychology had its effect. Chan- nelling enthusiasm into tough practices, crabbing down the field Crunning on all foursj, teamwork and persistent effort turned the season around with five victories in a row for a fly- ing finish! Front: Michael Guttman, Richard Suris. 2nd Row, L to R: Scott O'Brian, Gary Schuh, Garth Fudens, Paul Piotti, Mike Goldfeder, Mike Friedman, Sean Frazier. 3rd Row, Right: Aaron Stanford, Robert Lobosco, Tony Millon, Charles Sorren- tion, Iohn Donovan, Mike Feinsrein, Eric Friedman, Brian Koppy, Iason Kwiatkowski, Iason Lefkowitz, Adam Balkan. Back, L to R: Sean McGurgan, Kevin Kemp, Mike DeRisi, William Slamm, Rob Clinard, Keith Waring, Brian Kelly, Michael Lombardozzi, Neil Ames, Raymond Suris, Glenn Cira, Kevin Kustka, Anthony Mondrone, Coach Gary Aumiller. Scoreboard HF 12 Riverheaad 14 HF 6 Islip 8 HF 14 Glenn 21 HF 34 HHH West 14 HF 32 Amityville 0 HF 31 Mercy 0 HF 28 Centereach 14 HF 15 Portjeff 8 WON: 5 LOST: 3 back for along pass. Sophomore Adam Balkan drops J.V.FO0TBALL 65 THE DYHASTY IS BEGUH AS THE 2 TOHNADIJES TRIUMPH The 1984 football season was a very exciting one for both the school and the members of the varsity foot- ball team. Under the new leadership of Coach Lukralle, the football team enjoyed a successful year. After losing its first two games the Tornadoes rallied back in a tremendous 1 point victory over John Glenn. This hard fought win is one that will be remembered by all those on the team for a long time to come. The rest of the season went fairly well as the season ended with a 4 win and 4 loss record. The team had its ups and downs but in the end there was a sense of gratifica- tion for all those involved. This team was also the building block for a future football dynasty at Harborfields High School. Scoreboard HF 6 Riverhead 32 HF 0 Islip 12 HF 7 Glenn 6 HF 12 Bagiport 30 HF 25 H HWest 6 HF 2 Amityville 0 HF Z6 Centereach 13 HF 6 Port Ieff 16 WON: 4 LOST: 4 X Nw .1 'A 'J V'-L sf Craig Alipertiigiggi Coach Kip Lukeralle, Criai Snyder, Matt Kupka, Andrew Lynch, John McQueeney. Middle Right: Andrew Wilson, Russ Leggio, Robert Rodler, Brad Martin, Chris Alfieri, Todd Davis, Philip Clementi, Doug Venuti, John Diamontopoulos, Jeff Slippen, Robert Lynch, Mike Montaigne, Steven Sabatino. Back Right: Marc Stein, John Strong, Chris Orr, jeff Leary, Brian Forte, Dennis Keenan, Todd Cook, Pat Godfrey, Roger Morgan, Darren Brady, Iames Busco, John DeRisi, Kevin Collins, Larry Feinstein, Hagjyq. Williams, Jeff McMillian, Mike Roemer. D Q5 :TH gr MtmRight: David William Thomas 66 VARSITY FOOTBALL Fixx' X' , ui .W no .5 ff! H, .L Mug 'fa X QQ I' ix iq., Tornadoes take the field before the Coach Sukralle gives halftime in game begins structions to Tornado players. H.F. Kickoff team converges on Glenn runner in the incredible upset victory by Harborfields. The crowd cheers on the Tornadoes with flags and spirit. Touchdown' The Marching Band at the end of the halftime show, an exciting part of every game. 67 ss . Z , qw- uin 4. si 2 van K A F QS A , A 5....:,-X H b A S Vm.K::?? Hy' fx .Q , ,, Q ifwiiifwvlwk' iff..-A Q. 'Wu X ' ' f- '- . - . ,, , X . ,. Q , , . . , .R .1 If 3:,,:1x1Egr31.Q:2,. k1:g, 3 sa .. . s - - i ff, 1 iii? -, ,lk , - , 1 :M --no---111'-X -'--ze' -s N , Y A -g,.:,,--X 4 mu SE' Q1 '15'f'S? 5' f - V X kj . ,a- ' K. gl. 4-M-.. , . . .- ' Vw- Q, yd, ' A - A --? -- N, f'5-Fgfw--y ., - . - Q A W'..1if:i' ' fm. . X -.YN - . ,-le, 31.-Y . H , .QQ I 2. A, ,, vi. :Q - is E-:gf . ?' . 'K J ' . ' ' sl -if .,,k,4xf'x -sc-fzfr-Z' --A --fr: Rf. 363, , a kick in the grass. Junior John brow outmaneuvers his o onent. enior Ian Adrian heads the ball away from his opponent. Enthusiastic fans cheer on the soccer team to a home victory. 68 VARSITY SUCCEB QQ Y' In-fp K wllll il lll'Sl place lll l83gll8 5, ll'S Victorious It's easy when you're number one! With a season of 11 wins, 3 losses, and 3 tied, we came in number 1 in Division 5. Harborfields soc cer has more wins than any other team in the school! Coach Marra was a big in- spiration for all of us. He Junior Pat O'Connor heads the ball to mid field. prepared us for the grueling matches, in which we were victorious' The season would not have been so successful without the team s great ef fort and camaraderie We would also like to give special thanks to the suppor- tive student body. A near miss, Opposing team's goalie makes a save. Boys llarsity Soccer vt. Front, L. to R: john Hart, Pat O'Connor, Dennis Madigan, lan Adrian, Dom Petrocelli. Middle, L to R: joe Barra, John Risebrow, john Caracciolo, Charles Norwesh, Kevin Flanagan, Cam Elkerton, Arioch Griffiths, Bren- da Coyne. Back, L to R: William Rosenfeld, Damian Moyniha, Mark O'Shaughnessy, Chris Iohnston, Eric Rencs, Brian O'Hara, Dan Holmes, john Donovan, Billy Bertram, Odel Burke, jamie Hubbs. SCOREBOARD HF 4 Huntington 4 HF 0 Glenn 1 HF 2 Kings Park 1 HF 2 Islip 1 HF 2 Shoreham W.R. 1 HF 0 Islip 1 HF 3 Amityville 1 HF 4 Commack S, O HF 0 Glenn O HF ll Babylon 0 HF 5 Babylon 1 HF 7 Copiague O HF 3 Copiague 1 HF l Commack S. O HF 2 Amityville 0 HF 0 Bayshore O HF 0 Whitman 2 WON: 11 LOST: 3 TIEDQ 3 4 5 T 1 I7 0 X , ' ' t ,. ., X, A I Y' I 'Q O J, ' ' - I A. af ' ,H , .' , ' . A- f' 'ffffff , if at 1.3 'Ev VARSITY 'FIELD HOCKEY - Front: Laura Carillo, Kei Sochi, Mary Ruchell, Karen Solimando. Middle Row: Alison Hilsky, Nancy Mann, Genevieve Pullis, Mollie Weiss, Beatrix Kleina. 3rd Row: Sondra Walter, Donna O'Shea, Lisa Fusaro, jennifer Samp- son, Bridget O'Driscoll, Denise Merdon, Heather Pyke. Scoreboard HF 2 Sa ville 0 HF 0 Babylon 1 HF 0 Port jefferson 5 HF 1 Bayport 3 HF 0 Riverhead 1 HF 1 Sa ville 2 HF 0 Babylon 4 HF 1 Port Jefferson 4 HF 1 Riverhead 2 HF 0 Bayport 3 WON: l LOST: 9 Kei Sochi exhibits perfect form as she hits a pass. An early lead over Sayville is a cause for celebration! 70 GIRLS VARSITY FIELD HOCKEY Battle of the Ball, Karen Solimando and opponent fight for the shot. Struggling for the ball, Denise Mer- don attempts to outmaneuver her opponent. , I 4 an Kirks, IWW' M ,,f,A, ,M W' sl , ,, Q ' ff by J 'L 1 ffg 4' fl qgf I 5 Q 1 ,0,,fg, ia WITH YOUTH AND POTENTIAL IT WAS A SEASON . I,UGHT FIELD HOCKEY After winning our first league game, it looked as if it would be another winning season for HF's Varsity Field Hockey. It was not to be, but we did not do badly under the circumstances. We had to develop both teamwork, and adapt to a new coach, Miss Irene Walters. The team was very young, with only five veteran Varsity players. The new players, green at the begin- ning, were an asset to the team and have great potential. If the varsity team was young, the I.V. Team was even younger, consisting of mostly freshmen. If any team member were asked to sum up the season she would describe it as a learning experience. At field hockey camp this summer the learning will continue. Our league did very well, with Babylon, the league champs, going on to take the county ti- tle. Harborfields was not left out of the limelight: Two of our girls, Sondra Walter and Kei Sochi, were named among the All-League players of the season. We endured the long runs from the South Gym Lockers, when youq-e hot yolyre hot! Allison and the frustrations of the game, but we had fun. In fact, the Hilsky gets readyto go onthe field. favorite quote was Are we having fun yet? Seriously, we wrapped up the season with no hard feelings. And if the say- Reany for anvthingf goalie Allison ing rings true about the future being in the hands of the youth, we're looking forward to coming back and watching Kara Forte hits the ban away from awesome and talented teams wearing the green, white and the Harborfields' goal. SOI-d-I Endler defends her position. .... ,....,,. , .. .. www. I :jen I 3 Q95 ' IV FIELD HOCKEY Row 1: Allison Endler, Rosemary O'Brien, Heather Hunter, Carol MacMillan, Karen Gullotti. Row 2: Gertrude Bakel, Melissa Huelin, Karen Higgins, Lynn Kochendorfer, Kim Wille, Beth Friedman. Row 3: Chris MacMillan CManagerJ, Allison Baptiste, Brandi Hynds, Heather Keilty, Virginia Frint- zilas, Kara Forte, Gabrielle Small. Scoreboard H ti ton HF O un ng 0 HF 0 North ort 5 HF 0 Sayvillne 2 HF O Babylon 5 f E HF 2 Port jefferson 1 m8b lw -W ' .. ,..-. . HF 0 Riverhead 4 f HF 0 Bayport 4 HF 0 Sayville 4 HF 0 Babylon 3 'L HF 1 Port Iefferson 3 HF 0 Riverhead 3 HF 0 3 Bayport WON: 1 LOST: 10 1- 5 k .heard-ww W' ., ,.., ,.:., , ..,,,, A . y ., fp- ' LM. .1 ,. ' il ' . LI if kigemf- . , A : Z - ,.o95'a. - ,f in I' I' , 3.351 I 6 Wg my jf'jj, 545. I lg g gjf ., .vi-.' V A - ' I viz., -gf- 'f V':-v.'c' pm- - . - Vt 1. riff f -W. I - r - 4. ' , w ,.-A 11: - f ' I 7 A . F ' ' P ' A ., f - is . 'W . - - -- , W1 .mia is . saf4,:s,...a.a.1'f1. il.L1...lafg:-hii GIRLS JV FIELD HOCKEY 71 GIRLS VARSITY SOCCER Row 1: Karen Robert, Tracy Hackeling, Lauren Gallagher, Col- leen Kent. Row 2: Trisha Dos Santos, Christine Shanahan, Rosemary Meehan, Cynthia Poulos, Kathy Flanagan. Row 3: Katie Walsh, Iennifer Stevely, Christine Suchan, Susan Wohleking, Marina Pastroelli, Morna Flanigan, Coach Sue lv- , s N, 911 gays. J. Ryan. Jill Blackman not pictured. SCOREBOARD ' HF 2 Eastport HF CQIRLS VQZIZSLTHT SOCCER 2 HF 0 Shoreham . HF 4 Islip Q: 3 ggnffgwn Wes' 5 HF 2 Middle Country HF 8 Shinlfjeham 1 I-IF 5 Center Moriches HF 5 Islip 1 I-IF 2 Iohn Glenn HF 9 Middle country o 'f Kfgggfzfn I-IF 1 Center Moriches 0 W. b Sh t t HF 1 John Glenn o 'nm Y 00 Ou HF 2 Bell K 0 WON: League 13 LOST: 2 PO' Overall 15 lgahqlifl Q-all ff ,K 'H A if 'Q' Q' if if YQ -,V 'l'f'9 ix Jil X' I-,ll , ' fix TJQ, -YQWX5, J f +I ' A 'L f'-1 -' 2Jl ' 0 gl J ll! 'D M1 U. gag .ggi QI K tx D ' 'l X CVD Wye UT, U A gy N. ,rch v4.g 'R eval SOCCER League 4 champions 0 Sportsmanship Award from the Suf- folk County referee Assoc. Seven students made all- county and all-league. Coach Sue Ryan was awarded Coach of the Year. 72 GIRLS VARSITY SOCCER fa Charleston, Charleston! Cynfhi? Ecilllosascoggilits Karen Roberts sure can kick., again S 1P y Flanagan runs to follow up. 1 ., Bandages don't stop Morna Flanagan as her- shoulder connects with Lauren Gallagher's pass, Ji Oh no, my head! Iill Blackman blocks interference as she goes for a head. Kathy Flanagan runs to receive the pass. Fancy footwork as Sauren Gallagher la s rett soccer. it 1 , 2 . , my ,. dugg-.1. k tiyp A A255 T wx' XIV G ik .1 uf-3 if ' ' G - . fx 4 . el ,If ww' Qux .JY lv ,X -JO W' i?XV2yA MCU 1 A ' - A 'Q ' L Nj .fl :VH K X I F'-Q, V 'lx' GIRLS J.V. SOCCER August isn't vacation - not if you're a member of the girls IV Soccer team! Practice 6 days a week, and then 2 hours a day 5 days a week thru to the end of October. Practice paid off, enthused Ms. Kuch, the team's coach. It was a very successful season. The team finished with 8 Wins, 7 losses. The only drawback was we didn't get as many games as we wanted, since many potential opponents dropped their IV teams. Particularly disappointing was not being able to play Iohn Glenn. Andrea Romer, a versatile player, was high scorer for the team. Dana Bookbinder, goalie, Was injured early in the season, and was replaced by Lisa Byrom, who did a great job filling in for the rest of the season. It was one of the most enthusiastic teams I have ever coached, Ms. Kuch declared. The team would like to thank the parents for their support at our games. as il V N -' 1 -' .3 iq gl IJ gr. V i M A .A , V' ' W dis 'Z' 'J' Ji E. I X WU, 4'I P ' Q ' t Row 1, L. to R.: Kahmi, Andrea Amy Nickerson, Dana Bookbinder, Cybele Roemer, Mary Lynch, Kristin Alexander, Heather McCuade, Coach Kathy Kuch. Row 2, L. to R.: Claudia Colesante, Kara Sordi, Cindi Williams, Jennifer McDonald, Susan Weick. Row 3, L. to R.: Maryellen Mindler, Anan Sochi, Stacy Collins, Debbie Labodie. SCOREBOARD HF 5 Shorehamlwadin River HF 2 Sachem 7 g HF 2 Smithtown West 1 g Qjgghvoff ff gg Q Hfgdle Country f HF 2. Middle country 3 HF 3 Beuport 1 HF 0 Center Moriches 0 HF 4 Centereach 3 WON 8 LOST 3 2 AS-l A .,, f Sophomore Mary Cambell 0 K ' . .1-Efifiif-E' talks to her friends about the P upcoming Billy Idol tour. liwfl l'-,Azz V ,, i x l. ,,s x , ,,.,! ., i ,- Y X ,, v, i , . i, 4, X i, K, l i i i V, if 1. x-'X l nf :,, Li , ,, , ,A fl ' l , Q , a it 'W x -, -1 , 1 ' E Cf ' t . .c ..... NN... , ,N ,A t lf L X X , -' faq! Q Els . 1 V in, , w. J ' l. ,, if -N lv' f,, ' 9 .nj-ax iifl ll Qf XT' Rf ,,.i.,,, A ,' .X l A Y l,,'1.:' F' el 1 , VUE .'!l via T-115 l V IV, x, -L A-l Vi .ii xv-A li, N, ,g 4, yjwyy, ,,.,w., ,, Vsig 3,-, ',, 4. ', li K tj '., lv-if YQ L,, X . ' , , kfgqffw., :M , i ' 13555 ili Iftffw , film l in A , ,im 1-we fa-fu:,f,ui.' Vw! LISA , . 1'1 'J vfzr '11 1: it-:': ,, - Elffv , ,Nswffmvfl v ' QQ xi ' 0' 1 1 K if vTiTJf,,,.,.: 1 ii ,, ,,,u,.1fu'z Ming' :LgvHJ,f, l 'Q ,, fl,-5 . Q, ...f,f,fwf '4 'f- i if ,Q wa- ' lf W el f ,,M,ffa1f'f, - J W , if f, ' lu W3-f,'ni1ifTT'7fT7'-' ' X ,-,, ,',,t,- ' ', vi , Q-,,'-w,,:':1 ,-A,-f ,fulfill lf M W' ff v M' ' V I Y '3- l l': 'x 'ET,i'?Lf',-'.-W, Yflj, W Iliff' uflffly. 557' '- 'I' l. , N, , 6,,,.,,t,y.l,33,y,,l 'L gQL12',7p',T-,z,,2l,g 11:gJima,,:g1,,-1,1 Q, ' b, pp, .1-'51 , ,aff ip' aw,-1g1 ',g5'f -Lw-'T' xiglfe i,g3L5:J,1L,1.arss,-M.f Uyii, Q,,,,,c,.-',1w4t,,rff,ff2f:':f1t:f:ai:s,, , l fr 1 w, 1v:licY'S- , fw:,:m1f'111,,rusglurQ1,aa,,,a-, as E, A 1 9' f V 1,1g,QifLg-gggf:.g.Va-.uu,,,s,a,,, A ' 1 at iW4p,.ss, We 1 Lisa Mano relaxes in the senior lounge after a bus da at school. 'mag wjw1A,gy,,gw,,..2,A,,a ,gf ,-1, .. . , , .,,... ,,V. ,,,,,,,.,,., . , , , 74 PEOPLE :fu1:,-g:-,wwg'EH,.Lszml-J -5 1,,m,f--05,1 J, ,-. Hwy s.w1iaw1r.w-u, -i,f.,lf,QQ.1 .-.f..wrv-fa. wgimcftfgplgfivyeicrways ?,'-xml, fm ,,smwjlg-1-Jw-.5 ,,',fs, --fe,,gnQ.gu:::f wrbwuwiy.au2f,,1,Qwl:-5,1 .fr yu 3. ,r 1f..,w, '+wr4,i:rc,wv3,.m ,mwah 4 ,.,mf,vyW,j.. sssrpu, Cathy Skhinder smiles as she realizes that her picture is being 'W . vm x1ri.u:rw,:s1'f .,., ',:,nr1,f :wwfpp 22-1 taken. p,-,al -.,. My af..-,aa f, i1,f 4 o:,,,,,w, V- fc -swf. v':nw1:w-s ,w,-553614 iN.'.1, 4.gy': ww, ,Q ,.S,W,,,,Gw,, M ,wt W , WM Two freshman girls share lunch outdoors to escape the busy cafeteria. x , vxH 'nv 'N . x NK 'K X K N. w ' N u., ., it KA A 1 I 'sh . 'EN Q x w W W.. X Wifi, fi. 7' .vs ' - 33.1 - '75 '7' fi 1 . .f f 0 .-fn., . -gisbz' , jk 35 M I 3 3573 A uw- if 1 M. , ? ,rf ,nv 'Dv . Qfh., fw ,. 'FM .NL M -- A. ,..,',,v,, ,f N Q LH , . Kpvw' Jf, -4--., .M ,V -vj.. V .Q VWn,g+4-.1,,,.v-.fffh,g,.n , ,fs . , V ff .'7..N ,ami,c a,17'.,,,,'f1Hf,IWW ,,' -WM fx, . nr . 2,37 .vf'v,,'q,,.,-f-My .Am ...7 1 4vR4f13LZUiWI. MII' ' M W 4. 1 hiiw'-Q Xu M wtf., - ' HW ' 6 1 . i-1..,,..um,,b1,- A .,,4,..f ,M I M . 8,1541 ,.:,f.,- Aefl'.,h.,4,j, , .4 nq7.f - , H ,,1 , -. u M S.. . - , ff w M if f A f:F'v'mEw Y N '15-'f'f f 'f-' 'yi'51-1:-'wf.'..,fMf.W W W'-ww . K ' .. 'GEF -V P' 1- ' ff V: . 4' Sy - Aff .-1,,f-'- , ..,3.' ,,,,5qf-'.'5LR:,- !1.,3-qw.. ,gp-.ga,,V.y-f,,.7.L-.f,7q.-ii! X Mn. . 'H 'M ,O W 4 ...gg ' - fmt - . ' ,i.2bFfw1'-fzfei.v.'v'gs,j5.2Gg.:arw:1-Www... 49, . .' ' . 'W' Mfkfarlr4ma...fff'f:,'a f4v'vifawzwffli.zfi'wr.wflmffywzcmzwvfwww..., -X4'7..f' V 1 3' WW ' '11.m:-V.-am. ' A rv: '- MM - . f '..L.rmw,.5:.- 'cw 5?X-uw,,'qm?zvg..:,fy. -,'-,Q-www .,,'P1f.'g.4uy :gh Mm 'fm 1 f ' wr-4..., .Mfr :fu-.'1f.3r'1 lfwxiw' mf-'WYE-.'1m'c',511'.ZL., :ff 'fi L TY , ' WM . - W ' L-W1-:.f:wicA:iL?Q'gg1,f'f ', :,:,5 p1'.,,,M - 1 N -. , -1-'fM4.zL.4LQ.L5. Qiw'ff.Q 1'7'w3'f1 ' ...kr I V ....u4fgQgjJ.iElQ 3.11 'V I A 5 -ii-l 3 nun I Ill .'.,. I sa ' fffacfg l 2 4 I 1 J? , l ll I J, 232 l V .':3'?,3ff!5 r f l ' I 31: L ,df-Hb jj'v.': 3:2 ' .Mx 3-ff' 'lull N.f',17 ll.-Q... ' , , rn' 1 r M 1. ' ' L ' Q . .1 J ' R 3 .f viii-ff' Taylor 1 V. B. Perks Secretary to R. Albert Admin. Assist. Hard at work in the Assistant Prin- cipa1's office, Mrs. Harbach sorts cut slips. Stuffing mailboxes is so monotonous! Mrs. Carey, Mrs. Ryan, and Mrs. Dia- mond keep the staff posted on goings- on at Harborfields. Can anyone decipher this scrawl? puzzles Mrs. Perks, hard at work on yet another memo. .! 4 'g , . l I, M. All ' 'ure-. A '12 R' . if . 1 l ' IQ, !,,,-yr ,Li N 1, l -cw . r., f . ffm.. XJ 1 '. ,5 ','Q,' f ', ' '-Fifffm' 'R J if '22 '-A1 P 2 x..f fl' il I. Garvey F. Else Asst. Principal Secretary 'L it P' 'JIT' ,1- M .ga . l S. Sulowski Asst. Principal 4-.., Y f :,'?s:J. .rl 2 X35 .. ..,. if Vg., A . 'ln G. Harbach Secretary A2 h . Wfwsang 76 ADWNIS Anon 5 E Green Perks shows us Its tougher than you Mrs Diamond tackles the papers to be E- Butts M. Ponzetti TEACHING ASSISTANTS I. Guido D. Mitchell SECRETARIES fiffitf fiz M- a 5 X 15, 11 .13 ' I P. Kirschner OUR ADMINISTRATORS run the building, keeping everyone in line. But for all the details, see our SECRETARIES AND AIDES Our secretaries and aides take care of everything from typing up letters to the district to copying dittos- to doubling as mail sorters. How would we survive without their help? Let's just hope we never have to find out because we ap- preciate their presence very much. Secretaries and aides, WE SALUTE YOU! C. Smith ' Y 5 .1- f 1 'Y o :ff 5 N' ' .IA I. Leibowitz I. Montaigne TEACHERS AI DES IGS x?:5',i?,?.fg:, S f. 1 fs x 1:'l5V'.4, K ,J I 59 J 'W , .1 s . u ! w 1 in .,,,,,.., Q43 .,..,,,-,.,: P. Carey V. Diamond MAIN OFFICE 1 -,, .ig 1 X I '1 4' aff.. 2 , L Q Y- Ili H , 1 f s- ' .' l I N, f .54 +7 1 M .J ' i 555 I 7 1. in Cui . O98 - Y f M. Lomangino M, Ryan SECRETARIES! AIIJES! ASSISTANTS! MAIN OFFICE 77 78 LIBRARY ! MEDIA LIBRARYIMEDIA CENTER In the south end of Harborfields, there is the Library. It is a great place to do serious homework, research, or to just sit and read or write away from all the noise and confusion of the usually crowded cafeteria. Although many of the students can admit that they don't know where the library is, many students can be found there every day. lust off the library, there is the media center. You may have seen students as well as teachers pushing televison sets down the hallway and many of us have seen movies in class. These all come from the media center. Some of the sports and other activities such as plays and special programs are video taped for entertainment as well as observation and study. The Library and Media Center provide Harborfields' students with playbacks of past plays and sports events, as well as turning a long 40 minute class into an enjoyable learning experience. Mark Fredrick and Matt Slear do their homework in the libary together. A busy day in the Library. Hectic and rewarding for those who are working. Miss Phillips demonstrates dark room techniques to some photography students. This is one of those good times to go to the Library to study in peace and quiet. .Lt '24 4 h, 3 f .J Periodical room is also a part of the Library and a good room for research papers or just to look through the magazines. 1 1 ,.,. , 'ff f Q -fwfwwf x Ev. t aw We incl' 'i,15:y'f .I l '49 T J V? V4 D. Pignello B. Domjan I- McKenna S' Phillips B, Springer 1. Woyciechowski S. I-Iorlnrvlzitz Chairperson I LlBnA,hvfMEnlA 79 When we fall down on the job, they're always there to pick up after us . . . especially in the cafeteria. USTODIAL AFETERIA TAFF Very friendly and always plea- sant to talk to describe the ladies of the kitchen. How many of us would make it through the day without some food from the kitchen? Thanks to those ladies who cook and make us not only lunch but breakfast too, we don't go hungry. What if your locker is jammed and you can't get it opened, or even worse, if someoneelse has their lock on your locker, what do you do? Who do you see? Why, thy custo- dians of course. They are always to help out and easily make friends with both teachers and students. Needless to say they are a great help to us, and we thank them greatly. From the flowers by the auditorium, to the garden around our school sign, the custodians do beautiful work. S. Drozo D. Ray w- - :wav-V l,.i, A . 80 CUSTUDIAI. STAFF M, Wujick D. Conway ll at .. ff'-' . if 5,1 5 X , 'fw .0-L CAMERA SHY - D. Shipman, HEAD DAYTIME CUSTODIAN .Q Q 5 , - DIST. SUPER. 45 E1'If 'W7 ' ,.,..f.-.W ., , , ,. . 4... .s , f .,...,,,.,.. .... 1.4-4. R -. -.1 , g . f :-,,,: , ... ,W iv x L 1. ,gf , ,, 2 ax ,rf 4 ' H. Z!!! ngwvi WV. , 'Vi I, ' 'U 0 457' , ' I, V ' as . f 1 Gleaming pots and pans amidst butcher block and cast iron . . . A beautiful working kitchen. This is not a NYC sidewalk! It's hot pretzels at H. F. YUM! Qi , - I ,j i 'Af' k -UNMMUS' E. I, jd, VV - Y From Left to Right: Pat Seeger, Connie Dovi, Toni Abbetiello, Ioan O'Lough1in, Amy ,'.-.AA I Argentier, Edna Iohnston, Filomena Piscatelli and Barbara Vitarelli, Manager. r V 4 1152525 ' f. :sizes I -is zfzfzfz iff' fgsgagag I 4,311 2:11:37 4 ' 4,55 'hi A, 231:15 v -'fy 4 ,fr--'V-' :-:-:4:- , 'f Cf . 31 EEEEEEE' 'Thi' 'L 92-51-- CAFETERIA STAFF 81 552555 YI IIN 7' :fill I 1 J :-:fr , ' 1, ifffiii I I A 11' :5:3:l' i Y 1 1 ' il, Q ,Z 5 I ra' '1, 1 I . 4, 6 is v 'Y 1 fn 7' I 'V ,Y l y . 4 1 f .- . ,lf 5 . , v , 2 i fffi .L EA-it - I l Chairperson l 82 GUIDANCE From career to personal counseling, and everything academic . . . PUPIL PERSONNEL SERVICES Every student in Harborfields has one of the C6-7D guidance counselors to go to when they need help such as dropping, swit- ching, or adding classes. The counselors for the seniors have more to do than normal. They help the seniors with selecting and ap- plying to colleges. Guidance is where students get information for tests like S.A.T.'s and A.C.T.'s. But Guidance holds more than counselors, it's also Where the Psychologist is found. Dr. Aumiller takes an interest in the school far beyond his job. He has been seen in the last P.T.A. play and many of us, if not involved, have heard of his discussion group sessions. All in all Guidance is the best place to go for personal, social, or academic concerns. 1? Harry Williams, Linda Zimmerman, and Sandy Boccia clown around while waiting for their appointments. . ,- f ,fl 9 Why don't you go ask Mrs. Coker? ,ffl W Mrs. White tells a young boy. i jill Koenig talks to Mr. McCabe about dropping a class. l . vveqg lf 1 U 'P ' lu bla , - x i '35 ' M. Alper E. Carey I. Malone I. Moden GUIDANCE COUNSELORS 11. , . f, lil TITYQ1 -ff' ' ff -ifzsaasssgifi -. .1 A H. Murray Wolfe , ,f V 7 I , , .4 ,,.,,,z , . ,,, ,, ,-,, 5 ,V ., , fi.,-gi ,V . , f 1 f I if I I ,f f Kg, 49 ff f , 5 ' , f ' , L ' f 1 , 4 9' 1 'vga O . jf E 617 4? '4 i . Beyond the call of duty every day in the NURSE'S OFFICE Whenever I don't feel well or whenever I need anything, I can always count on Mrs. Miltner, commented Senior Darren Brady. The nurse's office provides bandaids, ice packs, and a resting place for ailing students. The comfort of air conditioning in spring and heating in winter make the nurse's office a popular place to loiter. Mrs. Miltner goes above and beyond the duties of a school nurse. She endures the confu- sion of organizing sports physicals, giving eye and ear examinations, and takes measurements for the Senior's caps and gowns. Mrs. Miltner added, The only way I can get the Seniors to come in for eye and ear examinations is to tell them I need cap and gown measurements. 1 - ,, IL- f:i E Picture , if 1 No -5 05 Q Available 0-rw X Q ' U Q , V- I I . I I . 4' J C. Butler B. Coker P. White G4Aumi11er I- Halpem M. Miltner I. Dono GUIDANCE PSYCHOLOGIST SOCIAL WORKER NURSE PSYCHOLOGIST SECRETARIES GUIDANCE I PUPIL PERSONNEL 83 1 QU 'T' 'L f ' WMD ACMV 1 ex OJTYVOQOO' Awydrg 5 ,N Q. 'K Lice V XZ' at 55V m .HL iflwff' of GQ ' 2509 , W sqm QDWZO Dfw fy ' x -.f t K .AY 1 5 A , . x. N K X I ,Q A - bet - -1 I NDT-J Mwg' L f EVM7 pi elm . 4 bg X V091 f DQ fgvggii Ny 'A U' ' 1 bww G' ' r sQx,fOG Um CMM 1414127 VZEF3 4 , X M254 iwq 0 fd! 6 L Mez X f ff M Qfw diff!-?gff1:. LW 44 UQ- K ff QVNLQKS gjQ,fV ' N XX KJFCL, f HG- Q15 Coward V' 9 A vs V439 If MT My JMMQ, 'Yxozf C5 Cb! Xw A Jw Im QQJSLMQ QWEX QA Ml oulfgixhxg 5500! X WQ Q QNQCBINXLJ QL, 'Xb 32115 'QZQM QVIA 3091 QKNQXFC 55 Q MUD WOW YOCA ivtrfj 210400 Xu wx wok ,y pveifxfxfix Q5 Wm ma QMACQWQNA CA gyldg 1001695 Q0 X Qwffxi Q 5? W7 0043 670191 umfl an x M K YQ fm W fm XW0 W 4,4569-NWA Q, b HLYDJ fl S02 50 WAQW XXX X' xx Y S Samrwf Q4-Q LWQ RMU fp H1 Cf Cgf- Q0 pm W 50154413 wen 5,26 R J 6 L Ci Q0 K xi 4 fi ff-W A wx If WL P Sf' Cilnclf wh T2 A 0 DX K VNU Wd, C +' if Lf AZN' faffff W 2 K M059 1 X s kg famfif U 60 W QM DMA O W6 rum' gf bbw W ,, A, ' M I-K ,?Pgl, g f 1 ,H ,lx ' f . 1 L, JQWW A! 'fy L V .ivkglmgv D C1 f Q, . X Jw, 0 ' ' A, fy uf- K if I 'FL -- YOU CNC Cx K'E,uXXY1fY,cQ 6 93 fx ZW! .TX+jufL IQUX ujifi-I 7 My W wx M MMM NZ! 3 lmxfsuf A ydmwix N UQ f' KMA 'XXV' N 'X YOJN fifw- 'fowgqyw .Luv V . O as Q I F H X ca , W 1 VQL2 ' NUI -F, ' tf NX ef ,f X5 Q! ZX fx. ' U x A X .x Q! V Uk? . 4 X ' in . fur , N, r I , K f' K X Q QQ? QQ .Ni QD 'Ci If WX-Q N KW U7 YOXOL nv . ' W J ' ' ' X If O fa xg? g .md A V . , P 1 1 -N q' ' Kr' Q O RT? . K I. Jxxxw L jx A Q X ri A N I My ' ' g . ' f , D ' ' 1- Sf- , C3 affp , Q WX .Y - ' , ' W H1 R QV X. x ' 2 f ' --1 iii? A if ,, 2 ' ,. .fb 1 G 4 Q V ,. Vf iii XPQXJT, , -on ' lg A NQM ' 1 V N' -ff X , 1 ' t - . CW' 'wk OC XO U X C Q VKX ----A, FD 2' , ,I I' x C ' ' 7 nf ' 1 , YT -51 OJ i b R,JrOX'3L ADR' YJ DOJ? X .D - Le RY 'XX ' 0 1 ' ' ,ff I . ' ' - I ' A' J Q 5 P-Z 0 ,, R so f v A , A . M is f - 84 2-Ck -4 I 1 2' 7 I A 4 A Luz? Qcblpgfi , . H585 Rf ' X my sw f by fb vip lwilf' Qyfggymfffwgh . A XX xy ' Q'-53N v 5 vp Ogypgbgypgyyy QEENQAEFQ5 55923985 wb A wk C, 5 ,Y Nwifwgi Wy My wif? fb QFD R Q xxem Www 4,...?5 ,t.1.,'Z,.ma.. U ' A NNN .bm Sxtbsaijxxs-R W Q5 sax W. iibgiaw f ff N 'eevekwffzxizb -7 NY'7 Wfw QQ em wwe vw LQWXWJP og gm WMfffJWiv'15 'xT':b 'ZY'N J WSQQQNW' W WMMQMSMQ - MPWW W vw Lqxglvab skdiik D Belgelbeck B, Keenan K. Kemp I .-. . is ll , znizgliz - l M. Collins C. Attanasio T. Busch A. Buffolino K. Curth K. Delong F. Douglass M. Emmons K. Foret R. Frisina I. Harris M. Hobbs N. Iohnson L. McClorey T. Melrose I. Misilewich C. Murray D. Picciano C. Reynolds S. Sandt K. Sanford M. Sarcona M. Trainor I. Viteritti H. Wallower K. Walsh E. Bacares I. Bambauer I. Bender I. Berg R. Cornell T. Donadio K. Dverwald L. Guido T. Harewood I. Hartnett H. Hunter E. Jacobs I. Leonard R. Moore S. O'Brien L. Pepper T. Quiles C. Silveri D. Stevens R. Stevens S. Storz B. Stramara S. Tyska A. Baptista S. Barber P. Bekatoros B. Bertsch I. Bonfiglio I. Casey A. Coloccia K. Crotty A. Domencetti I. Donno J. Donovan K. Epstein I. Groccia K. Gullotti M. Harris M. Holzburg S. Itsukaichi I. Jones A. Kotel S. Martin D. Misilewich W. O'Conner C. Pellicane T. Reynolds L. Sabbatino M. Stiller D. Wallens D. Walter I. Zwing 86 FRESHMEN W Vl,,,, 'iii'-f, z., Q 52 7Qzf:e3fLf ,. ,V ZZ., nl v-yjwmr, jf :,q,fgC,'77 , 6 . 1.1: ,nn gk M , 1, f 4' 1 A. Mattia N N. Reginald X F. Schluchtner , D. Sholcnop Q I. Stein Ieff Shade anticipates next period's math test. ' ww v . .v W uw :fav V , ,JP I I Hi-. J .e.. .N 11-'A+ ' . . , .,a,, 1 - - .. f - .1. . , Q: ' A .7 , r I. , 411.35 1. I f ' 1 I- .Uv t it . 'il Xl I .. 1 1' 'F V it -'-, . g . . , 'L,f3l5'l .I .7- BY HMA., ,.' 'f ' f -- . H V A I.: ll l -..1. 1 . . hd! u F Fl 9256 ' A ' -rf 1 y t l . F E, O me.IHT. ,' -V .. I I ' , I f . , N. ,H -xg, M5 ' ff-4'f ' . ,. 'T , gt -A 2 . - ,tvs ,-AG: .IVE --If . I ..., X41-Q ' , 4 Qff, G If at ska. gym ,. K 'Ms W Freshman brushes up on his ping- pong during hrs lunch period. M. Albertson J. Anzalone K. Baker I. Barton C. Botsko M. Calamari C. Cannon H. Christophides I. Curcio C. Defour T. Dixon E. Friedman S. Fusco S. Gardner M. Goldfeder I. Hartnet C. Hayes I. Henrikson M. Huelin E. Johansen A. Klinger I. Kwiatkowski A. Metzger M. Nathan S. Rao G. Ross D. Strong M. Traub L. Welsch E. Williams C. Alexander E. Aronowsky R. Balsano C. Browne S. Collins C. Dovi I. Ewen D. Falk M. Feinstein E. Fetherston G. Frankel C. Galluscio L. Geoghan C. Gillett C. Hajagos M. Kirschner K. Knoop G. Kott B. Lepanto R. Lobosco K. McKenzie E. Meneses K. Morrison A. Roemer R. Salina I. Shade P. Suozzo L. Weisenbloom A. Winges D. Anastasio G. Bakel R. Birch T. Campofranco A. Dempsey D. Gilmartin S. Goldblatt L. Grundas C. Iensen S. Kennedy I. Maher R. Mendelsohn P. Monahan P. Morotti L. Neville K. Palimeri B. Procida M. Pullis I. Schooff A. Sochi FRESHMEN 87 Patti Suozzo stays in the cafeteria eagerly waiting for the time to go to first period 88 FHESHMEN I. Beck I. Cunnin ham I. DgRosa D. Dunnell I. Hansen S. Harris K. Koza I. Lazar I. Pavlik K. Roberts C. Scola S. Stewart G. Tischner T. Berliner L. Byrom D. Croke D. DeLucia F. Diekman R. Dornfeld L. Fusaro A. Heiberger B. I-Iynds K. Iohnson G. Iones L. Mehl I. McDonald P. McKibbin D. Meagher E. Noa R. O'Brien O. Olenick K. Palmer R. Rome R. Ronda W. Slamm S. Uebele F. Berwind M. Burke D. Cooper D. Creamer P. Davis M. Fitzgerald C. Hawkins K. Iohnson B. Kelly N . Kirschner D. Krantz I. Leffingwell B. Lepanto M. Loper L. Mann V. Marathe K. Mark S. Martin B. McDermott R. Miltner L. Prives S. Richardson G. Schuh R. Suris T. Thorsen ' 1 :' - -i... W7 it ri.gu..l-- ,I Q A yt I pg ' A K j 'tlffqnrh j IU Xa. Ll l wo' v----.. . 'V' Q, ..,,..,..- ,.,..,,,..... fu--Q-....... - r--W -ee-, . f ftullsu-1 I J '5 1' f- nn- ' 1 1.-. .,.. - riva- qo--.-..... . Y' T ' '- F' 4- , W ,rw 7 vnu-nun-un. ,-.........,. . , ps---,., 9, 1-s-1 r--q..i INV- you-Q ,-.,..,,, - r-W... . , W.. A-....... ' 5 .W fliugf- ri---... f--f-8. I .13 X e 1 .A , azs -ci Av - ,W ff: .. N vi 1 .. i if - I 1 fx 1 x f. 8Hu::.n.. F ?'. slain... , 'T' fun-lui, gin... 'pp'- if 5 4 5 , , r 'i WE. K. Bookhard RJ Q C . Clark B. Conroy R. Del Mese P. Dwyer G. Fudens E. Giroux A. Milsky D. Labadie I. Leppert A. Libutti D. Marshall L. Marvin A. Megaris I. O'Brien I. Panettieri P. Piotti V. Pizzonia A. Stanford I. Stevens L. Stratton D. Tellerman V. Turner M. Wadsworth P. Calandrillo C. Cancemi C. Fischer R. Fleischman M. Gallagher C. Gillett J. Gold M. Gonzalez M. Griffin M. Hasenstaub D. Horan K. Hudson T. Iefferies G. Lail A. Mayerson L. McGurgan S. Miller S. Nadboy C. Nystrom C. Panagiotopolo B. Poppe A. Salmirs I. Salo C. Singer M. Slippen I. Steinhaus A. Viteritti M. Wahrheit A. Cheng P. Conlin A. Endler M. Fendel K. Forte V. Frintzilas N. Heller E. Hickerson L. Hilgeman B. Iennings D. Kirkpatrick M. Lynch H. McQuade E. Pooler D. Raguso K. West C. Wylliams Tracy and Leslie look for table in the lunchroom. an empty gil FRESHMEN 89 SDPHO GRE I. Allen N. Ames S. Burke I. Hart M. Iames M. Page D. Prescia R. Ruggiere R. Scola K. Thom son A. Washgurn I. Allen S. Bonavita B. Brown R. Carcone K. Collins R. Fludd I. Niemczyk C. Rousseau C. Satterlee R. Sherland E. Skodtnielsen V. Aires I. Argentieri A. Balkan C. Blanco A. Burke B. Clark D. Datz P. Dossantos I. Esquerre H. Gatle S. Gerweck D. Herbert H. Keilty C. Kohler M. Malone E. Mooney I. Perino T. Pickerell I. Silverman K. Solimando V. Steets D. Walker I. Ward K. Waring A. Wrissberg 90 sovuomumss - '5g,f ,fa ' . -e .v - ' .- K ' -fl . f - Q 'W VY? - .LA , ., ,.,,f mfe., ff.- it-toil m0U ' QW M3 wax cpl Q CL, G. Ancewicz M. Campbell P. Bakel L. Carillo C. Brown G. Cavanaugh K. Fusco I. Cook K. Harvey M. Froelich S. Henn K. Gibb C. Iohnson M. Gibbs C. Kamhi D. Grattan A. LeBrando C. Kent L. Moon L. Kochendorfer M. Pastorelli C. Lewis M. Robinson L. Mozzone G. Rohloff A. Nickerson D. Sperber A. Pukke L. Thomas I. Rodgers T. Tomei R. Rzehak G. Villani K. Sandt M. Woodall R. Sweene M. Wronsky G. Visicll C. Appoldt S. Wenner A. Baur E. Armet I. Como C. Bernstein K. Denu N. Bredin R. Dio L. Brownstein C. Feeley L. Dissler R. Fenderson S. Egan C. Ferraris P. Endres V. Goldfeder Z. Greene R. Grag T. Hackeling M. Guttman E. Hartman K. Haas C. MacMillan P. Heitman C. MacMillan S. Houston K. McKee T. Ittig S. Muscatello C. Lange C. Nichols A. Kott I. Paradise T. Lefkon R. Paris M. McDowell R. Schellha S. Naples S. Woo C. Pellicane I. Rezabek I. Woodcock S. Sullivan D. Azzinaro K. Swedish I. Blackman W. Thomas E. Callejo R. Veitch M. Carlin O. Verrelli YN '7 ' 1 .1 rg, Iill Bentwigna and lab partner 'nf 1 'lit 1 v , y 0 1 0 ,A 9' , . 'xi f O Axvl Q .VV ' I JH .r f,.. an um PO 4 exehange notes to a Biology lab assignment. P. Baker I. Delzotto I. Beckman C. Dooley N. Browne C. Galasso G. Cira R. Gerard A. DeLucia M. Gradel V. Gerardi P. Iohnson I. George I. Kellershon K. Higgins P. Knorr S. Iarovsky E. Mayer M. Kasa M. Men ler P. Lewis S. Meyer T. Mccrensky I. Piscopo G. Meaney I. Robertson A. Millon D. Robinson C. Oakland D. Schaffer T. Rhatigan K. Sordi K. Stevens C. Sorrentino C. Stiller C. Stratton D. Vagnoni I. Barra C. Vulcan D. Bookbinder K. Werner N. Caldararo D. Weyhreter S. Catandella K. Wille M. DeRisi S. Wohleking K. Baumb M. Bender N. Blue M. Bretner L. Books M. Carey I. Botsko L. Ciafardoni M. Brummer C. Colasante R. Clinard D. Depalma S. Dorman I. Donovan C. Fichtel G. Donnelly S. Frazier L. Fox R. Grundas D. Freidank K. Herbst M. Friedman I. Irenze E. Girouard W. Kennedy K. Krogmann R. LePanto P. Miller M. Mobyed T. Morra .I. Riggs K. Roberts T. Rosenblatt D. Soteropoulos S. Williams 92 SUPHUMURES D. Graulich K. Kustka R. Leas S. Neal I. Osias F. Sarcona I. Schoenfarber C. Suozzo F. Tantillo Y. Turner D. Varrina N. Vitkovich 4 f .'?.AJ Chris Iohnson gets a breath of fresh air while waiting for class to begin. Laura Fox checks her watch to make sure she's on time for class. Anthony Shade waits impatiently outside the library while his friend returns a book. W flu 1 lil 1 H3 x F , A , ,,t, . it N I. Bentivegna C. Bivona H. Brennen M. Case A. Cupit E. Donnelly L. Foley C. Gronbach P. Hewitt B. Hughes P. Koons L. Kushner I. Lefkowitz P. Lia M. Lombardozzi T. Luna D. Mashkuri I. McGowan L. Morales L. Rothfeld E. Schering D. Schnittman T. Smith C. Suchan R. Suris K. Walters S.Browne M.Davich I. Evangelista G. Flor oski C. Forman I.Gordon I. Harmon Q. Hu hes P. Iorfan G.Koravias B. Kogpy A.La adie D.Mayerson S.McGurgan A.Mondrone T. Orenland D. Piccolo K. Schuman A. Shade G. Small I.Tilden S. White K. Zisel I.Zweibel I. Camgbell S. Cric low I. Dore I. Fink L. Gallagher K. Greiner I. Griffiths N. Hughes K. Kane H. Leopold B. Moon I. Neder E. O'Driscoll D. Reichhold I. Sampson K. Schiliro K. Schindler M. Slear R. Wifall - snrnomunss 93 JU Ion I We're almost gf. p my there. Not far now. Thank goodness! I ':':t'-if '4 dwas beginning to far. think We'd never get this The words of a typical Junior. It's understandable. Iunior year is probably the hardest year of school. Things are changing fast, emotionally and scholastically. It's hard to keep up with and sometimes you feel that there's never going to be any relief. But, relief finally comes, and you don't know how good it feels. Keep your chins up Iuniors, there's only one more year till freedom. junior, Tracy I-Iackling, laughs with her friends during her art class. Pat 0'Conner avidly studies for his upcoming math test. Kim Marshall enjoys the warmth of the sun in the cafeteria on this cold day. -Q-..