Green Mountain High School - Ramblings Yearbook (Lakewood, CO)

 - Class of 1983

Page 1 of 214

 

Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection, 1983 Edition, Cover
Cover



Page 6, 1983 Edition, Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collectionPage 7, 1983 Edition, Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection
Pages 6 - 7

Page 10, 1983 Edition, Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collectionPage 11, 1983 Edition, Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection
Pages 10 - 11

Page 14, 1983 Edition, Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collectionPage 15, 1983 Edition, Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection
Pages 14 - 15

Page 8, 1983 Edition, Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collectionPage 9, 1983 Edition, Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection
Pages 8 - 9
Page 12, 1983 Edition, Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collectionPage 13, 1983 Edition, Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection
Pages 12 - 13
Page 16, 1983 Edition, Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collectionPage 17, 1983 Edition, Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection
Pages 16 - 17

Text from Pages 1 - 214 of the 1983 volume:

Ny w xc 5 G Q N f 31,523 9 ,W QQ-QQ WWF? BSE JV Sysiggyfqygsi W WP RRS KW AM W Q A QYQQQOQQQ ' UOOsblYN.Qf Ula 5 x SJ wx !??EL'l2QFf jTgnlZi?ZT?l5WW X Sv X x ,W 1 ng oi i +h q f LJ waifswaioqaemsuh WSVQU 3 is h S Q10 .Tamalc-ff1f,W0DjO-J cXO+L,:1Ugn,if'C 3 ,K LACEQLWNYWQF 'Vow I HHDT in W. 3w+Of+w+'dQ iii: HM b M0 'vw it 'c '5- A 5 XG f4+f,i , ff Oo' Q K S K , bij QI irffh xyfvviry fl : xfvb ' 5' Q?.f'AgaQ X X' f l by f I, , , , xx x .1 ', X U J SSX ' X WJ 1 '- X A 1 Rs W 4? Hf ffw ki Lv in, F .ff N X X KA C X fgbx . fi xx ff pf X3 X P '. ,fx V ' , I X K Pix xv J V .5 'KQ J,- X R 1 Aff YNXE ' , 2 !,q , f-f . :J my xg , C I 1 H QM 5 ' Y' N, A fp, X N ff wg ,Q QW 7 j K5 , . fx fxx 'P , xii WW? ,gg Q 0 W9 Ak x ,D il 9 XXX my 7 05 kj 5556 P wyxgy xv W, Laffy-, fifuffb-7 3 JXQJL SLLQJVX ,UN X l N 21-C3 QV Aff 4 , CL remit J haue, 9Jg3mm1S2Q M7'C ?,,:,,x 43 M 33,5 jfdhffx In I m mer cmM fwi bfffwgfvf ggpcxi JWPQ gy fd? 'ffff 63? fqff! -UL' Hunk ,pm A?oww1xxM 6Vfl-Y Cj4!7'fL kL 5756 C9f'.1v'l you-2 llolju fzjgzei X QE-53: Qiiww ,SUc+Q,Xq, 124' 5, leigh. .L-Lo www WW Qahxyx. Jbhifg, .22-uJYwmpfl 76104 Jcdvzfzcff' ' Ac 54,0211 jf Lffffccf gf wr-ez :hu 70 4272 fzifzggf Abdel! XOJZJUVV 0-fff? JJ NHPF? ahah buff! had Cl 616135 Chg 4140- you Clfflf ff? Qlaffnn f2ZZ!0J?4'c3-U3- 4,4!z'2'if?0Li'5 414004 CDO ai Lucado! fvadof-if 04,4 :bar M033 Zg.4,4ffP JG 0CWf'f'??f! X 1 Lf fnusc 7Qf20n'2cg,af Lo 0 mi! gwgf? efzcfjun JO 4,4141 COJ77 Q0 oU2:rcfPQv 0? JZaf77f7 Qmvfgo fffomb Xcc,w.c Uf? +1125 , MOP Q f776?.f,KLf7f7l,L5 ,D - 11,1-Qfi f24ufLQJ XC,-,7fMfA ,QLZOLJAJ 42607712 chanvqvcff you WCLLLQJ 0- 2220113 -61f7Qf?56f2'9GL,Zc'cL?u cgjflgfgh Cfpzilf CEL!! ,fnff Q26 'C7207 57 -6059407 ZW Ramblings Green Mountain I-1.8. Lakewood, Colorado Volume X 1983 Table Of Contents Opening ,.,..,,..l.....,l......,.. Senior section .....,.....,. .....i, A d J Eh S h SP Fh E Abddl-I A ph . 1 16 40 66 80 122 134 1 74 186 208 'T lr' 1. T at Ja lf ii? if J A lg X. 5 Q V? ,H 53 ll 'mp 4 w l e'r,lf ' W ,sm i dx: 'gm i pf Nw, . .M f , V ? .--Q '5lS6k ,...-ff' Y x V x. ' . ' ,.g, ' 4-of- 'Mt , , ,, lf , , J' , , ' O a W M A fl? ' E. ' 1--...., Katy Mikus and Judy McAlister sit comfortably in the hall to study. A creative note is left on the language arts window for students to read. 'SG IT GGES' Schedules strain sanity Well, here we are at school . Again. Can you believe it? Or are you still asleep, all snug in your bed, while visions of Water World, Thirsty's, and Elitch's dance in your head? I'm not. Registration NEVER fails to sl -ck me back to reality. Wasn't it fun A waiting in line for a half hour, only to realize you forgot your i.d.? Then you had to wait for a new one to be made so you could join the end of the half-hour line. Again. Then you got through the doors, Finally. And you began actually registering. THAT process was too horrifying to even put into words. I swear it's never taken me less than three hours. Well, This year I'm a senior. And I decided that for once, registering was going to be easy. I came up with a plan and everything. First I was going to just walk in, whether I had my emergency cards or not. If anyone complained, I was just going to confidently explain that I was a senior now, and they wouldn't be needing my cards. Then I would pass by the table and they would hand me all the papers, no questions asked. Just in case, I would be prepared with a bribe. Now, on to the cafeteria. Everything was to go perfectly smoothly. I would calmly walk up to a social studies teacher and announce that I needed psycholo- gy period three. If she said it was full, I planned to continue standing there, gently but firmly insisting that she let me in. It didn't MATTER if the list was full. Shels simply have to erase someone else's name. At this point, if she seemed irate, I'd smile sweetly and say, I know a little girl who needs a nap, before quickly walking away. If this didnlt work, I was going to stand on a table in the middle of the cafeteria, rip up all my papers, and yell, Fine! I didn't want to come to school anyway! Obviously, I didn't. Because here I am, at school. Again. 'So it goes.' Varsity cheerleaders Amy Ahrenkiel and Ann Morrisette help with registration. During registration, Troy Tyson and Jolene Baca sell Italian Ice for the junior class. Clubs Offer Sense Cf Belonging Do you belong to a club? Many students do not, but they may not realize how belong- ing to a club may help them. Dennis Shep- perd, Math teacher, believes that most stu- dents only have certain interests narrowed on one or two subjects, I think clubs help broaden the interests of a student. Clubs force students to work together and to therefore meet more people. He also be- lieves that, unfortunatly, clubs only touch a small group of students. I believe that clubs mostly have members who belong to other clubs and so only a small elite group of students participate in them. Sarah Nesmith, Home Economics teach- er, feels that clubs are extremely helpful to Brian Gallagher and Scott Johnson scarf down a hamburger or two while Shadows performs during students. Clubs give students a sense of responsibility and self worth, an example is it the student is given a job to do within a club and they complete it with excellence, this might give the student a sense of pride. She also feels that students grow when given more and more responsibility. Clubs also put a student and teacher one on one and make them work together, Students also learn that adults are people too. Team work is a must for a club, students learn how to work together also. Students may also be given a sense of belonging, making them feel part of something. Clubs also help students become more involved in their school. the float displayr Striking a pose, Keri Lown and Andy Alexander act seductive. 'w. Ill. 1 -ntgfg M I I ' M it 5 Ks dh WMU' 'IU' 5,-. 5, . -ui Nl ,. WEf W' 3.5 Greg Wetherbee shows class spirit by participating in the class competitions at the Homecoming assembly. SV 'Q Homecoming King and Queen, Chuck Reid and Annette Vitry, dance in the spotlight. The Junior float takes first prize at the annual float competition. Memories 0 Other I-lomecomings . . . Homecoming is a special time, celebra- tion is apparent everywhere, football players begin biting their nailsg clubs pre- pare for their floats, and girls wonder who will ask them to the Homecoming dance. Today, many Homecomings are like this, however, a few teachers at Green Mountain use to celebrate their Homecoming in a slightly different way. Millie Eccker expressed what her Home- coming week was like at Bear Creek High School. i'Everyone participated in the Homecoming dance. Even the alumni were honored, it was a very big communi- ty eventf, Similarly, Faith Gunther's Homecoming was interesting too. I went to Montezuma County High School in Cortez. We had really neat pep rallys, snake dances, and bon-fires. Also, at the dance, practically everyone wore yellow mums. ln Junior College, Faith Gunther was awarded Homecoming attendant. UI remember one time at Homecoming when all of us were sick with the flu, and we ended up getting our pictures taken in the paper with all of us in bed! Another teacher, Kathie Starkey, had her Home- comings at Thomas Jefferson High School in Denver, 'il remember that the royalty use to walk under arched water fountains, I also recall that the song, Light my Fire was scorned at by parents, be- cause they believed the song had alot of 'sexual connotationf but, she says, it was played anywayf, Likewise, Marsha Brown discussed her homecoming activi- ties. 'il went to two high schools, Scotts- bluff and North Platt in Nebraska. At Scottsbluff, everyone was involved in Homecoming. The floats were very elaborate too, they use to spend a month getting ready for them. In college, at the University of Nebraska, many of the stu- dents who lived in dorms use to construct floats in front of their windows. Then the judges would look at them, and award the best float a prize. The triumphant powder puff football team gathers around for a picture. Flying down the field, Kim Harsch sets up a touchdown. Solidarity: An Incredible Impact Have you ever heard the old joke: lf you can't be an athlete, than be an athle- tic supporter. ? Aside from the crude connotations, there lies a valid point to that sayingg A point, which the Green Mountain athletes and student body have pretty well established. Throughout the school year, athletes and members of certain organizations such as the band, have shown their sup- port for one another. Students attended each other's meets, games, and various other competitions. This new enthusiasm and spirit, which for awhile was lacking at GMH5, was a direct result of the strong unity felt be- tween most teams. Members of different teams all shared a common bond or goalg The goal to win and make Green Moun- tain the number one school in the state. A debt of gratitude is owed to every person who got interested and involved in any sport this year: be it athlete or fan. The Ram spirit and enthusiasm had an incredible impact on the teams and the season in general. The victories belong to the student body as well as the athletes themselves. lt was their push that created an awe- some school year for the graduating class of 1983! John Byers and Gary Anderson rehearse the fall play, Out ol' the Frying Pan. Peter Mehlbach and the soccer team join in the Homecoming Parade. A 4. T ,ai HW 2220 -3 51, 5 'Q 'frvyfgif if 'Y' wwf Wmwqmuw 'WF 'mv 'Hhs 3 'ik tt, tt rift tis. Rowdy Seniors Show Class Spirit Senior pranks are as much a part of being a senior as easy classes and graduation. Yet lately, the administration has been seriously discouraging any such activities due to some destructive pranks previous classes have done. The class of 1980 had some of the rnost vicious pranks. ln the middle of that year, Dr. Marilyn Henderson took over the princi- pal's job after Byron Tucker left. This change only gave more inspiration to the already rowdy class, to see how much she would tolerate. Consequently, the rest of the school was subject to doors being blocked with manure, straw on the floor, and skunk oil in the rug among a few. Also that year Wheat Ridge High School gained local publicity because of a prank dealing with dead cats in the ceilings. Some less destructive pranks done at GMHS and other schools have included stringing bras up in the cafeteria, t.p.ing the school, trying to check out all the books in the library, and shredded paper on the floor. One of the classics occured during the 1982 Prom fashion show. Masked men ran through the assembly -nude. One teach- er commented, I think it's the funniest thing that's happened all year. This year 40 seniors arrived at school by 6 am November 24, in their pjs, for a pajama party in senior hall. They brought sleeping bags, tvs, orange juice, etc. and they even played silent bomb and had a pillow fight. ix, i. Wg ' 7 3, Q 1, i . , l e Ari Annette Vitry satires Brooke Shields. Kim Roberts trys to fight off seniorites by attempting to do homework Billy Bob Broccoli, from Showbiz Pizza Place, gives Mike Amstein a hug -at Tit sf Ji ,af Political Experience Gffered At GMHS I want to be a lawyer, or a politician, or something. So does everyone else, it seems. Almost everyone I talk to wants to be a lawyer, oh well. Someone told me I need experience in government to get in a good law school, to show a true interest in the field, I guess. Thank goodness GMHS offers multiple opportunities for me to do this, like Gov- ernment Club and Senate. The students in Government Club learn a great deal, said Faith Gunther, sponser. They have a better understanding of how laws are passed and prepared, Also, the club shows how citizens can act as lobbyists. This helps students prepare for future careers. Senate, similarily has played an important part in how students gain ex- perience in the real working force. Since the people in Senate interact with fifty other students, they learn about diploma- cy and compromising, stated Bobbie Chiles, sponser. The students also grasp an understanding of how to talk to people and explain themselves clearly. Another important factor is that the students learn how to organize. Since pupils in Senate are in charge of Homecoming, winter re- treats and such, they have the opportuni- ty to do a lot of organizing. President- VJ Greco SecretaryfTreasurer- Monica Hamilton ,M W V I 4 H .W m mix hi ' ' ' - 'f , Rx 5 4 ' f' X V W l . I J - A, K , - V' N, V3 - ' i V Q - K N ii pf! x ' I r-I il 3 1' . Z ' 'L if' Y I pit K ' fi Q E I,-iw, X -iq M ' ' vs' if Y - M - X in . ' ' li re E '. . , 3 . ?, P 3- , ' 2- , ,, : 1 -if L H, , c in .4 W L , ,w , Q, , 'W iff' 2 QQ' 'Wg ,QEEQMWQ ' X In ,, ,MUN 'aw wi' K gy x 2 NR.. t-it ,fr A in gy L. fi: , A X 4, ,f Q f S if 1 A i 1 Mix A if, M .fa .Q M92 ' , x 11 2 ' mf ' r c 4:4554 f ig K 1 ix H 5 all ugillxk 3 3 -3, 4 1, ' . .K - . 1 ' ff, x -. , Q ,. -fi Y mi ' ysvfiif i. , - f . ,,, ,fmQ!,, A .JAN 4, ,J 4, ,. yi, in A1 V7,,:w-f 4 ,Q 5'-,.igM,x , 'ly . QQ 1' ,, 4 1 gf, K. gf 1 7 'Q' 1 s L F. if wa' f.. 4,25-41 1,1 7 X, Av' K , 0 ',,,' ,rl W' - 5 .. ,V 1, . ,427 - , V Q if v, :L , M 1 ' in M 3, lg, ., , - sv, l ,5.L', , fs., f , ' - ' tg 4. 4 - 'wi ' 45 c fi Q3-v'x:'! . f fr K' W , M' ff.. 'i xvyf x , , V, I, ,!'k Q I , X' f ' ' 4 - J I f I' , ,. sf gi- t' X W ' , ' ,, M ' K- - ,K , 5 331 352 . f . i' Wm I W , ff H -f.k ' . ' , ,, W if ' i X A K ' ' I af' ,Q ' . F law in I: ik 3 'vi ,V'v'W K A fi' , M ' nu , ,NL wfw mg ,i W ' , Fi? f ' ' E ' X 71 ' 1. -H 7 ' Q 'W iw: M V :N 'fif A e ' . i 1' 5 f ' i wi,,,Xf ga v 3 K1-? ti,:::..'e e g A rn. 1 ,,, R xi The senior class officers try to jump off some rocks at Genesee Park. i I r O A nf-- V.. Vice President- Vicki Hepp . f . , S 59' 49-ef A ,155 if Awesome Seniors !w,,,,,. Ron Keller hangs around the empty halls after school. Dan Payne and Debbie Hart study together during lunch. Debbie Bane and Michelle Karlik show true u-. senior spirit. I i Putting her books away, Carol Gwinn prepares to f go home for the weekend. Y Y l i I 3 xx 'lm F X l . I fi 5 -,-LK.. V A in W fx y qi 'x 'E i l L., l x 4 y .V-.. i Chuck Reid adds class to the school sign in a way only a senior could. 1- .......,,.. ., , , 0 Pattie Sutton enjoys her lunch in the sunshine. The Lady's Endless Smile Charlene Panietz was a gift to Green Mountain High School. Always willing to give of her time and under- standing to any student who needed it, she made Green Mountain her family. This vivacious, energetic lady loved Fife, people, and was fascinated by everything around her. A language arts teacher for her eight years at Green Mountain, Panietz coached girls track, gymnastics, and sponsored Senate for the 81-82 school year. For six years, the People to People Student Ambassa- dor Program was one of her interests. A strong believer of understanding, between countries, she viewed travel- ing not only as a means to personal enrichment, but a way to effect communications between people. Perhaps, Panietz' most amazing accomplishment lies not in what she did, but how she did it. She was indeed one unique lady. The students who knew her enjoyed her as a personal friend, as well as an excellent teacher. Although the classes she taught were hard, they were rewarding and always interesting. Out of class, her house was open to anyone at any hour, and always with a smile. To anyone who knew her, her spirit and prevailing go for it attitude will always live on. And her endless smile will not soon be forgotten. A For the gift of Charlene Panietz, the senior class of 1983 says Thank You! 16 Seniors Matt Adams Amy Ahrenkiel ' Andrew H Alexander Lynne Allcott Holly Alvarezf ' Alian Anderberg Pat Anderson Darrel Andrus Derrick Andrus Patty Arnone Carla Baca Margie Baca Russ Baca Andy Bailey Jim Bailey Debbie Bane' Kirk Barber Chris Barrett .kg J : 6 A ' .. X if lil S' Ha i KA , ...,,.,, '..: E 5 .,.. , . f s . fig QXV I Q ,RJ I 5 Q W 9 A inn K ' if ff if . 1 1 ' 4 K X ie- i 1 t eg f X f o - , 1 ff 1 M I r 2 5, e. o oft X I f 1 Eff' is N ' ,. i e l mLL,L mm NS iw , N Q, 2 Izz :Si xi 1 V335 iw? l f to CIT .J img 'NO :G- , 3 A X, .4 ,,., I . . 5, sw- 1 i f. . e sf. 1' ,. .gif K in , fmt 1 Kirk Barton Alison Baski Chris Bassett Eric Bauer Lori Becker Richard Beckman Ann Bagley David Bell Terri Bell Doug Benavidez Richard Benavidez Chris Bennett Debbie Bennett Eric Bennett Pat Bettis Tom Billings Cyndy Bloom Gordon Bonger Seniors - ff , The Poms are ushered into the first of two limosines the soccer team rented for them and the cheerleaders. Rodney Villanyi Sl2fikGSf3 GQ pose. 18 -- Seniors Doug Bortz Laurie Bossen Darryl Bostwick Brenda Bowker Lis Bradley Brady Bradshaw Rob Brady Art Brown Jamie Burmeister Laura Burnell Cheryl Burnes Gina Busnardo John Byers Amy Camacho Julie Campbell Sara Cappellucci Kirby Case Michele Casella x 'Qi V,,-H I ef W :M ,,. f, , fir ,fr AV , ,W , ,QL 1 , A 2, ff f B ff f I i L!! 5 X ,,,,, ,W '- . ., 5 f Q9 M4 2 2 V f i Z xg? r X 4 4 M l yi 1 ff We Q '95 If 5 1 Z5 .H , al. we 4+ 7 ,g ,QM Slain , .K rv J I li V x.. 1 .1 9 if Nu. 1 .L. ...lf f . ..,, . . f,.,Ai. ,.,. . is ':,- ' -mg in A . P , 1' .Lili Kerry Casey Cory Cason Jeff Chavez Tony Clapp Eric Clarkson Letitla Clements Brad Coburn Chris Cole Bevin Conn Melody Coote Cheryl Crim Richard Curtis James Cutschall Rashelle Damon Mark Danaher Jeanne Daugherty Raylan Davis John Day Seniors - 19 David Bell: alias, Pumpkin Head , show 20 -- Seniors I 1 ff f s his seniorities. Darcy Erb Francie Ernest Ramona Espinosa f 1 1 , , f 5 3 jx., ' 7 522 W if a Zin 7 f f ZW 9 W W Vx fyfv f , , f L4 W 'K f Z! f' ,, ,. 9 .Z ,Wm fi f f 4 4' f , x 4 f ,M 1 i 9 2 f 4 . M ZW V Egf ,, .',, Q29 www f f V, ff gf -1 Wg 'THQ- 'Q , L, 'I 673 f' X, f f 5 0 f W , it 5 ,f, ,: ?' Mn Q M' F3 7 Q ie! ,JZ M BQ W' -X my mnrufmr 'fu 'Y Q 1 Wendy Frenzen Eric Fry Juli Gammon Stacy Gamroth Andy Garcia Deanna Gardetto A Marc Gates Steen Gilbertson J uliefme Gillespie Dave Glaser Kristi Gleason Robert Gleason Keith Glose Cheryl Crirn turns in her chain during Calaulus to laugh at the people Mark Gocishall behind her. K ' After his lecture, Dennis Hastings moves to the back of his class to talk to his AP, History students, 22 -- Seniors Rick Gomez Dolly Gonzales Donna Goodwin Brian Graham C1 r an M 'i .. ffl' ugh., -- A, . ..:q,K.: 3.3.2 Q ESX , we 1 ' ': LQ J 19 ii' ,xx f vw' - 'gl s if J, , 16 J , ,gi Karyn Grant Steve Gray V. J. Greco NH x C' '5 F . ' Kevin Green Nancy Greichen Rosellen Gridley QRS Mike Grout Maggie Groves Daryl Grunau Vickie Guettlein Patrick Guida Pam Gutierrez fsfenfn Q in X we 6 Q Q K 5 if ' ,. -fav K Carole Gwinn F fi Jeff Haberman ' ,Q Brian Hall 'S--JL., .., iv- Julie Hall ,vs Monica Hamilton Jay Hammer 1 Seniors - 23 . ,. IV,-- W Q , V . .ihg if i me ii . ' l A': 75 'RQ ciT':i- W M, A?- - it ., 'VY gi, ' kk L A. , . 2 , i z in 24 Military services try to recruit students during passing period. What To Do Army, Navy, Air Force, Marines . , . they clon't ask for experience, they give it . , , you don't read it in a book, you live it! Sound Familiar? Endless military mail, brochures, commercials, promotion films telling us to Be all that we can be, 'cause they need us in the army. And what of all this publicity towards the military service? With world wide insecurity dominating news today, the possibility of war and military service is very real- especially to high school students. Student opinion and beliefs on the current issue vary diversely. A majority of GMHS students see the possibil- ity ot military service after graduation as totally out of the question, an irnpracticality. According to Rob Spyk- stra, senior, the idea of military service after high school is out of this world. He didn't think that he could handle it and commented that The military changes your whole outlook and mind. g Mike Stephens, senior, agreed and went on to com- pare the military to sports saying that, in soccer you work hard for a goal, but in the military you work hard just for working hard. Others felt they couldn't take being bossed around. Still, some students see the service as an opportunity for a good education or to learn a trade. However, most admitted they never thought seriously about it. Of the seniors questioned about the draft and registra- tion, most would, or have registered. They feel they owe a debt to America. Some students, however, 1don't believe in the draft or the notion of owing something to America. Christine Smaldone, senior, commented, I donft owe military service to mylcountry, work is just as much of a pay- ment. ,And the antifmilitary sentiment is especially evidentin students like Dana Kerwin who flatly stated, Personal- ly,,l'm Ei pacifist. Some students also ,felt the Peace Corp should be given thesameliamount of time the military gets in GM's halls. Finally, Sonja Roemish stated,f What wefneedgis universal understanding ..., I don't know, I just hate killing f s s i , l Think about it. l --l Seniors Andrea Hanak Mark Hannum John Hanover Shawnda Hardney Dean Hamish Colleen Harrington Chris Harris Kim Harsch Debbie Hart Chris Harvey Sheri Haxton Mike Hayes John Hedge Donna Heithotf Gary Henderson Vicki Hepp Suzanne Hermanussen Tim Herrera on-mane-ws Ai YN -t ., A is N I 1 3,3 is r N s is 'F 'K ,NF is it New Q 'Mu K Y. s. , . li li X ff fi Q 1-LX XE Ei ' X , use nil x gg W S S, Ali -- . XNXAS, R X 'Q Li -- .awn- Janine Hestexfwerth Diane Higinbotham Shannon Hiller Samantha Hise Kelly Hobbs Charlene Hofferber David Hoffschneider Jon Holmes Rhonda Hook Lori Hossack Steve Howard Wendy Hubbard Rodney Hughes Leslie Hulstrom Theresa Hutchison Brett Ingram Cindy Isbester Dan Jablonski Seniors - l 25 K, . A e Q i Fifi M X v--' X f 5 K 95543 -,L - - S ' ' .L ....e e K Q f Nfl X k-kk 1. 3 X AL Bob McCullough dresses comfortably in his jeans and cowboy hat for school. Brady Bradshaw makes a sweeping jesture to emphasize what he'S saying. 26 l-- 'Seniors Julie Jamison Scott Johnson Sherri Johnson Kitty Jones Ted Jones Ted Jones Gary Jugert Debbie Kaiser Mark Kane Mike Kane Michelle Karlik Diane Kautzrnan Tim Kaylor Ron Keller .Kim Kelley Sandy Kerr Dana Kerwin . James Kiahtipes 4' .2 2 l i f! .,-.,, o f I ff fi ...., I . 'fQff'5H3f'k?fZg7A ' H' 'L-, .. 'VW l l 5 ie M f ' 'Q . . 4 HO f My ge 7?-V . 1 s if 4Vi! L6 i W ,v Xi Y wil' L ml X Y' 1 X ff' A '.i qv. fb 1 Q. K iv'- '5 .. f .5 219 K 5, I X lv ul! in Q 2 Q Sk I l 4? P! , , si 1' 4 K X S. ,G K Hi we 2 .C l Q- -- . -1-A .1 , f 1 tk f A 1 V 3 ---. -fr 3 2 LM ,ggi ...-- .. A I - -'-- -4 V, 2 A K Q . P- ,fx - -. W J .5 5 fgf 'f-.k . N' gf- . ,X . . I -Q.. .Q 5 ee. A will M -an --4... A 'Q Wifi? XglY3Q Susan Kickbush Kevin Kidney Rachel Kimboko Bart Kisselman Lance Kissinger Mike Kleinkopf Laura Knowles Mark Knox Lisa Kontio Diane Koratich Betsy Korb Jenny Kroll Barry Kroneberger Curt Kunclred Chris Kurtz Michelle LaFleur Kathy Lanahan Judith Lange Seniors U8 trampoline is an He is planning to try out for the 1988 US Olympic Ski Team. He also pians to travel to New Zealand in July to compete in his first International competition. Although he trains most of the week, he does manage to get away and ski for fun. With a smile, he added that he liked to ski the bumps, Vail has the best bumps in the state, Wintersteen stated. 'He also plans to travel to New Zealand in July to compete. in his first international competition. 'and the ubumbsf' Vail has the best burnbs in the state, Wintersteen added. s Manager , Bret Lindstrom and Jeff Wintersteen study for physics. 28 -- Seniors Leanne Longnecker Keri Lown Scott Lundgren Jon Lundquist Ed Lykins Jim Lynch Larry Maass Scott Macaluso Sheila Madden 1412 ff,, . A I E , ., er i Q ,gp . MW . l 1 M nf, i l ii Q-v 'Q I ag! .aff fm- ,- 1 ,Ku I' X 5 i 1 wt., K iii 'W is i ffi Q X ii e i iii? 1' , f i n mi , gif M 2 As xy M i i i i 4 if + X X 1 le Q 2 R ii 'L W r' K - fit b si it 'ii 'wx . A if - 'il .ya K ig iffy 5 Y' 1 4 is x wiv a 5 'WE 2: ,W ita-, -. M. .ff H' f ,J W W Jeff Mages Christoph Manke Karl Mann Carla Mansch Angela Mantei Rita Marino Vince Marsagiia Hoili Martin Colleen Martinez Robert Martinez Kurt Mason Kavan Maurer Judy McAiister Mary Beth McAlister Anne McCaslin Bobette McCullough Tom McCullough Mary McDonald Seniors - - ::' Q R k. AQ'- me oe e e 1 W 3 - John McLaurin Gabriele Mehnert Manny Mendez Jackie Meyer Greg Meyers Karin Mlelke Catherine Mikus Cyndee Miller Beth 3 Miller Todd Miller Wendy Miller Melea Monson Jamie Morgan John McLaurin turns his head to see what the trouble is in the back of Troy Morley the classroom. Ann Morrisette Daryl Grunau waits in the Counseling Office to spealbwith someone. 30 s- Seniors Tomi Nalty Julie Neiclrich Angie Nelson X N MSM. me ,....-' rw .. , ,,. 4 . ,xg gg: Q, . -N- ill, .,,AA .,. is , .rg Q 1' x X P F K is lb' ll R l Rei 3531 C A A 1 X 2 SSA QF' fx. - , ' e X N 'Q' X 'K wk, iii if all 4 F ' .Elf ll x Q- 1 . . . if we A f f X sf W if l ' 3 l -f X Q S lx il' www JH. ob . Er: if gawk di? WYE ar ., - lm .Aw ihwgnu I EM AQ f Q f s WF Q 15' Burt Nelson Nicole Nelson Jimmy Nguyen Teg Nickelson Tracie Nielsen Gregory Notarmuzi Randy Notz Tom Novosel Carrie Noyes Carla Nuss Bridget Obechina Yvonne O'Conneli Danny O'Dell Jill Osgood James Otte Sean Owens Virgil Palencia Rick Palmer Seniors Challenges Begin For A New Life What do you do after twelve years of seeing your friends five days a week, doing homework, and maybe even hold- ing down a job? From ninth grade on, parents, teachers, and counselors bombarcl students with the question, What are you going to do with your life? Students often feel pressured into making decisions about college or careers. Some people have known since they were little what they wanted to be. Others have to experiment first and look at all ofthe options before they find the lifestyle best suited for them. Val Girard, a 1982 graduate, worked at the Westland Dave Cook to save up enough money to attend Colorado Mountain College in January. She said listening to the excitement, challenges, and freedoms of college students makes her feel sort of left out. Fm sure I want to go now and what I want to do. My parents gave me their opinion but let me decide. Bryan Johns, who also graduated from GMI-IS in 1982, attended the Colorado School of Mines. There's no one looking over you. You have to take responsibility and motivate yourself. People go there strictly to get money when they get out. l'm going to college to learn. Take the time you need to decide what's best for you. Val Girard said, To know something about everything makes a person more interesting. When you learn, you grow. When you grow, you become something better. Learning goes far beyond the classroom setting. Colorado School of Mines Engineering Hall sits peacefully in the snow during Winter Break. 32 - Seniors Darrin Pardee James Parent Gary Parham Tom Parisi Jeff Parsek Rhonda Patee ,,m-mmm if 1, is ,l f :wi H .s. f ' y er.: 5 , f .. K if 'V 42 if rf c . Nikuni Patel f 3 Pam Patrick if Ria Patterson 'l'f '.,.,,1,. ' . A, ,, , . Dan Payne Radene Peterson Vicki Phillips Jeff Pietsch Mike Pijanowski Kirk Powell --...sgw Dale Pratt Larry Pribyl Erin Quinn Q-ST' ,Mr 'wg' l i ,ia 4 f :fd W gf, I ki- .X 6 faqrw J- K 1 is 71 X A. ! 60, A - ,fire ,gi Hi, Kwai -, Ea xl ,, W? N x 5, ,m Q'. i J - L , K ' X who . 5- S 3 Fa v-.Gi Q 21? iii 'N' if N fwfr . , 1 , 1 ' , '5- iiigff 9'5 ,e z , R . Q 1 R or , A Q fir ' S :15f. g'- - N A fgfaef- , 'E' Si S Q 1-. X..-- 7 T.. W , Q, ,V 'N ins' Caryn Quinkert John Queen Sally Quandahl Laura Rangel Mary Reali Brad Redmiles Janine Reese Chuck Reid Shelley Reinert Lisa Rickett Steve Ritter Glenn Rivera Kim Roberts Mark Robinson Sonja Roemish Steve Rons Jean Rooney Holly Ropes Seniors Paula Ross D, J. Ruder Sharilyn Russell S ,V Karen Ryser Kristi Sagee Tina Sanchez Stacy Sanderlin Marvin Scearce Margaret Sandoval Nicole Nelson daydreams in the cafeteria. Liz Bradiy, Maggie Groves, Karen Vincent, and Stacy Sanderlin ditch sixth hour. - Seniors ,uv Myron Scearce Susan Scharenbroich Terry Schmitz Becky Schwartz Julie Scott Kim Scroggins Sonya Sedach Becky Shoe Marlene Short 2 ,'rr ,g V V 'i 1 ' in it he i l I z 'tm U' it Qi. I .3 me ' K s f r .. . Q. .,... ..Q:: i , , V Ni 2,244 lag Hg? S S if Ee ji' 1- 1 i Q r t Q r r X at Q r e in i X-t w i i - :W , f A35 'L Ar, .. 5 k 9 --::::-- A A .Q .. tL lx , 3.1-5.5K ,fs t . 4 ,S -F' Sie N X 5 tt S' K ii it X Q H R Q 5523 i Q Q 56 3 pg? f .Q f til I r f 1 . h ..' at ,gr at mir , ,fat ,re . . 1. ,t X Q A 'ie gf wig Q ff vsp N K A ,gf it 'W 'l AVF, + Y 6 . 33 agspgip , ,L -- t K D I . ,., ,. - ,,,: i is -, :lure . Q 'M' diff? ' fcsfw We 'A Q N asf-1' . , in - it Z g ' -M .. 1 V- m i - f ,. ,.., L .k..V,A' 1 - Q -f 1 , vit 7 1 ,. rn' ...R 1 -- ...iiw tm- . r -V-fi i dig? liz XA W t t Q rw ff, J V ,K cv iw we Julie Singleton Gail Skinner Christine Smalclone Karen Smaldone Charles Smith Jeff Smith Jess Smith Mike Smith Steven Smith Rob Spykstra Lauri Staggs Bret Starnes Greg Steckline Mike Stephens Rafael Suarez Teresa Sutliff Debbi Sutton Everett Sutton Seniors -- 35 Ra1se Thet Firm, And Stretch!! Cikay, ready girls, here we go, starts off every .Richard s Simmons Show. Richard Simmons is ayoung man trying to help overweight people feel good about themselves again. Simmons himself was once ata weight of 250 pounds. .His decision to lose weight came from an annonyrnous letter which read, Fat is funny Richardgbut fat people die young ancll don't want you to die youngff The touching note began Simmons, fight to become slim, trim, strong, and healthyy Q T T i S S Simmons lost so much weight, he had plastic surgery because his skin stretched out so much. The loss of body weight nearly killed him. He stuck with it causing physical and emotional pain, though once he put his mind to it there was nothing that could stand in his way. S Simmons is looked upon as an idol now. He has helped so many people lose weight from his dieting and exercise programs. He has written books about the programs, and, he's nationally known from his half hour televison show. His enthusiasm, determination, and love keep the other people going. They strive for the wonderful results Simmons has achieved. He has devoted his life to people who need his help. His television show is a big part of his success. People who want his help can see how it is done. I-le has a complete excercise program and a balanced, low calorie, nutricious diet. They can see how happy and energetic other people are. The response to The Richard Simmons Show has been so incredible, in order to be on the show you need to make a reservation one month in advance. Sim- mons has developed a whole new personality since some- one cared enough to write him. In return, he's doing ev- erything he can by caring. Many high school students believe he's a bit extraordi- nary though, because of the way he acts and talks. Sim- mons is a passing fad in exercises as Jack l..aI.ane was during the 1960's. Richard Simmons, newly opened health club, Anatomy Asylum. Q 36 -- Seniors , Pattie Sutton Allison Sylvest .Scott Teasdale, f Khris Temple Julie Terry Sandie Terry Tanya Thielen Daphnie Thompson Dannielle Thurman Rob Traver Troy Trotter Amy Trujillo Mike Upson Jan Urton Joe Vanlbyke s Joanna Varney . Michelle. Vasey Pepe' Velasquez t will S. . E - , ,-M' s'sllQ A I 'W ioi f W lll i tiiie iott ixx Mark Vigil Rodney Vlllanyi Karen Vincent Annette Vitry Thomas Wade Dan Walker Cherie Wambolt Jim Wanser Kent Watson Laura Weist Greg Wetherbee Mardelle Wewel John White Renee White Eric Wiechert Debbie Wiist Julie Wilberding Dan Willis Seniors 37 Memories Of Kirk Powell Pam Dahland Kirk Powell had been friends since they were six and seven years old. Dahl composed this letter after Powell's death this year. She hoped to share the part of him she loved through this. Dear Kirk, s There is so much to say in this letter, I hope I can find the right words. It is amazing to me how joy and pain can be so intertwined. There is joy because I know that now you are in the presence of our Lord, and are feeling the awesome peace, joy and love that He promises us. Imagining that, brings a smile to my face. You are doing great, with your perfect happiness and perfect body. I can just see you up there doing back flips or something! Yea! The pain that l feel comes from losing someone who was special, not only to me, but to many, many people. You touched so many lives Kirk. Your gentle spirit and sense of humor are being missed. When I look back on our friendship and reaiize how much you gave to me and how much I learned from you, I am honored. I have so many memories which bring a smile. I re- member spending hours riding our big wheels clown that hill by your house when we were about eight years old. And how we used to try to figure out new ways to barricade our younger siblings out of the room. There were many games of magnetic tic tac toe and velcro darts. I remember how we used to crawl around the front yard trying to catch each other. When we got a little older, there were the weekend bike rides and doing crazy things like riding down the steps at Irwin Elemen- tary. Some of the best memories are of the hours that we spent just talking. I'll miss that most! But even in the pain of not having you here, I thank God because the close- ness that we shared, makes the pain worth it. I Kirk, I thank you just for being you. And for touching my life. Your faith in God was beautiful. The last time I saw you, you told me that it was all in His hands. I don't understand Godfs plan sometimes, but Pm glad that He is the sovereign God, and that it is all in his hands. God Bless you my friend. I know that you are rejoicing in His love. Love, Pam 38 - Seniors Laurie Wilson Tracie Wilson Jeffrey Wintersteen Joy Woods Laura Wright Patti Wright Bob Yarrington Scott Yoshino Bill Young Ann Zesch Holly Alvarez John Berry Rick Boutot Scott Gallagher Nancy Gonring Doug Hillman Jennifer Hudak Karisa Kershaw ai' 9 , f' J A - I' 1 Qs nv! . , - .,, , N : ', , ,. ew .. ww' ! ,T 32 Q y ' f Tony Langston Shisting Liang Allen Marcotte Gary Morrissett Jennifer Reese Clifton Rich Kerryn Sampson Keegan Schmidt David Shelton Heidi Thal Wendy Wale Tim Walmer Seniors - 39 ACADEMICS Language Arts . . . . . . . 