-.se Q 94 JUNIDHS Did you get last nights homework? asks Rob Uebile Mmiilun 49 sl z , ,MQW I. ,i I .,f, ll-A Paul Ammirati Marcy Aronowsky Kerri Barter Gmger Bender Nancy Beyer Charles Bzvona Rrch Boettjer Bruce Branston Audry Bred1n Scott Breger M1chelle Brodeur Mehssa Buchberger Odel Burke Iames Busco Eva Butler Susan Byrd Theodore Cam Anthony Canceml Dawn Cannon Iohn Caraccrolo Barbara Cavahero Suzanne Cavahero Iackxe Cavanaugo Nadeye Celestm Margaret Chapman Lorame Chrxstxansen Lxsa Chr1st1na Kelly Chnstophxdes Kxm C1ra Mrchael Cod Steven Cohen Kevin Collxns Davrd Conklrn Karxn Cook Todd Cook Dana Cookler Brendan Coyne Anne Cuggmo Donna D Anr-a M1chael Dalton Enc Dav1s Kate deGroot Davrd Dell Acc1o Audry DeMadona Dorrunrque DePalma Iohn deR1s1 Kurt DeV1nney Ienmfer Donnelly Kathleen Donohue Drane Dooley Alexandra Dreyer Kevxn Dwyer Mxchael Emhorn Laur1e Engelman Educ Engert Thomas Everxtt Term Ferguson Henry Ferns Iane Fetherstron Kathy Flanagan Matt Flanagan Morna Flanagan Mark F redr1ck Rodney Frexdank Iulxe Frmtzrlas Davrcl Garbus Tarnes Garner Iennrfer Gerger Chrls Gennarelh .l . y Kristen Curry JUNIURS 95 Jason Gerber Davxd Glbb Ellen G1rouard Jeff Gonshak Anoch Guffxths Ty Gronbach Dean Guarnashelh Momka Gulatx Jamce Haem Kell Hallock E Hannon Susan Harbach Chnsse I-Iarnos John Hart Jenmfer Hecker JoAnn Herd Mxtchell Herman Davxd Hernandez Mmdy Hertzon Paul Hewltt Alexander Hochhausel Mehssa Holland Brendon Hopkms Pat Howard Charles Hudson Rodney Hunter Tlmothy Intermann Clxff Jackman Jon Jager M1chael Jenson V1ck1e Jor ensen Susan uhano Tom Kean Ter Klernan Beatrix Klema Wanda Knox Jon Ko p Matthew Kup a Beth Kushmck Kerne Lamgan Thomas Lanzarotta Bnan Larsen Matt Lattanzr Greg Lawrence Jeff Leary Kunberly Lettns Laurxe Lockwood Denme Mad1gan Krxstzn Maher Nancy Malone Jean Maloney Nancy Mann Steve Maman Kxm Marshall K1mJ Marshall Mrchelle May Mark McDonald Joe McGu1re Jokayla McKenz1e Kelvm MCMIIIIHH Lance McQuade Rosemary Meehan Nero Mehta Robert Mendez Denxse Merdon Mxchael Mrller Robert Mooney Constance Moore John Moore L 1 Steven lgrkoatrick E 96 JUNIOHS Iim More Dawn Morell Suzanne Morrissey Andy Mueckenberger Tom Murphy Ioeseph Muscara Naomi Nelville Charlie N orwesh Jennifer N unes Iill Nussbaum Patrick O Connor Bridget O Driscoll Brian O Hara Erin O Hea I X I ' l J Vinnie Ohenberger jennifer Okin Mark O'Shaughnessy Gina Pavlovich Dominick Petrosillo Peter Picciano Bob Piotti 51 5 . N my YN 1 JP' Iunxor Eloise Saltz talks on the phone during her free period. Iunior, Lance Mcquade, works on his math homework while Mrs. Graber isn't looking. Q, D., JUNIlJHS 97 W , ffl if Debbie Pianz is Mitchell Protass M W ' Genevieve Pullis if ' ' 9 ,- QQ Heather Pyke Il W kr Roberta Quinn 2 ' Marife Ramos E Kevin Reuter w ' 1 A Iohn Risebrow Tracy Roberts Ian Rodgers R Andrew Roth W Claudine Rousseau Vickie Royals Larry Salice Alex Saltz - Eloise Saltz - fl ,-1, Pamela Sampson ax, . if Kurt Sandt ,y V V g Stacey SanGiovanni 4: gf f ,fl ayme Savino 5? E janine Scarabino 'L .X 1 ffftkv' I E Stacy Scarduzio Andy Schmidke Christine Scholz Iill Scott Ray Scott Paul Sefcsik Christine Shanahan Laraine Sheere David Shivers Kathy Shkinder David Sim kins Sharon S ahill 'M' Kerri Smith Stuart Smith L-pl David Snyder Kei Sochi Nichole Sordi Chris Springer Ken Stack Chris Stasi Marc Stein jim Stellato jill Stern Iennifer Stevely Kerie Stone Barbara Strnad Robert Stukas Iackie Sundheimer Lunchtime is the time for friends to Donna D'anna passes the senior sit together and gossip. lounge on her way to English. 98 JUNIOHS Lesh Talluto john Tartaglione Sharon Tashman Barbara Thompson Sandra Thompson Ethan Tomei R1c Trotta Robert Uebele james Vaughn Charlie Veitch jack Viterittx Robert Vollmer Monica Wagner Katie Walsh Seline Walsh Tracy Walsh Ier Walter An rew Weis Mollie Weiss Michelle White Suzanne White Karin Wilhems Andrew Wilson Susan Wohleking Lisa Woodhouse Rashi Woods Gail Wurnberger Claudine Young Kellie Zarnmit Maureen Zubil JUNIOHS 99 SENIOR ..i The End of the Line . EW Isn't this great! All these responsibilities! And no one to tell us what to do. At least I L R no one that we'll listen to. So many privileges. This is what you might hear a senior saying. It's not all that great though. Don't let them fool you. Along with all the great times and feelings go the bad ones. After all it's when you're a senior that you get all the heavy responsibilities: filling out college applications, getting senior license, becoming a legal adult. But, ofcourse, it's not all that bad either. There's the Prom at the end of the year, underclassmen looking up to you, and of course, all of the obvious everyday privileges. But the most rewarding throught that a student in his last year of High School has is that it is his last year of High School. Not that we didn't have fun and learn a lot, it just feels good to be out. But we will miss you Harborfields, and we thank you for many good years. Dennis Keenan, Ian Adrian, and Mike Montaigne take a moment to use their privileges as seniors to lounge in the senior lounge. Tom Abraham Lauri Adelstein Natalie Adragna gh Ian Adrian lx cf- g John Alberti Ray Alburg i N 'F Carl Albuquerque Kathleen Alessio V' Christopher Alfieri Craig Aliperti fe, Ianet Antorino 1 Ann-Margaret 4 Ardito 100 SENIUHS l l Fic'2?!P'z ,:- J X' '.. A ... l' Sir, sr-Y AN? XJ '1'1'I7' l. ? SL, S. Q 0-'N QW H3 'Vi gs!-ea . va ,g, I ff, Senior Natalie Adragna twists and The Homecoming Queen candidates take their last ride around the track before the game begins. Debbie Schmitt and Beth Fornuto enjoy their lunches as they help col lect food for the food drive. Kristin Asher Pamela Bailey Jodi Balkan Laur1e Balsamo Stephen Baudo Michelle Benitt David Bertsch William Bertram SENIORS 101 Stephanie Berliner Jay Best Sheila Blue Sandra Boccia Barbara Born Denise Borneman Andrew Bosak Tara Bosch Susan Botsko Chr1st1ne Boyer Darren Brady Andrew Brown Demse Browne Iemne Bruno Joseph Bruno Karen Buswe1ler Darrrn Butler Mar1a Byrd Stephanre Caha Ieffrey Cannon 145 W'---vb X' an -...A-'..4gp ...NI avg Nl! TI? 'I r Yf f . B 35 B 'NP CIF ,Nil 'ivy .fd W Nl' . lf ',L, 4 102 SENIORS Rlchard Capnola Kenny Carcone LISH Canllo Iohn Catapano Chr1s Cedfeldt SOph1a Ioe Cmllo Phlllp C1ement1 Mary Chmo Susan Close Kenneth Coen Shan Cohen SENIUHS 103 Veronica Collins Stacy Collman Thalia Comninellis Margo Conklin William Conrad Tracy Cook Christina Creamer Carl Curcio Kristy Curth Chris Daniels Donald Daniels Lawrence Davis Remember When Bubba cleaned his truck you didn't get structured for cutting two classes Senior girls went out with senior guys we were all friends Jill Hickerskn was a prep' we were Freshmen at Oldfield Charlie drove safely Mr. Benjamin broke 3 rulers in one day Classes were cancelled ' the Seniors had good lockers the roof leaked we got proofed Jodi sat down and broke the desk in Spanish 5 104 SENIURS -e GJ!! fx I - f?jg'ii Q f j i 3 ? D ,fast ' Elk mmsfzsi ,. llmimsau s'i s - QAA, KI 11- ' W'- ' PQQ ff, Ll' X Qgy! 'IS' H MI' Q Last year of science and then Is this the life or what? - asks Senior Thalia Comninellis. Linda Davis Lisa Davis Todd Davis Kristine DeCarlo Cristal Delk Donna DeRosa Iohn DeSantis 4 Iames Devaney SENIDRS 105 Christopher DiCesare Susanne DiFede Chrissy Dissler Karen Domencetti Barbara Domlan Christine Dore Adam Dornfeld Susan Duerwald Memorabel1a Indeed I'm busched caught a bad one word em up! ooh no well get down Seymore did you get proofed Whose driving tonight slide off smegma Quiche do it up! it's hard for her could you die? party animals! thats rad blow chow cool, deep and heavy max out fresh shotgun! that's gay! yeah right! its casual lets go crazy 106 SENIORS 'Rx YP ,fix X! --I ,J ,.,,, , , ,L V-N' X fr of I A 'NJ fs--1 .f 1, - -4 -'Q' Q K as 12 fix J-4 f-f Q34 xr ls Deborah Dwyer Krrk Elcher Carlton E1nse1 Cam Elkerton Ellen Ersboll Matthew Farrell Lawrence Femstem Bob Ferrarls James Fetherston H1llary F1nk Kevm Flanagan Amy Florkosk1 Beth Fornuto Ilene Fox Marc Frankel Frank Franze Anne Fredenck Anne Frredman Chns Fr1s1na Margaret Fusco SENIOHS 107 Verb ' QQ ' fx A aff- , 7, ,' 5 1' l ' li lf ' 'l WX ' ii, 3 , 'NA 23 n ,r fr X ll 'A K f ,- A J., , 1 Y X -' 1 l.,,,lLQ:I X L., X if fx ill X K l '-1,1 Q Q i lt QQ X lx ,V V, lf 'jx 1 ,mpg 1-e,ffx,,,-,., U J eg, xy ' , .N-I., ,J V ,D X, L .,,, . is V l , li A .. ,FU X. ,ff i fel- , , vw .-. ,fe Aix f ' I ,J 'fo--Jlgy T f ' 'l r, fm, ,fm '.g'fy,,,.l -' ll MV? V , s 3 J, if 'x ,f H, x -H fl X ' so ld lwyb, V H 'x fx, A 'xx-X! ga, 'R J ,ff,qgl,j2r fs ,- ll Q1 F Nl 1 i '-if ld X.. 'sf' ' V ffmh C , X N fir ,K 1, A ,FK ' NE- . . A fp fel ,l if if w 1 if m ,ffl wif' Wlofwz, C pee' Q 'gi GET' QXVYJ M X ll lit, lg 'YJ fi Y ll 'jx' 'fx k-' X Q , . l. .K f I ' U l 4, er. Y fx 4---r A 2, ,MQ .V V - 'V il ff Tx f-N. fl 5? ls '1 lx GU llxjl Cie? 1 fll',YQN Nl i.A.ffq'f RX P' 'fs ' ru 'lf 'li 'J 4 fl' 7-3 V ' l ' 'ii '1 self fi ' N f 9' 1 Hoff Y -. , x.x G , X -, if l 'l U M lx ,MN Q f ,f V r swf ee-'U as -of - he ', f 6 was F . A Q gee , -.,,f-N, , ,. K V an ., 1 A ef J are fi l J if LJ beau Q' W V X 4' W -J 5 Q -B .' '. xN1,,g,' ery '- X-' fl -Q -,N V ix, R.,9 M! EIS W' V CJ Q, ll 'Li ' NV! G' , r N ,RX F J k Xf X' A Turn W O px -+R 5 X, my had 1, X., w f R ,Q I if x ,J',f 'y Tlx QQVGJXTL Q, k 'ilj XY! ui- ,,,,LfsQvf U V U i, Ji Q ,oi 'Cf '-' G' F 'i 'V . wffxs-fffx fx ffjvffj 'bv 'u.f:u,,f Q ti 'X G Q. . ' 2 fd '1' .7-f' If' m i l' 3 if . fx Xb XixgSe.?'1Z i2l' 'WU' Kai? ff 'L 'V xr r lf' U J ,,, - -Zi., . - in :RJ ejfi- ,5- 1 a ' ,ne W ,fe -X P-F16 aelfgy - h 2 ly! if -11519 , gif, VIA 612 SEQ A be X -Q' P'l'Q: 'l1Q'XHfJJ Ah' RX fe, ,ax , , fn fl gyylg' l:l x X 17 fin SEV, jig,-Qi: 33fwL!R.jlLw,yE,f xg ffl 'UG' -r F .-Fir 'W My ,L fx ,flki 45, jg J ,,-5, 'C ?i,,,1gLi Miers C5 m E ifi'fQii'Vai C1GlfflQf5 elw'liw Qligfqlllf V bf' V , 1' .:eb.fg,, Wit ing! v qlqffsl GX J in Q .,,' 1 V-, i, fW:,,f Ggyik K, F? x xy? if -fl fl lllflci, ,AQ Vx 'fx IEA, G :YA :IKM Qfllfii ' Ad., Xlxl XX lu ll x !v H ll X551 U -M, ,, em ,V . 'X A ,G e f U - N i i G K 1 N ,- ' 5 fa, f fl x 0' 'J l jp f .fp f f, 'IR ffl 'Army J A 'll rx V Ly if ly ig ,J DL! J ,- fC'f 'Q G M5 .'gE,iwX 1 Rb X Seniors Beth Fornuto and Russell li ' v...,, ? 'G Q! Leggio are obviously enjoying the festivities of the Homecoming Dance. Linda Galati Mary Gallagher Jerome Gallusco Kenneth Gantt .W Carolyn Gardella Erik Gardner y Michele Gelfand 'Sarah Gentzlinger N 108 SENIUHS .Q-. 'f Yl IH., 1141? A-...Ns ,nm 3 'weft Sue Gilbert Robin Glazier Patrick Godfrey Mitchell Goldberg David Goldblatt Richard Goldblum Adam Golden Charles Gouse Karen Gregory Christopher Griffith Gina Groccia Susan Guarnaschelh Qi T 1 just another day of homework in This looks like a shampoo add to the life of Stephanie Calia. me. SENIURS 109 411 X- ,J 5 V2 Each year the seniors vote to determine which members of their class have reached the top of the line in many different categories. The numbers change from year to year, but the spirit and the tradition remain the same. The results are supposed to be a secret, revealed on the day the yearbooks come out in Iune. Somehow they always leak out, and much grumbling and groaning and reports of foul play filter back to the yearbook staff! In an attempt to answer some of the questions seniors ask when the winner is not the one they expect, this reporter asked this year's staff if there had been any problems. Debbie Schmitt ex- plained that the only problem was that voting was haphazard. Very few seniors place names in every category, she explained. The result is that some are very heavily voted and so, are more representative of the majority. Others are not. Sometimes they are close, but we've never had a tie that I know of. We're very careful counting them, and we keep all the original voting sheets if anyone is interested. Congratulations, all you winners! 'WF MR. AND MS. HARBORFIELDS Philip Clementi Meg Kirshner 110 BESTS AND MOSTS .ff .. fm 'lui FROM THE TOP: BEST LOOKING Rich Capriola Maria Byrd BEST DRESSED Billy Bertram Linda Davis CUTEST COUPLE Dan Meyers Ruchel Ramos MOST LIKELY TO SUCCEED Matt Ricciardi Ruchel Ramos 3 IW S ,?,, all ffl In 'N A -cry wvk FROM Tl-IE TOP: PLAYBOY - FLIRT Todd Davis Sandy Ward BEST ATHLETE Robby Rodler Sandra Walter BEST MUSICIAN Iay Best Christine Dore MOST VERSATILE jeff MacMillan Shari Friedman , frgrii? lr l X I lf Ln if-fri , iw J is 5:4-,-, ,A.: 1 . ' fV Q 1 ' ig FROM THE TOP: MOST OUTGOING Eric Rencs Lisa Racaniello CUTEST Kevin Flanagan Ienine Borno I Q MPM BESTS AND MOSTS Ill I Q figfgf r 1 YYTVJ 5525151 ' ' f !. -12:35 . x 5555535 . gg 25533325 ' f5?5,z7Ef 5555355 ' F f :-:-:-:- , 4-f ,gp 2525255 ?',.2f-A-21 5:5223 ..QyY:g.4, ' .1-55: ' 1 :42 54 I Kr1st1n Hagstrand Bryan Haluza Thomas Hancock Enn Hanley Ben Harr1s Kenneth Hart Dav1d Heller Ken Hennksom DHV1d H1ckerson 1111 Hlckerson ohn H1mmelsbach Dan Holmes James Howard Iuhe Howell Iamzle Hubbs Pamela Hubbs Lauren Huergo Dav1d Hughes Holly Hughes Matt Hulbert 112 SENIORS Q. 791 AU' , 3' - -.- l ,QW A4 14' ws,f' 'QV -Nfl' '7T 'vr YW? N-4 b NI' 111.7 , . Alan Williams and Chris Griffith display the two most popular ac- tivities of the cafeteria - eating and working. Debra Ianovsky Kyllan Johnson Christopher Iohnston Iacqueline jones Caryn Kahsky Kathleen Kavanagh Paula Keels Kenneth Kemp Meg Kirschner Christine Klerk Dennis Keenan Achim Klingman SENIOHS 113 We Leave Mrs. Melillo - rigorous Seniors Mr. Mandel a class of wise guys finally Todd Davis his license and a car Mr. Rice - dog biscuits Mr. Mugavin - smart variables Mr. Klein an O.K., whatchamacallit! Michelle - frizzy hair Mr. Miller a flame retardant class Kathy a full tank of gas Doc a class that reads his novels Mr. Grove a gyroscope Andy B. and Billy R. Rick Springfield Debbie Schmitt Maria Byrd and Phil Clementi are study partners beforeatest Kurt Knox Bruce Koch Robert Koch 1111 Koenig Kathleen Komorek Kevin Koppy Andy Korf Ilse Koza Janice Kozma James Kremens Marlene Kwiatkowski 114 SENIURS .l Christopher Lanzillotti April Lauda Christina Lawless Frank Lee Iosh Lefkon Russell Leggio Mitchell Levine Stephen Lanza 9'-4 What are Larry Feinstein and Shari Friedman whispering about? Okay, what's the secret!? Harborfie1d's finest hard at work. Go Seniors! A free period spent in the lunchroom gives Sharon Smith a chance to catch up on some homework. SENIDRS 115 We Leave Richie some playing time Brad a parking spot Mr. Yed a new sweat suit Billy B the word sad Mrs. Murray a homework check Doc a Brooklyn accent Beta some butter Mrs. Wood Mickey Mouse Pops a tri to Antartica Mr. Belafiore a back brace Mr. Yed an updated automobile Ien and Deb - a trip home from Trenton State H Andy B. a white Mercedes Sam R. a sweater with a real back Q Raymond Lewis Lorna Libert Susan Lindsay Lisa Lomangino Helen Lutz Andrew Lynch Robert Lynch Kathleen Madden Debbie Maher David Mahoney Kenneth Marchia Richard Markowski 115 SENIOHS Pat Godfrey, spoon in mouth, eager- ly awaits lunchtime. Six 'is S4 ,-A, .Iv 13 'vzgnr Y Q wi' 41?-V Lisa Maro Bradford Martin Michael Mathis Alessandra Mazzola T1mothy McCa11an Brendan McDermott Edward MCGUIIE Mrchael McGowan George McKee jeffrey McM1l1an john McQueeney Klfk McTaggart Andrea Megans M1chae1 Merdon Renee Mesard Donna M1ch11k Angela M1198 Janet Mrller K1mber1y Monaco SENIOHS 117 Michael Montargne Greg Moran Roger Morgan Stefame Morotti Ieffrey Morrison Alice Mullen Cynthia Monahan Daniel Murdock I . -Ng, wr-1-34 -rf 1P L nf' Is that a break-dancing maneuver, Carolyn? 118 SENIDHS Homecoming Queen Candidates and their parents line the track beginning the game. Wake-up, Steve. They're taking our picture. , . Damel Myers Bryan Myles Lou Neal Carolyn N eder Lmcoln Nelson Iarnes N rckerson Charles Gary Novrns Jeffrey N unes Mxchael Oates James O Br1en Dawn O Conner SENIORS 119 Tracy O'I-Iara lean Olsen Donna 0'Shea Lisa Pagano Vmcent Panetueri Ioe Pang1a Ienmfer Pantano Dav1d Pappalardo Chrlstopher Parent1 Leonard Pans DaV1d Per1no Mar1a P1SC1t911l Cathleen Planz Mary Pollek Cynth1a Poulos Deborah Preston John Qu1n1an Matt Qumlan L1sa Racamello Keith Peterson 120 SENIUHS QC! fl? NI? T 'fr Viv Mary Ramos Lisa Regeer Erik Rencs Q A vue ff Melissa Reuter Charles Riggs Victoria Ritter Kyle Roberts Matthew Ricciardi Senior Lounge The music is playing, the lunch trays are piling up. lt's almost the end of the day and boy does that sofa look good. This is the life! The life of a Senior in the Senior Lounge. Located in the hall just before the North Gym, in case someone didn't know, the Senior Lounge is almost a memorial monument. Every year the graduating class leaves its mark somewhere in the lounge. In past years the lounge had a small radio for musical entertainment. This year someone volunteered a stereo, a few lounge chairs, and a few decorations for each holiday of the year. The most noticeable were the paper stockings hung from the windows with the names of the Seniors who use the lounge on them. Other Seniors choose to not use the lounge. The lounge is the Senior's turf and no underclassmen are allowed, but obviously the rule has been broken by the underclassmen or bent by the Seniors. In past years, lounge privileges have been taken away from the Seniors for their misconducted behavior. So far this year the Seniors are in the clear. Good luck in keeping it that way Seniors And enjoy! Last minute stories to be written for the yearbook keeps Senior Karen Domencetti busy before her classes begin. SENIURS 121 Robert Rodler Dawn Roe Michael Roemer Samantha Rondone Stuart Rosenburg William Rosenfeld David Ross Kristin Roth Dawn Ruggiero Alexander Ryley Susanne Sabbatino Amy Saisselin Victoria Saladino Elene Schachter Luke Schaedle Deborah Schmidt Dave Schmitt Alan Schnittman Elizabeth Schwartz Kim Senior 122 SENIOHS if 5 , 'N G23-Z vi ZS ii Sv' NIL 9. NF' , Q' agp' XP bww., '19 Rosemary Sercia Danya Singer Marybeth Ska1ack1 jeffrey Shppen Douglas Sm1th K1mber1y Srmth Sharon Smlth SENIUHS 123 Christme Smolcnop Cra1g Snyderr Debra Sperhng MJ V Dana Spmner rf' i- im 'Dx -Kal' '9Xv4...,...,. 'L' 'Y' l 'M Michele Stellato Kristine Sulhvan f '- ' uf Debra Tent1on Q ' ' -' Heather T1schner Steve Toteda Gu1dO Tries Brad Trotta ve 'ns fiat 1 N , I I NA!! X 24' In S In William Sweeney 4 X T ww' - -fm? i , 1 I 4 L I .V.', 2- l xg NJ -0' s. -4 'av i X Senior Michelle Gelfand and Stephanie Calia just escape the in- famous grip of Senior Erik Rencs with their lives. 'Q X 124 SENIURS Kenneth Vaba Iacquelme Vaughn Lucllle Vaut1er Douglas Venut1 Iosephme V11lalona Sehne Walsh jeff Walter Sondra Walter Sandra Ward M1chel1e George W1l11am Harry W1111ams Lmda Z1mmer1nann Dlana Woodall Maryse B1ssereth Chns Orr Iohn Strong Weissberg Nl . ' EJ I f l , nI1,, L n M ,,' Y,f-If ,. e SENIUHS 125 1 1 'K' YM. 4 Wm. I26 Mr. Benjamin attem t p s to scare his class with 4 9 Somehow I don't th1 nk he succeeded. Vlmzgs P4 .wkvpg-I. nj iw 5. Tag mm' , I wfrctfmmiiw mtmmf 33153 1- ,I 4-HM fill.-9: ' F Mil. uw.fL!,.99 .fave .Haw eEg'YQ':4..e12.iz2:?32 n,.p5w1.Agm313V , . W .f.,vcvxivAwy f..',,W1wmN9 wi. am --J 'CH . -' Aww, 'M'isi1,1f- 3W'h'?f -g.5....Ax..-:gm 'S-wx me A Kfigjibfriiifs' Wifxswififsfgx We s. ei . vxCmf?esnfw'45Afmg. W.. -1 f'.:f.:fv..,f?2, 570v?f7QL,jrfNQ2vv3l1, fin +R. Qmiaivux 5wggm55,.g.w-2639 f q..m'ie' dv. yin W 'W fm... . mr. .IQ-ef. 4. ., w wn..m.M..f, -m.ww.w.. iw. m3 E11. 37.7 f.'j,+hi.k.g3m5M mxemecvzmw, fifwwzertffzaff LQ .f34'v.Q:1v.J :wa SM JM.. f-. .umrngfwig ,.,w.... , W-,-gbfumfii Ji. U .Wp...,f-mm f I--v ,uu- 1, , .. . iff,-'JR Egaf'W1Qf. iwzf3 . Mr MLM, v ,wg -f pg-,..Quf. :'w:r W. f f , -.X ,wwMrq. Zfym5 f.-.e.m'M 9315452212 Jprfifn v ,m-imisfzjf 91, A i ,gfgwzww 1. . ,m..f?gC+4'm v' ...N Ni .m54sg.r.'a. We .X .,,w..,,33.,.11.f ' ,.,7,vV,.J....,1, N, x W. M 4 f ,.,.. f1e.+,5u,,.19g3afx '-EW +3-f'nf'3'. mm Q Ji Tiff- 11191. . J,,A V M Wi? 'v fETiff'LZ4ifx Ul.Je. 4iz 1391141-'ik f WL. s V1 ,219 My high. Wm' f:f,::fm' 'ff-:swf ' ,.A ir+ - vvmjjfy, I ,rfw WU ' ., - . .A mmf! . H1.wg,3g I H 421 mfsfzfiwmf 1- fm... Mawr. f5m3gfW+ ' v.fqiEe3:1Gf i'If' 'wi 1' ' 5 up M' 'f + f ff .:f, . Afspjw' H 'nf ' ' X ACADEMICS . , ...fx . f -.: .. . .,-'ywfv .. .V ,ye ez ,.f:wf4fe'iv yf JW ,4m,w1 M' 1' ' ' ' K., . 1 W...-' K ' .. .x , , , 1. ,,' .fw.1f.f.u... 'V .f . .V wi 4' ' ?'M i V1f4 744 any '52, . M if w..,..,+' . Y f X 1 7 'i9':..4l '1.f . . ,. ,M :fpw.-J'212P f1L'1k6 .wr-L :dw pw:--'-vu1.54.Q,1M+w1:,mfw-iwmxswjf f5gvv5,fa1yg.gugs5.3.4,yiJzzwgwgyAwfw1:.Q.f2y'1'-.ygjgpv ,w .en-.QL Lf .,, ,' 'U' g mfr ,,fM,. 5y...f.,..1. .rw.yvsyzxmdfv-.wwgffvw W M 4- - ,frm Wm .'fgvfw W pw' V . , KWW1..www:'2' A 'L .3 , , ...N ..,.f..-5-wfqmgg.fmfiL1HfQg..gSyl? .fy ,f,L,'f.5-'ii rfwf 9bW'U1,'4S'v'f' :Im Wave' L ,e. ' H' .mm ,,w.,Qf.1.,m.-f.fm 'W-Q1Q5.g.,..4w,1. by JC. .wp 2 v- 'L Pfmrw-wm,w 'ws' ,yfjvme-fmiffam'..w:z'fM--wwM:.'+z,:qJv.:f6:fv' mm. 'cE5Zwf:?i!Q!-1wvfvf'ui 'Wifi-'b!1. V ' .rviwfm'fM1w.1z'!f.zf1wr4:!e..v:'.f.'.f , -L, . wil . f K pp-2 j ' 1.5 , H Kinja-W' ' new L ,. M, 'm.1.w:1'e 5'3' La .wuz nv '.fa.33.fu, ' wg f' ...zu-4'1 ., . If -1. 'Q'-if-. :ugh If -' pq ,'.'zJr':.2'::-M1 3:vy9 ' Qjifilf .2J:.f QL ., -'. QL., i5, 'yf mi, g..-u ,,lM:1y'A3 p1.5'.i-6n,. JL'-2 'Q '.5 'f',,je , 'ffl ' xiii, M..f'5111fz.j:i5T1:'3'3'.451WM wg.,-Q 'Q-' T-au.fJi5'x,Ii 5 5.4.5. ZY25'Tj,iJJ2' ..iw:7f, 'FLG :X ,ff 1 21 f 1... ,gi v f:41' .K M. ',-- ., A gf 1 .. . ,,.. . . f ,+4.:5:,.y .i-.qu ,,4 -, ., V4 '4 Xu! ,,,q-gm . . if TV' Gif, if-LSI? ' f ' '- X 'I'l:'lL. . ' yy ' msg v QQ. , !,f . ' Qu .,.1 .-y,,,, ' MN ., 4. ,jx , ' 4 ' , .. L, . A ng.. 4 f . 521.-. ' f .J . ,- . Q' X H , . .fri-fr' ', . , H gf f' . Q A 1 W m M AL y .ffl ' y fPA!1 F4 V' .WN fix' 4 ' P .. J .,f7,fe. ,wf1f+ ' f' 'Lf' ,QM m5'g'fH F L' ' wwf ' E ' lil CF.fN'W.n1 'fT'1f3'AlYWQ ' Wil f-:f t .ma H' fi . K mt. .M is-Afeiwiiii ' Ebfggjgenitti ew 1 7,,vl,.,:5.,4f W., .,,.M . my if V, ' WAKFQE: iw f imvisp 401 -5-Lu, ' , 'Hifi 1 ww -, spar, g,, . JI' 'W' fj -!.z:.,,,' A' H A , 4 Qu'-M Q-f . .Q a A1 1 . 4 J' W fi' , - , lily, 4' ' -' if M ,sw 1'gf3JM'f,f -WWW MH me , 'Q' 'SM' nf I W ' - v, W l. , H . lw zk All , - w 2 M QW 1,2534 , ,i w Maw '- wav ' 'M' ' ,.M igh t- 41 JWQQ? G-4 'N ww ' P3 1 ,A 'gwiii l 5xQ???. ' ' ' w e l ' Ai E E ' If ' ,3 Eli Q 'naman 'WL fi 'Ex T ,F -4.-. :f'.:y.- Please! No more jokes! Mr. Domencetti tries to explain the punch line to his daily joke. Mr. Simone conducts the 5th per. wind ensemble in All Night Long. NRM X if ,E 1. , 'ML 'N W at M mm+,m,u,. 5,1544 f ,, . ,nw Hz .wwf-Q , qMgiga.imw,a+Vf,,fq,1f , U 'WW 3 Ms. Solowski listens to a complaint about student. -Q I ig, Q X U ' . :E ' .5 Tiff ' 'N It Y fv Al' I' 5 ' l WIQ ,1 , l . A. X gy V H A' ' r rv rf-r ' , HQ., ww? i?i ' 7l5f' M MI? ,l ,V ' 'ua -fi-, F, My-:fl M21 , ' 1g',gw'r , if ml? e Qmf-,.mffeva-W' ifq,lQ'wn1,m:f.Wm,- 'WL . ' 'gfpfww-4 ' ww, f .ft 'B Marlin 'A' 2- Q' ..b'71, .2 ,-g'g,, M '--44:15. , , .,,. LW '- ,ny W 1 - gf.,-4. -H-fsE,a+1eMi3A,g-gvhifm. -Q ..,.fwMww' A Hap M Lian ,QE ' .jr WMA- -.ACADEMICS 127 1 ll R I R. Slocum CHAIRPERSON 128 INDUSTRQAL ARTS l INDUSTRIAL ARTS The engine roared to life as the students looked on with disbelief. They had brought the old, tired lawnmower powerplant back to life, even if it had taken almost a full semester. lt ran better than it had when it was new. Now they could fix almost any two- cycle engine made. Meanwhile, back in architecture class, students were worrying about R-Values and stress points. Any student in this class could tell you that these deal with insulation and the parts of a building which support the weight of the structure. An industrial arts course can be an exciting and rewarding experience, especially if you want to learn a practical skill, without spending a half day at a vocational school. Something's wrong with this voltmeterf' an unidentified student complains as he attempts to repair a connection. DRAW! A mechanical drawing class gets under way with the guidance of Mr. Indelicato. You won't use that picture, will you Doug? Watch me! Senior Brendan McDermott is distracted during elec- tronics class. iff ,141 QS,- F. Gulla I. lndelicato 'si 'wa zz l Anchor those elbows! It takes concentra- tion, skill and a lot of H20 to throw a pot, as Iulie Riggs knows. Precision of a different kind goes into the film development and careful pen- cil work being done by Chad Gronbach and Adam Mayerson. R. Schwen C, Ronge Chairman 1 1 5:25251 -III 1 It's neat and messy, It s quiet and noisy, It's fun and frustrating, But mostly it's Awesome Art HUVW I QI 1 He fell twice. His sneakers kept slipping but he had to try again . . . A flying jump off the top of a six foot fence and click - the picture was taken. This would be a great stop-action photo for Art Studio in Photography, one of the courses offered by the art department. Mrs. Ronco's classes were til- ing the wall with ceramic adap- tations of drawings they had done at the beginning of the year, while students in Mr. Schwen's and Mrs. Graber's classes were creating imaginary worlds in oil paint at the front of 310. The Art department offers expertise and guidance in both traditional and avante-garde media and portfolio develop- ment. When interviewed by this reporter, Mrs. Ronco of- fered this quote: The doing of art is a totally satisfying, glad- dening experience. These rooms are warm, human places for students to be, and occas- sionally to find, themselves. Cb Q--5 B. Guterman F, Graber DJ! - , fw,5f,:fzy1.n in fx , fp 'E R. English Chairperson junior Odel Burke spends a period looking over his homework in the Gym Office. What's this? The South Gym? Believe it or not, there is a south gym. 130 HEALTHXPHYSICAL EDUCATION Lx A W -. Q i,. ,nt .5 enlfllffby ical Erizcalio WAISTLINES Students learn to shape up not only their bodies hut their minds in Phys. Ed. and Health. Do mood altering substances, birth control, stress and nutrition sound interesting to you? If so, you will enjoy the required Health classes taken in 9th and 12th grade. These courses are prere- quisites for graduation which are taken for one semester each year. In-class activities include discussions, movies, and lectures from notary officials. Students study topics ranging from stress, to CPR, to the detriments of drugs and alcohol. As Senior Todd Davis added, I never realized that has a good side and a bad side. Another form of stress is exercise. Can you pinch an inch? If so, then perhaps the weight training fitness program is for you. Weight training is one of the many electives offered in physical education. Courses offered range from archery to volleyball. These various activities involve the development of physical fitness and the sharpening of competitive spirit. In this class, participation and test grades determine each stu- dent's grade for each quarter. Let me at that birdie! Let me at it! Really intense playing guys! Don't let that birdie get away! ,t y , V , ,f . J 1 ' . .fa .1 ' -fa 4 ' V' Es? . so .fu L., if F6 fn-L 1 in lie xl- Iv :,'?l gr - :Ms ' I M K P Y, T.. ' sl. i se- if w , f . gi 'Z' we - 2 , . 1 5 , N :ii ' N 3 'W :J t L N K sf' ' l I 5 I tif' I .I - fx IIX P Karas K. Kuch L. Mangan I. Mayer D. Mayerson E. Yedziniak M. Wilcox HEALTHIPHYSICAL EDUCATION 131 Matlheml ics DISCIPLINES THE MIND, OR DRIVES IT MAD . . . Cex + lnyldx + x-dy:0? What?! Get serious! Only a genius can solve that problem. Believe it or not, some people in this school are brilliant enough to do it, and chances are that they belong to Matheletes. Matheletes is a math club run by Mr. Kissam, consisting of all the above average math students who wish to compete against other schools for a place in the division. , This year there are two AP classes and two Pre-Calculus classes for Seniors planning on using math in their college majors. For those who aren't, there are classes such as Intermediate Algebra, which takes algebra a little further than 9th grade Algebra, and regular classes. In this district, three years of math must be com- pleted to graduate. Grades are up, and Freshmen Andrea Roemer and David Tellerman receive Making the grade is what these their grades for the quarter. students are working on. il ,I 55' ' ' hfgfafg . 3' ' yd . 4--V K- .vm -- x sy, 1 Q, -,-- ...KA . . Q 7, I .U IFPL -Em f I C. Dale N. Erhorn 132 MATH . 'S -1 b ' fdvsurhwng eu, .... -. v , 5 'E 71 P, 'f?fif+5'.2fi9V . fllfffef , 751215 'I' 111: '55 1:5EQf553f XM I l . .Q S. Giunta E. Hartling D. Hickerson T 1 y ' Q L I v ' Il 7' J' I Il ' '- - '54 ' U f-Q. ,.' L A1 5 'fit-sl 'L?'b v' 'ni , ll ' 'all ll I I l ' 3 2'E'E'E' . - ' .- 1 e ggig L -, 'ff ,--5 Q '.,-5'6'r-5, 1 H .. 4.. . ,, fi 4 -, .Q -4 45? s 15 ' 1 E M B-11 Stuck for an answer, Mr. Guinta helps Senior Sandy Boccia with a math problem. Staring a problem in the face isn't just an expression here as Senior Josh Lefkon proves to us. 'T R. Kissam M. Lofaro R. Mandel M. Melillo R. Mugavin B, Wright Kg, a I I G. Vavasseur Chairperson l I MATH I A 133 -L -x V ,Nik f 1521, if . 1' I ' I T- 5 L r ll ' Av I.. vi gg:- ' 4' WE . 5, 1 HQ- ,'Q.x'H :ich my ,f i K ,--Q Gng. Q an ,- Pi L -i R. Domencetti Chairperson N 134 MUSIC mi Chestnuts roasting on an open fire as Mr. Czema conducts a seasonal song in choir. Senior Drummer Dave Perino talks with friends before practice begins. R. Czina J. Rauch I. Simeone 1 in L. Sumner 1-. ' TK . . 1 , New-. . A 5 ,655 1 Qi' .4 ,Q W, .. .Jeff Q 5, As the old motto goes - Practice makes perfect, the niusicians in our school all strive for the one goal - to p ay . . . MUSICAL CHAIRS The drum roll sounded and the reaction of the spectators was to stand for the playing of The Star Spangled Banner played by the marching band during pre-game. Half-time draws large crowds to watch the marching band execute different drills and manuvers. After marching band season is over, the band comes inside to split up into two bands, the Symphonic Band and the Wind Ensemble, to begin rehearsals for the winter concert. Some of the band members also play in the orchestra and the stage band, which practice from the beginning of the year to also present a winter concert. The choir is made up of students who wish to sing and they meet during school as a credited class. Within the choir there are students who are members of the Madricals, Harborlights, and Harbornights, who meet and rehearse under their own supervi- sion. They also perform in the winter concert. Other classes that meet during the day are guitar, taught by Mrs. Sumner, theory class, taught by Mr. Czena, and the conducting class, taught by Mr. Domencetti. x 1 U4 . Practice makes perfect, as Senior Karen Mrs. Rauch instructs her orchestra class Domencetti and Freshman Ernie Moah during fifth period. demonstrate during summer practice. An Underalls commercial during sum- mer band practice? MUSIC 135 THE REAL EQUILIBRIUM When asked what teachers they thought were the weirdest, the Harhortlelds students voted in the Science Department. Great! I never had so much fun and learned so much at the same time, commented Senior Karen Domencetti as she remembers 10th grade Biology and her teacher, Mr. Benjamin. This year many Seniors are tak- ing Physics and AP Biology. Next year, Honors Physics and AP Physics will be added to the courses already offered. An interview with Mr. Landers, the head of the depart- ment, surfaced a hopeful change for 9th and 10th graders in the future. Physics is going to be taken before Chemistry to Seniors Ian Adrian, Ioe Bruno and Dar- ren Brady concentrate on solving a complicated physics problem. give students a better idea of the mathematics involved in Chemistry. Students favorite things to do during their science classes in- clude: leaving the gas on until everyone in the room is fly- ing, mixing elements and compounds, that they were told specifically not to mix together, to see the pretty colors they make, and others that are unmentionable. Grants and scholarships are awarded to students with high Science averages to aid them in college. Mr. Bogart demonstrates the science of a Sundial to one of his 9th grade classes. 5 1 .-ffl. E. Benjamin R, Bogart 136 SCIENCE . ifihir- lg ' 4' l' S ll 1 4 f'4, . x , 73-1115 .3 ' U 'Wag R. Dossantos D. Glavin M. Grobe A. Honikel 5, Insolerf fy 1 i X A O 1 fi X '- I 7 I , 1 1 -- 1' A X 1 1 Y! f1 f , 9 1 L' ' . J .J 1 J1 1 1 . V 1 1 . Ne, RV WX 1 .1 X1 X-X 1 X 1 X., . 1 1 1 1 1 1 -of' if 1,411 Aj- 1 1, ,V 1 5 1- 1' .-f , 1 -1 ' X fx Y J 1' ,1 1' 1 ' 1 1 1' 1,1 5 :ll L X rE:E:5:g -' - K 1 XL vt J' 1 txt! ' ff gf' 1 Q 1 ' 1 Q' , 1 - 1 1 1 1 1 1 1:22:55 . - , 1 1 I f 1 V ef 11 1 3 X1 - 1:2122 ' ! 1 X 11 1 1 -..jf 1 V ' W 12225111- .1 .1 5 11 1, 1 Lf ' 11 ' .1 1121 1 1 f - fx 1 1 1 V 1 1 1 1 , 1 1 M' 11 1 1 1 - 4 95 ?-Sag? I X' K 'af V1 1 V -X1 1 'Nfl 1 ' J 125:53 .42-1'Q' ,L 1 '.niw'k 1 X, 1, ' f X 1 1 1 of 1 ff1 1 11 5:51515 I - ' df 1 1, 1 1 11-f f 1 '1,f 2:1 1 1 , 1511-Q ,-'-:lg-,jf-, 1 1 11 f. 11 J '1 1 1' 1 f -M 1 - ' V L A' 'Yr IL ' f1 1mx.f lj! 1 l '1f' J 1 11N Lf in I Cu I fin 4,1 I , A X X1 D, .X 1 V1 L I1 . l1 1 1' 1f Xe' Q '. ,1 J ' O, 1 111 111 Q11141. 1 ff 1 V 1? 1 1, f F 1 ffl 'Ml MIM at E1 A fit X1 y 11 1 'Q J JV 1 E1, fm fy VA X' A 1 ff LQ' ' 1 ,111 1 54 1 61 1 wg 1-J R. J 1 1 ZEN., 1 ' 1. J VL! ,Y 1 1 W .xyy 11 11 Qf V'1 F 1 111' L-X 1 x 1 V kj L I X '1 1 ,X 'J X 1 ' lf A Y V' 11 J 1 11 1 Q ,J xx J 111 ,of 1 1 1 - v X kjjxj fig r 1 1 5 'Q .X -X JN y j 1 X, 1 :Q xg JV!! 1 1 M! If i1 J W , 1 11.1 1.24, 1 1 1 1,1 1 1, 11 y 1 W 1 1 11 1 1 , . 1 -1 .1 1 Q1 11 1 1 , I 1 .13 1 131' X 1 11' 1 - 2' jf A 1x 5- 1 1 1 1 1 C J ,f11p',1'4f!If I vf' y CX' f 1. 1 ' ll f A Lf J 117 :JA -' ' +1 AY' 1' 11 Xvfki QM! 11 4 11 Q',, J , 1 1' ff Wk Ixvfvif ff I , K- I 1 ff' Q11 1 M 1 . ,f f-. 1 2' 1: va- 1L4!lV, A 1 X RJ,-f 1 ' ' f 1 Vw '1 11 1 .xx 'X , 1 1' 1 ' 1 '11 .,1' XJ . I, Lf , k X 1 H He , who ut the tac15on m cha1r! XJ '11' 'f 1 11 - 1 says Francie Sarcona. 1.x I. 1: 1-J 1 'T-Z V! X 1 - J W1 2211 f1 1. ,V 1 W1 -- Ax 'V V 'xr 1 1 Laugh it up now FF9Shl'fS!-S-Rf Next year 'V' fa 1 gjw' L, -f you get to take Biology? 1 A if 1Q.'v' . X elf . .f 12yff-11,1 1 1 ff V1 .I 1 N J If X' 11' Q., I1 W, T 1, 1 , ggn - vw: , . I '1 1 ff! W 1 1 1 v1 1 11 1 V t fx-f JJ gf 711 1 1 .. R X Vf1,1f. .1 --1 1 f 1' ff, 5,4 ' .ff-f,,.,.,, 1 1'! ' I ' . T 1 f1 1 11' ,, 1 1 . . 41f1'1'f l - f M1 1Tmi i1'f5 W ' ff, J1 1 5 .XJ I 1 ' S. Lander ,,f'-f' f ,,f'T -'Z' ' f ' 4 1,1 '- ..f' 4 - - ff? 1 1- JA' f I ' Wllgy ' -I fy ,X W 7 1. 1 111111-111 A 1 Q 1 1 2' ,, 1 ,V 'mi A 1 , 15 ' 'sf 'X ' 4' ,Hgh 'Q inqy I 7-. ,v ' .H-3 'affps F, ' 5'-'lf' 'f f X f 5 Q.: X tv! 1 I - .N-, I it 6. '35 1 1 ' .- 1 in 1. 1 1111. A 1 1 , 51 I 1 1 1 1 . 1 r Xi -A fr. Q H V Mk-43 Q ff - ' ' 4 U Y rs-.,,,, I KK X .1 A F Q if, 2 X ju ,, 1 y A il 1 5, 96-1 1 1 . A N R. Kennedy S. Lloyd L. Miller f' '1'-Q. 1 .I 1 lf f J, K P. Sabato H. Shannon I. Short I. Shuttleworth X XXX 1' . 11, if ,. .911- 1A ,1- SCIEHEIE 137 l l ' . 'VJ I I Yi I L U' ,ff r ,r s A JQ5, ' I' ,117 . 1. ' i,giLq', D V 1 , rylfyvwtfffyf -1 ,rLq7ivfff.1' x In first period, Mr. Hall talks to his class about Roman architetture. What's up Doc? Doc Ziebarth lectures to his class about World War 2. X N, if Ts il Us l .. F55 '1 '- '41, 5 ,ss S -N ts. My Aobisher T. Hall W. Hennessy 138 SUCIALSTUDIES 4 , ,Wi n V I -4. ff ' 32 if .-t l A t s A s as R. Klein E. O'Sullivan M. Singler 1, Szokoli , W 1 , , . , - ff-,,.,u, ,m r tm. 'W l , as 4 V- .- Cf 1 wi 4 V W. Thoelen ..,,-A, , fl, Z4 ,lf ,125 ,. M x7 v an nw -me --it rss ,--.Q f , .559 -iff ' ' f i VJ I. . - fsfssw ,S I S, -,J 3 g -s ultra-Q-i'figf K -M . Q 5 II p in- '-,Tl 5 If W f Q R. Ziebarth D. Zaretsky .ng ,.. 5 gag, CULTURALLY SPEAKING Learning about history and idealogy, while explaining the rituals ol the Ancient ltomans, students are learning - culturally. I never knew there were so many religions in the World, com- mented Senior Bill Bertram. Mr. Thoelen adds an interesting Com- parative Religion course for Seniors choosing an elective to fulfill their curiosity. The Social Studies department offers a variety of courses for students to fulfill graduation requirements ranging from Psychology to Afro X Asian Studies. Students must have three credits in Afro! Asian Studies, World History, and American History to meet graduation requirements. These courses are taken in 9th-11th grade, and are geared to bring success on the 11th grade Regents taken in Iune. Sophomore Toby Miller learns about Kendra Thompson studies for her up- democracy in ancient Greece. coming test. awiwlf. 'H W f. SOCIAL STUDIES 139 ANGU GE LI KS Students speak and listen, travel and learn a wide range ot languages, from German to Japanese. Opportunities opened up for those students interested in stu- dying a foreign language. In- structors cover various ap- proaches emphasizing speak- ing, reading, writing, and listening skills in effort to make a challenging subject more interesting. This year Japanese was added to the curriculum of languages - including French, German, Spanish, Latin, and Italian. Mr. Pavone teaches his Iapanese with reat enthusiasm due to his infatuation with languages. As Iunior Pam Sampson com- mented, Japanese sounds so different. It was really hard to get used to it. For a cultural enrichment of the language, eight students from Harborfields went to Italy to learn about the language and culture they are learning in class. Sophomore Karen Schiliro said, I had the ab- solute best time over there. Everyone was so excited to go, and the people I met were so interesting. Senior Linda Zimmerman smiles her way through her last year of high school language. Como estasg, Sophomore Scott Muscatello asks his classmates. FOREIGN LANGUAGE ' 4 view ,f CV X5 ,sffi ,, , W, an-., I J Q79 1 s Z X a , I 1 4 G H N. 'G 4 I. Davidson R. Dolle E, Hirst Sophomore Debbie Vavrina waits for her turn at the blackboard. With eyes behind his head, a Spanish student tries to gain a headfull of knowledge. ifeff- ' i WL-basis A 1 S. Kass C. Khatir A. Murray C. Pavone 5- RiChmO1'1d P- FI'iSiHO J f - 2 . X A. Scheef Chairperson V lil?-1 Illl ' ' f X .i s HIHI :I-333: ' T',1,-',',.1-f-1-'Q ' . g , . V I FOREIGN liANGUAGE 141 I l 1 YlUNlJf Hll 'I' I ' I. ,il -359 ' ', 1' fuf I' K ' , ' 1 42-. l l 'V l ' s. 144- - 4,s , h 'N I : J 4 l 3 , n ,,,, Q , V E 3 P., ..:1. U g V x -,,.-1 . , ,Emi 142 EN I. Lemonedes Chairperson l ousn We know the sound of two hands clapping, hut what is the sound of one hand clapping? . . . Eazen Koan READING BETWEEN THE LINES The English curriculum covers topics ranging from grammar to the history of the English language. Honors English, Regular English, or English Skills are required for graduation. Teachers group students into one of these classes according to their work habits, degree of motivation, and basic skills. Dennis Reichold gives his friends his philosophy of English. Mrs. Emmerling helps one of her students rewrite his essay. 21? '-R. Armenio A. Atkins As the average student takes Regular English, the more ad- vanced student takes Honors English or possibly AP English in the 12th grade. Elective courses offered in- clude Effective Communica- tions, Drama Workshop, Public Speaking, and Writing Lab. Tricia Endres looks over her homework before handing it in. l rv-- I ha. S. Bellafiore R. Davis C. Deren M, Emme 1- V, rling So this is what I get for be- ing such a nice guy!? Mr. Atkins expresses his feelings toward the unidentified photographer. 'i' M X W QS A. F,-eitas W. Fults B. Redgate K. Rice W. Thomsen I. Zeitler il i s uf Tricia DoSantos avidly reads A Separate Peace, a re- quired book for 10th grade English. ENGLISH 143 'Q:i,!i'f:g.Q :ggi If: fi f I '. Q ' -is 166f4f J 1 t B A0116 j Ciwwryl 040215 fo W A pvvyindfijfr Have Off gravel ' iff wow ,QMJNWQ7 V Q 9 Wouldn't you give a hand to a 6 friend? Mr. Ofonnor helps a student 'get the hang of it. 2-QQ0 r '-va guum i , .1 in r ' -FZ 'ix '. .-s --N. , Yi' ' ,4 - XX, ctinf Er7m7nl7on- -' Only recently has it been recognized that learning disabilities hamper the school behavior and performance of otherwise normal, often talented and highly intelligent young people. Albert Einstein was learning disabled, after all! Gur special education program was developed to meet the needs of those students who were found, through observation and testing, to have a learning disability. The teachers work on an individual basis with their students during some portion of the day, so that they may follow a normal schedule the rest of the time. This individual assistance with specific disabilities can often reduce or overcome them completely in terms of performance levels in school. We are very lucky to have such a fine program. Keep at it - you're doing a great job! Datz right! sophomore Denise Datz encourages Mr. O'Connor. jokes with classmate Ray Scott. K I xii .: kgg'-Qffi '. 5621 -4, 15 I ..y.-2, - g In f j H 1 . A '- . ,f,,:,. W-,-,, .,.'r ......- .f,. , . . - ff's:a.:s'a:g1-: .3 gi .:., .,A., vga.-. . A- , . yltxgffriij- jf:-2, I., is. i av :ff ' -- ruff ' ' 1 , ..., .. ,. x,..,t5., -. ,,,. .-.L-,.,n., ,.... . , 144 SPECIAL EDUCATION Only four more days 'till Friday ... sighs Mrs. Metviner. .f ,. ,,- M, . 5 ya.. 5 V s Xk.A x . wg V V V f Xf' 'F' W , gl V' V V. ' x J f W X X , 'Q , V 'V , A 'V P ' 'Ixj in K k-2 Xl. X 5 'V-'V' A' A , J f ff ' Qi XF XX Z iq X xx j! X - , Q N , ' ' x' W . XANX AX lf?-Xxx EJ XX AX Vx-1 .K XX VX 3 2 ku . ' 'X :V ' 1 x.fX ' ', ' tx ' . ' xi , ,V Vw V 'J MJ V V ,V f V mln , - ' V wx x X I Nw 1 ' . 1 ' N , VX, X V. JV, , Y VX' VX.:-f f X , ,X 'V . , rv 'V 5 ' I V ' 'V f7lJ' Ilil ,fx gy, - QV K N , 'L x Q ,, , r-NX 'N' , , A f X if .Wy V . F 4 ff? 4 , ' 2, 2 V ,-, if ,A V ' Xp X , If If XX , vis' I iff! ii. 'V ' ' 1 , V--..-, -.4 ' 'WV--.1 If if' g ,Ii Q. ' X V Q-1 V-' i ' '---F ' 'qu-.., X' . no au 4? Pa fggg , 5 .1u,a.A-... It Clark S. Hurley CEX ,KN .1 ,xxx gfx, x.!g XT, 'N . LX, if ,jf ,K Q 1, yf bf L. !x.2 K N 4 'q:,1 Yfff , V x X v 1 . I XY 1. McNamara M- MGfViI'l6f T, O'Conr1or ' x X M1-13 ,...--f-- 'V Q30 jk! -ff xx 1,-'I' , ,lg 1' 1' 5,29 ?ffE.,-.. S-1 ,Q ..f N.- 2.1 4 f 'X ,,fx.f x.,.fx., N.x x,,v'X-' ,Af X 'J jg xf Lf fiat! fg!J i S41 X 1-'N J 'XX I' gig ,. f-X S x V JVXJ X. f -J J x f 'V f f !.1, ..f -1 ' v X ..f fJf f X Xa ' X Xf X X, xx. 1 X-f' 'x , A iff -X ' 'Z Xxx x,N k' ii -V f Rf- ' I. Feinman ,Jf zz J ,Q V. . I J ig , w X fxxx 1 IX ' ' . L V, X ww' 1 V - ' Niki X X Q X! ' 'V X' N ' A Vg. ,...n V X J -N If Y f X ' ' ' v , 1 ' ' f x ,rw . ' Q. XX 'J XX 'Zi T, fl X fm ,' V I Y N' ffqflf' , my , ' if , V , 'V Vf ff , f xxx X' N X X XV If rf , X 'V 'Q F f X ' f- ' X X A if, ,,- ,lf J -1. ' ' '- ' X ' X ' -' .' L, fffifff X f XE! 1 Xfrj Y 'L ' :2:f:f: X X , -'X , , 3:5232 X , v A J ff V .' 1 XV fs ' V - f J I V XX N X X V' X, 155131. C 1 I Q w X X xN,! X' Vvffd V W J! V Mjfuy ', 255525 -J f y w 'V ' V N, K ,P I V ,f W 5555553 gif.: X X , Xi, X J X -X ,,,,.. fb f ff X ' V W' J , V ff ,V . :s:s:2f , . N V ' , V4 1 V -yffJ' 1' faf-ssc 7, 4 W V I KJ Xf XA .k V . , .Uv v I . , X X X X V ' 1 1 V , V' ' , ' 1 1 1 XX XX , , X, IX XX 4 v X. If X X1 f, V . , Q X15 . ' V '- 1 4 ' ' , UQ ' i J V' V 5 f f ' f ' V 5 1 ' , K3 ' Q I p 1 1 X 1' V, L ' X ' 7 1 ! I ft ,XZ-1 W' ' ,I K'-f! ? A ff 'fag 3 ,fm -,xg 15 y 1 5 X . , b X 3 X , ' ' ,- Q A I W ' V ff f th! ' V V 5 1' ' ' 'X 'Q g,f 4 If V V11 ' ,Vg X , X' f , X- 'Q A 'hy - ww. f ,X vk, X! ,Q , 3 X X X, , f,. .7 . ,J A Q., , 'Q 1 V .id . JN V1 A V ' f x' , . 4 , X X ,VXXV .. X, V, ,V -, , Vf 'V' ', 57 xy Q X ' X17 gXg, Vxx' -. ' 'g 1 ' - ' ' 4 X5 f xl 1 , Q , ' .X -7' A V A A X , 1 '-'Vw H ' 'Tk , J 1X w X, 5' f f ' , x li 4 ll X K , V , W 5 Q xx X X' XXX 'XX X'n in 'f ' 1. j JX f f f x J , 1' f V' f V V' X -' -f f V , LH - . V , fm H Vi, 1' 7 XXX' X Jr-2 I - ' , XV 5 XX! X, X ff' X XX, X XXf I VX fX, , I J ' ' J ff ' X! X7 X ,Q XXV' , Xf7 1 K TN ' ,f R' , f f rf- K' ' f ,CX , , A f '1X,V' xx f'-,Rl X, Xff 7 Xf' ,X ,V jf fn XXX' X, XIV Lf, ,ffl an 'fl 1 XV 1 f' X X V .fy 1 I ,f K-'VH ' ,V , Vx, I 'Xf w-5' ' ,f 1' - ' U , 4 -ff I AX 'N' if -. X , ,As Ty f R ' TR 1 fx . V1 ' X ,' fd 1, VV , V, Vs .,, V VX .YIXX Xl, I, X'xX . 'pr X Vf f X X XXX X 'X ' . V X-X. . 15 ., 191 k ' , ,Z SPECIAL EIjUCA'ITON 145 I E VV 'I 1 n R. Senzer Chairperson RCT's, ACT's, SAT's. . . No, this is not some heiroglyphic, it's the business of READING Many students enjoy the facilities available to them in the reading room. Some go to it with their English classes, while others go there during their free periods. Offerings include Power Vocabulary, a W credit course given. It increases one's knowledge of the language. Students can also work on material for standardized tests, in- cluding the S.A.T.'s, Regents and the R.C.T.'s. Anyone can use the reading room, either on their free periods or can even take it as a class in their daily schedule. junior jill Scott, hoping to find the meaning in a dictionary, works on her daily assignment. f ...M -,--, --f--- -f' .,..-M-wwwwaaa. l c -in fi 2 , 4,1 11 -- - - ,' IS G. Cuffaro B. Fichtel Mrs. Fichtel helps students in Power Vocabulary work on computer pro- grams dealing with analogies. Senior Kenny Gantt talks with friends while Sue Byrd and Sue Cavaliero work on computers, hoping to better their SAT scores.. nun 1 un-1 lfnaw .V -,.,,,,,q , .. JI fP ,1 l .t,,tt diy . s In Goldman T, Kyriakakis 146 READING READING ,, f, G. Lauler 3, Morado SPEED AND EFFICIENCY AIIE THE AIM FOR FUTURE EXECUTIVES AND ALL ELSE WHO FREUUENT THE DEPARTMENT 0F BUSINESS Typing, Bookkeeping, Accounting, Shorthand, Word Process- ing, are only a few of the courses in business. If you are a senior, Working alone in the Quiet classroom, senior Ianet Miller completes an assign- ment for typing. The typing rooms in the north wing of the school resemble busy offices, and the chatter can be heard throughout the halls. Z- ,. O, .ni TWV - Q Y ' ,ff az ,z--gn 54322-f f, collegiate typing is a smart move in order to quickly and efficientlytype term papers in college. Other courses can be used for getting a job after col- lege. This is only one way that I-IARBORFIELDS prepares you for life after graduation. ff T9 -s ' sz- ma I , SJ- It I ' , I ', ff P-AJXX!! Lf ' J gy ,X , I, , A f 2 f'N A iK I X -U1 ' A 1 f W cf' gf' q 1 I I V gig, -f f 1 or V 'X-w lx I fx fxy '4 , ' J' I I Aft X' -N I5 X N kj I X -f ul A b l . I. 'I , IR ,I f rx' qlrgf , X j-f I ly . Z -f I -N fr , i I , Xxx, 4 K I I x gg, H , 1 X- g,k,,1 i MJ V f X1 , , fv- D Dells I Gottlieb A WOOCI K' X-1, BUSINESS I47 ALTERNATE SCHOOL PROGRAM The students in ASP hang together - as you can probably tell from the photos on these pages! They are a close knit group of students who have their home base in room 308. Through group meetings, camraderie and the close supervision of Mike Siese, they hope to overcome the bad habit of not going to classes regularly. Instructive field trips enhance the feeling of responsibility to the group - notably the survival training excursions taken at the beginning of each year. In this, each student must literally trust hisfher physical safety to the group through a series of real exercises that teach survival in extreme situations. On special occasions, ASP students cook meals, invite other members of staff and administration to attend as guests, and, in general, operate much the way a family does. It is a home away from home, and has been very successful to date. Keep it up, ASP! 1LL,.i,,.,:,eL,a , 2 :Jw .Sl S Here come the elephants. ASP tops to This is a very silly hat! Teddy Cain gets take a break at the Museum of Natural into the holiday spirit with definite Histo .It's reat, but it sure is tirin ! reservations. VY 8 8 148 ALTERNATE SCHOOL PROGRAM we ' E M2 ,fl ' N X 'U 4 'hh 5 f,,' 9, an A a 1 V, , 5, . Qi m y Kristy Curth Charlie Bivond ,I -IV it' ' w :'P 5 ,, 1, M v' 'H -4 ,K 4 ,ul'I x lilli J 5'lUYW'+ fi, v . , - 'j 4'k- ' . 314314. ' N13 , , , f. f- z'+ I, 1 +2 1. f W ,I 'ff , . H 1. Q, a , , ,, ,154 1, 5 I ,gf , qw V H ' 2 X . X 1 is .51 4 ' , , ,'gw, XX x ff 2, x .,, Y . ' my .X!,!,1,1U,l A' I' s' f 1' 5 1 ' ki 'fl A 1 f, Ui' M S., 1 , 5 '? 7 ,jywl fl , ff - gg . fi f . 55 'L -471 - 1 - I r P x h Y H , A xl :ln ' R - QQIJ- 1 4, 3' . 4- ' 1 'H ' Qlfgzitk- Xin ' I f I in U film J 'if ' il 3 , , 6 Y , . 1 Ll 7 Z ' A A NI J, 9 if K ,f 1 V, ' 1 Q - A , ,V K U . , .,, 1 - N , r ., A 40' I-, f- X MVMWJ M . I ,Awww m,, ,, ,W Q ca ,uLi:,,. . ,HNF M515 ug -1 mzgafift wl- W W TOUCH DOWN! The cheerleaders re- A joice after Harborfields scores their first ,J ff- zmtifi' 55 ' r'S1Y'f'f'Qff, pf y-ff Jmltvff 'PNP' I i touchdown. f5jgi:45:q:jl q 'ji' 5 +i'2QQQjiy,il1fa:Qi in ,,, ,.,tt,.. , 'fl il lww.f,,,'i'.s'w- hulk tl 0, .L wwf Q. W,,,, t.tgl,,,'.ft-t ,V .,,,, ,J HV1'Aff'LafH,J'.-'ia ,A .,,,,,. N 2, , W ':f.tmHt5iti7,- Im , -'1:ftMgQp:Qi!'tLrA1a,1s' ff. , 12,3 'U' f f.f,.f,'f2r 1g0,,fM,4 ,1g,4y l v , 4.1 .,, , Wzi:,fQli,4 mr u,uf,.f,,,y,:5,tF' .V ,,,,.,f,i, , , if , miymf ,Gvf.gzi:PvvzQ'i .Y , , gf-ffg,5i45,:i.'-31-,Hr ,gt , .mf if M 4 .,.,7 , ,, f .slit t:??:w2f,?P922'W ,,,f,,,m': eg, .' ,, nube:HM:7l:2? IW' 'iflwi fu HM' eif,:14 ,2DJf l?' V 45 ,, , '. gym ' 4I'f'Mf1fiAvl'fk 'iiwlmfa W' H, 5' f f L-J xe,1',,.,+'f.U. l V ,ml I -'1'zl?5if'ffT'fff' A it l 7, 1 ll l l. N N . ' Al! , f I a X l X V Xl ' f .. fr txt- , Wt , is is , fx ZA ,gangs l . X , N. lt: , l , , emu lf, .i. , l fit, it ,VL ,wf',i,:,w,, 1 K X , as . v YM. J! ftikjfl ' - ' f ., ,,,,, ' A N' JA ' ,,,t , .,t, l 'l1t,:g,,,: ll 'E121'3f7WJ?Jliiffl' 'li' ' l 1f.i:i7,,laltf ':' rw 'wig-f','e Pti1'1E23fl:,l't pl:gi ii Qftiiid' ZW 'Hs.qu M- ull. .s111liQ2Li-'l321tTlT'595,l'151362ill! fi WS' H The Varsity cheerleaders cheer on the . . crowds during the Homecoming Parade. ' 'W 1711? li? il' 'T' -A litil zw-fe J ?5f3?,i5Q-7F'7 , f1fi5geZfl,N?b2ji5q1q, W :-' Q 7 if Meg Kirschner stands in amazement at all I the work on the a genda. The Student Council meets to discuss plans for their upcoming meeting. nm 1255232 ' f y, 5253559 I I , 'N fffifif ..-1 af. 2132311 I U ..,Q.i,3' . 55555551 - .7 15151515 ,, ,ev-Y ' j,4g.w . 252555. lil 5+-L:-1 ' 1131157 -2- 'L' :.' 150 CLUBS AND ORGANIZATIONS 1 f . if 'IW ' Wgmf s A Q.. If .1113 Y ,,2fM:, i 1 . ' ' ,,,g.3g:,.Q MN ,, Y W Y V, - 51:1 Q ' . , W . V ,- 5 ' wg I ' ,E M, CLUBS AND ORGANIZATIONS 151 ARE CHARACTERISTICS OF MEMBERS OF THE lillll lllfl NATIONAL HONOR SOCIETY CHARACTER, SCHOLARSHIP, LEADERSHIP AND SERVICE Qfkitif-T '?? ?f The National Honor Society consists of eleventh and twelfth grade students with cummulative averages of 90.000 or better. These cum- mulative averages are of ninth thru eleventh grade for seniors and ninth and tenth grade for juniors. Along with the 90-average re- quirement, students also must qualify under the characteristics of leadership, service, and character. Once inducted into the Honor Society, students must keep a 90 average throughout the year and participate in various service projects, such as tutoring and helping out at various school functions. This year's advisor is Mr. Shuttleworth. INDUCTEES FROM THE CLASS OF 1986 Paula Ammirati Steven Cohen Karin Cook Iennifer Donnelly Diane Dooley Edric Engert Terri Ferguson Mark Frederick James Garner Beatrix Kleina Beth Kushnick Kerri Lanigan Gregory Lawrence jeffrey Leary Kimberly Lettis Kristin Maher Steven Marian Nirav Mehta Charles Norwesh jill Nussbaum Patrick O'Connor Marife Ramos Sandra Robinson Eloise Saltz Pamela Sampson Paul Sefcsik Kerri Smith Arioch Griffiths Robert Mooney Kei Sochi Monika Gulati Andrew Muckenberger Nicole Sordi jon lager Thomas Murphy jill Stern Michael Jensen Ioseph Muscara Tracy Walsh Steven Kirkpatrick Naomi Neville Karin Wilhelms INDUCTEES FROM THE CLASS OF 1985 Lauri Adelstein Carl Albuquerque Stephanie Berliner Jay Best Maria Byrd Stephanie Calia Thalia Comninellis Carlton Einsel Ilene Fox Linda Galati Kenneth Gantt Carolyn Gardella Michele Gelfand Susan Gilbert President Ruchel Ramos conducts one of the Honor Society's meetings. Honor Society members listen attentively at one of the meetings. A representative picture of the members of the Na- tional Honor Society. 152 HONOR SOCIETY Susan Guarnaschelli Kyllan johnson Christine Klerk Bruce Koch Robert Koch Jeremy Kohler Deborah Maher Michael McDonald George McKee Ieffrey McMillan Christine Melnik Renee Mesard Kimberly Monaco Dawn O'Connor Tracy O'Hara Jennifer Pantano Keith Peterson Lisa Racaniello Mary Ruchel Ramos Erik Rencs Matthew Ricciardi Alexander Ryley Amy Saisselin Elena Schachter Luke Schadle Alan Schnittman Sharon Smith Debra Sperling U Npptiz 6 'Z' .55 'Q '11 I ,W- ' ' gg. Members of the Zephyr Members and advisors of staff work hard at editing our school's literary students' literary Works. magazine fZephyrl staff. Illll 5 . 55121 I 'f::3:'?'5f? ZQ Tnfffstz i kia ., . -1 ' 1 ',In-if? II ,. Q5l,,2'f?bza:w1fr,:.1',z -w.As,:v,.f.-,.f..11.oav.afgwv,t.-.A-v,I 'I-Ive-f:s4z.'-1'--sara-f I 4 I Az' I Jjf' 1157.5 'I' ln. . wats:-fan-..-A CREATIVE WRITING AND ARTWORK ABOUND IN ZEPHYR Zephyr, our literary magazine, is an annual publication which comes out at the end of each school year. It con- sists of outstanding ex- amples of students poetry, per- sonal and literary essays, song lyrics, and short stories. This year's advisors are Dr. Lemonedes, Mrs. Emmerling, and Mrs. Redgate. Students meet weekly to edit Work that has been turned in. YIIIYY 1' Ilil 9 I If I Lpqisfnw f 2325522 C 4 15:52, ' f f. Eiiiiii' ' ,Af 1222222 .-J ft-I' iiiiiiif II. 4143175 2:22213 ' r ZA f ' '15-,: 2:5:5:1, '4ig.ff 25121221 'a'T'I. 'I'1 ,'fM .E7 55?E5E? ,f,,.-- 1-:x , If , --cms. 4.5649 3'FAl' IFN f: ,AIIQ ,If If, XI' ,I ,sf X,IQ,,I',QXl,g, X X xy time I4 Eh- A M: 3,1941 V .If V ., 'XX f . If f AX. 'I :I , I 17 mf-K ' I-ex I' ,fl . I 'QI-T' X a-If-4 ' ' L ' 'f 1 - ' 1 X I , I X ,f N- ,-. I X , I, NJ ,I ,, . I X k IX 3- I -,, , X X X I , ,QI I..I'IsII . -L1 be gy 15 A 2'-.1 by u V9 - ' rf ' V T 'XT' ,, Q ' ' ' A : ' A If , - 1' . ,- ' .- fx -A-A . - -A fx ,- l- I,-I l I I ' - A -' - If' 11' fn' X2 I ' Z f I' ,v' f' ff I I ' . ' I ' F ,I I'I' -- I ' j 1 X3 N1 'Jzr-ff Q I Q Q . l kb ',,,ffI I, J HJ'-5: he-X ' 'J ' -f g 4,1 '-- - 4 . 2 X XA ,X f f ' E1 -., - I 2' ' W Jfn, XXfI ,N N X- fx I XXA ,fXX ZX 'X If I , X : , J X 4 -X K' , W , -if I-.-. xy X , fx X f- ,f Q ' 'sg 4, is - X, .. . 'jk 'fx II 5 I I' , ,fu N '-ft x.,' A' I I ,I ',.f'v Q-I.: Q .,' - I A I v - r' . ' -ff ' I ' 'N- -' If I..iLIX ,I A., , I,,I ,f F, , A I , . I s XI K ' X, ,- I ,., fc I , I -M XL .4 I N 5, N, ,If ' 'I ,V Q ,f . If IX I I I If 4I-' II II I,-I I I-I I ,I J: L ff 'I ,- p Q-- .Q .. .- . : - I I I I. x II,.. II I IN., any . , , - . I II J S- II, A I X- I., I-f sm, A fe-S--I--,,,,-, ,Km X , X X-fI 1... 51 .In f1III. -.-: In . '-'rr I ' I, ' H - -- X., 1, - J ,A Ii- :.,,'-I...JI..: f ILI.- 'I I- ' , A I I 1 , 2 ,I -AI-.--M I Jx. , -II', kv-K7 'g--f',r fi' f' I Y f A I I k..f ,-. I - - A . - - , A ,, ,,- , fx - . , I I X I , I I , I . I I I I I I , .. If I X , ,H I d XI , I ,I-I -, ,f ,I I ,I-,, II, Q I If I- .. . I.,fI .., I I ,Q ,wwf , - I. ,, - , c, . I I ,X I, y , I , I- tr ,AIII Iggfw ,rf PIII!-I 'IJ I Q. j -ef C- I, , , X- I If ffII 1. I I - -- c V' ... I I' 1 I I fo- X , A oc 7' .- I- , , A, fx .-...x .., WI I' I If--I T I ' - M 3 f I J' -. 7 ' I tk 5 ' 1' Ig ' ' -W -- - 'X f I I f ,ff '7 .Qi If-rf I I XI I-I If ...I 'IL gf ' I I '-f I B' ' X sfff' ' s- j I 'f' . ' - -' . Jr- f' '-I 'Q f U... .I I A,Q QL, I s., - I I A I . X - if s ' I I I -4 -X , . ,M . I - .. X. . f - . f-- Q ,. I 'fl I - ,,- s ,f- If I, ' 4- 3-as '? -'-f' ..-L , 'I I-4 if? J I' ' w., If . ' A - .. I 'fn . .. Lf: A' X, f f fb' L L I' 1'-I'XJ'v' V 4 Ix., f VA- ' U I ' A L 5- ' . fyr I rf' ' T' . . rf' 6 'X ,T 7 ' ' i 'F- I- I .. I I f' - . -- IM 15. I I I ,,- g - Y X A 1' K f fs I uf If A.I,,fp I I I a Yr' II I: -f I'-I tw-I I: ,QI 4-I I I -1 SI. I .I I XX. I. ue-J If I ls2'lII-we .fl ps, Q, QM IM .ff-c I I f If I A I I .. fp- F ,I -. I I f f Q.. 2 if . X' 5,5 ,Fx k I- ,- ,- 1 I fg,,. F III I' If-X' 'Z I :az - X If I P - :fI.QXI.II I-I .I f pg,-XI I I J LITEIIAIIY MAGAZINE 153 .. Xi! - ig fi 3 The I.V. cheerleaders .. ,J cheer on the Homecom- -- ing crowds during the Parade' ' K, V I 3' 1 ,Z t , V xx M Ji, F 1, sez- ,il 4 ,fi ,ft . ,' fl '- '2 1, 41 . 6 Q 'wa aka yy f 3 VVAA I I, a -. f ' I . , V 1 , 1 I , tw an . ,. B fg, Y w, I- A . M ' I vi 21, ec' ' N., . W I 7- Y 1 Q B Q A ll Back Row: Nancy Hughes, Karen Schiliro, Lisa Rocaniello, Linda Davis, Cindy Monohan, Shari Fried- man. Middle Row: Ienny Okin, Sue Byrd, Chrissy Har- nos, Tara Bosch, Connie Moore, Stacey San Giovanni, Toby McKrensky. Bottom Row: Lisa Davis, Dawn Can- non, Holly Fusco, Sue Cavaliero. Ienine Botsko, jenny Cook, Stacey Fusco, Ellen Johan- son, Pam Monohan, Pam Morroti, Meg Pullis, Kerry Walters, Joanne Ward. - ... .- ,4 1. l l . y L ,c,,, L The Varsity cheerleaders under the direction of Senior Lisa Racaniello practice a new cheer for the upcoming game. 154 CHEEHLEADING I .. ,a The cheerleaders await the signal to begin their cheer. Junior Stacey San Giovan- ni cheers the Tornados on to Victory. 4 ' ,, , ' 2 5 r. ,, iizv y fy- 'A A ,mm , -A I, '14, ff 7 Wy., V .. , Q9 M -4V , I f i f 1 V . ' W' P 52 fy A 0 - J.V. 81 VARSITY GHEERLEADING Hello and welcome we're glad that you came. We wish you luck in today's game! So say the Harborfields cheerleaders to opposing teams. Practice begins in early Iune, two weeks before tryouts. Thirty girls are chosen from approx. 100: 14 I.V. cheerleaders and 16 Varsity cheerleaders. Once teams are chosen there is practice every Tuesday and Thursday from Iuly through February. During that time both squads of cheerleaders attend home and away games for football and basketball. Cheerleaders also compete against squads from other schools. We placed well in the competition last year. CHEEHLEAIJING 155 Keeping close to keep warm, juniors Pam Sampson and Kerri Wilhelms watch as the events at Hofstra begin. After halftime, the Drill Team members can be seen frequently getting their jackets from Mr. Shut- tleworth's car. Following Captains Natalie Adragna, Dawn Roe, and Meg Kirschner, the girls follow up the Homecoming parade. ml: .. Long hours of f Summer practice I A inedible camp food 4 shin splints and pulled muscles couldn't stop the DRILL TEAM from The 1985 Harborfields Drill Team had an exciting and rewarding season this year. As you probably already know, the Drill Team is a group of girls who perform at all home basketball and football games and at Long Island Kickline Association CL.I.K.A.D competitions at' SUNY at Old Westbury. In their first competition this year, the girls captured second place. Part of the team's success is due to their attendance at Drill Team camp at Trenton State University this summer. They travelled by bus to the five day camp, where they practiced nonstop Cexcept for lunch and sleepj for four days and put on a show on the last day, doing a great job, as usual. Said junior Missy Holland about the camp, I think it helped, because it brought us all together, and we all had an excellent time! The camp may have helped, but most of their excellence has been brought about by their hard work and Advisor Iohn Shuttleworth's dedication. ,.,.., , j 'W xr - . md. rin, ,,,,, V, ,. , r -- .,- ,, 1, 1., -Y' A ,Y.,N'. ,f .hh -3, r 4,5 ,' . E ..,.,.,91, ., ,, 732 , V -ur: -4, .,v, ,g ' fail, Jw , ,,-, ,, ,, 1, . , , , t ff, - ' - '7' - eff, 5 ' . -' L -. , 4. , Q, , lg .4 W 1 A A if wwf ,. v f -' . ,W Hwzm.-p 1 .T 'f,,, 'f W 1 1.. 4 4,,, 'I 'ig-any 'Atari 1 p- J - n ':t . . ,. , 1s:J-M, . w , A....,. W ,af ,I ZW I , 'Edie' 522 ,N Laying down on the job, the Drill Team members end their routine. HX 10 'W' Q Sw? is af 1 , Front Right: Karen Busweiler, Kate De Groot, Stephanie Calia, Kerri Wilhelms, Kim Cira, Debbie Maher, Beth Fornuto, Melanie Bretner, Elizabeth Schwartz, Tammy Lefkon, Caryn Kalisky, Maria Byrd, Laura Ciafardon. Middle Right: Erin O'I-lea, Don- na D'Anna, jill Nussbaum, Pamela Sampson, Debbie Schmidt, Michele Gelfand, Thalia Comninellis, Sue Guarnashelli, Amy Baur, Linda Galtati, jenny Pantano, Stacy Crichlow, Stephanie Morotti. Back Right: CAPTAINS - Natalie Adragna, Dawn Roe, Meg Kirshner. ......,f.- Q L L ll X ' -3 li ,L'5Z'Q41ia :L'3,42:i'f1f:-'f,I:f , FL. 4. . , . , :A - i What a line-up, just look at those legs!! Leading the Drill Team and band, Seniors Ienny Pantano, Stefanie Morotti and Beth Fornuto carry the Drill Team banner. fan., 0' HARB FIELDS HUOL 1 L, 4 H D . if S4 ge R DRILL TEAM 1157 5222225 Senior, George McKee belts out a solo during rehearsal. I don't want to work. I just want to bang on the ' drums all day, says M senior, Alex Ryley. STAGE BAND MEMBERS, W. C ZANELLI, DIRECTOR Saxophone Ronnie Fleischman Dawn Grattan Alex Heiberger Iulie Howell Chris Nystrom Percussion Glenn Ross Alex Ryley Guido Tries Electric Keyboard Holly Brennen Ienny Dore Mike Lee 158 STAGE BAND Trumpet Claudia Colasante Christine Dore Bruce Iennings George McKee David Sperber Trombone Iay Best Ernie N oa Rich Schellhas Guitar Chris DiCesare Iennifer Fink U. AZZ, SOLOS, IMPROVIZATION . . . HAVE TO DO WITH THE STAGE BAND Members of the stage band Work very hard for one and a half hours on Wednesday nights to perfect their music in preparation for the Iazz Festival in March and their concerts. The stage band consists of brass instruments, percussion, guitars, and an electric keyboard. They play mostly jazz music. Most songs that they play have one or more solos in them, some solos are improvised and others are written in the music. All of their band members Work pays off because they always give top quality performances. mb Y 9. A! lu ' flvfggy Why don't I freak out Mr. Zanelli and play this song by Prince instead of what he wants me to play, says Sophomore Holly Brennan. Future Elvises Sophomore Iennifer Fink and Senior Chris DiCesare sing You Ain't Nothing but a Hound Dog. 43- Freshmen Ronnie Fleischman and Chris Mystrom have sax appeal. STAGEBAND 159 Chrissy Suchan, Sandra Walters, Kim Marshall, Beth Fornuto, Chrissy Shanahan, Jill Nickerson, Ienifer Cam- ball, Ruchel Ramos, Holly Fusco, Ienine , Sue Walking, Lauren Gallagher, Laura Fox, Nicole Sordi, Kei Sochi, , pn 'Wifi Q35 Eilene Fox. 2 I . ,ff f .,..,Ljf fl ,, l l The Girls Leaders try to arrange themselves in order for their picture. Ienine Bruno and Eileen Fox sort out the mailing cards for the candy grams. Iill Hickerson, Ienine Bruno and Eileen Fox 3 :,', await their perspective 'I customers. I60 GIRLS LEADERS l L LLL L 25 Coach Mayer, Ian Adrion, Darren Brady, Phil Clemente, Brad Martin, Chris Alferie, Chris Orr, Kevin Flanagan, Doug Venuti, Rob Rodler, john Quinlan, Darren Butler, Pat Godfry, Jeff Slippin, Iimmy Garner, Tyler Grombac, Ray Alberg, Kenny.,Marchia, Brian Myles, Roger Morgamflargx lJDBiapj5,'Keith Bookhard. BUYS A D GIRLS LEADERS To be a Girls or Boys leader, there are some requirements one must have. First, one must have a certain grade average. But probably the most impor- tant requirement is how much one participates Within the school and in the community. This is important because, of course, the Girls and Boys Leaders . . . t. e do so many activit1es in the school. They sold candygrams at Christmas 1m and Valentine's. In past years they have decorated for dances at the school and done car washes. If you like to help out around the school and have a good grade average, you may become a Boys or Girls Leader too. I 4. ul 'Q V X A A I ff ,ff 5..,..,,,,,,. aj. ,f ,KM-,. ,J -.J ry! 11 Ilene Fox and Jeanine Bruno try to read the secret holiday messages without anyone noticing. BUYS LEADERS 161 lTS'S NUT RUBUTICS . . lT'S INTUITIVELY UBVIUUS FUR DUB VICTUHIUUS MATHLETES The Mathletes Club is a group that, as its name suggests, works out math problems and does so under the careful guidance and supervi- sion of the world-renowned mathematics professor, Mr. Toby Kissam. The group itself is rather in- formal but is composed of students who not only have a knack for math but also a solid interest in the sub- ject. There has to be a willingness to concentrate and work out problems intuitively rather than simply ap- plying formulas and laws robotical- ly as can be done by any computer or calculator. The activities of the group consist of monthly competitions with three of our other schools locally. The results are then sent to a county- wide competition in which the top teams in Suffolk county are recognized at a formal dinner and awards ceremony. The individual meets themselves have a rather social and relaxed atmosphere with plenty of gooey donuts and soda, which help to raise everyone's blood-sugar and caffeine levels to prepare them for the rigor of the ac- tual competition Cand if you believe that one ...J. Then a series of six questions are given to be ac- complished in a limited time of bet- ween 4 and 6 minutes per question. The Harborfields' team is doing fairly well this year, coming out on top in our division as of Feb. 15, pushing Iohn Glenn, Northport, and Commack to miserable defeat. It is possible that our team may even place in the county. This decision had to await the results of yet unen- countered competitions. A number of our chief com- petitors will be leaving this year to move on and apply the vast talents and skills gained through the Mathletes to the world in yet un- seen and yet unknown dimensions to bring the Light of Wisdom to the Darkness of Ignorance . . . Above right, senior George McKee is all smiles when he realizes he can do a poroblem that no one else can figure out. Members of the Mathletes team pose for a formal picture. 162 MATHLETES ,J . Left to right. Kenny Shindler, Dennis Reichold, Matt Ricciar- di, Paul Hewitt, Dan Murdock, George McKee, Ienny Samp- son, Iay Best, Alan Schnittman, Paul Sefsik. Far right, advisor Mr. Kissam helps senior, Alan Schnittman with a challenging problem. How on earth do I do this one?! says senior Iay Best. ,,,f-W. -1 E.:-'W -1 x gi' if .2 F at 7 ' 5 FOREIGN A LANGUAGE CLUBS This year, the number of foreign language clubs in the school totalled four CFrench Club, German Club, Italian Club, and Spanish Clubj. Along with their own in- dividual activities, together the 1 1 clubs participated in National Foreign Language Week during the week of March 4th. Each day of the week, the cafeteria ladies prepared foods from five dif- rc ferent countries Cone on each dayj. Due to after-school rehear- sals for Oklahoma! , the main festivities took place two weeks later, during the week of March 18th, when there was a big volleyball tournament and then , an international dinner to follow. Although there was a lot of competition, a fun time was had by all! Each club had little things of their own to do all year. The French Club, with their advisor, Mrs. Khatir, started out the year with fund-raisers and then went to Peche Mignon, a French restaurant in Hun- tington Village. The club has seen a few French movies. Other activities include carving L'Arc de Triomphe out of soap, and listening to the music of popular French singers. The students have also signed up to get French pen pals. They planned on ending the year with a big French dinner. The German Club also had a succcessful second year with the help of their advisor, Mrs. Scheef. They started out the year with a big Oktoberfest on October 24. Various German foods were cooked and brought in by German Club members, the Oompah Band played familiar German melodies, and plants and Advent calendars were raffled off. It was really a fun evening. The club also hosted a Christmas party for the Steuben Society. The Italian Club's main event of the year took place from October 27th to November 10th, when eight Italian students, and the club's advisor, Mr. Pavone, went to Italy as part of an exchange program. In March of last year, Italian students came here for approximately three weeks, and, in exchange, some of our students went back there. The American students were able to go to school with the Italian students and were also fortunate to meet with the Mayor of Genoa, as well as to see many familiar Italian sights. The Spanish Club, since this was the first year of existence, with their advisor, Mrs. Khatir, used this year as a building- year. They had many fund-raisers in order to build a solid treasury. They had a small fiesta to celebrate Three Kings Day, where various members baked different types of Spanish goodies and they listened to Spanish music. Students need not take foreign languages to join these clubs. They are a lot of fun and offer many different activities. FOREIGN LANGUAGE CLUB 163 STUDENT UNIUN Where service is the name of the game Sometimes school can be down right depressing. Work, work and more work, that's all we seem to do. At one time or another during our high school years we've all, some more than others, felt locked in and frustrated with our daily ac- tivities. In many cases it's not nearly enough to just sit in a noisy cafeteria or be held in silence through an agonizing study hall. There must be another way to relieve our painful tensions and suppress our negative feelings. The way of the wise is a visit to your friendly Student Union. Here with its laid back atmosphere and non-demanding attitude one can regain his or her self esteem which enables one to face the remaining portion of the day with a renewed outlook and regenerated powers. The Student Union's effect on its patrons by no means stops there. The Union's arms extend far beyond its outer- most walls reaching at one point in time every student and teacher alike in Harborfields. DID YOU KNOW: The Student Union is a completely self supported organization with all finances generated through its own programs and activities. All profits at the end of each year are donated to the various clubs and organizations to insure their survival and ease their financial burdens. All moneys collected specifically from the Student Union recyclable can drive will be donated to aid the unfortunately starving children in Ethiopia. Each year the Student Union awards a special academic scholarship to a deserving senior. This year's scholarship will be 550000. From more of an athletic point of view, the Student Union Sponsors Several Unions key foie in school and scholarships helping many these boys are doing just that. students who wish to attend summer athletic camps. The Student Union has helped our athletes to a far greater extent by donating a substantial amount of money towards the purchase of the universal gym on which they now train. The Coca-Cola company's donation of our new 53,000 foot- ball scoreboard situated on our football field was made possible solely through the dealings of the Student Union. The large school banner displayed by our Color Guard at all of the performances by legendary Harborfields Marching Band was donated by the Student Union. The Student Union operated the Harborfields Book Store which carries a vast supply of pens, pencils, notebooks and cut-rate review books in Biology, Earth Science, History, Chemistry and Physics. Yes, the Student Union has much more to offer than the obvious soda, pool, football and pingpong. Its service stret- ches far beyond the more than 500 to 600 students who pass through its doors each day. There is but one person who can be credited for the incredible success of the Student Union. The Student Union staff and the entire student body thanks Mr. Emory Butts for his masterful creation. Let the Student Union be part of YOUR day. Socializing is the Student by I ANDREW BosAK T64 STUDENT UNIUN All Emory Butts, Achim Klingman, Andy Bosak, Ken Kemp, Marcy Aronowsky, Dawn Morrell, Angela Miles. el Whether it's to Michael Iackson or the D N score of Oklahomal, they just keep on . . . r. 1. 