42 Mathematics .... ..., 4 4 Science 4....,.......... ..,. 4 6 Social Studies .,.,........ .... 4 8 Foreign LanguagefBusiness . . . . . 50 Readingfl-lome Economics , .... 52 Artf Music ......,,.....,,,. .... 5 4 PEf'l'ech ArtsfDrivers' Ed . , . , . . . 56 LibraryfSpecial Ed ,..,.., .... 5 8 Counselors ............, . , . 60 Administration .,i,.,.. . . . 62 Extra Special People . . . . , , 64 ,. iw ,A if , 1 . . -.Hy WWC Li 1 V, gn f , I., If ,, Ula, 1 x Q5 ff ,M 1 V, 4 4 ' 23:0 ,fzff M f I ' , 'W 3' , f jig gk' V my ,, f my '? , ,V , A gg, f R , f -- A , 4 m 'I , 'iw E ' 6?fK5 ' - ,L w,Myg45, i 4,339 N 5 ia vf '27 In we nm ,L 'v i if 5 Ay Ji, gx i 1 'PEW Aff! 5 ggi' gf' a y wh yi ,,,. X 2 -y , Q 3 . 1,2 .1 V U ' ,Tw if , mag 'M 2 W K ,,'L', ' - :X , 'w 2 li iqij 4 ' 1 fill .5 fd: 1 r f Tel ' 'V Y , V x 'x 'filf A ff gm , 4 ff, ff Q25 JL ri 'E' f ii E 1 K ki if H5 E3 A Q: 4 V. ' rf 4 MW .ff WM' , , , ,aff W if My fm , fx y , My ,A If I' ?,f: nw .xf3f z' 'WM LN , , ,,L., W 'M 7 M Lisa Denorah reclines backstage during lunch. Someone shows their enthusiasm for Language Arts by t.p.ing Mrs. Cappellucci's room. . n-a- 42 - Academics Q5 A group of sophomores write in their Big Chiefs the first ten minutes of class Sabrina Forrest gives an oral presentation for her semester final Language Arts I would hope that each student would learn his or her talent when they take Language Arts. says Kathie Star- key, Lang. Arts teacher. I think that Sophomore Lan- guage Arts helps the student discover this. Most Language Arts teachers feel that Language Arts is perhaps the most important department because it is the one area that pro- motes life long learning other than career learning. They feel that Language Arts studies skills that are the base tools of communication. The ability of Language distinguishes us from animals, commented Jim Starkey. Several Language Arts teachers feel that GMHS has a uniquely innovative Language Arts department. Green Mountain's Language Arts department, as with many of the departments here, teach above and beyond the County requirements. says Starkey. Kathie Starkey feels that GMHS has the best publishing departments in the county. One of the reasons is that the students create and publish the material themselves, instead of having their sponsor do it for them, like in the Creative Writting magazine or the yearbook and newspaper. A very popular quote in the sophomore program this year was, From there to here and from here to there, funny things are everywhere. - Dr. Suess NSR 3 2 . N .Qs l ui , . Ti f 1 A li' its gn if L 2 IQRPUIQ I iw Academics - 43 Equations for graphing hyperbolas florish through-out the Math area first semester. 44 - Academics The Apple Computer sits ready for a student to use. Aa V fa - .- ,ifgwqg An underclassmen math class works on their assignment after the lecture Several students collaberate on a Computer program Mathematics Most students realize that math is necessary, but are unwilling to work at it to make it worthwhile. stated Dennis Shepherd, Math teacher. A lot of student's attitudes for math vary a great deal, some feel that it is of great need and others don't see any need for math. Faebian Baker responded, I think that the students attitudes towards math are, in some cases, a reflection of how their parents feel about Mathematics. Math's effect on the careers of today is emense. With computers becoming more and more popular and being used by more businesses today, a good Math background is extremely important. responded Baker. In fact, most of the math department teachers feel that computers will require more math for the student. I think that math has even a greater effect in general on jobs today than it did definitely thirty to forty years ago. stated Shepherd. Math is becoming more important in businesses today also, not just in the Engineering fields. Although the Math teachers feel that computers are on the rise, they see them at this point no great asset to teaching at GMHS. We are limited because of the number of computers we have avail- able to this school. Perhaps by next year, we hope to have at least fifteen new micro-computers for the school to use, and that will greatly increase their usefulness in teaching. said Shepherd. Baker feels that the terminals GMI-lS has now are outdated and are expensive to repair, and looks forward to the new computers, should the county not cut the budget. yy ,xs L 12451 , If sc X Q E X i R ws N ,E r - V Y'-W . A 321' I ki: 3 X s X 5 R X 2 X , X. , Q, is X KQX YQ? iz r X Y M? if f9 1 1. M -7, , A .. , Mg, ig' 4 ,9 i 1 We Academics - 45 46 - Academics During lunch, many students put in extra time on the computer. Mrs. Efting lectures an Honors Biology class about birth control. vm A. - ' - ,A V Y ,USFS ,, m 1 4, 'Q 1 X? h igh ,ic ,239 rg, My Mrs. McNamee and Mr. Martenson grade papers during their free time Karen Ryser tries to find something to do after she finishes her Chemistry lab early Science A lot of people suffer through Science because it is required for one year. stated Allen Snyder, science de- partment teacher. But science should be enjoyed, and is, by a major portion of the students who take science. We offer so much, students who enroll find the class they want and are therefor happy. commented Cindy Fite. In fact, many of the teachers of science feel that the students make an honest attempt to view that which the science depart- ment has to offer. 'il hope , added Dave Reid, that the students learn to view science as a process of acquiring knowledge and applying it. One of the main things the science department would like to stress to the student is that a good well- rounded science background will be extremely helpful in College and in many jobs. Several teachers felt that we have one of the best science departments in the county. One of the main reasons is because of the good science backgrounds of the teachers here. said Snyder. The staff is also younger and more flexable than most science depart- ments. Science is having a greater influence on careers today also. With technology, science is impacting civilization, like never before. said Ried. With that will come good changes and changes that need to be carefully moniteredf' One thing is make clear by all the teachers talked with. The teachers in the science department want the students to enjoy science and enjoy working with the students of GMI-lS. Yr 2 ek . , , iuwwmf V ,., , ffmmfm , ' V HM A 47 .. , .1 .. .. gg, DS ' M' iff , W ff fy af 4 1' 2 A 1 ,Q if MH' ' .... f.':EIL ' lf-lf. ,U L, 'ii Academics - 47 48 - Academics A typical History teacher's desk is surrounded with maps and piled high with homework. Rick Bath's sophomore class works diligently on their map assignments. XS-cf 3 'I' ,,r,,.,.,.,.,..Mw7.--M--Y-WW M Dr. Bill Parkos talks with Psychology teacher Dave Dickason and another interested person after his lecture on anorexia nervosa. Dennis Hastings looks up to see who is at the door. 1 -ma- .- Z 55 x In Social Studies Social Studies, why do we require it? Social Studies tells us of past history and events. stated Larry Knott. It should help us not make the same mistakes twice. Dennis Hastings commented, Social Studies helps us grow, ex- pand our horizons and learn something of the past. It gives us a better understanding of the human condition. Scott Roberts, junior, felt that Social Studies gives us a good view of the past. I hope students learn cooperation, and how to share, when they graduatef' said Knott. Hastings hoped that stu- dents would learn appreciation of the liberal arts, and an understanding or awareness of themselves and society while still acquiring knowledge. Knott also expressed his hope that students wuld learn how to get along. Among most of the Social Studies teachers, a lot felt that a good portion of students who take Social Studies classes have poor attitudes. A fair number of students don't appreciate what they can learn in, not only Social Studies department, but in all the departments of GMHS. added Knott. Hastings responded some appreciate Social Stud- ies, but many only regard it as a mandatory class to meet the graduation requirementsf' The study habits of some students are not conducive to good learning. commented Knott. Steve Chase, junior, felt that, should the teachers in Social Studies include more enthusiasm in their lectures and some humor, more students are apt to have a more positive attitude. mwsmt-at .W pa S mv 5 .r 11:5 1 pm Academics - 49 50 - Academics Learning how to correct mistakes is also part of the typing curriculum. A group of Foreign Language students present a play for the class during the Christmas season. Q ft' 3 K , . A dedicated student does extra credit after school. Mrs. Zebauers points out some special places of interest to a student Foreign Language And Business Foreign language gives you another window to look out of, Ruth Meyer stated. The study of a foreign language does enable a student to learn about cultures and traditions of countries in which they may have only read or heard about. Similarly, a foreign language may even benefit a pupil in the use of his own language. As Meyer explained, Since a student must write in a foreign language, he soon learns about grammatical and structural usuage of the languages he speaks. Today, with so many people moving from place to place, it is no wonder why a foreign language is important. It is the key of ultimate communica- tion with other people, Finally, Meyer summed up the feelings of how she and others feel about the foreign language area by saying, 'iit's very energetic! The business department is one of enthusiasm and strategy. As Cole stated, i'The program is very worth while, and I feel real fine about it. Cole has been a business teacher for ten years and thinks that business is very important. lf there is any job open, it is in the business career, said Cole, The business department, much like the math department, is now currently using computers, The machines have proven to be quite success- ful, and are a real help not only to students, but to teachers as well. Another program the department has offered is the Occupational Job Training. This program allows students who are currently enrolled in a business class, to have the opportunity to actually work in a business like area in the community. The program too, lets young people participate in a real working force, while gaining experience, and money at the same time. 55 x :Z .SQ :V ik Teixef .i.. zz, 3 .. :fi-..l-ffzg -.2133 ,Z Academics - 51 52 - Academics ' 'MV: ,i A3.A: 5: , Mt ,,,. V , ii The reading office walls are covered with student posters. Outside of the actual home ec. classrooms is a small living roomfoffice for meetings. , 5, , .T if iff? :six ZF ' A ,v,,, ,,,,,.. f ' , 1' F W f'1':mi ,f-at ww-2i?2W,, f' yWyW--M V -s K' 2' mm ,W ' i i i t Q digg? JZ ' '37 i .,V, , V V , W! 1 fLV,. w ,,,, , W if l Q iii. W ' ' .f , -fm Mfwmww-W.W..WW,, , , Q M mad am! mind , . my yan , , We twink ff! , Q. A 11, it X' ' Wwwim f I 5 ft f 1 il 'L' ' 2 G , Wil wi rx lt, ' l , , I - M l These are many of the books students can choose from to read for class. A stereo-typical home ec. class works on their sewing projects. W: Reading And Home Economics Most schools have a general reading program aimed at the average student, but GMHS' program makes contracts to each student's individual needs. The reading teachers are very proud of the program they have built. It included a Reading Lab to work on general skills on an individualized non-threatening level. There was also Advanced Reading for the college bound, and a ninth grade program to pre- pare them for the upcoming three years. This fall a pilot study skills program will begin for sophomores. There is a possibility it will be offered with Driver's Ed. I like teaching this because the students can succeed at their own level and most feel good about themselves, offered Rita Couture. Couture also said they encourage students and help the students get started with papers in content areas like sci- ence, social studies, and language arts. Math really doesn't have a reading background, she added. The Home Economics department included many choices this year. There were general cooking classes and an occasional sewing class, but their main emphasis was not on the traditional classes. Classes dealing with people were stressed, including Marriage and Family, and Child Devel- opment. The ratio of boys to girls taking home ec. was about equal. Q. as ii ' ig ' T 1 i , 1,4 Z 5 Z Academics - 53 54 - Academics Judith Lange works on her painting. Seniors Rosellen Gridley and Dolly Law, freshman Joe Jensen, and junior Jamie Verdoorn exhibited art work in New York in March. C.J. Shibly and and Carin Clarke get ready to practice Concert Band members warm up their instruments Art And Music Art is something everyone can participate in, stated Carol Vanous. Vanous feels art is indeed a teachable subject, just as math or language is. Her interest is in commercial art, while the other art teachers, Ray Knaub enjoys painting and Ted Desnica likes to create cartoon characters. The art members at GMHS are very active. While they not only design certain wall coverings, they also participate in art exhibits. The National Art Society has presented many art portraits in the Color Scholastic Arts Exhibit in Jefferson County. Similarly, in the past, the biggest art displays have occurred on Cultural Arts Day. The organization also goes on field trips, Vanous also added that, There are limitations set up for the student, and this means that each person may have to solve his problem in his own way. In conclusion, Vanous felt that everyone benefits from art, and that more people do need to recognize that it is important. She also stressed that art should be taught in a sequence. We want kids who want to be here stated Steve Meininger, GMHS Music Teacher. We don't want students here because they have to be here. Meinginger felt that, of course, it would be nice to have more students enrolled in music, but he didn't feel that it should be required. We can't make the students like music, or force them to be good at what they do in music, they have to want to do good in music and they have to like it. He also felt that this way, the students that are enrolled in music are the cream of the crop. GMI-IS is so strong in every department, it keeps some students away from Music. Should GMHS be less strong in general, more students would perhaps take Music. Meininger also expressed his opinion that GMHS has one of the best music departments in the county and through competitions, one of the best in the state, ln my opinion, I have heard no other better men's choir than what we have at Green Mountain. We also had seven students go to All-State choir, which is the third most students from one school in the statef' Academics - 55 56 - Academics Tech. Arts students are hard at work in the drafting room, Gym class stretches out before they start their activity. i 4144... .W . ,. 1 is-- 'AHRE 'lam ' . 04314 U H. IJ is an -:E f--k. isp - Wwmw saw fi ' -' .........:s..-as-...L.N...,.5. -r Diane Vega takes a break from her reading. ambitious gym student picks up the ball to start a new game. P.E., Tech. Arts, And Drivers' Ed. Richi Brown stressed the importance of PE because she said as people get older they have more leisure time, especially with the coming of computers, so most people can fill it with some athletic activity. Besides your mind functions better when you feel good, and you feel better when you exercise. She added PE also teaches certain social skills like cooperation. The variety of PE teachers at GMHS was a plus Brown commented about the program. g'Each teacher has some special areas they work with, so no one has to really teach something they don't likeff Technical Arts is also affected by computerization. Every aspect of industry is being put on computers, but GMHS is still teaching manual labor. But because the industry is on computers GMHS teachers stress a lot of creative thinking because computers have taken away the menial work. Dave Schenk added, we try to instill a sense of pride in their work. I think in this day of change, Tech. Arts should be required for graduation. Everyone does general maintenance once in awhile, added Ken Henderson. An- other important aspect is it teaches motor skills instead of academics. Ron Crilly teaches Driver's Ed. lt is a quarter class and includes on the street, simulated, and range driving. gg ' F- j ' , 1, 3 .P Els -2, 5515 -U 'Wy -- W1 wmv? ,a w w f . fa 1 MHZ, ,Q ws t l r t 4 M Wx. f M X l L ,E 'W ' 2 Academics 58 - Academics A library assistant talks with Jim Mitschele about the stack of books in front of him. Janet Lake works with a student. its tt,- ltt- f V t'-- ttttt Burt Nelson and Jeff Wintersteen have fun in the library The library fills up during lunch time with students doing their homework W 'WN--xmffv M Media And P.C. HI'd rather be helping kids find things than asking them to be quietfl stated Gail Mclntire, GMI-IS librarian. l'm not good as a policeman. Mclntire commented that they have a good basic collection but needed more books. Not just one person has a paper to write and we don't have enough books for an entire class to choose the same subject. The security system seems to have helped, but she won't be sure until she takes inventory in June. Also the wall between the pit and the library has helped keep it quiet, more people use it to study than those who use it for socializing. I donlt find as many apple cores, orange peels and empty lunch sacks anymore. P.C. stands for Perceptional Communication. By this the phrase can be defined as someone who has problems per- haps differentiating words such as was and saw. The pro- gram also deals with other learning disabilities. For exam- ple, if a student cannot read a test, a teacher will read the test to the pupil. This does not indicate that the student is in anyway mentally retarded, for the students that are in the program have average or above average intelligence. Pri- marily, the agenda helps with the academic areas of educa- tion. For instance, language arts and math are stressed to help the student. However, as Janet Lake, GMHS teacher, stated, Often times students have more trouble in the language artsf' Academics - 59 60 - Academics Matt Vuxinic speaks with someone in his office. Melea Monson and Joe VanDyke listen to Tom Towner talk during my K their September retreat. Mm' ' 0 , t Y Wwewkmzg All the peer counselors gather for a group picture Glenda Adams and Andy Alexander have a one-on-one session r i W1 2, Counselors A And SERS Staff Many problems are settled with counselors. Academic, social, personal, and other such cases are handled with a counselor. At GMHS students are lucky enough to have a counselor somewhat of their own. Counselors are assigned to stu- dents in an alphabetical order. This enables each advisor to have approximately the same number of students, so that every student may have an equal amount of time to spend with his counselor. Matt Vuxinic, GMHS advisor. Every day is different. My job is not routine, new things happen every day,', ex- pressed Vuxinic. He also stated that counselors have the responsibility of scheduling, and informing students of high school and college programs. Peer counselors are another facet of the Counseling Department. They are students who spend one class period a day second semester doing the same thing as the regular counselors. This gives students a chance to talk to someone their own age, if they are leary of talking to adults. First semester, the peer counselors went through a class with Dr. Glenda Adams and Tom Towner in preparation. They also participated in several retreats to get to know one another. The peer counselors included Andy Alexander, Lynn Elliot, Larry Eden, Radene Peterson, Chuck Reid, Melea Monson, Joe VanDyke, Jenny Kroll, Troy Morley, Kim Harsch, DJ Ruder, and Christine Smaldone. 41 ,lmgq rg 'THU ,, f V Academics - 61 62 - Academics A Marilyn Henderson addresses the faculity at the first of the year. George Colbert listens'l to a caller. if, 9 - . wwf I 'fm 1 The faculity eats donuts supplied by Senate before a meeting with the administration. Duane Paulson looks over some papers to program on the computer, Administration I like the hub-bub and the turmoil. The kids either like you or they hate you, there's no passiveness here. Dr. Marilyn Henderson, GMHS principal, pointed this out, re- fering to high school as compared to junior high and ele- mentary school levels. She added that this is why she would not like to be an administrator on any other level than high school. About being an adminstrator Henderson commented laughing it has its days. More seriously she added, it is the hardest and the worst and the best job. I'm probably the only principal I know who goes home to sleep for eight hours, waiting to come back to school. She really likes GMHS and added, I come up here KGMHSI a lot just because I like to. She pointed out the Ad. Building had her out of the school a lot with other things and she would rather be at school with the students. All of you are my family. Henderson expressed her concern for the different competition GMHS enters, the disappointment if they lose and the happiness if they win. She reinforced her ideas with, I'm just like your parents, because you are my family. Concluding the interview, Henderson discussed what she would like to be when she grows up. I'd like to stay here as long as I do a good job. She describes what would heppen if she stayed too long at GMHS, adding that when it becomes too much work to make things change, it's time to leave. You get lazy if you stay too long and then it's better to leave. Academics - 63 Secretaries The secretaries are a very important and versatile part of GMHS. They answer the phones, do paperwork, get gradu- ation things together and handle the finances. Eleanor Lip- pert, counseling aide, added, We think, aah, we have got it all down pat, then they change it! Consequently they are always meeting new challenges and upgrading the work they do. In all this turmoil, they still manage to run the school efficiently and know almost every student's name by face. Informed Jan Campbell, I know all of the faculty and a tremendous amount of students. And the parents as well, added Lippert. 64 Academics The TRC tTeacher Resource Centerl has made the sec- retaries' jobs a lot easier, relieving them of dittoing and some typing. Campbell also stated, I've learned to be very diplomatic and tactful as I am often between parents and counselors. Although being a school secretary is not a high paying job, it seems to be a popular one. l'm off when the kids are at home on Vacation, was a charm the job held for Camp- bell. Lippert discussed the convenience of the location and the hours also. Working with students was included by both. Additional Thanks Often times we forget to thank the many people throughout our school who keep things going, so the yearbook staff would like to extend their thanks through this page to those people who dedicate their lives to keeping GMHS in working order. . Cooks Aides When the walls begin to tremble and voices start when you get a fresh ditto that Smells good do to rumble who is responsible for appeasing these you ever wonder where it came from? Certainly students? You got it ' the Cooks- N0t Only do not the great ditto center in the sky and of course they make the meals, they have to ensufe that not from your lazy teacher but from the local each meal is nourishing and most of all make the teacher aide. The aides spend their time helping students happy- the teachers ensure that their classes are informa- tive and complete. Virginia Block Janet Hehr Maria Holowaty L' ' a Margeret Antley Emily Loendorf J!ffri2eidaSl?rficht Mary Clark Carol McCandless Bob Cook Jackie Sanford Head Cook-Georgia Spencer Ann Herronen Marilyn Sandford Jean Huling Ann Thomson Montine Knowles Mary Wilson Nancy Kron Agnes Worrell Eleanor Lippert Security Finally, Nancy plays an important role in keep- ing our school secure. She prevents vandalism and crime and ensures that the student and faculty are safe and happy. This year has been one of the best years for the upkeep of the interior and exterior of GMHS. The people who are responsible for this are the custo- dians. They put in a great amount of work in order to keep our school beautiful as well as helping the students and faculty in any way they can. George Allmer Bob Prewitt Wayne B061 Louis Tate Monty BUUHI John Ward Another important food aspect of SMHS is Beth iO?T'r'fAHllzn3 L25 Wolff who works in the school store. She puts up with a Y Zac am whole lot from the students but just keeps on Head Custodian-Charlie smiling. Next time you see her say thanx because Armstrong without her our school store would not exist. sgr lgfwwrimmm .M mmm, W .,.,rf.a, W..,ZwM.i.W5g,W5imetisgeiisirggzgr A 5 'fwfiii Miifriw ijf2.TS?2r k was 6 'Aiifaggfwiswf s,w:22?Z3'2i4555Si3l,:r rg'j:1:,fgggg,1f:::L :3 :s.m,iraa:,ss i f Q t Q to , ' Q52 ffa:,mfQQ, wzaw Y 54 g,i':?sfw:2:ffs9 :wg wfwazmffn 'lf wggff ffwimi viz 22' f?3W 2'r? : Q4 ' My MM xy ,,f5,,5L,, f,fg3,,50,g ,,,:,f,g4,eQg76,g1Q,ifi1-1 465W.4Q,gf,QgM,,,fwf gfwffwriszwwigaf A, Wmf4f6.12LXKs2'Ws22fX:g0,WMw3?Q,fwlynx, fQ5w f2a.,H1.gf f,2f,,w g,cE'gf,,':f yxwggqbfwiw , H ' Qafng'Aw2gg25w,gfs:,M:',w,fifrwewawifggag.4fyf.,gZ,ffg gag?-f7,Z,', ,MU ,aff --wfjgd, Jgmfg z 2433444 fwgfff. 7w2MM,v1fwi 55:71 'm,Zi?,1f',,'4a, ff,Ng fug4MfJ,'fJY f msffiyf ffmagwjw ','K4J. ?f'6vq,ffpJ544,wQf.,, i ff'5'f2!M,L'wZ Zfwfiw -Jn: , 5 33 fz,Z', fg, fffv ' Jx ,f, -jm,.!.9gjy'j 4, wil' 4453! 94,fj.gy2,f?wy,f'wg,j fal,Qfw,f?,2,,0'nV Wwffg9'5yQgffw5f.Q Mw,:gf'jZ6'3 awzmffwg fffi543f3wwf'if-W, 2:0355 iwmyyfvwauzqfnwffgff jfZjm?',1 .156 M- gg, wfifffwfwg? AZN ,w4Mw4:e,gw,f7mf'7:y2ffI4Nw m,2,:flfh:,g: 5Af45w,g'-wif :af K my 6, W, ',f2,,f, ,,,gf,,,m,4M WWW, ,52,,,,wmy21m4fg gf, W, WMU wi 4 ff hmvev 2, Hum, Nb Wgfyvnbffgows 2f?,,,,,2w,29mf ,Q gf. M fx ,www aww? 5 gwzffsa M,-Qmwfifs ff, gfzigfffvfwL2:w:g,f,2,f,sysmayw' wmmfwgvw2343,153Q.fw:m5i,,m,,y:m fff,g5f5gxQw2gx5,,w,f' zwffgy, r ff ' x 5 L 224 215526 ziiaffiiziirwfifffiffza:Q??s2w5if'f2z2f: Mssff'w2,w:ffifffyrgffmffg w2i::1'f1ffQf?:ffff?:GfffQf5fl'ffQu1fwi''wwffivffizffffzmlfffw251244 M ffyyxyg-,952 any -fmzgfgag' 3-msgfsfg mmf' E Qgwgvfffffh 4 Q 7 .Q7',w,w1zgMf 2' ,f W4 wwf ',?f1,,hfn,.?f,f.w45sp: lawns! 491032292 'Af' Q ,ygY:ggZ'.'g,wggffgfyfgslgf :gw Ugwww if Vg fgsgvsg f fi sfgzzffizzffigsw f:i?4:gw:f,' 55555553 Q5zfZ2 sf:fgs fkiggfgfagzzfg fggziig ffkzg 2555254455251 fu . ff .5225 ,,f4 f :we w,irv,pf'fJjwi fiygfspff WY: upf'2.ggMi,:N::-'25 M:wJfg?3'rfh'Z '?,:mgf,'4J41 Swimf4W1f?2f'Sf fZ,ffJ1,f My 1 Wiigwfhiizvff ffviwzfkfrfff 3-wif 'Ji' 6w259!'w?'Wf4f1''niwlwff, wffjg' W4 f5w,.?wwfg,g4.2,fw:ww 26w3'5ff' 'ivfvi wmuxaeff Zfwimnwlmw' ,w'fw'f?4'wQ,f4i,' HH 'wil 4Z7'fw':hf','w4m W J' wwf' My fs 4 :'fw4f pf 'un f Qmiwzw wif, wwwW,-:u,,mwfN,.,wgg.f ghgfv 21 .2f4Qgf,3w0,m4fn,ff 'Awww Q :wif Qawq Sw an 'ff-Hmm wynrn iwawfw, .gf,f5.pw, f,fw.gt'u:w,,, wwfQ.fy,wz49f W Q51 Mg , f-uh sfiisgffggfigggws55325552'5g:5?f:552,gggggf:ffzzifw,f,f.,z?ff,HMisa,454fffzzim2f:?vsz2fffisfikffzsLffffsff4:6amyQffasg-f5.fwffs1?2fmffairsfffff' M . Qyfngygi, 553,353 Lf Y fm! fvzgssmy-K gwiwxigfryiijflmigmkzfl mm 1,1 Awww .q,,W,.,, fyyw, guyz gyygfwf wish 'Wh Vyywz MW, Wen 'Gp Smfwy wi rf ya!! gf Jin Msff ffgifawf ws: Qfffwfgff 2, 53535 5 'Affffs iff fizgffzaf :q asf! , V , V as wi: 9 ,, www. gn www 669552 6 mm: Hz' Sf: lffssfffi wf?f5s'2?f:: , 13 M4 . zifffiffffi h ' A ?'.f'P5'!j .: 0945: ' f ', viifiygk ff,iQ:Nf-51 l , ,qw,g,5Xm ggwfhgw,fwgwvgm,g:5m,5gf4A. wsfmuzqfiiwgfffw mgnww iw: fi 'fqwzufgg ,:e?f:a : 4' f:,,4f.pf?4Qf54m dasfsfii V ' , m5553335 'Q Qfssimhfzf ifsff in ggrsfsffsegswqfx:W:g,:rw,zggffw?fisgH2':f:, W Y N' ,, If 'i iilisifsiffffrzwwffiiasszififfffgfigriff, a 4 4 V t ,, V ' , M A, W. H 33:5 wrffgv' 555:51-' 2 , 25,553 ,,'7f31'Z:jP',' 7' W ' -f Y , . ' ' 3552, y flfzgqgg Thqfsygff g1ZyMi'7g5K- :wifi?z1f?'wif?I5:pZ'Z?ff R:h5SwF:'fw::':f2h3 Wu, ,wzffl ffm: , Agra . :gym W wr: X- ffm-z.f,wf.-gwzf , :wg t ,Wd I Uq,.,.,,-qivzfzh ffsgffzma xfkgr,-.:f2:-wx ffl: L5Ig3'sf:. I4 :,f,25.fLf:g I g , 5 Sas: 3:3225dxpigggfisgwf.hfJ?,f,,g:::fV::3:z,g2w feggggffffisgfii fazhisg wswzwirs 3212:'1i::,m:Mfswwssfry w,ieQffQ'Kw wr: ggisxfsrvfiifzfwffssiff We 'ffgfiff 4 ff n: fs? ggi? 4 fafzgyxf, T'yj'2Z',iyfQ q +4::45:s:.fgVf f:'?5f1 ff 1 figfiifi252535Hf:f:?f?s:s:qf:,vf3ii?g,wffffffwf ww: aff Ah Nggghfggyogcgfgiig55535,gayPyga53gyf,gv'p5m,1wjffgwgfrsgg f ,gf A W: gy: J W' lm, ksasgmssg ,:ggf?::gvg,,,:,wf,.:5: . Y:-f . ' 15-as mf up WMM-'v frfww. wmv :v5fWum:.w lm W1 1: it wwf, www 2052555XigzgvgdygQggmsgvzgft gm sr 'gmfygw mawiis mfg f:yy,2gMg,x:,g xwfmy ,gh 53 fk::2'5: f f12w?x?G:55 254545152 1 -. firfygg jffsif-1. 452,152 1:gTff:Hvf2ig!f1i f4ff:Qifx' ' 7 ' 2:2429 Qffsciffgilfsscsif :gm U Wi? :airs mffpfl,g5':g2':g35554554,f.fp5:,g.z,g3fl:'g:i,1?:55'i:g:5g54:V Agifgymxy, , wk ' hw? 'iifzifsi' fyffifff' Vzfglhf' fff:3'i','L fffgiff 'fi ' A gym? 2fr?:3fa?w:g2f?g55r?lsiissfsiszfaMS' 1 ,-Zi'::sj'f .TTEXQF '-fY35f.2f3 fe.-I V135 :figs v ,gfh - ,tiff , :g5if,g' K' fiwzr.. S-,isp A yggfg, ,gfigggp Y f4:,g xlfh- lfgff Mi' Pf ww::4.,.ffg,Q..w MW., ami: 7 fffggglf .H A f gif? i V fffi' n - Wfffffffsi ew? 4 512:21 I 'frsw w TZ A ' ff? Q, gjggfifj Ng Q. My .Nusa 1 5215. is Wg. Q A UQ N N H. Y W MZ, A F gm, M aw ef gg? w Q? rw. :Na If ,., N ,fx 5 If if v. N HK is qw M4 my ,Q ww .1 v ss. Q -wi., E' Nswsmf. M M:fM:,U,W f ' 6i:5g5imi'M 'a wa K ax , ,S 555223 . 5511.2 K 'lib 315:13 q iw :iffy Q , MSNLw5zg:Q:wfQH2:M:fiigH'ivwgwwgelm-1 ':2Q3xzms:n ,2m Ng kimshfsgswswiwzwf'-xkfbzzww'iiwrfizfw3Pw?w:,fNm:f3S'A 'Q-Wm,-M ww W N ,W .ww JN www -Kwewm.www -. mmm -H,.,ww w.w.mf ., WA , Qmmw 'Vw.,,U,, ,UK Wm, Wm, :.,:ww,N.1,l, m.,RgX,f,Mw., 'Q iw , -.vm-, Mg-fn' rmwfgw :,fmNfw :wg ,,:m,,f eh- ,g+3fHegv.'X5,U 15, AK-Jn'f,a'f:Mg5l:wg52,gy .,fgz??gAgA.i-'L,-3,53-Saw, f34gm:g,f'm-xv 5? 5 Wiz?-fqirlfs A - Y F F5155 Q ' im Wx' wx Jw: wiw.--,Qm5gf,,g1sgW gm-.6wMqhggh,few. vasmvfzfsfiiiwiffsQsgkizffv-wswsfswsfzsgswefbffx fellas: Wv.,:i,g,w,,,1eMw,,gQ,,3n,mfe,,,.m-:Wt ,,32 fgw,1ww.,.v,Mg.MMA M, A ,A Q WM: gif: f7w,'gvg?'i QYZj:M5FS5f'ZZH'f5A H.i??,Z'fQf. f?1Z3fg4Fff:?H Jjgdik L, iii? pn, +:fgf:Nf1.,:figg-1,:' fum 1 :ff 552, 1:fw.2ps5- g,gg13g.'yv,:'gyx,z,- Vuksgnigf w::',:w,X -ff - 11 yi,- gfasiU.pfN535ffgifg51gS2,ffw92QgvsilwiifzhJ41?:sQ'i!.ffw ,Nw A sfixw wg 3?fi?i:f'e?x' :4a:4.:f5grff.p wise: fffgw f 5,::f,:fswH,Qsf15:?fwfvfazfwlfffzif my f. .frffyifaffzs ff A . - s?ff5f:g2:1,fgg.f5:N.fwi55.ffi:'gwQ:MFQ2rgggsmiwfaigiisgx, 'Wes' VJJWSE1 ' M fjx?sff1 ,asm gvfljjg -g:g.:, . . M'-.iw-iw: wgm, .