'F-7 ' . I A Q.l,Q.4.,r,44..4 .J4.,,Q.ll:Z...-.fo ,i,t:s,.f Dance Co. Members Lucia McClorey, Iennifer, Berg, Chris MacMillan, Carol Mac- Millan, Kimberly Mark, Mary Ellen Mendler, Beth Ann Stramara, Tonya Monque Harewood, Kendra Thompson, Monica Wagner, Margaret Chapman. The 1984-85 Harborfields Dance Company, run by ad- visor Patti Dohn, had a very successful year. Patti has choreographed both Dance Company and Theater Company, including this year's musical, Oklahoma! During the year, the Com- pany did numerous dances and warm-up exercises to familiar pop artists including The Iackson, The Pointer Sisters, and Huey Lewis and The News. They give perfor- mances in the other schools of the district to maintain the discipline required in danc- ing to an audience. Also, they like it! We do, too. .,, I ,,,. .fu-an--A-w1v', 5 wha' E. BUTTS, ADVISOR I always feel like somebody's watching me! a view from Mr. Butts' office. Chaos is no stranger to the student union. As you can see from this pic- ture it looks like rush hour at Penn Station. DANCE COMPANY 165 f 1 ff' v J. 1 0 - X 1 '. ,V Z fo .51 5 , 1 f' WWA :Q Q Rx N 'SBXXX as Q W An arm of student government, concerns are discussed in the Students sometimes feel PRINCIPAIJS DVISORY COUNCIL that the battle lines between themselves and the school's administration are very firm- ly drawn and uncrossable. i 350 Hugs mg But the Principal's Advisory Committee, a group of students who meet with the Principal twice a month, seeks to cross those lines and improve communication. During the past year, the topics of the PAC's dialogues with Mr. Taylor have ranged from the smoking patio, cafeteria and an- nouncements to testing and curriculum changes. The PAC is open to sug- gestions and participation Mr. Taylor, Sid Gardner, Beth Kushnik, Kei Sochi, Navey Hughes, Heather Pyke, Ann Sochi, Jill Nussbaum, Andrew Atkins. from all students because school can be a problem for almost anyone somewhere along the line. -4-, '52 , 44 ...five .'f'-.fw 'g. , .,. ,:f , . :A f . ' . N f' p r A .. -we-iz.: :f Reflections, taken by junior, Mark O'Shaughnessy. Qbf' Ms. Phillips, Audra Demadona, Beth Ann Stramara, Marla Stiller, Susan Woo, Kimberly Mack. Not pictured: Iillian Griffiths, Hope Leopold, Chrissy Suozzo, Mark Frederick, jay Schoenfarber, Dave Sperber, Alan Williams, Doug Smith, Chrissy Blanco and Ken Foret. Sff11ff.fl,i.i1Sjf5f1i?QhtS... THE LURE it's all part of This year, the Photography Club consisted of both experienc- ed photographers and people who were interested in learning a little about cameras and darkroom procedures. The students helped compile pictures for both yearbook and Newspaper, as well as doing projects of their own. PHOTOGRAPHY!PRINCIPAL'S ADVISORY COUNCIL 167 Helping to keep the spirit alive at football and basketball games is the job of the PEP BAN Pep Band: a group of approximately 15-20 members of the Marching Band land one seventh-grade drummerj who cheers the football team on at away-games and the basketball team on at home-games. The Pep Band plays familiar tunes such as the Fight Song and Go Green Go to either help cheer the team on when they score, or to get the team out of a rut when they haven't scored in a while. The purpose of the Pep Band is to help lead the football and basketball teams on to victory. At halftime, after the cheerleaders and Drill Team have finished, the Pep Band uses the left-over time to entertain spectators with some of the mar- ching music, such as Maniac or Son of a Preacher Man. The Pep Band had a very successful year this year under the leadership of co-captains Hillary Fink and Iulie Howell. Buttons were ordered and delivered to each Pep Band member in time for the basketball season so that people would know who the band members were. Also, at it almost every basketball game, there was a theme, such as Hat and Shades or College Sweatshirts, which described how each member should dress. There is no theme for the away-football gamesg in- stead, it was a kind of contest to see who was able to dress the warmest! The band traditionally end- ed their successful season with a Gourmet Dinner of pizza and soda at Mr. D's house. Look! Even the instruments get into the spirit of Pep-Band. This time the theme was Hat and Shades. 'k I juniors Mike Iensen and Charlie Hudson discuss what song they can play as a duet to entertain the spec- tators during a time-out. 168 PEP BAND Senior Karen Domencetti, known for playing strange solos at basket- ball games, takes a moment to think through a popular melody before putting it through her instrument. Y If the game is going slow, the Pep- Band will entertain themselves as well as the audience as Dawn Grat- tan is doing with someone's flute, 1984-85 Pep-Band captains Iulie Howell and Hillary Fink kept up a good group this year. T Helping Teachers Left to right: Hillary Fink, Mike Lee, Kei Sochi, Sue Byrd, Nan- cy Hughes, Kerrie Lanigan, Michele White, Robert Uebele, Charlie Hudson, Iohn Moore, Iennifer Fink. Below, Left to Right: Rich Goldbloom, Eric Mayer, lan Rodgers. The Harborfields Helping Teacher Program began last year, giving students an oppor- tunity to legally leave school Q grounds and walk across the street to TIL during their lunch and! or free period to assist one of the teachers in his or her classroom. The program was started for three reasons. One reason is that, within the next few years, there is expected to be a great demand for teachers, and Mr. Ryan, the coordinator, and Mr. Garvey want students to get experience in teaching and to acquire an interest in teaching as a career. The second reason is to give teachers at TIL assistance in the classrooms. The third reason is to give students an opportunity to give service to the community. .-1' Kei Sochi listens attentitvely to Mr. Ryan during a meeting. ' STUDENTS HELP TEACHERS While at TIL, students have the opportunities to both get to know a teacher better and to work with children. Sometimes, the student-teachers help the children with homework while, at other times, they either help the children with an art project or read them a story. Working at TIL is a very en- joyable and rewarding ex- perience for the both the Help- ing Teachers and the teachers at TIL. HELPING TEACHER PROGRAM 169 FROM VIDEOTAPES TO SANTA IT'S ALL A PART OF . . . THE HISTORY CLUB The History Club is an organization that performs ac- tivities Which sometimes relate to history and sometimes don't. The club does both fun things and service projects. The club has an annual journal entitled the Historical Review, which is composed of articles pertaining to history itself, social studies, electives, viewpoints on issues, etc., all written by members of the club. The club participated in Newsday's Adopt a Family pro- gram. In order to fund the project, they set up a booth in the cafeteria for people to have their picture taken with Santa As citizens, we all have a responsibility to help each other, said advisor, Mr. Klein. This is our way of making a start. As in the past, the club also participated in National History Day at Nassau Coliseum. Students from Harborfields compete with students from other schools with historical projects ranging from written essays to 3D projects to videotapes. The club also took their annual field trip in the spr- ing, and had a great time, as usual. Members of the History Club pose for a group picture. Front Row, Left to Right: Tracy Walsh, Kerrie Lanigan, Matt Ricciar- di, Danny Murdock, Keith Peterson. Second Row, Left to Right: Naomi Neville, Kei Sochi, Terri Ferguson, jay Best, Mike Leef Third Row, Left to Right: Renee Mesard, Carl Einsel, George McKee, Bruce Koch, Ad- visor, Mr. Klein. Fourth Row, Left to Right: Robert Koch, Kenny Coen. Mr. Klein, the advisor, listens to club members arguing as to where they want to go on a field trip. x The HARBINGER, the Harborfields' HS newspaper, has been making slow progress from the two issues published last year to the once-a-month publications that are hoped for in the near future. Steps have been taken by the staff of the Harbinger to in- sure that this will happen. For example, in Iune of last year, two Harborfields students attended a conference held at C.W. Post College designed specifically to give suggestions as to how to lay out, set up, and run a newspaper. Hillary Fink and Alan Williams, the two students who at- tended this conference, were also given the unique oppor- tunity to Write for Newsday. In a September issue, an article titled Do You Have A Pass? appeared with Hillary as the author, and another entitled Cliques Don't Click appeared as written by Alan. Despite the common problem of a very small staff, the Harbinger had a very successful year, starting all the way back in September with an issue within the first several weeks of school. Their work continued throughout the year, and will conclude with the Senior edition, which will be distributed at the graduation ceremonies. 170 HISTORY CLUB -.Q Q-.m.,....,...fp-ff ess.-194915 asffffpasrl Co-Editor-in-Chief Alan Williams looks through a book of Feature ideas for the next issue of the Harbinger. Alan Williams and Feature Editor Hillary Fink try to figure out the best way to do the layout for the March issue. .f 5 l jf!!- if f The Harbinge N Co-Editors-in-Chief . . . ..,......... J. . . .... Alan Williams Jeff Nunes ABBOCi8Tf6 Ediwr .... ,,,..,. K aren Kane News Editor ,........... ..... D avid G-oldblatt Feature Editor ......,...,. ...... Hi llary Fink Assistant Feature Editor .... ..... M arife Ramos ' Sports Editor .........,............,.....................,....... Mike Lee Exchange Manager .................,....,.................. Jennifer Fink Q Staff: Jill Bentivegna, Robin Birch, Holly Brennan, Angela Cheng, Ken Coen, Adam Golden, Bruce Koch, Robert Koch, Jenny Nunes, Keith Peterson, Rich Schellhas, Kenny Shindler, David Sperber, Chris Stasi, John Tilden, Susan Woo k Faculty Advisor - Mrs. B. Springer J 1 , W MJ Lx if EUQA ',,,-o-il 1- I: nf ,- T , M11-ff 1 . NX L.. X u 5 .. S Staff members Susan ..... Woo, Dave Goldblatt, in AMN, X go, A v' A' Iill Bentbivigna and fin ' , Alan W1111ams pose for , hggijgff , F ' lCEI'2'.' a picture. 'V' p - pk? H I I , , nl V in V A ' -- n ' .f f- -A E -- 1 , ,fi-1 . 1, V' 7. 'X . ' ?f '. Jif'3 1 . ' V' , , 'V' ' - 7 so -li ' '- ,-K , ,, nfl 13 . , ' f' 4 ' 1 , ' :c- ,. , V, 9 .- ' -. ,I-L, , . ,Q Z f, U V ' , f C ' V so rw.,g21ff -o ,fl 0 ' . ' xx -X ww 3 s X I 1 . I - A .fx xx ' , ' v -5 47 - 5... f N -2 ' b ,.., ' ' ' ' ' -W 'Wi ,Q .: f e .. , ,,, 6 if ' s X f A Q ' 3 .Q - ' ' . xl . Ni' or QC Q .1 1 1 ', 'Q' .sex .Q , 0. s - ,s ,, I 'JS 'sr 0 5 ' H Advisor Mrs. Springer laughs at one gx ' 'ox 4- ,' if of the cartoons in a Harbinger issue. - .f' f- 5 J - . y , ., -hw- ,sxcgr I ff ' 1 , To .L .4 NEWSPAPER 171 THEATRE COMPANY The Harborfields Theater company is an organization for students not only interested in acting, but other areas such as music, lighting, carpentry and painting, to name but a few. The Theater Compan puts on three plays per year -- two dramas and one musicall The musical takes much more Work and preparation than a drama does, not that a drama isn't a lot of work to put on. The actors are not the only people who prepare for a show. When putting on any production, there are many hours of long, behind-the-scenes preliminary work involved. The stage crew is responsible for constructing and painting sets, and making sure that everything is in the correct place, scene-by-scene. The technical crew designs lighting and records sound effects and is in charge of making sure that this type of work goes smoothly during performances. The publicity crew makes sure a poster is done and is responsible for making as many people as possible aware that there is go- ing to be a show. The playbill committee makes sure that a playbill is printed that includes anyone's and everyone's name who was involved with the show in any way. The props crew arranges the props on the props tables in the order that they will be needed in the performance. The make up crew makes sure the actors have enough makeup on so that they won't look pale under the bright stage lights. The producer is in charge of keeping all of these committees under control. Eligibility for membership in the International Thespian Society is determined by both the quality and the quantity of one's work in at least two aspects of the theater. At the end of each production, people are awarded points for their in- volvement and once they have a certain number ac- cumulated, they can become members Of the Practicing for the orchestra pit for Society. ok1ahoma. There are so many dif- ferent things to do in theater, it's sometimes difficult to decide what to work on for a production. Cast of Oklahoma! Back Row: Rodney Friedank, Bruce Iennings, Chris Springer, Ray Lewis, Craig Fichtel, Dennis Reichold, Steve Lanza, lim Howard, Doug Venuti, Sue Robinson, Holly Brennen, Vanessa Steets, Rich Schelhaus, Jennifer Fink, Brenda Clark, julie Howell, Lisa Brownstein, Alan Williams, Carol Mac- Millan. Front Row: Ray Scott, Kevin Hudson, David Tellerman, Kristine Palmieri, Sue Harbach, Mark Slippen, julia Harmon, Chrissy Lawless, Sharon Tashmen, Paula Ammarati, Naomi Neville, Charlie Norwesh, Karen Herbst, Karen Domenatti. 172 THEATER COMPANY , K .... A41 Iulia Harmon sings a part for Paula. Let's sing Oh, What a beautiful morning in a round guys and bug out Mr. Czena. IT MAY NOT BE THE REAL THING, BUT IT SEEMS LIKE IT IS AS H.I2. STUDENTS TAKE ALBANY BY STORM This year's Youth and Government officers: President - Kei Sochi Vice-President - Alan Williams Secretary - Naomi Neville Treasurer - Kenny Schindler Public Relations - Iennifer Fink Mr. O'Connor discusses a fine point of the law . . . Youth and Government is a school club designed to let members get an idea of our government's procedures and a possible career in the area of government. Early in the school year, each member decides on the branch of the club he or she will enter, and the careful, serious work beings. The branches are Iudicial, Executive, and Legislative. Those who choose the Iudicial Branch act as lawyers in an appeals court where they appeal real cases. Seven justices and one chief judge are higher positions a per- son can hold. This branch is informative and inspires many to look into the field of justice in the future. The Executive Branch is made of individual departments which justify bills being presented in the Legislative Branch. A Legislative Branch member writes a bill which is ranked and debated by other bill-writers. All dedicated members travel to Albany in the spring to present their work to other students who belong to the pro- gram from all over New York State. Besides the three bran- ches of government, other activities in Albany include Press Corps, which writes a newspaper distributed at the end of the Albany Conference, to all program members. There are also Lobbyist and Page positions held. The state conference in Albany is a rewarding and fun experience for all. The Youth and Government program is very successful in our school, thanks to the Advisor Mr. Tom O'Connor and the students who have devoted so much time. This year, many persons from our school have received honorable positions in Albany, including Kei Sochi fthe presidentj who has posi- tion of Attorney General. Others are: Laura Carillo - Committee Chairperson Tricia Endres - Deputy Attorney General Liz O'Driscoll - Assistant Attorney General Luke Shaedle - Sargeant at Arms Rachel Wifall - Board of Regents I l A ow 1, Left to Right: Naomi Neville, jennifer Fink, Celine Bernstein, Iill Stern, Trish Endres, ZKimberly McKee, Laura Carillo. Row 2, Left to Right: Allison Hilsky, Sheila Egan, Kei Sochi, Peter Bakel, Renee Misard, Lori Ann Sabatino, David Goldblatt, Michael Mathis, Gertrude Bakel. Row 3, Left to Right: john Tilden, Robvert Uebele, Mike Malone, Kennyu Schindler, jay Schoenfarber, David Sperber. YUUTH AND GOVERNMENT 173 MR. ATKINS - ADVISOR .-, .:, , ' f ,L . A MR. HICKERLSSN STUDENT ACTIVITIES FUND TREASURER. SENIOR CLASS OFFICERS Pres. - Meg Kirschner V. Pres. - Marla Byrd Sec'y. - Michelle Gelfand Treas. - Rachel Ramos Hist. - Lisa Racaniello JUNIOR CLASS OFFICERS Pres. - Charles Norwesh V. Pres. - Marafe Ramos Sec'y. - Nicole Sordi Treas. - Mitchell Herman Hist. - Sue Wohleking CLASS OFFICERS, EXECUTIVE BOARD, PRINCIPAL'S ADVISORY COUNCIL ALL COME UNDER THE UMBRELLA OF STUDENT COUNCIL IN DEFINING THE I . thusiastic students on a monthly basis and terrific things can happen. This year's Student Council really towed the line and in the process not ' only provided the student body with some memorable events but also made some major and lasting improvements in the Council itself. Highlights of this year's activities include the most suc- cessful Homecoming in years, the establishment of a new high school tradition - Senior Slave Day, and a twelve hour Superdance to benefit the Muscular Dystrophy Association. The Council members became more responsive to the needs of the groups they represent with the institution of regular reports on Council activities. Business at Council meeting ran more smoothly because of increased atten- tion to parliamentary pro- cedure and improvements in the Council's organization. The Student Council is already looking down the line toward next year. I Gather together a group of en- The Executive Board is composed of the Student Council officers and class presidents. Front Row, Left to Right: Chris Alfieri, Rick Capriola, Larry Feins- tein. 2nd Row, Left to Right: Charlie Norwesh, Phil Clementi, jeff McMillan and Meg Kirschner. Not Pictured: Mike Friedman and Angela Cheng. 174 STUDENT COUNCILICLASS OFFICERS -.va bw- ttf x - f 4132. 1. 5 , .1 law, 34, .fy-. f-, ' 7':i2'?-'52,-g ' . ,U 7.,,w.. 5, . ,,45,,, .g, L.-gqygf-,,. ,1 2, . -I apr-. an .7 ffjyg V' ,ig gs I-SX L, 2 1 1-Qw Q it I, Gertrude Bakel Angela Cheng Kelly Christophides john Donovan Frank Douglass Kara Forte Stacey Fusco Sid Gardner Lisa Grundas Jenny Hartnett Brandi Hynds Beth Kuschnick Melissa Lopes Robin Mendolsohn Pam Morotti Kristen Palmieri Emily Pooler Brent Procida Meg Pullis Andrea Roemer Jeffrey Shade Ann Sochi Ray Suris Vivian Turnek John Viteritti 10th GRADE Adam Balkan Laura Ciafardoni Rob Clinard Jennifer Cook Stacy Crichlow Mike DiRisi jenny Dore Rachel Fenderson Jennifer Fink Rhea Fludd Michael Friedman Lauren Gallagher Sean Houston Nancy Hughes -Colleen Kent i Chris Kohler Toby McCrensky Tony Millon Marina Pastorelli Andi Pukke Joel Rodgers Anthony Shade Karen Schiliro Ken Shindler Ion Silverman Sue Sullivan Rich Suris Kerry Walters Qs, 11 GRADE Michele Brodein Sue Byrd Dawn Cannon john Caracciolo Barbera Cavalieri Loraine Christiansen Kelly Christophides Mike Cody Todd Cook Karen Cook john DeRisi John Diamantopoulos Morna Flanagan Brian Forte Mitch Herman David Hernandez Beth Kuschnick Kim Marshall Iill Nussbaum Charlie Norwesh Pat O'Connor Mark O'Shaughnessy Andrew Roth Eloise Saltz Stacy Scarduzio Kei Sochi Nicole Sordi Mark Stein Ric Trotta Mollie Weiss Su Wohleking 12th GRADE Chris Alfieri Stephanie Berliner Darren Brady Maria Byrd Stephanie Calia Rich Capriola Phil Clementi Larry Feinstein Ann Fredrick Shari Friedman Holly Fusco Michele Gelfand Caryn Kalisky Meg Kirschner Iim Kremens Russ Leggio Brad Martin Mike McGowan jeff McMillan Dan Myers Lisa Racaniello Ruchel Ramos Doug Venuti Vin Panetierri Sondra Walter SOPHOMORE CLASS OFFICERS Pres. - Mike Friedman V. Pres. - Anthony Shade Sec'y. - Toby McCrensky Treas - Nancy Hughes Hist. - Lauren Gal agher FRESHMAN CLASS OFFICERS Pres. - Angela Cheng V. Pres. - Ray Suris Sec'y. - Jeffrey Shade Treas. - Ann Sochi Hist. - Pam Marotti STUDENT COUNCIL 175 Tom Abraham. Activities: Boating. Likes: M.C., Myron, Lying. Fond Memories: IC. Ieeps, Lake George, The boat. Future Plans: Gain weight, not to get married, have 3 kids. Laura Michele Adelstein. Nickname: L.A. Laui Marie. Activities: Marching band, concert band, student council. Likes: Weekends, ice cream, par- ties, softball games, having a boyfriend, B,K., swimming, Rangers. Fond Memories: 11284, 5fl9l83, summer of '84, HI w!Shari '83, Camp Ramah, Prom '84, Florida '83, Chinese dinner at L.M.'s Natalie Marie Adragna. Nickname: Maui, Nastassia, Lee, Activities: Gymnastics, Band, Powder Puff '83, '84, Drill Team tCapt.J. Likes: Pink, Robbie, Strawberries, The Rockettes, Indian Summers, Lauren, Green Eyes. Fond Memories: l0l29!82, jets game, being with Rob, tailgating with Maros, Homecoming '83. Future Plans: To enjoy a successful, healthy life and somehow repay my parents for all their love and support. john Alberti. Activities: Frisbee, eating, sports, music,life: Likes: Parties, Purgatory, neutral drops. Fond Memories: Battle of the Bands, The rock star weekends, The fort: Carl Albuquerque. Nickname: Alba. Activities: Marching Band, Debate Club, Lacrosse, Y dz G, Likes: Snow, hunting, insect repellant, cold, music, guerilla war- fare, color orange, Rangers, Hofstra. Future Plans: College, desk job, marriage, children, money. Ray Alburg. Nickname: Ice. Activities: Playing basketball. Likes: Cooling out with friends, going shopping, girls. Fond Memories: Going to N.Y.C., bugging out, going over to Rob's house, hanging out in Bubba's truck with Scott and Roger. Future Plans: To be rich! Kathleen E. Alessio. Nickname: Kathy, Kath, Woman of the'80's. Likes: Good friends, Firebirds, summer, weekends, sleeping late, mint chocolate chip ice cream and hot fudge. Fond Memories: Summer of '84 L.C: and D.B. 17th birthday, 4th of july with P.T. 6126184 with P.T: Christopher T. Alfieri. Nickname: Alf, Crusher, Swiss. Activities: Football, Basketball, Stu- dent Council, Powder Puff, Float. Likes: Parties, Mr: Inevidable, win- ning, ski trips, weekends, my master mixes. Future Plans: College, Family, Money, Happiness: janet Antorino. Nickname: jan-jan, product-2, S.S., interplanet Ianet. Activities: Tennis, Skiing, Bowling. Likes: Concerts, Neil Young, party- ing, friends, V.K. and F:P., American pie. Fond Memories: Ski-trips, Neil Young tour, Spring break '83, Florida '84, Great Adventure Future Plans: Traveling, Nurse, Don't let it bring you down Ann Margaret Ardito Nickname: Annie Activities: shopping, working, spending money Likes: Alex, vacations, Saturdays, the beach, being wlfriends, par- ties, Prince, hanging out, driving. Fond Memories: l!19!82 tthe day that I met Alexj, Summer of '82, Bird Island '82, Ardito Beach w!E.H., L.H., and D.F., Sunshines wlC.G. and DR. Future Plans: College, Success, Happiness, Wealth: Kristin Taylor Asher Nickname: Kris, Krissy Activities: Softball, Partying Likes: Hendrix, Led Zep, Stevie Nicks, RQR, l960's, Woodstock, All kinds of skiing, B:H.'s, Trips, Friends, Softball. Fond Memories: Talking to T.F., being best friends with Craig, go- ing sailing with Charlie, going ski- ing with Sha, being young. Future Plans: Graduate, move out, have a party Pamela Bailey Nickname: Pam. Pammy Likes: Summer, sleeping late, danc- ing, money, weekends, roller- skating, love songs, Syracuse, paychecks, etc. Fond Memories: Syracuse, Mr. Finn's English class, Class of '84. jodi Kim Balkin Nickname: Io, Iotes, lotsabets, Hodi Activities: Tennis, Badminton, Powder Puff, Basketball team, Girls Athletic Council, History Club, CollegeShopping Best one-liner: Let's go get some firewood! Future Plans: To marry a nice, jewish doctor William Richard Ole Bertram Ir. Nickname: Whitie Activities: Soccer, Tennis, Golf, In- tramural basketball, Leaders, Stu- dentGov't Likes: Making Flippy-Floppy, cocktails, Beek's wl the Boys, Polo's and Bermudas, Mr. Inevitable Fond Memories: Beefsteak's, AGAP,AGAS Future Plans: Win Lotto and blow the money on a party with Van Halen Laurie Balsamo Nickname: California Activities: Advanced art, yearbook Likes: Raf, art, shopping in the city, California beaches, dancing, par- ties, Mercedes 450 SL, funky earr- ings, weekends with Raf, muscles! Fond Memories: Sneaking on Senior Trip '84, G,A. when I was a junior, when I got the pumpkin, Summer '84, Hampton Bays, sail- ing, skiing, Beefsteak Charlies's. K.I,, Mariner's Inn, T:T.'s, Landind, smushing cake in Sue's face. Future Plans: College for adv. art, success, live in a California beach house with my Mercedes in the driveway. Stephen Baudo , Activities: soccer Likes: girls Future Plans: Diesel mechanic Michelle Theresa Benitt Nickname: Flo, Mica, Mouse Activities: Volleyball Likes: Cruising, horseback riding, skiin , summer, quarters, McD's, traveFing, road trips in the rowdy- audi, Ludlow, Vermont, sunsets, good friends Fond Memories:Germany- Denmark '84, RS 2378, Lehigh lil and 32, the 4-some, no brakes, T2, manhunt, feelin' groovy, Hamp- tons '83, l2!3Ol81, Reds w!D.B,, hanging out w!S.G., E.E., D.B., etc. the B.B's Future Plans: college, marriage, health and happiness Stephanie E. Berliner Nickname: Este, Steph, Stephie. Berlin Activities: Harborfields Theatre Company, Youth Group, Student Council, Candystriping, YG Pres., Powder Puff Likes: Family, pepper, shopping, GH, YG, ferris wheeling, GP's, gossipping with jen, Bo, Dool, telephones. Rick's, The Med, Chinese fire drills, laughing, cast parties. Fond Memories: ARS, PowderPuff '83, Summer '83 8: '84, Monday nights, downtown with Meg and jen, Fiddler. Future Plans: college, marriage and happiness. jay Best. Nickname: Bigfoot. Activities: Stage Band, Band, Orch., Pepband, History Club, Debate Club, Honor Society, Trom- ba hones, Ladd. Lilgesz Intelligence, Incredible Beauty, The Combination of the First Two. Fond Memories: Mr. T's Class, Mr. B's Class, Roofs, Libraries, Rick. Future Plans: Conquer the World. FROM LITTLE KIDS , TO BIG KIDS . BABY PICTURES AND BLURBS Sheila Blue. Nickname: Bluey Blue. Activities: Rollerskating, Eating. Likes: Pizza, Being Around Funny People, The Jacksons, Fond Memories: The Day I Met Candi Station Future Plans: To Go to College and Become a Successful Business Woman and to Own 10 Pizza Shops tNear Mel. Sandra Lynn Boccia. Nickname: Sandy, Sander, Van Okre, Fiona Flaps, Big Fat Hen. Activities: Badminton: Likes: Cam, Mom, janet, Steve, Rudy, 5, N.Y: Rangers, The Who, Gold jewelry, Clothes, Roses, Porsche-'s, jean Russo, Annabelle. Fond Memories: Vermont With Cam 84, V:A. 84, Niagara Falls 84, PA, 9th Grade. Future Plans: To Live to See the N:Y: Rangers Win the Stanley Cup, To Be Healthy, Happily Married, Have a ton of Kids. Barbara Ilse Born. Nickname: Bar, Barbie. Activities: Shopping. Likes: Pink, Pearls, Gold, Mom'S Cooking, Summer, W.W. Group BB. and More B's, Barbados, Gun- nies, Van Halen. Fond Memories: Montauk 84, Sur- prise Party 82, Battle of the Band 84. Summer Of 84, Van Halen 82. Future Plans: Berkeley College, Travel, Marriage. Denise Borneman. Nickname: Dee. Likes: Weekends, Summer, Vaca- tions, Sunsets, Good Friends, Hangin' Out WIKA, KD, LC, MB, SG, The Ocean, Sunny Days, LC Be- ing 2nd Mom. Fond Memories: 17th Birthday, Virgin Island Trip WXSG, Cruisin, the 4 Some, LC Birthday, Great Adventure 7-29-84, Para-Mouse, Hamptons 82, 12:00 Mint, Reds WXMB. Future Plans: College Health And Happiness: Tara Lynn Bosch. Nickname: Ta. Activities: Band, Cheerleading. Likes: Friends Phones, Good Music, The Police, Big Parties, Piz- za, French Fries, Spending Dad'S 5, Summer, Surprises. Fond Memories: Police Concert With B. D., R.O.I. at Craigs, Cruisin In The Truksters, Summer 84, 8-18: Future Plans: College, job, Mar- riage, Family 555. Susan Nanette Botsko. Nickname: Susu, Suey, Suzie-Q, Activities: Dance, Yearbook tTreasurerl. Drill Team. Likes: Earrings, Sunny Days, Strawberries, Ballet, Accents, Busy Streets, Red, Toffuti, Individuality, Close Friends, Exotic Islands. Fond Memories: Summer 84, Sunrise, When Laurie Got The Pumpkin , Vermont, Candles S: Cloves, Beefsteaks, The Hard Rock Cafe', Taking A Midnight Swim, Special Talks With Special Friends. Future Plans: To Pursue a Dancing Career. To Travel the World. Christine Boyer. 7 . Y mf?-' ncwf ,- ,., . is , 'sa f' f N '92.:z-,ge . 49 L. Adelstein N. Adragna M. Benitt S. Berliner Ie. Bruno jo: Bruno L. Carillo S. Close B. Domjan C. Dore Nickname: Chris, Pooh, j.j., Activities: Student Gov't 80-84, Varsity Tennies, Powder Puff '83. Likes: Billy Ioel, WLIR, Turquoise, Larry's Parties, Beaches, Hanging Out W!Ang, Spit, Tails, Food. Fond Memories: Augie 2-2, Skiing at Loon 84, Time to Make the Donuts! Hecksher Park 83, Kol - Foo - Yol, Elosa, HH To Commack, Cruisin to A815 QPFJ, Prom 84. Future Plans: College, Marriage, Family. Andrew Brown. Nickname: Drew. Activities: Track, Dance Company. Likes: Girls, Volleyball, Badmin- ton, Making Ice Cream. Fond Memories: Going Out With Cindy: Future Plans: Electrician. 176 BABY PICTURES-SENIOR STATS Y,-nf 1 Antorino A.Ardito S Boccia T. Bosch M Byrd S. Calia L Davis K. DeCarlo S Duerwald E. Ersboll I . P, VI 15' 1.6, ' at ' K. Asher J, Balkan S. Botsko C. Boyer I. Cannon K. Carcone M. Conklin K. Domencetti L. Feinstein H. Fink Denise Brown, Nickname: Dee, Activities: lflth 8: llth Grade Spr- ing 61 Winter Track, Back Stage Crew. Likes: Guys, Music, Friday Nights, Parties, Chocolate Chip Cookies, Weekends, Summer, Vacations, Having Fun, Being With Friends, Fond Memories: Penn Relays 83 , Mrs, Ronco'S 9th Per. Art Class, 9- 28-84, I.M.'S Party, Mr. Atkins 8th Per Class, Am Birthday, Canada '83, Future Plans: Nurse, Independent. Ienine Bruno. Nickname: Nin, lenini, Nina Beana, Puma, Maggie. Activities: Volleyball, Historian Girls Leaders, Marching Band, Concert Band, Homecoming Float. Likes: Talking W!Friends, Suzy Q'S, Vacation, Testing the Pickup, Volleyball, Italian Food, Soap . Fond Memories: It'S Frank IiIl!, D.C. 79, Camper Click, I-Iullo, Hazeltine Picnic, Baretta Car. Future Plans: College, Good Career, Marriage. Joseph Bruno. Nickname: joe Activities: Powder Puff, Homecom- ing, Breathing Septa Quacon'S. Likes: Boating, Buckwheat, Cheetos, Muscle Cars, S.N.L., Tans, Mary'S Bikinis, Beaches, Little Rascals, Hi Pro, Summer, Bousches. Fond Memories: The Swipes '84- '85, Mission '83, The Shadow, S.Oh., New Years '84, Alt S Organ Restaurant, Days ot' Marty, Fwa - Boom. Future Plans: College, Drafting 8: Design, Grow, andfor Win Lotto Karen Busweilers. Nickname: Ka, Bus, Bussy. Activities: Drill Team, Powder Puff, Teachers Aid,Badminton Like: E.H., Weekends, Being W!Friends, Summer, Skiing, F.C., Wahoo'S!, Traveling, B.K., Beach. Fond Memories: Summers '83 8: '84, 10-28-83, Ski Trips. I NEED NEW P.H.!! , ThaIia - Duc!! . Darrin Patrick Butler. Nickname: Gumbv, O.B. Activities: Boys Leaders, Powder Puff, I0th Gr. Yearbook. Likes: Skiing Parties, Sun, Fun, Van Halen, Crusin, Going Crazy, M. Goldens, Women, Islanders. Chargers. Fond Memories: Ski Trips, Powder Puff '83, N.Y.C., j.Q.'S Sleep Over, All Hail IQ., Dodging Tress, The Big Wheel, Drive Into Snow Banks, Underdogs, Pocono Summers, Car Golfing. lake Breaking. Future Plans: To Be Rich, Marry a Babe, Have 2.5 Kids. Maria Byrd. Nickname: Byrdie, Marear, Marie, Mer. Activities: Drill Team, Homecom- ing Float, Powder Puff, Student Council. Likes: Phil, Parties, Eating, Hugs, Being W!Friends, HF Football Games, Talking, Being With My Sis, B.K. Runs. ' Fond Memories: Ski Trips '83 Gt '84, Chicago's WfGirls, Chinese Fire Drills, Mush's I0-22-83 Party, New Years '83, II-2-81, Walks W!M,G. at 3, Powder Puff '84. Future Plans: Marriage, Kids. Stephanie, Calia. Nickname: Broc, Cali. Activities: Eating, Band, Bowling, Drill Team, Student Council, Stu- dent Teaching, Powder Puff, Hc Floats, Honor Society. Likes: Firehydrant Convos, Varie- ty, Bbm, Chinese Fire Drills, Meeting People, Usg, Beaches And Stars, Crusin W!Mk, Code Names, Dancing. Rapping W!Km, Old Movies, Backrubs, Chameleons, Fond Memories: Meeting at 3, Teen Tour '82, Michel's All- Nighters, We'll Take Your U, Chicagos Wfthe 6, Bk Runs, Dt Camp, Bak- ing Ziti. Richard I. Capriola. Nickname: Rich, Cap. Activities: Student Council Pres. Student Gov't, Football, P A.C. Powder Putt' Likes: Being Bushed, Lounging, Missions, Good Times, Fine Women, Close Friends, Parties Fond Memories. S.A.G. Missions, Chuckles, New Years '83, Tame. Powder Puff '83-'84, Harries Par- ties, Ski Trips, Knicks Games. Future Plans. College, Success, En. joying Life to the Fullest. Ieffery Cannon. Nickname. Boom - Boom Activities: Hockey, Pool, Foosball, Likes: Maureen Zubil, Hanging Out WfFriends, Crusing, Firebirds. Fond Memories: 1974 Buic Lasabre, Dead Mans Hill, B.I.'S Grandfather, The Night Out W!C.P, K N. IB, L.M. Future Plans: To be Very Wealthy and to Have a Good Lite With a Good Family. Kenneth Fred Carcone. Nickname. Ken Activities: Basketball And Baseball, Pool, Ping-Pong. Likes: Sports, Horror Movies, Bike Trips, Pizza, Candy. Fond Memories: Bike Trip '84, Milton, Atlantic City, Friday TH 13th I-4, Summer ot' '84, Blackey. Future Plans: College. Good job and Happiness. Lisa Carillo. Nickname: Lis, Mom. OR., PO Likes: jeff, Spending Time WlFriends, Shopping. Being 2nd Mom to Friends, Going Out With Friends, Beach, Friendlys, Mid- night Sz 4am Snacks, Vacations. Fond Memories: Summer 83-84 With B.F. jackie, ID., P.K., Hamp- tons 83-84, Prom 84, My B-Day. Sushines, Crusin With Good Friends, M.R., K.D., D.B, K.A., Spending Time Wljeff, D's B-Day, Saggy Toes, Beach Party, Fire Island. Future Plans: College, Marriage, Family 8: Happiness. Sophia Christophides. Nickname: Choice, Souviaki, Dix. Activities: Cor, Representative, Gymnastics Gr Soccer Intramurals, Goya, Weight Training, Painting, Women Helping Women. Super- dance,Greek Club. Likes: Arthur, Hanging Out With Good Friends, Fast Cars, My Red Hot Z-28. Fond Memories: Iunior Prom, 5-30- 84. 3 Years at St. Francis Prep, My Hometown, The Boulevard. Future Plans: Happiness Sz Success. joe Cirillo. Likes. Hendrix, Page, Clapton, Beck. Fond Memories: Prom '84, My I8th B-Day, B.H. 8: I.H. Combo Party. Iuanazooblitzicated. Future Plans: Move to Mahattan and GoingToS.V.A. Philip Clementijr. Nickname: Phil. Clem. Activities: Football, Basketball, Lacrosse, Intramurals, Student Council, Student Gov't, Powder Puff. Fond Memories: ll-2-82, Missions, I2-3I-83, Ski Trips, Beefy C's, L.F.. B B., B.M.'s Parties, Montauk, New Iersy, Philly, Powder Puff, Lax '84, F.B. '84, BB B4-85. Hoobying Crew Cut. Future Plans: College, Family, Happiness. Mary C. Climo. Nickname: Mel, Mares, Dings, Pairs. Likes: I-tkt, Summer, Waterskiing, Sailing, Being in Love, Party's, Nice Cars. Fond Memories: '81-'84 With lay, Prom, Summer of '84 With Ken, Crazy Times With Mill, Mars. Future Plans: Getting a Career, Falling in Love and Getting Mar- ried and Having a Family. Susan Close. Nicknames. Sandy, Sandbags, Xandie. Activities: Color Guard, French Club. Likes: Sweaters, Chinese Food, Roses, Fridays, Red Mustang Con- vertibles, Laundry, Dead Flowers Fond Memories: H.L, CR, Fred Dusting Again, Class of '84, Ph, Fe, We, Taxis, Ski Trips, Work Camps, Bruce juice, Rocky. Future Plans: To Become Very Rich. Kenneth Edward Coen. Nickname leans, Professor, Ken Activities. Youth dz Gov'T, History Club, School Paper, WBA Basketball. Likes. All Sports, Math, Vacations Future Plans. To Go to College. Shari Cohen. Nickname.Sha,Shaf,Shuree Activities Tennis. Likes: Tennis, BK., Sunny Days, Vacations, let Games, Shopping, S. Clothes, Islanders. Fond Memories: Summer of '8-I, Teen Tour. R M Beach. Fig Newtons, H I 83 BABY PICTURES-SENIOR STATS 177 Future Plans: College, Accountant ICPAJ, Marriage, Family. Veronica M. Collins. Nickname: Ronnie Activities: Softball. Likes: Snow and water skiing, snow storms, rollerskating, blue, spleefmon softball, bikes, CA., friendly people, having a good time with friends. Fond Memories: Aug. 1 Wally's party, the last day of Tech, Cindy falling into Northport Harbor w1Chris, managing the girls' basketball team. Future Plans: Graduating, become a lawyer, a happy life. Stacy Ann Collman. Nickname: Statistic, Collface, Sta, Stacee, Rem. Activities: History Club. Likes: Sleeping late, summer camp, roses, shopping, sunsets, hugs, chocolate, long talks, the beach, vacations, sad songs, G.H. and soaps, movies, ice cream. Fond Memories: Williamburg w1T.C., summers of 83 and 84, Canada, 9th grade P.V. w1S.G. and B.G., Delaware 84, B.K. runs. Future Plans: College, Career, Marriage. Thalia Comninellis. Nickname: Thal, Taliara. Activities: Drill Team, Powder Puff, Band, German Band, Or- chestra, G.O.Y.A. Likes: Weekends, long talks, the beach, D.X., shopping sprees, good music, dancing, Bruce Springsteen, Sweaters. Fond Memories: Williamsburg w1S.C., Greece, Boston, Washington, football and basket- ball games, Hofstra, jets, B.K. runs, Powder Puff '83, Summer '84 K.B.'s Vette, Future Plans: College, Marriage, Family, World Travel Margo Catherine Conklin. Nickname: Mar, Marg, Marglo, L.M. Sunshine. Activities: Swimming, Yearbook, Float Committee. Likes: Being wlfriends, shopping G.H., cruising, the wee end, N.Y.C., sleigh riding, talking on phone, whiplash, Fire Island, par- ties, um, Florida, Mercedes 450 and 350SL, scooping. Fond Memories: Datsun, concerts, summer 83 and 84, mini golf, toga party, trip to Loyola, Prince. Future Plans: Trip to Florida in condo, College Marriage. Christina Creamer. Activities: Skiing, swimming, candystriping. Likes: Keith, shopping, roses, my family, Nannie's cooking, care bears, Cabbage Patch Kids, Cousin jaime, l4K, diamonds. Fond Memories: Smiths Point '84, Prom '84, Van Halen, Sweet 16, vacation to jamaica, Louie and Chris' wedding, Great Adventure, skiing,4!l2183. Future Plans: College to become R.N., to live in Dix Hills, and to own a red Porsche. Carl Curcio. Activities: Boating, working, hav- ing fun. Fond Memories: Late nighters, N.Y.C., camping w1CFD, Summer 83, 84, 85, 86 , . . B.K.'s B,B. Future Plans: College, be rich, make the most out of life. Tracy Cook. Nickname: Cookie, Giggles. Activities: Dancing. Likes: Parties, travel, meeting peo- ple, dancing, loving Adam, boating. Future Plans: To travel and be successful. Kristy Curth. Nickname: Kristle, Scrufty, Krispy, Mock-Model, Ace, Likes: Being with Steve, 4- wheeling', Smith's Point, racing, trucks, fast cars, art. Fond Memories: Racing at Islip '84, The Purple House, A.S.P. '83-'84, summer of '84. Future Plans: Make Max S, Donald Daniels. Nickname: Dazzy Dee. Activities: Wrestling. Likes: Girls. Future Plans: To be a Chief. Linda Davis, Nickname: Lin, Dinny. Activities: Cheerleading, Wind Ensemble, Marching Band, 178 SENIUH STATS Swimming. Likes: Movies, Trace O., Lisa D., Marching Band, Car, N., swimm- ing, cheerleading. Fond Memories: Band and jets '84, Victory Tour '84 and the Jacksons. Future Plans: College, Grad School, staying happy with life. Lisa Davis. Nickname: Lee-Lee. Activities: Cheerleading, Student Council, Powder Puff. Likes: Dancing, Cheering, Food, Clothes, Michael jackson. Fond Memories: M.C.O.R.A. Shut- tle's 2nd period class w1Kristen, Caroline 6: Bill. Future Plans: To mari? rich, foxy guy, to become success ul. Lawrence Scott Davis. Nicknames: Larry, Lar, Lorenzo, Lah. Activities: Yearbook Staff, Temple Youth Group. Likes: Heavy Metal, Def Leppard, Sheila E., Prince, Robin, Chinese Food, Bowling, Sleeping late, Par- tying, Good Friends, Chrysler Lazer Xe's Porche 9285's. Fond Memories: Camp, my Senior Year, Burger King, Bar Mitzvah's, West Point, Summer of '83 and '84. Future Plans: Go to college, be a biology teacher, get married, have 2 kids, live in L.A. Todd M. Davis Nickname: jose, Hotdog, Skully. Activities: Football, Lacrosse, V.S. team, Student Council, Boy's Leaders, Likes: Sports, girls. Fond Memories: Beefsteaks, Senior Slave Auction, Powder Puff 83-84, Mr. Inevitable, '83 ski trip, Billy's Boat. Kristine Lynn DeCarlo. Nickname: Kris, Tip Woman, Hutch. Activities: Bicyle riding, cooking, dancin ,cruisin'. Likes: sacations, beach, R. Moses, tnicks, Corvettes, talking, cruisin', boche-balls, good friends, Italian food, Bruce Springsteen, roses, Christmas, dancing, money. Fond Memories: Being w1B.T., 21l4184, l2125183, New Years Eve '84, Starsky 6: Hutch , ZZ Top concert. Future Plans: College, success and happiness. Cristal Victoria Delk. Nickname: Wa-Wa. Likes: Fast cars, white jaguars, money and clothes. Future Plans: Living, Loving. Donna jean DeRosa. Nickname: Leather, Dee. Likes: Baking, sleepirlrg, Led Zep, snowballs, New ampshire, mellow people. Fond Memories: 21 Tulsa, The Bakery, BB Co., The Slobs, 10128183, Halloween '83, j,L., G.B. The Place. john DeSantis. Nickname: Mugsy, Crash. Likes: Waterskiing, snowskiing, boating, working at V.P., Golfing. Fond Memories: Great Adventure, Action Park '83, Sand City parties, ELPAZ ski trips, camp out with C.F.D., horseback riding at B.B. Taxicab's Fire Island, Death Mobile '84. Future Plans: College, success. james Devaney. Activities: Flying. Likes: Flying, airplanes, converti- ble, 60's autos, waterskiing, spring, summer, sunsets, large parties, beautiful girls, mornings. Fond Memories: All the good times with friends, solo '83, licensed pilot '84, B.I., summers on the water with D.H. and L.H., N.Y.C., B.A.B. Road Rally. Future Plans: Automotive Design, Commercial Pilot, Water Commis- sioner, Anything but hardware. Chris DiCesare. Activities: Stage Band, Intramurals, Ski Club. Likes: Music, skiing, camping, soc- cer, karate, driving, Chinese food, Winter, Fond Memories: Summers of '82 and '83. Future Plans: College, Success. Susanne DiFede. Nickname: Sue. Activities: Horseback riding, 4-wheeling. Likes: Danny Palazzolo and horses. Fond Memories: Going to Great Adventure with S.N. and A.F., go- ing to Hollywood. Future Plans: Going to school for hairdressing, living on a ranch. Karen Elizabeth Domencetti. Nickname: Psycho, Nuts, Co-Ed, Karri, Babes, Cookie, Harry I: Kareem, Princess. Activities: Band, Choir, Yearbook, Drama, Harborlights. Likes: Being crazy and nuts, danc- ing, Harrison Ford, Lacrosse, Soc- cer, dimples!, M.j., Prince, Genesis, '67 Mustangs, '68 Camaro SS, Kevin's Ford truck, good friends. Fond Memories: Class of '83, 1983, 412183, Freitas' 11th grade Eng. class. Future Plans: Going to college and majoring in Fashion Design, to make it to the year 1999. Barbara Marie Domjan. Nickname: Bob, Bobbi. Activities: Band, Newspaper. Likes: Skiing, sailing, VW bugs, cruisin', hanging out wlfriends, The Police good music, S.S. 8:B., summers, sun, ROI, concerts, friends, spending money. Fond Memories: South Padre 83, The Police Concert w1TB, 3rd degree burns w1LL, Hold Me Now, cruisin' w1trucksters, Quinlin Pretzels, 8118. Future Plans: College and to buy a convertible Volkswagon bug. Christine Dore. Nickname: Kid, Kiddo, Cookie, Chris. Activities: Band, Stage Band, Pep Band, Choir, Theatre Co. Likes: Fire Island at 7:00 A.M., M.G., chocolate, music, autumn walks, good friends, piano, rap ses- sions w1julie, Angel Delight, Mar- ching Band, driving. Fond Memories: jets games, All- State, England, Summer '84, An- nie, Hofstra, Homecoming '84, beach parties. Future Plans: Music, happiness. Adam Dornfeld. Activities: Drama Technical Crew, Lacrosse. Likes: '67 Corvettes, vacations, lif- ting weights, sleeping late, work- ing over the summer. Fond Memories: Centerport Beach tBio tripj, Sunday afternoon soccer games, Rush, working out at Col- umbus, English 9th period, sailing, Oswego. Future Plans: College, getting a job. Susan Mary Duerwald. Nickname: Suzy. Activities: Band, Volleyball, Bad- minton, Honor Society. Likes: Being with Kevin, swimm- ing, sailing, Billy joel, '65 Mustang convertibles, horses, chocolate ice cream. Fond Memories: The jet Game, Hofstra, the dunes of Block Island, being with friends. Future Plans: Attend college, get married and live a successful life of happiness. Carlton Einsel Nickname: Carl, Mac Activities: Wrestlin , coin football. Likes: C2H5Ol-I, ioisch, heavy metal, hard rock Fond Memories: jersey Day, 1212182 Ellen Ersboll Nickname: Willie, Veelee Activities: Volleyball Likes: Russell, parties, snow days, crowns Fond Memories: The Butterworth Family, Denmark '84, Tuborg, No Parking signs, Roudy Audi, K.R.'s U., the pub, Big Barry's Cameron Elkerton Nickname: Cam, Big Fat Hen, P,T. Pie. Activities: soccer, hockey. Likes: Sandy, Led Zeppelin, Zebra, cool people, M. Golden, skiing, partying, long hair, Bryon, money Fond Memories: Sandy, Summer of '84, Vermont with Sandy, Center- port skinny-dip, New year's eve at K.F.'s, boppin' with Dan, Suny Stonybrook bash,'Pieces, and Dead Gut Fat Future Plans: Sandy, life, liberty, and the pursuit of happiness Kirk Eiche Nickname: Ike, Killer, Squirk Activities: Sleep, work, school, par- tying, concerts Likes: Yes, Rush, road trips, parties, Little Rascals, volleyball, Abstrac- UPIIS, HTR's, Hockey sac, Tribbles, video games, etc., etc: Fond Memories: Summer of '83 at lock S PIECE, Caumsett, Yes '84, Rush '84 Fuhrre Plans: College, the undead Matthew Farrell. Nickname: Matt. Likes: snow, rocks, summer, American pie parties, B.Hs, friends, money, weekends, 12th grade. Fond Memories: j.C.B. party, ski trips, school, high falls, prom, Bvca, D.i.m., the Rock. Future Plans: to have fun, to make a lot of money. Lawrence j. Feinstein. Nickname: Larry, Harry, Getaway. Activities: 3 yrs. Varsity Football, 2 yrs. Varsity Basketball, Student Council Q ublic relationsj, Boys Leaders izlreasurerj, P.T. and Pickerball. Likes: The six'em, Sundays, mis- sions, football parties, cruisin in the Asp, late drops. Fond Memories: Beefsteaks, my bachelor party, Powder Puff '83, beating j.G.-football '83, SAG, the mission, boating w1B.B. Future Plans: College, success. james Fetherston. Nickname: jim Fed. Activities: Working, listening to rock 'n' roll. Likes: the Yardbirds, loud music, Pink Floyd, onions, Vartan Gregorian, guitars, electricity. Fond Memories: Vartan Gregorian Fan Club, Rush and Yes concerts. Future Plans: go to college, become a fireman, policeman, or astronaut, Hillary Fink. Nickname: Hill, Hills, Hillabean. Activities: Layout Ed. of Yearbook, Feature Ed, of Newspaper, Theater Company, Co-capt. Pep Band, Ger- man Band, Pres: of Spanish Club, Literary Magazine, T.Y.G. V-Pres., Homecomin float, Powder Puff. Likes: football and basketball games, music, red, chocolate, kids, being with good friends: Fond Memories: Homecoming '84, Powder Puff '83 and '85, jets game, Billy joel concert. Future Plans: college, success, happiness. Kevin Thomas Flanagan. Activities: soccer, golf, Boys Leaders, Student Council-Rep., Powder Puff '83. Likes: K.E.G., parties, skiing, weekends, women, The Police, M. Gaddens, ski trips, golf, soccer, money, summer. Fond Memories: N.Y.C., Loon Mountain, Big B's, Keyfood in P.j.'s, Underdogs, sleepovers, night hoops, Police concert, Powder Puff weekend '83, going crazy at D.H.'s house, j.Q. breaking, Homecoming '83. Future Plans: be 6', have college success, be a wealthy stockbroker, marry a fox. Beth Susan Fornuto. Nickname: Beta, Besh, L.B,, Swiss Miss. Activities: Drill Team, Float Com- mittee, Student Gov't. Rep., Girls Leader. Likes: being w1my friends, sunn winter days, skiing, H.F. football games, weekends, looking at j, ronk-ronks, lusty men, B.K., jR runs, soccer players, M 6: M's, good parties, long earrings, surprises, gentle men. Fond Memories: 3112183, Chinese Fire Drills, Mush's 10l22183, Prom '84, summer '84, Deb's 716184, Powder Puff '83 and '84, R.B., Hofstra: Future Plans: college, marriage, lots of kids. Marc Frankel. Nickname: Mugsy II. Activities: being with friends, jiv-jitsu. Likes: dirtbking, jiv-jitsu, weight lifting, girl watching. Fond Memories: dirtbiking at Farmers Field 6: Hazeltine, getting chased by cops, P. A. through Hun- tington, pulling people over Future P ans: on to college, into big money. Frank Franze. Nickname: Psycho, Activities: Band, the Gang. Likes: good times, the 55, racing, cruising, the Comet, Rush '82 and '84, the Gang, Saturday nights, parties. Fond Memories: the Hill, summer 1984, Ocean City, 300 +, 7-lvl, con- do, Harry's, Tholen's window, North ort. , Futui-ePPlans: graduation day 55, Animal House, The undead, ME, SGH. Anne M. Frederick. Nickname: Annie. . Activities: Co-captain cross- country 11, 12, winterlspring track 10, 11, 12, Student Council, Homecoming Committee, yearbook. Fond Memories: Shari's boat trips, Penn relays '83 and '84, Yale invita- tion '84, Meadowdale H.S.-WA. Likes: New York City, polo, T.T.s, ice cream, sunsets, beaches, Italian food, dancing. Future Plans: College, success, happiness. Ilene Fox. Nickname: Leenie, Fi. Activities: tennis, badminton, piano, Girls Leaders Club, NYSSMA. Likes: weekends, vacations, travel- ing, skiing, swimming, camp, hockey with mom. Fond Memories: Israel 1984, lab partners with Holly, Washington with Rockin Ro in, Spanish with Senora. Future Plans: go to colle e, study medicine, and become a doctor, as well as have a family. Anne Sharon Friedman. Nickname: Shari, Sha. Activities: Theater, cheerleading, winter track, spring track, Powder Puff, Student Council, band choir. Likes: the beach, sunsets, boating, jeeps, waterskiing, snow skiing, my bro's, Tom Col., my little pup- pies, singing, impulse, Maine. Fond Memories: summer '83, visiting Tillie, Penn relays '83, '84, Fire Island, ski trips, T.P.W. beakmans, BBQ at beach '83, jets game, Octoberfest '83, Mr. Presi- dent, Fiddler on the Roof. Margaret Holly Fusco. Nickname: Marge, julio, High C, Mom, Miss Mona. Activities: cheerleading, Student Council, Girls Leaders, Student Court judge, Raven Homecoming Float. Likes: Michael, skiing, walking on the beach at night, G.Q. men, pink, jewelry, nice hair, shadows, Wrecker, 30, Y.P'S, AG, T.M., L.R. andj.D.,snow,dressin u . Fond Memories: CHS gom '84, winter recess sleepover '84, Loom Mountain, I'm so excited, Hot Tuna. Future Plans: College, accountant, maniage, at least 4 kids. Linda jean Galati. Nickname: Lin, Roxy fRoxannej, Mouse. Activities: Drill Team, Student Council, Powder Puff '83, mar- ching band. Likes: going out dancing, iced teas, traveling, summertime, on the beach, meeting new people, clothes, money, big fancy parties X-mas time, spending time with family and friends. Fond Memories: California '82, Sweet 16, 5114183, jets game '83, Florida '84, Boardy Barn 6184 w1S.V., summer '84, college weekend vacations, Hofstra festivals, H.F. football games. Future Plans: college, marriage, long life of health, happiness, success. Mary Francis Gallagher. Nickname: Mare. Activities: volleyball, hockey. Likes: the Centerport Fire Depart- ment, nursing, dancing, company, working at the CYC. Fond Memories: the Centerport Fire Department Drill Team, Satur- day nights at Sunshines, weekend at the CYC. Future plans: to become an emergency R.N.nurse. jerome joseph Galluscio. Nickname: j.j., Superfly. Activities: Centerport F.D. cadets, Italian club. Likes: football, pretty girls, money, gold, Camaro's. Fond Memories: Italy '84, Summer '83, Centerport F.D: Cadets, '84 fall drill, Northport Halloween '83 Paul's Pizza. ' Future Plans: college, success. Kenneth Gantt. Nickname: Dudley. Activities: Cross Country, winter and spring track. Likes: sports, going out with friends, Yankees. Fond Memories: going to Penn relays. Future Plans: college, marriage, career in veterinary medicine. Carolyn Gardella. Nickname: Ca, Caroleen. Activities: gymnastics, honor socie- ty, field hoc ey,track. Likes: sleeping late, weekends, vacations, regattas. Fond Memories: D.R. trip, C.M. '83, summers at CYC, ski trips, Murf alert, B.l. and Police Concerts, the in cognito affect, Colorado. Future Plans: college, success, money. Michele Gelfand. Nickname: Mush, Shelly, Weirdo, Migue. Activities: eatin , band, bowling, Drill Team, Student Council, Stu- dent Teaching, Senior Class secretary. Fond Memories: Shari's parties, 10l22!83, the tour, baking ziti, meeting at 3, Tho's class '84, Avon and crazy Pennysavers, Christies I and II, ski trips '84 and '85, Chinese fire drills. Likes: variety, food, being spon- taneous, fire hydrant convos, U.S.G., beaches at night, cruisin wlM.K., strawberry dag's, daydreaming, meeting people. Future Plans: college, owning a mostly yogurt Sarah Marie Gentzlinger. Nickname: Sal, Peg. Activities: Band, volleyball, sailing. Likes: summer, Fridays, cruising, sailing regattas, quarters, 420's, Mc'D's, roadtrips in the Rowdie Audi, Purple, yellow. Fond Memories: V.I.'s w!D.B., Denmark '84, w.e.e.e.e.e.e.e.e.e.e.e.e.e.e.e.e.e a.a.a.a.a.a.a.a.a.a.a.a.a.a.a.a.a.a a.a.a.a.a.a.a.a.a.a.a.a.a.a.a.a.a.a t.t.Lt.t.Lt.l.t.Lt.l.t.f.t.f.t.l Sarah Marie Gentzlinger. Nickname: Sal, Peg, Activities: band, volleyball, sailing. Likes: summer, Fridays, cruising, sailing regattas, quarters, 420 s, Mc'Ds, roadtrips in the Rowdie Audi, purple yellow. Fond Memories: V.I.'s w!D.B., Denmark '84 wlE.E., R.S.2373, Lar- chmont race week-'80, '81, '82, '83, '84, Lehigh 81 32 313, 4-some, no braces, H2, racing wlL.B,, manhunt, Tivoli, feeling groovy, hamptons '83, K.R.S.U., B.B.'s. Future Plans: graduate from col- lege and marry a millionaire. Susan Gilbert. Nickname: Sue, Pete, Maxine. Activities: Secretary, Treasurer, X- Country, winter and spring track. Likes: summer, the beach, sports, music, my dog, food, blue eyes, C.W., Eddie Murphy, meeting peo- ple, Ianet. Fond Memories: summer of '83 and '84, 9!23l84, growing up wllane, Chris Scotts party, 3l25l83, Center- port beach, Gina drive. Future Plans: attend college, get married, become a teacher. Robin Glazier. Nicknames: Rob, Eugena, Rockin Robin. Activities: hangirrtg out on the patio, going to orthport tech., cruising. Likes: lohn, well dressed guys, hanging out with Deb, taking the train to West, getting loud, living it Fgnd Memories: Florida '83, Great Adventures 34, Th? Wesfbufl' Boys, xFamily Feud '83, Mavi Family. Future Plans: I plan to find a fox and have a good job and make cash. Patrick F. Godfrey. Nicknames: Pat, and God. Activities: football, lacrosse, stu- dent rep., golf, Cherry Pickers, N.S.P. . Likes: females, lax, parties, Sleep- ing, C.C. weekends, VH, Crusing, sunshine. I , Fond Memories: summer 83, 84, Homecoming '84, beefsteaks. Future Plans: college, life, and death. Mitchell Goldberg. Nickname: Mitch. Activities: youth and government, photo club, bowling. Likes: Mets, Rangers, C.D., party- ing, beach parties. J Adam Bmce Golden. Nicknames: Sammy, Dribble, The Kosher Kid. Activities: basketball, newspaper, wrestling. Likes: scavenger hunts, golf, sleep- ing, the hand, parties. Fond Memories: Great Adventure '84, Beach Boys concert, Rocky Horror. Future Plans: college, success, and cash. David Goldblatt. Activities: youth, and government, newspaper. Likes: parties, fishing, electronics, computers, sport cars. Fond Memories: realizing that 12th grade is it! Islanders whipping Rangers 3 times. Future Plans: electronical engineering. Christopher james Griffiths. Nickname: Chris Activities: theater company. Likes: acting, skiing, biking, scouting. Future Plans: attending college, meet Ian Brady, have happiness and success. Gina Groccia. Activities: softball, Likes: rock music, sports, parties, swimming. Future Plans: college, med school. Susan Guarnaschell. Nicknames: Guarnie, Guacamole, Iguana. Activities: drill team. Likes: summer, roses, being with friends, having the car. Fond Memories: big bashes, class of '84,H.H.S. Best one liner: Excuse me, the par- ty is over! Thomas Hancock. Nicknames: Troy, Tom. Activities: band, hockey in- tramurals, varsity wind-strength uessing, iikes: skiing, sailboarding, hard core, heavy metal. Fond Memories: Stratton, Maine in February. Future Plans: college, marriage, meditating with Gura Rashma in the Himalayas. Kenneth R. Hart. Nickname: Doenob. Activities: baseball. Likes: Mary, baseball, beach, Real People, Georgia. Fond Memories: summer of '83 6: '84 meeting Mary. Future Plans: college, return south, life with sunshine days and so- meone special. Ben Harris. Nickname: Ben. Activities: harvesting garden pro- ducts, dirt biking, heavy duty par- t in ,waterskiing. Fyong Memories: ski trips, Yes, Rush, j.C.'s birthday, camping upstate High Falls. David Heller. Nickname: Hella. Activities: basketball, tennis. Likes: sleeping late, weekends, vacations, good food and good times. Future Plans: college, successful business career. Kenneth Henriksen. Nickname: Ken. Likes: hunting, fishing, lacrosse, the Islanders, he Giants, football. Fond Memories: super bowl, parties. Future Plans: college. David B, Hickerson. Nicknames: Davey Idol, Bradford. Activities: industrial arts, treasurer, S.O.L.I. instructor. Likes: skiing, being with Sue, ten- nis, soccer, water sports, windsurfing. Fond Memories: 9!23l84, 7!l6l84, 8120184 Future Plans: college and then head to Hawaii. jill Alicia Rose Hickerson. Nicknames: Tart, lilly. Activities: tennis, badminton, girls leaders, French club, history club, student govt. rep. Likes: beaches, pineapples, snow, skiing, horsebac riding, sleeping, Christmas. Fond Memories: Bermuda '83, ski trips, slumber parties, Guido's 10l20l84. Future Plans: college, il 2 ?-, - ff 'sf : f 'E - 2 1 an it 'fl ' ge 1 a ! B. Fornuto C. Gardella G. Groccia I. Iones C. Klerk A. Lauda K. Madden -f E . We-a ' ' ' . 'P 'il1g it ffl- 'ix Y 'AKA x 3 Q .Isl- ,ixf ,Q 'ti 'S ra Q., ,- ,- ,- .Z .4 1 ..- ,- ,- 'sur .V A if l- 147' I. Fox M. Fusco M. Gelfand S, Gentzlinger 1. Howell D. Ianovsky C. Kalisky K. Kavanagh I. Kozma S. Lanza M. Lee R. Leggio I.. Maro M. Mathis Qian' L. Galati P. Godfrey C. Iohnston M, Kirschner C. Lanzalotti L. Libert I, McMillan BABY PlCTUllES!SENI0ll STATS 179 N travel, marriage. john Himmelsback. Nicknames: Key, jr., Mugzy. Activities: hockey, basebal , bousch committee. Likes: blonds, beaches, The Police. Fond Memories: 9th grade. Future Plans: be rich and own a business. Daniels john Holmes. Nickname: D.H. Activities: soccer, band, hockey intramurals. Likes: Rangers, skiing, drums, Police, VH, Genesis. Fond Memories: Loon Mountain. Future Plans: business manage- ment or possible, stock broker. Marry a beautiful blond. julie Diane Howell. Nicknames: Miss Howell, Bananas, julie D., jules. Likes: good friends, autumn walks, teddy bears, roses, marching band. Activities: band, pep band, concert choir, stage band, track, newspaper, orchestra. Fond Memories: my summers in Michigan, jets game. Future Plans: live a long and happy life. jamie Hubbs. Activities: soccer. Likes: snow, long trips, big rock. Fond Memories: j.C. s birthday, ski trips. Future Plans: to win. Pamela Hubbs. Nickname: Product 81. Likes: remembering, friends, sum- mer, train rides, writing, flowers. Fond Memories: late night phone calls, ski trip '83, my sweet 16, American Pie sing alongs. janets house. Future Plans: traveling, social work, living the good life. Lauren Rose Huer o. Nicknames: L.M., cgiatterbox, spaz. Activities: field hockey. Likes: guys, being with friends, weekends, shoppping. Fond Memories: exit 40, Where's the beef, concerts. Future Plans: trip to florida, col- lege, marriage. Holly Carol Hughes. Nicknames: Hol, Hols. Activities: marching and concert band, spring track, student council. Likes: chocolate, Norwegian guys, BLt's, dancing, talking on phone, being with friends. Fond Memories: Homecoming dances, Hiya Toots., 18th birthday. Future Plans: a great chef of Europe. Debra janovsky. Nicknames: De , Debbie, face. Likes: Bruce Springsteen, hugs, pearles, tans, long nails, no school, grey, pink, football. Fond Memories: Bruce concerts, boating to Conn., prom '84 611818 . Future Plans: get married, have children, and growing up. Kyllan johnson. Nickname: Kyllanah. Activities: spring track, honor society. Likes: mint chocolate chip, music, weekends, skiing, sailing. Fond Memories: beach, summer '84, N.S. football game. Future Plans: college. Christopher William johnston. Nicknames: johnny. Activities: soccer, lacrosse, theater company, student govt., W.B.A. Likes: lobster, clam chowder, M.A.S.H., VH, Michael j., war movies. Fond Memories: P.C.'s new ears party, B.B.'s boat trip to Sand Cvity. jackie jones. Nicknames: jack, Yackety Yak. Activities: yearbook, managing football and rugby. I Likes: sun, beach, Fond Memories: Italy '84, Homecoming, prom, Sweedish parties. Future Plans: have lots of money, marriage, children. Ca an Ann Kalisky. Nitlkname: Marty. Activities: symphonic band, wind ensemble, drill team, float commit- tee, student council, student teacher. s i .A1 ,.., an . Y - 'li': -rf' 6 a s W A. Megaris Likes: my family, weekends, sunsets, roses, white teeth, Garfield. Fond Memories: 918182, sweet 16, trip to Missouri. Future Plans: college, marriage, family. Kathleen Kavanagh. Nicknames: Product 84, Face. Likes: skiing, friends, snow storms, summer, weekends. Fond Memories: ski trips, partying with the Products, Fire Island. Future Plans: college. Paula Keels. Nickname: Lady Ace, P.K. Activities: volleyball. Likes: to go out and have a good time. Fond Memories: when I first met Tony. Future Plans: For me and my boyfriend and my baby to live a happy life. Dennis Michael Keenen. Activities: Varsity Football, Varsity Winter Track, Varsit Lacrosse. Likes: THE MET! Girls, Van Halen, Mom and Dad, Fond Memories: Being Born, j.V. Football, Pep Rally '84, Can't remember the rest. Future Plans: Possibly graduating H.S., Going to College, owning my own bar. Kenneth Kemp. Nickname: Ken. Likes: Dawn Morrel, Baseball. Best one liner: Worry about it when the time comes. Me Gari Kirschner. Nickname: Meggie, Mego. Activities: Senior class Pres., junior class V. Pres., Drill team fcapt.J, H.F. Theater Company, Choir. Likes: Being Sammys little sister, My family, roses, cast parties, weekends, soccer players, 5th er. free w1H.B., j.D., Sz C.L., Leadring men FWSG. Fond Memories: Trenton '84, New Year's Eves at my house, 10th grade, 819183, Can Can, H.F. Foot- all games, HOFSTRA, Being Caryn's Roommate, Kim's ll1261B2, Fiddler on the Roof, H.F. Soccer games, Downtown w1jen and Steph, Mr. A's class, 17th B- day, Powder Puff, Chinese Fire Drills, Who do you love I hope? Future Plans: To have my name in lights on Broadway. Christine Marie Klerk. Nickname: Chrissy. Activities: Swimming. Likes: Listening to music, Swimm- ing, Waterskiing, Islanders, 816, Snowball Fights, Genesis, spen- ding money. Fond Memories: Chicago, D.E.- H.H.S., Summer of '84, States '84, Oreos at M.K.'s., Mall trips, car- pool, Club Meets, Watch out for the bump-what bump? . Future Plans: Collegle, Prosperity, BMW, and no more c lorine. Kurt Knox. Nickname: Blo. Activities: Drawing, Track Likes: to go to the city. Fond Memories: Having a good time at Tech. Future Plans: Computer operator. jill Koenig. Nickname: Pokey. Activities: K.K., The Beach, j.T. and 67 Cougars. Fond Memories: Playing backgam- mon with K.K., Florida, Vermont, watching R.B, with K.K., Winter with G.B. and C.N. Future Plans: College for Adv. Art, 180 BABY PICTURES-SENIOR STATS j. Miller Being with Kevin, Travel. jeremy Kohler Nickname: Bullfrog. Activities: Camping, skiing, Enjoy- in life. Likes: Nature, elling at faculty, sleeping late, Star Trek, Parties, Hittin Greenlawn at 2:00 A.M., Grandfather Clocks, Doonesbury. Fond Memories: Summer of '84, Teen Travel, j.B.'s Parties, Fire Island, Spending money. Future Plans: Yard Work, Becom- ing President of the Viking Fund Organization for Preserving the Martian Landers. Kathleen Komorek. Nickname: Kathy. Likes: Going out with friends and having fun, being with: Dan C., Nancy M., Shirlene M., and Lynda F. Future Plans: Going to college, opening my own Day Care Center and working my hardest to get what I want out of life. Kevin Koppy. Nickname: junior, 130' Thrust. Activities: Bousch Busters, Track. Likes: Cincinnati Reds, New York jets, Detroit Red Wings, Bousches, Mini-skirts, Bikinis, and Kaduge. Future Plans: Electrical Engineer. llse Koza. Nickname: Iliss, Elkie. Activities: partying, dancing, go- ing to the beach, Health spa. Likes: Smitty's, OBI, Robert Moses, friends guys, dancing, long waves, spending money, Northport, Fond Memories: Smitty's, Dj, Vanderbilt Museum, Brendan'S, Police Squad, Airplane, Deli, My house 1 Aster St.,Ke food parties, Frank's, july 4, 1384, Huskies, Hunter Mt., Action Park, All sum- mers, Cars concert, Centerport beach, R.D., Christmas Eve '83. fFuture Plans: college, airlines. 