-New - New - ww ,wywfv wssw:-W-:sw YQ-i.4f.3fvg-ww ,zz-,ghw,s,,,fz'.apw:s,qf5.,p, ,Ng V .p,,w,V .ggmsw-A f,w,m www-'fmfwg-iwv m:fs'mfw:www f--gw2'm.w,wa,rw-.ww f fr: 25:5 - J'1Qiif,:ifv'f: f S if M Jszwf ' wmff' fu: 152155: 1j'EJ'gD,1 1 K wif? F: 'qfgf .3455 M way. L,w,:w,f www 'X .'fM,:y,:. mm? :K Sims? vm fsgisgvfiswsw::f?:'2f5i'w:sw2:fv G25 nag J M :ww ' 1215 5fffi:gM?'wF: Egg :iff -55:8 55: 4 V f55'g:2':'g 'ig 35555354375 'wif :wir 1 if 3 5 4,.4 ,nw fimiit ,5 mg, . ., , H -is, qfsssff 6:55555 ,iii ' f 4 R fb:V.wfwsgwgy:.JgM:wv.MggUQ:f4.',f:,f hsfgfs- gffigfqff .4 :wg , , N :w:3wf3f.fm::w'f7::b :wig'Jfffgwwfgefgzmfhzmtgwsg 55,3 V, , X by qw fgmglg mg2g4f3.Q., 415 he :A xy ,gm Y My Asp sa Qggqsia kg A-,gp has ww wg - . w?:sf2.fQf:,ff.2xE'?:.:v ffffmlfisff awrfgg :Q W ffl r :, fefgif bk H Z v1:f1Z::vf3.f Hffiiflf Jffiiz 4.fQ!:9'-.51 iw-.,-riswfgwrJimi:f:.'4G4M'.hi'f3,m:wV:wi:bi::hf, my-.VM N,-W. Q rs::g:,'wX'ssJ2gfisfismfgwsHgzgvgwiazfzwk'Jmswmwihsilw Siivrff H 'f fffeigisff:sfsshmhffgzfsfxsvftfzfisifzgsegnfagwv.ww:'ef Q55 w:,:3gi:f3H15:g5f .fH5?'fj:1-f Xing?-rglwgieligjf sfyffifiy ffffqf 36 5-55351 .L 1 .5 uf ,R i:g4::giJ':ff: :gg 45552: iifziffg,- if: 4 gigssizn - NW? M E5fWfT.f '3G'S fswszfff rw22:wwm:f2bQseMgfsiffgsfsswswsz 2 5 'Q wr ?:g ffwf: ff?2:bfw wxffsff 'x?h55f'?:fff P Hg , 7S,f':ff efrffgff S 'v Q 3 ::1:ff?::,f4.. ifigfif fasflff fgfffxfl. N Kim ,ez:wg3,,gM wg,6,g,Ngg,,,y,gg w,,5f:5V,y.1, Amsghmgfw vm is EZGQSS-MSM?Hifww'-1.g f-fa5fmwff4Q W ww! 3q?Z'ff f'w?,, A Y A mu, M, h Da w,.W,nmm, .,., M G G , , ,, , ,, ,,,Xm3m.,,46 Uwfmwk ,f,,s+wM,wsfwfw., Ga ,Q 4. fm-mggmbg-Ls,-,Qg3?.'g3.wlsi5?fM 2 'Q H ff Y N W .1 k x fJ,Qmz'::4ff,ga.::iSf, -Zfsiffr W Q X ,, 4 Qmsgwiiw rg 2 2 qfZ,,mf?fst:VPi:1g-Qfgw, TQSL nj? Q, gg Q 5 Q fs? wfgf PH hm- 'L N Q ,Q X A s Q x WN ,X uf Q L 5 ,, 1 5 - 'Q .ffssi-.. 5' ?1f 1 J ywm . - , M Q f .K V an xx : .5 1 J. wig 7 . L ii :Nm . . . . , . X :5 ..Mx ff?-iw -i : .. 1, A v , .ig X . M f D, Kms, A' 2' ww 'f ,viva ww P1 Mwmf, N :S 'Z U: W, W., N .M , M rsm::w2:'. W:-JN :Wes m-Wgxw Q..-v?.g4.5 yjhmgw -,jfmriigwga I 5 we -wgwgqvww. NM, ni' .,wv,gaz', Lfgw'.,2M,yfN15XfQV Q ,.-,w:w,. .wigw wgyq N .S N, 7, MN, 1, W U 1 W as ,, wmfryxmifxwfbavww-mf1wm.w,'m.Qfw.www,aM:'f.',,3W:-f, N. .,, ww Wm.. wlwwmmww Wmzza ,mf,.,'f pm wygmw. 'muih Q M5 :haf-1 Nga M96 - r 5f5i3jffggf!'f-'47wigX f iifgfifg7,y63f5gJ 'figggit 369355 - pfgzgqgd.: .g:..:- ,:g,f,., awf4,,1,h 1:3 f 5.35 Msgfm K sxwaafyxwgffg J ff.x,':'mgL'g3.iC1U ffwiiis- if 5, 3 vgfffx - q:mf5,w5.:h.,gMgW,9q'Mg mgww:m21vw'wfyimgg-an sywmwwwh vhwgva W,nm,,- X, A,,pw,,u5.,gf.m,Ww,M,f.2,w.:,g.,1, M. . whz4f2'gf5ff:.w5: w?iw3m?5PffwssisU1:6wbQwi:fwf:fHS:w::1ffai2 25:f2g?5sZ:WM:w,zw.wf:meszswwwvwpwsw awash-v wwyww V4 Wm W. A 4 X. , 1 ,M W, W H M. M W ., .W , A, V, 4, ., M, K' 4. pf, , ' . Aw W wwf. 'ww -:ww . wwf' mffswf fiwf' fu: M -RKWJM :wf,w'w :',fi.:w Wff-f 4-wi: .ffm-,' .sm -. Q ff:fff,wzM.jw - M4 my 'ff ,Qwwi L. . 'Q gy ' fm N. . F gxwm . 'w'fNm'-f,.1?'bRw -Jiffy' vwwk- Ywiffw q'vSa.'M-Vmlf'-'NW-M'MQWGQ 'vivid fx lfbffwiw ffwm has 'anim mira, If 'vw PM -m'w,,w 4 ' 2 'ww 'MM-,' yui ' Vfwfw' ,M-.ww '2f'fx'f f MW? 'K 4 ,WWF E www, . A m, f- new 4 f Af, - A . f V mx, an ew.-, .wwsm 4 ,MM .fa ,W my m www!! v.,w,w.,fUwQ,w., ,vw h,Q,1fmf4 f. 4f,f'v,,,-mmm. 7 ww. f-f wx, .,L,M,w. ew., r M 4-.W wufwx mm: M,,Mgy,: my ,swgb W N, 6, ,ww Q g,,,gM,FwWqT5..,,,m,,,,3a 5Sg,m,gQ,,gM.,,.,:.,,ggw'5,A,:,N,:1,,:.,Nw Kg,x,:5,,,gb 4w.,.WwZgQv.,,,.,9q Mm53,,,gg.,L.n,5.,,,,,,Q, bfqffsefser : A V Lizzy: 1- :piw Qffffzu yisfffusifg mm: FSgf :f:fa55?,gf5:ggsffN Sm, :ww wm:g2'?'QfG?g 4 isrffiwis wislgw X. 255515: Qfsgffizgywfsgi -'faizsfggfff Qsfizmf :iw a.f,Q?g,wSf::w4ffQ.:gf:15g:yf:fa?a:1 Tr, Kfwftp .ww ,MM ,gf wg, 1Qfggwgu:4,:m,My.,5w:gU .::fw?irU.wfwfmM:yisfkig ,fqigqfgsmhanWagyugA.,gm?,?gw4':we,fgwfM zwzssgwvg:Qww?21mgg5Kg1wEzpfeftfgUfmfgfmrfywwf:Hf':d2mVSwy52Qggfwsiwff--agus mfwgiggsfwmz-wwwfswfrbigifwffagfiwf-2is-Qsgfgwy - -Q ,KMJ 1:53 i JVM ' -X fkwfs 'E Q R x. -Jw!-n wivlwg ,f mf ' N2QfHU.'v'M:wm3w.' wNA'Wf'XL'. 1-1m f,'f'f' wivf f?w1S:f4'5fQff'ff.v,f 3 vZ'31'm?'ulHw5'wZ'5'ww,Z'Yw.'- 'LZ SIMM' 'V' wg fffWm5'w3L-vfwfffw f5fwi'wA323 mx GUN w'?'ef'-1 'Ri' H3555 'H5 5,W5WtQ Wi 5,555.1 V n A541 35,3 . wggf? ykifgx' .fxffm V. .:ff,,y W 1.ffQf:fgN:waiim g9,:yf wgfgfg- 0,53-wwf,,,3fK2g5'-,,m5g3,41g,.,5,g,,A-wegffqsgv :Y A532 :fayghrgfgxw-ffHf:,:h-.frwybgwgy11455433 1--fggggsfg,:V20fgfg3:g.3w51,3752 fp wiki- , ,KK-ig-imyfx, ' Www, wg: 5 ,p4,gI. gym ,,.w.g.,',-,'fgw.f,gy.-.?gg,-,W lfmwrt ggmgy, fffzff - fmsg, . hgyqfy.-:':WN i 7.'v3I, , ,rlyffz 'LM' 4' Z-'iff fini: L- wfff' ww Q4 Hx-wa wbmz: Mg,w,,LLwgm.,,2flw -wg 'f-.n-.V 'm,vfw,wuw 7-.wws.w.0wxH, - 2,'www'mQW1- w ?wuw, '.wHs,'-mgmff -New V wwf -:wymtJQfN6'2M. t Jw' 4 'Vw-'A ff Nav 2: ,N -fvffv wffwm , 'U . JH. H zrfgyfwgfasvf-.gwgwg-..1 Xgwmgqfw QQ-4.umm?Mgm5w.,gfh:MQ.,M ummm,f,Ui:w,.m-:ww .whsifw Mama ::wivlswsw.bwiwifwf Wvffvswxffw I-lfihfqfwswfw.wwwiefmfwfn wwf' ' W-'wsvw -7 wsww f Jw 1Yfw:'m Jaw! -wwp wmwmw2-UfiiafwflfgmizffwfXfbrfifffzwifwsfviss2:3-vawgmzfsf.:e.5:fg2:sw.::6m,:mx:ffxifrslzgaevmiisf-5:4fzgmwkiw,:NewtWfsswiswzwiiiw.nf.wsswsw:fmawegemsf5lw2::m.aNmw.:,m-new msfwzmz fwmsw haw. :mv-gmsyfsz fm.s,U2f Msn' ww: N W H W W-fa+gmwQsN2s.E:f5s? HW Sw W, ,W 7 uf m vw 'Qfva'5swww'Wie'kE2?35ffi?wHa sfsswiufissizmig MH 'W WW wg, 6 wawrw::gsm,5-2,35 wwfmfwsp:::fr::ag:w,assgfvsfqfffmafXafrffwfmm W A, 'N W 2 gigqgxfigwgmvfygqs,bwgwwifgmfiiffSfizzxgfwilif-lpfww.Mwf 'my ' H N ?54W?g5:g3xgUga,..,,wW5?Q wage M U ,Q M WM fw.-Www, 'Mu-:5?v125'? my wwlwsxgw M231 mmm L W 5 K ,ggnssgmfggwffg Q,:,Ma,m H f ' , x H M ,D Vwggng h3b:,,3f:4g fXffivsfggfzigffzyiafisfmiisfwfa.:wsffQfffnwJWV- V ,, Qmgwwmfwysmf, 75:2M5i?:f::ff:::w:m:Hg M W M , ,,, awww, m,,qw,,wwMW,fm,m,.:fsM,MM hw H E W va4,jvbgJiagmfamygwfdzpfU'K:v:w,j'Ygf.5,yqAfgv2P,g2g,,,gwwgbbf WBA 'M' Q Q, warm we wiisf GsmwffsfffwfwwmM H M 'W' ' fxwgwzfmvmesglw, M, im A W .qs .5 f 'Q' ,X f as SQ S X fx ? gg awww gwsqgg ,mg M. gf, y5 fff.:pfm 'wx 33 Y W X .M Y GLEN .igfffis - W.. fHN,,:fMsggwgHgqS'a5 wfgggkgviwgiswfgn, WWW' W ,W ,., W Wwl, gym Q, x ., A y ..,, WmwawQasfifiwfwwwymffgfiigifww fi wkl353554 Q M 5 ' 'M' ,vggvgwgksmfgshbW,w35gQ,:5k:zggmg5Ns,wg,-'w,,fm M Q .vw SW M gh? H ,, w6wm:fwSI, M W'-mx vw We N pwgwggsw, sw A Q X Q sv - Kp, M 2 .A .b?.?:'grLmQ'm9 ...... , Q ww, Q N,mgm.gms':,:2:,,wfg5W'35Ef'wi.1.:5MffWwW 4 M, W, ,.M,6.4 9,,,,,,g:,,n5S,f:w Mzwwggw SuZ'ZJ:fww2 fW' W H 0 ,, W QB ,W 5m,,fwm, Rim.. af w em ,,, kwa w,,gfD,g U Ns M pf sw M, v,v,w,,g1w., -w i2f,255ff:?55.5:Q33 S Jimmie awifzwfifxwg' : - :EQ ':s.5f A, ag Mm a?,25,mf2ggl.,U 3 aw? 5 iawlv S' Q 1 'bw 3 5 E W 555355355 as We 'EHS SW aK.,,,fgm isggmswfifvwn Wh H, Wim Wgigifgikwfffwifgxssaefi :2.-:::r:- -I -I .mffgmgivfvag gf,:sffwa'sws.q, .. .:- 2- M 22 W N W vm' WGS? ,lwiy fiafiflfsbff FW -'1XE-2 ' Qgfe- E W MW svwwpfwmsawfwws:Am we Q, ma , Q 0 af msffmfwwsw, 4 Fw -- , , 2 Q fx ' 3 J?gv.2w5Q'Q:fWE aw, E. ,, ,W 2? W ffgmfffffrw f f f1 4Q3i12Af5g5 ' , w U? ESM .f S' ismiffmfifslg Sfglzwffif 1 5 R ,gm s M, .W MR - Mgmg may -wiygm ,M ., www Hr My xg, Ei :JH X A H H ' ,wf::?S:s55g5:H53f 5 ,-Lqwm, .mwgs ifgy:55?iQ5ff3?:s:SSH53g5? 2 wfJ,'m,,'X'eSJ'H 'M ypwfwwwgfx fsiygiwffigshs A. , , , g ew m,M,5 w fs'fff3v35SQ5iWEYif5: fyjfggf ,wy5,fffm,:v W K, with 2,2 4f1?f3f gf5f K v:'Qsfff5 2 Kim ,H gyfegsfs-sikgwlfggkiwi ww2'.m5f4.:Hw,35ff W 1, ,, Afa:xM.g'WZ'fw,K?wW, ii. W fg,Lgg5x4,1,gg43g,5g,1, gg: ,X 4 sfpugg y if 4.3135 fgrgfsgfisfg 3:2 gag n ffizz g lam? 5 L 5 Yweffkwrrfffwsniss bg Wwiiwiwfiz MSM wg egwgg wufw. gg, Nmap-effzghhi ms Us Ima z X'S555S5sSf4:5xi5QiS??Sfi55i?i3,?3 :b 3:55 l 'fr?i'iQ,g2:55?J 'ffrpgik M'fg?g'wf?W fW5 V E 9 5a?g54,:g,,Qggi55?f, iywmw y H' ,, gil: W 1 :za ., 1, Q My aff :q:M.M3f1Xff rg 51 f 5 ' -f ig- A A iffy ? :if 5 ' f ,ffifffj 525 K H K z - ' .. . Sigffsamgfhfslf' Wfizffwf H , 4 - i , if' ,:fw.'-'Sir ffm: g 0A5'g1.w?:fwf5ifi:W5?'5f74'ig-5 Smsffiizyfif Sip fri-fs fnfsfixgffgrfwf :A,s:5v::fQWmwf:ff5:ss Q1 W' If ff- ' fffzfifzgs? fffffffazvfiffaifargginf , A 'mffiiff k 'A A W- 'D .Jw -1 fpfisffm V .swffsfgif-wfzsgiw .. X X fffmffsvwf, , 1 ffwfffw, vi fgg?f::m:g5f:i:ff22'eeg i w - - Ns 4 ,5:?4iw.gf W :Mzs,fhf2zf,,f,. Y . Q . gfffw2'f?2:vfH22-'NJ :wif::w?fWis:mfsaswf::::2f :wf':gM wggiwwf' mw,:Hg5,21z,g,f.w:1.' ms.W-wwwgwymgwwmsbmwfbgv iw M M :si N A H?31?2 'f?,?Z:5? wwfswfesffgwmffwfsswsgw his 1 sfwfaggsb -2 mm, Af ywzwrsfb 55152 2wm,:a:Qzf:?w.:gQ 2 q?,em5S,,,.::V?eg - xswcgsw geigliifmm mgwaxsw 2Q5gg,sfH?v::mfwuQ :wie-wmfu rfivzwm , mifwf-Rig mffsgmgw Msgmssws gvgfamsgqffwfszzmifewmgz Myswwra 1 .Q f2:gf:g2sQ 255255559523::553:g:f5::sy,3esg5g,i'smg,f5:myfzfgaggizgeggfqzsfgiiifgggipwf H - .. QQ' 52:29. ekifziffzg H 52:55zQfh::ggfff.2::gfSfz:,i?::'nv?te? - - V .V -V 1 wwf, 93,13 kf:gfU::,fs1'3:wfgggy.4 f 5155: ff 0QQ.Zw5f-U?:g-W Q. . 6 T. , ' , 1: ggsgign ,vZ'5gw,,g ,kgfvjig 51225 fifjg 2,5 5.453371-11.42516 ,-gw' QV 614954, g . .V::px.:,fsw:ggW, .uxf:WY5,:,f0:iw-wf25::wir:Msf fb?i'.?fSS5,:'5D5'3H ,. ig - f . W srygwggxsgwiisg Hz, :gig wigs ASS?fgggS:?::5.:5:f15N:.m 'P 2 Nia: Keg M EF x ' X- - ,- : xfssfwff ef mf:s:,z1f,:::maf,wS H 2, ::,gw5:mfimg H 1, . . ig , . rs.s52'H?5v:55-f'xwwfw:qv::zwf:?222fbif?fmsff32::5Qf2af:wi355?QQ, , U.. .., ,. .,,. , -sg .Q .A M W aagwg, .sw Us W ,gg ,QW ,it r s:sg,53iyg5g2gAS:Q4giQsgf sszgfghsiiiisz gwfzvxyggsrggfismwgwa y gwssg li ,, ??2k:5fkf5g25f?5Ti25a'5:f A-rfhfsiiggggigfggfi:5:5,g524fa:g?,g2::,5g?gg3E5g ggifgiw . A X i ggnfgfsg '1::Q5::,Em:?f5W:gf:55s2,.,4 Ms5w,.,e152Sf, ga 5 .1 ,1- 2222: f::kf65Ses0w'5Eq2sf5'a:fffQfssvffffzk Wwwwwizsqffm-fiiav fa' ,AW wmgw Wgwmwygfgfu m,,gf??g5gm,2wiw bfwxzgpbfgg - :- mass? Mbgsssgzssgggggsswgs1155225 '?v,:m:,::QQwssggw .:,:-,:.1:.-,ds ,.,. N ,,fw,ew.Q fm ,r:,4,.z4,g. 5, afgg he W ' - .... , ::- 1ifi35q1fvs5g,gf2f?55?'fsr:g359:s?5w'g55igf ggd3EQ ::5?5Q??55:? g gi?-?gfsg H1 .- ,ff:::m.P:':y3g 0 0, s.,,:fmff,.gfbQ :w , Q , wf5fiWi533W?::fQ:WVinymiwmsfifkgigagasffwgifi251:55 - Qffiaigks i ww f55sf:5g?5g5,ie2aggsfiffszggfffrsiiffrgg, 5525255 'A mpg gw.35'f,:w, vw yfs:.,ggfM5a:w55,:e fe rwilfsw Zz: wfiiiswsim, nwrswxgff 'f::wxfzs::Q::: zfsrbrmsq fwsifys W 1-fggvswsfgwf 5,62 swsrggm . , QM Q N Q W we Mah as A :gg pmgsfgmw ,U iypssgfgxfmsgfw:,:g?Qmf,:51ME:g?b2f5g agfwirii,-kg f f wr Hfmsf Saw: ,fwszw :z5252:1W2::fFS fgwwifwzsf wiswfggqs ssxzsfsf: K 22, cggazgwgw xsgisssfgizkggsfgmfffg214:31'sigma 55? .1-4--2 ., RHSQWKWW'U,S:2f55'QTaJ0? f W Q M 'D ' wf::gf:.:U551s:,gA, Q M sggiwzgygw Bm? ..::f Q we I ---- 2 1 '- Q 40 sf' W if W fifffr 2 ' :Z lf! ' V A ' ' H' ' ffffff fm: :eff .Q Maw Swv 2f::f?fS,i1z, f ' ,,, W Mfwffaime':wf:5'eM:f:w'gsgvfwiwzffwsgwwf T 5f,,f5g,fxzgf4Q: 'Q Q J E fafgiiififm 5 ,ew 2,53 , , K A 5 X Q vying ,gggzsiifm ?g5w.wf m,,5xg,. if 45,232-3giga,,yi, :,sfM?fNi Em?- ::6f:.f5g iss Q fgksffw rghfeiiw w w kg w m 1 wiwgffgsgig if? 92 wmgsfgggffsw Q Eiifzfg , Sf WS:fff2f?'i??2: 5.1, S 755352555 fm? is S::Na 523: 559: fx. ms 52222 5 Evwsfmffgfiisxig :r gfwfiggg 5i?,S:5'-'?5Q22,2i?5?i?:5ii5Y:':53?'? F552 gg fff- M 5 gf MJ: ff ,If-v'2::v'2 ,wiggw img ' f vw' fr-1 gg my HW Qwff , W 2? 'iw pf f 2' 22' Q gg ,::4g,Ahs5g,gy?9Qf2'ig?gfSE15 , ig My ,E af? 9?i::jY,fwfMf4,f'w5'fWi 9 6: ' M -f X ff W SJW: ff? i555gg ,fzffaiww V' 9 z 3125 QK:EEZ,5?fi:525if552i55g2'315 ff W ' 's QL U sm? if iff? ' k5555i?f?1: ,, 2 ,E 2 2' 2 if 2 Q aww Q M 1 0, QQ iffy? W A 'ff 4 if f S2 X If Q, A wil gifs: Y 5 :v55W4?2a? fffgwi:wS:,awww w:zfv?9zQ 122'zwFmQf f wg Q 1, If Q , :gw.a,,,k5,:,w Q U:-mkegmg V: f 2.::?wf,4ggm::w fm.zgmf2g5?m:M maj Q, h N55 S51 at lp U M a,,f,.,5'b:? ,D 'f view H M' 'M K 555225552575 4 gg,?f-'i2',:f,.?f 'zfffziffwqw ffm M' , M, ,, H W: k f:'UiE5f?1ZJ' H M Wg,fg55:m5J H, 31 5, wnfw JM, fm, M Arun gnu-3 v gy Q , W if We gg Lfz w-awww 'Wm' Q52 51 ,J fe' W , . if, N Qffsgfmgvw, 'ow' xy2'Z3Qi5af73i?255i5f .aff 54 , www , VwwfWwK5'z2y.?,?,'7fA255?Z5'w?'! '?2fe'Q2U3'-vw-fS34'I 54wii-W 4 H' Jim!-Ygiffffifffvfiw vggfwww if 7.4 wnmv ,f,,fmw ,ww 42 iw mf -gm fm 9 4 .WW . g v,vgp4f2q,-,?'f54amY1fenf e2?,f2i w.w,,,2 , v 32,956.24 M ,f H an 'Q m2zv 'A0?'Ad Y 2' ,QA-294vw,M 2,2 2g3ggg,,g,,,,,W,f,h. mf, Q 3' ,E fe wffm?Qgf::fga:: mm snvy q,,,2,gw,, 7 f,gQ,.,, E ww v :ff 19 ,Agn 5395215 g wif wggmzggfmfqfgfy F 6 z5ggg55'g:mss2::M,qff Y, ,Wd -ffwgmmffsfaf vfiiigffgiiiiiiiisff '5,:brf,Qf,::fy f 54 :M zzfgifgggmsighgybfsxge w.? 1M.5 7 f' Wifi' 2'i.2 VfQ1 35 7 :4fN,a?,?1s,z V , ,NJJ3214 7,,,,L, 3 fl , w,fH,wm,g1.,??f5 ,fwamm '.,wgW,w,a,fQ'-w,mf55Mmf Xffmvfvf, ggwW2:wWM.,,y qw: , qyszgihZggfggdszfmgfqzffb ' f 252, , ff :ymff-6fg,, yy-cuff fzfmffz-H i sgfggyzyyziizzyggggffgggfx qigmzygg fs:.vmwzgw0sf Myzsfsfgzf M6,g,m,,, . , gwhgwgff ,gffigggfg ifywi U, ,,, if , wif : f , 'f'f?9f 'Wf , 0 , ,Q ffzmig fiwf A M w5igg5f3gggg,45gf?,g1 vyfw pgifi, fiifbffqsgsgvfggggffifeifigifg ff ff' zfffffw , . 1, , A N, V x i Y x 2 x E 3 , 55 S E 3 , g 5 :N 's Q w 1 5, V A M n WH - 1, - f -W , ....... ,, 'f: :,,- , , 1 ....,.,. ,., Hmm: 5.,1,Wwgmw.w:mmm.s,:w.Q1f:,42ssmssseeaazx.,:ssssmmmn'ash 45,4 . ee asa, :www ..-M , vxsezm-W ,,, ,. ,,,, ,, ,, M...m,mw,m4L.. ...,,. W,.,....,.....,W..-,, ,,,, .... , , ,.... z 5 ,, 3 2 x 2 4. s E awww,-M .,.. : I?I .::-':.-.::r:g:s -.:': .:2 .:-:':s:-: -::'.-E-::I.:.' ------- -vi'-::.s.:: :, W . :- f ' ini '--'-' - :'f' . : :- - -i: gs:52-'::5'::'.::.- lZQ'Ss6'fQ5' f f 5i.? BEi?f ??Qm?5gw2 .' -E-'.5:Z::. V '-'- -- - v S12 3, SV SW- .: 51.:'g:.- - gggggiwfsiw a f wgqggklfzi - M .k.m51zi'zJ.m,,3AfV ysfggirzz, 32,112 i n A , wg-mg wg' L: ww ww 5 VM ,V fm iiigm '537'feHgi4ZAW wi? jg.-2E'1Zf1Mo5f'HgS.5?'4 dyff,-Sg5? ,,g2x, ,zigg-gm: gi, f V .,?V3,V 2l1?:GiJQgrfH-U2s52fiVwfi:::f 4SiUW? g1.s':::. :2 . 4:5 MS V x ' . W .. V , E f ' ,s,,,e,H'T 'Fig xg 52zgf:'2,:WQ2is3g?QSg.s5yw,e?i: gvfiicpiq asf-fa?'5i757'5'a535i'f'3'T37f:'XY 5bH K if N' A Jmifffm 55? qi W5f1s'- 2 :::w,ffxa:sw 533993 ?mV,f2,. gf . Qzgszs a...-.f ffgm, A 5,437 ,:Hff2'?sm.Vgf4mfg,Bvrwwfzwmrggwcfggg M ,Agffgwfsgfgsgwffgffzgfsg,ssgggffgfmf 5V ' H ' . - V E wfmV::,,Q,f:f1a :Eau param vim, If g,,Wmgf :W ,. .. A ,. .L x V efgggfc, Kgg:gmg1.v:'55 ':'ff?1Sgg5:gfg1-2'wf'4ffw53g. w5w2,:f3,5fM2zwfw:w21525 5?SfVw1'aV?Ee:QR ffiiwrzsbiinssfw z e f, Q .. w33:::1:f,.ff::?i22 f,::i?5'5:: 2Ef:::5Q5i'1z? img -1: VV .V : f - f- f Ff,z:'?Y:,Qq,, 7 - ,Qifff .IEEE 6' 'A Nw? aw' qs' :W ' SW ' s a y' wwf wil 2:2:2-:'- ::: :. wk B gg W, 5521355552: '-32 -E:' - V 925555 ,. 15543 325 .: :5fj.3 .E::::.f:' :: :- ms? ' .:' ,: Q f 2511 5fw2f53i?gf?2Qff5f?f22i255 'S e?V,J,1S5f's2gm2:,x:QS -2 .251-E 5:5'?1fs' -'E:'.:E .. 25: 25 wb . , S? UW ' -:':::::f:-' .I'-:i:I1:55i :2':i1h:.Zi -255'-.5'.:f-::5'.. A -.-. 2 55551225 539 :iw 'I'.2:. of '2.22E'..2' .-. 55955 2 V 'SHHEV .g:-,-5-: I -- .::..E' 12:25:'.:, 4-: ::::43-,:g.:2 -ww 29,3522 ,:-,g:-: --E5- 5 . ---- V:- 5 55p3e55'?Yf5iJ Q'?'W5-ziirf Q 'A ..:.:f'.rff-if .. aiQE5sW5Q?s52ff555?E55?55KifSZ ,563 Vgggzevfgg N22 2 4.1-1... iw ,af A Va 5??,Lm'??,4, :1 .,-V .s::g.g?::,gfjV545 ,. H :ig .... V .V,:g,, V Qs,,ES:?f:?sEf iirw :ff-2 1:.a.2.'-:'.:: -5 .2.2 .:: 2 -1:5222 - 5- if Y ' -:2 .:fQ... -5'55'--3::i ::-:EZ-2-255 x, 31 ,gM ::: ,: :. .Q -: -.-. -.-. , .... , .-.,.. , gigq . 2, ---- E: ...,. :gi . f -2- Q? -:- 1'- g.-::-2: .-..: .,::g5-:Ee-:E -:g 8 X, X bzf f ilw 1 . E:e42 1:f5f'5:1f:f E'. :- .V : ,f -.25':51 u Eef 2-is vi if Q,-EV::..wm,b..,w ,,,,mf5,i:55 M, W-lg ------ QW--yu W f -gf gmy 'fv M - 1 ywbw ggmfryjjln ' W W :gg2Q:s:5::::.g- 55: -' 1 'W giigzgf gg E'5EgM,::::.:fsxzy5mmfQV,i'l?SmW.wmaQwm.1mwm5vszmmM5ssmWWm,:VQ.w ,...., 2- 1 - - --:-.: :-:.:- 4 f a gg.:- I 5 5: g'jg:1g:g5:252V 5:g1g r x: 5:f:sgg:5gag: .. .,.,, V A nnu .,.. gym mf: , I V, V, . V f I. , ff f 5.-.:,,:' :E? 2E'.:2 ' X - 'f mg Li3'+E,.g Zz?4.iQ5w !ggmQ . Y I ,,.. w W W3f5?W5fE5:'fMN N gg i wwfyw V? ' H , f' ,, V i i V 5 Vf , was 5? v 4, ---'H-'M Mmszia 1 W'?swMw wW...VM mAm' Saw? W V, 4 M ' xx? g g, vw WW. . W ---- W-Q .M .g.g.,:.?,: .WW9-K,mg1 ..,.wM-NV .....,.-. - QM 1 , . , V.-,.,.g:-,fn-5 , 5 ,gui pw, V f V B A 5515? ,gsfi wg 555124 Q S f Z f ' . :2.2?: me ff' ' 'QQ 4 ' Ji, - V 3255 3' ,.. ::g: fa 3' X SA f 4 F 4' V V- .,:g-:- ::- 2- 7 X 2 1' l g Q 5- 2225 ' N, f i Q2 ,V if id? M ' QV 2 if fi fii? sffifgggi 5 sf 5 32? iii? igmi 1 225 ig 5 fear : 2? 'QQ I fg i ' 126,32 Y if .XV 22 V a::- f -'- V 22' 51 521212 -f gs V .iz zaef AV 3 'gg gi ',!a,E2iigHf, . 1-:1-ar ' 5 V 15-'f-: ., 'f f u Z 5 525 5?1,sE5g?,5l,?f fw Q E?'.Z.VEZ525Wi V y 'f Q Qi Vf f it ' f 2 EElfgg2 :12gf f: 'V f V A V, fiiim f 5111? xi V2 - If ffefgiaifav ig gg? ' 1 ' ' -5:22-' 1, '- v ' A 4, S W i? '51 Q Vw V1 fVVi:Vp H 5 H4 Zixfii QEQEEEQQ Q25 , gi sy? , 25229, gfgwgg 'Q zgfffe gggw Q gem , 0 Z3 f V Q5 2?:5a?r ?3fegl: 5 2? X? 14 N is V9 e 4:9 49 4.52 A V 1 V- 'Y . V , fe V-K f 1 2V-VVW W 1 mf M W ,gig Q .5 fx f i 5 V2 WSW ' fm , J ' ' 2 i if?if?5gf 5 ?i 5222 Els! ' V 'W ' 1 , 1 an V 2 ' M251 , 4 f 'W V V ' 6525?-15V M2252 '12 fi fi 5 H N ,VJ af wi X253 igkgsfgigf VM VV if 3552 21 X '??f7az,52522?5ii 22 V f V fi 9551552255 M, 3 1 5 Eg - F? 'W ge e fi ii,,,,gffg-QE ' s V ' E f ' 53 554245 EESEVVJV 3553-Vw 525 +55 V Y' , , '5 ffm 23 5, 291152 W H? :Six ' ' .,,. , X 56 5522 9 X 2. WV ,A,A .,A. VV V.,.V VV WV VVVVV V f V M WM wi 3 , 5 W W: ' V ' , , 'Q a , V W M W i if liif 551.1 gsm 3 ., V52 i, ff Te '35 Ze Q 9 fi fs 5 if is sf Y gf, 3 E 2 F ,gm ua . W ,,1...mum ,,,, ' - 'KQSSQ V , ?, , U ,ggg-ff?fggmgmiirgsxmffsi r msfwsswxiknsrmrpsffeb 5?5?ggS?353W?33'Wf'k 2222, Z ww , Q UMSTE M ,phwxmgws Q ,kbvxanw M ...Qzzssiggiwi 2 H Jifsgfgf., .. 5 Qlilfiggilflfz 2 ...M .ww Nqr, Wg3:?F5.3w53ygff: 2 ' ...,,.:gsQ2:gg355g5,f5f?S?W Y3'5if,2:q.,,.52r-1' 'f.'55?k 4 W,...:.smfzffg::g,: rgssefwsm N359 Y . maqirns fefzissh' ' ' - ' . . S: wh me- Nivdigffqgyvwws' f X . Wfww.,-Pgfzfisefrfsss, Hissssmimfz-W ' Q. ssisifhslfsfisiisf K' .,..,.,i.:z.fx:Sn1N4wg5f?byg.g fmgaw Q - Fiww H A .,,.::f: iff? . ,,.:g.2:3Sf' w New ' .M,-.-fvliiik' W. be ..ww::fc:s:?9W an X 'WW gsm.. .. wwrsui ,wma W wnxwsbiyi .Nasal-111:-mmm,eww-Ywsuwwwaxm A mms. ...im - .,:.,Q.:.ms,.,f by , M .Q N .. ..... .,, ,W ,,, Qfgfgguwf ESS 'S ,, .. 4' Q ',.Sfaf2W' ' 'k ggym M ., Q 5 Sims' H? Q 5 Hmmm' New mmm! H Q vm M .v E. M W w M W 2ms fussy is 'K H lwqrullb Q, wsziwgq M M5msg:.Lw:Fhf 'Q ....,.:ffrf:5f515kW Qkml M .W ffm Knew if My .N K wmv Q MASQ? eW.::fs55l.5f-if E ,5,,g...g55,::zmzz'M ,sa W Qs? .W WW .3 . fa, mmwwimwwu . W ,pxgglugwggggfgwmkWybgbgwwzv Q,..,.,swmss.5565.:.,,..5mgs::f::g:2,:gag:aw iifiviiifiigglfxiiiivmggfi fisfffairzsfr ffsefsssgmi N, 15 W Jsgggisggzzsigiqgggggg , W Ny.. ,.Ww,fM W-my www. m,wWw.Qwywfw fgfw- NW .wqqxfswmwn Awne-wqwwmm,MMMJrw-wg? if K : - S f:H::ai?:,ii,3'SMS5q - iawgafggygggwf Y ' , - A 539ff?T53?f55:ff5,V3-zzfm? f -3, , :Y-1 gf , H 45: .E S' Wi : 555 'K .gif . W K , V552 g? ' f '34, , X i ggfg , M Y ,, WH. ' ' 3 ' if W , iZiI5?7L.Aif'IF?3 ' '-Q,3QiqZQ.2f3Z4A 'f ..f3i.i,.:'S'5.5L K ,'i.5'.Z?5'T.fg3 ,wfwxzw -. M ,,3,'xzW. 1,2252-, 1535453555 , 1 E' .. , ,..:::g::.ffffrg555:,gf ,yggff fgagmssg. . . f'ffrM22?nfxmmffp5ggf:f:g.f:f2M?i5fs? ,N - ., ggw.,,J.,,:,f,,v555,,gN,m2wgfggw Mgagggew f:2?,2z,NWm.,..:U3-5 mm? . 1 f . - w. f . Ama... qw ,ggggggfipei WFS:'ajiiiwgygggggw 'Ff'2'!5q5'L f . , V xg ,fl - WP Q .5 2 ' ' K . , X 6' f Q' wry, f:21fss5:f::??2:,:t:f'igwgigfis,::::s,:f?3ifff'fWf222W is ' 4 L -X Q H Afzaffgffffffefliffl' 225555512Qk3??5fY?3'555'5?5g5f:55g'?Eg52g ' -f fwfr rs: , ' sm g.:9:asz4I,5g5W ww. m3f:5,s':::sgQ:gg, wg X q ,.4:.:,wf:g:::sss, fm?5mQ?,:s?M2:,:4:::53 .:1:srwfwgigfg .- --. A-Q 6 ...WW Www 55- Nw. W., s'2'z2w,m,wg5g,, .. 7 - .,.g,,,:s:wf24fzzibgesssfssifaswWSW'?5ff,f:.:1'f smsgwyslfiiga sg., Q X ' ., wm:,'::s5:s1,v.:iMQiqssfszffziwzsbfww Sfazm ,QSQS 'S i2144g 15: R. f .. f 'iliiiyzfr655553525111:sfmsSQii'5i5S5?2'f'4f5Swziiffh , T313 5:22220-W if Qm.,f:,::2x?gg?w :g,:S4?5S:ZZ52i'35? .azs- r.s:.2 1::efiikbs4525535?'1Q2s2'Mff?S?N5F9i5?f ?:.-::.:f5w:s.ea?1 s Wq N52 H w :e55z,:f5:gg:g?5fQs.5szzzggagsg 255252255zzzsziersigfgggsgggfxgfwgiy nwrgwagwybjgghgsggg ,:f f3,? ?',::,3g..ug qw 1-115 wgfwg 4 gym. -.-. r saggy 'iiliwsssam f:::?:.,5q: lszzgj mf 055235 J' giiwiigfg .. Q ,M M: :s.fS.wf .W Q, ' W :gm Wgsifiyii GM aw -:E-5-? ga -'-2-1-:,2-5-2-- if H' sf, Maxis, 'wzsgiiii .2-.:'.:' :-5- .:: r,,21?W3Q5ffSf35'f:L::::Hffs::gs:z ww-:WW G23 -..:..-- .:,.1-.- Rm g:::g55rg25SiF5S:2ii:::5gQgQi5gss gfgiifgiiigiicigi i- ,... .riwmxswa xv ,,, ss, fwzszfqzfi :g.:'.:5-,: :H g5mH?W'?:??w.Sm ,f3 1fQ1 Fix ? '55 f' ff wisigai' H W 6F3s.Qi:3'55f w'fW3WAf??2 - Qffizfgiigw ilfifi 2' '.2r 24 ' 25'W -'FE3' 2E':r:1a5:5:2:-E' rE'If 333555 33 'gfifi 5 4: as 55 3 9556 sf Ei Ei 2?M-f'2Sff2Q?fg:z,, 5329- f-.gE,.g.5-1.1- 1 :2' r:' 2? 53255Q?1is.vyggifxggmvwgwggqgfgggi i Jigbgg fiff 55?f ,5,:5i2 --:- wzwnwffmm mifswfmfgy .::'.g:,.., sa fZ.,Xv?QQ5g2'g55 .1' ,.E'.:5:i.E..-.:. s::agE12.2:?f2?Sg'g2g:iiR25?g gffsz gmiim gwi .1 2 SSN, W2!5?? !Hgw,.55?55 ,5:wzM w 5I' .:-. r:.:'.:iE'E2-:r 15 55.125322 !?T?if . gg ...... . :g: Agjgg g: , 2-vw . , ..'.:-.g:::-..:..: :..- 5 WM S'-1 .:-tram. gggiw .g.g .-..:.: -:-3.-.5-.- ggi 5? WL: ,-,,- g - g-33,5 :-'.a24.g:,:51.:,:.- , M'-93 z. an . ........ . me 1141 3f3q3Q5?5:ff:f5j :g: ., . ..-- - -:- f'- I- .q fbgisg .gr- - I wiixwigbgb ga- a:,E'1gE' .:' ggr' gf g:':1- f' f5 gm , Q,:f,e :aEs2s?2Q?e,wfgH Msgs: .- .':':r.:-'.:i.: -:'2'f-IQ: , 515.':f:E- zgol? :--:- Q-Q1-fw?i'y2 f K2 gw W W '- ::2:., :- 'f WSSTQYQ W X Y'25?7,g' ,g yy W' N -': - :j:-'- -T:-.::: :-,-:.g- ns Q - - gpg mfs: q sg55g3 g:9ggg .g:-.... war g: f ,,, 55,???5f?5 34-24 SQMQQ SEQ -ff'.f'1.rf-ff-fQf'f -. If-iff - 1 -' vggaggamggzgsx zf'KSig2225i??g5w 'fgwvgwgga Q ii-15,5-QQA ESQ ------- ' zi:a':5 w-5932? f Qssmwff 2 gf:e:gf2 gMf,W .g.:f ggi? ffW5'lisS2 fbf52Q?E'5 1 :1 .:::2-.:f-,az g:.g.:fs-fu We W AX M fg' ww 3: -355653 - 5:-,I',:-.j::I'.eg- M. Sis .. . ,f,,,..,,,.,mgQg-5,f1g,Q ., .,.. .. .... ,,., E1 53 .ff2z ,g? ,: ,... . M.: MF ,Q ..:.: : ' gf2'55 i,f?:::s gmQQ :fir 6hg.W?Q:wgg.g?gs:g3g 4 Aqsw zzfzzmfff m fggg g... ff zgwsf -2 , rfggmf 1. .:. :sm Ewwfg mepsszffg sssigqsfw E555'.X qX5em4,g ,3L'si? w12hi M, ..,,.wff5.fe:wwQff:w fgsf f f. vzsgze - .:s1:1-.,,1 we . 2939.55 ywfwgiwwgpfffss A ,Q .. ,f ,qw Mam ie WN .. ,W Me tz W V' NM.-,-wiwmged' M Wie' g2f,,ygg?s:fm2: 'f assi 552 25 if W gg Ny:::: :55S,4w :X: g'efa f3' 5a?i A siiZ52S5Q5S5f05,?5f??SWS3ii55 4rrgf,,5Zfg?W'f::, -.,::, gig fm Em efgsg ,,2S,f,fgfyEg Q55 I, gi:5?::25:z,a:f:f5 omg. wirgytgiiffggffiigizz? .:frig ' E1E . : : E 3.:- is Q 3253 .,,,..:Q.,ssbazfszsfgfggqggsggsmgfzzswmgwffffff:,fgym gfgggga-4 :g,sg.5,., ,WV2.4,.Wf::z:z3?,q,:,,gii?:,f5Hgg ,3w f5?,.,.Wg,D.g4g g,,,,,g5,35 fwwf?52?5:55?f52S2E5f5fS?55?:z:, 15. M252 W Qffik, f ::Q,gr,. Z f M.M,.,.xg5Sfmmw5 2 31w5f2?WWf'q:ZZZ?5:5f7x ? kin 'Jim JMX fi ,af ffanjj Xggfgpiisfsrswzifflvfwsfsiiafiaigfggsz, ,,,mG'g':511f:2g:g'Z2mf,5. -1 Q, lwfwgw 3 fmx izwg' 5 A-.gr,::agg::Q,,:g35s:Wwi'Er?f? Wm f-g.f,:g,w sg 3w:::1?s::Q,, -W Q1-W.Awww'fVwH:.N,f:2nfrw wig: 4Ef2'wf1,wa M,,:ggf,:,:gq,,.W.,.,..,1.msg Mgpwfqgggggyi ffm, if f,2.1,a.,M3?f ,fmEfQ'ggqgggghggssswssszyiv .s2,W, pm 2. 33525-gggzzzmgfrfzss' gagxfL,v,pw?Qs'f,, fff,vf:gwD'fz3Q5g f- wig, rf .,....zfzmff:::s:ss::::::s:mfff2f52fqffffffm, ,ff-gf ,552 .Ig ma gmxzsff Wy,awzgmffffmissgggmfgflhaggssiiggssfsnzwszf rmgwgwfgfgfnrmgrsfgwzszffasffisfyffmga ,::,2Qgmff2g- ?fgzV5afg..2 .-.-:-.: Hieqgygmwg W.,.msizgzxg:e::z:g::.f:::ff:ff:NF-'ffiffi 'wffwmzzw Ava ues. aff:fifff.:rgf5nfs:asww:wiIgfwWf5E'?fffS':b':, f2fSg2??fQifii?-Eiiwswffwf 1zs':w::21w.2f22S2Q?'WW'1Skf'x.:Mz:s.2:25A11ffSQ 553ws: ,,' 2B'2fg52 '25WfyA5fi ,, .gpm,,YWm..WfMwwvw. -M s:,:g,:.J,f.:g.f fu: W-Mhfgmwfvgfwgwszzaggzg ,f,.,:sm22 ff, wgwrfa,-ff s.fi5z,,,:.,.,W gg-fNg,:ga,H:4ffWMszQ:, f5'f26wiQ?f, g,fWi 5 Qfwgf 5 MW f vf,?5:::g..:Wm55f.::5:e Hw,3. ' mf: him wfmww W iw: W,,,m .rzmw ,saszfvsfsagmsmhw vy-. LD wggfgqg.sSf-'fgaffww-J mHsgwg5'ff?33?m wH',,,:i'fl jgf,,.3w!NS6f3wwww215313, Lf,,m0f7gvm1ef 1 ,f,41Wg gfxiw 2, gg Mer. ::::::m2::::z:::s:f:: fwffgm T.?5P,?5,1Z3'i?SEi7S'sZ,?5S'f3 ,f5 M55 . ' ,,A.'fw5f.x:::::.:mewas'wgffssssfssffwfgfiTfs'5 Jibiffi' fig:ifffgsgimggi,f,'.5.,gggz::fr92f:2f:fe::Sw1-wgxgw,gg5.ggfzfzKwikf?,gff:s:?sie:?fM 522,5 52 12 Ei gf Mzzpfs.:::::zsf,':q:f: : h::?ffmff.::..e.f.:2f.f55, wg mass.-::::.:::.:3s:f ww W fyzffer, ,,:,gsgzziisizwgpgfgzfsgizffffffm:ff12fAmf4SSf555'ff .swim,:.mfz:ffa':f2ffr''iff1fffzfswQ2F52Sf5fwff1:2:,J2sesifG,mg:egf.mff4 ,ay.ge5f2Zfi9j, 95 Qsgfrwffrwsffggyf Q :g'fm5:W'w A' uggggggugffwfgggfgsfggwggfskjffhm:1 '2?535355Zgf 22141515522 '-Z24iff25?f'??if'. ,,.w2?fS5f55fhf?2HZv,g.fzf:'w?,gf f um? 5 1255, W M w,:::s'ss?12 l27Efg9fSff? 55 ff' Y 'M' z::f,:s:,,.2tff:?',df' ?42i:f:,f,ih:'4,' gi:5l1w22f2 2f5f551ffvgfiwd. i?5l.3'Z5wA5w wfigf:,:,15xLf??Sff yi iz? ' 1 if ?m,wMgw,, fr.: www! qw, My fwhf-wwe 7 fs:gf:fwfvn.s. ,.'5M.'wy wwwgqgibhN9gwh:ff4:4:2:f:U'f.fw2sw,N,Wg.wvfgsvffwffgif,w,.'ywmfmgifsfszigziqig ZWEQ, :zum W ifffiiii' .1255 4Qw,'f5hfI2,?'sA, :::,Afw22'V , w:::.q54f:'Wf?21lGf5H3?g f5ffMf'22l'f Qiwffiigi J' fi,raw..-:'2i2i1fyfflfffmwxii ikggfff? gi 55221555225 , Q 2MPZ':i?5,'fj5?3'? ::.f:,g:,:,:,iqf:g:: 2 4w?:s,f,5f,yg??f:.Emi:f'QiSff 'gWg? ,.L,sfwg2f2g?35 . 5 2 gig? ., 3r3?3li53'?f'l3fWi 1,5 '95 4 y ff. f rV: zi.fz1:Q4:s,sf24?gV4f2vig?61 ,jgwf f f? lf, W w e F 2:6 1 . ffswb' 'fe f . my Mmenww ' M525 ff M+f:5s,:,.,Wwmwfwx-,fxw 9 gpxrfisffn-v' If ':,Wff,fZ2Mw? ,W ..-. :-2- ,A v i gn W ...Wy f . .,.ff,. 2' ,. 2? Q, H M 24 wfaggwfggwigffy,2552?,., M.. My -M f ww :s,?:5?22Z4,:,,,,fwviQ. 11: ffm,,mW,fffwq-v 4 was 4 ,Q Qgx 4 msf .. . ,. N aff 'Q.m:.20:,K:p,2s. 2wrff-, ,X ummwgfwgg',xfrfg:g,: .5wv?w,fW fvg'zQ:.,imf.vsw1Wf Wgwaf' 1, 2 .,g-: S K' , 1,::'j'ggq.m5f:f5s?f?E?ff ' s5fzf:fffg?gggfQ?2z52 w wggz kg J, ESS? ws.: 1f1'wf5z2'??f:w , u2? fgev iz.-.:'12- :M If 5 my .f ..:.rsz.:.f:.fzf,ffy Qf, germ. 1, .afq55:,.5s:::.,5e?ff:fr1?zff:'?2f,s2'24f2fw::'::Mi5,52Hffwififaffyggsfag,4vw:,:,2f.zMfw2g5figgWa-if-MQ' 5.E:':2.I2E1-I 2 wi ,ww .mmN,, ,Q 'H 5, H M, ,,3fm.m.,.l rfyfhmgggh wpwy5wgggg,.,:m.,Mwww ggmg .,6:.fff,,f,ZQ,.uwwmlw hwvg w,,1y', View wg... . , , ,, ,M,,,.,fs3:i.,mf1,z: ...wwfmw 209253, fzvwgyxdgw 'ff5f2?i.,y3,,g3g,fgM?gf wg H - .ye g 5, 2, ffwffff asf' 4..,:.,,g:ff1::zf,f,wf+ff:-vi, ywwgmw:fig?2,:::.W::1f,vfm,fgf fii?i,4:,ggzQsg::mff52.iw fffwgmw ffzza i -1 , 1 fx :sm fmsfzsfffxfwf. . H n5g1.i,f'z'nzfrfzmf?25fwiSf.2m:5Hwfgfzzfrff?msff.4fKi6f5wM?w??wf'1, 3' X Ay f 2 m,,51z.,s5fz9' . N W4 ,.wM'I,5fw5.f,34 fUyffwwDwwgg::a2f2E.,:. 6 qwwhggyggfgysrg,52223WW yffzgg f,fwf:,Agf2w 4:5- , f Mg, gg W 52.245 4 Q :firing H ig, 3'?f2'f,32gfg,gYf3'f31gwwzm3L55:5'5fffh?f'?' gggggggygffsggggssffgg?g,y,,5fygggg 35:- -e f gg.. 2 .- X Q ,gf 5555? fry QS' 5. 5' 2222.255 ,gig-ix 5 , 'Q f::g4::3 ::g 1959355595 N555':'.2Z'M.'gz',L55155.33gizszygifzrffwgfxyg,15V3.z35,ie2::,gfzmf,.,73' gg 3 5g7 ,?f?.s71.., g d? ,img SWWT '29, 455' . 'Qf'fTV?f Ks' WN f' N' 5 '7 V ? 03 9 0 f'W4 f A5':fv g fl'-'Zh Z 'fi' LT? ,Af 3 95 4 4 029114 2 y,,.l4 fd' . H Z-' . 6? Wi' wing 1 . f gif? gag? ,,w,ff,g 5 .,:5wff,gg2'U1W,,..:,,,fgM5fQ:,g1 wwe,ig0fg2ffg.g:Wggf2gi2?fJ:3 yQfF1,1zfg5gw3.w4. 35 .4,-:gt gf 22:39, we 55 ',',2,m,M 'g , 75.:'r:,:, 15221 faggzggg fijfsfzszflwfgzfiziz 4:wzffweiws,:.afff2fw2?222sf1Lf:M'ffg2v' M522 fm , W if A Elegy, My hgggllgggmfggfggvp ,g QW--.wgygw y,,.v,i. Mwmww13,:Z,,fw fh5gg,Av5g,,QMMf,,fnfwwiwi w5?Z5g H:fm2w ---- K W,ff?fQf2 1 5 wow ,,i,w, f. fi YW faqs ,N wwf Zifffu Zfffffwz az f2'ff'55' v'ff':1f??'?'1f fi- wWQ4f+'f:,?:'m-EM fffwvffw' 4f'fffWEfz5ff Nfwwfvwffl -' gi 359 s 15.3 3 Q 'f W A V X! ,4 ,ff ,m,,,,,,4,fg.?,-...W M.,,m4,,,.,,,,,,,,4,, ,Egg www -mf,,yWgfQgy,,,wW, ,Z,g,,,,f?5,wMfW96 wwf ,ff W fimwffwggif 45 fag 1:-3-3, wwf' N. gwfaow K 'Vffnf wwf: 'fm -N, fzffkuigff HW ff A wh-ffuwffff' fixgwvf' Www 1-2. My M , .5592 wwf V: Biff, if:fgm.,,:Wfl:n:f:ff ff .g7gQ5fg'5,gzgfffmiw Mi? ,ffihf 4434, fm gtfQfzf .:?2'y wif , A : 1 'Q ' :af X, 1 .24zz?f': ' .1 WM' 'f N A .wwf V ' 21? 5??ff?5?5 ??5 fff 5 f Vi,,M:..--'-- Wf 'f W' wi., .0 2.WLf,,g3,yZg5,3,2f,w,,Q,MW gf3gfgg,::4,:.2,2.:,g4,.iggaggf Mvgzmwf? fywg' ,ff iz X369 E., fw3:g4f,,,z.ffmrs2,,wig, ,,: ,, wifwsgqfwwfwf bf'-vQfff2ff'fL QMi'if,,'422 W3 f 'f'i2f'fZ 5 ' lzzw :Q ' flg'A fff 2w'?SQ22?f?fw.Q5iffQ12ff fm1M,gf.w ' WWW' wfgggf gg:2g,f'6 yy.: r.,:..,2M,, vfwgzfzfw mxg,X,,rg,g5y5,2ggff2Ziwygs, mis 2' gif! w1g254W5fwf19'iffA2W3W'g',':',g'g2.::I'1.I ---- : ww 555, U-Qi .,,:M. ,WMM-.rw ,W vg4,.,,.,,,,M?7,.,4.,.,,g ,W N, dgwffv, ff? ff-1 we wel ffifwfffw ,. y,g,,, wk? , V ,M ,Q h,,,W5 ,f J W , Www, M,,,Wf,f...f,f,,,h,,h, ,A ,qw V ww ,yw5m,gg0f5A2,Mfffvwfglggfg WM Sym 1, K Zizfzf vs. sg'tzfzzzzhf,,!1i5fw'f'.Mz f' ff X W' ewMz'gP?5i-?'f54'2f :fx '55 44 ky :if ev ws. ,,,g,,4,n A, 6 f ,mm ff., fnfgfff fwfmf saw ghfiww gwgw,,:fgf,fw. b,ggW2gg5W2,f ,,,MM 532.5 2 mf., J .43 , ,zwfmzf S,g'?2f ' ,e gzfzzvz away gifs., g,,,mga, W fwfr 15:25zfrwffzzzffffzw,551421923,.::W5f?fgz., efZ2vwfw-if? ..::.:.,.:.:- 'WEQZW 53303 We 2, ,wwf ...mf ,flew fgfs'fgm,z:: 5g, 4 5f MW Qss. . wfzmfwffffw ,4,:'2fz2f2421zfQ?:kf2z M225 , 2?'22f5fHz-fz W Nggfzg 2 :Jaw Q, . , 73g7,?:w.5g5z2vAf5g5ww ,fQw.W'M:mA, , Jim? WW ,,. Q ., .,,6,,,5,,Wg..m..,,,,..,,,.g,sg.,,,,,,,.g, ,wg N59 f :4:ffz'gzgg5 ?02,Q,:.:,g,fqf.f:z,:z:, af .:.-.:.-...W gf ff ,Wg -hu.,-1,.,L , f ,www W,,.w,,q .Www .-,s.,:.fgf- - fpsfy V' , W M52 ,,6'25:::f2,:.zg5fv+wzf:,1.fzf5'zzsrsfbgjiisw-'ff 55:21 ,.f Qsgmw ff W if :Pg uf fs 1' fir ,, 1 fMz:f5'i5':f3g22g532222?Zf4f?b5!bi2,?vM2fiffff ' , 5: . MAmwZ5g2:M2:.em5,,Qszgqgggggggggim A ff ' ,V,.,Z,..ggfgg:5:?::Wb1 lf Q W. 95,,W Q, ,-,..,,...,.,f:z.,:z:,,:z,. .g gsfw gawzzfgxw WW : ww mfg w0gag5Z?s :2:-.,::.-:- W' Qwgy 5 M -1 saw .Mf,,::i-Q51 5 5, mx' asm, Lqifff' g5:V,.,, 553 .V www NMA 575572, JU. ,hgmgw wg wh, wwf' fgifiik' ,.:ss:4:4'w2S5i2:wg? W MM fm Wfpw. ,mm-. WW. g ,fmxfmwb fn 'fab MMM 5 wwf, zsggzzeftwfwh'msyialfjzvfwf-WJvxwiiisafffefgisiixixf'ER 4 mmWfm,,,Jhuf,-M,v,,L,mW5q,x. V m,4f!.V5w,,WU.m.m.i,:m?w1wvwmzwm.'mewwm Wm fa. ..g.,,h.e,,U1 A-q.,,3,,,,,u A-' fwQh,w,,9 Lf. fynxzpwwggygah Ar-'-agivwaf:M,M,L,,, 'ww'N,,X, V 'igfggwfffffiZ?.f,':fyQ5pfr'Q'::ggmfJfsggmw,smfiiaiiiifiiifhmm ' hfjfffffg WW, grgiff' N mfs: fyfi- Trsgggfifffssszzzsssrfg1555551zsgfsiixsizfzgxfgifszfiszsffffAffgffff 'affih ffm' 35+ A 1555333514:sg5:35:35:swdigg:gggivggggswiiiilzsffSZ?2:s3afwi'wSif'f:Wa-'1 Wmsqiegggggzggmssiwsszzsg H Jfwf-?fs:::gwwf42:e:s5QS::5Qi5??Z5:5ww?wm5223:?.f2 'wfmfligssisfizwwwZiZf???::f:QK s: W .Huggy Wzgggg,Q.::j42,ggfgggfwffgg555353gggifgqiizgggggfgljfggf922125555M5525555551:ggwiff ggfbil rgfgyw5::31a3g:g4515335257Sggsggswiggfggffffffifk fgfgwg W ,. am' .gfmwf L..,.h:.5:fm3.Lt5, Mm-f2,Wm,gg 45m,J,,,w,5:gf,.,3.3:fw.,fwD, .,g3gfgUf,,yggw ,3,wg35Mw.m,::m4,.aiw.: WH I Mgt M,3.,f,,.,5 ,,,Lm5J,, Wm., W,WmM gawkigfggggmfgsqawv.w.sfp5i,y-.,,,,,m,3y.,,,,,J5-Mm-Q,-1.,,,,k,0lg wwf, Ngm,,,,mj,4v-fpw.sm.,,gkwww, 543551 t . ,' , N57.a,y'54.megMAVMmmQgQ,.W,m,m5wgQpW,,M,Q,,M,,,gzvw.,,W.,,,, fmAW.h, Numa 45235511v,,,,,gqv5gmgQgggh.mN,mfwfg5m.m.,flwgm . 2 my , A ff .WWM.,,, ,mgwgv ,.,,,4,,,A3w5QM m,Mm,.m,,q3y,w-my,,L,UG,.g,F'g,h,,fgqf-..q,,',G ,vfm3,gv,,Up5m,x,,,5:g3g42 . m.,3,,,4, bww, wgwpm-,f,vggffgf ' my ., .:5gg,:gg' usemywmqi. vmiimggfgfswp3,:,4w?52v?g5wefm.,jggwgf' h2m,..L,t35',j,ggffm.5'.m,,ggggggwmsgmmsg?3?5SSZ55Hw3f5?5Qwafgiiiw'wry' wvxfg, 1,5 ww Wmw2,2:?:?f5:H W av-nwwkgggilawfsmifww ,5Z5g:'fwm3ZZs:f'Qfwzi- Sf ,-www 5333523XswsqwfigikZSXEBSEFQWQMMftffmw ' HW SJ WJ, 53,2553 ww qisziarswgmsfwy .is ::gggwfq.,g:522,:2w,:?33:::5W1QxZf::fg'qwJS4:555s5,5?5:ggW:f1-YMQG22i':i3v'2sw?f?:Qfff'1ffD'::f3:f .liiswiagfgngwZZSSZEM ww wf'HSf'.f ' wmrffwf:mfgfg5f5M0,534-:WQFZSXZSSZQg,w,Wmfsmfm:2:sZ5ff:Zf::gMfmwf:?9gJf?:5 ' ' :gp N afpgwWSssszizzm::sggS:2ssvMV5firzfsfD A 95:55am-JgfeaipgM145:5:53Xfgiiifiiizifgz-wwfiiifwiifs3:53:237fem: Jfrszzg .igggw fmifgg' frsdgiiffifiifff513255-1-Juli' asiirf' 5, :il mwiifffWm05,51vey12w,Q:5,.gfwmhfjgjiffrwfwWVffmw 'NWN fmbgig Hm1.w5:5W'fwQP'5?mWKSIMM' ',Jif Mg, 11:5 .N Sim-vmswmgQwiifisifglgwii2555555'Www-fzfqfzffg uw, swf, wgizsz' 25?:wHS' 5?,35f:5m-ffifffiggf -ffiiifh - 'Q V- Hmfm. f-ww S? v.gggg,gf5M:::gjggggmEmmgfgygmi. ffxgggysv -,L440:,m,g3ggs. 1gigzggkffhQgmsszfgfginffg U,,g,fw: M , V.pffW'Ai:::gghff 'iff' ,A J fiQ?f?2f?J1: wwf, 'pfggga 45555155GigZfmigggggmwqmiisiif'yjwgegsgg Tri: ' M 4751: ,sis-Z., f' , :hs fkwfw VZ, fW iM fin' 5523? W'H3:vi'79 HP'-'2f:,ZSqY?'Y ?iE w5AS 3' 'NW wi wLi.f..L.' -- Q vw- :ggw5M,,::5:::LW,-.m?SbsQg'2geggw?:55:gsgMW,:.fw:rgfg. f :iw ffm, f . g 1145, ww fwglifffaqwwwv.2:??1f5gwfw2N::J5?f'fwwsmf h52 f7 'WM A il N 5 ' Mfi fgmwazfzzwgffvwfwzffumw+2f2ff:s:.::f,' 'fm ' Q - H 1. k . g5w5i'L'hf:::, 5,-f:?,5f11'ffhf:s:::h Nlmqgn, U - fffmfyq ''::zsszsaggwlisfszzszffgsf - -- N U: wiseP21sfggggggwiizliazffwgfi in 75 ZgfggffwU,.,fPw3wwwfswshnfifiifqQ'H ffl f eg V'?W5:f:ff Mw 'Wg2fw'm,Q,.s:,2f M f f, 2521mmw,f?, Y F51 I 'G W' I ' 5 W' K N41 vgffig- g, Jie ., if S51 iiiliiifilwmfwlfw ,SIMM UW? W Wyms-v-fwtfbfw-vw' in ?g5f3'f5iPV ' iff' H wg, b 'fffw ,giffsg ,v2?S2Sm:45??5f J:4::s.1: gfiisgwikffiif . :mi 155442535 viii' ' 'U 13152 Qiiyglzl fx: j ,Mmm WMM fm I 1 'sf WH Aww J , 1 , ws - 3 Y , N 1 - , , X 3 ' ..,:. ,, MmUs'1Wx2 .www ze' .,,. ,vw9ia'w.1?,?'ggjQg5f3gQmer MMM' ,, wwwfzlfzsfffffffesfv 145 W, ,L-Q Y m,Mm:'wewJ- www, ,- .V 4 'X . www I ,M,.Q.,Sgghgggfvmmmv, Q G lawn-fW.5,f::::f5 - - k -V ,- ,,.m.f:,fwmnw...,.WM.:'Wf-W 1' war' fig -'5?5?'