'janice Kozma. Nickname: Kozi, janDee. Likes: summer, camaros, ICM, red, the Islanders, Chester, having fun walking on the beach, hangin' out w1jacks. Fond Memories: Rush Concert '84, Prom '83, going out with friends from Chefs II, Gary, Summer 83, Sunshines, SEL, M imitating j's lauglh, The old boat QHB, all nig t out-New Years Eve, AV. Future Plans: college, marriage, kids. Andrew james Korf. Nickname: Slick. Likes: Led Zepplin, Van Halen, girls, Monte Carol S.S., Z28's, vaca- tions, money, parties. Fond Memories: Van Halen, Triumph, A.M., City '84, james Kremens. Nickname: jimbo. Activities: Student Council, Choir, Madrigal. Likes: Gigs, summer, beach, the Fuller Brush man, the Radicals, grunties, jamming, plaid underwear, lead flavored raincoats. Fond Memories: Why in the world, Amish Country, Pogs, jim-move! mhatmgamba,dingle erry. Future Plans: college, mid-life crisis. Stephen Lanza. Nickname: Steve, Sleeve. Activities: Guitar, Moviemaking, Sax, Baseball, Theater Co., writing, jello Snorfling, Trombofones, tower climbing, Proprietor-jacks place, band, rage band. P.j.'S, Hackysack. Likes: Mobulating, Caumsett, iam- 1 K. Monaco S. Morotti ming, bopping, Mets, Folk, Bluegrass, originality, all friends, Hot tubes, parties, mountains, Sunsets on the moon. Fond Memories: Guitar at pit w1Dave and Dylan, Balloon of- ficial, Macy's Parade '82, '83, Bunruns, Bon ires, Pumbkin, Arachnidman seaside, upstate, W. Hampton, Paint1Tarp night, Hose in tent, jacks place, Talent show '84 an '85. Future Plans: Major film Director and Producer or open a chain of Mothballs unlimited. Chris Lanzillitti. Nickname: Lanz, Lanzo, Lizard- man, Sniffles, Sweet Pea III, Groucho. Likes: Yankees, Rangers, Chinese- Italian food, bousches, summers, Hollywood Beach, Montreal, Mex- ican Americans, Country life, Old Stones, French-Canadian women. Fond Memories: Camel, key, ar- bitor, bousch busters,'l-Iank, Doc, Patty, Lauri, Mr. Dale, Aeronautics, Brain, Chickkenman, min-bousch, Days of Marty, Mr. Rice. . Future Plans: To save the world from oblivion. April Eve Lauda. Nickname: Ape, Monkey, M.D., Bay-bee. Activities: Having fun doing what I want, hanging out, driving wild w1jayme, dancing, skiing. Likes: Steve, Gutsy people, huge styrophone cups, Madonna, being friends w1jayme, Roses, j.O.'s loud parties, being away from home, fast cars, camaros. Fond Memories: Stuart, The Year w1c.L., New years Eve at D.O.G.'s, Huntington 613183, X-mas Day 83, Cnrisin in the jellybean, friends forever, my house sweet sixteen, Grafton St. 82, beat. . : Future Plans: Becoming an R.N., living long and being happy. Christina Mary Lawless. Nickname: Chrissy, Lipless, Flawless. Activities: H.F.T.C., Choir, Girls Waterpolo Team-Capt., Har- borlights, Madrigals. Likes: Singing, coordination, hang- ing out, dancin , G.H., Mokin' w1Shata, my famiTy, rainylcold air, the Capezio Fond Memories: T.S. 82' with Audge, 234, How now uncanard brun, foot rints in m bathtub, 23 W.S. Fiddler, V.K., ghewd show, camp, black eyeshadow w1Laura and Kath, laughing in bed, Fireman's Fair '83, Christie's par- ties, Homecoming, city trips, fish store w1L.Z., C.P., L.L. Ez T.R. Future Plans: Successful career, happiness and money. Frank Michael Lee. Nickname: Mike, Michel, Mister Wonderful. Activities: Trombophones, Band, Orch., Choir, Stage band, Madrigals, Titans, Newspaper, Cer- cle, Hist. Club, Tennis, Debate Club, Sr. Hi's, COCOA, Ladd. Likes: phones, Choir-lo ue, WWF, Desk Art, Figure-fours, Igiledrivers, The Hosers, writing letters, Chicago's. Fond Memories: Phones, Cow Creek, G.P.A.T., j's and Doug's Par- ties, Chicken runs, Tuscororia, Bananas for Filby, 'Candy' for Doc, Hawaii, Family. Future Plans: A platinum 'Phones album, a book to Pencil, A WWF Ti- tle, Success and happiness. josh Lefkon. Nicknames: Rockstar, EGO. ' 'C- Neder C. Nonneninacher Activities: jamming, Marauding, Dorito bonfires, Guardians of Knob, Lawn jobs, Smoke shows, narrow escapes. Likes: YNGWIE, Marshalls., B.C. Rich, Groupies, Ego trips, true metal, Venom Cronos, Human Beat Box, KISS F.M., Tirante Cajitas, preaching. Fond Memories: Purgatory, Battle of the Bands, CAC North and South, Boot Hill, Rock n Roll Weekends, Fort Hill, Sweden. Future Plans: To live my life in a Heavy Metal Daze. Russell Leggio. Nickname: Ledge. Activities: Varsity Football, Sprin and Winter Track, Powder Puff Float Committee, Boys Leaders. Likes: Parties, Booshes, Fire Island, E.R.S.R. ski trips, summer, sleeping in Sr. Lounge. Dislikes: Waiting for ski trips, Health OKEY. Fond Memories: Saturday mornin breakfast, The Bangers, English with Doc, Anthony 6 mouths. Future Plans: college, money, fun. Mitchell Levine. Nickname: Mitch. Likes: Computers, sports, cars. Fond Memories: Great times with j.S., Summer '84, First time I met jackie, D.R.'s house. Raymond Lewis. Nickname: johnny the Magnetic Man, Ratman. Activities: Tree climbing, camping, cycling, Boy Scouts, roof walking, exfoliation, S.C.T.C.A., Guitar, Hanging out. Likes: jimi Hendrix, Niel Young, Glitter, Washington State. Fond Memories: jack's place, Bike Cape Cod, Paint1Tarp Night, In- version Unit, Caumsett, The Blues Unit, Hose in tent. Future Plans: Forest Management. Loran E. Libert. Nickname: Lorn, Lorny, Punce. Activities: Band. Likes: Guys, Pa in , art, Zebras, black vettes, Mojorisin, weekends, Fla. Sun, Mets, SS6zB, peanut butter. Fond Memories: 8th w1Lis, Hold Me Now, Fla. '83, Fried w1B.D. '84, K.R.'s U, Smokin' a bone, Shotgun blasts, cruizin'. Future Plans: Become an artist, man'y a millionaire, drive a black vette and live on a zebra farm. Lisa Lomangino. Nickname: Lis, Lee-bonz. Likes: Dave, PRINCE, fuscia, hang- ing with the gang, dirt biking ridingi small hair, t e Neil Young side, i, Triumph, T's tuna melts, Randy R., Rik, Fitz erald Gibbs, Trey's truck, PURPLgE RAIN, the Redesigned grossmobile, Fridays. Fond Memories: Crashing with Dave, Homecoming dance '83, riding with C.P. and the gu s, when C.P. fell off the bus, Big Barry's, Organics, Mr. Bumps, George Torment, Avid Photographers, Christmas vacation '83, Kyle's parties, falling on Gary's pond, a note to jim jamie, Ann + herself, refri with a denim jacket, the lounge chairs, Prom '84, lack pizza, 5112184, being chased w1C.P. and E.C., Caumsett, 4!l7l34, Little jim, Scavenger Hunt '84, Susan Linsay. Nickname: Lindseed. Activities: Band. Likes: Music, sports, parties, Fond Memories: LACES, G,L,, BL, 1 M , 0, - mf V j. Nunes T. O' Hara S. Rosenberg D. Ruggiero 15th birthday. Helen Lutz Activities: German Club tPres. and Treas.j, Northport Trolley Co., horseback riding, creating mild havoc. Likes: M friends, the Police, Sting, IZC.K, C.E., Alvin, Haagen-Dazs, roses, Chinese food, sweaters, argyles, parties, backrubs, guys, horses ows. Fond Memories: 9117184, Olym- pics wlA.S. and K.K. at K.K.'s house, 9123184, 12118182, N.T.C. '83 and '84, L.S.'s going away party for G.S. fKarl!j, E.S.'s pool party, S.H.F., S.R. party '81, Arizona w1j.M. '79, Olympia w1B.c.D. and j.R. Robert Lynch. Activities: Football, Lacrosse. Likes: The Beach, Fridays, Satur- days, Holidays, Snowdays. Future Plans: Become rich. Kathleen Patricia Madden. Nickname: Kathy, Kath. Activities: Skiing, having fun. Likes: beaches, eyelashes, warm sweaters, Met games, rosy cheeks, apples, rain stonns at night, jack and Glory. Fond Memories: parties at Christy's, Firemans Fair '83, beach parties, Stu and Eric's overnight, my house, dancing w1Steph, ow are the Yanks?!!,' bonfires in the woods, New Years '81, Sue and Vanderbuilt, laurghing in bed w1L 6: C, 'Best riends!!', bush jumping-eh?! , Ruchel's 16th B-day party, Dennis', R 6: L's B-day parties. Future Plans: Happiness. Deborah Lynn Maher. Nickname: Debbie, Debore. Activities: Drill Team, Student Council, Track, Powder Puff '83, Honor Society. Likes: Being wlfriends, pepperoni, money, clothes, Madonna, B.B. limos. Fond Memories: Summer of '84, F.M.'s class, L.R.'s boat, Ski trip '84, D.D. at 3, Who has the dresses?, Colorado, T.D. Kid. Future Plans: college, money, happiness. David Mahoney. Nickname: Crasher, Dude. Activities: Foosball, sleeping, Y.B. Likes: girl watching, cruising, my alpine, Lamborghinis, beach par- ties, N YC, last day of school. Fond Memories: Centerport beach, Pyromania in Mr. Benjamin's class, jammin with Atrilogy. Future Plans: making money, lots of money. Kenneth joseph Anthony Marchia. Nickname: Musha little boy. Activities: Football, intramural volleyball, basketball, student ovemment, Powder Puff '83, '85., goy's leaders, float committee. Likes: Present girlfriend, M. lights, ,uv ' an t, ' P 1 .. 'N-,-gf ki 'nn Q. ,. 1 4 ' ,'- -a-l. .,' -' rf --z 4 ff' . .Q-1' -al W gnu' 4' -. 1 ix I me j. Olsen D. O' Shea L. Pagano A. Saisselin L. Schwartz D. Spering spending and getting money, Nickname: Dibble, B00- weekends, loud music, Kenny Rodgers. Fond Memories: Bubba mobile, '84 football season. Future Plans: becoming a Physical Therapist, living in Montauk on the water with a 5' 100 pound blonde, blue-eyefi girl. Lisa Ann Maro.' Nickname: Lee, Lis, Lisa-Ann, Marowitz. Activities: Powder Puff, float, Mar- ching band, concert band, student government. Likes: T.S., dancing, nice clothes, shopping, traveling, Christmas, the Islanders, jets, Giants and Trans Ams. Fond Memories: Montauk '84, NYC '84, 918185, Mazda cruisin action, Kim's parties, H.S.M.D., jets game, talks w1K.M. Future Plans: Marriage, children, wealth, happiness and a Rolls Royce. Bradford j. Martin. Nickname: Chuckie, Bradley. Activities: Football, Basketball, Baseball, Golf, Boys Leaders Ex- ecutive board, Student Gov., Stu- dent Council. Likes: The six'em, Mr. Inevitable, Poisches, Wrathing in the 'stang, Ice cream, Beating john Glenn. Fond Memories: four years of the six'em, when Rich got beat up on the train, Beefsteaks, going out with Annie, Cruising in the horney-T, Missioning. Future Plans: College, Law school and a lot of fun. Michael Andrew Mathis. Nickname: Anthony. Activities: Marching band, wind ensemble, track, yearbook, Honor society, polo team. Likes: joan, Tina, marching band at Shea, Madonna, talking with Mrs. U., the attitude, the Mustang. Fond Memories: No, we're cousinsl, Stowe '84 no keys, those dark Southern Swedes, Mom's pastafazul, the regular guy look, woops, Berlin, New Years '84, let Ken chaperone, quarters, really?, I'll pay for gas. Future Plans: Extreme wealth. Alessandra Mazzola. Nickname: Sandy, Sandy D, 55 6: M. Activities: Horseback Riding, chas- ing guys, having fun. Likes: B.T., M.V., ice cream men, Billy Idol, guys wlpunk haircuts, staying out all nig t, Paris New York, Smitty's, cruising parking lots, hanging out wlMichelle and Vickie, Paris w1Vickie, Mike, and Phil, Chevron searen, Noelle's sleepovers, Florida, Apt., Mobil gas station. Future Plans: Become Rich, Olym- pics '90, Have as much fun as possible, Timothv Thomas McCallan. Activities: Wrestling, Lacrosse. Likes: Chargers, parties, Scavenger Hunts, Everclear 190, Moto cross, Layinilieavy abuse. Fond emories: O'Gradys parties, South Carolina 81-84, Great Adventure 84, Dennis' boat at Centerport Beach, P.A. cruisin' in Huntington, Ralphl, Bird Island, Kibbles and Bits patrol, Deathmobile Crew 84, Homecoming '84, 'The Make-up- Men, Top Row Nuts, Blue Suede Shoes. Future Plans: License, 69 Charger, Electrical Engineering, McCa lan Electronic Inc. Brendan M. McDermott. Nickname: Bren, Beanhead. Likes: K.K., 67-678 Camaro's, Fri- day nights at j,T.'s, hanging out w1A.L., B.S., D.P., M.S., M.H., Loud Music, Money, Sleeping late, vaca- tions, Stevie Nicks. Fond Memories: YZ 80, XR200, XR80, DS100, Hazeltine Knight and dayj, Westhampton '83, O.F. nights, Dirty Dave-wash your knees, Colony Hill, My 17th B.day, L.I.E. races wlthe Fuego- QI ll always win!j Cycle Mech, 84, Wildwood, Burrwood, Bill and the ninth graders, 7-27-83, Matt Hulberts swingin' singles party, Caumsett Cliffs, Bigfoot. Future Plans: Marriage feventual- lyj and good job, then death. Michael james McGowan. Activities: Lacrosse, x-country, In- tramural, Volleyball and Basket- ball, Honor Society, student council. Likes: Sports, parties, fall. Fond Memories: Kissam quotes, Lacrosse seasons, Intramural Volleyball, Night maneavors, All pizza in Rob's room. Edward McGuire. Nickname: Ed. Activities: working, hunting, fishing, hang-ing out. Likes: Babe's, Queen, eprechauns, buka, hanging out, snowstorms. Dislikes: jock guy's, English, buses, curfews, bosses, administration. Fond Memories: The Foob, Bob the tap, High Falls, Wut-Du-Crew, j.D., fishing trips, jR1SR Prom. Future Plans: To win. George Raymond McKee, jr. Nickname: B-Bomb,'99. Curious. Activities: Sta e Band, Mathletes, History Clui, Debate Club, Trombophones. Likes: bicycling, tnimpet, playing the Trombophones, lobster, shrimp, walking into doors, The Pink Panther, Mom's chili, my dog. Fond Memories: Summers in Ver- mont, Fire Island '82 '84, j.B.'s jacuzzi parties, Roof, Fireworks and Pursuit, jakes' trumpeting out the passenger seat. Future Plans: College, job, mar- riage, happiness. jeffrey McMilIian. K. Roberts W. Sweeney Nicknames: jeff, Fire. Likes: running, grapefruit-juice, twinkies, wee ends, football, a good book. Activities: football, track, W.B.A., honor society, V.P, student council. Fond Memories: ski trip, powder puff, all state. Future Plans: West Point, perfection. Andrea Megaris. Nickname: Ang., Pengy, Aaaang!. Likes: Leo, WLIR, Purple, Hands, Sunsets, Red Roses, Clothes, Diamonds, Parties, Walking on the beach, Rapping with CB, Spit, Tails. Fond Memories: 411183, Prom '83, Ski Trip '84, Time to Make the Donuts, Hecksher Park '83, KA- FOO-YA, Elosa, Larry's Party '82, Summer'81 and '83. Future Plans: College, marriage, and happiness. Christine Melnik. Nickname: Mel. Activities: Marching Band, Horseback riding, Bugging Mr. Kissam. Likes: jimmy, horses, R's, P.B.C.'s, M.A.S.l-I., Raslputin, Goldfish, Billy Idol, Pink Foyd, Peanut Butter, Snow. Dislikes: Monday mornin s, Dou- ble periods, Drill Team, Wg. Fond Memories: NPT., Prom '84, Driving with Kellie and Kathy, Halloween Party '83, Carl's fight with joanne, Anna, Chemistry with Carl and Kristin. Future Plans: To become a veterinarian. Renee H. Mesard Nickname: Rennie, Menee. Activities: Theatre Compan , Youth and Government, Yearbooz. Likes: Theatre, Saabs, clipboards, skiing, Vonnegut, real music, com- edy, caffeine, letters, black clothes. Fond Memories: cast parties, Canada, Andover, sunrise at the Grand Canyon, Flower child, 8th period English, Theatre Co. witches. Donna Marie Michlik Nickname: Donna marie alberghet- ti righetti spaghetti, Killer. Activities: Track, Band. Likes: Irish, Yankees, jets, Dave Righetti, Daryl Hall, Harrison Ford, Green, Mom's Irish Soda Bread, Dr. Pepper, Vermont, Mustangs, john, Fond Memories: Sth period for soda'?, marching at Shea, Hofstra, Daley Parties, Stowe '84 nokeys, 16th birthday, Aggressive?, Rory, No, were cousins. Angiela Miles. Nic name:Angel, Ann. Activities: Tennis, outdoors, swim- ming, beaches, guys, gorgeous hun s. Likes: jamaica, beaches, cute guys, and best of all summers. Fond Memories: Year of '82. , ., .4 ,rn D. Roe L. do M. Roemer Vautier C. Yuffitn Future Plans: Going to College to major in Geology, I would like a Ph.d., To be very much independent. janet Miller. Nickname: jane, Roxanne, Pete. Activities: working at Hunt's, sleeping, having fun. Likes: weekends, summer, meeting people, being wlfriends, C.S., j.M., music, sleeping, food, blue eyes, my dog.: money, the beach, N.Y.C., mint c oc. chip, red 944 porsches, Pistachio nuts, Sue, Iifeguards. Fond Memories: Centerport Beach 84', C.S., 7123184, Growing up w1Sue, C.S.'s party, 7-28-84, get- ting lost on the South Shore fFire Islandj 9130184 Future Plans: College, money, mar- riage, kids, and happiness. Cynthia Monahan. Nickname: Cindy, Cin. Activities: Varsity Cheerleading. Likes: Chris, smiling, dancing, weekends, driving w1Ronnie, baby blue to cuddle. Fond Memories: 5-18-84 and 6-2- 84, 9th grade w1Sarah M., summer of '82, me and my R.C., 9-4-82, 3- 19-82 w1T.C., B.B., St, Patti's Day wljohn C. and Michele S., O.B. and S.C., 11th rade w1Michele and Erin, Irelanti Kiss the Windshield! Future Plans: College and a happy life. Mike Montai ne. Nickname: illontague, Farmer Brown. Activities: Football, Track, Likes: Mets, jets, Football. Fond Memories: Kissam's class. Future Plans: college. Paula Moon. Likes: N.Y. City, beaches, shows, concerts, parties. Fond Memories: Summer of '83. Future Plans: become a concert artist. Greg Moran. Nickname: Wheels, Felix, The Mammoth Trucker. Activities: WBA Basketball. Likes: Sports, Cars, Professional Wrestling. Fond Memories: Student Union, Bob Mandel, Foosball. Future Plans: Go to College. Roger Morgan. Nickname: Sir, juice. Activities: Basketball, Football, dancing. Likes: personality in a girl, sports cars. Fond Memories: When we beat john Glenn. Future Plans: Go to College and Play Basketball, and get a degree in business. Then I am going to take over my father's business. Stefanie Michelle Morotti. Squattie. Activities: Drill Team, Powder Puff, Girls Leaders, Float Committee. Likes: Being tan, USG, Fie Island, BABY PICTURES-SENIOR STATS 181 'io B.K. Runs, spending money, being with I.H., R.A., I.B., D.S., Red, Get- ting presents, my room, Chinese Fire Drills, Italian Food, Christmas. Fond Memories: Summer of '84, 10122183-Michele's, Drill Team Camp 83' and 84', Powder Puff '83, Vermont, Iets game '83, Chicago's, 716-717 Debb1e's, B,F.'s slumber parties, Charlie's Angel's with .D.B. Future Plans: College and Marriage. Alice Mullen: Nickname: Ali. Activities: Theater Co. Likes: Parties, money, hanging out with friends, talkin on the phone, making people laugir, sleeping, be- ing loud w1E.L. SNL. Fond Memories: Stage crew w1S.T., 6th pleriod frisbee games w1D.B. and .M. in '83, Friendlys w1E,L., Huntington F.D. w1N.M, and M.W., L.S,, D.G., 619184. Future Plans: College, making lots of money. Daniel Murdock. Nickname: King. Activities: Debate Club, History Club, Mathletes, Youth and Government. Likes: Silly Walks, Talking Heads, Star Trek, Rush, Monty Python, Roofs, Rain, Signs, Stephen King, Leave it to Beaver, The Honeymooners. Fond Memories: Roof, fireworks, Pursuit, Garbage cans, sleeping out, I.B.'s Parties, Maine. Future Plans: College, work, immortality. Daniel Myers. Nickname: Dannies-Dannies, Dan-Dano Manuel fMannyI, Abu Dhabi. Activities: Varsity Golf, Intramural Hocke ,H.H.,Ruchel. Likes: Ruchel, Hockey, Golf, sleep- ing, eating, Prince, The Clash, U2. Fond Memories: The Nighthawks, Stanly Cup Numbers 1, 3, and 4, Drive for Five, Paper Towels, Twinkies, Canoeing, Purple Rain 31's 1, 2, 3 M, Number One, 12-10-82. Future Plans: Happiness Bryan Scott Myles. Nickname: Scottie, The Rock. Activities: Varsity Basketball, In- tramurals, Boys Leaders, Likes: girls, hanging out, parties, basketball. Fond Memories: Dr. Davis' class. Future Plans: College, be wealthy, the glamorous life. Lori Neal. Activities: Band, Bowling. Likes: weekends, skiing, friends, partying, being BQ. Fond Memories: April 14, 1984, summers at WORC. Future Plans: College. Chuck Nonnenmacher. Nickname: Chuck. Likes:S orts, cars. Fond lvllemoriesz Mr. Hall's class, Powder Puff, Summer of 84. Future Plans: Become police officer for the 2nd precinct or Suffolk County. Carolyn Ann Neder. Nickname: Frieda, Ca, slim, San- dybaby, Freed. Activities: Band, Stageband, Stu- dent council, float. Likes: Laughing, shoes, Macys, Making money, Spending Money, Aerobics, skiiing, well dressed preps, diet soda, bluefish, driving 'the sub. Fond Memories: Be boppin' w1w.w, Stu1Erics ski trips, 6th grade wash. d.c. trip - I, TNL W1L.R., Mo Yo 83, roselles '84, crussin w1T.B, B,D, L.L., Bio w1Ben, Speed reading 83, French class w1madame 83-84, Fun wlbean, fi, Thom som twins 84', action park and dilljy dalling. Future Plans: To become rich, traveling, French speaking nurse. Lincoln Nelson. Nickname: Skid, Zed. Likes: Weekends. Fond Memories: Quiet nights at the park with L.M. The hot car in in the cornfields, the Hill and the guys. 714184 . . . Fireworks!! The lake and the dinghy, the cliffs, Halloween 2 with raving bands of our own. Future Plans: To continue forever and a day . . . a love to last forever with L.M., and make serious cash semi-legally. Iames Nickerson. Nickname: Nicks Wild Boy, Stick, nickie. Activities: Soccer, Sailing, Karate, guitar, bicycling. Fond Memories: Bloody Thursday, Stuck in ski country, Stefanie in Florida, Stu and erics ski trip. Future Plans: College, Inner peace, success fmoney, ame, fortuneI, Family Ga Novins. Nidrklname: the Crane Activities: playing football, baseball, bowling, tennis, Youth in Government. Likes: pretty girls, going to parties, computers, socializing. Future Plans: To be successful in medicine or business and enjoy life to the fullest. Ieffrey David Nunes. Nickname: I.D. Activities: Newspaper editor, Bowling, Debate club, Mock Trial. Likes: I. P., skiing, Mets, S. King novels, Rush, Yes, Late nights, Lasers. Fond Memories: England 84, UVA, Doc, R.F. 6:P, Iays jacuzzi parties. Future Plans: Adventure, go to the stars and beyond. Michael Oates. Nickname: Goats. Activities: Tennis, football, hockey, waterskiing, biking. Likes: Summer nights, wild parties, and oingsick. Font? Memories: the time I had amnesia, abusing Nunes' locker Islip speedway, going on boat, Sunday football, hockey w1Frin and Tim, ski trips, docks. Future Plans: Proctologist. Dawn Marie O'Connor. Activities: Honor Society, Track, Field Hockey. Likes: Madonna, vacations, being wlfriends, eating peperoni, hugs, slurpees, limos. Fond Memories: Summer 84, F.M. class, L. R. boat, working at Dwdc, B.l. concert, Ski trip 84, Wake chas- ing, DD at 3, where are the dresses?, dr trip, Colorado, T.D. kid. Future Plans: Go to college and get rich. Iean Nancy Olsen. Nickname: Ieannie, orphie, Curly. Activities: Swimming, bicycling, sailing, wind surfing, snow mobil- in , working. Likes: NY Ran ers, Sunda s, Howie and his Eandbag, 4 clay vacations, A.L.L,, old houses, the Volvo, Pool Parties, Relaxing, dill- ing, 41, carebears. Fond Memories: A.V,, M.D., 8th19th grade, the beach, learning wind surfing, summer 83, yellow pacer at 7:05 A.M., kitty Kat, Wally world, Aug. 15, 1984, frozen hair, What did you do this weekend, ,,41,. Future Plans: Long term happiness, move away. Tracy O'Hara. Activities: Volleyball, basketball, marchin dzconcertband. Likes: skiin , weekends, parties, dancirlilg, 57 'F-Bird. Fond emories: Iets game, Powder Puff, '83, Summer '84, Hoftra, 31l7184. Future Plans: Marriage, Medical Illustrator. Chris Orr. Becky Boo. Activities: Football, Lacrosse. Likes: Weight lifting and Burger king mns. Future Plans: To o to college for physical therpy. I-Topefully to Spr- ingfield College, Mass. Donna Lynne O'Shea. Nickname: Dona. Activities: Field hockey, volleyball, teasing Mr. Mandel. Likes: Peter, Adam 6: George, Barney 6: Brandy, Grenwich Village, clothes, snowball fights, music, straight teeth Fond Memories: field hockey camp 82 6: 83, Chiringa, OF 82, Chris 6: Carlos, going mobile, Trivial in Conn,, Great neck summer of 84, erics ski trips, hanging out w1Wendy. Future Plans: college, career, marriage. Lisa Kate Pagano. Nickname: Lee. Activities: Varsity Tennis. Likes: S.M., Tennis, beaches, starry skies, going out, clothes, V.S., I.D., summer, music, being with friends. Fond Memories: East Hampton In- vitationals, l213182, ski trip '84, Montauk, 16th and 17th birthday, food fight with I.R., Great Adven- ture, Adventures with T.L., I.D.'s '66 Cadillac, Harbor Heights Park, Comeseque Park. Future Plans: College, success, wealth. Vincent Franklin Panettier. Nickname: Nuzzi, Gumba, Chinchillo. Activities: Raven, Drama Club, Float Committee, Student Council, Kobe. Likes: Water skiing, snow skiing, traveling, golfing, road trips. Fond Memories: Elpaz, Sand City parties '82, sleeping late, Dead con- certs, Hot Tuna '83, water skiing, King Kullen, Loon '84, winter vacation '84, car racing to Fire Island '84, Beekmans '84, cruising Huntington with P.A., Beach Boys concert '84, Nuzzi Burger King, Great Adventure' Future Plans: College, C.P.A. firm with H.F. Ioe Pania. Likes: Blondes with blue eyes, B.H,'s American Pie. Fond Memories: Who '82, Bob the Tap production of the Products. Iennifer Pantano. Nickname: Ienny, Ien. Activities: Drill Team, Choir, Stu- dent Council. Likes: Snowstorms, roses, Stratton, suntans, Cokes, Fall mornings, Prince, Christmas Eve, gossipin w1S.B. 6: I.M., F.W., S.G., Mom and Dad, Fond Memories: '83 ski trips - wahooin , Loon Mt., my Sweet 16, Powder Puff '83, '82 soccer games, Homecoming '82, Prom '83, 10128183, laughing with Steph, B.K. runs, Trenton State, summer '84 Future Plans: To marry Pat Cash David Pappalardo. Nickname: Pop, Dirty Dave. Activities: Moto X, Likes: Hanging out with the guys, B.M., B.S., A.L,, M.S. and L.L., Dirt Bikes, Boot Hill trips. Fond Memories: A.M. Tech, Motor Vehicle Dept., Hanging out at my house with B.M. C.C.P. and Eddie Murphy, 250 runs. Future Plans: To be the world's best motorcycle mechanic. Christopher Parenti. Activities: Skiing. Likes: G.P., partying wlfriends, hanging out on weekend sunshine, driving hot rods, trucks, sports cars. Fond Memories: G.P., '74 Buick Barge, B.I. grandfather's with P.B. Future Plans: Good Iob, live free. Leonard Paris. Nickname: Lenny. Activities: Bowling, Medical Explorers. Likes: Bowling, Baseball, Profes- sional Wrestling. Fond Memories: Winning Suf- folk1Nassau Bowling Proprieters Association scholarship. Future Plans: College, Dentistry. Keith Edward Peterson. Nickname: Kep, Thiek, Spiderman. Activities: Boy Scouts, band, Youth and Government, History Club, Newpapers, Trombophones. Likes: Life, the Universe and everything, blue, making a scene, frisbee, I.D., parties, stainless steel rat. Fond Memories: Usdan, Barton, Papa's class, Iay's parties, I-Con, Chemistry, Spiderman!! Future Plans: Megabucks, Mar- riage, Omnipotence, Bio- chemistry, NASA, immortality. Maria Rina Piscitelli. Nickname: Rina, Reen, Rea. Activities: Cutting hair, dancing. Likes: Diamonds. gold, roses, Vet- tes, Trans Ams, cutting hair, work- ing at NuDawn, Hangin out with Kimi Rifky, Tina ant? all my cousins. Fond Memories: Concord Competi- tion for Cosmetolo y '84, going to Images w1Kim, Ricqcy, Alex, Ste h and all my cousins, going to Sally Dog w1Kim and meeting Iohn and Keith, 4-17-83. Future Plans: Becoming a licensed hair-dresser and owning my own shop. Cathleen Plana. Nickname: Cath, Daffy, Caddy, Ceep. Likes: Adam, cruisin', hanging with the gang, riding, cold air, parties. Fond Memories: bonfires, W. Hampton '83, scavenger hunt, Big Barry's, Gary's Kparties, TIL, the Ci- ty, Prom '83 an '84 Cynthia Gail Poulos. Nickname: Cyndi, Smile . Activities: Soccer, softball. Likes: Weekends, paychecks, vaca- tions, sleeping late, spending 5, talking w1A.F., K.F. Fond Memories: U2 6183, Pretenders 5184, I.I.'s 614184, NYC '84. Future Plans: College, money. Deborah Preston. Nickname: Deb, Shmeb. Likes: Rob, partying, friendly people. Fond Memories: camping, Florida. Future Plans: Getting married and having a good time. Iohn Quinlan. Nickname: I.Q. Activities: Basketball and Boys Leaders. Likes: Weekends, beach, skiing, V.H., Police and Doobie Bros, summertime. Fond Memories: Police concert, Loon Mt., B.B. N.Y.C., New Year's Eve at K.F.'s house. Future Plans: Get a driver's license, college, businessman. Matt Quinlan. Nickname: MQ. Activities: Basketball team. Likes: Hoop, water skiing, sleeping late, good food, weekends, Camaros, Myrtle Beach. Fond Memories: That weekend at Saltaire, N.Y.C., New York's at K.F.'s. Future Plans: College, Business, Money, Lisa Ann Racaniello. Nickname: Lee, Lis. Activities: Cheerleading capt., class officer, Student Council, Honor Society. Likes: Boating, skiing, beaches, parties, Madonna. Fond Memories: Ski trip '84, sum- mer '84, my boat, windsurfer, boat breakdown, Montauk, prom '84, Powder Puff, 9th rade S.S, Future Plans: Colfege, get married, have 6 kids. Mary Ruchel Ramos. Nickname: Rush, Chel, Ruckel, Hey you, Chi. Activities: Field Hockey, Badmin- ton, Student Govt., Girls Leaders, Intramurals, D.M. Cycling, Honor Society, Student Council. Likes: Hugs, receiving letters, red roses, Tweetie, the beach, getting dressed up. Fond Memories: Homecoming '83 and '84, dinner dance, Danny's mono days, 18th birthday dinner, Powder Puff '83. Future Plans: Balance a career, raise a family, and still have a great life! Lisa Regeer. Nickname:Lis, Lee. Activities: Hanging out, skiing, driving. Likes: Dancing, artying wlfriends, life, sunny gays, roses, spending S. Fond Memories: Ski trip '83, Smitty's, Vanderbilt Museum, sum- mers '82 and '83, my house, Europe, Tiverton, R.I. Future Plans: Success, Happiness, College. Erik Rencs. Nickname: Wrench. Activities: Soccer, tennis, volleyball, skiing. Likes: Parties, girls, soccer, ski trips, deep religious discussion, making people laugh. Fond Memories: Loon, Milwaukee, Boston, Canada, Washington Square Park. Future Plans: College, money skiing. Melissa Ann Reuter. Nickname: Miss, Ralph, Deb. Activities: Band, Badminton, Track. Likes: Todd, good friends, cruisin w1L.C., D.B., .D., shopping, food, I.R., dancing, sunsets. Fond Memories: Fire Island Mass. L.C. and D.B. birthdays, Hamptons '84, Great Adventure 7-29-84, prom '83, Homecomin . Future Plans: Coiege, good times. Matthew M. Ricciardi. Nickname: Brain. Activities: Track, Debate Club, History Club, Newspaper, Mock Trial, Mathletes, Boys Leaders, Student Council. Likes: Monty Python, Santana, ELP, frisbee, skiing, sailing. Fond Memories: Roof, fireworks, pursuit, Santana concert, Iake's TV, Mrs. Filby, Tory, Summer of '84. Future Plans: Law and owning a castle. Charley Riggs. Likes: Quarters, skiing, sailing, ar- ties, Islanders, weekends, Police, sleeping late. Fond emories: Loon Mt., Big B's, Salt Aire, Police concert, Pocono's, golfing, snow banks, dodging trees, Centerport Beach, SUNY Stonybrook. Future Plans: College, get a real car, money, dump the bug. Victoria Ritter. Vickie, E.T., Seemore, Vickie O. Activities: Drill team, fox hunting. Likes: Ice cream, Billy Idol, Van Halen, Horseback riding, beaches, Paris, New York, leather. Fond Memories: Paris w1Phil, Mike, Sandy, Michelle, hanging out, trees, Tech. Future Plans: Travel after school, move away from L.I. and become a horsetrainer. Kyle Roberts. Nickname: Cecil, Carl, Calvin, Smile. Activities: Practical jokes, record collecting, cinematography, water tower climbing, sailing, wd. assn., art, concerts, Br. Runs. Likes: Rooftops, green, grape gum, frisbee, hockey, Star Trek, arties, summer, Beatles, the '6il?s, M. Golden. Fond Memories: 16th birthday, Christmas vacation '82 and '83, paintltarp night, Rush, Yes, Crim- son, Hamptons, Scavenger Hunt, goal posts. Robert Rodler. Nickname: Robbie, Bert. Activities: Football, wrestling, golf, hockey, intramurals, Boys leaders. Likes: payday, sports, movies, par- ties, winning. Fond Memories: Ski trips, Powder Puff, Commandos, Underdogs. Future Plans: College, fame and fortune. Dawn Marie Roe Activities: Drill Team, Orchestra, Powder Puff, Histo Club, Likes: the beach, rkangers, Penn Station, chocolate, weird clothes, and being spoiled. Fond Memories: Iets game, Hofstra Trenton, Ioumey concerts, Amish country, 82'183 school year, Duran club. Future Plans: To be a successful businesswomen and happily married. Micheal A. Roemer. Nickname: Headro, Haas Activities: Smegma, Football ar- ties, my bug, Bandit, money, IEISS fm, z-100, 36-24-36, Corvettes, Fond Memories: Summer 84', up state N.Y., S,V., D.G., Football 84', Fixing up The Bug, Lake George, Billy's Party, crashin parties, Beefsteak's, carousel, The card- games, Action Park, Billy Ioel Concert. Future Plans: College, Good Iob, corvette, Making it. Samantha Elizabeth Rondone. Nickname: Sam, Sammy, Sam I am Likes: Roses, sunsets, The Big Ci- 20 muscles, the phone, summer, -D-, Cars, weekends, being with 182 SENIUR STATS friends, Homecomings, B.U.M.S.S. Dislikes: boing boing, just really close friends, P.U.T.A., dirty brownies, cliques. Fond Memories: New Years Eve and Day, .38 Special Concert, St. johns, A.D. with Kim, singing into a bottle, 11l7184, Mercedes. Future Plans: go to Parsons in Paris, Travel, Get a job and make a lot of money. Stuart Ray Rosenburg. Nickname: Stu, Stuey, Booter Activities: Soccer, Volleyball, Skiing Likes: Skiing, hot tubbing, joking Around, dressing, different, Dislikes: Coldness texcept with Skiingj, physics, cockroaches, Gym, The wookie, applications, Huntington Security Patrol, Fond Memories: Ski trips, cam 77-84, California, Powder Puff Weekend, Rocky Horror, fast times at Ricks, my amis, nrnn- ing away Deathmobile crew 84', Canoe trips. Future Plans: Veterinarian in California with mega bucks. William Rosenfeld Nickname: Rosey Activities: Varsity Soccer, Pres. of Ski club. Likes: Girls, Girls and more Girls, Soccer, Skiing, Skateboarding, art, and easy going people with good persona itys Future Plans: To be an Advertising Artist and have a lot of money. David j. Ross Nickname: Dave, Favo Activities: Golf, Histo Club, Youth 6: Government, Ski club, WBA Likes: Yes, Police, Playing Golf, Yankees, jets, Pink Floyd, Rangers, C2H50H. Dislikes: the Islanders Fond Memories: Diners, trip to G.A., 1 Ted's surprise party, jets games, Ban'y's parties. Future Plans: College, Marriage Family, Death. Kristin j. Roth. Nickname: Kristin j. Roth Activities: Stony Brook Likes: music, words, people, food, fantasy, spontsneity, Sunday mornings Dislikes: regrets, cellulite, doubt, boredom, myopia, insomnia, split ends Fond Memories: Karl, Sigmund and Phill, summer 83', RUSH 84', Albany '82, the Dexters,l-jacuzzi arties, The Cheng ouse, Newtown, midnight walks, LC,LC,NLO,EE,ES. Future Plans: The Synthesis. Dawn Michele Ruggiero Nickname: Little Dee, Dawray Activities: Student Rep., rack Manager. Likes: Family, being with Eric, Diamonds, gold, Billy joel, walks along the beach, picnics, roses Dislikes: Monday mornings, get- ting up early. Fond Memories: Prom '83 and '84, third period with friends, vacation- ing with Grandparents. Future Plans: College, living a hap- py, healthy and successful life Alexander Ryley Nickname: Rube, Skoob, Rock star Likes: Toast, Drums, grunties, raw sewage, groupies, rubber donkies lungs, Monty Python, Dale Bozzio, immaturity, Neil Peart. Dislikes: Phonies, the Eurythmics, Duran Duran, AP courses, Black Metal, Prince. Fond Memories: roof, fireworks, ursuit, Papa's class, Talent shows SR, Rush, host . . . Guest, lakes. Future Plans: education, General Diaper Service, Rock stardom. Susanne Sabbatino Likes: Boats, waterskiing, sailing, beaches, sun, warm weather. Fond Memories: Times spent with my family, enjoying the summers with our boat, my brothers weddin . A Future glans: Study Law, CONIHUQ with my art work. Am Margret Saisselin Nickname: Sase, Space, Aim D Activities: Band, Orchestra, Choir, Pep Band, Marching Band, French Club. Likes: Chocolate, parties, friends, the hill, St. Eli ius, Camp Sears- mont, Billy joel, the Boss, S8rG Frenchhorn, Islanders, N.Y.C. Arlo. Dislikes: B.K,s, tests, Rangers, Suburbia, Fond Memories: X's B.B's, Carl, choc, cake fi hts, trees, 17 Birth- day, Hofstra, its game. Future Plans: Colle e, career in music, marriage, chiTdren, grand- children, death. Victoria Saladino Nickname: Vic Activities: Talking, playing trivial, working, hanging out with friends, Likes: Being w1friends, L.P., cruis- ing, Madonna, Fridays, having a good time. Fond Memories: Hanging out at the courts, Halloween '83, great adventure, L.P's parties, Ed driving us to 5.R.'s, 4th of july '83 8: '84, Action Park, Memorial day, Ski trip w1 L.P. and friends, Prom '84 Future Plans: College, Be a Phar- macist, own a red stingray conver- tible, get married, live in a house by the water and have kids. Elena Beth Schackter. Nickname: Mickey Activities: Dance tballetj, reading, heavy conversations. Likes: Spirituality, conservatism Kafka, joyce, Proust, Faulkner, par- ties, chocolate, ballet, every kind of Musk. Fond Memories: PARTY, summer '84 Papa Thoelen's class, '84, Mr. Atkins english ll class. Future lans: To become a ballerina who will make people believe who I'm portraying. To be a thoroughly well-routined, well balanced person. Luke Schaedle Nickname: Lucas Activities: Skiing, sailing, hiking, camping, piano Likes: blondes, blue eyes, snow, sun, beach, frisbee, arties, leather ties, apres ski, call otllhe wild. Fond Memories: ski trips, regattas, bloody Thursdaty, stuck in ski countries, Flori a, Albany, fast times at Squirrely's Future Plans: College, skiing, money, sailing, money, business fmy ownj, marriage, money Deborah T. Schmidt. Nicknames: Blondie, Splash, Barbie Activities: Cheerleading, drill team, French club, powder puff, ski club, track, yearbook co-editor in chief Likes:S-I-Mo, Centerville, glane tickets, sunshine, Calif. oys, manipulation, cocktails, expensive jewelry, old money, hats in air- rts, ni ht uttin , out o town Rims, jizaissm 8 Fond Memories: Mike, summer 84, Immm Ssorrryyyf' TD blowing it, Charlie's Angels w1j,B,S, drill team camp 84, Ohio 5110184, Homecom- ing + Beta 84 Future Plans: to marry an older millionaire with an Austrailian accent Elizabeth Schwartz. Nickname: Liz, Lizzie, Lisette, Elspeth. Activities: Drill team, choir, newspaper, French club, Photography club, Dance, piano. Likes: Friends, parties good times, sunsets, guys, chinese food, flowers. Fond Memories: WCWP, Gail's go- ing away parg fCarlj, Shea Stadium, choir, PP, LCH, Prom '83, Summer '84, SR party 81, DC's. Future Plans: College, career, mar- riage, kids and money. Kimberly Maureen Senior. Nickname: Kimmy. Likes: Weekends, Chris. Fond Memories: Prom '84. Future Plans: College, marriage, happiness and success. Danya Singer. Nickname: Whit, Dane. Likes: Dancing, going to Images, sleeping, goin? out with friends, shopping, IC D TEAS, Z28's, Porsches, the Rangers, Friends from HHHW and Whitman, disco. Fond Memories: Hanging out with Ilene, Lisa, Kris, Antoniette, Tina, Diana, Donna, joey, people at Im- ages, going out with Chris, Going away with Craig and Dad, Time spent with j.M.D., talking with Mom. Future Plans: Don't know, but I want to be rich, have a happy marriage. Marybeth Skalacki. Nickname: MB, Mare, L.M., Naughty, L.B.T.C. Activities: Swimming, float and earbook. Likes: Being with friends, shopp- ing, W.B. parties, beaches, being tan, GH, NYC, ni hts off, cruising, muscular men angscoop in a. Fond Memories: Datsun, Exxon, 38 Special concert, summer '83 and '84, DWC, Micky D's, What for?, Toga Party, Great Adventure. Future Plans: Trip to Florida in condo, and being a stewardess. jeffrey Slippen. Nickname: Slip. Activities: Football, Lacrosse, Boy Leaders. Likes: Skiing, winning, HF, parties, weekends, boating. Fond Memories: Safari, Lacrosse in the snow, CIBH, Paulie's Pounders, beating Glenn, Saturday Nights. Douglas Smith. Nickname: Dou . Activities: Banci yearbook, Photo Editor, Lacrosse, Knifemailing, Fly-tying, chemistry Mad Bomber. Likes: Old Mustangs, photography, working metal, cold weather, hot cars, j.D., marching band. Fond Memories: Rushbus '81, Rush '84, the old office, Hofstra '82 and '84 Future Plans: College, life. jacclueline Anne Smith. Nic name: jackie, Angel. Activities: Dancing, Piano, tennis, guitar, winning, talian club and Psycho Group. Likes: Italian guys, blondes, Cookies 'n' Cream, hanging out with j.K., M.L., and A.K., j.C.M., bein with Mitch. Fondg Memories: Hanging out in Northport with B.L., G.L., j.R. and Espitilally G.R., j.,l-i-its seventeenth irt ay party, ' e one do ar bet, Ruslgzconcert, breaking up with R.B.' . Future Plans: Going to college and then marriage. Kimberley Smith. Nickname: Kim Activities: Yearbook. Likes: j.K., roses, summers, the beach, parties, weekends, vaca- tions, sleeping late, new clothes, snow days, skiing, concerts, scoop- ing, Dodger. Fond emories: Summer '84, 417184, N.Y.C. with j.K., D.M. and C.A., dead zombies, CSN concert, dirty brownies, AD with Sam. Future Plans: College, marry Rich. Sharon Smith. Nickname: Sha. Activities: Marching Band, Badminton. Likes: Miracles, working, Snickers during 3rd quarter, Mom's Italian entrees. Fond Memories: jet .game 1983, Hofstra, peaceful Fri ays before long vacations. Future Plans: Serenity. Christine Elizabeth Smolcnop. Nickname: Chris, Spaz, LM Scatterbrain. Activities: Working, S.H., Float Committee. Likes: Bein with friends, football players, GH. parties, beach, shopp- ing, day? off, B.K. runs, journz?'