- Lfesrfr 'm....mw ---A - - -f i S M 'L ,yr . g:mmwf:3::ffM'h 'A VS: Sail, , viii: 4533 fx- .. ,1Nm,:S:2a?i'52f: 215??ff ' 5251 A-M533 ,Wm M we, vggggggggwwzpggff-h..M 'W M1 - f W A , if sm: ggi: , :Seah U' N ,WW W wwf, ,mzgf wwf M sssgsggg wf'mmaef:5::H M559 ms. fr A5551 Mfwwf 6 'L f::w K W, , avg f::::, 5555, mm. H: wgg 2535- k 55551,f:4gL53ggU?uf3JS?S:,::?, SDH 3 A Sfff. :HU l?25s3:i:::g531-fwyfwwfksA V .IEW :M Www :1:22sI3'vf:5g3,, 'g3,g5::.h M f fwzgasy' wsiggggrs gf w5 :s:m.E55 ?F 'D L ' WQg55gw,m,fgsimmgrszfzsffiarfkwiiifiifiifgmgy X. ., :ff V5 ft K A 4545221 vrwgwwSg53S2:2,':5fffzzifmwmv.13:55:13: UWM .wp mmzwmfv S2425W1w.25::J33:'f:?5:g5 yin: ws-5,3 'Jazz Zigi: v hx? wisifegg 2113: A v4 f?.i5Qv1rPaGW wwgmffmmzg f-memzmassssf'wiffggsfszzsmffzza 'wmhsis' WM v:,f,wr,,,,L,3g5W55b,Ws.y,,,M,m,igggqa3q MM,,,,f,,,v5w,mWf,,Mg ,rfgfvww Q gagwwmfwwr ,ggw,gzgH,4gMm5agm nw'-sqm wmiv.,,f,w.gggv-W V WW e wefmwbamwg, Q15 gy My wzhi- gw sm w.Mm,, 4 WM agggwggwgiszgsyikaf,,,,g-3'f7wwm,:f,K:,?:ffffm H' 5 :g,:'-:nf NZM fzivzszfimg m.:Qr:i,6'!'E?::g,zf:Hrf'Y'J M? gsggwwwk M - Nw? H.f'P?sfs3?f255955f5 Sgf is ' 'W K 4 wfsgigaswfimf 3 Q H555 Q 5 , Q Wyre. U ,E R s::w.f.fz:mawQ Q, 9 gggfggvgqwfsu ffff-ww N1-15. 'H ex sksgwfisgf .gsefiggf5g:1,'5S',?3ii351:55 33f5N5SW Q sggigggggasiiirziiim was 32 wow-Q35 . M A ,4 j??SS5Q?3 . M.D:s'fa::s?L??2?2Qrf:::::::xwlgifiiggfwz ff fgcswgggggggvfii?fifgfisbfqxdw 0 255 550953255 :-: Siifigggew 5 g5m,,,m:m 4 M Q1'5Lw3-zgvgipm K . A w W. Q. W.,,:2zMg3?2 6 U .MSSSSSY 2555557955 WMM' A ,..,g ,,g, 35.,mw,u U -' 25:59.-:ffm 32 Q ,effgiggg , ff - 'fvsrzaifiifiizli-225539 i maggm, 4, swim , 2 wmv? We 5 M if 3 1:1- --Qfggassgzifsfss 419 we U U time , as ri' m,.,.5,p 'Sig , . wppouwapiiyg ' ' . wwwfww, '12 Mwmqyf Www. ,,.,:rg:v-IQ mm wimirtzazbymfikf' ,, w2f3E5:,,fffgqgy?2z?:R BQ . ,M Q, w5g.f,.f,:W.gg,:H Q3 Qigffgggkhhw,ssmvzfssimw ,V X lggwf , A M M .4.4,vig?50w 52255551 N Masssfggw Mama mmm 1 kf sf mfzzq 35352: 1 F , m,51ew.,5qW,,5'-w,X:i-gfgg gr1w3f?y2m3?'1,K ,jgzngg 55-2 My mm ,, 3:gyWVgm.,,,.,,a, , iagwafssgisiifimsqwzfsesfszgsg2fifwfsa msm A57552f'7w55lf ' f 25250 gpm?M32:mia?:73,::::a1d:Wrs.zs'M:fg.fwfgi,gHificszsis 43555 S 52? 1 x igiigigiizissszmsyffgffiiwfwgggfgfw? 5 . fu i :A:::::,4:,g5f,gg,g - frzfzffgv 45 55 15: 2 5:29:54 ff 5:55 25 I ?::g::r1 ,pfH:v,ffyfmmf5,5435eg-12iwffsziziiigsMgw,sh,2Q5f:?E:f:ff H -Qfmi A f::::f: 7 2 WSf2?5f::Eg::.1f ffffwsf. H: .LV-iw' . gag: wfgwisfszezszg t iseszfffqgmm, 'fsfffgg gf?wg2 1fvaz::::V 325151552 i 4-3:gggy:f:z:::: 5? A fQ:::: X ,::S:f:',g3ggggf,55Q 4:.:::22:55mgfS22S.I5:wzgzgrff MSA , Wsxfg gggg 1 T235l3454I:if 55f'fgif5I'323?5?:j 5755317-N., Fifi, , ,fzfwgmzfg 2 fzg,efge:2fgm22:21,:4ggiegpfw -5:22.14 I Mfg, fgmzwfgiis 2 ff::sgi.'-' 3555, b::s::,g ,525625ffsfzggsrzggfilifffiiysifzDf2?t4S5?MS2 f f sgzggiigfisiiriiffi rfsggfifirrfsy' U 'ffssfsszz , fx cgqsasgmiiifir 5 wpmfftgzgwggw mga.. WM ,M:5g',A gwmwW,g,:,3g,:ggw'wmwsfgwg A fi 1 '.f.7.3::,jf A 1. Q Hsin r, iff1w.e'::1afss,::f,:?S2ifSifwf:f:Ef,A Y iff fissi5::?E: 1sBH?::w5h53'?Q22 fggsf- V hffiigfrm W.,.4H:QgggsffmviwfgsfiSgmfggggmiew 2 Mm, 7ff:f::::::, fvsszsfwiif -ffiriiiii 1 ?5',f16s..4:V-:wwUng,iazggsgggqwwwmzsgggggigggwqimsffzjggwvvga 5255? 'wwf 1 mvMmSsQa's::s:fwmWi.':: bf21fQffwmmzisqfw-fxW-JSZQ,1 WU -Weisz: E gggafgigmqfw,ms2:pa?s:ggv,mf'sQ:::y MN, fwffsfvgf flgiliiiiif , ss gggkgmfwffzfss. :mimi 3535915 S Q' 5S?i5SJ5Zif5?5?g'f?5iifiiffiigffgggggffmf wi :?J5'1:w1:A:,::m 4 5 f55gg::::5 a3 ?5f5:5255?? Wrf::5,1ff:55g '?7W5!f fff I 535 4 ,Q :.:mQ s fflggegwgmggggsw 5 favs? 5f2w,:,ssig,54,,ggf me Q- 1 2325, PM 2 muh MiasfzrsfzifmiisziaMLfyvnfhyfayissmzewwmbgni gg f A ,250 My Qgmmgvggwqggywfkmwg Sirfgigfegwwsw' eivw ff1m3?3?2?X 'f 5335,153555-?wf:.Lfggg3fQfsvsrsnimQwQsgss:fs2'g-55:1N255 3:vfv?xe f- Qfiisw 5 2 ,:g::5wg::g:5:fW5gg?3,?fgsggsgggmgwzsmsfgiggggvf 2522 ggaffgxfgigwxidfwi,-is S ea Av www :Q M 0 'A ,N 'Q ak 'si ww QW :':z,:P .Kf2:Ff?fi.rH 0 fs 55555355525sS?siQg?25??35g2gWi:gf5-rgsiffrfffw4 ,V Qmgm:fggssmssmgggQiszggszsswgwwfwswsisgiw' Jr: EZ fg iwsriiwfm qw? swam sgkffiyifhfffsgwm-6hffwsmwws 2 3,,gEgw3,m55,w g,, 52.4, x,3,M.,,,Qggnawm,,,,maMmW,ggMgMW. W 6 pgggbggigixmgirasiffliwisfssffwgfwiffweszsg2552'3222Qwg2sgg2f2f5 sz , 5 siffsrfgffQfgfsssfsszsfgsifw ggi, Sk:fzs223f,s5i,zg3ffwxzfsswffsmr 5 wggbm.msslwgg:wgg,g1wm5S?1g4g'1,gw Qmgmmg gg'-fgg,wgW,swz:: f aw W K 52 ,gbifagw gwgfxsgi gwgfw sw Zsmv rfGMfJma2s.'hfwfw :An 'J vmiifs fb , v , seg M ,W 2W2,,wMfM,, .M U . M ffsiwwfp ,sive LmM,,f:25:f:2:gww?'m gsyfww 25? 1' M we ' WW Q .1 D,,, ,4 N M- , , W, H gnfg, , ,, M , Q ,f S 5 ,z,,,31mfSS::':3sz.s,:geilfrfmysff Q My 151529 ssfaszggggsfazffz wg gs gg ,wgfgsgls 0 g mggiifgggfgggg wmfgwgg rifkafgyfg gifulifigzbgf 61,5 522 i?'gj5,fqgw5Q3.Zf?.,22g S: Xwiiiigfiig .sfs:::5555f5?ff if FT ffzgsriiifwss X mm.w. ,.,,.gsfz'2H::::Wfmw3f222,5g ,ggwmfzgzi xf2',fixfy.'gy:w5Q M. Wmii PD fQ,:3::,::s:3:52Q Iggiw yaz5m:f::ff ' 55:33 221' 4: If WW vivyfqqwzesaggwafwnvx HIS Sitiszmwisq ,503 31 W 'H fe 65235 :wh We ff , ,W gf, 1-wwe www Mm Mfww?m2W,.,wwmwxy wws..,x,,, , fgwiw sf S Qv22U:2::::sf:P2:f:::?gpe5ifff:2:ff5rg,gfrxigsrzsyggii sgzzgfgrwifis Wwfgwgai A 2,4 f Qfmsifsfsggxmffsagsssgfsggisigfsg Q 2 W..N,wwwszgggsgggfxfwmmgf , S' .izzrw kiwi' Sw Mififlfifizfezwf 1 Hz gggwgggfsgrgfiifi 552 5133225 9515 555652: F2 5555522222232?2:gf::?f.f:f?Pff 4 ffgsggfsizzfgspgsgzh Hggggig. m,rffg:fga,g15a5w..:Y.z-Q, ::::fm:,.W,:rwm h,.:':':AW-ww Wf'-ffwm .f 152' 4 if S MQ. Mm ffggggwwaggggwf Hmfrwm aw 215 5344-WWSMQHEE 5 :a::z4::sg,'f:::QgQ2f:g gif Mamas 2Swsifggffmmfififw 2 535, J 2, gyggwssssvigigiigiii iivlfqki -WWf,e:w.,Q:ffwQmf:V'w,wff::::::,:wffsffmfwrffayffsfvsz J ,U My Hi wary fwiwy HF iw , W 2:rx:3:5QSexism:wwwvsmfssvsqffzialff::wSf1?. M2144fyeiizzxwffgffi A, -1zfM1?Z?E?if?5'??'SgikiwUFQ35?5!5??Q3iQSW'f5:m35? :Wg S',,,,2af?W N220 ygg1f:ww5Vmf,,. f:gy53mmf.:.Gggg1pfmsafgf .,,hm.Z,,fwm Magnum, WM mmsfrgfg fmwmwwW.A,p2,z5x,2m+wwmm ,ZZ 2 'ww v viii, mf? ef M154 - M5554 agvw f .... ,. 4 ,, wiv?'WM97:34eifgwfmlftifgzwwwPfgzW4LSZ,:fff?9zsfHf2:Hg'4ffwU.ZLEZZV , vw?L32Qhzwggwffimfiiiifs ,lgwfffyggwiai ' REQQSN E ,wufwifiwiwiq W W fi'S::Piw'wf5fL 2-fm I-f--2' :' ,,,,,5,,, WWGt,,h,,,3.,,5efgmwifmgfggavvwwiiggifgumig5w0fwsZ.25?:i'Hwww ywswQy,?J,?:'WUfWWA: :Wigs wswvifvi-?,2.-f?'63fa4 Wwwwswwf-1 952322,QfvfgwewwgqwowiyffwHgszwfimzfvwwlmige W ,Q W ----- wm,bf55,255y m,,4M,,gzgyxfngwvzg,wggfggggww, sggwg. ggwfgypm. 5 lggjmigy wma,,D,,Qgg3:g'5g5I5355mM,,,Ag3fg5555gW,m.gggggwgggmgygyX,MSBQigqgqgggggwgggggggggyfwmy555555,-yggy,2.3wyw,,,ggggg wg fgggggygq :4.:,::,f..gg ? vfgygg,Lggiggggggggwggmpiffgizfgzffxg wwvggggggf...fy2,:g5V,ggrgUWmmm .M ngflxemawgigfs M5521HeHAf6gww'?i5365Wg'ww:QJSYSKRQGPww:fiv?i52iGQ'3'2QQ21'f1?g?gWK8fH wifqimggzfmw:SZ2?5:'SfQ4Nf-Evwfiriifi 'gsgxfw N533 2'::: ,:f5fg- s- 1 W, M, , Z, ,Ak N. QM Y , w,,,,,Q , 9 M ,H ,Q ,, -f W www, M W W, ,D ? Mmm, , ww W .. .... ------- 2,,,.,,Q,,gM.q ,M,,,Z5,,,E?Aghgv,,,,m, :m,,, w N.M,,f,,,,g,g35,3f,x.W, ,,1.,4g2-,,Ag,fMmWN,,:f.,:,ggwmgm,wgwgxmayWSJXQ,zz,ww2-evAimpm,,Z,:1.fi,:,w,:,,a,fg www?2fms3 5 gg .. ..... , . pzzsswwaff.,:Qf:s3fwn,,NMm: ffwfxfv , Mwezrwiffimflfd ff Gmfssafwff-SW2-Mfiiifw'QmsmrafwwizfwwMrfxswwmmWrzmwwfiqvbpffzamggvkbmmagsaxw W gh? - Mi? 2- ---- -' Mmfzswww.?2xi,::,:fwwwhyfamiiiZgzzgwmzzf-warez1'2zgm5v2Q,2QM14 Q gexzzsziswffzvf?FwwfxSfig:5,i2fwf.g Qfibssiizzfspggzm2bgwiffsfsmggswQ4-ali,izffwMiiffefssggggfggwmwwffzfzfzggUwwggws wgwwf? ,V :z--:Aw -' ZfzsfffffsfffflfVw2-WWxr:Qgsgfzgfmwwmszssawgszzsgffffg-egawwBffifrfrssyifiiffwmfia 1 gsszlgggmgafwffwsrss sszzswwwffzsszsegwffwgsfWwwqfffszvsgffsf' Z6fp?K2sggq:222?2MSz2SB5fzWgw sw qmfg mf,q.g5gWww2,fMfx mzgzgssmwwwszmgggmfpffm:A4Pmzsssrffmszffsagfzzsszszwg-wfsgszw fgsKii5?0w4i?z2?52S??? :gg:iMwfzwsszw-04gsQ'sQaDffmQzfxsgszgssgmvgvfmvzs' 622315 ffsxzzwfmzmsfowhfiimS2252 Q fsf-.EH gm.fmgggWmxssszazszzszmzew,5m,,:,::Q:sgf:f:.: wwfWmaimaximwwmwzwwmffwfs mzmifzagsmffwfzfn M,hf,z.:,:fs:fggfwf,Q:fzzaQ,fwigmfzwfiv zsssfsgw Hgfgwvbziwiwggwfk-ff3:Qw?z5,5:f5SfW -- vz2,ffwwm:22 '22 fmyWX,1ww??:fffgggggg fs,59,2553mfgwigW,1q,gM2,1EJzssssfW2afm3'52::i6gwW,2Q:y::gz,f2QWwzxfmsggwffwfwsgswwwvwzzjfgafii?La?1f'ES2S5s'f2:?0wHHfvif2fp5sww :ef rgwgfgikfwfw ,,,,,pf,,,Nmiffy,-z,,.fg5a5ffm,5,,,-QM...:,,,,.,,g ,5gWM,.A,3,,,,e,,3g5,..4 gm,,w,N gggefmg gwwm iwfpwzwmmwfshMW ,agvwwgz wi ,,, wwf-wsuS.2mM,f2w g bmw My 419661215 M,-g we-a5iwm,M WWE? Sw W ,M QWW ,afm.wMn,m amy, ,4 4 Q, wf,Wm,M 4 in MW ,,w2m.W,,wS? M.Wm,,,,,,,, 2 ffm NSW wfwms m sw gives ,w'fM,,,s2,,W5f,n www msg ,mmm gg hh r In ,MNH , U 1 U pvfyogf ,W,,4,M.mmfg yay, Q,q.,3,,f:,W,z 45 ,,,.,,,,.,,wm-w,,,,,'.,,w.,Q.U, v,,,,,,,,.4,,f vfsfmv, , 1 m.254,f,,, fgwfa gwgm gl Q ,MMM wmv, J' WY, Qwwfm.-.QS Zawya ,gg H,,gqm,V,h gow aww. wmwwwt WW, , ,W wWz,,gfgA . ,Q MgmggwWww,hw4WM.wQw,,x,.x,, fgg?-fm,,,g,f eiewzvsm-sw.5,,,g31gf?g0bmwv5m 'Z Qgfm-wiwmf,m,,w3,:f?M ,S ggiggymww' MsgfQ1.:,::ggWaiigzxfffsggszsae ifgghyffs ,f- V522:Sf525512Yf::mmfffsmffzi.sfsszssgmQggfqgwfimzz mug 'wfszfsfifg my Lwsakvsi Sfiiwgffdffigggwfifsffgfmwmw ' X?'ghSi5'wMw vsfszzwmmmwm W, W ., .9312 :sys pf Mffzssssffssggnffszrsssflzggw rw S332 wixizw 32533555 wwggff w H 'fgqwgggm W ,,, gg., Q . M , bi ggymgmfm-Sw 6 wg 8' .1 x W,qM.gUgv-Wfmn,,W5.,V55w,,3q,,Mqe,,,,,, WDM MQ5' W ,g4iv?gmm,. ,::.g,:.g wEw VggyvPgmpf.fQww,,,'Mig:2ywa mg,-35555 M' , g55U,,,f gg, 52,556,332 ...ww 6 ,MXQ,A...m.m,ww'pw,,,,,,4w,,gmg,33f?Qm-qewwmfzgka, QMS gg mm ,,Am,,a2g,, QW. ww, , wwgw Q I-1-w,? fz?i3q'W Ywwa:,fQffm'ffgw 'fwgfgfqgUXwwwvmigaggzgfgggqsmfgftgg swgwmw fggyiwsggzf Www . W WM S2 002555529 M M D ,,:,,U,, W, -Q,,m,,3Xgfw..-A F. Msg.-1 m,.M,,,x W mms. - ., ,- 4 ,4 Q ,r 330,54 Q mgiibgkgw M 0, gwwj? M 4, fggwngsgfwgfdgqvg Kiwi? 52,557f5v-f5iUm,,1'Hwgg5Pg- lgvggggmwgimg f'?i3WfvQQsvf1f153?S?B'?,g'ff5w emma: zavymyywmg Km M23 3554? wifi? ' m,5,.5:g,,, .tm W mggw N my ww. ,, 4 ggQzwm..m,W,g.5,,3'fwwqwqwyqgqiiifgimwmfwggv iixmgwwwm Q ggwfyggq g5:,ggq,12g,5'25T5w3,, i,2,3j3'fTUWQWWffgq 533555515 'Q awxwggawggggggngggnie ,Www wmv ,,:'22Rm Mlifixsgw fizgfrsfg M'55,s2swffgw W Q. 'wswwv 6' wi g We 5-U w3'aQw:5,.5-f usa bighkwisexwa A w::gxAg??5Sf5,x.z5,:S?51'iQ,gW, mama-5 vb ' . . ,z ,.,: E31 J. 251.5 . -2 E . .,A, ,,.G 5 Q5 it Wi 3 -fi Ef 2 iigiflg 2' f E X Qi E 3 5 a 5 E 1 f 3 s X 2 K X I 1 N 1 1 1 4 x A n l 14:5 1- :EQ wmszzg :mg4gfvfggg2:5gf:H5:41:g12's2:3Q'ggm:1fS2M2SisSirzzgffg5gg5gg23f?m:355g??f?5S'Z VQBQTW :skis -5 25 .5- 5':' Zf::-Q: .S W , W' Eifs'-Ef5f 2 ':?:5:: :2f2Ei?ffIZ' 21571: 35.1 .iifffasiws 5,g4lSf5??i:5ylffffi2iS xi 55555353 21235534445 1.5 44.4 ww We-Waff?.WW m.,,,.4 , :. ,. ,.., ,,-..,.-4g-4.44-4-444-W ...M ww 44,-,Q ,ww ,f4,44,4.4,4f4,4.44s,2ses,sf44w44f:W. mW4m,,.z:AssQx:Ss Q, ., 5 ,Q Q Q ' s .fm xi k .Q 'f is -fi 4514 v Y QQ -X N . N14 ' L L KX K 'T -fs., R Tiff, QF! Y ll ss. ? x g 5? X 3 55? 4 4 5 si sm K xx '. EES? 1 wa' , 4 ,. gg 25531- 5 ff? Q H ,J sg, wears: 205456531 V szisilfi iziiiszlf si ' iff TMS!-1 3 QFXKQ ,ww swf' as 'D 1-1114, 5532328 W was was :Z:zffEa3'2 W Af 24' V E 5373! W my 52451 In 4, fy 1 ss 5 wg is ,Q ,E E CWM' as ,nw 516 534 fain 4:3 my waffff E W1 'Y ggsm'5m..,,,ggggg55q 4 H5 +1 ww A' sziiszwf 42 2331 -F2122 H X WWW?-EQ3l5535wg??5?5f5f5i?Q?f5 'gi 4 SER A.,, f F44.44x,4? if , ,Q his 41.,E..f?4. gggigq isfgqfffiiggip :gage wb.43.,, M :A -if we f,4X .::,-:-:-.f-. .... , . ---- 5 .,..,. :-'::- .:.:.:., Q 5 Qgiffrfz.5::sii4,4,5?3ii:f n Q 1 44 W Q fmimm ..... f '24 szfzzfw ..,44,f,,4.44...4 m,g,M4W ---- H .... .F 2 xg Jaw 9- iw' ,, Jar 535 52 A qw 'W,4::Z :' :E 55352 :iii ' 55-5:1552 122 if 'iff r' E 4. 4 Nia. i W 5 Q Q 1-Y W is Q, v Q ,, V55 1. N Q 43 vi M, 1,1 X2 M K1 E 2 2 w as Ast, , ., Q WW, .X 9,4 any 5,1 gy? ,, :':f:?25Xr 2 .. , H gl 4.45 25 ix: l wig? zexswwjfv-1254 HSS: X :f5Sgfi51?M's'r?'1'PB'k :E Qwg' Tggw dafsi-if? ? E.EE ?' Ei . ,,,,4.4,-M,,4-Q4:M.m4 .wilfwi w4'M,. 4 x,,Jg,45 ss Mggkm A J? ,, Q' gmiizsfbfxiigimf Q vw 4 fm Y, 'lifzeiwglmq ,W .4 ,j'2,?mv3'2iil , .,z,,m::5.y. 533521 '41 fw5S22+M:W WD' H3535 Eff: Q4 Qnmmi .vwwiw 4 . grssmw 44: mm' l .... , .... 1 v 1 if K 1 E25 4 Ei sim sa 3 A Q . 44 .J ,faggm Q, H..-..,,n.-::::- -9e3..4.,w'3'P' 9 W 'Q 411. up , 'f 'S35?i8:f3:v Ef:w::4?:3ifQ?4 ' 4m22x'gE:1x:::?4:e5f5W ms N 4 4- ,Q mm' 5 w 1,5 , ,.m,4.g4.,, 4435? 2: 4445.:.im:23Hg W me 4- 4. . 4 . 55 wig 4: 4, X4 X, Nw-S4 ,N mfr: Y' Q as 1 Sv ' z44mg+m:44 M., 3 A 434445, W. 13225 i .w'rm:f,m. w.:esE?::8:E sms-mi 5 -Sh 'L if wfg?f::ve:w:e:gQ14fm Qfwwwiiifw. fiwwq, fzfzmw, . mv, www L, mwwvm . gx4m.,4w .44 iifmgw 5532355555523 U .44 4 X gs, ::::i224,zf 4J. 7 W p444:i'1M V 4 W 3255 fri ,Wag 4 4,g,s:gm4..:- :?4g5:4wm.4. ,H 4 'bfiinsh' .W Tlffifg 2 44, W1 22555323 brlrsfws ewiggizirw: P- Afwgggfgmg, BTEC' my ,, ,4,.SL4.44 mibifsf .Mig ,g?E55Wg:w sw vwwwyssiliif gzfigagsssermgg gag v swerzgig 7 SQESW 'ifziiifa Meri: . 3 2 w Ufliifiimi . Q43-Sfkizfs ,mm - L wzfrzsww ,444 ,W Wrffitmrf,1.i:f,Ei3?2g5 5-52555552335 1 595. Q ,44 , Etfiikgf A 2: 5145235255 L53 ?ST'??'iW' we H. ZH! uw? .1 i,sai5T 4.5 we f444z.:4f?:m Q 2 , liwsw 4 :f::'f?is55E5f4' ,, 4ix4mj:fa5,Q23 zzsfigygggsgszs ,mggaf QQ, ,gg gg SNP. 454.4 0215 wiiifi- , 1:1 :,:sggf:f:4.:,4,.4 ., M 446 2:-Y W HZ 4 f 44 .,525mgr:::m:f g,,,gHfE55g:54..M 4 :sau q,., 4 522.55352 Z? Wig: , M4 ,igfffgtwf iixwg 525255454 455222 wwf. 525359221 fiifggggsiafii mxigggzwf ivgggziiifi' W ' iw in 5 12WkW:m,4,,44 ggiifiixxzse M. s , 244454 Eggwvy445f3 g, Mygggh, M5543 .,g5:,3:g1m5,,mQ Hgg5:g55xma?,,,, g3gm..4w.w5,,Wgfgf A 55255555f:553fX'555y'3f?i?E5g5s1 3:15:21 e::iE5,?5S25ssfEe?E555Sg a5Zf'i frasssizf. fmfiiilzfggm 3?fi?5WNv55l5iQS:?SiEW WWW ima., mm444,4..,mE 4444,4,.4:K:s:vf4 4,g:,.,,4E:: M,4,4,ms my 1- 1 Q4 mg Ww44e??f::::::w42X g:fz1gffgw?':m:gm5 52:51.25 i, i5S3E2i2f5g viE5 H254gziszfziafemiiiipfis 234404 5.:5xgm.y44,4,.gggwm:5 4.Q,,4,,gggfqg44gM W., , 2w?44,44,.,4f 4 4. M 54, X4 g 53152244 ,V 4,55 4 151555244 2 ffiwszi:5555552SS?gs::ssEEfSQS ' mffii, f gzrrsizzszsszssgiigmfffszizzfiil 2S::s::a:g?555S2:4-figgg miigpf, iam. g2:4:12frf?:SEi?:f,:s4.,.i?iE?2g:::::,:z41:ff-yiwwiii gw , S 251591544 imifiiffmz fsrifiifigszcg:zE::f95gSfsz::::sg:gg g:rams wt . 4 ,M ,Lf8S'3s m2f' www wMkvwM3w2iNwMku ,,ggwwww QE .,,,,,f,4..,, .,,,,Z.44, .,,.,,WH,, N 43,44,,4w4,,,g,g ,,m,444..4w 5 ,, ggi.-1 2554544235 :ggg:3g4::rSf':2::,2g555gg:zzzggrsgggimxm 5-ggwfgffy A ,sw w,:z,:f::f:H4 ,4 .ssff?::,w W M4 4 f .' : :.- Riliizigf Ngzgiiogaliii,,gggwfygzgii'lS3'ZSQ2fwm.4Mm9Q5 25mmMg3 f,E2:gg::Eiz3 5552? riff gszfszsfz iiixii:Eiiisiiifigvamifiiifiiksgsxgggsiiggg E.: . - , Q H4 44 ,mm wszizazlzw M4.55215':::'zg:wSw55.4Sf:2zQv f . '- ii'S::..: zgp' ' cizggfgMfSg:Qgf1':5fgwm33-42322 Wagggggg A N M, K 5 N. 'S'S ',A?' '5 V wx Ji if H LUZTSQ' W Sfgswwukgzg A Sh vswqkaay, 42552153 .. . .4 2:55364 Mfrsssgsggv M ?5W22,S? Swiwrfas' SWZSSSSW 2:-mmff K S ' .. - 4, 4 42255: Q W::fgg4gg44f4ma42:ef,.:1.:,.,Qw44 244,111,553 4 - . .4 g 4 A giizasx, 2 A 1- A 4 4 A asf, 2 41 5 :ls Qs , 'sg' f , Egisssgz 'szfigifezi5544212ZSzigsigiXQQNQSQQQESEHSQEQEEQQ -. 4 4 3344... X, we wmggxs.sgzgmdmsusasfszs ggiiwmwmim Wm 4 X , .x wmzfifx 2 ..::5:fg,,,,wg4,g,,,,,,ggmM,,,,,44.f3244 5552335253 554924551 ff in A R.. ixiisw wmszfz HG?ifzszmffsfwzssrgzgigwwwqgggzzwefsag iffguf' M N' UWHESSSQ: :?::g1gf:55fZ,is3iL:5?M gg ww 1244z,::,, WA ifizazzw :gm 'iiifgggeiiiiiifig 325352334 , 2253344 Jfztflfi, -4iZI.56'i5:si,4:5g:w wilnizgggfg Qzwlszz' i5352'E?'45'45 fiiiiiffgaziaM'4QD'fW?:?::yw asiwms :sm YZZQZSLPF' mf442.4hasHvmmeM.Q2,44f2sm:2S:if2Sgffgm2252 ES wise:zswzyziiwifff:i:4z:mi?gg?1 flgrssasifgfggzggfwsfmswzslmv wssszm gggwiiszza X Qsfiiiiffrfsfmsssfz NYE:55522235525sz:5?5g55g5S5G2?2:25g555?555?s: 222535555 7253525 f'f55522sf 43527255 'QSM ZEN' 7ZSSEZQSEZILFffifgfggiigiillifi 5 M33 .ZZEW . w .2 ffAN532,il?5EflZflZlf'Wv.fw?Z343.'yff 'B 'f'g,4 Szwiis U, 1 i?Z5:'srg::gM??23ZA5S?1ES' ::':5--5:5: A 55432222252 442585531 5??f??3 ?i?2z1:i35-5375554525544653 fa x :M zsssssfw 57355123522 efsfsgfggfm222::s:gs5vgg24:z fff:H f'zv:i??T K A 5525! i Y :sz4:z:.::, , .Z?Z?5f:5iS?x5?f1S?S'3w gum vggggf-fgfw :4..m,W2,5::N,.,43'Pg ws ,43,3m,,: 5552? X zzizzfifiifg wzszigisiw 5552553535255 ,Mb qmwfowwv M,wmuW2'- mmqqhggkgwmqegwg ' 4 'him ' :tg Q ,4 44.2, 4 Q, ., .4 , .1 ,M 44, , 5 we 4 ,41 2 4 ,N 'ww ww, 4 4 XM f 4 -Www, ww W 4 446,444,444 bf Q .m0gv2,Wm,,M wiwwn, :sw WQfgggfsswgQgfggggigsszzzsfz gggggggszg Wynn w:.fg',M Q 435245,gzggigggzszsggsgzgfx 'ESV 2521255229::::i25:5EE5E5'A W N fs: 4 5' 16555252 4 4 , Liiggzifil. 1553552505222 , zfflliiffsifdwf 4 Twp 4 45.14 ,-gM,,::h:: ziggy, H 4:zf,zg:5, , , 4 , 'YH 'f:zm4f'5,',-'frmg 4. ef' f 4 M 4 Sngifcgg J ws, 4 H 3 4 f ff feggzgazf' 145: ,,,,,5gfg5W4,M 4 ,4'1'4w wewz3?W ' , zgslam 4 egg, wxfazggfg fvfssizme Zfgmszk iff 'fliwvwlh,'lZ2'zu?'Z4fi'?Z'fZf3f ff fiiiiimffzfafiiizizzi mi 'V 4 ,, , 'G f 5 :Zz X53 ' 34327 Vffifiw ' 4. 4. -f .4 y -..:.' .,, . M. ffm, ffwJ'f2ff 2 - -,':-rw.: M wwisifzz '2:9'.4I'i'4'1' 95.4. .4 - ' i ' 15.4 1,141 4f4iS,ZMW '-vM75Z2 '4! Him t Rf -- f , ,:g,1f,:,, , ggi5s2:4ie:2:eg,g?g?i5fQ5fg,,,, fr f '11agZf3fi.71335g55,!32'z52v f 4.5:927224z::Lz:zz2ggff3i::,:g,: 4 5 ' f , ff 4 x ,ZF': 24. 4,h2 fz14w'f4-'w wwi?ffi?2?4f ,4,44,'wf:4W, 'fHfwmf4f4wz12,-14442974514 f44,4:,2z2z5,g4ff:af:Zai42QMfff fffhggeqjf hw-gum' f 1 :f:zf1?Wgf92'3f' gh, , W4,.i,igg!f 4 ,..,,.,2?fv Qfsegggfcggf-2 ew ff f ' ,1fwiiaifii7ffwWWw7.2f QQWWW , ,ml 1,wW:e:'444,4?gQgeg5iQ 5,4 4. ,iy:325?2iQ,m:2yf,,, ,,,,y34-2444: ,Q 533, 'Elgar V , N444 ,f1!gefggf44,,, '4 ,,Z37'4 Qwia zw,fg2g:glJ?v 1' 'avail , 4 4 f ff 4 4 4 4 sagaszzwgfwfffzizwzwfgzgggw:a:4s4M2zw,4ff,4QWMKQ? ,fggy 4 54371, 7,44 4,4,g,ff37fggMM.fZ awww444w3 f:wwwv'24j42?',4gf44Wg,,f4f? 444, ,V 4 4 , 4,,,mfY45A,44w,fgi?,AW.,,W4f,fgwfff.-4155345 4, www ,, , 'W' f4 , LH - h 'w72?'L ' fzgwi wl::,fZ?v 24Z2'ZfffMfff' 4 W, 4 Hia' 4444 4 4, 4 Qfiig mf: 0 4ifwMff4 Miiffff' M44M4Ms,4f:'fZVfww,4mz4:w4 we fwd , f wie ' : :.:'5: in f bf WWW. MW :ww A 4' Mm, 4,,f21f- .444,,gw2fmA44 wwf, 44fMHwyZ',m..'w4Z.4M4.,-,4,,,,f mmfrwwyja 1 m4M2' , Awii' 4, ,WW .,,4 ,,, , r ., 44 , , 4 , W,,,,,4 44,5 wp, W4 ffwgg' 'g' 4535: ,awww my WM'ww.TzwzfwwffffwwfZ,ifZ'I5fg5'54s 1 awww, W 2 , f f , . .W 1fwwws.wWfs,4 4,4 2 m41W,S'2f2w4,44,xi,, F 4A4y4w.,,,.3, V www, , 4 ,ww M fm., MMM, 41,4 ,444f ,,,,, ,W . ,,,4f4444,,,,w,,.,,,,g ,f1,q.m,.9,,,4,f ,4w ,v 02,2694 W- '4 wfvisslfveivffwwwmi 'sims' 12'w1w44wm4?.?f1'w.2, ,43,gw-fm. 4m,3,3,,,e,.w4ff,Wf ,,,,4445V Z4 4M,.44, .4 .MMV f 44,W4,,M,4wyyfywgm,f'r,z,,g 7 ,'g,,h,4Ax1m4,-4.M,W,g gy 44w,m,4 vfgg,,, f S553.44,.4,::zXSS QffusfbsdvW.mzggyigfgggggqifmwxww mm Wwaiiifs5''wf:.ww,2wfsfffff:?',, , ?2,1'W ,4,z'ff2fM444W::ww4W:U2, ':4Wm4:?:g3,24f exigzggzif -3 - .::5 wgmw my 37 'WWwm M1553 i4ms5Zf5 2'9mm 5?-Fm www Misa mWS5wW444w55fg': f .7 HMMM44.4w,,g,gW+v 9 miie.: v m,'f4wfmW,,W-.51QW,,,g,,g7,A51,,w,.,,,,,,,, ,Z ,WMWQQZ f,,5,,,a,,.wi'?xfm.4 sfmamivm wfzsfsszeesmimggpWmmm: ?f5'351:1s'i5is3uy?'1AZ1i7:?iifLmfEfZ54,44WimsT,.lS2 64 4, H Qfszweff NmQf,4,4,z.4G,:::, fsw.4f,,:e 4 M Q 4 4ff:wz4m4m4a44Mf2.f5m4afg4,:4zzfezf1,,f4Q4m4f2fQ?f'fv5f4szeez44,Assf4f1Q,6?a144f2a:f::f42, g,4..,4,., w, .gi A f:iIis. ' :' E :. FIX 'X X N3 'XX X :K E R xx NF x X 2 iff X Sw Q Q Q x X X 5 r 5 x Q X Y X L? Q R x x NJ nf bmw 'mms:mamaev::xa2ww:4:wmw?27s:12: sswwwszsa M erxzwseexsla ww' fzzrasw Wm mm wwww Q QSM Q52 Eg Q .....,..,.. 5 3 5 gg 3, ,.,,. Zgaggff X M ww 7 f ff 5 ,, fs , 4 ii fg u Q 4 f.fgX 5g 5 gif af 2 E22 '55 Q ' ii aimli an 5 h 5552332- Qgg gig ,:'. I .e:f. 'Q , ,Q zz us ' 2 , M WJ, 119 9312? A , 52 --:::-:: -3 -si 4, 413, 5213 S 2 j g H f 2? 5 QQ' .... A 52 ai' , Q ...,., , Ng- 9? , . , Lays 'QU 51 wiwmf 'gfgpfgs EQEFEW Hz is 2 ? 5 25 32 2 5 3 M SW X 5, H 3 , 5E 25 we 4 ,.,. 2, gg, f ,U gg W5 1 525 E5 55 -: 42' 2 :- az .,,. . fa'-'Qian fr, ..,. i E 2 A ., .. , , ,Z 'W ,,.,, 2 I , A 1f Qii Q x if Of X Vw ff f lj W ff M f ff 1 f 6 5 f 'f . ,ZW M, Q 4 434521 f K .W X ,4 f fi, fy f , f ,,,,,, H Z 7? ff ff 4 N:Whwm..m,,m f, ,N....N... ..,...... .mmseaf,, i ..,.. , 3 5 W4 , f 2 w e 2 gf 3 , as Mg Aa ,.,. gg, .. . , ,,., 3 5 2 if? Z ,,....... . , 5325 lk, mf , 2 mfwff: wffmwfk f f ,e ,5 532 4 2 sf? 4 f Y' , ,,,, H 2 pf iw 5 ,f f 3 9 W 1 2,3 y ,fe EQ W f , 5525 fig gf? 13 Wg? f I? f 2 ..,. ,ggi AG! 4 f ,,, 2 f gg 5 3 Z 2 1 s 5 , E 3 ..! I 5 2 1 is ff, 1 f , f f , if 92 Q' x . x ,E iifv! M , in fx 22 33,25 eg W E z 3 5 uma Eif 5 ,s is 27? 'E 1145? ig 1 g 4, -4- fy if ,E an 4: 5932? 92 , iw im, 21 ,iw six Qizf f 23: 222 I g?,.,4f 'i K ,Q 4 k im , gf 2 f Agg wgi ga 3 Q, 24: f 2 a A 4 :V iw? gg! ,ei .5 sig gf 2 f ii ' ie QM? jg? ,L 3 J 4 ggi? f jggf g W 2 ig! g eg? f 2 si 5, gf , f 52 gi ,,, 1, 9 5 , 9 5 2 2 KS ag 5 Z.-1-M-:4-:f.:69:n:v:.::f:9s:w., f z fs ,IE 'f 1097 fl ffff! ZW f , f , THUS ASM Student Body Officers A A A A A A 82 Senate ...t,.....,... A A A 84 Pom-pons ...t......, A A A 86 Varsity Cheerleaders A A A A A 87 JV Cheerleaders A.....A A A A 88 Freshmen Cheerleaders A A A A A A 89 Spectrum ..,A...AA.. A A A 90 Shadows AA.A,,. A A A 92 Wind Ensemble A A A A A A 94 Concert Choir A A A A A 95 Vocal Minority A A A A A A 96 Images AAAAAAAAAAA A A A 97 Symphonic Band AAAAAAA A A A 98 Marching Band AAAAAAAAAAAAAA A A A 99 Concert BandfGirls' Choir AAAAAAAA 100 Pep BandfSymphonic Orchestra A A A 101 NovafMatrix AAAAAAAAAAAAAAAAAAAA 102 Comparitive Cultures AAAAAAAAAAAAA 103 Student to Student AAAAA AAAA 1 04 Art Club .AAAAAAAAAAAAAAA AAAA 1 05 Creative Writing Magazine A A AAAA 106 Ram Page AAAAAAAAAAAAAAA AAAA 1 07 Key Club AAAAAAAAAAAAAAA AAAA 1 08 National Honor Society AAAA AAAA 1 09 Government Club AAAAAAA AAAA 1 10 Science Club AAAAAAAA AAAA 1 11 International Club A A AAAA 112 Latin Club AAAAAAAA AAAA 1 13 Bowling AAAAAAAAAAAAAAAAA AAAA 1 14 Forensics AAAAAAAAAAAAAAAAA AAAA 1 15 Chess 8a Backgammon Club AAAAAAA 116 Outdoor Lab School AAAAAAA AAAA 1 17 DECA AAAAAAAAAAAAAAAAAA AAAA 1 18 FBLA AAAAAAAAAAA AAAA 1 19 FI-IA A A A A A A A 120 HERO A A AAAA 121 .A -ff 'K . A ' 'AX 5 if M ff bf' 'i . 1 A Q K 2 if V ,ik , fin 7415. , . 9' N K i , M 'A S .Q k k ,st X, - fb' HX 2 F E ,if :g33f?. . .jx A ,f ,yy , - , iff Q, 1431 , ,' Q Mfg 5 . , ' A 'Ai 1 ,ty k N4 5 -RTI . 'WD' fi, Lx 5 , - E iss . if A' ' 'ffm' . - .K Qi Ast ' x 4 s as l 5 L A f Q X, qw i G1 - xf w ir P 'TVX' .SW ii ,f5,W 3 ln. 2 - 1. N X - J - 2 x 2 3 1 . ..., x Q y X . A - gi- D 3+ - 3 g 2fW :?Q'?'2x W. . 5 - -fi 151 -L. X215 71. - .,-sxJgi,w,.. Q ,A L M, 'nw - M-512-M X 1 We N Wrrff T K 51- .5 1' 1 .. SK 9 X ,S .'-535' 1' vffff : Rib 2 - pijf-.3 3 : g Q' f if ,wa 4 ,Zh T if X f- 5:-N, 'Q . ! 'pgs . . 33 wa i ihk: 7'. W 2 Lf ggi J- , sl . X . A A ,L , Q Sanz! gf' S ia X ,min vw xf V. - 3323 f ' f 15 gl- L K 'c- - '-EQ? Erfy 45515 - 1 214 ,Q Q 11: x -f Wa 5 Aw 135. 5 Y Q. X 'I ' ,W 522,53 Q ig 'Q ' E51 9, ' 1 V . . f , Q. X ' ' ' N . . Q- 1 wif ,. M H ix 'fa in x Q. Q, V: 2,-UW. X hw , . , ff- . w5rN!A.x x E5gQf5+,,,.xz h . 'gh in Qi X K. : L 3 If ff x K Q . . 'Q ,f .ER L 3 A ,L,, , , 7 0- 5 G !f?f,,ff, W f X Q 1 'K ,HQM fy x 'f ' Jf x L-wx. , V -gg w 5 . m ' Inf' A 'faiswf Y .. E A ,,,.,5.....fm 'ww W, ,M I if jr 4 WN kM,,.,, . ., ,Lu1,x f-ij:,,,?r V i Lx., A , AN W 5. M i-JW: x ag, 'i2'?? ,QQ Sf. Ralph Suarez- Senate Historian Student Body officers at Red Rocks. Jenny Kroll, not pictured, is Senate Co-Histori' an. Wuygw Ram Pride Leads Uri Being Student Body President this year will be a mem- ory that I will cherish the rest of my life. My involvement in senate and athletics had made my high school years that much more fulfilling. By viewing GMHS from inside I have grown to appreciate everything that is accomplished and respect the people that have attained the goals they have set for themselves. GMHS has a reputation for excellence: What best typi- fies this reputation is the word RAMPRIDE. It is a belief here at GMHS. Pride is seen in all phases of our school. Always remember that your view of GMHS will largely determine what you get out of it. At this time, I would like to thank everyone that has played a part in making this year a tremendous success for me. A special thanks to my parents, Mrs. Chiles, Ron, Steve, Chuck, and Katie. I am a truly blessed person to call each and everyone of you a friend. Curt Kundred Student Body President 82 - Student Body Officers The amount of time I've spent at GMI-IS sometimes seemed like my whole life, yet the older I got, the faster the days seemed to fly by. As a freshman, I never believed it, when seniors would tell me to get the most I could out of high school because the time would go by so quickly. Now I'm saying to those students who aren't graduating with the class of '83: Make your high school years something you will always remember. Senate has been a major reason for keeping myself involved in activities. Each year I have made many close friends with this group because we all share the same genuine caring and concern for making GMHS a place students are proud of. I have given my best to represent the student body well, and I want to thank everyone for giving me the opportunity. I wish you all a great future! Julie Campbell Student Body Vice President 7, , ll Julie Campbell- Student Body Vice-President Amy Ahrenkiel- Student Body Secretary '- ' at Q RW' ti ,V ,. ..v, .EJ ulu as t tx . sir M sf J, K .S as i, Green Mountain High School has been my home away from home these past four years. lt's been a wonderful home because I've shared it with special people who I'll remember always. Some l knew only slightly and would like to have known better. Others have touched my life and helped me become a better person. With the help of a concerned faculty l've watched fellow students grow and develop their talents and abilities, ln all areas of our school, athletics, academics, music, and clubs, there are students who aim high and accept the challenge to be the best that they can be. This is the spirit that has made GMHS one of a kind. Don't let your years of high school go by without striving for the best you can be. Get involved, everyone has something special to give. Good luck, and God bless you all each day of your life. Thanks for all the memo- ries , . Amy Ahrenkiel Student Body Secretary I would like to encourage everyone to get involved in high school, and senate is a great way to do it. The reasons vary and go on forever. First, you get to meet so many people you wouldn't otherwise in classes and clubs. l can personally say I have had fun in my two There is a film, every graduating class from Green Mountain will see sometime. lt's called These are the Greatest Days of Your Life, so far , The film stresses to get involved in high school or all you will have is empty memories after graduation. Halfway through your senior year, you'll wake up and realize your high school days are numbered. You'll feel like out into the real world - and high school friends' get to- gethers' really help to make you feel better. So once again, take the advantage and make high school your fulfilled dream. Good Luck! Student Body Treasurer i , .T years of senate. , - G-,wiix if , fr. . ,aww ,,....v M .rw .,,,,.s- s' lsr 'Q , A you re getting pushed ' . ,,vdP - g ss.. believe me, it's scary! Friends, clubs, and , '2W,j'.Q-we- V, ...,s- 1 :: .,'fj ,Q X? Joanna Varney QE 14 . Minky ,,,....I7J'f'fL.--sf it ,g S' Joanna Varney- Student Body Treasurer Curt Kundred- Student Body President Student Body Officers - 83 Sophomore senators included: Kelly Murphy, Mallory Moore, Stephanie Volz, Dini Deibert, Kristi Parisi, Diana Glose, Tara Cronin, Ricky Gray, Jennie Aar- on, Tracie Heinz Freshmen senators included: Mark Kinney, Mike Fuchs, Laura lnzano, Jill Stevens, David Lawler, Shawn Butler, Sandy Stevens, Stacey Cole, Lisa Gar- cia, Dana Guinn, Jung So Dini Deibert cuts out decorations for the Christmas Beach Party. 84 - Senate Q purse.. 3 Ng g . fi .xg S l Are Fundraisers Ever Over? Seniors Juniors The last year for the senior senators was spent helping out the school, and their own class. They spent a lot of their time showing the other senators how to do things. Their own projects for the year included the Win- terfest Dance, the senior gift, the senate re- treat, and of course Graduation. Of the four years these people spent at the school this past year was one of the best. The senior gift was something new this year and will hope- fully become a very profitable project. The juniors in senate worked hard on their projects for the school. To begin the year they sold Gold-C books, and spirit buttons as fund- raisers. This money proceeded to support the 1984 JuniorfSenior Prom and Christmas Week. They also organized the After spring spring vacation dance. Juniors senators be- came increasingly involved with school activi- ties. The junior senate started its way to the top rapidly. Mickey Cronin, class president, stated We're trying to create more communication with students to make a successful year. Q. Q Pattie Sutton hangs a shark fin up for the Beach Party. Kim Harsch, Julie Hall, and Monica Hamilton point at the other senior senators. Junior senators included: Vance Stillman, Jolene Baca, Doug Lawler, Julie Chavez, Bodene Shearer, Suzanne Clark, Troy Tyson, Amy Dalton, Mickey Cronin, Dulci Chapa, not pictured- Steve Chase Hall, And Monica Hamilton Sophomores The sophomores senators put together projects that not only were participated by students of our school but in our community as well. One thing they organized was the annual Sadie Hawkins Dance. During the year they sold doughnuts and nachos as fun- draisers for it. This group of sophomores also took on out-of-school projects, including taking a group of orphans to the Denver Zoo. The sophomores tryed hard to give our school the good reputation it deserves for the students and neighborhood it's in. Freshmen The freshmen have had no major projects for the school this year. They used this year to save money for their class in the future. They sold pretzels, bowls, and baked goods, but these fund-raisers was not spent on any- thing this year. The use of the money will be spent on a Sadie Hawkins Dance and the freshmen-sophomore Prom in two more years. Since no money was spent this year more money will be provided for these ma- jor events, and they are hoped to be two of the better dances GMHS has ever had. Senior senators included: VJ Greco, Vicki Hepp, Holly Ropes, Pam Patrick, Sabrina Forrest, Chuck Reid, Ann Morrisette, Pattie Sutton, not in this picture-Kim Harsch, Julie Senate - 85 The Poms do a Chorus Line type dance. Q 1 - lf . Stacy Taylor lines up with the Poms for their routine at an assembly. Carla Baca and the cheerleaders jump in the air for a touchdown during a football game. Sara Cappellucci looks over at the other Poms during a crucial moment at a wrestling match. 86 - Pom-Pons is . ft as Music, Poms New Talent The Pom-Pon squad consisted of ten girls this year: the two co-captains were Lauri Staggs and Sara Cappellucci. The rest of the squad consisted of Lori Bonds, Barb Meiser, Stacy Taylor, Brenda Bowker, Betsy Korb, Sherri Johnson, Holli Martin, and Carla Baca. A very special activity the Poms participat- ed in this year was being back up vocals with disc jockey, Steve Kelley from KIMN radio, on a record. It was entitled 'iHey Ronnie after the popular punk song Hey Mickey. The song satired President Reagan and his administration. lt began with a plea Kelley made for a cheerleader to call the station and the first to do so could do him a favor. Carla Baca, senior, called first and Kelley said he needed some cheerleaders for backup on a take-off song. Baca accepted the offer, and the Poms were on their way to fame. They recorded it in a professional studio for two hours. They were paid with KIMN chicken dolls, but if they should cut a record the pro- ceeds will go in the Pom fund. Kelley also wants to do more take-off records, and the Poms are lined up to help if he needs girls. As most cheerleaders do, the poms went to camp this past summer at the University of Denver. Stacy Taylor, junior, explained, Camp was fun and we got along really well except we only had a few hours a day to ourselves, the rest of the time we worked. The poms came back with the superior trophy and the unity award, which was voted upon by all of the squads at camp. When asked what the most frustrating part of the year was, they answered that it was the lack of school support. We go to five games a week and there wasn't very many people at our competition. lt's really depressing. Ann Morrisette and Lisa Hough cheer determinedly for the soccer team. All the spirit leaders are involved in the Homecoming Parade. iving GMI-IS Spirit And Pride A special squad of GMHS cheerleaders received the superior award, placing in the top five, at the State Competition held January 29, at Bear Creek High School. All varsity cheerleaders were invited to be on the squad, but due to conflicting things, only these participated: Seniors- Julie Campbell, Ann Morrisette, Sa- brins Forrest, Amy Ahrenkiel, and Juniors- Amy Dalton tCaptainj, Jolene Baca, Katie Mongeau, Ann Camacho, Lisa Hough, and Dulci Chapa, Monica Foreman acted as the group sponser and Cheryl Cartin spent many hours working with the squad on a difficult stunt that won in Competitions several years ago. Among the cheerleaders' fundraisers this year, they sold Christ- mas wrapping paper and stationary. The cheerleaders usually begin their year without any funds, but do their best to earn the money they spend by selling things and having activities for the students. The Varsity Football cheerleaders were seniors- Annette Vitry, Ann Morrisette, Amy Arhenkiel, Kristi Gleason, and Sabrins For- rest, and juniors- Anne Zentner, Lisa Hough, and Dulci Chapa. The members of the Varsity Basketball squad included seniors- Ann Morrisette, Sabrina Forrest, and Julie Campbell, and juniors- Dulci Chapa, Amy Dalton, Ann Camacho, and Katie Mongeau. Senior - Annette Vitry, and juniors - Jolene Baca, Carol Worrell, Lisa Hough, and Kelli Lucas composed the Varsity Wrestling squad. Annette Vitry watches the wrestling match against Golden. The varsity cheerleaders do a stunt at an assembly. Varsity Cheerleaders - 87 , Carol McMordie, Vicki Zion, and Stephanie Voltz lead a cheer at an assembly. The J.V. squad makes a pyramid. J .V. Spirit Leaders The 1982-1983 Junior Varsity squads did an excellent job of showing their support and spirit this year at many of the GMHS sporting events. Their camp this summer was held at C.U. in Boulder, working hard at cheers, earning spir- it awards and ribbons to take home to GMHS. The squads were as follows: J.V. Football - Laura DeMoye, Mallory Moore, Vicki Zion, Stephanie Volz, Kelly Murphy, Rhonda Danzeisen, and Kristi Parisi. J.V. Basketball - Kami Ogden, Mallory Moore, Stephanie Volz, Shelly Hassen, Kathy Lynch, Leslie Mathis, Rhonda Strepman, and April Sum- mers. J .V. Wrestling - Kelly Murphy, Susan Terry, Rhonda Danzeisen, Vicki Zion, and 88 - Junior Varsity Cheerleaders Lynn Debroder. The squad's head cheer- leaders were Kristi Parisi, Rhonda Strepman, and Kelly Murphy. These cheerleaders felt that they helped to bring the school together better than any squad before. They helped join GMHS' ath- letes together with the band and cheerleaders. They are very proud of the spirit they gave over the year. The cheerleaders work very hard at what they do. Cheerleading sponsor Monica Fore- man said, The average cheerleader puts in about an average work week. It's difficult to do and many of them also go out for sports or have part time jobs. Freshmen cheerleaders form a pyramid during home- coming pep assembly. '86 cheerleaders try to get the freshmen class into spirit. Freshmen Give Spirit GMHS' Freshmen cheerleading squad made their class one to be proud of by offer- ing their time and spirit at sporting events. The members of the Freshmen squad for the 1982-1983 school year were, captain - Janel Rohe, Linda Hinkle, Kelly Monahan, Aimee Reinert, and Michelle Abbott. Their summer NCA cheerleading camp, which lasted four days, was at C.U. in Boul- der. Together they practiced cheers and routines to be judged in camp competition. The cheerleaders tried to do as many unique fund raisers as they possibly could to earn back some of the money spent on uni- forms, camp, and other expenses. The ma- jor event that brought the most money was the annual cheerleader sponsored dance. The cheerleaders attended an average of four games a week and had practices on days they didn't cheer. Some of the routine things they also did on the side was to make posters to help raise the spirits of the team and bake cookies or cakes to bring to the games, for the players. The squad got along amazingly well this year. Monica Foreman, sponsor, said, All of the girls this year were really mellow. The Freshmen squad also managed to get ever- ything done without a hassle or arguing. They were kind of ignored though because there are so many squads. Over all they were not a problem. The Freshmen squad get involved in a pep assembly. The youngest cheerleaders start off an assembly with their favorite cheer. Freshmen Cheerleaders - 89 CJ. Shibly practices his hula dance for Hawaii. Beth Miller, Steve Ramsey, and Linda Betterley practice for the Fairmont gig. 90 - Spectrum I-lot Charts Spectrum, according to senior Randy Felix, is one or the better jazzbands around' This jazz ensemble is made up of 18 of GMHS' finest musicians, At the end of each year, tryouts are held for the jazzband. The auditions consist of playing the major and minor scales, presenting a prepared jazz piece, sight reading, and jazz improvisation. The best all around musicians are selected to the band. Spectrum plays a variety of music to please different audiences. Ballads, jazz, rock and swing are just a few. According to senior Dar- ryl Bostwick, We have about 30-40 charts we have to know, which averages about two or three a week. Basically, they are a very dedicated group of performers. We've got a lot of talent,', Bostwick con- tinues, at least as much as last year. Bostwick credits Spectrums success and popularity partly to director, C.J. Shibly. Hot Gigs! He's very talented, with a lot of years behind him. Shibly played lead trombone with the Glen Miller Orchestra. Spectrum had a very eventful year. Besides the annual school concerts, they performed at the Green Mountain Plaza for Homecoming, participated in the 30 hour music marathon, hosted and performed with Alan Wise, lead trumpet for Maynard Fergusen, played a dance gig at the Fairmont Hotel, played at the Rocky Mountain Jazz Festival, and most im- portantly went on tour to Hawaii over Spring Break. The band held various fund raisers to earn money for the trip. Once there, they partici- pated in a Hawaiian jazz festival, played on the beach, performed at different concert halls, went swimming, snorkeling and sailing - all the basic things one does in Hawaii. Spectrum ended the year by playing at the graduation ceremony held at Red Rock. Randy Felix practices for an upcoming concert. Jeff Fowler, Darryl Bostwick, Keith Glose, and Derrick Andrus make up the trumpet section. Toby Rockley hammers out tunes, Corsica members Darryl Bostwick, Mike Stephens, D.J. Ruder, and Paul Hildebrandt jam in Air Band competition. Scott Foshag gets into his music. Spectrum - 91 Carin Clarke tries a new instrument while Doug Rollovvitz looks on. Shadows, members included: A. Alexander, M. Amstein, G, Anderson, AJ Charest, T, Deitrick, E. Fry, S. Gilbertson, R. Gray, S. McMullen, S. Owens, M. Roose, L. Akey, T. Bell, A. Camacho, D. Higinbotham, R. Loewin, K. Lovvn, B. McCullough, C. Nuss, R. Peterson, P. Sutton, K, Wyckoff, Drummer-D. Rollowitz, Pianist-C. Clarke, Director-Steve Meininger 92 - Shadows Happy Days On The Beach Shadows of the Mountain is one of the most recognized musical organizations at GMHS. This group of talented people con- sists of 24 students who are a mixture of sophomores, juniors, and seniors. There are eleven females, eleven males, an accompa- nist, and a drummer. Steve Meininger is the director and coordinator for the students. Shadows of the Mountain not only sings but dances as well. They choreograph all the performances themselves. Shadows performs all over the communi- ty in such places as nursing homes and ele- mentary schools. lt takes a lot of work to create and put on a concert, but these peo- ple feel its worth it. They perform around fifty concerts a year. Shadows practices everyday during seventh hour, in order to perfect their voices, the group also calls ex- tra practices every so often. This musical organization has a special event every other year, they go on tour. This year they were given the chance to travel to Hawaii. Here they were judged and critiqued on their spectacular performances. While in Hawaii they performed in schools and The Polynesian Culture Center of Ha- waii. Each individual of Shadows had to pay a certain amount of money to go, but not all the money came from their own pockets. Fund-raisers for the group included selling magazine subscriptions, and Santa-grams during December. Santa-grams are an annu- al event with Shadows. During December students had the chance to buy a Santa-gram for 53.00. Shadows would then perform a song for the person of the students choice. Shadows also participated in the schools bi- annual music marathon. Students sponsored Shadow members for their participation. W Mike Roose and Amy Camacho relax for a few mo- ments while Mr. Meininger give instructions. Andrew Alexander and other singers get ready in the choir room for a performance. U El Alexander and Pattie Sutton. Eric Fry, Krissy Wykcoff, Regina Lowin, and AJ Charest decide to pose for the cameras, in practice of future singing careers. Carla Nuss pays attention. Mike Roose and Krissy Wyckoff dance on stage during the Music Marathon with Andrew Shadows - 93 Concert Choir looks over their parts on some new music. Gail Skinner looks up from her music. The 1983 All-State Choir members from GMHS were seniors Amy Comacho, Andrew Alexander, Carla Nuss, Pattie Sutton, Eric Fry, Diane Higinbotham, and junior Regina Loewin. 94 - Concert Choir Battle Gt The Choirs Winner The GMI-IS Concert Choir was a qualified group of musically talented students. There were seventy people, in the organization, both males and females. In order to partici- pate in Concert Choir these students were required to audition. The auditions were strict especially for girls. A major require- ment was they must be able to read music. The director was Steve Meiningerg Sue Boettcher was student director, and Carin Clarke, Accompanist. The students of Concert Choir sung most- ly religious, soft, and entertaining songs. They only practice once a day, during school hours. Concert Choir performed five con- certs a year, which are in school. They did, however, perform in The Battle of the Choirs. They won this and were given a Trophy for their outstanding performance. The group goes on tour every other year but this year was an off-year. The students seem to enjoy every tour they go on. Fund-raisers for this event generally include selling maga- zine subscriptions and pizzas. Concert Choir is a collection of the finest voices in our school. Kryssi Wyckoff commented The most interesting people in the school are in Concert Choir. Kim Kelley plays her clarinet. The flute section has a solo. Instrumental Excellence Wind Ensemble was a special group of talented, qualified musicians. There were thirty-four members in the organization. These students must audition in order to participate in the group. During auditions they must prepare and play a solo and must be able to read music for their instrument. Once a group has been selected they meet and practice once a day to perfect the music they are required to perform. Wind Ensemble had four concerts during the school year, all performed at GMHS. Their performances showed how much effort they put into playing their instruments from the response their audiences gives. C.J. Shibly, the conductor, commented, Wind Ensem- ble is the top performing group of instru- ments at Green Mountain. Traditionally, their final performance of the year was play- ing for graduation at Red Rocks. X A Wind Ensemble waits for Director C.J. Shibly to start the next piece. Two clarinet players play while the trumpets have a rest, Wind Ensemble - 95 Images smiles for the group picture. Mike Amstein carries a box down the hall for Mr. Meininger. Vocal Minority wears Beach garb in the snow for the group picture. 96 - Vocal Minority Look Up I-Ier Dress? Now starring the all-time favorite, Vocal Mi- nority! Vocal Minority was a bunch of guys who dressed in beach clothes and sang off the wall songs like PDQ Bach, Fruitcake, and others. Because they participate in some sort of tour yearly. generally instate, they sold Coca-Cola at the Bronco games this year as a fund raiser. Vocal Minority's idea of fun wa: to embar- rass girls by singing a song about a couple going out, but before they go out, the father and boyfriend have a conversation about the girl which turns into the song Look Up Her Dress. Last year, they sang it during an assembly and received a tremendous response. Steve Meininger led this band of 'trouble makers.' They performed at older folks' home and many neighborhood schools. Yet during concerts, Meininger did not direct the group. Instead, they sung their hearts out while they also danced and joked about. At the concerts, everyone from Meininger to the audience seemed to enjoy their style of singing. During the Vocal Minorityf Images Christmas Concert they gathered all the small children together and set them on their laps up stage to sing to. Tryouts are held in the spring at the end of the year for the next year. Karen Walker smiles, thinking how well the.concert went. Vocal Minority performs in the auditorium. 'Grandmafs' Singers Throughout the school year there were approximately 20 girls who got out of their mid-afternoon classes about once every one or two months. They left the classroom for about one and one-half hours to sing. This group was Images. lt was the counterpart for Vocal Minority. The girls all wore long blue dresses, and swayed to the music, leav- ing an air of happiness and fun about them. Directed by Steve Meininger, they chor- eographed dances and developed their own unique style. On their afternoons away from the school, they sang at nursing homes, elementary schools, and shopping centers. During the Christmas Season, they also sang at various concerts on the weekends. Besides touring within the neighorhood, they also participat- ed in a tour within the state in different schools and communities. They enjoyed singing because of the positive responses they received. They sang any kind of music, but mostly they enjoyed spunkier songs. Meininger him- self got involved in one song by dressing up as a grandmother and feeding her 'grandchil- dren, sweets and fruits. Images group in clusters for their song. Lisa Danora and Doug Kasel practice a dance in the hallway. Images Musicians Tuned-Cn When you hear 14 flutes, 11 clarinets, 10 saxaphones, 8 trumpets, 8 percussionists, 5 french horns, 5 trombones, 2 tubas, and 2 bari- tones you have heard the 1982-83 GMHS Sym- phonic Band. The band consisted of 8 fresh- men, 4 juniors, 3 seniors, and the rest of the band is made up of sophomores. The band met every day during 5th hour. The band had its first concert on November 17. After the con- 98 Symphonic Band cert they felt ecstatic and they also felt they had done a good job. Their next concert was on December 14 with Wind Ensemble, which is a tradition. Band director C.J. Shibly said, The band has a lot of potential, and it has the high- est caliber of players it has ever had. lt is also very exciting and can be as good as it wants to be Kim Kelley converses with other band members on their way home from New Mexico. The flags of ColorGuard perform along with the March- ing Band. l i 2-W 5 - My Mwwma... :est , ,,..,Wm.WW,,, ...W-ww. W w-annum Q- ggb , , . ,V the homecoming parade. W?W ?q9l Mutual Sup- port Felt We did the best! sparkled Drum Major- ette Melea Monson about the 1982-83 Marching Rams. In the state competitions they placed sixth, the same as last year, but their score was much higher this year. On tour this fall they traveled to New Mexico where they succeeded through the finals and received sixth runner up. Monson said the crowd loved us and described the hush that fell on the crowd when their place was an- nounced. I-lalf the fun of Marching Band is exciting the crowds. Before tour, their room was filled with balloons from Senate, and the cheerleaders often supported them with cookies and punch. At the Jeffco Invitational lots of people came to watch. It felt like we were part of that mutual support. Monson discussed a competition at Little- ton High School with the CBA lColorado Bandmasters Associationj After the compe- tition, they all went back to the band room at GMHS and discussed goals for them and weaknesses while they warmed up physical- ly from the competition. This was very good for their moral and permormanceg it pulled them together and made them serious about the band, com- mented Monson. Before the season started they had been presented with two options, either to be competitive or a lot of fun. After the Littleton competition they pulled togeth- er to be seriously competitive. Karen Vincent gives a startled look as she raises her head from reading a magazine, while her bus companion hides behind her hat. Drum Major, Darrin Pardee and Majorette, Melea Monson lead the marching band in ri' Marching Band 99 i-'f I Wi Concert Band rehearse for an upcoming concert. Four members of Girls Choir wait to begin the next song, Lead by John Miller, Girls Choir performs in the auditorium. Mugcal Building Blocks GMI-IS music department added a new group this year-Girls Choir. At registration 85 girls signed and at the end of the year 80 were left. Six guys were in it to begin with but director John Miller moved them to mens choir. The group started off the year with a concert at St. Judes Catholic Church near the end of September. They have to work with people and it helps draw everyone into helping everyone else, said Miller. I like it because it is a fun social group but people could work a little harder. I've been in choirs all through school, and sure we could im- prove stated freshmen Sue Cielens. Concert Band is not only a performing 100 - Concert Bandf Girls Choir group, it is a class. Any student who can play an instrument or wants to learn how is eligi- ble to take the class. The bands objectives were to work on the basicsg such as scales, exercises out of music books, and aptitude. Concert Band offers the basic foundation for future years. This year's band was made up entirely of freshmen except eight sophomores. Concert Band has helped me these past two years with my skills and techniques. said sophomore Mitch Smith. i'Concert Band was a young band during the 1982-1983 school. It was loaded with a lot of talent that was fun to work with. commented director C.J. Shibly. Misha Eaton works diligently at her violin in hopes of improving as a musician and helping the Orchestra succeed. The Orchestra, an important part of the Music Depart- ment, practices for the musical. Bands Sup- port GMI-IS Symphonic Orchestra is a combination of string and woodwind instruments. The group performs throughout the year. The biggest role during the year is the Spring Musical. The score takes many hours of re- hearsal for the outcome to be professional sounding. Symphonic Orchestra had a few changes this year, the main difference was the band grew. It was composed of more violins and woodwinds. Senior, Kim Kelley and sopho- more, Sharon Roehm were clarinet addi- tions. Symphonic Orchestra is one of the finest musical groups in the school, stated director C.J. Shibly. Cheerleaders and spectators normally cheer the sporting events on as well as Pep Band. The band was sponsored by John Mill- er and directed by Melea Monson, and Dar- rin Pardee. Pep Band started during soccer season then on played at the boys basketball games. The members played at most of the girls basketball games too. The group liked to wear wild hats and t- shirts just for fun. Anyone who played an instrument was invited. I was excited be- cause it was a blast, like it always is. I am glad the athletes did as good as they always have because it makes it even more excit- ing, stated Monson. The Pep Band works hard to keep both the crowds and the athletes enthused. Plucking away at the cello is Kim Shifers, an aspiring member of the Orchestra. Symphonic OrchestrafPep Band - 101 Nova circles around to get to their next formation. A Matrix member is supported by other members while he does a routine with his rifle. Matrix lines up at attention before their show begins. 102 - Nova f Matrix Mt Guards Exhibit Well Nova was sponsored by Earl Carlhiem and his wife Cindy. The organization has been going for three years. This year they started in No- vember with a camp in which the girls learned the techniques and skills required to be in the group. After the first camp they met each Wednesday for three hours. They had another camp, in which they learned the drill design. Shiela Madden, senior, was the flag command- er. Madden thought the girls had a great sea- son. Karen Naper, a 1982 graduate, was the rifle instructor. Naper was in Nova for four years. I think the girls had a better attitude to work hard which helped the season. Two things changed this years Nova, they're not part of the school and they brought in girls from Bear Creek. Matrix is the male counterpart of Nova. This was their third year in existence yet they begun only this year to be fully recognized by the student body. Matrix was not afilliated with GMHS but the most members were students there. While Nova is a competitive guard group, Matrix is only an exhibition group. Brian Gallagher, senior, commented that the ratio of females to males in guards through-out the state is about 2011. With a smile he added that he and his friends figured out the odds once, and decided to start up their own group. Matrix is one of the only all-male guards in the area. lnside the capital building The Lincoln Memorial, Washin gton D.C. -9.2 .,f,t.x4,i tar- 'A-1 A Spanis Comparative Cultures Comparative Cultures is a new program designed for students to broaden their hori- zons and expand their views of different cul- tures. This group travels abroad for about one month during summer vacation. The program takes the place of the Peo- ple to People Student Ambassador program which GMI-IS students have participated in in the past. Comparative Cultures offers ba- sically the same deal minus homestay fam- ilies, plus a few more tours, for a slightly lower cost than People to People. At the beginning of the school year, stu- dents, freshmen to seniors, are nominated by teachers and students fwho have already gonel to be selected for the trip. The stu- dents attend a few informative meetings where they learn about the travels abroad, and then decide if they would like, and can afford to go. Next, those students who wish to go are screened by a panel of teacher leaders and adults. Most students are accepted. Throughout the year, the student travel- ers meet periodically and learn about the countries they will be visiting. They discuss the countries governments, customs, reli- gions, and learn a bit of history. When the travelers finally board their flight for Europe in late June, hopefully they are ready for the adventure that awaits them. AW V,,,.,. ..,,.wg-- .,.. 5 elif .j e .... , .. . f '.y 5f5jv. M K' -vu.. ,. . ', ,fe -A - .fr ..f,,, . - - f ' 'W sm,-A NA, ...K km, -W . .,. , . as -.Q--wuz, t , . -- ,U j,,i-A-15,5 W ., t .,.. W . . . 1 sw W - .- V . tu- 'wftsw .5 f i, ut.,-A af ' -.f - .. Wi K .swf ,. .- sz...-A-M' -A N.. . Lx K t.,L I t.,.......M W .-we ,K f- A K N cs, -:A-+1-c,.,. if M-4:5-K,-. fiflase, - Y? --6 ' -Y 'vw-ff .Lx aww W , ,..,.,. st. Y A- .. ,-A, --s'-- ..., . ,,......., ..,.,.-W W Neo- .WW A view of Europe h monument Comparitive Cultures - 103 Art Society members gather for a picture. E.T. is present everywhere, even at McDonalds, in Rosellen Gridley's painting. 104 - Art Society Talents Work For Fun Budding Donatellos and Van Goughs met every Thursday morning this year as an Art Society. These talented people didn't just stand in the shadows of the mastersg they began to create a name for theirselves. They put this talent to work on their own, and as a society. The club worked on several projects this year including repainting the wall across from the financial office, making and selling Christmas cards, and painting the windows at the Green Mountain McDonalds with Christ- mas scenes. Windows were the newest addition to the wall across from the financial secretary's of- fice. Different scenes were painted on both the inside and the outside of the windows. As a surprise for Ray Knaub, sponsor, the mem- bers painted a scene involving him, from a caraicature art teacher Ted Desnica drew. Their Christmas card sales were the only fundraisers they had. This was one of the charms of the club. As Kitty Jones, senior, put it, It's funny how all the other groups are always raising funds. The only thing like that we do is the cards. Everything else we do is just for a good time. Like, NHS is a service club, but we're just for fun. For theirselves, they made T-shirts. A mem- ber designed the motif, and to save costs, they used an air brush to apply the emblem. Nor- mally, a professional would have to screen- print it, so they saved a great deal of money. Karen Smaldone, senior, was president this year. Sue Efting makes a face as she looks over the hectic schedule, Group picture includes: Front row: M. Smith, D. Thompson, D. Thomlinson, C. Eberhardt, P. Thompson, K. Scroggins Back row: Sponsor Sue Efting, K. Meesey. Not pictured: H. Cozzens, A. Zammeron. Thank You For Not Smoking! Tobacco smoke has been identified as the major cause of several diseases, chronic obstructive lung dis- ease, lung cancer, and heart disease. To a large degree, prevention of these diseases can be accomplished by convincing people not to begin smoking. The Student to Student Program is one way in accomplishing this. In this project, GMHS student were trained over a two month period to give programs on lung physiology and the danger of smoking to younger students- as a means of preventing their early use of tobacco. Student selection was based on the ability to commit at least two hours a week to extra study, and adequate scholastic work, to allow for some time out in class, both in preparation for presentations and actual time in other schools. Students were cited for their generally good rapport with others, the will to speak in front of a group, and is a non-smoker with a certain commitment to good health. The Student-to-Student group didn't use the basic traditional and conventional means of teaching smoking education. The Living Lung exhibit carried the most impact on the students. The lungs were donated by people who died from emphysema or natural causes. Hooked into a container resembling the chest cavity, air is inhaled and exhaled, allowing the differences of healthy lungs vs. emphysemic to be visibly clear. Included within the presentations are: posters, slides and personal exper- iences. Past experiences have shown that peer guidance has a very strong influence on younger children. With the aid of the American Lung Association, GMHS students are building a strong determination towards the abolish- ment of young and old smokers alike. Dana Thomlinson, Cass Eberhardt, Pam Thompson, and Mitch Smith listen to a discussion. Daph Thompson prepares for presentation. Student-To-Student - 105 Creative writers discuss submissions while Kathie Starkey lurks in the corner. Keys in the Middle of the Floor poses uncreatively. Pat Singson, Greg Fickas and Tammy Borgman listen to short stories. i Keys In The Middle Of The Floor Keys in the Middle of the Floor: Some- thing Spontaneous in the Title was the name chosen for the 1982-83 Creative Writing Or- ganization, and the magazine they published. The name was derived early in the year when the group began brainstorming for titles. Kathie Starkey, sponsor, asked the club to throw out something creative fmeaning ideasl for the title. Senior Chuck Reid, being a creative thinker, threw his keys in the middle of the floor. Hence, the title: Keys in the Middle of the Floor was born. The organization, composed of about 20 members, began the year by writing and hid- ing lateral poems, written on computer cards, throughout GMHS' halls. The poems were designed to stir students imagination and curi- osity - also to publicize the magazine. During the Christmas season, Keys per- 106 - Creative Writing Magazine formed pseudo Santa Grams Ca parody on Shadowsl. Students could choose from such literary works as Dr. Seuss' Green Eggs and Ham to be recited for friends and loved ones. Throughout the year, the club reviewed material submitted for publication in the mag- azine. Submissions were received from Eng- lish teachers and students who submitted their own works. Talented art students again, as last year, illustrated and added their works to the maga- zine. After many hours of hard work, hundreds of submissions read, and a lot of patience, Keys in the Middle of the Floor was com- pleted, published and sold in May. Seniors Gary Jugert and Brad Coburn were co-editors of the publication. April Lidinsky shows her vivacious personality. The November 12 issue of RamPage deals with 5 sports championships. l FTW ? an f X 14135: ,. ,., W . ,W r 2 'The Voice Of GMHS' Every three weeks, GMHS students are mailed a copy of the school newspaper, the Ram Page. Each issue is the result of hard work and dedication on the part of experienced writers. The publication usually covers local stories and events, but occasionally deals with national news and controversies which affect the general readership. The Ram Page staff is made up of 21 members. Although Newspaper is a class, many hours outside of school are spent preparing the paper for publication A especially around deadlines. In order to be on staff, each student must endure a full semester of Journalism. Staff members agreed that Journalism was one of the tougher classes they had taken at GMHS. Along with learning how to write in the specific areas of news, feature, editorial, and sports, students learn journalistic style, interview techniques, the art of writing headlines, how to edit copy, layout proceedures and actually put out their own paper. Those who wish to be on staff must receive a 'C' average or above in Journalism, and are also inter- viewed by the editors. The 198283 staff included: Brad Coburn, Editor-in- Chief and News Editor, Gary Jugert, Editorial Editor, Sonja Sue Roemish, Feature Editor, Jeanne Daugherty, Sports Editor, Whitney Seymour, Advertising Manager, Photography Editor, Juli Gammon, Cartoonist, Jack Franz, Illustrator, Chris Harris, and Exchange Editor, Julie Pratt. Kaycie Arnold, Dulci Chapa, Laurin Collard, David Daniels, Heidi Koleman, April Lidinsky, Mikel McMul- len, Kristin Plese, Jeff Shearer, Greg Wetherbee, Julie Wilberding, and Karin Wollenhaupt completed the staff. Cheryl Cartin served as Ram Page advisor. i The 1982-83 RamPage staff chooses to be lateral for their group photo, Gary Jugert leads a discussion on a staff editorial. RamPage - 107 Key Club members pose for group picture. George Johnson, sponsor, listens to a deliberation. Jo Fleener, president, runs Key Club meeting. Members included: J, Fleener, J. Daugherty, T. Fisher, A. Baski, D.J, Ruder, J, Campbell, G. Gun- ther, S. Chase, T. Jones,B. Gal- lagher, S. Johnson, B. Yarring- ton, R. Martinez, L. Maass, M, Maass, S. Dye, W. Seymour, A. Lidinsky, T. Freehafer, E. O'Conner, C. Kuypers, A, Young, J.E. Rogers, A. Hugh, K. Vincent, N. Patel, G. Jugert, L. Bronowski, S. Dave, S. Luna, H. Cozzens, S. Scharenbroich, K. Jeffers, D. Jablonski, K. Kelley, M. Pederson, M. Cronin, M. lsaac, C. Bpnner, J. Hernandez, S. Beagle, D. Butler, J, McDoanld, S. Higganbotham, J. Manke, D. Stevens, L. Kimberlin, K. Harsch, M. Vasey, J, Jacox, S. Cielens, B. Bonner, J. Saunder- son 108 - Key Club Unlocking The Future Homework, homework, homework- realisti- cally, homework accounts for most of GMHS students' time. It surrounds them at home, at work, and occasionally in their dreams at night. However, Key Club was composed of 55 members who managed to find time to serve the community, They followed the old adage, Stop asking why things are as they are . . . and focus upon how things may be made better. Their focus for improvements and help within a community was dimensionless. Every project dealt with some overlooked part of society. To start off with was 'Toys for Teens', an annual project where Key Club collects re- cords, books, games, etc . . . for teenagers. This was in cooperation with Jeffco Action Center. Another group Key Club was involved with was the elderly. This year they adopted Jane and Joe from Villa Manor Nursing Home. Members visited their friends bi-monthly. GMHS' second blood drive in a row was this year sponsored by Key Club. It has been the number one drive within a Jefferson County High School, averaging at least 120 pints, which is a record in itself. Last but not least was the Special Olym- pics. Early in the year Key Club sponsored a bowl-a-thon for the handicapped. The mem- bers assisted in the scoring for the partici- pants. They also held a Friday Swim Program. Here too the special olympic swimteam swam and their progress was recorded. The efforts of Key Club were numberless. They strove to fulfill community goals, and attain them with their determination, will, and sole pride as Key Club members. if Stacey Sanderlin, Kitty Jones and Brett lngram lis- ten intently. N.H.S. poses for group picture. Members: A. Baski, B. Bowker, J. Burmeister, J Cambelle, S. Cappellucci, B. Coburn, J. Daugherty L. Elliott, F. Ernest, D. Ubanks, S. Forrest, J. Franz J. Gammon, N. Gonring, M. Groves, J. Hall, M Hamilton, J. Hesterwerth, B. lngram, K, Jones, D Kautzman, K. Kelley, S. Lundgren, R. Marino, B McCullough, J. McLaurin, G. Mehnert, M. Monson A. Morrisette, C. Noyes, D. Pardee, N. Patel, J Pietsch, D. Pratt, C. Quinkert, D.J, Ruder, S. San derlin, J. Saunderson, K. Scroggins, C. Smaldone R. Spykstra, L. Staggs, M. Stephens, R. Suarez, P Sutton, M. Vasey, K. Vincent, D. Willis, L, Wilson S. Yoshino. i i y v A . 