. Fond emories: Summer o '84, Great Adventure, beach party. Future Plans: College, marry rich guy, trip to Florida. Debra Dee Sperling. Nickname: Debbie, Deb. Activities: Theater Company, Can- dystriping, National junior Honor Society V.P. Likes: Red, summers, candystrip- ing, plays, music, talks with S., disecting, all-day rehearsals, N.Y.C. people. Fond Memories: Summers of '83, '84, winter '83, '84, Flanders, Fid- dler and Annie, garbage per- son, trip to N.Y.C. with heater Group, H.S.-V.P., Stage Manager. Future Plans: College, career, mar- riage, family, to have a long, happy and healthy life. Dana Spinner. Nickname: Bim, Red, Danish, Ro- dent, Dizzy D, Chilli D. Activities: Skiing. Likes: Paul, friends, Westbury, money, roses, 14k gold, clothes, diamonds. Fond Memories: Westbury, sum- mer '83, '84. Future Plans: College, marriage, money. Michele Stellato. Nickname: Mickey. Likes: Weekends, lasting friendships. Fond Memories: 914183, The Park, Centerport Beach john Strong Nickname: loop. Activities: j.V. football, V. football. Likes: Chinese food, football, Van Halen. Fond Memories: 1983 New Years Eve, Summer of 1983. Future Plans: College success. Kristine Sullivan. Nickname: Krissy, Product 3. Activities: Partying, talking constantly. Likes: Friends forever, sea breezes, telephones, ski trips, snow storms, Fire Island, vacations, water skiing, horses. Fond Memories: Ski trips, '82, '83, '84, Neil Young '83, G.C. Hill, Knollwood Beach, R.H., N.Y. City. Future Plans: College William George Sweeney, jr. Nickname: Billy, Guerme, Marvin, Uncle Biw. Activities: Band, Theater Compan . Likes: Being Irish, skiing, gollf, parties. Fond Memories: Stu and Er-ic's ski trips, marching at jets game 1983. Future Plans: College, accoun- tinglcomputers, success, marriage. Debra Denise Tention. Nickname: Debbie, Deb-ski, Love- child, Shah-love, Cookie. Likes: The City, taking car of Tif- fany, children, helpin others, talking on the phone For hours, vacations and sleeping. Fond Memories: Faster of '83, The DeBar-ge Concert at Great Adven- ture, he New Edition and Force M.D.'s concert with Renee. Activities: H.F. Dance Co., H.F. Theater Co., P.A.C. Future Plans: To do the best that I can do, to be successful and happy, and lead the glamorous life! Heather Tischner. Nickname: Tush, Angel. Activities: Poetry. Likes: Eric, cars, Burger King, beach, snow, roses, money. Future Plans: Man'iage, working, family. Steve Toteda. Activities: Ski Club, Drama Club. Likes: Sailing, wateiskiing, skiin . Fond Memories: Summer '54, waterskiing on Sue's boat, ski trips '82, '83, '84, '85. Future Plans: College, a job, sailing around the world when I retire. Brad Trotta. Nickname: Brad, Trotts, Bradley. Activities: Lacrosse, wrestling, History Club, Surfing, Life-guarding. Likes: Surfing, good times with good friends, beach parties, Mon- tauk, placing in tourneys. Fond Memories: Huntington Tour- nament '82, fishin with Greg, div- ing trips with Totfd, attempting to bum the Lifeguard chair. Future Plans: College, money, mar- riage, kids. Kenneth Vaba. Nickname: Goya Bean. Activities: Fishing. Likes: Parties. Future Plans: Work, marriage. Jacqueline A. Vaughn. Nickname: jacquie Vaughn. Activities: Art. Igikes: Malcolm, Micky D's, Beach now. Future Plans: Marriage, working. Lucille Vautier. Nickname: Lucas. Activities: Partying. Likes: Parties, sailing, sunsets I 1 FVLFMVC WQWZSP Puerto Rico, ski trips, waterskiing, seas breezes, V.K. Concerts. Fond Memories: Spring break '83, ski trips '83, summer '83,, Hun- tington Beach, Prom '84, horseback riding in the Fall. Future Plans: College, reunions. Douglas Venuti. Nickname: Doug, Venut, Magilla, Dougie. Activities: Football, acting, baseball. Likes: Girls, money, parties, Busch. Fond Memories: Powder Puff, Larry's bachelor party. Future Plans: Computer-programmer josephine Villalona. Nickname: jo, josie. Likes: Going out with friends, Manhattan, walks on the beach, spending time alone to draw, shop- ping, sunsets. Fond Memories: M.G.'s party with I.H., going to Manhattan with M.D., spending my summers in S.D. Future Plans: To be happy and successful. Sondra Walter. Nickname: Sonji. Activities: Varsity Field Hockey, Varsity Basketball, Varsity Softba l, Girls' Leaders, Girls' Athletic Council, Student Council, Likes: Basketball, Mr. H. 811, peanut butter. Fond Memories: Emtpire States, 9121l84, Powder Pu f, talks 'til 5:30, backgammon, shopping with Chel. Future Plans: Basketball coach, Biology teacher, 2 kids. Sandra jeanne Ward. Nickname: Sandy, Flipper, better Vs,jeannie. Activities: Powder Puff, Homecom- in Float, M.Y.F., Band, Pep Band. Lifes: Sailing, going out, skiing, Trivial Pursuit, football, the beach. Fond Memories: M.Y.F., M.G.'s par- ty, G.S.'s going-away party, fishing, summer '84. Future Plans: College, accounting, marriage. Alan Williams. Nickname: Alvin. Activities: Youth and Government, Photography Club, Yearbook, Newspaper. Likes: P otography, acting, music, Trivial Pursuit. Fond Memories: 619184 and j.D., Homecoming '84. Future Plans: West Virginia University, journalism. Michelle Weissberg. Nickname: Shelli j, Mickey. Likes: Being with friends, nature, sleeping late, weekends, time alone, talking, money. Future Plans: College, traveling. Linda C. Zimmerman. Nickname: Zim, Lin. Activities: Varsity Basketball, Var- sity Softball. Likes: Softball, sunsets, friends, Mr. Mom, partying, hugs, Fond Memories: Hamptons '83 and '84. scavenger hunt, Sweet 16, Easter Seals '83 and '84, Haunted House. Future Plans: College, marriage, curing T.M.j. Syndrome. P. Koo wviwfi Vxicfmame -: A445 Ac-F flvfifei 'iff K' H 01565 -Anja h Lpjryj DQVIS Q19 fl f 0 :fl JS mf D15 HIGHS- 1'-Trust in ' and shi! 5:'traaW1S' out . - Lune Deaf! SENIUH STATS 183 INN Q 3-fi 5 . . ,rij 1- I' o 51: .n ,1 1.1. 11.-1 s-N J, A study in contrasts is the most appropriate one-liner for our district. From the hilly seashore community of Centerport to the once-farmed developments and quaintness of Greenlawn, we contain a bit of many worlds. While primarily a commuter's suburb of New York City there is a wide range of businesses from Washington Drive and 25A to Broadway and Pulaski Rd. From wealthy to poor two old established communities ' - have absorbed Suburbia and , , H it produced a 1200 student t 1 ' Q high school in a district , -' ,' considered one of the best on ,fl ,af'i'f,. gn, lx, X., , N51 fflil l' Lf! 3- Ybfvi filiifl. N1 F54 -ik 15542153 Xin- nv LB, M X , 1 Mn. X , Af-:fX1,flf'Al'-it fff if , Ewifii ' y ,r sexi? , g ,Tl ,.f- W X 2 I wgwsg wg' NSW' . r 1 'N :jd 4,-' lr , -va - I-at Q fi I N- ,iv Mfr J ' :W My miM?Fix. 'W' ' v lst we Wavmlaisdiii' ffl v A ff x 4 w rig ft fu ' it 2f?ftg 'iygk ff 1 'fi.?Lf.7 H.'.f'w1 fu L5'5',: L' sr -ni' MMT' afwaa- N if w:f:alg1'E:1fw1 . Broadway Gfeenlawrl 15 one . of the most traveled streets in ' ' fa. . our commun1ty. 184 COMMUNITY AND ADS X F mvff-of y y ' :lil- , H. . . M sw In the more scen1c part of the k vq,hA Y Centerport Greenlawn area we see one of the les traveled area of Forest Drive. I JQV fyiwzgg ,, ,.,,,,.gwwpL,-.1 Q -ww V wmv ' ww fl ifvgkiiifiafiiiel 9 ,fp-?nmiw':i ,ygpfmifs-4:abzn33H 'J' i,Y:JFy1Er v1m1w.f' ,gr.-Lmwgfjilfklif H3 'L Q' 25129 ,fir if:'f5s'iw,i1 ?iAf' yamaltvvfrrwssg wfgwtfiztffll M525 kl,gw:,gfMw.,gw L34gZr?Qgt-Tw . 'lwigxfl gfililfi Kami mgxgtjf mf X t:??::fK ' v W ,l'.'fJ'Y'4f,. , J ' W qw ,lwgpltkg rm ,M ,N-fi '- lm, :?'2 4 , , . 5 w-yy: 252-'.uJ?9' H, 1 W- Hliilmq gin? U ! 5? ' 1 I +uG,'7W' , ,1 .1 ,J'1'W,1W'-:I Z, Jffgf' L Y f ik Af M :fd 315 , iff iwfyfff 1 fluff, -frm? . f W, uiiiiwwwwfiwmf+f:..f fm- ., .,iezsgvxw-fgmawaMai, i5zZl51i'fg H . r 'ifdlwwfwfrfe-L'-Jetfa J lbgzffwiqffifff9-MW.: 'W V 4 -if.fQfjQLv344' Centerport stores, a small village with all the necessities. V95 '3 Ws'3A'?? 'W5!-F'Jl lrgfliw-iw,kf--ww Clsjgwfnwg 14,3423 1is:-iiwifilivwki,-'Es3,, Twi'W:1.,nv Ml .fwxms-i::'eQf'1's rizgmzlxl-fiawasmg W fwms9Fy3p,:,u1.r .. ,wqwf-1. 154157, lbilifll. rub vf 'fwliiwi QU! p 'W , 3 gfv. ,wwe ,.,r MPR' Laulmfllil www ,Isl nf X ...,,i,,,,, 'iaivfik-'vac mall . .Hs 'V'f1V'N.' ZW l'ilil'iW.ai5rf?ei5 -.mlftgwqjwa ,l,, A Q 'fW3E ,ni3:Fr5q,g qi wgi .mir-ffM?'f:3iEf2 sm? lwfwii. ggi- guy ww-1 llllwiiaglv Q' '. L. 1- MM .rl . ,i,,w,f V, wx Q-M: -W-M' New 1 l r 'rx' as le51h9fbt..73xy m-f -'alll .mf 'ill-v. llsimfvefwi H mlmlyfi- 1 r l fs- .Qt if-SL' 'F F154 Q. x'-vqiwwgiril, Www-sibrfan The Hart Bus is a very effec- tive way to travel everyday to the mall, work etc. ew - v- 1 ririfirftvil-l1,,,r.,, Evilf-my4k:W:v,eWHu.f1 Li'f,91.myz :Mmm f lik-hlwwwffwexi'-1, fir-if?-V' ,, 1-:e1w- 21'1i21ZQ:Lu'95- MvwM:W,.4i .4 M,-1, l1,ZQw,g,:' M-'f'3H.1f:413i15 ,ti-5,W,.,r.,t ,. me-v.wrlc , mm,,f,'-fqwg f,f,,w4S2i9c'1?ji., sl-311 War ,mi-infra fl 751'-'Z-QPZW ,, wi-'i,Y .'w VHWINQMI ttffvlglateaftz-n145'if l:t1f5:gfw,3fg,ewff: F1545-ggW -i'i'x'?2vQZ!3: JY' H 'L:L'5LQL'li J,,tg15fm-wftfig w M 4 I 146, .N is T I '.,.,f, u 1 , ,, I, 4,,.'1':fp,,1.f,, e , . . ,4.,,,,,,',. . 1 A Q' fl ,jbifffalila , ,..,.. 'Hfr.:f:,i1'- , + i:v5.3,,k,gj H . 1 r. ,fi ' s ,Ja 5, 1 A1 '4- ,K Y i- .'H.'Js:' -2 My .X .if . , ... . f -. 4 . I 1 , n rf ! ,Q ' r ' , - ...Y fa frffvv-5 -' . v .X Q W: wr, .... X,- ff wwgfkr f if . it -,,, HL ,,. ,, up-wg.,--, 7 .JA -1RsA ,,,.-,175 fvcvlgbffzw ESM, Q12-wg 'W lm. ,vgf,,LJ:qix?l-Qf.z'f'5w:,f vitfzmee., rfwwMLaAww-' ' '- f' Jw-aff izwfff, -, wth yawn vit? 1-, 'wsvll gy- Gi 5,5 ,1-.Ltfrf l,w!1lm'j?'QE'+rg,' U-,sy-, Mew ,'Cfrv,.:.g,-q.q.y'ff' vm Y ,mir-fu fm 'ws v- g-, im W wz1g5jig.'zfG1lMgL1rm,ZH ,f,57mWG.l,2yfW'f f' 4 ,,,a5r':m,y,aw A , -mJQlf, 'V'-,fll'A Lf- jk ei, V Q. Y, ,V AND ADS :lu SNAPPY 110 VIDEO 66W tJ h Tpk gt St NYI 673 3130 Qzmbmhma Pizza 4 theta CONGRATULATIONS Class of 1985 havin LARKFIELD LUMBER 81 SUPPLY CDRP 575 LARKFIELD no E NORTHPORT N Y 11731 15161368-3333 BARRY FORNUTO 263 Main Street Huntington, N.Y. 11743 . 15161 427-0063 CS CI'lC O . Huntm on a., . . 1746 RALPH 0. BONAGURA SAUSAGE BREADS 1516, 549-8177 I 7 A , ,,vt,1L, D ,:,,. spscmuzme IN ITALIAN cuusme 278 E. Jsmcno TPKE. NTINGTON STATION, N.Y. 11746 1 M I 1 4 H iw,-5, -ef 'ia Ax A .. ' .. . W 4 1 Q. -. l l I , I l 186 CUMMUNITY AND ADS - Jill cfuarlt .Hair Sinha ik John wuz Q 2 ' nc. A L' Ibleflllla I X gfcsznfawn Qfofulat IX-1. MON. TH . 9: e N .1 5 - by A BROADWAY ' Realty, GR WN. NEW Yonx I 0 1 3 was anoAowAv I GREENLAWN .....1 New vonx 11740 39 711B in Slrclf, 77orfL':orf 515-754-3939 261-3232 MY BEST WISHES GO WITH YOU CLASS OF 85 MR TAYLOR I MW., f E I516I2616647 1 P in-94 HUNTINGTON M salma! of music and dam' I :ao SPRING ROAD M W HUNTINGTON NY. 1-ooze Hours Mon Fri 11 9pm E I Q sat 109 .,'!?'ff fu - Sun 12 5 67 hir- . ACTION VIDEO ' MOVIES vcn W . EQUIPMENT I 11 W RENTALS SALES 5? V 4- 84 Broadway Greenlawn N Y 11740 1516, 549-4211! SKA N DIA wonua WIDE TRAVE 2 ms sa tH1lg1 Ne vofx1114a Boysldkar DIAMONDS ARMY -1' NAVY ,Timm 54-'l'NewYorkAve More I-lunhngtvn, N Y was Q51Q427 1012. Mm NU DAWN 7. UNISEX HAIRCUTTERS ' . Q. tinall ,r , X I HAH..-TON 5 l .- . . . . .L -ds? - 1 F . X .L , - - Q A 51 .W 4' Q- .. 5 ax L - 53 n mo, n on, w , . . ' 757 3 . , I 7 7 Iznu'Pu-nyz Sgdpu-v,y1, hhrfiukar . 5 3, 4 I X I - I ' K 3 0 ' I - 9 I s Y F 9 ff 9 Q and J df I O I ind . 'A A f . N 'Q 3 . 751 A Puusxl no 7 MON,WED menu ENLAWN HUNTINGTON 1 TuEs THuRs,Fnl 10-SPM I LAND SAT MPM COMMUNITY AND ADS 187 allon PETER E MALLCDN Salaries the Class Q' 85 May yomfym s atHmfIv01gFzeln1s be thejiundatzon fb7f' afuturehlled mth success amd peffsamzl sans nctzon 'F' 188 CUMMUNITY AND ADS I bf ff-is clllon Of C O - A ' .A ' - PETER It MALLLUN V 'ng ,,,.',4 , ' , fl, ' Long Island City, NY 11101 ' Ll - ' 31 fs. V ' 1 X ' TTS ' A New York's premier full service printer . I V' I HV-,ft----V-A.---J .7 'flag -I 15,-' Q- 1 1 if ' Lv.-,, P W' CONGRATULATIONS CLASS OF 1985 BEST OF LUCK P O BOX 313 GREENLAWN 754 1050 Lauri Adelstein May you always achieve what you set out to do. We love you. Love, Mom and Dad Kathy Alessio CGive me a break!J Con- gratulations and lots of luck in whatever you do. Love always, all your relatives, friends and, especially, your Mom and Dad. Karen Busweiler To Karen Lynn, our one and only , congratulations! We've never been more pro- ud of you. All our love and best wishes, Mom and Dad John Perry Catapano john, you have such en- thusiasm for life. Never stop being enthusiastic about it, opportunities are waiting for you. Go for it! Congratula- tions. Love you, Mom and Dad Kenneth Coen To Kenneth, Congratula- tions and good luck in all your future endeavors. Keep up the good work. We're proud of you. Love, Mom and Dad and Chris Tracy Cook Dear Twiggy - We're so proud of you! You did a great job. Congratulations! Guess you really were born ready . . . We love you, Dad and Di Christopher Daniels Chris - Congratulations. We are happy and very pro- ud of you. Good luck in your coming college years. Love, Mom and Dad Lisa Ruth Eleanor Davis Best wishes for the future. Have faith in God, have faith in ourself, and the world willihave faith in you. Love, The Family Linda Sarah Louise Davis Best wishes for the future. Have faith in God, have faith in ourself, and the world will, have faith in you. Love, The Family Barbara Domjan If credits be hard work and debits be life's pleasures, then make sure the ledger sheets of your life are pro- perly balanced. Love, Mom and Dad DEAR SENIORS - THE CLASS OF 1985 Your road through Harborfields has reached it end. The doorway to the rest of your life lies just around the corner. When you pass yourself with only the fondest and most pleasant memories of HF' forget the rest. These will be the base on which you build the Future. Go forth with pride and confidence. I wish you all the love and suc- cess in the world. You will not be forgotten. Our Love to You Always MR. AND MRS JOHN SHUTTLEWORTH through that portal nothing will, ever again, be the same. Surround Todd Davis Congratulations. With all our love. Dad and Sandy Carlton Einsel No parents could be pro- uder! Your sisters think you're the greatest! Con- gratulations for all your academic and athletic achievements. Our love is always with you. Mom and Dad Larry Feinstein With loving pride, we con- gratulate you on your graduation from the solid all-around years at Harbor- fields. Let's celebrate again four years from now!! Love, Mom, Dad and Michael Hillary Fink There is only one Hillary! We are so proud of your many accomplishments and the fine person you are. All of your wishes and dreams simply have to come true! Love, Mom and Dad David Heller We hope all your dreams come true. We are very pro- ud of you. All our love Mom and Dad jill Koenig Iill, you did it! I'm so hap- py for you and so proud. Good luck in North Dakota. l'll miss your smilin face. Much love, Mum Janice Kozma We both want to wish you good fortune in your career, and a healthy, happy future. You deserve it - We love you. Mom and Dad Marlene Kwiatkowski Dear Mars - Growing up is as difficult for parents as it is for kids . . . Understanding both sides is usually the key . . . We made it anyway. o Love, Mom and Dad Lisa Lomangino Dear Lis - The best of luck, happiness and success in all your endeavors. With all our love, Mom and Dad and Louis Robert Lynch Dear Robsy-Bobsy. Con- gratulations Kiddo! Great Iob! Love, Mazy and Pops Lisa Maro Congratulations Lisa. You made it! Love, Mom and Dad john McQueeney T.O.T.O.T.G. We love you! Mom, Dad, Mary, Harry, Matthew, and Alphie Renee Mesard Dear Renee, Who can say more then rich praise, that you alone are you. - Shaxespeare. Love, Mom and Dad Kimberly Monaco If she were someone else's daughter, we'd say she was smart, sweet, a delight and a joy. The best part is, she's ours. Love, Mom and Dad Roger Morgan We would like to con- gratulate our son, Roger, who will be raduating in june. Lots of Fuck and pro- splerity during the years a ead. Love, Mom and Dad Charles Nonnenmacher Chuck, we are so proud of you. You have come a long way and we have faith in your future. Love, Mom, Dad, and Sue Dawn O'Connor Dawn, we're proud of you even though you didn't make the wrestling team. Congratulations! Iohnny, Douglas, Glenn and cont'd on p. 196 COMMUNITY AND ADS 189 Good Luck Elementary School Class of '85 BEST WISHES to the TJL cLAss OF 1985 oldfield HARBORFIELDS Middle PTSA School Adventures 111 V I D E0 743 PULASKI ROAD GREENLAWN NEW YORK 11740 BOOSTERS Deb Lisa 81 Carolyn You guys are the Bestl Dawn Lee and Vic Best friends forever Purgatory rocks Good luck In college rock stars Good luck Christine Julie Hlllary and Sandy Love B C Suzy You made my 12 yrs happy Stay gold Sharon Shrlmps are word but lobsters are freash Lee n Lee Lisa You need a good one no Maul you dol l d like to say goodbye to a few ln the Jew Crewl? Nat I m gonna be late cause I gotta clean drs Marla Thanks for drlvlng us everywhere Rick L S M L 8- J N Take care Sr HI s It s been WONDERFUL! Pres 85 Suzy Keep the splrlt of 3rd grade recess always Sh Hey Hosers Giggles Wheezers Vicks peas etc BUFUI Best wishes Class of 85 from the PATRONS Carvel 412321 1934 Jericho Tpke E Northport N Y 1 1573 Greenlawn Hardware 83 Broadway Greenlawn N Y 11740 Huntington Business Products 339 Main St 11743 North Shore Dance Studio 875 E Jericho Tpke Huntington N Y 11746 Augal Jewelers 332 New York Ave Huntington N Y 11743 Fisher s Catermg 306 W Main St Huntington N Y 11743 Gunny Sack Boutique 54 Woodbine Ave Northport N Y 11768 Mid Village Pharmacy 51 Broadway Greenlawn N Y 11740 Oscar s Bookshop 389 New York Ave Huntington N Y 11743 L , .. Ig I i I l NIY- TROMBOPHONESI, Thanks for everything - Dad, Mom, Glo, 81 Ro. - Love, Pudgieg Alba - want to play some badminton?g Congrats - Julie, Hillary, and Christine - Love, Richg Karen - Thanx for all the memories hiccupl - Brenda 190 commumtv AND Aus 4 Negative Kept on File for Future Reference r CARCL STUDIDS, INC. 80 Atlantic Avenue Lynbrook New York 11563 fi 'Q YY 'Q' Offrcral Photographers for the 1985 Yearbook BEST WISHES TO THE CLASS OF 1985 9 a,., ,....... A V . 9 A X N 'X '- 3 6 ' H 'W . 5 X ! v S 3 ' R 4 4- 1' 1 , 4 1, pic' I V .U A '!5,c',' I' 5 . . ' Cie ' 'Q ., H fr' we M 4 A 4 N .- xxx 1 mffwb N 2 K 'K ' k k ' P fx . ' .lf 14. L 'wgst' ff - : .K-1 .3-,' -K1 n 'f' ' 'Af' ' ii . , 'ff' , ' . NA v,f,,1N - ff-PL, H , . 1 km ,JY 59.1 -,ag - V -.A rv'-fa'- i'. !'Wffrii r ' - . - if, . ,. ' - ' N 'gf E' W ff! 1 5 . , 1 3 f -- , A. . f ' ' . -ff 711: :Wu M - ' Qfgt' -V 'fftff' ' Q ,SMT V, ' ,- 5, . I ' -1 ' , I9 X. gughggf A rg .P M L 5 . . . COMMUNITY AND ADS 191 Doug Smith on delivery for Centerport Surgical. V .- l x l 1 V .-.v xg t A-, x ir li -1 -, H Sv. .3 hs: 4' n-'ni..'fQ 'XR -,,...u I X .lr , .- .HS gwfgvx tg . -Q , :hw H' o '. .4-J ' fl -, Mi.. 1 yvyvfh-15 , S - 'Turf' - tag . iv y '-uk - rl. If vrk' v I 9' , 9 ' 1' Dave Garbu s stocks the shelves at Huntington Business Products. Samantha Rondone takes inven- tory of the back room in the Wellbred Loaf. AS SOON AS WE DRIVE, WE WORK And Som Before . . etimes What do you mean I have to work my senior year if I want to go to college ... This might sound familiar to most seniors at Harborfields. Once you drive, you really need a job to support it, adds senior, Kim Smith. Without a car, it's really hard to get to work every day, comments Margo Conklin. These are a few of the problems that seniors go through with working and school. But all ends well as the seniors joyfully work through the last year of high school. 192 STUDENTS AT WORK Slit, 'X J mkfjmf x M.,-f' tel I . ,f UD X 1 ,gi fil l L' 1' .. 17212 I KZ ff' - 2 12: f ' , va ,ip -4' , Q fn Y' I . gpg , ,., A 1 7 L f N ., f-wqig What kind of cookies do you want? asks Kim Smith, a worker at the Well Bred Loaf. The crossroads of Washington Drive and Lone Oak sits Center- port Hardwae where Carl Curcio and Iim Devaney work. ,,. ML, . H 9- . , ' -+1 N-.., 5: rm Margo Conklin, a cashier at Waldbaums, grins at the passing customers. Mary Beth Skalacki cheerfully helps customers through check out. V i ' I X'gff'12 f ,7- f ' I, -A - so mmm . MW- , ,f1y:ff'2f'f- 44 STUDENTS AT WORK T93 , V . x 1'-'N Mx git' 75 6, - - 4. 1 ,hr A ,gf 9 'eip u-, aww ' w fi'f nf X Z 1 -L aut, 1 3 0, M -wi.-f 322- -. - N A gag Q , - 3 .. xc, A ' K1 f wi ff , v Y W 1 , .. EMU f .4 , F! 1 , 5 4 QF - 'W -. '-if , 0 i N Hn G M912 V A V lj N, Q ' JT Wfpf' 'am ff, 'Vi ' mf f V f ffl X J W FIN ,- .1 NN I 7 PX ,, U-f 12 Ecwljfpn lj ,N ,P ,. , A K AQ A! , J, Q fb Q W QM ff? 662 if I- Q .-,, ' R fx V Y n A 'P K Lf3!:af4M?7 fax WDSPJTCE5 ,fp ,,1 - ,H Vx ...J 'V QE :lx ,f I1 PV l N W K fx ,E V' NWMXX C., LJ C Q QQ f - A fw,A,, S U1lsOff5 Q: j fig 1, X Xxx ,. w K, I U M MQ Q5FE5+Q ii: W KW M ? 712 V K X Tha we 933. base -F-un. mu me N fund' qs o. SNS 'xx ff,-.I Q yay Rtll.tMbt!4U7'l7 5 'ly an P , , M Bryan 5'f3i..1,A,n .fam 000 D w 'QI ,IN N .n an Kung-1414 ?:::5:5:vwoIAd 59?-:z.q:.Sr.:Ca.g1Z0wb06n wt xskfmf! V1 g,Xp.v,g,g 4, 9'wn.,bvl- M14 Kfkfws.m'X5t,1Hi mu ebvhh vcmadgaivs lvfqlw 'A CML tak!-0-nl litggd ztwvnmlvsf-Hu.'l'lmd P wcomch re. m yn, eq.. .u1..,....--ggg mf. 0l0lNQ.9Ax We mjn-l- -hyws ,N gt E oh' SMS JP Egiiidlafat 1lIifTlierhBEt nn Q., . QM dan I L Q 3' irltgthe yearbo ever seen b ,'g' 'l ' ' 'PBWP e'aLQfg:2::,a ifgsrazfi 'J e. Thi n, so 9. pictulie aifclitave land S U, floor oth rwis fl 7 IM e L RCMWM LU' gl' wmv wwxw n. 'J' H Q :'H'V-9VTl'Iuwl43n23 II 'wLL'o C . J++5,-gm ef 117 973 3il'1, .f1'R. wb 'ly v-km gig.. L.,i'?1i-YN 6f'ix,':'2, 1 fg,gf,g-3 9,55 -N-ks Hwwgg wwk gilhhg BVS Lmullems ai-hmu. q,.,9,,Q,m' fhosc i JQl',LTf HQNE mhold, 'eu-f-S '52-5 ' ?'J'f'1.ww sw -enm- kt ,Alf .S ., 1 f mx PAWQK lf. 4 , QQZI-N :ciaf aM-an fb 'm. dura-725 cont'd from p . 189 Marc g lean Olsen Congratulations to Iean Olsen, a very hard worker, a real special person - May happiness and success be with you, always! Love, Mom and Dad Christopher Orr Honor, inititative, integri- ty, these building blocks to manhood, on and off the playing field, you have carv- ed. Thank you Chris. Love, Mom and Dad Lisa Pagano Yesterday is but today's memory and tomorrow is to- day's dream. Congratula- tions with love - Mom and Dad Ma. Ruchel Ramos Congratulations, sweetheart. May you be suc- cesful in all your undertak- ings in the years ahead. We love you. Mom and Dad, Sister and Brother Samantha Rondone Samantha, we are proud of your achievements at Har- borfields and wish you con- tinued success in college and all your future endeavors. Love, Mom and Dad Amy Saisselin To Dylan's best friend and my pride and joy: I love you better than St. Elsewhere, Hill St. Blues, and frozen Sara Lee cheesecake! Love, Mom Victoria Ann Saladino Dear Victoria - Occa- sionall life is blessed with beautiflul happiness. Victoria Ann, you will always be our happiness! Love and joy always - Mother, Dad and Anthony Elizabeth Schwartz We're truly proud of you and are looking forward to even greater ac- complishments in the ex- citing years that lie ahead of you. Mom and Dad Kim Senior To our beloved Kim - How very happy and proud you have made us. Thank you for being such a bless- ing. You'll do wonderfully in college. Love, Mom and Dad 196 Danya Singer Thanks for being you. Love, Mom and Dad Mary Beth Skalacki Congratulations to our Mary Beth!! May God always hold you in the palm of his hand. Love, Mom and Dad Jeff Slippen Good luck at Union! Love, Mom, Dad, Marc, and Danny Iacqueline Smith May your tomorrows fill you with the pride, joy and love that you have given us these past eighteen years. Love, Your Family Debra Sperling We are very proud of you - Success always. Love Mom and Dad Brad Trotta Dear Brad - May your college years mark the beginning of harder work and even greater rewards. You have made us proud! Love, Mom and Dad Alan Williams We are proud of you and your achievements at Har- borfields. Our message: Love and best wishes go with you at West Virginia University. Love, Mom, Dad and Cindy Diana Woodall To our first born, first love, first teenager, first to college - Thanks for listening. Love, Mom and Dad Linda Zimmermann May you always walk in sunshine and may you always have someone to love and be loved as much as we love you - Love, Mom and Dad Lisa Racaniello Congratulations, Lisa! From a fun loving little girl you have developed into a caring and wonderful young lady. We are proud of you and your accomplishments. Love, Mom and Dad Debbie Schmidt We hope your constant zest for life will last the rest of your years and that all your dreams come true. We love you. Mom, Dad, and Tipper gift - '- ,., . , D0 Nor snr H415 4' ,v ox 'Q X .5 x. F' ' IP Doug Hillary Karen Sue Smith Fink Domencetti Butsko PHOTO ED LAYOUT ED. COPY ED. BUSINESS 5- fa. Suzanne Kennedy, Jennifer Fink, Kim Lettice, Ann Frederick, Tricia Endres, Larry Davis, Charlie Hudson. STAFF MEMBERS Photographers Alan Williams Kevin Higgins Denise Datz Ann Fredericks Kim Marshall Sue Wohleking Tracy Roberts Steve Lanza Paul Miller Writers Donna DeRosa Kimberly Lettis Trish Endres K ' S 'th em mi Liz O'Driscoll Ruchel Ramos Rachel Fenderson jennifer Fink Layout Trish Endres Liz O'Driscoll Typists K F' aren in Christine Klerk Susan Woo Kenny Marchia Christine Cancemi Sandy Boccia Barbara Domjan Sandy Ward Kim Smith Mrs Ronco COLOPHO Ori inally a staff of 35 Harborlight 85 dwindled to 10 varying staffers with the majori ty oft e book produced by the five main editors Books went on sale in October during Senior portraits and again in November for 25 dollars Books sold after Nov 30th cost S30 00 Mrs Ronco has been advisor to the yearbook since 1980 This was the first year she and her students attended a yearbook conference hence the change in the format of the book Lettering and artwork were done by Samantha Rondone and Mrs Ronco The cover was designed by the editors while at Amherst and executed by Mrs Ronco It was camera ready artwork printed as a four color separation The endsheets were printed in black and white as artwork 80 lb glossy stock was used for the body of the book Body copy was 10 point solid Palatino with captions in 8 pt standard Palatino Headlines were Palatino Bold Caps and Helvetica Bold condensed 14 point bold Palatino was used for page numbers and folios Senior portraits were shot by Carol Studios of Lynnbrook who took 309 photos out of a class of 326 They also took underclassmen photos and supplied professional photographers film and developin service After being produced at Harbor ields High School by the Harborlight staff the 1985 book was printed in Dallas Texas by Taylor Publishing Company Our book was chosen as one of the best books from over 8000 by Taylor and will be distributed to their representatives all over the country Production was coordinated by Neil Sanders the Taylor representative to this area - - r . , . . I THE EXCITEMENT OF CREATING THIS BOOK HAS BEEN WITH US FROM THE BEGINNING AND :mc . 143, Ai A Jill Debbie Samantha Meyer Schmidt Rondone BUSINESS co-EDITORS-IN-cH1EF It all began last Spring at Columbia Univer- sity in March, and solidified at Amherst col- lege in Iuly. Four staffers and Advisor Ronco received intensive training on the how-to of yearbooking. Thanks mainly to Doc Savedge and the U. of Ohio's yearbook workshop at Amherst, Mass., you may notice a few major changes in the 84-85 Harborlight. Despite 2:30 AM fire alarms, Tony Noosebacher hos a aih-conditionah hilariously shouted through the hallowed halls and wild Thyra - it's 'wicked' late, the four days were an invaluable learning experience. So here we are, at the end of a book put together primarily by five of us, with a fluc- tuating staff of 20 or more, to type, write ar- ticles and take photos. Part of this new Har- borlight is the colophon above, which defines all the specifications of our book. In this arti- cle, we all congratulate one another publicly for a job well done - Cwhere done is the operative word!J. From Sam: Through all the last-minute changes and hassles, I'm glad we've had those great times together fgreen hair, smoke alarms and beach meetings!J Karen, Don't be a bathroom tile! It's been a pleasure working with all of you. From Debbie: Though sometimes I was ready to drop everything and run, in retrospect it is more than well worth it. Sam, I owe you one for all the times you've been there for me. What is going on?! We know what we're doing, at least half of the time . . . Thank you Mr. Ronco, Paul and Charlie for toleratin those marathon work sessions at your house. From KBTBIE Didn't think we'd get this far did we? Thank you all who've helped make this yearbook such a success. Thanks, Debbie for showin me the ropes of copywriting. Thanks Mrs. Ronco for pulling on our reins when we needed it, ang for keeping us going. Thanks Samantha for your house and for being there when I needed someone to joke with so we wouldn't go crazy. And thank you very much Hillary for alwiys having spirjf and il Hgujzil-gt9ho attitudegfowgardgylearbook. By the way, Sam - Go water your tur ey, you mega oor ti e.' 0 picas, two ac wi e. From Hillary: Thank you Karen, for keepin your sense of humor, especially on those days when we worked all of those hours and hours and liours . . . And don't forget Don't worry about it! Thanks Samantha for all that drivin - especially over vacation when we left the junior portraits in the yearbook office! Thanks, Debiie, for showing me how to do layouts. And Doug, for taking and prin- ting all of those pictures last minute. What would we have done without all of your quick, hard work? And finall , thank you Mrs. Ronco for keeping us all together and organized. If you weren't here, what woulcglwe have done? From Doug: As we end this year with a sigh, it's nice to look back and say it was great. We had our ups tsample bookj and downs tlate deadlinesl but all in all, it's been fun. Sam, where's that list of deadlines? Debbie, it's been a blast ever since I chased your makeup case at the terminal! Karen, it was strange and interesting working with you , . . and yes, Hillary, there is film in the autofocus! Finally, to Mrs. Ronco and the rest of you: Thanks for putting up with my idiosyncrasies fforgotten film and last-minute assignmentsj From Mrs. Ronco: Well, kids, we knew it would be hard to aspire to the standards of Doc Savedge without a class. Maybe only I knew how much harder as the year pro- gressed. Remember when we decided we'd do it right for as long as we could, then wipe out when it became impossible? Well, it did, and we didn't! I'm so very pro- ud of all of you feven if you did drive me crazyl. Sam - for those flashes of brilliance and all the angled spreads. Don't worry, Ronco. And Debbie, for your solid Ohio knowhow. Yeah, uhuh, okay, I'll do it tonight. Karen, God bless those dog-eared scraps of paper with writing all over them that somehow turned into copy! And of course, for standing on the table. Hillary, you are a marvel! Calm and steady, smiling and always there, in crises and otherwise. fAnd thank you, Mrs. Fink, for typing all that copy.J Doug, it took great courage to work with so many demanding females who depended on you doing your job before theirs could be completed! You did good, kid, but is that knife really necessary? To the student body and staff, we present Headlines the 1985 Harborlight. We hope you find the whole to be greater than the sum of its parts, and enjoy it. Respectfully submitted by The 1985 Harborlight Staff 197 ,fd v, L f 51 L Senior Kim Smith thinks about the end of the year. The end of a winning streak as the senior class leaves Harborfields. 