'Wfffff A Mark Cf Pride The American Heritage Dictionary defines honor as: esteem: distinction: achievement, integrity, recognition for academic achievement. These are the characteris- tics members in National Honor Society value national- ly - whether they're in town or back east in Washington D.C. Presently, there are twenty-seven-thousand honor so- ciety chapters nation-wide in secondary schools. The first society was chartered in 1921-making it a proud 63 years old. The NHS has grown remarkably fast, A primary reason for this is that membership in the society is meaningful. ln order to be accepted, students must distinguish themselves academically, through: leader- ship, character and service to the school andfor com- munity. Once inducted, these students not only live up to the exemplary lives within their schools, these stu- dents have to continue to be motivated by the challeng- ing ideas of the society. The primary reason of N.H.S. is to recognize stu- dents who excel in academics. Through the school, they practice another goal by serving as a liaison. They help out with the special Olympics, sponsor a Thanksgiving drive, and work closely with senate, Key Club, and Ram Rodders, to name a few. ' Noblesse Oblige - the Honor Society motto, trans- lated reads if you have the ability, you carry an obliga- tion. Members share their personal gifts - lt is with prestige they make time and give of themselves to their community. -ef-Q,-.. Mrs. Couture chats with Brad Coburn, gif 'Z Lynn Elliott presents a project to NHS. N , , ,4,,,w.W f V, ., 'V', Mm National Honor Society - 109 ifiiiiiiiiislllr i F . :CHQ ,. sr .3 4,1 5.rr?f3' 552,521 ,,- i E asfiisifi i i E ig. F iiiggsriicsi .t .sswxisiais :,.2 as flwifiiisiiiice . . F sf 1 fiii i is g A . . i i .si W , t ii -3. 'i of ' Faith Gunther and Caroline Rosno, Government Club sponsers, march for suffrage in the Homecoming Parade. Tim Fisher, treasurer, waves hello at a passing photographer. t is K- 1 'ur tl wP5Ti'fi . i so C, V, skew Qgasfl, -2-ia-.s,j F 5 .,Lk M ex is '-.gf .L srmtsg wsfw . -,- , ssssssssssw-A a r c : iw T i 1 Q iiii at ' t . - as Club Creates Bills The government club was a new addition to GMHS this past year. Faith Gunther was the sponsor, and it was her first year of presiding over this particular club. However, she has sponsored Youth-ln-Government and Close-Up to Washington for three years. Gunther's goals were to create community awareness for the November pre-elec- tion. I also wanted to get all eighteen year old students aware that they should register, said Gunther. The club has accomplished a variety of things this past year. During Homecoming, the members in the club got together, and decorated Gunther's Porsche with crape paper. The students walked beside the car with their 'lget out and vote signs. 110 - Government Club Similarly, in order for the club to raise money, they sold candied popcorn of all kinds. ln addition, the club participated in a mock congress, whereby students who were in the club had an opportuni- ty to present bills which they had written. Some bills included, acts to change the appearance of a minor and provisional driver's liscenceg limit the usage of fertilizer on croplandsg require students to be enrolled in foreign language studyg acts to allow minors to donate organs specified on a lVlinor's Driver's License, change the pre- sent Colorado law of not guilty by reason of insanity to guilty by reason of insanity, and to include sales tax in the listings of merchandise. Vs Dave Reid, Physics teacher, co-sponsors the science club. Science club meeting notice on department door. Time Gut For Science Student debates and demonstrations on the apple computer were just a few of the activities the science club members partici- pated in this school year. Other field trips planned were to the hydrology lab at the Federal Center, and the Jeffco planetarium Christmas show, among other activities. The sponsors of the club, Sue McNamee and Dave Reid, had promising goals for the club. McNamee, who has sponsored the sci- ence club for three years stated, I hope the club will enrich the lives of students, and also promote more interest in the program. Similarly, Reid, who had started his first year of sponsoring the science club at GMHS, hoped that the club would develop a sense of comaraderie among the members. Activities which the club has participated in over the last several years have included selling plants in the spring to raise money for activities, collecting aluminum cans, and test- ing the soil level in gardens for people in the community. Officers in the club included, junior Gail Roberson, Secretary, senior Dale Pratt, Chairperson, junior Doug Jones, Treasurer, and senior Mark Knox, freshman Eric Mon- son, and senior Gary Henderson as advisory board members. WNW, Science club meeting is in progress. Sue McNamee, science club co-sponsor, teaches a Biology class. Science Club - 111 Heiki Scholz helps put the finishing touches on the float before the parade. FRONT S. Marion, D. Wolf, J. Worrell. SECOND K. Kuik, C. Jahns, S. Holder, M. Vitry. BACK K. Anderson IV.P.l, H. Scholz IPres.l, A. Tirreo lTres.l. NOT PICTURED I.. Davis, T. Freehafer, N, Grommet, S. Holder, J. McDonald, D. Perry, J. Radecki, J. Smith. Cindy Jahns makes a 'iclay-do snowman. IN EHNILVIO L B .Q X ,Ji .s-me E fx RX K Sis. I Looking At The World Doesn't everyone speak English? The stu- dents in International Club do. They are also learning another foreign languageg Spanish, French, or German. Finding out about a few other areas of the world is one of the club's purposes. Kristy Anderson, sophomore, said, I was in it last year and I learned a lot. It was interesting. Amy Tirre, freshman, comment- ed, You learn about different cultures. GMHS students can experience other cul- tures on Quarter Abroad trips, where they travel in another country for several weeks. They raised money to help cover this cost, other camps, and special events through bake and lollipop sales. Every other week International Club stu- dents participated in various activities. The year began as they got together to make their 112 - International Club Homecoming float. Although September 23 wasn't hot chocolate weather their float looked like the Alps. A girl who had traveled to Europe shared her experiences and slides with the group. At Christmas time, they made ornaments. Little mice made of jute appeared wearing Santa caps and having tails of various lengths. One of their highlights was an outing to the Yum Yum Tree restaurant in Aurora. ' . safaris .. -.-. I as - l ws iss fs is LQ xi 5 ,Q is .X X . Q , as X X Fi X X x X N fs X s 7 Exhibits with an international theme were an- other option. The year was tied up crisply with a foreign language picnic planned by the club members and their sponsor. Heike Scholz, sophomore, added, It fell through last year. We're going to try to do it before the Seniors graduate so more people will show up. xx The Latin Club sponsor was Mr. Fairbanks. The members were: M. Anderson fPres.l, S. Anderson, M.Armbruster, P. Arnone, A. Baski fVice Pres.J, S. Burks, D, Chernyak, T. Fisher, D. Harden, J, Hight- ower, J. Kitley, E. Knight, P. Knudson, M. Lenway, L. Longnecker tTres.D, A. McCaslin, J. McCaslin, S. McMuIlan, C. Navratil, M. Pankratz, V. Patman, G. Roberson tP.R.i, K. Roberts 1Sec.j, E. Schaller, J. Schleicker, S. Watkins, and R. Vigil. Pete Knudson takes part in the skit, HA Trip Through Roman History as part of his initiation. Leanne Longnecker in her formal toga, watches the punked out Latins, Patty Arnone, Anne McCaslin, and Kim Roberts. sss Y E Lingua Latina Floreat Long live Latin, the Latin Club's motto, goes right along with their theme of encouraging Latin as a lan- guage. A little fat Roman Senator, wearing sandals, a laurel wreath, and a toga to cover his fat belly is their mascot. His native language is alive and growing in the vocabulary of the club members. They must either be presently in a Latin class to participate, or have com- pleted two full years of the language. As Gail Roberson stated, UI do love Latin. It,s an excellent study in ety- mology and increases your vocabulary. Quite a few traditional activities were held in addition to monthly meetings. The club members were united at an Initiation meeting on October 16. Most of the stu- dents came in costume, The new members entertained the 'old' with the skit, A Trip Through Roman Histo- ry, complete with sound effects, They also enjoyed a Roman feast. The pizza dinner meeting was a popular event also. The final get together was the Senior Ban- quet at the Athenian restaurant. Club members said good-bye, celebrated the Seniors' graduation, and pro- nounced the graduating students as guests from then on. Something new was that the Latin Club president attended the all-school President's Club meeting. Club members put their culinary skills into practice by making decorated cupcakes. They were sold throughout the year to raise money for club jerseys. These gold and purple T-shirts had a big Faticus on them and written in Latin they said GMHS Latin Club. .r 1 A kk to I Club members and sponsor line up for a 'family portrait' at the Initiation Meeting. Scott Burks and Scott Anderson enjoy a Roman feast. Latin Club - 113 fuumwwk ' Sisfigflsrif Slifiiilffs iff The 1982 Rams Bowling team: C. Donatone, N. Patel, B. Ingram, L. Maass, and D. Daniels Brunswick is only one of the many neighborhood alleys sponsering leagues. Some bowlers left their balls in the ball return, ready to play. 114 - Bowling Bowlers Win By One A new addition to the GMHS sports scene this year was the bowling team. Although not many students were aware that it existed during the season to support the players, they made a name for theirselves when they captured the state title. The 1982 High School State Tournament was held at Har- mony Lanes in Colorado Springs. lt was fierce competition, but the Rams came through in the last game to win by just one pin, and cinch the title. The team consisted of junior Dave Daniels and seniors Nikunj Patel, Larry Maass, Brett Ingram, and Chip Donatone. The team, coached by Mrs. Wil- ma Kelley, was picked according to the top five averages in the junior league bowled on Fridays. The success at the tournament was the result of a total team effort with every bowl- er coming through for the team when he was needed. Individual honors were bestowed upon Daniels for Boys High Series Handicap and Donatone for High Series Scratch lscore without a handicap.l The Forensics Team takes pictures as well as they speak. FROM LEFT TO RIGHT Pat Singson, Scot Anderson, Karen Painter, Chris Loop, Melissa Peter- son, Richard Curtis, Bruce Cooper, Laurie Murphy. NOT PICTURED Jim Bailey, Norene Ritz, Gail Rober- son and Katie True. Competitors give their speeches before competition in order to get practice. Orators Show Skills The Forensics class this year was taught by Barbara Logan. In addition to a new teacher, the class participated in some excit- ing events. The team was active in competi- tive meets from all over. In December 1982, an Invitational was held in Colorado Springs, while in March 1983, another Invitational was held in Littleton. Similarly, the team participated in other activities as well. For instance, they would often have breakfast together before going to a meet. The members have even gone skiing. Logan stated, The class becomes very close, and social benefits are gained. Forensics also became involved in perfor- mances for the Language Arts quad during the spring. In addition, they held fund rais- ers, like many other groups, in order to help pay for registration fees. The type of speech the students were involved in included, extremental, original, Lincoln Douglas Debates, oral interpreta- tion, fwhich included poetryl, humor, drama, and duet acting, all in the scope of Forensics. The Forensics class had mainly Juniors in it, however, any Sophomore, Junior, or Sen- ior was allowed to participate in the class. Similarly, first year students were usually regarded as novices, while second and third year pupils were considered the varsity. ' I Forensics officers, Karen Painter, Bruce Cooper and Pat Singson. Chris Loop enunciates as all good Forencians do. Forensics - 115 Vice-President-Carol Bonner, President-Chris Loop, SecretaryfTreasurer-Cammy Michel. Students break their concentration to smile for a picture. Front row Janette Manke, Carol Bonner, Cammy Michel. Second row Richard Schottler, Tony Ji- menez, Chris Loop, Eric Monson. Back row Bridgette Bonner, Ke- vin Green, Bill Griffin, Ed Knight. i MRO Are Board Games Back? Have you been wanting to join a club that is all fun and games? Well, this want can be fulfilled by a new club brought to our school. If you enjoy playing chess, backgammon, or any other board games this organization is for you. This is the first year of Chess and Back- gammon Club and is considered a success to the group. Chris Loop, junior, and Cammy Michel, ju- nior, are responsible for organizing the club. Michel, Loop and a group of other people enjoyed playing backgammon. It all started last year when these people got together dur- ing their free hour. Mr. Mehlbach, social stud- ies teacher, is the sponsor of the new club. Chess and Backgammon Club is not like other clubs in our school. Its only real main 116 - Chess And Backgammon Club purpose is to play board games. At this age, people don't normally play board games, so we decided to make a club for this purpose stated junior Janette Manke. They do not do public services, and they do not have any money. Though, they do have elected offi- cials. Chris Loop, president, Carol Bonner, vice-president, and Cammy Michel, secretary- ftreasurer. The club is an open group, people can join this club anytime. They do not only play chess and backgammon, but parcheesi as well. Mi- chel's commented, 'Someday we hope to have competition. That someday could be soon. lt has started at GMI-lS, which could lead to have other schools start playing. Brad Coburn watches flag ceremony in front of the lodge. Two sixth graders from Eiber Elementary use their senses in Geology. 4' 4.82 v-s Seeing The Other Side ' Once when l was in sixth grade, late in the year, the whole sixth grade went to lab school. lt was at Windy Peak. There were two, by the way, the second was Mt. Evans. The first was the newer one, but smaller. We arrived in the busses just in time for lunch. We lined up and sat quietly at the lunch tables until they were ready to serve lunch to us, family style. Then the rules started to flow. They told us all the things we could or could not do and what would happen. The director looked mean and strict so we didn't say a word. After lunch we had a little rest period, actually just to straighten out our dorms. Then we went to our first activity class. It happened to be art. And on it went with the fun, throughout the week it got better and better. l constantly dreamed about the years to come, when I could become a counselor. All of a sudden, I was in the eleventh grade and could go to Outdoor Educational Laboratory School. l was so excited, l was going with my homeschool, and my little sister. l got all the activities together, packed, and dragged everything to school that early Monday morn- ing. Kids were everywhere, the counselors got to at- tempt to load the busses. Then everything was loaded, and we all climbed into the busses, students, counselors and teachers. This time we were going to Mt. Evans. When we finally got there the procedures were the same, just that the counselors got first priorities to seating for lunch, lt was a hectic week and the counsel- ors had to keep on their toes at all times. By Wednes- day all of us were beat. The last couple days were spent on a less strict bases lby the counselorsl, and everything went well. r N .Nag xx Nik A student smiles during a lesson given by a high school leader. GMHS graduate, Dan Stephens, says 'goodbye' to Devinny Elementary School kids. Outdoor Lab School - 117 Laura Weist displays finger courage at the hands of a vicious typewriter. Julie Chavez, DECA member reads an interesting document. Pam McCain and other DECA members work hard to prove that their club is one of the more successful at GMHS. 118 - DECA In The Job Market D.E.C.A is a classfclub that deals with the busi- ness field. It helps students build their knowl' edge about a specific subject that they are inter- ested in. This is the field they would like to go into. Distributive Education Clubs of America offers a job placement program in which they find jobs for the students. This year they planned to go to the district convention, and possibly the national convention. They sold dif- ferent items to gather income to support their activities. Shelley Rooney studies material at a FBLA meeting. Group interaction is essential in the business world. FBLA Looks To Future Future Business Leaders of America is one of a few classes that you get two credits in, but you have to work also. This club- f class deals with the management, or secre- tarial aspect of life. The students need to type and possibly take shorthand if neces- sary. Diane Mashman was the sponsor of the club and she commented that they attended a few of the district conventions, and had hopes to attend the Nationals during the spring. The clubs goal for this year was to achieve more this year, and come out look- ing even better than they already do. Their activities included selling keychains, and oth- er odds and ends. Mashman sees a great life for students and says that they will keep all they've learned. communicate. As well, business leaders must be able to communicate among themselves. Conversation is emphasized at the meetings as it is essential for business to FBLA - 119 QS FHA members prepare another outstanding and worthwhile activity their club is notorious for. HERO sponsor Robin Nantkes and FHA sponsor Sara Nesmith discuss convention results. 120 - FHA iiisgw' MN FHA Retains Tradition Family 8z Future was the theme for this years FHA iFuture Homemakers of Americal club. The officers met every first Wednesday while every second Wednesday was for general busi- ness. The third and fourth Wednesday of every month was reserved for fun nights. Sara Nesmith and Colleen Utter, sponsors, commented that they didnit think they got enough recognition during Homecoming. ln fact they were quite involved. They sold calen- dars and cookbooks for fund raisers and partici- pated actively in the many functions. Later they planned a variety of fun activities including a kidnap breakfast, pizza party and a leadership retreat. The officers were President S. Karnik, Vice President V. Monroe, R. Obechina, Secretary E. Nushawn, Treasurer Brady Bradshaw and senior advisors, Desiree Obechina and Julie Fig- liolino. X 'Im Y I ul sw.e .. ..i.,, gs, wtf, . .wg . jst N HERO Aspires For GMI-IS Brady Bradshaw another FHA member listen intently to FHA members pose for the photographer. Another class Witl'l initials, stands for Home Economics Related Occupations, which doesn't stand for cooking alone any- more. It included interior decorating, child development, food service and health care. Students belong to a HERO class and the club. Alongside of that they held part time jobs outside of school. They met twice after school for club meetings every month. Their goals for this year were to cater a luncheon or dinner, have an employer-employee ban- quet, and with Bud Simmons, theatre direc- tor they held a dinner-theater night for the fall play. It was a great success even though there seldom is a great response from the student body for an activity besides an athle- tic event. HERO members pose for the birdie. Desiree Obechina looks over lecture notes with another FHA member. HERO - 121 Jennie Aaron Kim Abbott Christy Abood Jay Abbruscato Linda Akey Karen Allison Gordon Ambrose Debbie Anderberg Kristy Anderson Scott Anderson Teri Antley Tonya Archibald Pat Armstrong Kelly Asato Lana Athanasiou Todd Attwooil Kenny Baca Kevin Baca Nancy Baca Alan Baker Kirk Baker Robert Baker Deanna Barrett Cort Baski Cherie Bassett Dawn Baum L Debbie Bauserman Michael Belt Greg Belvill Felicia Benavidez Eric Benefiel Mark Berry Rich Betz Keith Black Leland Blatter Bob Blea 122 - Sophomores Sophomore Vice President Carrie Bradsby ,N Lori Bock Rick Bch Wendy Boness Garin Boso Kevin Boso Sandi Bosrwick Sheryl Bostwick Allison Botkin Tammy Bouril Heather Bower Ann Bowers Brad Bowers xx a ,, X it - -.er Sophomores V fl Sophomore President, Ricky Gray J Sophomore Secretaryffreasurer, Tara Cronin li' rar l N X I -i : ,F ia r 4. ,Q ., - 'ff ' Mark Bradford i ' Carrie Bradsby Gina Brady Correen Brand Chris Brewer Joanna Brewer Lisa Bronowski Todd Brown Todd Brown Cory Brownell Steve Brozovich Lowell Bruton rr Q L Q 'Ta x l N3 L Marylee Bryning Linda Bashar Todd Bubliiz David Burbach Lori Burghardt Gary Burich Scott Bush Frank Busnardo Bob Butzen Sean Caldwell Tawnya Campbell Tracie Campbell William Causey Charissa Chamberlin Mike Chambers Tracy Chreste Pam Cisneros Brice Clarke Karen Clinton Heather Conn Kathy Connor Scott Cornish Tim Costello Wendy Cox Michelle Cray Tara Cronin Clint Cunningham' Julie Danaher Jackie Davis Rhonda Danzeisen Lisa Daunora Lisa Davis Lynn DeBroder Dan Deibert Dini Deibert Doris Delaney Sophornores Laura Delvloye Todd Dempsey Paul Detary Cindy Dick Jack Dowd Deneen Drake Jamie Dunn Tonya Dunn Jerry Edmondson Kris Eichenauer Mark Erickson Liliana Esquedo Tina Evans Nancy Fairchild Wayne Felix Charlie Feree Tim Fischerr Tad Fisher Tim Fisher Robbie Flageolle Chuck Florian Laura Forlenza Meredith Portman Dee Anna Faust Jeff Fowler' Tristann Freehafer David Galiagher i 'James Gates Stephanie Gates Merrill George Kevin, Gibson Chris Gifford Julie Gilliland Hal Girk Katie Gleason Diana Glose 124 - Sophomores wk' A math studenfs hand reveals the formula for his success .1 M X if f' 1 .iq.: l - Todd Gonring Dan Grant .Ricky Gray ., ,Ben Green J Nikki Grommet Suzanne Grout Cindy Grove 'Barbara Groves Stephanie Gruhn Guy Gunther Dave Habenicht Lisa Haberkorn X bw QM M 'Wg 5 af? 5:- k g -fr The Hidden Advantage Have you ever wondered how many other students at your school participate in, shush, cheating? A survey was taken at Green Mountain High School on the subject of cheating, and believe me, you are not alone. For those of you who haven't the slightest idea what the word cheat means a definition has been provided: to practice trickery or fraudg to act dishonestly. A cheater is one guilty of fraud by deceitful practices. The best example for the word cheatable table to be defraucledl would be the majority of the teachers at Green Mountain High School who work busily at their desk grading pa- pers while students drag out the old cheat sheet. One student, no names mentioned for obvious reasons, states the many techniques he relys on. Personally, the best way for me to do it is to sit on your cheat sheet and just kind of squirm a lot. I also like the notes on the hand bit but it's more noticeable and if you donlt have it mas- tered it's easy to get caught. A social studies teacher at GM!-IS, Ken Boerner, told the method he thought was most ingenious, a student used two pens and a rubber band on each end to hold his scroll like notes in place. The only reason he got caught was the rubber band broke and shot across the room. Now for the survey. Ninety-four percent of the students here have cheated on an exam at Green Mountain. The class in which they chose to cheat most often in was math. When asked if they knew cheating was grounds for suspension 8801: replied they did not. tfr 'ff---f, , 2, ' Derek Haberman i,i Holly Hall N .5 3 fi , ,V ' Maureen Hallacy I Larry Hancock 'i g 'J Kecia Hansen 5? my Amy l-lanlin f eg T V V ,fy Chris Hardin M Y, ,, ini' Mike Harlan Julie Harrington . Tim Harrington Q W' Therese Harris rp 1, i 1 i 3 Trisha Harris sl W , .,r, , Michael Harvey Shelly Hassen Ann Hastert Kristi Hathorn Paul Hawley Lisa Heaston Dorene Hedin Traci Heinz Lisa Heithotf Roberta Heller Jon Heman Dave Henderson Michelle Herman Sheri Hess Bill Hill Julie Himstreet Karen Hobbs Jeri Hochnadel Christine Hollop Dawn Hopkins Pat Hower Stacy Howie Kent Hubbard Matt Hyman Chris Ismailidis Kelly Ives Trevor Jacklin Kathy Jahns Mark Jariney Tanja Jansson Nanette Jaure Lisa Jelliffe Cristin Jerinett Clark Jensen Tony Jimenez Roger Johns Sophomores Carolyn Johnson Erik Johnson Harry Johnson Jill Johnson Darin Joko Curt Jones Glen Kelley Devin Kerr Tracy Kimball Dave Kish Jenny Kiteley David Klein Craig. 'Knott Jim Knox John Koehler Kari 'Kfilleth John Korb Bryan Kortum Doug 'Kouril Beth Krahling Janay Kroneberger Regina Kroneberger Jenny Kundred A Pat Kurtz Casey Kuypers Bernie Lange Mike Lange Paul Lange Paul Langfield Tammy Larsen Brian Larson Amy Laughnan Matt Laumann Cary Lehigh Teresa Lenway Laurie Leonard 126 - Sophomores R Mark Kinney and Tom Boos show suprise at then' pucture bemg taken Becky Simms and Forrest Mars take tame out for a snack by their locker. Robyn Leonhart Chad Lewis Chris Lewis Kym Lewis Jason Liechti Denise Long Robyn Lopez Leonor Lucero Lisa Lucero Kathy Lynch Shawn Macaluso Steve Madden Dana Thomlinson catches that Pepsi Spirit before play rehearsal. Gary Mages Karl Malakian Jenny Malone Lori Malone William Malone Nimon Malouff Lisa Marrama Forrest Mars Amy Maschke Leslie Mathis Tony Mathre Arnie Matson 4 . ,.,. e- 2. X ik . S g i ' was x 5 N fa is 'H xl Q i as , fl Q Y-B., nf' 'mi ', . A :- if Eg as fr Sa., 5 'ti' J i Viv J 1 J Jeff Mattingley Mike McAlister Kathleen McAnulty Bob McBride John McCaslin Samantha McCluskey David McCullough Davin McDill Jodie McDonald Michelle McKenna Jim McKown Carol McMordie Scott McMullan Rod Mead Steffen Mehnert Michael Merschel Tom Meyer Stacey Michael Julie Michel Donna Miller Kris Miller Michelle Miller James Miller Randy Mills Elaine Moe Mallory Moore Geoff Morris Kristin Morrow Kelly Murphy Mike Murray Charley Myers Paul Myers Kevin Naughton Todd Neel Dawn Neelands Mike Nelson Sophornores Peggy Nielsen Rochelle Obechlna Jim O'Oell Elaine O'Doherty Kami Ogden Joe Olvera Nadine Omasta Bren O'Neill Jerri Oreskovich Lisa Osborne Erik Oscarson Tom Owens V Brad Palau. , Fran Palencia Kristi Paris Chris Park V Pam Parscal Christi Parsek Karen Parsons Valerie Patman Sonya Patterson Jim Pearl ' ' Marcia Pedersen Jeff Perkins Jody Perry V Robert Petersen Dee Peterson Doug Peterson Steph Phillips Mark Pijanowski Litta Plant Kim Post Janet Pratt Denise Prew Chuck Puma Dacari Purvis 128 -- Sophomores we WE , 7 1 nw V is 1 - B' ,V , ,jr I ,, m v .M s ,se 'QW Ted Jones, senior, descends from the school bus for another day at school. Stephanie Grunn momentarily loses her con catalog. Cheryl Quinkert Jill Radecki Mark Ratner Doug Rasinski Scott Reed Jeff Reeser Sherri Regenwether David Rich Charles Rich Steve Rickett Lauren Riley Bill Riley w W ' ff Y ,K , ,f , MMU 1 V- , f is W I fs 4 centration at the card 1,1 -75 ., V in if rw ' 4 1 f ' ff -s ff , S T W ' 2 3 Mi 7 if lg iw 5 K lxw-a A Decade Of Expansion Four wheels roll down the newly poured cement to' ward the yellow school bus. A cane guided by its owner, moves through the halls with a sense of purpose and belonging. Green Mountain is ever expanding its pro- grams for physically handicapped students. When Green Mountain High School opened in 1973, it was equipped to handle wheelchair students. Nancy Groth was its first student in a wheelchair. The wheelchair students this year are Brady Brad- shaw, Ted Jones, and Sharilyn Russell, who are all seniors. In the past, these special students have come from as far away as Westminister. This year, Brady Bradshaw rides the bus in from Arvada. He thinks the best thing about Green Mountain is the atmosphere. The friendly students and teachers will help me it I have a problem. They'll pick up my books, open doors, or move out of the way. Rita Couture said of Ted Jones, 1-le's a picture of courage. Sue Cielans, a freshman, and sophomore Lisa Davis are the schooi's first blind students. They have an aid who puts class notes into braille for them and translates their work for the teachers. Both girls have gone to some public schools in the past. I really like it here, re- marked Sue Cielans, She said the teachers are good about talking during lectures and not just putting notes on the board. Lisa Davis said, The students are really helpful They don't make fun of mefl The people at Green Mountain have been very ac- cepting of these students and have tried to make them feel at home. It's a privilege to have them attending here. Katie Gleason stated, I think it's neat we have handicapped kids at our schoolf' dl' S S N x Jody Rivera - Q .v 'S is Kelle Rivers A .,. - ku -I Q Bret Roberts 'kzk t -I --:- ' qqli' X .T 5' Erik Robinson - K .ll T Tobin Rockley Q., Z :i'll Sharon Roehm if i . i J t i in ' Jill Roghair 1' 5 A Melissa Rohe A f,.. q hz 'W Lisa Rosar Tim Ruel Erik Runchel Darla Sabin erik . i ,, X i r s lx WL I is .QL ... K Q A SS' it gi' mi S521 st N tg x s X g f. A . A iri . 5 SM i h .gr ff, r . .. Vicky Salwerowicz Susie Samuels Don Sant Karen Sattler Lisa Saxton Walt Schattinger Terry Schneider Heiki Scholz Richard Schottler Mark Schroeder Cheryl Sears Julie Seberg Mark Seidel Missy Sherman Aaron Shipman Darin Simmons Becky Simms Chris Slater Suzanne Small Liz Smith Mitch Smith Mike Smith David Snelling Heidi Sofia Scott Sparks Mark Stanley Scott Stanton Mike Steckley Rob Stephens Tina Stewart Bill Stordahl Rhonda Strepman Duane Sutlift Ron Sutton Sheree Talley Denise Tallmage Sophomores Paul Tariosivicz Paige Taylor Traci f Cozette Terkelson Susan Terry Candie Tlihqmas Debbie Thomas Matt Thomas Scott Thomas Ray Thompson Dana Tomlinson Liza Torres Shafon Tari Tucker ' Diane Vega Ronivigiljif ' Steph Volz Jenni Waddell Lloyd Walker Heidi Wallace Ken Walters Bryan Watson Scott Watson Tammy ,Watt Michelle Wevvl Mike Weyneih Kathy Whiie Steve Willoughby Jim Willson Terry Wilson Gary Wing Don Wood Eric Woody Jenny Woolley Lisa Wooly Cheri Wright 130 -' Sofghomores i QQ Tari Tucker squints to see who s coming up the sidewalk Steve Willoughby sits with some junior friends during lunch Tim Wright Todd Warm Dalen Wyatt Darcy Wyse Barbara Zaraie Barb Zimmerman Vicki Zion Scott Zuerker Ten Years Of Change Looking back ten years, GMHS resembled a construc- tion siteg there was no landscaping and it had a dirt parking lot. The school was clean and new, but uninter- esting graphically, as none of the murals were done, said Steve Meininger. We brought a sack lunch because the cafeteria was not finished, stated Jan Huling. Some of the teachers that helped open the school can remember these happenings as well as their original goals. Dennis Shepherd mentioned, I wanted to help intergrate computer programming into the mathematics which we have done to a certain effect? I was so glad to get a job the I'm a bit embarrassed to admit that my goals were self-centered. l wanted books for my American Short Story classg I wanted the MSLM war in my 4th hour class to stop, said Kathie Starkey. Additional changes in teachers have been their teach- ing techniques. As Tom Perault expressed, I learned throught experimentation that first you must have the students attention before you can teach anything. There- fore, I have become more of an actor than I was ten years ago. l was a student here, just our of Dunstan Jrg Highr If someone had told me Fd be teaching here in ten years l would shavebeen shocked, not just surprised, said John Miller. s Also vouge at the time were raggedhtattered, and torn clothing of all descriptions: mini-skirts and remnents of military clothing. Mini.skirts represented so much to teen-agers: a chance to be themselves, to be daringfto lrebell in an acceptable way, among their peers, ,re- marked Patti Cappellucci. A ,S f Not pictured Diana Alley A Daniel Baker GregoryrBarnett Karen Boos Melinda Corbett Lisa Doran i Kimberly Elliott Brian Haar , pho tes A tliagyegf the teachers who teach at GMHS today began here ten years ago when GMHS Cathy Ayers Todd Dozier Dorene Ehclin Amy Figler Kelly Flint Bob Hawkins in . ,., Q rss Suzanne Higinbotham Paula Houston Jackie lsaacson Brenda Jones Andrea Joo Shawn Moody Staci Morley Eddy Rodriquez Deanna Rupoli Laurie Schmitz April Summers Kevin Thomas Amy Tirre Debbie VanDyke Eric Halton Michaei lngram Efim Litinsky . Ronald Luft Charlesflvliller I Greg Miller Deanna Montoya Kara Quinn L Melinda Rasmussen April Rickey Kelly Riley, Steyen Rontti Kenneth Sagee Dawn Smith Raymond Vigil Robert Wagner Sophomores - 131 Muchael Dunn looks m makes a funny face on her ,.--MN 132 - Candids Kelsey Knapp proof reads her paper for Contemporary Holly Ropes questions someone about a Math problem. A,,,.....Q-A Nancy Gonring talks Jared Saunderson smiles at a Sonja Roernish and John lunch-time outside the camera. Marcy Miles concentrates on her Steve Chase advertises for the Tylenol company. SPGRTS Football ..AA.......4...,,,,...AA 136 Cross Country . . , . . . . 140 Gymnastics ' , .- , 4 . . , . 146 Soccer ......., . . . 150 Tennis ., ...... Q ... 152 Girlsf Swimming , .g. . . . 154 Volleyball ....,., . . . 156 Golf ...i,.. .M158 Boys' Basketball .... . . . 160 Girls' Basketball , . . . . 164 Boys' Swimming .... . . . 168 Wrestling ..,.,... . , . 170 rf ,-,f sv' 2, 7, l..0.v-rg, 'For owe dawn peYNlQr49d jvq BQNQQ., awsome.'X'kovskS go, -A-he Xo.v5h.5 -KB 9QO.Y. 0h d.ovx+ 512+ 4-ob horn, 'rxrxd SNJYVNYVXQY' Q-5 OVQY' plciqhy 3 ONS you warg, NN-4 Bkxx W5 kbvwi 3 50+ M961-4.x-Kew Q wif 3 0 d on Q. ! imifw 'nm' .L ,ff ,, Vf' ' f 1 , W!! My A HY ,f KM , . 5-,H,5g73,xPiffj,A5l fz T' 421 , A v ff-rf 4' fa' 3 54' 'fzf' ff ,MM f X f A V' ' ,r Z' fm aEgQ,fff:,wy'f,,C 1 in ,gg ,! gfV, ,X ,, . 55,2 . ML W,Vf,, , V az at V 5 w'K'f2fZiW12 ' Wf 5- Dow ' PCv.vA'5 ' ff' W V00 wx vck , ,. ,f ,M 1 Mag ww gf gli ,J f 1 ,- 'M Y ff lg,, '51 ' ' filly' 555, 55 + ASK , 173 A. if vgfivf J M Q. WfW k, K3 W 5555? If 1 ' ,I Q1 Ah, V , ,, Vx f , 55, 7 ,,,,, 4211 Q Lg, , I- if ' 32,39 1 fr M' ig? L , fx 1 3 1 3 1 T , 'L 1 f H ,f 'L if W, 31 K M n . W it 5 L f, , an , ,,,f 9' L, ' x ' my 4 N f - Mya, Q., I Y WW fa A V ? 1, V ,,Q,,, M 14 ' I Ni W , Wifi? 5' Afkffwf f f f Division Champions GMHS' Varsity Football team com- pleted their season with a 5:5 record. One player commented that the team could have done a lot better, but a lot of strong, valuable team members graduated last year. The head coach was Don McGatlin GMI-IS P.E. teach- er. Most players felt he was a good coach and well liked by the rest of the team. Some of the season's more aggres- sively played games included the game against Grand Junction Central. The final score was GM 33, Grand Central O. Two other impressive games were against Golden 138:61 and Bear Creek f49:3l, The other two wins were much closer in score, but the team still managed to bring victory to the school. In fact they won the divi- sion championship and made it to the state playoffs, where they lost in the first round. Their final record for the season was: Opposing team:lGM score: Their scorel ---' Pamona:l6:12l, Grand Junction Central:f33:0l, Arvada West:l16:20l, Columbine:f0:20l, Lake- wood:f17:2l, Wheatridge:l27:12l, Ever- green:f1O:7l, Golden:f38:6l, Bear Creek:f49:3l, Pamona:f7:24J-State playoff game. Front Row: M. Hoeter, B. Rogstad, S. Burns T Ellis S Rons D Hoffscnider K Eggleston E Clarkson, D. Langton, A. Flores. Second Row: R Benavidez E Nelson R Boutot T Richardson R Rivera, E. Bennett, P. Wilson, J. Grant, D. Shallenberger M Linne T Walmer Mgr J Morgan Third Row: D. Burseth, B. Weber, V. Stillman, J. Volpi J Lehman J Chavez B Keiser D Lawler M Pijanowsi, M. Young, VJ Greco, Coach Mean Mead Back Row Coach Cronin J VanDyke J Brehm L. Prybil, J. Kinney, J. Weems, J. Wanser, S. Lewis D Smidt D Kasel R Klein T Trotter Coach McGatlin. Eric Bennett takes a breather on the sidelines for a few minutes 136 - Football Wmnmg Goal Tim Walmer was number 62 on the 1982 83 varsity football team He played guard and was the place kick er Walmer has played football for all four of h1s high school years He ad mits football is his favorite sport but enjoys almost any sport He also plays baseball for the Rams Walmer was selected to play on the all conference team and was also se lected as player of the week during the season. Walmer commented that his most memorable game was the game against Evergreen because it decided the team that would be division cham- pion and besides that, he continued, I scored the winning field goal. Tim Ellis waits for a time out to be put back in the game. Football - 13 Successful Seasons The sophomore football team ended their 5935011 with 3 f9COI'd of five Wlf1S and The team watches an exciting play on the field. three losses. Some of the major victories they experienced included the games l against Golden, who lost 30:0, Whea- tridge 14:2, and Evergreen 33:13. Their head coach was Steve Blair. The Freshmen team record showed a season well played with four wins and two losses. Carrying them through the year was Coach Ron White. The sophomore team record was: Pa- mona: l37:13l, Arvada West: l6:19l, Col- umbine: l1O:17l, Lakewood: l2O:34l, Wheatridge: 114121, Evergreen: l33:13l, Golden: K30:0l, Bear Creek: l6:0l The freshmen record was: Oberon: C49:0i, North Arvada: l19:0l, Arvada: C42:6l, Bear Creek: 122125, Deer Creek: K6:12l, Moore: 101391 Front Row: K. Baca, R. Mills, C. Ferree, J. Willson K. Baca, S. Caldwell, T. Bublitz Second Row: D. I-laberman, M. Murray, S. Sparks, S. Reed, G. Wing, T. Ruel, S. Cornish, E. Rodriguez, Mgr. R, Boh Back Row: Coach Dryjanski, Mgr. S. Hassen, G. Burich, W. Schattinger, L, Hancock, D. Sutliff, S. Madden, J. Perkim Perkins, M. Laumann, K. Baker, Mgr. L. DeBroder, Coach Hindman, Coach Blair, Knot pictured: S. Zuerker, M. Smith, D, Sant, D. Jokol Front Row: B. Gwinn, C. Parker, M. Worrell, A. Yarnell, V. Hellem, M. Saxton, T. Ellis, R. Grant, S. Witham, Second Row: S. Pecikonis, B. Schneider, G. Smith, R. Murray, C. Vigil, T. Jamison, E. Schaller, T. Karsten, N. Marcheso, J. England Back Row: Coach Cronin, T. Boos, D. Lawler, S. Ester, R. McCuskey, J. Buchheim, M. Day, S. Ricigliano, M. Steckline, J. Miller :WNQQ-Pglxucg.. W B-X Sql, 0 rf gr: 138 - Football is if ' 1: 'W .,,.,, ,M f W 6 Tim Walmer and Ron Keller rest on the bench for a few minutes. The sophomore football team during the Homecoming Parade. The stands go crazy after Green Mountain makes a touchdown. Football - 139 -LSE ,. , , X V- ', 1 V- V m ' ' V ' at .. - , 'V f A - in 'L ? - , I 3 X X ' ,. W .V,., , X5 gig fra: 1-f3ml5ik.V rr ' A V QP, - , :MA W3 ., S: X ,X - fs , k ws i x , , if 3,qgQg 3 ., , K FK' fx-sq -N52 -- V 1 113- Q1 ,e.Vx,,, f V' ' , f , mf -X: V y x :an 'art Y , E -EZ, ,- 1 x : is ',,5.,,'.' .. . A -Y V,, -A we -f ff- X ' x -1, , ae, V , , -' V y ., , V 1 V , X , ff if.WfZZ?1V '-fj'5b3ffV, ' X if V -V ,A ,,,,,,, Vmfm V VV'1Vm.',, V If if ' V - 2 V L,,, ,, VfV if HYVW ,.,1f,5?h X '- L-YZ JVVZJV -V ,,., 'WV V, ', ,-,VVV,f,VV , H , ,, V Vw .,,,W ,M,V.V,, , V VWVM, ,V 'VVYga4MVVaflfmsmV fwW2gf,,,V,f,w,V, , ,V K V' ,,,, 5, , 5 Vw, ,Q ,. wi 'V VwVV:fV,x -Q f-,,, , f :, ',5,V1:'fW2VVfgVVa,,.f,,fZ1,,VV,ti 'V www V,V,,,,,,g,,gg ',f4,,,fffw,VV V mmm, V ,V VV, ,, , ' ' ' ' V' I , VV V, V V 3fVg,,VV,,,yfgi' .af gf V1 V , ,' f ,V U Wh: - W, 1' 9'VfVV'r,,g ffiTgk9fW,,f LW? Wm' 'V A y.lfy,l 'W LVVW1'HV?V'4?'ff'fV2'wZ5A1'1' ' ' I-Fm V f'f5QHV - . V V Q , V ' if ,L nn, w+1,f'g,,,mVe1,,VV5,l 'V,5,LHz,, -V,f,,. V? 4 ,Q, Hz, W V w Y Vffaw ,, ,,,Vj6K'V4 V,,,,,1, 72 . ' Lf J 'VV' Q! Q, ' - V ' Q V , 'A V V'w,... 'V fwuiffi ,,VV ,, , , ' 'V V , ,,,, ' V-' fgfgw -- W, ' md 2- , f'wf VV M , V Vyz ffffg ,,w'1w V., ,,VVVV ' , , 4 , ,, VV , ,, , , L' V Vw V - ,. f ' VV , V 'V W V ,V , 'Q yi' f,, ,- fi' E27 5V 5 554417 BL V W I 41 V 5'f'5i 3' ,QV 3' 1'f,,W'Tt,V' 'irElwQLf5f':f' Vf 9521, :: 5ff::fi:vP ?f'?Z:-' V'VV'::7M 'jf f V ' ' f V ,V . 2 my QV UV V M ' f fm, g ' V' , ' fff f 1 VfV M mf , ,V :W,V4V,,N V 5 , V ,,,, ,A f 'sm f ,fgifl , V K' We ' ' ' ' V ,, ,, 'S V 1 WV 'V T , V , V, , 1 Z if NV ff V Vw 44 W ,, VW V 5 5 , wr VVV1V,mV ,if ,4,,WgVV VV ' V r 2, A W y V 'V 'V V , N.-' 4, ff ,:,V4g',,f:,g , ',,,g,14p,,,V M ,, V, WV ' My , , ,, ' if 'ff VM, MZCIQQXZWL' wp, , f,w,:hV, Vw . ,WV V N QV 1. V V ,. I M ,, , V V, if, J. Zwgiggg v H I I , In 7? 3 i V , . ' ,, ' Y 321 V4 1 2 ,,,mwaV . , -M ,-V11 lfms- , M24 s 7 il -wx V1 VL fc, x ,,VV-uw V VW- ,M VV,. , f V, VV VVVV , 1 V , Q, ,,,,, W, ,, say, , Mfr, , ',,V Mwxm -: gw Q, -Vmiwffffi WWV , ' VV,,VW4e-,,,Lg7my, , ,LW 11 g ,g,vffQ,q,zi 33575 , ig V xg S W Si I X XE. Xb 1. M . R Y- , , Q55 .,.k . R 9 L' R. vi x i . S025 S . . me is - .- .fst- wf i 59' X r fsiwff fi Wir -- my Lf iizrk, f J, 4 :Mime f.n,' r x .1 rye, .rr i m.. . ff -ia 'fr Y is L ,ma ii. if Ami , :mlb , ft . if U tl ' K ai gyfv - f fil l, R f.-if 3. . A 9 M .: Q X ga Q tc? r Pit ' 5 E 4 , t if ff: ,M S -.ig Sw J, ,Q 'jigs 5, r 3 Q Mi J X lx 1 1 A ' L .i5sii'ff.gggi 9raw','wf 7 ry ,fi-fp h .vii-l at 'H .,1 3. t rf 'i'i5riS'Q .flax is , f-'qzzxee' 1,1 - . iifiif' .st gi V. er .2l?'r4xQ'fA ,gf 73,-ty K -f f aiai wteitrf :f:x:.f', 4 , ,, ,V fia.ff's-fa, 1,4 ' ' '12 ,, Afrifbttxwa '- :ve lc- ffgiizzzisw i i - .,,,- we y l i Stay With It 'iWhen I was a Sophomore and Junior, we were expected to win state. This year, we didn't have any top notch individuals, but still we won it, stated Rob Spykstra, senior. He was the boy's Cross Country team captain this year and has been to three state meets. He scored for the team in state for the first time this year. Spykf stra said, I was more of a spectator the past two. Even after hours of practice, Cross Country runners still go through the same paing tired legs, breathlessness, and aching arms, The big- gest thing that Spykstra has changed is not chok- ing. He said, Last year l got really psyched out. l wasnli ready mentally. I learned to discipline the mental, Spykstra commented, lt helps when you have people there. That's why we won thatf' gatriw f ,- s vi ug, cs l I Hustling Harriers Guys join the Cross Country team for many reasons. Running clears your mind and makes you feel good,', remarked Burt Nelson. Rob Spykstra said, You meet so many people from other schoolsf, Chuck Reid's reason- ing was, One, because I like to run and two, the team was a lot of funf' The season began in late August with camp at Breckenridge. The boys and girls went at the same time. It's a different type of running than practies at school. They tackled such obstacles as Argentine and Georgia Pass, ran the trail to Frisco, and took the path to Mohawk Lake that ended in an icy swim. The alumni go too. You get to run with people that are really good, stated Rod Schreiber. It,s a time for the team members to get to know each other. lt's a neat way to start the season and we get a close knit team,'l said their coach, Dennis Shepherd. Team practice usually ran from one and a half to two hours long. They averaged five to eight miles a day and had a variety of long runs, speed work, and short intervals. All of these different tools helped to build endur- ance. On your own you learn self discipline, mentioned Spykstra. It takes a long time to get ready for the meets both physically and mental- ly. I think about the meet a week ahead and set goals for a time. I also wonder how many times Illl tripf' said Nelson. Competing usually helps the runners feel more confident and strive for better times. This year, the guys in Cross Coun- try were a team. They worked hard, pushed each other, and had fun being together in and out of practice. Both the Varsity and Junior Varsity had a good season. Their sport doesn't get as much support or attention as some of the others, but they are good ath- letes. As Shepherd said about the meets, The people that come are the ones that want to be there. Front Row: Mike Lane, Scott Tanner. Second Row: Burt Nelson, Rod Schreiber, Rob Spykstra, Tom Billings, Jeff Mages. Back Row: Coach Dennis Shepherd, Junior Varsity: Tim Spath, Mike Harlan, Karl Mann, Chuck Reid, Eric Wood , Jim Knox, Brett lngram, Dallas Eubanks, Greg V Meyers, Todd Hanson, Coach Ann Conley. 142 - Cross Country gr iw N. V .. Ay- , K Q A il .E f ,rua , is W ff. . sw Dallas Eubanks, Todd Hanson, and Greg Meyers prepare for the B-squad race to begin. S i , I E 1 , 5 . im 12:5 fi V51 Zigi, if, wp, Greg Meyers iV3fS1fV Season Scores :ifmizira hieoh Anapahqelnv. 2122 . South Dfweffco L 1155 Qi R0fifv Inv. V 3f2Si J i 1 3f?5 1 Li5?ff9f'Beug 14 oeii sfso Jeffco i g i North VsQ South M 2112 m 2112 Boulder veney Bw. h3f1o 5110 h 'Pikeg Peak Inv. 1115 3114 e 1 Alameda mv. 16122 NS 4 Jeffco h . District 1 League'Meet 1112 ' 5112 State Meet 1122 1 N5 Mike Lane catches his breath while waiting to receive his place. Cross Country - 143 'Shepherds I-Ierd' Cross Country is . , , 'iGroup unity, hard work, and friendship, said Ke- leen Huang. The season began with camp at Breckenridge. The practices were fun but challenging, as the aver- age mileage during camp was sixty- seven miles. Some people got sore necks from always looking at the ground, but It gave the girls a good base on running. I joined Cross Country because I wanted to compete against girls around the county and state, said Jo- die McDonald. By the time the chance for competition came, they had been practicing for over a month. I was so excited for the first meet. I can't ex- plain how good it felt to finish the race. After all of the build up and practice, finally putting it to use. stated Micky Cronin. It takes more endurance than power to be a cross Country runner. The girls team had a lot of talent this year. Mc- Donald said, Itls fun and a lot of peo- ple should come out for it. It's hard if you make it hard. Kelleen Huang pushes to reach the finish line before her Alameda opponent. CQ-A' .A H A QQQ3.. M... fx- K 5 Front Row: Micky Cronin, Coach Ann Conley, Karen Sattler, Robyn Lopez, Kelleen Huang, Marina Velasquez. Back Row: Dini Deibert, Coach Dennis Shepherd, Angie Nelson, Laurie Wilson, Julie Campbell, Julie Hall, Angela Shirley, Jodie McDonald, Melissa Rohe, Allison Botkin, l l 144 - Cross Country X XS iii Ei 3 M A .. .., of .. ,wp st fs --for . - . -. 25 N-. . ' x 3. r 1 an 3 59 London bridges are falling down on Kelleen Huang. Q sativa Hail qwhen 2 started Cross Country as a Sopho more 1fWHS1Q32ly'iUiqfQ0Q ismgbhageifortraclg As the season went I began in may Crass Coafrify as ite own individual sport fi' said Julie Hiiilil Senior, Sha W5 6213128511 of the girls 255111 this gear She hasfhmrl lots ei help io the beam arxdune ofher best. races was at the-ifehgue and Hvazaefda mess., Hail psacflhed shader rims :wer flue sumiiier and drclnf go to camp in top shape Sha fit reaiiy the hard practices at the bagxnmng at fha season helped he? ,Hall stated 'Fl-le things 1 like best about Cross Country were the friend ships we all sharedfa' fic aff you Green Mountain Harriers of Shep- herd s hezri i just waht to leave you with one last ward Always set goals and reach for the sky Run f e the wind cause you know you fan fly! Allison Botkin runs in good form. f f Q i fs Y f 'ffw , 2 f fa 1' if 2' 2 12,1 w 151223 ziiim i gi QW E2f21Sl2'52xElw? Z YVUP W'f2Q'Wi'::l M52 Dzmr1gi.rL:MlgfM , -' 1 'l .wrt .Q Www lwtgfz l L. gwmwl qui ,wwzz :gi ' gen, ' -':3f,,:,fr2ff V .fyy 'f,f?.l1g ad? i l W4' T21 l,l' . W l l o ,fqli . S gig ,V,J, V k ,K 4 1555, Hy ,, . lll, l Making it to the top of the hill are Marina Velasquez and Dini Deibert. Julie Campbell streches out before the race. Girls Cross Country - 145 League Second, Earned Balancing precariously on a length of wood five inches wide and four and a half feet off the ground, flipping up- side down in mid air and landing per- fectly right side up, and spinning around two small uneven bars without using hands to hold on are all the things talented gymnasts do. There are other events besides beam, floor, and the uneven parallel bars, but these are a few events the GMHS gymnas- tics team competes in. This past year Coach Richi Brown began holding practices after school was barely even out for the summer. These gymnasts were't ever really away from school, as they had a camp for five weeks in the gym. They practiced five days a week for four hours every morning. Then in Au- gust, they began the actual season work-outs. These practices continued once school began until November 13, at the State Competition. Between September and Novem- ber, they participated in thirteen chal- leging meets, and took home eleven first places out of it. A very special thing that happened this year was the gymnasts took first at the Fort Lupton invitational. Other exciting things for the team were taking second place in the league, and they received a trium- phant seventh place at the State Com- petition. Individual honors were bes- towed upon junior Sandra Watson and sophomore Michelle Wewel by qualify- ing for state. Watson also received first in conference. Summing up the season Brown commented, The team worked really well. They had to work harder than many teams because we just didn't have all the top notch gymnasts other schools do. Besides, other schools ,. , . - -fr -- +'-:-w--- Imsw- m sums., Coach Brown watches Leanne Longnecker do a flip for style pointers. Jenny Miller mounts the uneven parallel bars. 2 E Leanne Longnecker performs a difficult movement on the beam. Suzanne Hermanussen practices vaulting as Coach Richi Brown spots her. Gymnastics - 147 Team Support Great also have club groups that practice the whole year. The gymnastic team had twenty- four members including seniors-Janine Hesterwerth, Suzanne l-lermanussen, Vonnie O'Connell, Angela Mantei, Lenae Logan, Any Trujillo, Wendy Hubbard, Leanne Longnecker, and Reeshell Crawford: juniors - Caryn Mansch, Stephanie Sparr, Kristine Amholt, Sandra Watson, Jenny Miller, Karyn Wollenhaupt, DeeDee Stevens, and sophomores - Teresa Lenway, and Michelle Wewel. The Freshman Gymnastic Team also had a very successful season. They won four out of their six meets. The team consisted of 15 hard work- ing girls. According to Tricia Ernest the team had a great season and showed a lot of improvement. Karen Burbank attributed to the successful season. Competing as an all-around gymnast, Burbank had the highest score lfor GMHSJ at every meet. The team agreed that Miss Brown was an excellent coach that encour- aged us a lot. As for next year the girls should be a tremendous asset to the varsity gymnastic team. The fresh- man team included Patty Fitch, Tammy Hughes, Karen Burbank, Diana Turzynski, Shirlyn Ward, Gina Wolfinbager, Karin Bates, Sam Juara, Tami Brown, Sherry Sachdeva, Tricia Ernest, Vicki Mitchell, Laura Scott, Jill Campbell, Carol Cason and Asst. Coach Michelle Wewel. ......ai,rm,f1,f ff.ff 7 -r,-r, - 1 rr Leanne Longnecker practices her routine on the beam. An inspired gynnast does a back flip during a floor routine. Angela Mantei watches Suzanne Hermanussen fly over the mount. Janine Hesterwerth does a flip on the parallel bars. Gymnastics - 149 Soccer Wins League The 1982-83 GMHS Ram soccer team had a very impressive, successful year. Finishing the regular season with an undefeated record of 9-0-2, the team captured the league title in a game against Arvada West, making the final record 10-0-2. According to varsity coach Peter Mehlbach, GMHS has established the best record in Jef- ferson County since 1978. Perhaps the most remarkable as- pect of the League Champion team however, was the fact that no one ex- pected GMHS to do so well. As Co- captain D.J. Ruder put it, We sur- prised so many people! But where did this Cinderella team come from? Mehlbach attributed the success mostly to team discipline, and a lot of hard work and practice. Senior Mike Stephens agreed .and added that determination and the mental and physical conditioning Mr. Mehlbach taught us all led to success. Another factor involved in the unde- feated season was the team closeness. We gave a strong effort as a team and not as individuals. Ruder stated. But although the team depended on their strength in unity, there were also 1 - - mr umm. some outstanding individuals. D.J. Ruder, senior, Steve May and Ricky Cudworth, juniors, and Todd Neel, sophomore were selected for the All- Conference team, first team. Neel, goalie, became the first soph- omore to be selected to first team all- conference in Jefferson County. Rud- er was voted most valuable offensive player, Cudworth most valuable de- fensive playerg Neel most valuable player, and Tom Parisi, senior, was voted most improved. As for next years team, Mehlbach commented that only five seniors would be leaving, ten lettermen re- turning, along with 3 all conference players. The J.V. soccer team completed what coach Dennis Hastings called an unpredictable, but basically success- ful seasons.The team finished with a 1-3-3 record. The team was the best bunch of kids I've ever coached Has- tings continued, They learned a lot and will make good varsity players. Sophomore John McCaslin com- mented, lt was a great experience and l'm really looking forward to next year. i ' 'N K Stair WI. I . ,,.. . . . . l Chris Cole heads the ball to Andrew Meyer Varsity: Front Row: P. Velasquez, S. Michael, Coach Peter Mehlbach, T. Gonring, S. May. Second Row: G. Kelley, T. Parisi, A. Meyer, D.J. Ruder, A. Geist, T. Neel. Back Row: G. Gunther, D. Smith, R. Cudworth, C. Cole, M. Stephens. . Junior Varsity: Front Row: P. Hawley, J . Burk- holder, F. Busnardo, S. Cox. Second Row: S. Jen- sen, D. Henderson, P. Yale, Coach Dennis Hastings, A. Geist, T. Gonring, G. Kelley. Back Row: R. Ste- phens, G. Paseka, E. Jansson, J. McCaslin, B. Lar- son. f l ' so K .. Kipp! 5. 4 sw r QL ra Ruder Scores Senior D.J. Ruder was a remarkable asset to GMHS' League Champion soccer team. Playing varsity since his sophomore year, Ruder reflect- ed that dedication and hard work pay off in the long run, Honors to Ruder include: voted most valuable offensive playerg selection to the All Conference team, first team, and selection to the State team, first team. Also he finished fourth in the league in scoring. Co-captain along with senior Chris Cole, Rud- er attributed the years success to team close- ness, and the fact that everybody wanted to win this year. Ruder began playing soccer in sixth grade and has played on CSYSA teams for 5 years. He admits his first love is soccer and more soc- cer. During the season everything takes a back seat to soccerfl Rucler gave credit to coach Peter Mehlbach who Utaught me more than anyone. ,My , V Ly rw If W W1 ,W ,, f , , V! ,W , H wifi f .Q ' ,wt rf ,, W ate xi f f Z Experience Building The 1982 boys Tennis Team en- dured a rebuilding year, which should place them at the top of the county in 1983. This year, the team's record was two and nine. The coach accounted for this because of the inexperience of the team. Also, the team had even dual matches and one district tourna- ment, where they placed eighth. As Coach Weaver stated, This year's team had the hardest workers on it, and the team was very coachablef' Weaver also said that if more people had turned out for the team it would have helped, The Ram's squad contained only four lettermen from last year. They were Larry Maass at -732 singles, Jeff Pietsch at 33 singles, Chris Harvey and Jeff Werned at Jil Doubles. Next year's team will posess the tal- ents of eight returning lettermen, in- cluding sophomores sensation Steve Willougby, who displayed flashes of brilliance at the highly competitive 9951 singles spot. Also returning will be Werner, i?2 doubles team Troy Tyson and Jeff Shearer, f7lf3 doubles team Bryan Kor- tum and Chris Park, and 9954 doubles team Tom Meyer and Scott Anderson. These eight should provide a solid nucleus and the addition of Freshman Bill Peterman and Curt Vigil should make the team a contender for the Jefferson County title. Willougby feels student support at matches is neccessary for succes. We defintely play better in front of a crowd. Q , 1 ..... V V I... ' -wan-My -'W-...,,,g-www. T'w.N i i 1 bw'-7-W... ....c,?.-MQWWWMVL-M Q T 5 X, Nw--.....,, .uf W Steve Willougby shows Coach Weaver the height of his serve. A doubles team practices for an upcoming competition. Athletic supporters came in many forms. Tennis - 153 League Record Perfected GMHS girls' swimming team took second place in the league this year, the highest place ever since the swim team was established. They lost to Wheat Ridge High School, who has won the title for eight years in a row. Cheryl Cartin coach, described the GMI-IS team as being incredibly ner- vous and WRI-IS as having the com- posure and championship qualityn to win, Where we lost the meet was in the morning prelims. We out swam Wheat Ridge that night performance wise, and we drowned them in invitation- als! Cartin pointed out. Cherry Creek and Arapahoe High Schools were the only two schools to triumph over GMHS in the duel meets, and the final was 9-12. The league record was 5-0. They also had a total of ten girls to qualify for the state competition, quite a bit more than nor- mal tor GMHS. Next year they have two state divers and five state swimmers return- ing, as well as picking up three other strong swimmers. This should strengthen the team as they are only losing one exceptional swimmer. Ann Comacho, junior, added that next year GMI-IS will be a little stronger' and WRHS should be a Ulittle weaker than this year. Based on the points each person accumulated, Dorene Hedin was awarded the Most Valuable Swimmer. Jana Zamboni received the Coach's Award. This is based mainly on atti- tude performance and the example she sets for other team members. Swim team began practice in mid- August at Green Mountain Swim Club and their season ended in November. 154 - Girls' Swimming The 1982-83 GMHS Girls! swim team Carrie Bradsby flies through the air in a perfect dive. . we .X N X . sf sn' --- is if - si ' Q xg? is as Q , X Q we NN . is gs . -SQQ if i Q. .5 Q is veg in Q N. Q. M c. me 51 sv 'Nik Him 'HSS X . s gvmkfxss. 1 a fs - A few especially za zealous swimmers build a pryamid at a soccer game during half- time. GMHS swimmers get ready for the next event. Karen Mielke dives into the pool backwards, Girls' Swimming - 155 Sub district Champs Volleyball is quickly becoming a ma- toughest competition was the Ever- jor womens sport. Aside from the tra- green Cougars: a team which hasn't ditional basketball and gymnastic sea- been beaten in five years. However, sons, volleyball is opening new hori- the team thought that they gained ex- zons for female athletes. It is a sport, perience in playing the Cougars, by balanced by boys wrestling in Title IX, sharpening their techniques and skills. which males do not participate in at a Denzin commented that the girls state championship level. showed a lot of improvement over the GMHS is honored by having an awe- season. some volleyball team. The team began Although the team played well, and the season by attending a summer was strong as a unit, they had some camp which helped promote team uni- extraordinary individual players. Sen- ty, and pump up their spirits as they ior Kim Harsch was chosen by other were named Camp Champions . league coaches to the All-State team, Composed of twelve young ladies first team. An incredible asset to the ranging from sophomores to seniors, team, she was voted most valuable and coached by business teacher Mick player in th entire league, Denzin, the team finished with a re- Senior Jenny Kroll was also an im- cord of 15-O-7. The girls succeeded in portant asset to the team. She re- capturing the sub-district champion- ceived the honor of being selected to ship title, and made the playoffs. This the All-Conference team, second success was due partly to the team team. closeness, and the lack of competi- The team should be equally as suc- tion between the girlsn Kim Harsh cessful next year, with only five sen- commented. iors graduating and a strong junior According to Denzin, the years core returning. Varsity Volleyball team, left to right: Coach Denzin, L. Jelliffe, manager, K, Worrell, L. Wright, L. So, S. Mohr, J. Kroll, M, Vasey, L, Jelliffe, J. Chavez, S. Clarke, L. Hossack, K. Harsh, K. Ruder, K. Lang, manager. l l 156 - Volleyball , ,M-f Q Laura Wright bumps the ball, Kim Harsch, Lori Hossacl-4, Sandy Mohr, and Jenny Kroll practice hard, Volleyball - 15 Swinging Season GMHS' Golf team played well this year, according to Larry Cole, coach. The team played at several different golf courses throughout the year sea- son, including Foothills, Applewood, Indian Tree, Lakewood Country Club, and Rolling Hills. Although the team had eleven new members this year, Cole felt that the team played well. A coach always wants the team to play better than they did, but we played very well over- all. Cole also added, We had good young golfers. In all the team consisted of eighteen members. They had problems howev- er, Our greatest problem was prob- ably a lack of experience and tourna- ment competition. Cole contributed. If the team members will practice be- tween now and next fall, putting a lot of time into the game, we should have an excellent season next year. Brett Starnes, senior, commented that he thought the team played well and pulled together. We had good team spirit, but we could use more work. For the first time the team had a female member, Shelly Vance. Being the only girl on the team could have been a bizarre experience but Vance, junior, had a great season and even competed at districts. The team was compiled of six sen- iors: Eric Bauer, Steve Gray, Tim Kay- lor, Bret Starnes, Tom Wade and Mike Upson. They had four juniors: David Lojko, Jim Topkoff, Terry Burnes, and Shelly Vance. Finally they had eight sophomores: Mark Janney, John Korb, Jason Liechti, Mike McAlister, Jim Pearl, Kevin Thomas, and Brian Watson. J. Saunderson, senior, man- aged. ,gs The 1982 Golf Team Shelly Vance steps in to coach Terence Burns. Q l x . 4: ws.. Jason Liechti and Terence Burns watch to see if Mike Upson makes a hole-in-one. Steve Gray makes an attempt at getting his ball out of the sand trap and onto the green. if - - 'X 5 John Korb putts the ball as Coach Cole examines his technique. Golf - 159 A Long Court-ship The players on the Varsity team have been playing basketball for sever- al years. Some have played together before and know each others moves. Their team unity showed up on the court as they cheered on and encour- aged each other. The team didnlt have a lot of height making them powerful but practice and skill make up for it many times. When they lost, it was almost always by a very few points. They were beat- en in Sub-Districts 60-61. Jeff Chavez said he learned, When you don't have a winning record, keep on try- ing. His favorite part of the game was when the crowds got into it, and win- ning. The Varsity players were: Chris Parisi-10, VJ Greco-11, Jeff Chavez- 12, Greg Meyers-13, Joe VanDyke- 14, Rob Hemminger-15, John Brehm- 20, Rod Schrieber-21, Jeff Shearer- 22, Ron Keller-30, Jeff Mages-32, Sean Dowdell-34, and Gordon Apa- daca-44. Their coach was Bruce Dick. All of the basketball teams attended a camp at Mesa College at Grand Junction. It gave them a chance to get closer to one another as a team. Rob Hemminger stated, lt helped by giv- ing us a little bit more playing timefl The J.V. worked hard for their win- ning record. We've improved and work better together,'l said Hem- minger. The J.V. members coached by Jeff Klimper were: Rob Hemminger- 10, Trevor Jacklin-12, Duane Sutliff- 13, Sean Dowdell-20, Todd Wither- spoon-21, Rod Schrieber-24, Walt Schattinger-30, Gary Mages-32, Jeff Shearer-34, John Kinney-42, Gordon Apadaca-43, and Scott Stevens-44. The Senior and Junior players along with their coaches, mascots Cindy Grove and Tracy Heinz, 160 - Boy's Basketball and the Varsity cheerleading squad. ie 'Z l Jeff Mages and Ron Keller wait for the rebound. . fx k use tm Varsity players recuperate during the time out. VJ Greco and Sean Dowdell wait to get into the game, D 3 qi- -ur Q .f Q i Q-' 1 ri , X SX X X X N X 1 .. lx Todd Witherspoon shoots for the extra point. l Boy's Basketball - 161 Follow The Bouncing This year's Sophomore boys basket- ball team had a winning season. A bas- ketball camp was held during the final week of school last year in GMI-IS' gym. About seventeen guys participat- ed. They practiced drills, learned the philosophies of the coaches and what was expected of them. The members worked together as a team during the games and not just as individuals. They encouraged each other, gave handshakes and pats on the back before free-throws, and told other teammates when they did a good job. Trevor Jacklin said, The best part about being on the team was being around the other players and going to practice with everybody. Some of the Sophomores also played on J.V. but they got to play Ball more on the Sophomore team. An- other GMHS team was the Freshmen A and B squads. Everyone learned something to im- prove their game. Being in the new atmosphere of GMHS was something to get used to in itself. Scott Chase said, I learned how to play offense and defense better. They were coached by Joe Beckner and beat their eighth grade season. Each victory was special. If they lost a couple of games they kept trying to win. Chase commented, Everybody was hyped up! They complemented and helped one another. Some of the players were new this year and some may be new the next too, but they have three more years to work togeth- er and improve. A-squad, FRONT D. Radman, A. Yarnell, K. Ingram, T. Chiles, Manager R. Nelson. BACK Coach J. Beckner, M. Beckner, S. Danagen, M. Felton, R. Keaney, M. Day, R. Kaylor, M. Kinney. B-squad, FRONT E. Klausen, G. Estrada, J. Gess, B. Peterman, S. Chase, Manager R. Nelson. BACK Coach J. Beckner, T. Meyers, B. Wright, J, Schleicher, C. Laflin, D. Kubitschek. A VWMQJK -4 The Sophomores line up for the throw WW' MW' III. 