198 CLUSING ,Y F- V A X!-l . 3 . 4 ' 5? ' -fn . f: - , 7 I . J , y 1' F 7- 1 .: f- . - ' ' 'H -4'-X, hmd ,i .2 Y' vim! SCAN J QL A .T--fff-3.7 , . ' A af CJ , ,.,.,-Q Y inf, H w rs Y U ' I-X Q37 M- J 2 S is ,aff if V A D ' is H are-ff: +A f f 1 C 'Q ' 'N-qfffx A ,, --, lx . ,,'fzV, JADE U4 Q3':j.w ,Ai 'PQ gig? We f , ' , A ii j 1 tag 3 ,J ,P T 'la-x CTT F5 V 'fi F' F g de T FL4 fi 'v , , W, gt: S ail C42 FJ .Nj f .. ef , ..: -Gif Q aiw 'ff' xg Af. G: ,, is .1 ' 'if X 1: gi f I Q, , , , i 6: XD .5 X he N ijf. ,Jr N 'A ,SWE as We A , 1. H , XJ XV K --,J if 5, J-1-Jkiilxf Q i X I L iq' N W ff, Y Us W ' f' 21' UQ? li F' X. . Y' -sf .wxjfxif Jays' L Y , ll Q 13 -T wi - .fu . f ix ., Ii L55 'xi Wi .-ii? T' . 5 1 ffl 'ff 4 2 .QV-7 'Q 'Q X Q dw Yr' AN 7 L ix ....... f y I mx PE KC' ff' f, ' , so F. M N Q ,W W., 5 ,vue 'Z 55 The end of the Buses leaves the school at the end of the day. '55 la I 0 0 . f WV Zffefb-51-ff-f Well it's that time again. Although some thought spring would never arrive - the year finally ended. Over 300 Seniors graduated to make room for the 1989 freshman class. From the starting line-up on the football team to the straight lines of the Marching Band and Drill Team at Hofstra, Harborfields made Headlines. For most, this is a time of joy. But for others, it's just the beginning. And for those who are Seniors, the beginning of an entire new world. So many things have happned this past year, and so fast too that you probably didn't even notice them. This was the year that the school was painted that awful brown, and then changed to green and gold. This year we beat Iohn Glenn! 7-6! And this year the roof was fixed, What a fun year! Iust think of all the friends each of us has made this year and all the good times we've all had together, in and out of school. Remember that Bleacher Bunch at all of the Home Basketball games? Remember the crazy Varsity Soccer team and their first appearance at the pep-rally dressed in shorts and Hawaiian shirts? There's been so many good times this year and there will be many more before this school year is out. Thank you people of Harborfields for making 1984-85 a year that will stay fond in everyone's memory forever. The sun sets over Harborfields, a The end of the Lunch line. Not a fun gorgeous sight to those who stay place to be as you can see. after for activities. CLOSING 199 I 5 4 Y N N5 wg by x , X I yqf' 5-E v X 3 S if Wig xiii? V35 .sm V lx , 54 S 0595 6? if 55 zoo cmsme ,Y , M95 A905 QOXOX oxvxgg W X M5065 VNUNC WN mchdjgk END OF THE LINE D if 1, 411 1 xx ,M 5 wen, 'IB Qimllkg over- wo more Bfology ' Ovf fX30wov'i-Xe guxcnjzifggfwe gamma-f IKE, Sgocyx uuLi3?L'lI 106, ld lyhfig OV1 He Q ofa 90109 Gligywtj ni' , , jliwou eewob -gifs Ljilgf vdffffivx QFYGHY QOOXO4 fifl-LSQQQQI' SKZSSQVI LMAO 'vw- S 'Y 3MYWiE,+ CAMGS cqliqmg bejfn WIS, Kyufvlilb IOOMDK, 6vi7n5,f8S3 OWJL343 def PYUZPHCQ1, 34-aJfif79 la-.sl--qfhe Qowlfbovll piwgyffw 619 WW, gp 'ogy -IQ 50 413 pmemca Cwmd KMXWXQIAQS .sifmeggaf gm, LOW! f+ +1205 lawns CQW YYN3' Z0 wi Qgfbldffb W QW M ,W mm, MW W W,,1U ,f,f,g+,3ggg3ggj ,jwfve cimbled NOK KQHWJ, kj9uJX,-Cliflcg WVWY 'TOWW ri3uo.J'VNQf3f me '0f'04'WM'5 awww Qovf-P-4 + Sieve l,om zox'S K-wma p9wH1d-66+ mfqslfwevl meg-gh? Q,.,F,50,u ggoowm, mgxmol fb? cggmg ao will Mum ew sash wQwQJf1++bv3'LwuK gywfvrw ww-4Wi.w1' 2,M9LQdsmZ?5oJfw1nf1Uf1'W05t 9fNd ffw i+lfw+PxoEef1fx0+owxD,LJC,-ES.Q,a.,511op OLY 00liHq Col, waiwxhnw Quai WMM Gd-LK Wai Comoug, -Hwe, cowrlb A901-YN TO Pkoidigi Vgxggrilwoimdil ,EORJQOVQ Oo-434, fiimnxmrf, WIAJI' 'l1waJkvuotfYD - WWE! ,w'?'1'5gQrEMLfi0. why OIC we Mn5vw?OjCiXejcizQ5Q-a'Vg!Qtm wamtcwuj ppm!-5pF', QM Qipyeg-kNLxi4 ,CJIZQOUUM Cm ,0YX44fLQ12ouYNf11qc,-iff! ww Jrhese EYUCS C324 SMP mUUnDC'mQn smog fqfmpuq Dim ,Wj 5UnbJrn Q DCDM51 VWQAZQ. me fauQjh,'ww M3 Pau HQHSBI ggmbyk pagan? amend-'Qnll S Pow 'vw-Jfw 'HfYXQ25 md We vrvem vo ww ww, imma bam new M OMB U06 f min 3 W W Leolfi QJIICQ, mwah my Qfwffxdwa much? 1'5f'Gl,'-AQ.f'kQ www lfiiegvwlfdj mini mwfln? Hoya mg cimld WSH!! 'l-v0lU+O? Kwon U-'Sf-JIUJW4 Q0 an S196LQ,CYYNQUfYvT31fyx,f Qnaapgd SPQQVNJ bowl cw? NUT rulfvyku UQHGJWN Qrwncifvwol fell Cyn, 9-Mqalagf 4916 CGW, gd BMW M when 'gow wer A pic. 549 Wwe! gwj, www dwfwlf guy TOOK Ox pk l9'P vs wr -PM QOOWNOLOLQ, wvuzfv we QAM m ifoulouv bg SMMIGW M Digfulgrplufg fywejwl QQLL much, aww wwvh lfPVW'CJ ljf Bi+Un vvwciv YYHNT Yfjwofps? Gcwamil CUE W WW' -dfiilgf im W WN-Q, O'VN T04 J Ovm Q I 5? 'wwm,,11,b So woswu M we-,wx cm, 1 awww Q01 'am FOYW-In 91,3 9,Q'VQ,06m, -HNUXJ-LA HQSQIVYNCM MOVE sHfw'Sfx95 -P0 Sig? mmf Him A W SWM-ff',M MQW wmv P0535 i l ff A' frm md MM- VNS Oihwmw- Jzwwfmvwwju 7f 7 , 1 ' ig! ' 'I . . , , . , . ,V . v ,-, I . , 1 U.-1' N I , K. U .I V . U , :F .j 1 , ,. .,1. ,'-' - . 1 .'g 1 -, 'ff . . .:,1,-. ' '-: -- ,. ', -, -,- 4 ', x 1 -- , . '- ' . , 7 , I. - e, gl 1 5 . : - . , ,, .Q .- ,vv ,.- ,., . ., -2. , . . - r nv' - ' ,, f ,,g -.114 . . - I. I f . ,-,,-, .' , A. ., ,. Q .al'.-..',- ,,. ' . - ,. - 4 L , - ,.: ,a,.- . , .. ,A I ,...'l U1 -.A. , ., ' - '5 .- .'-f Z! ' '. .. . .I - v ,w, ' '.. r - -. I . -A . g V51 , . ,,v. .' .1 7' . ' 1 - . - - . .- -nf , ' . 4. . . , A . 4, o', r, Q . ,. .- V V . Q I . .JQQNV -'fi , :'-I h- - I- :-. . , ' . .- . . . , . lt.. 1 a. rss - V A, . A W Q. 1 . , -I P- 1, .- L Q - l. - -. 1 -A V ,,-. ' , Q . . - , -, - - 1 '- , - Q, .. .. ,', . -. -' -A . 1.':v' JR ff -' A . '.' - 1 A Q ,4 ----. , up .,.m o.. . - , j. . , ,' -. ,' 4.71. . .kg ..', . L rqzt- , i,. ,JU - - .' f-. , V A - ,gl 1 - Q 4. -- . '-1 - on- '.. ., . k . w. . . . ., , -- 1 ..v-- -. ', 5, ,. 4 ' .. .. . ,. -., .. ' fi' ,'-51 -, 2 . Q. A! i . - - . p xugl 1 f' 7-Ar-1 1 , A' .- -- 155: 1- A .n Lic, -. 1 ' ' i I--, ,- --- .' '5, :..'L'. ,.-- i-'.' ,I 1. 3,1 .', ,.:.- . ,-'- pt yy- ,. v .ASIIU I '. J. w A . . , . -. .. . . , ,gg 4 .a..,-my -V .. . 1 --f-..-fn ' , U . .Q . , , 1, ,, , .-, V 1.,1 . -. .,-,l. '...,' ,M-j.,-r-,.,',C, . , v.'f., 1 I - - 'AMY , ' . '41-. '41 ,, , ,. ., . , . . . , .. . .. , 1 -. 'U'-1-, 'wif 4 :ld-' 4 fl lg- .12 -V . , , ,- X -. - Q'.:- 'F 'V -- '-31 6- .' , ,.' -. , :.3.,j' . 1, I, V. ,.., . . ,.,1w , ,N V z f ' li .1 ,f V, -fr.--.w.f,.. -ug A I . , -A . 1- ,.,,,j15, I . 3: .' 1 5' -lyzl-, Q,-'.1 , '- .. K .- - '- Br .'f.' sr' . lv , . .. ' 1 ' '- . -- -- . N, , w . '3'..- .f ' , .,- , w.. .. U-. . u . .. ,. -.f , - '- .f :,,g ..,. , . . . ' I Q I.. .amy .., . ,- U- : ,f Iv ...-,.,.- .- v ,-,-..- . EQ rl . .F 4 . . .,v.5., -mv, ,un--.ff.-1 '- -. ,. . , J, - ,' ' , Q... N,-,.. .-. .5 .A . ,-v , v.',. L. ' -. '-1 r ,, ff' A ,QL J. Y 1...., ,. ., . . . ..I ,H . . f-. - 1,-,4,,, .. .A ,an , ., .,.. . -. ,,4. K- ....,11,4- ,, ,vw - .. ,L ,. , -c My -' -. fa . A . I' ' u.- jy,5.r44 Y ..?-.,,:-,b- .,,-,,,,--- iQ, : R 0 , l 4 . . . .. K . vv 1- .-. I . -- .,. vi ,I .- .-1 4,,V :..., .,,., . ..I ,.V,,.k-..1. -, , , Q, U.. , , , . Q , .':'- .-r. J ..1,.. .,A.7 D, -.kf?h.'!'.J..11.11-Q.,,.g, H. . ,--. . K-. .1. .1-. ,-.., 1, , V4 - - H 4,,,, ,,,,..,. ,.,U lk , , I., H w,4:d.v-g1'.:..,f,-. 4 ,-,.. ,- . ., 1 ..,.-, ..,. ,, , , , r, -.A A-g..4 . J,-.1-2.311 . - , '-f-f4,..'. ,r - .. ,UH :g ' :'..'.'4-, lj :,.fg1.,-'.-vg.'1q'f1-.f'--.y-- ',. - '-nf' -4 ' 'M -- -'f-. '.-31.0. .-'W-1., ' ' ' IQ J--..-.-.wg-'., QV: v-4,, '.g--'1:.. VL - gv, 1-v. -1' , ,- ' -, ,..-.' ., .'A ff, :. 1-f-.,,l... b.,gi.2'x Tj-f'c',' fir.. 1- 1 T IR'f Hxf, 1-, ' ' f:- ft-.S.fI2.: .' - 1-1A-Ei..r F' .1--'.' ,T .zu f-.- 7- 3- 'FAH , N. ,,, , - . 4, ..-N ,. .f.. ., .x I :, x,-,. N .H df .,, 4 .-x.u:r-'.'-- 1- -1'4 -.-,..-r ' . -.--v '---14 1...-.,.'.,L.f f-11.1 .fi--.,.. V- .ff.',- -'LA.'f,g,: -:1:v.1'--1 r . . , . ,35f2,r:v,',...'1 ,':,.1,.,:j :-.I-Lrg-3-:gi3K,', - ,: 355. 1v,:'..., V , ., I F?'.P1i21.j4l.LL?',J'?:2-?'IQf'5--- Mig, wi-Q'Ari-nw. aim , -gy' -ws fgz- '.- uv 311 . Y, V - 3, -' fu, ., F J -.1i'.',-15+ , . fn., LQ-y.'LggLg3 .544-9.-wx ',.-.QA-uf. :K V Y '-.ij 'H2I...A f -,f .fm-,-, ,V 1. '.' , ,f-Z,-',,1 .L 4 L Af-1 Igifffff-f '.'1'fAf?'f.. 5 ,.7 zfl' if ' L I3127T '.': ff ' 'Y -':.'5 :f?'i:f,17r ' W 311923 'Zz' 2-,.-+7-g5f'.TE?'f7 ,525 r H-. fx.: 1 . L1 .4-Qf pez. my fa. j,'ff54':'?'.ff url , - 41- -1-.'4,e1,.: 'v JY-F--f 115.4 2811! yfqyh., ,H-X ,., ,MJ . uv., . aifnk-' y-'f .f54i1'3.p tau: f.sf,.J1-Vw N- 109, ,.-', J U-'r ',1-1 N-fy - ' 5--..I.V ' '-.1 I-91? JF 4-'.,gf3,,' ,ws rmziiy-.-.M-gg. ww.,-.mm ....e+-...Vg .1 1- ' .Af ,-vi., 4 K.-. ,v ' ,.f. .1,--'.g-,f-fr'.-4en- 4 rm.s'v. 3 J, 51'3,2Q'--X uk-A' .,,v , L , Z ,-1 , X J- , A x -. I.. K , 1 . . 1 V.-' 1 , I I, ,Q 1 1 ... M r 'r,, J D 1 Q , A . .4-. , .- , , .. - .3 , A- . c f - , V, ,u ff, , W ,' fffw' 4 1 . 1. I ,. .I. , ..- , a , -, fre - -I-. . '-'ft J- 1 -:.g,Q1-gi. .1-4,.-,-F: Q- '4.--:,g'-A.'::- 5-3: L '- - fr , 1' f ,- V 12 .' rff- -vff'!2f--f'1- if -'-35.1-'-. ,.. .- .V . A v,f'!, fP:v 5 ..-gig, wg 7'-212.1 -'.-gy' :.'f4 ,V 3 'I --..:g'.:.?gf.,:,?.j:f,ZaJ--f,:4,ff-y'Gffi-'1f QllY1f 4,'- .,, ,- .,. n . ,, - .... ,.. , . ....,, ,..., . if A . .4-. . , . , . .Ax ' .. .. -: If-I .-. .:,,,.,:-,-' H '1' --'l- ','. '.. 4'. r'--.. ,L-, -.---v , 1,57 -- v - ' - 0 f,- .9 H ' -: - . .'-44' '9l1':,ffg.' -1,-:,.-':,'1-.f.-,1.:.v:--f.,,. N , 1,-jf. , 1. -..-..2-1'- ','---- ' -.-'-.z- , .' Ng a4.,wfj,- 115-ff. 2LZ,:'g,. 71:1-L :,apJ4,j:y,w 551-.31-,4 5 -a'gLq53C: gg- mi' e',',f-ex'.f-1'Leg.g2,j?:i-.Q-1'z'2laj'1,: . ,. ,- ,. . . 1.4,--. - 4PfL-:gi ,M .fwfzrl-241: ,. . .Q L , -.I ' .rn- U ' 2.'5-' 7 V g- ,T ',1 ,,-,. , r , .M I . 15.1. ,J . ,I 1,454 ,ig ff. .F X,-Gigli-5 4,-ppl., .-V: . v ..J,:'.' -1 D --..,: ,.1,.':.'. K 1. , A . V -r 'g.'x-A ...-,4.4A. I '. Y I '. :,: ' . . .A - V 1 .- .. x' ,-- Ui'-I.-1 ,li V '. 1,-fu-f-..-X - ., ,. .' 'ru . L ', ' . 1 1' az' , .Lv--..r ,. , f. A, , , g.4 , . -.J . . ...-.. b ' r- D . AU. z J ',.., , 4, ' ,, ,.. .. - ,Q - f . , ., I , V' Ax IIII V . , L. . .1 . . 1 U ' , , ., . . ,, ., . - -,1 A, A -' ' ,r1' , ' 1'.li,.w'--' 1,.'f '- ,' A , x .1-. 4 'r g,.5 ' 4 A- gxffkf . 'X -ffm, -. -.ff L lem' 4.-I: ' 1-. ' ' ' -f 1.-V '-X -. .' ff A -'--if-3:-.. . ' ' . ' .. ,: - H.-1,, 1 - V'-1.'.1.-new . . . ,- , . . . -J.. ., . f',-- - dv- -U11 -:..,.9 .- I ' rn- ,J - 1 1- ,,-,1 -- ,. -' - '-,'j'1g:-f p'- .. -23.51 ,fxi-vv.Jf,,.gT . 5 .I-:'17'L :..'-lffjjlf 'Z' QQ., 4 1 -4 ,F ..-,f' ' .4 .f','g. gr. u.w . 4.1.1 ., ... ,.-, ,:-- , .J ,. , , V. 3:3 ,..:.,L, .,. ,. , ,NN :'f1'.','.-L 5 eff: .V ww ,..'.fh.- f-455:01 Q, 1,23 .,.'5L j3:t'ff'.5r --1gf,i'v'4,- fl '-1: ,,.L74 v -.al ',L, I -H.'.,,-fL-,-..-- I -.723 -U .M .ph ,n-.,g f 5,., w:..:.,vv-,.,, 34-3,-,. p9,,.g-,,,f.,- 9'4 -'-'-fe-.fG'9':4 .af'1s:-,iff-QE ?f -'Wei'-.,fH:' :PH '-. ,-',' V' . 551' t '. ., if ,. . .- q,,, ' 1 I., gf' 'g'4'- -, 'yl' tv, Wy: j'.S,'f'If?i, ,.j fri i '71-g ','L,'vq ,' Q-gl.':1L7,f 'S.' - .--3 -. .v'-- .,f,-'1. rn- W'-.-1-, -Q, 44-., ,A -..ry U, 1 . , , , . ., f , .,,,. . Jw . ,..,.,:,.,,. ,. . . gl, , -- 1. M,.-,iw-WQLF , , x I' 9 .-'If,:'4n!1:' 1-Q -'If ,. ,- . . .,.' 5 ':.-, -, .x ,- . :gh ,tj , . ,5:,:jq.4,e,j.-Q.-, . g f -Q 1 . . K .. I . . .. .1 - . . fy? - 1-, If ,,,-guy..-,-1,-,-3, -- .-,f, - -- ' -LT'-fn' af.,-? .uri .'gr:',ff..L5 ., ifff.'.L-f.l25'-'-'.'?1.v?,i'f,f T 'fi' ifivf 1---. y..g,.igf'A 7 5-J.. ,VW-.sr -,.1..w,'P:. wtvur. , ,V-,WL -kr mg ,K ,,.,, ,ATA QL 1 .' If , Jai, , a, ,. .. -Q r xv...-qg', ..'r -..---. V-uf. . ,-, ,: --of,-ff' 1 fx 1 n L N I I r , M i J I , Y r , L ' wh I A 1 f . fl 1 A .'fiEtl'f' ls'..-?-G... ' ht-' -'- .L f ' - .JH-L .' . -ju..--, I-4715.11 1211'- ' U ' 'U '- ' - HE -' V fZ- if 122- 'Jar' X JJ H,-.fp -ff,.af.- ,..,4,,,,...,a-, H - ,.,. .,,, v ,-,. .f -mmf. '- - , 4- '-N ,. .1.'.-, .p -'1 we ,- . .. ,. . '- E-, -f.. - ' . -rf,- Q - l,,E-,.'.-.,--,2p..-.,- 4f:',.i1.x,-34,fyi:5'- :.'f'Iv!9'5v'i -E22 1'.31'..,, ,a 3-.fgyzd rf a-.-' .WJ . ,. .I ,,..,., , , ..,,A.,. .. r.,.f.,, ., ...-12,91 , 4, N ,V ,. ,,. . 14, A',fQ,tl,1.- 54,11 .31 :,'.rv,i:-5,1-f.g 5.1-f 4. .,:,-wfy,-'A-4:41-fx L+, 5,-' Q4-.,,'. ..e '44g:..7.,,,4- g'i:g7,,!5-.',,, '1-,:.,. wg-45,1 . ., 3-. 1.11 41-r'-,77,'r3 fl f ,f-5:8-ff wi? J, 4- -99 1' 111 ,A 1 , ..',.:' f ' ,,.-.-In ,g.'..u- : H, vyggli Lngg, ,.ff,'-g,,'.a'.4i-.-w-fvqy: 3, K. nk 5113-w-,..,,5 -2- ,. W ' ..51',.a ' tive: '-'-eh'L-JY?-,f ?,'T'3:-L..-135' --1.-v.. -,fsafs-gf.,-1 11954-f2?n,:g.f'g,5'Z?f.5,.--:ff':a'.,e!'1-'i.:.:?.r',-1i'+f1 :.ff',:f?g3:Q?f4:,:-.'4' A4'VL'-'lf-A-fn- .:n.' .4 ,f2'-igvff 'b ':L1-':w'L- 1f,'V'f1'-1.'Gj-y'3.,yg-,'lQv :j4-..,-fefljf'-9.kj,'!fd4v, .. . ,1 . .x.. xi., ,+g,.4-,.,1-,3 ,gl .41-rf:Lf,.1 213: -Z,-aj? , 5 nan... - -1.2-4 .f . ,.b'Pf, .. QQ' i . .4 - g...,- 'f I ,J '-1,113 g., . -, I 595, 1,1 l 1 '4153-3f 'i5 iff-iii 5' - 7-Q' . 1455? 'l'2':5x. . ' H-1 W--ini ' 'V' '-21 1 '1r5f7.- ' '73 Yff!E':. :'4f' 'VH in , if ::.7!31:?ff'+:' Ja v',12'?f?5'1 :?'f f,g1-if 1 . II wr -,.l?f4 3,4 - 4-14 .. . . ,. .... A VJ. . :I . . N . . . . .. ' Af.-:', fm' ,l.:9f'4 fb, -' W . Br-f Y AF '.-'E--4:2 1: 2.-.f : -v,f!..sA 1 , ,, XJ, .,y, mf' an w'7'1 ' Exam ,' 1'F', iw,-fr ,fr ,-,Q -M.-..,-.,,'s.,Ag:.. '. 9 ,6 5- ..: ,Iv ,I 114. . 1- l, ,fy -1 1M-- I b 5' .v .3 J., -' ,I .5 '. -yu, 'A .'.,ff g 'L'52-: gffe '?'tQ-2'-Q?5fff'g2 :,,:1Qe,,2g: Vff.g'.f54:q,:23!:T' L,' 4-lfy'5riS,3,g?:' ,.-S. .. .dr-ff ..,'.:'. ,. ,Fir-49 ,4- ,Xa ., J .. ,fgrh fi'-. , . ., fa mf. - wi fQf'fiR'f ff: wYhf:ii5Y4E'.?2e gfifizwflfl .- '.'iig,.f4w.a1 lg.1-WL,'4mf:,b1-'xy-i',,vzfq-2:-H4m,a.57i4gi.f fggsrffgxl My ,wyff .gg-bwwfn J. :H I it Ayr if likatvf ww? ya 'gh!i,t4nY , y ,ml n-,ff ., 19, :elm Q,,r,,.-.R -4:-.1 fx-.jpg g,,iuS,-Lita? maya 1 4, -.T N ,La-,li 'Xi - -i ,-95 - 'fI 'i1',,' 'Q ' fl- -f,l '5'5'--ffifff. 1 'ffIf'iZ 1fS'L' ' - ' '7 - 1 ' '1 a, ' - 1 Q, , ..gL i 1. 5-J gfrjfg- '3f'r'gx5P' 4 -H+, 1' r,w:lf1 'z.., f 5. fig ' , ' -J-1 '. .- gif .-W'-'ag-ry' :,.'f.g. .f.-5-4-K msg-44.-Q-.kyag'-,gg -gui' yum. gm g5u3-Qt,-54,4-L'-Q1'2QA,4,9.,vg,R L- .I 'jf ,3 ,., f !,:,:.g:.j-Q.. ,a4:'.igz3j 'gf-'11p,,gf.fa,gq5p:,5g,,g1 ' ip,,1v,QM.-g,xg,53,3'HgL v-35'g,--IQ,-1. ''i'is.!,-'kia-i 'E::97fj V. ,-fa 1'-7235,-wlwm, rv - ::f'i'::f'ffh'5 :gf 1-ff-1,?2V'-.xq.ffgs?1g:2,i.55:2-fatiigifzezazgi? 2,35-i,i'?-iii-2-Q,t'3'? V-- 2-f.-,-Mfr. -Q:-r., . .i,'f'::: .v 'Tu-.-,.zfg:-,:Qw.wg,. :Jann .-14 :stu -'T -5.21: 'f-pf' ff u '-'-.w,.-WE., . 'um-.Y - ...fe C9535 'g - ..i .- , 4- x..,,-.-fl. .-'r -1.f.:Q- .5 5 , -jf-. ' 2.1 .-,,- vnu., Q. - L- ,:': ,. ' -' Q.. .--3' 1 -r - v-11 W- , rvg.4-'- -.-..., z. .3,-1 :.f, QW. ,,n4.:.1f4,,-,--M,-,-,-1-J-1. f f.em!?H1.'em'+- '1f3'.f ? Q:.,.4 'LT-fmt A-P w,. G. f.f'r3'ht2Lf - 'JK - '- - .5 1,1 '- -I .- I f'-1 r ' A- .r - , ' 1 'fr-. .'.-'.41ir.4 - 5'gK. - -MQ'- .- ' -L1'.'f ' : - R-F x. 1 rdf' ,..- . .- ' H- ' f- If .f..,-fw. at gf,--.ffm-,' V '.'g,.g.v.,J4.-qy Fha 1' -' ,f - .. f Lg-M'1,15 Ll' .-5.-DEI'-.' q R'wf .1.','-7 ,-.,'?,g,':..-5111.1 rr, v, Q54 . qp 1, gffxl. rg' v , ,,f .F , 1 ' - - Y 1 5 u., .-,rw 1 ,1, fl ..f ...5 -3 -xy, ,- yy. ,, z-- ,-.fj.-ne!! ,1.:. r:,4dg,,v,1g,,-.4 14-yyf,-V 35- ,f- rf, -. 1, 'wg-,f -1 , -. .,',,ak-0. -1,-,., Mg. ug,-P' - Y- 1 , ,N ' gm- . ,fr .-.ff f.f...ep,-,y, 'wf.,4,:Q:o, f2.,ffxzwPFZ,-2-fx wif, 1 3,153 '-H, -ww f' f :- K 'f ' . f J' .. Wi fd: ,A X ja , ff., ,QR ,eolaj 593,945-17, 'Wai age' kai? ,QS 'f-,Lp N -A-,v,'-. r Vi' an .' --r. n' -- 1' 3 , -'., '1.., -- L, .wg ,,'.'., Q 3' q4..a , 7 .'-V Y '--!.' - 9 , - my Lg -'- -Z f.L 1 .u1f4:. Uj.,,.'-,'-' 1 5-' :H - , .f .,-'- i - f-ui., .V . ,,. , , . g ' , - uf, --' - - V 5. ,I - In r' 3711- Ln' '..' lfki' - 'K f7 .3. 4f9 xf,-Qf. I,?3E93S- L:'1a'L?-Y 4 if '-7 Lrg?- sf I fv' 'Y' fi? fe Tuff!! xl-N, '.X ' , x,i: .,. . P,13,. 1'Z: 1'f .2if'7j1- NN 'V - 'Y 1? 9' 'sew' '- 4: ,ir '9 1 ' 'Tr ,,-Q . T' ',- '-f gei' 122 - ,N Hu' 5112- -'A ag, ,- -, f '4:7.'. fi- -, 'f-I-01.51 .1--'r f ' 'A 11 1-'l.,i-.-.7'4 L uf, . '.'X..q', 'f -: -E L '- -,. j,,' ag ' 1. '-23 - ,e 5- -: ' rf '.g.-41, ,go-,-,'T'. LVL. .Qtr I mg. ,f,, x.AI,.' 'M My .-5,33 .. ,, V ' , 4 a, ' .-159 Hit'-fi--'o' Iv- -'3f'fy'1f H. ',3'-- 1- ,911 -Fw-' :5 4 x., .,. ' - , .qv-,-Rr -W - '4 'n..,A,. .,.' !'4 19. -' -14.. .- 2 n -.YN t-. - 'lr if iffy .Cr-1: 'A ' , ,N z ,. ' J.. -r , Q. J-' - - - ' . 14 f :wa -, aw.. -PM---1 -v -,-af- -- - w QMW1.:-ff .V '. : -.fl w--f'f-'1-:.,f- 34? . - .. -2 . Y'-ff --'M A -5: C -- , 'V' -- : ' ' p.: , : . - 't!5 ' .5 rw, -'?iX L5f'-2g:'?'i' ffi, . '1 '-Vg?-' iQ5i',f .-A? xi'e,.-',--'J Xlgls' .' x '-,2','i-. , -C Jug, ' a'i J- :',.tg-.M :gf --...l 1 1. 5-'If' 1 .,jv,,K' fra' .QL . , 2' 125. -if . g 5 Ze ' . AZ'-zl14': . 4--A irq 1 2' 'X' , ax , ' . - - .1 f. -,.....' .4 .f-- ..,, --, .., f... ,. . ,. -,. ,,.,,...,,,., ,- L -,-, .-. M., .- -. - . , 1 - - -... ,. . 1 - ' - . . Pu I 9 5-'A ' '29 .V-' ' g f' 'F 3. if Q 4 5'1- WNNM Y , J ww hi ,AJ .. x..lMjf,:1,g1t,+5f'L:,fifA,,,,4 ,gy A, kb -.T 3, . in ow A ,Mn . FESM1, 4 ,..,f'9 .,r FQ , A mfg Q Wi if -W . ., X .-' . 5 P A .. . ff -5 f 4. 1- 17 'A M ' .4 n X 1 f iq uf ,In ug ,lu 'x 4,-'ft 'W in ei ,f 4, W 1 J' ,dial SIN Y -W. ,is . -, g-2, 4-um -N. y.L.L,,,,g,j.-gg ,,',1-.N ', .,g V,-A -gh., .3.g,,--.K -'-L,--. 1'-3 ,445-5.',..,.'.-13-Yg f.:-i.-.,.a.-bf, 5,-41 :, -V .- ,ln '-, . Az.,-A ' '11 V, Q - . :M , .,- .4 .. - . , , x - , , - -. 4 .W 4 1 X , .',.- Q. , ,,- 1 ,,.4.y. ., ,' f. ag-hy. 5, ,. r , -, f.:-fr.. - N J -LU. hu, ,Q- .-va,-L lg. y.,gfQQg,-'- , A vp' -- -,- -f' ,f -V ,..Q ' t - ,-' 1' . 421.196 1 '. - .--1'-lv, ' 4' '31 1.-5:-1-'f. ':',g,-- w.:1' 1 - ..'g,L 3 -. ff, .Y,1.,.-Q.::r- -53 ', .f V3.1 '-- -f w v, : V I 4. 1' ,I , , - ' 142 ' , E . .. ,. --. - -' U 't' ' -' , w,wQ .. .iq-wa if f . 2+ wif.,-ffm r -1-W fi? . f 1 1 f 5. -if 1-rw v Q 14-A nr ,'5'l, , 'H 'HNF 'Q ' .lplfv u -w, - f w i A 'ji' J, '? :A Aff! - '. ,Q-is Q , . - , . . 'fc.f'. zt,f.1 '.- Lf..5 ,-1... V. J, 4 3,,,,,. 3, f- ,FL-.. .., ., L-, ,. '.. , S-v,,f,, 5 . -. - , .. . ,, , .,,, L. ,Q 5. .. M -- '. ' - - .H .., .V 1? , K gy K Af Q r' Kslf 1 ' fl ,L Y A Q Q55 L' ,., E XJ! 'F -off'-,'tf if ' MJ' x i A gm ,' ' ' r WS :,?!3',I- x 5' 4,556 'Eg N'7ir91fsE 22 ,' r. ' wwf' -- .. V r . ., -5- - : '.-'. .5 . - mf' 9 -. ,- . ',, -1, - V- V -- -, , 4- 1 9. .- - , -M , - - ' , - . v ' --.4 .- ' f 4' V, -43,4 k,, .'.:,'-1'-,.. 1,-H+ f - . ' gi ,- x'aQ.-.v, ' - -, . -, 3-w - ' 4 , .1 . . , .- 1, 1 ,. ---1 I, ' ,uf ., ,fr 4. A f 4 ---, . '-w -. '- g Q - ,n WJ. - ,g,.15-km va, . p 7 ,, 1. .' , -- . .. , fax' - k . v - - , f , .A . ,fr W j, ,ff.- ..- :mf 5-'xl ,, 4- , ' C 1 v- w..: ,x'-1 -'a.. . P- -g'-4 . 1-5.1--.--5' . 'vfw , 4..- ' - v: N- .. , .- -N f - ' , 1 - A -11 ' ' t : . A F .-. -.---'1f. , ' ag '-i??'f -TF-.4 ff: 'f 641-. ' : Uf at -' 4 , X 'H' ,-r fqfif-v-cvizf-' 1 .,' 1 'Lf' -2,1'f 'f'- '- ' 1 'Q Jw ' A' . ' 'Ip 1- 35 fi' ' . f ' V+. .f. ' , ' ' ' 'l. - 'jf ', 1' .. N 5,f3.'PEjJ:4j-,3f'-,?,1-,v:vP1-huyfgzi, . I v .Q . I V l -f5,'..'.Ef,wg'f ff1- 5445545 'fi' 'gn -'11 Ag, WL , J :lf ,1 ,331 r :ffl gl- U L ix- nv? ' U1 V ff-,-fqgefr. 7, -1v.',,,:'.!' 1',,f-,q-1. ,am ,g Q1 J 2 Q zfvm' f + - ,J J' ' -4 ---W:- ' ' ' ' R, X I g 1 y 4, - .- - L,-N ' rf Q3 1-' , -'ml ' , 5' mu ,.- V- 1'- ,- ' f' 'fa-.g , 'Q M.-, -. ',L '-F. , 1 1 V ., I '- , , 5' 11, v ' ' ' 6. , -, ' 1,7 . . ., A f 49, .-,,' 'Q . I. -4 ,.yx.+ f.,,x' -4 i. 'f.fprl 1' -- f ,...-.ff .-' .-, .-lf -r -1' 1 N 5 f 7 ,Nw '- 1 V- -- '- ,J 345954 y- V ., ,ig , 5 L 7 57. A fr- I fur N N, ,, . , ,r , pw, 5 ,-mr if-as Wtkvf uf Linh' J. 'bf V I id? . 161.1 T L F' i: bf'v X-wif V 4' than ' '24 144'-f , N 5' vc' fa: , A -' 5, 71 -ff x r vi 1 ' 'QL ,Q 1 N . .lg 1,5 .4 f'.'V'Y,,1ET-'ffqi 'gf' Sf '15 f 1.-,ZTT1 7' 2'1'.g',3ifrg1' ,gffv-,153-, ,file 5'-42.1, ,z -3,,g!'?..,r:-Q . ,H 5. -A If ... . ' ' . i f Q ., 'jx f ' y1::5fEx!5?,,14x5,q -. . - T' gl -.f , , J 3.1!-., .j::jf,.'jf .Q'j me 'NFA-l: QQQEL-,a u.-45.iFL2aff.,,, .-Q, ,, 41- 14 ' .,w 4,. -. , A aj, 'SR -A ,. -I , . 4 Q1 E4 4, 1 -H I 'ef fix f gp if f X1 as-:.':i,, A I. ,..,- ' -A ' I' :Q 13,1 f 'W MMM ffm ff 55 l 'C 1. .. . ix ' J Qi inf, yggff L , 3, ' VL, ,M 41 5 4 f f.?v,,.,1 ' ,4,l:g,ff . x F924 ,S ,QS A K , -1'521,y5K:fd'L1f,v ,gf 5511 pw- iv -f' L ,QQ JC? '1 'r- vw f p dui Mi QA , 3' ff ' 3 xixiy-f '-1 ,J Qf', 1? 'vw af '53 -ff eu , xl.. 'ff 45+ n..-.ff + 355' 'fp ' ':? 'ii f, 1 KJJWA A31 f'g'l fw1ff l -v F 1 L 45 w 0 ff- ' . 7, ' 1 .' I ' e 4 nf 1,-4627 :fi A-. ,431 JB' - -Y? 9 ' -. ',,,v,. 'gmgi-514 Q ' -figfz-' ,vi ' Q, , ' x . ,. x .- 5 1 M, ,, ' .. 4 , 4 V gf-E-4' ' - -'fr '1.,e.-,.x., ., .,,,,g.-. 4- ,, '.,..1.,t'-, ,pr f '. 1 --R fi- 5 - -'f -,4-f .af f- ,- -Sy -, ' .., 1' - -a -. .,.. ,- . - -,, , I 43- , lu ,- . -1.-H5 A V'-I M- ' ., - . ' , 'fuk I If-.f'f41' ff' : .iii-'X 'U z 1 ' 1: F' . '- ' -4' f':f-1- !' WW' 5, ll .. V 1, ' '- :r .Q M 7 ' 4' 'A' ' ,fy ig-, i: '4 -A 'fi ' - -' ff 6 -2.52156-' ff - 214- ' VD'-elif k 4 7' - 4' L-sz,.1'f:', J- 33 -1 - ' . Vgj- :Q :' .J -- 1 'A r' ' ,L 'L vi ' 5'1 -' fn- A-,A ' '7 1 M 5 V ' - - ' 41 ' , , x. 1- '- ' 1. Rv 411- ff- -Q f ' .fe vi-.'--.35- , .1 ,-s , V ,- --v, , ,q fm- - M., L. 1,4 ln, 2 I , .,,.,1,.f,-L 3,1-. f. V3-,.. , ,Q V .,' . .. , . , , A..,,. Y.. H K. .sf , 1Qf-tffp gpm 1-w.'.:f'. J.3:'.vf'.-,-'5':1,.. -' f. ,A -fwa, 1- - -1-, my rf 5 1- ff .421 -ig., -. . - ,. .- , . 4 , ' '- -za,-. , -4. 4 .550 p.vg,, - ., - I .sw --1 .AL W -1, cw. - . -f 'z' 1 . V X. ,s---f x - 1- - Q. . :if a-,-.' J: 1- - ,H ., fv , .A-f . kg - .N 4 .. '- - A, rv - . 'vmrfr --35.3 . fn Q'--'-11 W3 -A Qzsm- ff A A y at - -. m'W1yf 'bg -Q Iv 1' 2 1 X 1 a. v .- M -' VN ik h 1 , 43 r fl -H0 x 45 'vis' Q' 'r rn 4 -.f ' 4 1' 1 ,H sf' 11, gi , Og. -9-:Wai-':'.Q74LSfl7f.g1.Hg:'.fw f.. ik! 1?-af.sfrE'5M -wtf. ? L .i'+.- KW ga. Q if Hi? , ..-. M . -.fmgff , .. . we 1 2 ., ,QQ 'M' P' f'TZ'ffa4'4'Qig5'-..,'.w:'-4111 . .- y .ai --V -., Navi. .L-Q4 I, 3 -' ,Mfg I. A-5 .W 5- , h V V. uf- -3 . . -. L, 1, Q ,l , 1 ,j . -- f ,, r D , H, ,V U ,. -,Q A 1 --.U Hi- r - f I Lg . rg 1 I QW' ' ' x2! t?1,v9?5?'5:a?ixTQugfHi:3 7,1-J5,4f',' sig. V, W, 'z..fQ,5,f.-?:7ffg?w1fgff' +A,'e3j3 ?f ,QI I 45,97 f 1.0 - L FL-5-, vw ff. 1? 'i-af-1 H 1f'g f?,fgA'fj2322 -pg. v, : 465- . 4:1 5 af 159' M X -,fb 2' 'H fi ww 'wi wfwaf ww gf . , . . , .. , , , . , , , F, . ,Rugs Q 5D ':3'?E'5? fu -ff'!3i'v- QI f'1'5H5 i M5'w- wf'-.-Q3-, F3951-4 if ..s1'G- LW ,EXW ' ay ' A' W1 559 ,9 '3?x'5, f '1 'S1u.,f' ,.'w5,b?: f'Wfb'3p ?'f rd L 32430 f 1? 4 P JY X A. L ,G -.ual J- '-S' A 11.1 uf-1,r ' Q gg?f-Qlfvfjg we-QQ.552-Qgi,.zs:-ew lw.Q51-fffv'g''4f?vw.,gi ,A 5 . J,5yai, , 0-559 E?-z, ,'R.Qrv:pfflFg::5if:. fngewi 1 ,Ag 55,45 PQI?-:y5'1b, '. at ,Y -4 : XII K q I . 5 . i3,fg,I:J :siqgifafgjk-i2?::.,, 1 -215 -. 'QF ,AM A. -. ' 'F fr- -z-34-Q Aff..,,g?5ffa 1 f'eg'f .,2f,.: -Zfzfg-L-Q. A, '-1 . 17- an-QP'-f1,ff3,e-iNv4w2f.f5gffif . :y'--:WEI5 .w.ww2'sw4:9: f M1211 .V -. ' ig fa-'f' 0 Q -,, , .,g L1wff'Q,-f,f5sema,35:.:?gls -'..14:.g4:'.5 hffZ24if' sgm.ffx.Qmw,: W- ' - . - f .. . 1' 1'--JE?-rza.fr57Sf ,nm -'rggfw - w I 'rx 41, ,-v-555, ff , - fy. v. -.-W - V N-:Lys f' :Aa ,ra 41:13, fn.. 1, -m,,i',:sf.,- ,.i'.f1:-9 1' ,,.:-4-f:1-'g1w',- - ' 4 V .- , 415 Sdn- Y- pf.-nf., 1 1 w'S- Fvifg ' fy-fl'-.1-3 v -' 0 1 .' ,- - - 55 -.xffln 4. 1---5 .414'Y'f-4-:-? .4g1 v.,w-va AEf:4'-l5J'2ff4'? -- 'K + 'Q' -6,'Pff3Zv Af +I? 'fa ff? w ' R-L 'ahh' zw-,ka 'fyifwf MP1-45,-'YT411 f yi 59.5, L5-Jfsill 54:41, 23, wig iiisgiig-Q' LM Masy. 2,551 v ga ,LXQ ,1-2546 Anim ,,,,,,dg':f4,i,u-Mggfs ik . ,HA .hw ma is-fr? ii: -55, ' M 'Q :iw ya f H, Y if '?3fg'9 ,,M 5 4 wr, A ff? ' A ' 1 U - . 2 F512-M f 'Nf'1-'H'7'f5 2, gi fw? 7'Q g ff H tgiageffi 519351 xvggifx M5 91 rw- J: M f , . 'M 1- h Sf- fy! Air' .aw gm. -+-Af:-4 . , if 342' Iv A, ,ye . uyq, Q14 grief, ZLL MY, , 3-wl, MH, e -Liga., ' . if '- , L. 'lf '. ', 1 'cf Jw. - ,Q f - - -- - 1 - 1- 1 .- 3 ' - l ' ,.'- 1. ' -,',- '- ' ' K ',. 5 . 3 .. H--,Wiz-'. :I 3 ,'-',,, L- Q - ' '. .,J5,: , . 5 . 1,3 ,GfQhg4f'r 1231? AP' ah ' -59' ighki-3':'1' 1' 45' '49 k 1+ ff I 493715, ,gf ' 91 , '.. '2'nt -v v ',g'1i'7- 1.4 ' 'f J' W A Qifnla- ff 5 '35 2 4? i if Y 1 2' - H ' 'E ' ,, M f 49 M , , , ,Qu 4 -xref 1' ff ' Q. ,j?f 'A 5 '-Af mfg ff x 721 fi -if 1- 44 + -. 1 ' I -' 'ff ' S' . 1N997 5 'Ae' ff- T' '- S -5 .B ,. hu r Lv g.i?,5-,,WggU?,.4us5ig+?fgi?,,3Ng. Ewwg rfgf. M ,Q - ata. ug-K . . as 7 5- AL -3265. LrfufigL33f,:,-gCsL.3gfa2s:g',5kf-,Q'4i,5gs:4?i,gbwgxi .. 2553255 Y JN. -V i , q L' '- 'A' ' -H '.--lfflllv gg'-f 33, V-L. J .. ,. ,sw ' A ' .s M ' - v , f 7 'F X-I -f 4- J' . 21.1. -' , 151. -ui.-uw 'fri - ,gy 'TW6 -715.6 11 , U f:7',1gfi25vjiM..A if .AN-5 Qz4V-gg.- .gf 11-51, -J., 1- :rp ug. n- . . , W L -. 2 5429907 11524, 5- ,,,33fg4.za?-rwvggffrgf ':'..w-,gn-gqrggfifg-V -fffh-sf 15i1.a'i1p?gga,,-Q If-1-541: Mp - , . .Ln-fi 2, ,. ,Nv.-Aw NH, , fm-vcfn.W . V . f-W I an ug - , - Quay - if 'ani'-1fN P - 4 '1'v- -m- 'w' ---+V up-1 - ev? -ml - f '21-0 ' r PM -' Ig '-41.5 .. fr 'rfb 4, '-,Aki-r XL 5 P jc' S ' Y T gf? 1 -1, f. 7 fi 51' -A YV? 1 '917'-'f?'V L ' Ybk.ie -'1f 9 I' 'ff -rm , ka ,pp , ,, gg 13 N . if- 4 f., , '?1!m 3, gzbxwmkl H wi J liywkz, E, 57 Q4 1 ' g4f7 'Lsi-'-7 44,5 P47-9 In Wg H3 As, gg. -9-'1l'yg 21 v' ga ,g qriv, 1 ,afqfv ,,gt ',. L- 42' 1 Q' 'vp-7, if 65:3 Y ' w wqn , ,,-5 5' :,g.,: ,g 'A' gm, A ,, , ' ' ' 'V Y 5-Q of -'-.5 7- .1gj':Qp.g'1-3'ff77f1j'95 H5335 Aff gq ...arg -.f 'e . 4 D 7? Fwy I -'F --fgffv-11'x,3. mg35gj4?:gLF: '-L?,'E1f2,zf-'V5?9154,,fEgJf-T'12?-N, 4'iZ.'1??'f' 7. ., . . . V ,.. .4'3f.f fy, if -,J ,.,,. rg, . .I. , ,gh , ,A :ml Nagxw --1-q fl 55. . ' '?f. J. .,-aff' gm-T1 , .1 v'1',w-f,d'-:TS-1-MN 512'--kk'-1 Y --.. ,- 'ff' 4 m il- 475522-g?'4 ,,, 1 ' fi--gwffj 1 -L ,nw 'f 1I.f:'5 -1 -Qu-7-fjyj ff'L,1'w,:f,g,'Sg',,.,,i2,i.q. 55135, 1, -V ,,. Ai , fr?'ifg 4' A , f x- pq.. f ' N' . '51 ff W Stagg, 'fggg gf Qfogfinx ,iffy 5 y 'V :Fiji-fi 4-' fi av. its-F, fy' wig, We. 41. .ff 154,45 f - ,p..,, - H ,J Hb .mu '19-KMA Ur W 1' 4, Q L1f !'i.Qf,,-sv Mirvwa- 1,5 5 I . ,, M 1 -4, .. ul-15 Sf,-.pai-ggi: K ff, nf -.N ,F Ju . ., . A . . A ff-. 4, . 4 .- -,, ' ., 4. 4+ ,QM 4. . .1 X ' 72 I- m 1. . ., I -.-A,,, -. . .- f- ', , , 12 '. 4 ,' ',,.,1-,3,,.:g '-, . - !,':k.,.Y. .-5125 L :735f ' C' 'F' ' .6 -. ' A -if fi jk.-2 - .A 9 ' n S.. - s' ' .M gin. ,Qi ,a-f. ' -,' x 5 f. ,2F,Xi,'1-31' .lr45 i'f4':fe'7E 'Z92 :': '?T?KEtMxff'-.L?LQ1:-'.:ff if ' at . ' 14 ' 15.1 '15 1 '- : .47 , 4- W -N 1 f. ' 7 - ' ' . . A '- .4 - ,,-' 1- '- - ' wry'-4n.a.f1',ii.:-. ' .2'g3-if ,-L-:'g,1-92,12 H ' Q - .- gf -' fl ,..f'-,. P, - 'if ' vu ' 'V . , ff'-.'-4' . ,gi 11 5- . . .fr --ff-' , N7N F7'. fu : -1 5,126-' :v':f g.-gr:wf- 41. W -' fi H2514 f.'3'3'ff HF W ,V,:'1:xs ff' .FHW A E45 if .. f-as 'irfgiw JV-T :i v 45 Q. . ? Q .,9--.iL4,4'.5-.iggbfgit-pi .3.y,Mw, . V K I 14, 156.6 ,4 .A ak .Q ,L I . ,Z I i ,,5,l,- Lrizqqgqw ,Q ..,z,2y5v,,:?,,?1,1,ih.ta1J. amgQh1,1.,5:5,.:3gf313:r.fvf?,N.,,,,. .94-a J: A as A -SQ J.. W' 4 1f '?g 'w -1 5 4' fig iW'f?fa W wht 1 ,ww 5P'1'p5 HZ?,- P'1-'if K 4a.wi25?f E5 x '9','q'jf 'Ya' ,Fl ' X 4 ig Q! rn, f' Ma' ' if' H Ii- M 'al ' 7-. wk, 44' 1 KN? -Rf eamf '71, :Mm vm . 4, H PY W ww-'1 aw- W-1,-1. J?'V 1r79? 'HWY' I 'wg 459 VS- Pg zk.9 2.szfY?g':i'g4 594 N?4Xea.-'25 VY 4' ww we iz'-4... '4555J'1 45 bf f hfiif-Q-fM.J Af-m ,A v- 'H 9355- A 4 5' f aww, .- -WHL ,f 11 uw w W +R- V aaa 'ww .' ,va - ' N 17' f-- . 1 .f. -' .. 1, .v '. W ' J A . - Aa. . , ' , ' f -' .. -A -f. wf, -. . V-5 .l- 'ffsf ' U F-f - f -. ,-':.',z:,: -2'.,.,fH- --2..' 1' '.r +A-fi , A In '1 -: :J::' 1 L -. - W. f , .f-. A 1. -qL,.r: ,f-,-- -, uv - .,,--V ,, . 4 ,.- ,L . , . . 7, -, 9 . . .- . ,.,..-,fl 1 , :I My -' , ..+,,.5,,, F wi,-,M 1507, 1.-,74,,L. -1,3-,.,,,:g,1, 34 ,L-f,, ,.-,,-,,,. -' ., 4' 2, 4 . .,, .1-J we H ' 1 'M . , ' fs -V 1, -.L ' is ,' .- - V ' .- L-'Aft as Q 1 .4-.-- 1 f -A -1 ' -Lf-N-A.-im. --.11 1-'Q :v N 5 ' rv--4.h.'-'ef-,-'fa' -. 1 ' .'. - f L'--. . - A -, f-xv N Ar- - ' . ' . 4 J . - ' ' 4 r- - V .- :- v. 1., - - . - f . 1 -5 2 , -,. 1-.2-'t '-. 'u ' -' ' Wulf-M. vi, -:. '4.+ ..'5fn -.. r'e, .1 -livg-tulxfafijvxnfu fi 511 1 W 33 9 J ,I L ,5 5:5529 B 31 fs' 1 ff Q 'fx x ,Zi FK! 'sr Q , off: ,y lgffi, X ',?v:L- ff? jfzgjlg ,f-7,-7 ,154-,A A!'vM'1.:yN,5:-G',. n , 'H ' 14. Q-'. Q-Y' '- : in - f T J' ,ESV .Qi Rs, H .1 1.1, z .pf ' :iff -+ iw r- '-!'5'1:T. f f -. L A I 5'T 'ff Q ' . i iv 5' ff -A , .,. 1 ,f-e 2 ,. , 'Qian ff, 4 . E? N 1 - , 4 ,. Qw- 'f5l3?l-. ?5l5 + 3'- 4- f -w i 'Mir . l'?3 E4'. 99 H?i?5 f::if2?'f HW f .iv :H xflff-ff 'Z :di-5593 'K 15: 2' isa' Y.. Y., ., I 'v-135, fi rf' 'Fenix 'im ' X ' ,Lf 5 1, W - 9-1 vw ' x - v --A:-A 7 - .,,A, 7 ra ww if L , Harm 4,9 5TEfi-.'.5v-i,1'!T- 1 'ak 31: f.f',- ' -- 1' 4. L' iig ve , ' Q -'fr L1 , ,' ' -H. ,. Y ', .T ff-'fav-g'-,,-.1 -jgkn x, 4- 1 4- .0 if .' , ,.31., -,f-.fx - .,-YQ ,'M -f.n.F' Q W. ,I-:,5,,..LW.,.-an ,gl-...ff-gm. I. u 4 1 523, 943- Q- , 4 11. 5: qi Ni,-U -' 4- M, ,- -, , ax-. .-.P-sr,-12:1 ...fi K, 1:5g.eg34g,,,ZfiT .A ' V ' -ggi .,. ff: J. Y'-,f9.'--ll ?QIQ'!,x,:g, -1'',,T'ffr'.'F,T4i'1'f6f 5' ..y,, A5123-my SK- ' 'Q -,QV ' 2 'vigil 2 13+ -Ziff:-' f.---e .fu ,,.v f A J?Am,' :,,hvL.c3w,e:g ,,1,5-,.,,,,-yq- , 5 Q . v.+..x. ,- ,. 1 .v . . arc. .231 :uw 2 --'f -1,11 -u: '-A . -'f-K: -u-'.-' .A - Yfw. .. .. . , 1 , , - , , . . ,. . . 'ff' , - , . 2. V 1. .J , 1 .,,4,Lut, QQ, ,,,., ..,.,,., 3fs 11'f:.'TNig---Aziz3,1-',-fN:,','4.1X 'a gigs W . . 4 V -- 55331. di , .V W J,, i !,:3,5L,-5 -sq-fl 5L1,i',L,:,t , .L.ivA,e1.. -E., Q :Q - .-'T-1-1111 Sew-Q . ' ' A' ' 3 A A 'H I ' 'X' V ' - - A 'if?4 -v. ,a'fi2 .- 'pk 3'fxs.1: '-Y is'-WMC -QTY 15-V lb-T i:'.f -?f i1.V?, 2141- WV:-:Z+,f:1, '3'51?f'f'I'-L '-fl lf' ' X 2-if'g,'3N'f.S.'5 32, V dir ' ' .. Y V . I- fri X -1, 4 . 7' L F ' 1 1-' 'f ' , ', W , , ,? 1 -- :f 155 -1011',f:w 4Pw ' YW' ,L.-11529 'fwfnfz- '?f4?1 n-11,6 P1534 ww- mug- ': 3' -V 1 -A-.-W'- 1-H . Qs- '... . , ...-A .f1z-H5-ik, ,Sh'?If maf 'Z-53' '? -, v ' - m , A 2' kQ721'5'??5L'fZ.f3?-ifffif:L-14ffQ'p-QQ!'ffff'f': ,JE-Q. 'L' wmfymwsmvmecmfawmsva:-u:..wfn4::,:fff'w-npaef,:a.:m4.m-:Awww.ffa1.5:m,q-.,,g..-m,,wk.,z,,,,,.W,,.f,.44,,..,,.,.,-, 955. ' ' ' ' '- M 4 ' ' -' 'f -: W - 1' - es1--+'v1.u-zfwg-.': iv 1 -1 FBWMMWPSG- -- ' ' . YH, . , ufwtf 1 x r WJ Q, ,,. J, LS? 2 'fyfk-318, 1222, 11,423 ' cy H wen--g 'f! , z' . , -.,, - ,, , , 1 ' ri 1 -- f .jf 41 -Iv-Q 95:11.-'f.Q 5 Ls, fy ff, 5-K ' -. +, 1 f-,7.-, 'f:.w.' ' '15 Jw- -wg- Lei' - 2 ' 7 ' 1:73 . 'jx' N-'13iff tf'f5 -7E: ix'E2'i'A:ULP 5:1 '7'x?: '5 I -. il 'pyify 732 f .fi . v ff A, ' --wk , .Q 'P -ff nf- E15 - 4, .-'-. 1..f,.,,,.,A QV?-1 ',:j,..qg .5 - -X , - 5-.Qu--:I-,fl ly.. I kAfv'af 4 idx- 'il I?y ' dy-I7 ,ffl 'lx' 012,71 ri Q 2 'Z F 'Rig fluowq' 2 'f J 'w 21 'K fax'-'12 -:Ig tZZ..f,. .: .-,r!::f,r'l,5',.-5.1 7 M- I ' 'ina I V I YY g,,.-, , 1,5 ---L J -Q. , . . ' ' , ., ' , A --,' ' --ML, -' :-. V f , - f .. ... K rf, 1. f. ',f .. ,zz ...sqm mfg, ffwuim .. .. .v 'hw ff. .. , ,, - .. , . - f- , -.. , F -,, . ..f ,A-. . . . , ,. .-. 1-.-w,-2- 4-,-4. - za-f,-, ' - . .1 .-.1 V- . 4,, , ,:. ,.- . . V f - .af ,gf ,- .- ,. K ,-,,,-1',,, 1 4113 , 45, 1? ,JAX Q73 'Qste ?'fn 'gQNgf1'f'L 'A N N 1, ,Fw , - -53, 1 315 ., F Q 'Ugg' . 'VEJ5-'Jo . V K 'QRIEH' Xu .fvw if ,fw'a'f,'?' Ww l .M K. v - ,I -.1 lx- 4, 'f 'rg .Jw v q'j.- Q '.. H - . ' - ll- , 1 1 1 , v. 'f'. I 1 1' 3' ,L -' ' V 'Q' gf -1 ,, 'A ,I ., . -1- r- vv lu, -P: l ,JZ - f,.:- :YS ,-.- gig , w ,-47fq'v,,q. .5 -'.,. : -.2.,1-.41 Lug 1. '.,q'1,- fl 1 A ,' -. -'f '- f -1 1 . . . - , f.,-' ' - ' '. ' ff 4 , V ' :1 , .' ' . 5, :-11-1,2 .7',Zi5v'.'1f-L-1-Q--5 1,2-5 1-1'- - ,, s V- -. W,-bw -y u .x . .4 .. QW. Q , . mv f . ,V A M L - -z'v?' -famfff v 5354 1-lif1vfIf:i!125!f2:1usi.' lil -'--eg vw -4 L. ., A ' 3 , . -. ,... -i'-3vl'gr', '. 1 A, ' Vw fn K ns , ,,,A , ,',.. , - -,,.. ,wg,fQ.:x F ' Y 7'5f '- QV '- ':'-. -1 ' -'5 ff-581: -Yi' ff? ,: '1 ff ' 'W' -- r V1 U ' - Y ., ' A 4' ' . ' - ' - -. ' - A - -. . - 4 -4 . s. k vie' .x'41'y ,:,Y.f--31Q,'NfF'f 7,u,,,. ,161-fa,2-Ze-jcgnki - -'Ph gQ'q .r.- - 'U ,rp-.-A 91 -uxwy- K-,Y ,N,i.v . ri ,. -- -f. w- ff mwxmwawfnwfmamwfmmkwwmwwmvmwmiiswmh 4 q , Q 6 , . P . . . , . , .. ,. I. f . A I . , .A . , .. ' , . . , - ,fq,1,.y.,'. i .V --,' .A-Q - fe , . -, - .,,., -, ,. - 4 -, 4 ,f . - 1 - -.- - . , .. - , , J 1 .. -, -.L,,, , Tv- .-1-Ax ,,..sf- .,v- 1-N-, f,,,,,,.,-f..,,.. , - ,. x ... , . ' :. h,1c. 1. A- M- ' , Y- - -4- . , v 4-. '- ff'.Y-'- ' - -, . . . , .- iw -' . K - - -.v 1 -4- , 111 - '..+. . -, .va ,- ,+P --..f ...fr v...,- Y- f 2, .-, ' I ' ' x eq.'!' ' L -' ' f . - 'Pr ' 'D' .- -- . -Hifgrx Y: .. -. ' 9 xf fl' . I'f' - 'i1'25 '1 .5 137 ffbfgi 'if'?Yf5?n7?'f-z,f'?:.IylZv, xf,5'! x F 'Gif' -,4!f 'f'1w1f S'-Q. ' 'i,5'...i+f , . , . ,. , - , .1 A .. .V -. , , fc- Q- ' . , -' ' 4. .- , --, 'f,, ' .5 wa---.f.. ,. ., , A L ' ML ' - ff . - .. fu... :A f , L v ' -.51 VLrg ,-,- wif: mp ,:vu-3..'h,7x.X.gg 13- A J, -4T'3..:1, '- 4 .1 fx, , .. ., M., , V..-. E if n ru . -. ,, -Q P 5 J, 1 X H 4 -, ,H ' -fl.,r: ., .. . 'fri -I 1- - . 4 3 nr, 51' -'P-.X-A , .'- ,.f .4 .- if - fx.. xx X4 1 4-we. JH


Suggestions in the Harborfields High School - Harborlight Yearbook (Greenlawn, NY) collection:

Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection, 1960 Edition, Page 1

1960

Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection, 1984 Edition, Page 1

1984

Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection, 1987 Edition, Page 1

1987

Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection, 1985 Edition, Page 35

1985, pg 35

Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection, 1985 Edition, Page 58

1985, pg 58

Harborfields High School - Harborlight Yearbook (Greenlawn, NY) online collection, 1985 Edition, Page 172

1985, pg 172


Searching for more yearbooks in New York?
Try looking in the e-Yearbook.com online New York yearbook catalog.



1985 Edition online 1970 Edition online 1972 Edition online 1965 Edition online 1983 Edition online 1983 Edition online
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.