'W'oro' r Ms,.....1.-ip.-v-+,....W...,w..,... W ff' - K K Q t lkyw... 7. John Korb shoots a free throw. FRONT T. Jacklin, T. Wright, M. Schroeder, K. Gibson. BACK Coach S. Harrison, S. Willoughby, W. Schattinger, S. Bush, G. Mages, M, McCallister, D. Sutliffe, J. Korb, I.. Hancock, B. Stordahl, M. Smith. NOT PICTURED T. Neel, M. Janney, C. Meyers. Walt Schattinger jumps for the ball. Boys' Basketball - 163 New Coach For Varsity This year Dave Schenk was the head coach of all the girl's basketball teams. Although he was new at coach- ing the girls' varsity, he has taught the J.V. teams for two years prior to this year. When asked how he liked coach- ing, Schenk replied, I love it! It lets me see students in a different light, and not just in the atmosphere of the classroom. The girl's basketball season started on November 8 and practices were held six days a week, excluding Sun- days. Often times, before a game start- ed, warm-up practices were accompa- nied with shoot arounds, and other types of exercises to get the girls moti- vated. As Coach Schenk stated, We always practice before a game in order to limber up and get mentally pre- pared for our opponents. 5 .... is-.iggss FRONT ROW T. Davis, P. Adducci, T. Flageolle SECOND ROW D. Guinn, C. Jeannett, S. Bostwick, K. Lang, L. Osborne, D. Diebert, THIRD ROW S. Bartlett, Coach Schenk, K. Harsch, K. Weeter, BACK ROW M. Cronin, M Vasey, J. Daugherty, K. Kelley, L. Wilson. Michelle Vasey tried to shoot a basket. Kim Weeter jumps for the tip-off. Suzy Bartlett fakes a pass. Jeanne Daugherty grabs for the rebound. Girls' Basketball - 165 Hoop Builds Character When asked what game was the most memorable, Schenk stated that Wheatridge and Pamona were note- worthy, but that a game with Colum- bine was especially intriguing. As Schenk expressed, It was an area tournament, and although we were be- hind, the last 26 seconds of the game we really started gaining points. It was exciting seeing the team shoot up like that. As far as basketball camp was con- cerned, Schenk hoped it would come again as in June of 1982. 'iWe had camp at the school last year, but I'm hoping that weill be able to have camp elsewhere this summer. The kids real- ly learn a lot at the camps such as basic fundamentals, team principals, and how to get along with other peo- ple. As Schenk quoted, Basketball helps prepare one for life and builds a strong character. Michelle Vasey waits for the game to begin again. FRONT ROW Tina Evans, D. Diebert, D. Glose SECOND ROW Coach Schenk, J. Manke, T. Cronin, C. Jennett, M. Cronin, L. Osborn BACK ROW Coach Jaramillo, K. Sattler, S. Bostwick, K. Weeter, S. Stevens M625 FRONT ROW Coach GMHS watches the ball swish through the hoop, waiting for the rebound. Mel Corbet fakes a pass to Diane Glose. Jaramillo, Y. Lopez, SECOND ROW T. Evans, D. Glose, THIRD ROW C. Bassett, M. Corbet, K. Sattler, R. Kroneberger, BACK ROW C. Parsek, P. Neilson, Nl. Wewel, T. Cronin Tara Cronin watches part the game from the bench. O Girls' Basketball - 167 The Hottest Winter Sport The 1982-83 Boys Swim team had the most successful season of all the winter sports. Taking fourth in League, the team had an official re- cord of 8-3. With the duel meets in- cluded, the team finished with a record of 14-5. Seniors Gary Henderson and Mark Knox served as co-captains of the team. Henderson commented that the team was so successful because al- though we had talent, there were no superstars. We worked as a team - everyone did their best. Coach Leon- hart was also sighted as the reason for such a successful season. We had a better coach than anyone in the league. Henderson continued. Highlights of the season included the Jeffco Invitational, League Relays, and the League A meet. The team seemed to agree that the prelims of the League A meet was their best meet. That morning, stated sopho- more John McCaslin, we all swam our best meet of the season. The team succeeded in qualifying their medly relay team for State with a time of 1:47. The relay team consisted of senior Gary Henderson, junior Ed Nelson, and sophomores Jim Knox and Mark Erickson. Nelson also quali- fied for State in the 50 free, and Jim Knox qualified in the 100 breat. Sen- ior Mark Knox and Gary Parham, ju- niors Mark Anderson, and Mike Roose, and sophomore John McCaslin all went to State as alternates. However, during the State competi- tion the qualifiers didn't swim their hottest meet. Henderson commented, A'We choked, but it was still a lot of fun. As for next season, the team should be just as successful. We all learned a lot and improved this season. stated McCaslin. Next year we're gonna' be the best!! Boys Swim Team: G. Morrissette, S. Mehnert, G Parham, S. Bryant, J. Schneider, K. Johnson, E. Nelson, E. Jansson, M. Anderson, Coach Leonhart D. Deibert, G. Dawson, C. Smith, G. Henderson, M Roose, M, Knox, M, Erickson, J. Perry, J. Knox, J McCaslin, S. Jensen. Coach Leonhart and Fast Eddie Nel- son watch swimmers during the League A meet. John McCaslin swims the 500 yard frees- tyle. John McCaslin and Ed Nelson show their razor precision at the shaving party. Mike Roose stretches out before his event. Co-captains Mark Knox and Gary l'Hollywood,' Henderson laugh as Mark prepares to swim. Boys Swimming - 169 Grapplers Go For Gusto The 1982-83 wrestling team was considered a very competitive group. The varsity wrestling team had 3 wins and 5 challenging losses. Wrestling this year was extremely tough for a few of our wrestlers. The team may not have been as big as others, but the coach taught alot about the sport. The coach was Craig Place, who has been head coach for 3 years. The GMHS team had many individuals that were assets to the team such as David Hoffsch- neider. Mike Pijanowski, Tom Novo- sel, Bill Peters, Tery Detwiler, and Brad Christiansen. They achieved many points and success together, and team enthusiasm was theirs. Place said the Arvada West Tournament, held on January 15, was the bes tournament GMHS wrestled. The Golden match was considered by Place to be the most exciting and the most well-played match of the season. This year's varsi- ty wrestling team was exciting for the John Grant wipes the sweat off his brow. fans and the team members them- selves. Front Row- C. Rich, B. Keiser, B. Peters, T. Detwiler, J. Grant, D. Hoffschneider, B. Christiansen, K. Barton. Second Row-D, Rich, E. Girk, T. Fisher, Q. Pey, R. Peterson, L. Blatter, K. McLaughlin, 5. Rickett, D. Kline. Third Row- G, Bublitz, A. Kleinkoph, T. Fiser, T. Hughes, F. Palemcia, M. Pijanowski, B. O'Neil, B. Green, K. Baca, K. Gsato. Back Row- C. Slater, T. Brown, P, Myers, G. Wing, S. Reed, T. Novosel, M. Pijanowski, T. Nolte, T. Rual. 170 - Wrestling i i 1 Z GMHS goes tor a take down in any way leagally l possible. l i l l Skt ls awarded David Hoffschnerder was one of the most successful senior wrestlers this year He has wrestled for 8 years Has older brothers had some influence upon him because they were also welltrained eeeeesefnlf wrestlers Haffseh nelder made 6 pins and won 15 matches this year He felt hrs best mateh was at the Fort Collins Tournament He eompeted against a wrestler from Cheyenne East who had the ad vantage of winning, but didnt The most memo- rable match l-'loffsehneicler said he wrestled was against Arvada he won the match in the last 10 seconds He added that everyone was cheering his on Hoffschnexdef received a scholarship to Adams State College for his talent tn wrestling but said he doesn t plan on going there 'Th s year has been fun, lfelt the team was good and I engoyed being on rt 5 t s eeeo - f f e l V ,i -'iffiff JPW54 ff: 1 .we A or ,, :Q I 5 74 fvw, ll fswf- M .reef ' V hh-g, ' tif I U' ' l 1 i fooe M 'igffrf ' N I ' We A' A ii ' ' f' ---- V - -55 Irma a,,, :ffefswzgg U .,'::gfs::: - ffiszafgfz, Q- 3 . 1 f , - . Jiffy .,,, L A ,,.' f 7 zf 'U -f H jf , ' 2, , V , i i 2 V I if K- 'fit , ' lf ff' 'ff f 1 2 I g , i 'l r 12 ,V as f it V. LQ ' M 44 V , : or ,, f-,, - L, '-h' f rfieefgfk ,,j?5Q'r ' 7 , L, J ji, I fl l 'V 3 W fr Q - . as 4 I Mark Pijanowski makes his move to place his opponent on his back. Bill Peters sets himself up to take control. Bill Peters, Mark Pijanowski, David Hoftschneicler, John Grant and Brad Christiansen are all on the virge of pulling their hair out as Tom Novosel competes against Golden. Wrestling - 171 Matmen Master Skills The Junior Varsity wrestling team's most successful match was the Regis Quadrangle. They had tough competi- tion during the tournament, but ended being one of the best teams there. The J.V. team participated in three tourna- ments, Regis Quadrangle, Jefferson Tournament, and J.V. Districts. Of the three, the Regis Quadrangle was the most triumphant. The J.V. wrestlers were very competitive and enthusias- tic, influenced by the varsity wrestlers. The team got along well together, which is why they were so intense at the matches! Tim Rual was considered by Craig Place, coach, as the best player on the Junior Varsity team. Next year should be one of the best, GMI-IS has ever had. The Freshmen wrestling team was extremely victorious this year. They had a season record of 3-1. Even the one loss was a close match of 33-37. These young grapplers are going to be one of the Schoolis best wrestling teams in years to come. Their best match was against Arvada, which they triumphantly won by 40 points. Place commented that there were four fresh- men wrestlers who had the best quali- ties for the sport. They were Tom Boos, Chris Michaels, Tom Jamison, and Jack Miller. With these were wres- tlers competing the way they did this year and with the success of the other wrestling teams, GMHS is going to have the West wrestlers in the state in best wrestlers in the state in future years. w unhw .44-,if L' 7-MM Brian Keiser puts a headlock on a Golden opponent, 172 - Wrestling l l Greg Bublitz gives all his strength to turn over his competitor. QX Tired wrestlers watch Scott Reed and Tom Novosel practice. Dave Kline overflows with enthusiasm for one of his teammates. -F., T Wrestlers lose all frustrations when Tom Novosel wins his match Wrestling - 173 ,wa sw W WW s wg Wvwfaem. 'NM U, :vw Xu , 'Yiwu-QM 'eu-.W3.Wv '-'Wk xdv NRSV Agua aniigMmi5?5Ms,.,g'iSi3':,2 S-Effw.Q1d'X2ZHS Z'S pmeijfiibig .jfhw . x xx Z4 . x a 'M x 'w,,5f Ma, 12' if S9315 -'?5w.N 0'1?255f ' Svgfeig' 4 'W 4 V M vm' w,'4 W Q 'Q 6. ,Q f',, , -5152-I:I,:, H-H fi :-:-:I,Il'-'l:l'l:l-:l'I:I :-'I ' 555553255-ismgggg5,32355:555552sz??23z::---Sfxsss--:asmgssz-:swanfQ-ms----isis:--:sam-es:sf-,was:1-gsm--fsif-flea525:sem22ssfwmzissfsgxsf522-zgiiigszfzggggggp5355522225535 'lg-5gw5:?5521ggg 55:5 15333352223 ggggggi' .55-EEE ! , -wiibizm-fami-ewfegg-fggma iigwgw-2iZ,M3f,vQ5g S2252-,g??:1 2? Q fam, 5239 ss :5:::' :5x- 5:-QL-5--: -wsisff---vf M iff--m.:U-M ffm' 4 2--w'..5m1mwvfmgapiseimi M35-GSQEN-ivfwmsgf-wggw M-iggg 23222-Hsemwlism M-imaf .eww --Pr-'- ...::-.::: , Hi itiizfff-555256-5J-fsfigfgg-ggi - M . 355,55-3525552555-mmf:1-M231fyfggf-2,?Z'fg?ff2Wg-f-25:-f ,,,-159525S525-Kari-225g--fain'la-v-55512211-'fxf-Qeffffamg? 35 H W ' Q- 0 , ww , 2 W Q M ,Q .MMF W , ,E fa , 9 W, -pa Q 5 A H , W Q we , 5 .. Q E ,gl of-m.,., M, g se gp, av W M, , W mm , J, 3 as as W ggm ,Q 1 -Q M -fi . .... N ,ggggg:5g35igg55g?fg,gg55M55ggg ggggzgmmiggfgggggggis353Q355535535-ggggggggg-Esggggggwzg gggggggggsegggigggx amiga: 5-M553fwiwfzf-liinsgff-2553 Q. a--52254:--Wx-piifii. mfs-Waaamgasirm. wa ,xiii-lwbgw ,, W, gr gm, wks:-z ,gl-WM W -2-r r-'.5::. -'.3:5:-,-5- -5 .5:-: -.-.-2-:':-al:-2 wwwgf--Q-f,,,,5-m.QQH-fe-W, W,-41555553-55--WW:-as sis--Mew--mggw Esggw-Msg-,egg eg,s-gg--.mggwi .... , W,1,,3wQ,pwM6--..M-mv?-M2 5,m,,5--wwf.-3 V M,Mi-W-M,,,,,g-i.Q,3.,fQ,gQ,--1,1 5,31-Q-N., 534-, wig-W f-my--N? Zff-Sfafzg-H,-2-vE's3-if--as - :f-:-.--- W .--::: -,:- --w--yH.-ss-wg-rf:-ff?-me-gg Nfsagy-XizwsgsMs?-W-ws:-aibfwgw--, Qwssxaiqfbf- -za Qffswgwswisa- Q---fem W -fs--,-w3? .g:-:g.::-.,., -Q-1 Q 1 3, 5 s4'i55Ntf::54,am:35a,5S:S:4:4::p gg-mf.5'5g5.mg5g5..,Wwmmwsiiggy-M, ,ggggwgagg-w5af?5fKMmgg:Q22: J:y5?i,eg1?5g-2325155 V--mga, 5- gg- .:..:2:::.g- :I .I'..:E:'-g-g?:5:',:5-,a---: Q: 91-0-2Wa.,,S---gm.4-mm,--M ,ggi-.-,.,,w,WN,m,,,,,,,.,Wf,,,,-N.-g.1mm,fww,,,,3g-gag- Z,,-fam M W 5- my --.gf--M A-A M W, -3,,e1,,, -W Hzw-M---.-Mesa--M,,w--.ww-M -.-mswfiq'-fffwww-ww-mm,W--mmgm 3, N1-:-1,-.g,b'33,?Q'f'vg,i-1-Zag ,W wb, Kg WD B, M M ww M, -vw ., -1-1 -- I E , J, Mmm WNW W M , K 3 mm ,X M -M, Wim 3, , 4 Wm -M. ,, me M ,N ,, 4 -isisiiszggg-M252-fimggm gggg-Qs:-gags.-MyimmaE,gm-QQ-5.-gggggw.-fQQz5,,gggQ.-MQW-mggmvgi-sg mg- 3 gag- isa- .W --W Bs- .mg , H my Wg? --2 - , ma K it -Wm,.,:55-555534:-Q-,:f,gge ffifzgflkimg--www:--Ek -fflfffgv Wilfsfmifzgff- -2?-Eli' we-.45---y -Q-Kiwis ass- H-'Elia R2 31 W?-W SQ, TA M. T 2 M :Ei gm,-Hzizsaszgggs 1:55,-,::sg-5.Qy:s:s:::fgQffggwgiigmyarefsfzf-:f:SE3gf.255?g5g-,,:,-.izzggg-i-gigsas,-3'-kgZa2535--2isgswfsy-issggmsfgsmgw -.-.1-1,1 I 2233525 3:2855-gfzsfiiggiisvgil 5525552-135555:S2SL:3:5'S:::,:s:wq:ss,m-205.22591-M :ff-mmfw:1,f-efbsag---mek swam- ,::5-Qzsazwfszsse bqa asf- me-w::,.. g m.w:-www.-,gg s-WYE. ' swf,-gs: A ,:-:5:',:g: 1 5RANW'?'w Q WH-1 V , - Www Haifa Wan N . V-Q--wr Z mm, ww. fm-0--M. -M M-mg if f J - 4 fff4::?:Q,,g::Re--.ff , . f ff-Q, - X :: ::' i2x:3s:s'fg,,,m,:g---sssfp ,gag - ,I K K if is --2---M f5?Z?S5'W3lZ7'?W4w3L5, , xr- X - f 1 ss S 2222552522fe-1--'-if--sfi2,:s,:g--Q-4 ---S25 X X -ia we -mf-msgzggw new-fmffss 225-1 x X RQ 5 2 2:55552-M-Sf:--5455225 --03:5 I X it -an fff5:::- 55, ffff' - 2553! 55535515535-an5:35-Nliimi --2 W f -gwg-H mmm,,--m,,,,,gWm,,,,5,W 5-f-,. .. X MM www. 9125223 -. 92-if-xw.-MXN kgs? ,ggg-Q we wx I be--2, , 1 M 5 6--my. J ,gyggm gig-U,g.:g5 4. Q W 133-, Q3 4 1 1 S 2551 ,Q :::2r.::.ggg'f--24:f-asm , :sf www' f X - S , - ' ' :semi-Qgzwss22:12:25-kisses 1 ,, - 3 5-ma-sssgga-wwgf-mmf:--W ss,--A x - , ' 55551, ,mfs 3- Q mga J 'N -ww SSS,?5S5'95i5i:5'5--15:-z-4-55, 75329 A X EXW wx my 235535. .zizuigvsw gg -3? , Q jggw 555522522251-55:5255:25-img --1-,Q -5- -'QQ' - f gs, ,Sims:Q--S123-?fZi.:'M:,gg:-if-52:22 535322 - f V A-33 sm:::,: . S M mmF,-A-mmf...,,,,gg1.,f,-3 M-.5 N --me-X Sfrisf--hw-M55 f --is sw- U M -'Z-wia?:5a:f2 5 iZ?W5Z3W5,gfSi:: 555452 KEN? 535 522225 25:6-mes:-if wifi .2 :-.5:-' X ---wff-:s-----a:-f::::---- , :cgi we ,,.,,.J -QE 55 ,S ,im -We , , sgmwigwwig--,Sk mm? :W Wm. -. Y wsawlmwwgweaiinyiqigi -H-Q. . -:-' 5 x gamidsszgwwggg-,gash--Km, :sw .:::: 5 f . , .Q zgzvu-em swf --Q., :..:: ff-2?-firm --1-Sz, ' 'W' Q7 5 Bl nvfffi nijjwie. wxfi A -if 1 Sggfzgggidlfg-qqsszaezfssfsa my- , 5 is 5 QA 48 5255222555:-532:55 sm . ms,-Q2 jg Q L wmifzm-iigsfsgiifiszf'-Fsszs gs! , if 2 5-Q-fggqmiiqsmsissggg 2- f L L 5 E ,Q H awww ,aw 4- M W - 2 W1 Bgwssymifgqgfgbpgfbiq-. -Q35 -Q E ZIP'-MSN M- SESSSE s H gs ?-ws42fr,fgqsf::::gN-msg ,amz 'f - giggggiagaiigzggygigfg 555 ' 2 ,- ' sf QSN YS -7 Za' ww SW v2:Q'W'w 1-fwfw-f sS s1 Q LS Q s W 'N W2 .:.::--::- - g s-a v-Q N W-iw -ww va ' 2:22212 ' gg f'gg3b5SQP1'sm3?g 5-fisggwg :H-SSR . - sy 251532 :I. :-zf: an ---fkf.2:'-22 .:':- ' -:' :5::5-:5-.522 gmwqfwge- Q 2 35535855 gg igg52. , N,.,1 Q r-' ::- .ss ss-SSH-W ,..s2f,s.:w-ms,:,:- f' SQ-Mads 2 M- 1-W XU-S9 W -:,w--A f'f? 2V w -'ii -' Q:--2 -2 - :f:E--EI' , , ' ' 5-:E2 E::i.:E.:::::2: -:- --:-:5:5i ' .a2:2:-:22-25 2: 2I2.E:I::5, .... - 5:-:IEIE2525!:I2EiEaL15'EI.E'.E'E: 5:-:5':5'-5 -I5:-xii'Sis-'25-1EI':II1E5'.. ..a5 EI-225525 '2:':-.' N his w , an wise 22 :'-.-:':iL:5 -I, K ' Ei n, M3535 -. 5?2Cm . 'sa?552H gx fifmz n ew 2-fin .Ui -32' w- . s:w:?:-:- - Q 553,25 sg-gm-W, 4 sag 21 My sax '- I:'.gIgQ -I--I--.'IliS5EE1.fl I5IE'.ZI'.'Z-E-2:-25152525255'-,3535IfIf'Z:I'I5I:':7-55:52-E55-I-I-'Ql':5i5E'fE3-fiZ:,.: :E- .--E-I-I-32 mg.3 '..M!....,..M :j---H 'W v mamma'-1' W.: ,WW ' - 'WLM MWjwl115aBwsm3QgX:,WWfW-wf '- N'KW +N M'W-W'-f05 5f-'I-X-f'f-'1N 'WWQMMWWW -- Mgr.-vw--m:..:,s. :Fx- - - ---..-,-.,.., ,Q-.-,-....,:, M:-ww -- ,, .ww --:pm-WM -wi M n--M My .. -W . .... a,,,-M-- mmmmmww W -ww mm ..v.W,.,.,.M.. : - --. WM,-.-m,,...,.,.,:m.w,,.-1--wmwsmmmgzxwwxmmmwwmnrwmm-M ---- mW,,....,.,,,,.., Hmmm? S, -WW me-.Sw - M ' A N..- , 1252: 324525155252-E.IEZI:I5 ,:fZ'22:15--: :I.,I'?j,?Efig:-'.5I',.fI525,231-gig-g-E-2:2 .4 Q :-:.-I-I-'.:I.I'.Q'., V , .QI.,I':Ig,'g' : :': .E: 3 'E 25' :2.25 :fF955 ' .H g-g-'--:-.: ,: -W 'I we Hi ' 12'-sf'-345:-yz f -32 - A 1. I X' :::E-.:::s-:22:?Er-r- - 1- Q- W ff 2 ' -5355, A Mg 1: I 1 Fai -f:-:--:-'Psi ::g':':'-:- 35N- - in ggwy BSN - 5 bf if,-5? :SY iw,-J .: W ,sw- 52, gg 5 --.-2 B' af g,,,g-Q 'Hugs w.,?35':jJ51 -wigf'-4 fglffggrwib 6 EI5E. -'- 'gQfiQ'.'7:3g2:-rmgage:-w-N,,,2fw.':,5Q?'f12,gf:1-S,sezf 9.9-,M in--zfiifq-M123 , '1 .-nw My M Ngg-1-22 +1 lm- wig' w ws w2'::fem.rimsf--wW,v Ws,.,YZg-1.5- 53552a3553giiifggeiigigigsggigiifiisfzSq-Qwe-fm-ffgigfff-fffsa22f-gig Mzwmsg, Q 2s.,,-555' ,wma D by , fm, .. . , -1 mga,-M, Wm M - J B 755 Him, -5391 4 '35-fvmfflai M 3: 9 -W ii ,gf-Qwgg? ,gg ,sgggm 0 32,2553 ,M-w.,3,Q,s wi, mm, 0 N, ma Q , ,Nw wsfffa- ?, P4 sw Q k 8 W: 5 gm ESQ Q- 233922 W ew Q-F' am., M 'Www ww UW 335613, 2 535318356 W E iii, -fS?2153 ZW U SEM vm if 25 ,-gn Q W Q m'KZ'i?-f .W waz? -was fs 2555533 'ww Q, UW-V031 em: za, was ,::f,:' N wg pzsifvbli, SEG' ww ew. ,Z wk, sm Q iiwwe-62- D ka-as Q -ffm,-:gg ?fS, ::-M - aiirffizewkix -1 by N.- mimn- I -. mga s X ,- ,awp gb em Q as we 53,9 Q N -zum-12 S Q gimp -f Mi: V? -,553-2 flvsw-1-gg ., gmsfh- -H .,1: W: xwg:,:-gm 5Q,,,ssp-,rss-sw 5:g,asQ:Qe:,-f -- -Q-.g -Q f .: ..... Q- 331-W, 4 6.-, Q Q, - :ww .B ,, 5 , A- ,sw mg:--V9-v.,mg:,,,wW-- 5- 5325? 5-5 52 Q53 - 4 5552 ii? ,afni-s-.-fi-3f,.,3-gi 5' as-B-3-2:55 f,-::wf-,qw -Q Wzzwmz- fm-iw-was --mgzffggmgsgzssfzii Wm :asm-fsfggwgg-5:,,,mgffymwg -3-3 ,:-r fffiwr --U ff:5?i iff 2455? wgisfgxgiiffss' .5M52?'W 55k5fE55?5 ali?-?2im,5:g::s.f: ge 1:32145-2:55335-ss W55?a32?Q.2,fw' 'Zigi-YEgm?-??iS?'5S5xQiiff22553553-T Q --Simffiiiiss' ms-:sfifm-Iss:f3e::f.,::vff::xM-if -fi'-'ifirfffvfsw W ':'fw'N'5 'F' pf T J 2 2255 Q Q 2 ' Sfssra -2-pw: 55555335595 z : 'K 1,223 2 W M 5355355559-35325555 :, W3 'Sri gig:-EW - E -- Q 9 ,'523?:T:::,-5 ' M555 , 553545. wg- - SNTSSSSS55?9i:555553595w'55S?5Fiiifslflfgfiiiy Sf' H 2:Simsiiawgivfs352-wzsssrisszss 9 Q Q -N sasfiigi f - , Z , X -rp X Rf Sf vm -2 - ' Mm, Q-N5 is ELS '43-? ff M my W 5-gg? 4 'Q 3521 gagg- ' 5- Quin N' 535214 3 M iw. , Q ,M-gg ,gg--, 35:5-:gg ggi: 4,-Q' Q we Qu W -2- S25 sim --2W:'wQ,:5l?21zZWf- W gg WW. H--S? my- .2:2-'22'.E2 N? -2.2: gqgfigfxfgiihsgx H5265 2 5 3-Wa A g gfiigfssgifisgsiei Q A 44 :--- , W .-.....- .1 me ,fgfxga zaiipa ,Wag-Q, kwa A vw QS: Q ..,. -Ks qxgkgilfg 555334, G do M, as .zz Wwwwbb wg-gm H S- -6 -esi?1:::,,f- 2-Q, .w 2 wg 5 ge-H AWL-f' wi- ,:,- ' -ff W f 419 4, V11 ' 2 5, S 52 4, . .,.. . ,, me ,D X, , ,NW .,, 3, ,W an up , E- . G .6 -W , --mfr, 7f5B?':'-WS? W? SWR '.:f is V F-if 1 -xg-mwgffsezsgmW4v?:3fW's-ffrfzfifffsg .. -1 ' fm ine--kwa H D 5155?JWv-W w-Saizwgfiin, Q, is an .3 551-sa gg? 125 N., 5 -SW- gqfsgsl,ifgssggghfssggyzzgg-Q W G . ,, , 3, , 2 ' ,,, , ,B ,m,,,f,,fA ,gm if .1 ,R W, WSW 6 M: G-Qgis,-,QQ ,,WmgR5-5355 3555 afirfffisigifsbi 2' f I 12? -if ww 4 5'-Q 0 f 2-'fg gwiiww. E ,Lia .5 5-m.,,z,f,-.sjfxgg Mag-H -,irgw f 225,gf?gSgg5E:5iyf.2Q?gfQH255525552535255agggggwgggm.g,,g:55qggig,m.,,5gg gf ,fmaisggw-Gm, WMM ,,:-Mew--Wes-pw,5---683,55--Mvaf,,M gf-2525233 :egg3325:-figw,--2?f:,:H::f::f fziisg,-ge, :T G -fi 43:5 iii. :fggg 5 :i: ,155 Sfigiighgffgkgjg S zggglgyzffiffiisfgf ss 5,5333-Ti fi 5: 1 ,ff ' WN755?-?':,:lf?3 3, S b Wfmk fW-seal-QS?'bw'UVMsfiiwfraf-v5.5'Wf2?xf W6-Sw U1- A 'U' 'vu -222.1 vifw 5 gg- Q, wg '22-W mpg- 53'-2:5-5 fag-wwssw-SQ SMH B-ZW-Kg--fzzig-rv-:fm--.msg--522 5 ff f?2f,f?2'ff::f2:5sz ,ii v izggwggwrzfiiew -322,-5-,E-,5-ssgf - -ia: gmrzsisv ' - -fir: - 1 g Fw 9 wifgggf-zwzggw-MZ:-315,5 -we:M-wa5?gw3:':.'37-522575:W Zsggmiff'-W 1 sifggfffsiifisssizefifi:::f2S:s:S!rf:-mf52:5-2'f5f::gif 1 'K 2? 32:50 :-2255zairxsf-2522225551:si-2522:5-iam:-lies---fbzfgg :-amz 5 ,gggigsgg55:22:23-Qzmiffsz322223-502:32-fy-Ssffzwf:::,g-gif:sms:-1222252222: 2 gwsgmsqsg--ffizsgfr-ffsigwgiv -'2 5, - -Vim lim 5, gg,-?S:-i5?Si2z:,f,iD::,f:f:2: 5:'mg:.f5-f:::Q,? 1':::gff'7 rug:-. if S :gin-4 ,-:gg 2 Q 1 W kv- ff- zfiw-zWf,,k-rs: f mg wgwmyggf--sizgw 'fiiwzii-1?,3'--SEQ 2 g - 1, 'Q ' if 'Q ggi-2222:-1iz:-:seqHifigi-ff',f-655:-,-Zfsfsw'zz--fir- -faxing .Jaffa Hwzgf-W-frggww, awmgif-,,,5gm,.:g-,.,.:g- Mzgis AM, :L 1 sw 'PMLQU :'va.v.V .ww Mm, wawwwewqvylqf -M my wx, -2 . ww, me W9H'UY-f,vv,v.1Qf w:9ws fwyf,v.,? xsU'9Nax1v?V4wp5 Mw 'MM,wu.9., Mamma -mf. 5 4,f?'AW0-U-wf?:,:2'f-fw32'--'m,:w Sfw-wr wifi--wiipiw,ya-wif Men we-5.5 55555553525 :e2-:saegg-szzefggsssigff-2:2255 ffamggzgfzfszi an -, -:Em Wi,-fi mg -- gwgwzwfmzzmgggwgg,fs-3-fw:55.,2iZ,fS:z-M5,mg..a:f---sms' -lzw-1 W2-lfifi Q g5::f??s1'::.g,zf:gg-5v:- .smff55Mz:fy,f::::-- 'Sw-y -f ,zesz ::---:fff-s,::-- sw- , mf, xg, - im,-gsifzzsss,:gms-..,sfsifgf-Aesszsgi-'ff-ezfsw 125:51-M fs: ' -Z gg!! , , ,. . . issfgiizigspirzgisafv wxiff--2:5155-frzsigfzff-2222533 ff U '-?q3A'W--4522 - ,- 577353555 ' ?f?ff:5Wff:z:: '55 ' 'ff-W ,, A, 1 . SQ 5fZ 'w?ffWifff ?w-21 ,, FYQQZY' liiwbfa?fj'mi,Z3 w,uww-.qm7,, fs I iw ,-YQ. .. J, : '2'J'I2If'?,' :J 4' 5 W Mm N-m,ge-mm:--W sf-M2-QW.,-WWg-mi--'ww g- M: ---sw-W ww- gf- afizs-wjggssmxmfs:-P,,,:f:-2312-fs:-Mm-6,szzwggff-zzggm,:Q-W., f, wfszgp - 4,5 M 'f - A ,. A ' 522 . - , ' ,Q 32--W if-----h':f--,y:f::, ,,:fff'ff5-122, 1' 'M' 7 'f-fl? ' 2-'f LN -2 5'55,gi24F:':,,- lm-.,5Wa,3J, ,.Lf:m.'--Nagy--:Jw-6: VW, , f. fm 4, 1 S., v ' - Q5 ,wav 'mfwyia A-fzvSmZ?'z1.f'wwe4 .-,.'63v--,,gMani? .NM 'H Y M . MW NM 2- f Hui: 'VW .31 ff- ' ' - fvywigibfywzgb-wwgsgD--ISM-vsfgwiiig'---SSW-mg---Z: -ww Qs, Win A75 . , -ff VW- 2 3,2-3 -Q2 Q I M-1 ' K is im.fzsizeffigigffgs:Fir:g-i3:fsj?f5f.','-,.:::1:g52., las.. 4 - iff , - 1 2--1:---mg, f' arf- . -1 ws,-H '-,, - ,f , :fw- , ,, , 1, , xg- -Q N33::m,Z:.TfSs-,592-xmsfsw,,fg3gxm:3:b-4,12-meifmmfmss 'gg-R wwie--.ww f, ,, U . , , ,W , f 0 :-. W, ,A N V 'bf 'f5?fM':f2Qg'2,E:fff2:3::::,'iff2:2::--fwbszgf fi 53232253245552522522539fisilliefieiifsfiiggiieg-5:Qsz2gwwfixgiizrzaggggsefwsgbmgvefs2fzgjgw5:Q-ff-mfsswfgsgglgfzgggw-15255 'jg ,Sify-Hg:-wg ,g3.fgggfgQm- :Mg-t,5,g--,,,5W, M, g5,.,- ,534 gi-ZW, 55g,,.,,, 3530, m.,,5f,.,,,., V3-523,,,-5A3KM,g5,,g-N43-.,,5:m,:,:vg,g::4,.gh4,3-m5,J,5,Z,-fS,f55K fmgggfm,sggw,,fggg'mW ff---2:35---swim WU---Sisrifwfiiffw 20 . -05:2-W M -Wi? 62113 If:- w,,ggf,Lgjf-s,,5w-.,,S, G- wmgg---,,33gw,:,g-3-M.. 4,355 f,,g-N55 g-MMU Maggy --Wil--.K ,.Z5g2MvfiZ?3Vff ,LEM-,,.,:U-wQ.,p m,f:zM-7:2---JW M253-M-'.:w Sgr-Wm-zgiww-v.?1:55,w??i:.nW?5Z5w.4g3xy,,3-2-msg'-fggxwgg-egi,,fgggw,,ag5gq,,,,g,g-X,,,3'g1-vw-91.4752 gmswgg-mi ,,Dg:gsqv,,,g,f,-pf,-3 5 b gwggwsfzg -gg 3-M155-5 s,w,ggg-fgwfiggy mlfgggg ,,,g3.-wgggrfg-gf5,g,5.. gm 7 iwggw gg -ggfsggg gg-Ms: gp- y.-55:5 5 sbiigzggfffziisw fzzm-.5525 -1552EggSizggmisiig-'-53254515 Sagem-45:2im:,g 7 5- 5-wziggg -wgisiirff5325-eiazggg.--sgsigp Y955-33-fZ:ggAg-yiszggzwgsw gisfzav-ww 55:-zwmifygmfiwk mgg-552553522223gggazggmzsssigg sims,-gf,,: gf7g:gggm, :Q-g qzsgmigg 5:-sfszszsggzfggwfszse:seq252Q224555Qszggfgisgggazzzszg-Q522529212 yfgggggsg ggfigsggg-55222-g5eS,:ggg?i225ggfS2ss:gg5:55325Qizzggfzgggigzgigf-2:5559 ,. 25555-5-Fgmfgvgg X :sf 1:22555-21:22:51-ff:z:::' - if A 'wifi 'Y ffm We-,Mass s, gg we ffzsffrgifsf-SSW-22:25-Sim :mg iiigzgg.-322:55--rmszgwfgig-2-issggsfgiegfiiaifssggi mg-anis2:eggwiefzgimsgwisgi-2522: QE--'55 2 lffsfgggyfggpggfg ,film f 'fgfy T Sifff F ,::g:f5e 35:5 - gf?-Tim' fffiffi 553'zS5525iz:252553555555555:5:4:P-53325:5?Z2s:es:2:S?Fsszf?-zlgfifimigfff52355559525535?ZxE5?52255ESsf?5gg5E Wiz?-5512152 fa: -f-5:w'--1-S?:m,s:fYz2-Bmw..:::W-msfsfm-wr, -imzw 545'--Ammssz,--M1555 --Ziggy .isgfw-Pvwgfmmigf--S232---2:'m3::fm:i,:-Miw--Qfiw-,sw-fiiafzm-wifi:maxi,H---5::gGf-1T:QQ---rss-g.m?5f--i?:2:?w--2ifgwm?-555--zgyixwwfmf-EVSM2 wma-bobbing? 2 wfwip' su-'w' WL--SPZWSM-:J9'2w-X,Fw--LW -1-wff:--sw--6-. -wwfw. '-fem-w.,' --.w,,D.s'Df-wma -affw-.-'mv-4, me-mm.fe,-,,,,wH.,9g1gm-gauze-Q ,-W, ,ifwvwzwhzWm-,,,fwsw,.'vMmm,ZH--vw-'24---iYQf2H:sz 'Q ww, 'J-fmwltff--MUH-awww 1 -,,gwws3,2 vm g,,PWWww.,ggWvv.w-,S-'i w -,qw--f,,g'i,, 5 M, gf- ,N--,ep-N.:ggg--Q,,, ,Q --mgyggfm ,,:gWQ55,,,-miizn -.Awwggwfmezgg--MQWW Bwwsbggwsggwwmf--Mig-pq :,w,,a--5 gpg-M-gw-Mz,,g-w,:gf,gsfg,f., pg-mggmf.mg-2-M,:50-ew w-umg---2m,-- gm 1---ml-gf ,m,gf-P122 ,gg-we wg--,SE - W ,:---- . -fc. -, www-: ix: , fi 4 f if , - fr---Sprf-Wig-WWwrfwsgss -wry:---2- ' wiH:--ww--gszwgf--izsmg 52: -fre:-M-25,SM--lf--mmgg--w24221z'w -W QW--pwbmefgiq fam wg ky? ' fgssf-5---?HsM --'53 ----WJQJ' --1, ,, f . Y -A H M - -N:,:--',,:':w- gif:-f--,fwff-7, -wiv .32-:W mm..-mf.,:: Q:-mai!V-wwggm320-awww.:-fm.NASZMM:gg,m.wm.2'5:f-mf,-:W--6:'f--M,,:wm5vm3?q5wmiimfmgre .:.-.:- 4 ,,,,g5v,55H.,5,,,,95 ,.,,5g35-wsyM,5fz- -Wg ,NIJ-7 M5--M Mqmzp Vsfifi - Wfgf--55mw.'jgmU'w- -M255-,.g,w ,gf-mn -ziiifwfg--1,2363--,fb-mmffm-m3?,:Q.-s,,g.,,,2w--rWg-n.gggfqw.,gf5-Q,3HfwrjggmNW5AwW.,gy-M-,,g,,gg.-,,,,ga0wm53g5 ,Mg :-.:-.-.- 33lZMg:3wZ:--Z:3aP- we f ' 'GMD Lg: --mf-algg va---f -. L3---ax::' 'A-5i,l'U1-5:---isbn -y iszzw- N U Q- - A 1 gg My , gf - -szixvwfsigwe-J 'lgzw-M s 5- -msg W- . X:-Nr---,'.'m55H--.-.::Hew-m- W 5: 'HWwSSfWw2 -YH-vin. mw15v?g-w::5g-- U s ggfwgig:---.J3E:'-H :SWHi-5325322-QJWMSSRWWS KWH? '-.:':-.- - .2 ,mg-,G -.,,,,5gQ -55::,g:qmmg35-W W,,ggg53?U..g5g55,,,,55g.3, i53,3?.,,,530w:g5.., 3553153305-QM2324,4-gwmzg-iw,W2-gm,-gggg-4:3-mi:'Q-Nififm -wufpvlfgw-,,1?'2'5v.fw4a'Z??X':ffw'1'2gf-ln-252 weQ? Hggiwqbfstwwkmrwpmzg miigfwmssg-wgzgmwgsmwiwww N .- 3: vi, 5-MSS'-ffmsig-mfg?-Q,ff-wmfg -gm.UV:,'gve.ngyyM,Z?f-A,aig-.-mi-,,,.,2fhWF537-.fig-gg-mgymmizifiim 3,22--Fgggg,-ml fig-2wQi?:ff2-sfigibswZW-wifgf,-5.-,2,?,Qg,i,Z':www-figs' sgesaggw 1-wmgygx 'Wig -2-Zawya 3?--2252 Q 5- :gym-zwigggemggww umm.K-wwfg-,:,'-w.,,.':ya,-.1 w.IHweu-6 t 'PM--Mg-MM z1's,w-ti'S'wZ'3,,'---j,'jf-y-My-,--f,i.' -V., -.fgfwm,-sw-,,,g--mmgb-My-M,'-m,.,,:-wx'mx., 5-ff-W,-H-ww,w3 fm1,3 Q-mf wwf ,X S ,f,g-WEMKSQ, 'M-M2-:gf -w,1g2w-uimmg-3 -M-,, if HH-Qwsgmwigmgimqw-f-K-2 5,,f--L:sw-dis:-ef-m.gEgi5,fg,wm,g,, 5154-,QimW5-3,553,331-.wqg-fa,gg-www 'wwm.'-ff--:aww-si-Q. :---Ls, U-w?:zw-W. -mb, ,'U--'mp--.k w a-f wv - 9-H Q 8 -,M M,,v-Q-.sf,vv32-semi QQZH5,-,Qigwlswafgwssmymswgw rf-mm,-N, Hg--1Mg?5-M-3.55 -mggfw-9 MM mf Q as-ww Mg W kg-was-mfgm Y--gmgg-QQ-Ugg-vm-2-gwwpmg--w',gg-5 -5-my-:wg- 2 ?gs? b w-S if S :ww in -mv hw Wm -' SYM--wjgpv -Q-:mf :mm-qsefve mf 2'2Q?Sf-QQ-gg -'Aim :'::':::.:-,:- -2-2-.::..:'::: Qsfiifssixgewmwzsesagaze-2ss?SEsk::2wS2sHxs:eQSS2afSiLf-Sszssafs-:ffBias,-5-ELE1252,----affix-Mises:Q-sgssawga 22525 yggsisfzfwi se-Sfxiig-1,?e3s8SQ2?s552WsSQM55BSa2E25S:wl fwigkmkiggaiiimwgaafwg was-2-1:5 , w:s,,.?y5?Mi,g g,.g-:s, - .,.. , ..- FSWSZZWEEQE 'WSWS :W5?Qm3W55,fT5i??Sff5m 4 6' M WQSQSQS fww -fzzi wmgizeiff Tf55?2'2?q??xgq2mDM.Q5,fpW wif . im... . Q We .F saw H Q Q 'ix WH QE? if fir mfg N5,1z,g M5355 , ,W E Q ,N ,. PM my Q MN , Q, ef-im. :wg Q 5 'xi , 56 S Ag Wwe gg 'J ggi Q Q xl? 22' Q is M ,V f W SL im.,-:Winn H Q W igigg w, Ew saiifiizggwsi issgffssexwgvmywwgv K: :mise-2 an if wtf ww' A -. , lima Sifggieifsffifmgiizfif 5wbvZ5X2.23 ,., W ap Km fl-ww H?'wsrz'.m f 'WS' 2:35:55 :'ffk 'ZsiS xii ms? 4. P Q at we 'IP M are ws ,ummm y 1 my W H AM as Minn r ggzisgh, 'wr Wg fb Nkgggggg Sgggiuvgggmg--M ,gww g,,g?.m.,Q,,,R,,V . VW MQ H 4 M x, 15 My :HRK 2 ,N 5:2-ff N QQ by M H M , , .N W W ww 555 H ??Qg,,Wf55 N W :bfi V-Y MM NM me ,N 5 f 2,2 vw H X S W S13 M .Y k' M :mm W X355 6 wh' A me wa X92 wa X mms Q F ? Ewa., M N553 W W , X Wg. . SEP 3: 56262 2: ga - SQ-EW 155 i5 1S:'M1i? , wwmimw'-1 W S '3 v Q ,G U 323325. H336 bi 3' 'Sc Q Eff: N Q. wb i ' ' J , , ,, , 1, XT v ,W '::?5W' fi'f f ff11fZEMY?ff2 rififvwktzfwdiiveezwiiiihfi U,7Q:.wQw3?5B1iwb 4, fxxiwv 341553 355 5 xiii,igzgfgvyi-'fgglgfiiij 551 Cjfgwgfiigw 'ki Lf: A :ff viii? Lieff U if fk U if fiijfg K Q ei fin' ff grfkammff' fvr- fig?-1 giffij. f-nfs.: aswwsg:wg:,,g:ggfV:zz:x:5FfS'::sgfggeszz l1:52:55lzzsf,-2b:::zggM.r:sggggUwsg4fQpfgggig, zssgyszwfggfiii Zi Lf 555555 Y ' U' if P .155 4 M55 1 fn f '5f::yg5?Q 3255552 , , :fri . K 'hfdfifg M X - b 'mfg V Q-v . - ' V M-,giiivsgggldzf 7 fgi5N:3,g:gug,g,, miss 'Q ' Qs' .11 xsaiiiflffsffffff H gyms -QQ: , i . , Sv. L-L, , U, . -M- fi A ,gwwm ,A ,Ng , .. , . . A . wg W. v. M., ,wbfkfew .,-mg N 'Q 5: - Q ' 'T 'gp '2-iw iff- S1:Z:z,:::gLgiZ5i fiii-'Qt , , '11 X A ' , :Qi f igk k nz' iffy' ,sues -, if f 5 . f L Z 7 fu. ,Z2f::::::igS5:s,:k,j4f4,2:fz:55,ilSz:.s:5zz ihiwffmsf . - -N .X i . . V fglim 5 , gfgk -New - mn wvfszwfvsfzgz-wifz :new 5i5'1?' wi: 335252 fivfigjxfi Iqxilff' P ,g JS A ' Kr gfggg if'Wff'S7!'L:ff52' MSE Wzzggfiffiiiym 5224A:2:gfEi1:i2:g1544wZ.ii.Z2,'1 f?22q:: - wif' z Wli::m.wLS2.,m.Hwi:Sff:M?S.Js5552x5'A'5m55fi?5 2f2wi::?5 !?2'1:W1fisisiv451325515395?'f::s'E?-Wisxsiiifsxiri EY M H fvs:-fswf n Q 1 Y1122212w5sf:2s::??f5::':sfwfgifvssiwfiffsfffg , H W W gd, 5 is?2f?'f if Swffffsis xfiiggiif? ff fff 55553535 eg i f :fs 335501 Bifif-3?-WU'ff1Q3?f rw5i?2g:PM3'?Ep sms: wiifiiwwmfm v pm Wai? f'??'f:gmz: W.f'TZ?n?'f .m2 v:- W 23'5i:w5E Www 6535525 526 his 'Q r::Q,:f,,InfAV21f5x:Q2:4,:QQ:,zMQ4Q::2M::w:5g,:ww:' :si Y jw,:gmaq,x::i5's4Qg gf Q wmgssgggg maszw gaiim: kai? WW 'fin 4'Rl'?:fiZ 'D 'Wszsiw ,wzgzfzm Wm: G mrs .Q Q s.SxQf '02Ks3 Ag Qfiiqgl sibiligfgggisisiw Q w vfg5bW,fggw mg, -:g.g.::' Q gm 52:335612izzfgggg-iigaixzwigf H5g5gg3:if,,g,gL5:3f:35 : :z f Eff wW,,wwww ff usewwm H Mm Jaw uf wg my ZW 1 :,:Qz:g:1..A ,vf,E'gfQ2m:be:f-fi Qizigswimsgwzig, Smgmgivfba 332351, gg 5? 555 Efs?Sfifggfgiiigfgwiigfiygffggigisgmivigegfifgs E W M '- fe 21552: 5251253555 fsxggiigs' ' ggi is-'SMT eggwiiaffgfvmawfsssbg 3223232361 SSW 2212231 megf :::4a-.g:f lf wgzggww mel 56012236331 B N2 gs wwe, 12 0: fbias: V Q? mfg Ssmz ssfs sw as E:-.Q2.2z .s51 f SQ M552 1:mee-fmis222:52imsaagffizfa2141522522Wiwkzwzsissq .542 M 1 QM vim , ,wN,.,,h .www ,www gfy.mw,,g, v W2 2, W xmsa,,wwvmEfRAm?:f,,m2 ggwmggwwfffe-f.W,Q,:x,N ,ggi bm sw JWW ffVm,,wggQ1 Massa, aw W ,M Q' a g::,:::-::- ,:..fg5.,3: mega gfffuggisfssgggisss 35525545 FEE m .7 531 M2 my 5' , mf! .Wm www .. .. Q53 25522::ySFfi.'fz:g3?fE:2rfTW'SSfi?2:2?5Q??2Sg:s???555:gf:z:25h1v:::3E 5535335 SWS: mag Hwlzgmfnilggagz iwiffzzswf iszegskiib 529 vim: ww -E 212 za' few ff2wf5'42w fu SW' wwiiszz 1-vw EZZQW 'wqaisifmw E335 a gwfifg -. :rzs W my wma M W M asp Q, .lx 5 E iiiigfvwilla? :::,:-143. es,-125552:5r:,::ff52z:a5f:s?12f:Qzgizwssgiitsiea'fmiggg 2:2125 -Q'Ir s: :s:1.:i:::::r if XZ-wifi fasvfwgmiwfvV-2f'f.fQ:'sz W-rifsf vigeim H wg-if .,.. Q 2 S' iiwiszzii isii :5 2f 55H 5? swf ?2?E?U??? ,::1?S?::'2ffj. ffzscgwl Qagigwigzieggggss gg . ,Q 1, ,,3??Qy'f'5fg:Uwl as5Qggwissrasblwgzsssziw255:05 4 M? W s:fffEQs: f3',w:?TSEgSfffss?'P'3gww2em5 WwzsssgQ25'f::f,24 Q92 .,... .MW . ..,........,.. ,f-1 M ...... WWW ..... WWw,,,,. ,izgggwmi ,fgwf-ffz51j2'225f:2wufkfsgwgfvyw 1 :',:ggg-, A .. 3:6fgg55i'f5d Wfggggfeizftfgfwii5235822 Fjgviiggwgfm vg -v J - A S32 SimSwxfiffs5232fif2f2?5??ESfsszsi??5f?3f5fi:S 2552225 ???s:? :5 s X f Al V ' 'Q . . W ' N. , - WS:::f+5M TcSa21f?5? f'S23-isa?hifafzsszfsgwlim: S - BR .-..5:::-.51 21 X A if A W X K K- Eizffif.-n1,f:f?13QSiZ's:,:'v5fYf2i2:zf5f55?L42ExQfffifisif zfffgfw Lfssssw eg ws: - f N g Es:-z'-fgzzfffsqzi, w.:f.::a?MfQ--wiaszzfwwsizaglcfwhsgsaqazlgwwei gina: 2 GN ..N-J- ,. ,m,::,,, fkgmzyw qv ,,x 55g3wwf .wwgwg-M-W:32aYk www? qw-3 MW 3 xi Q3 SswwiwfsszgsgliQifassfwfifigafisyssfs??22ff:sW5?21s2z'0 if S2 ff SHS g ,za Q1--5 P+ fzszfmggiiffzizfsi12552535ff:2faM:iz1E2:Eggssfazgbggfwgqzfggqggyi Q-.iiiiffgwg W 4 :Q .- aff' ,. ,fgfimgy 394 Mizzzg-:gg 3555252455555 , ' ' K 3Z5'l'Q?f5f9 3 057552fgifiiggjjiligiii532552152952 32555523 ,gwgiiiimzsgwglzzsmggaal . ' . - ' 5?5ij37fl5Z , f fem' Lzzggyf gfkzszpff-wi: ygifimfggigyz 12, - XX . 1421515 lfzzu riffs: 552 igisiliiff 1' 5521244 f3?Si2'5?:??Aii::iZw A H Wfs?55E?gSSQ?1+ ' ' ' ' V K R 1 X- - - :gmfm1Q:4?::i'm,,JSZSQMMSQSZSWT Wfiilfzzgmigirgz' sizzix: slgzgfyd we ,V - f , . fizifryGS-Wes::Sf5555fiz1::z??fPS1S?fgg??55555555fbM5555?2z::'5gff?:si1f?5i:f::5:'g'?5g'2g V, .. M ' 'W' ifisw- WQQ if f'f?35'i,:f- fsffiiiW2Q?5Z:z:zfz52?:i1fMm fn - 1 . f ' fffff ::.g vs rw fy ffzzfrffmfgzwzsssv iff - . .- K x - 1: :Lei Avzw iff? h:wz2f4l.1:LzH5'i::umi ww 1 I 4' ,fi -M- . . gp- - ZQSUZI f:fef2ff:Q::::s:,? sm: 5f33E,2'5ifi'555?Z3'i?3f33S75?3'.i7::53 -I 1 . ,. 5:2 L 52? J ' K- -'Q 'ff' :U Wifi? qfififf, 'Jia 'f5:fi'fif?f?:?if?5J55Z ff? A , 1 i' Y- 1 M V - ,322 ,iii 231 V 'iffy V. .. N,,.,N,N, , .,,, .C4:4,.UQ153,, .wgghzg L.,1f:,gDg Mig. .ziggy ygggggffiaifggfgirgwy, A 73Z3-mm.zrzasqwzsbgaz..22:41we1r:g:wU5sgggg,Wq.se..f,:?Ssg:::y::gg4e.4,,:?,,gwg:.vfsaggymmgggggfgmzg, ,fM,::5gfgyQ,z4,fgggw .wgfggg www Hy. ,J:g3g7f,q.g,55Awwigg,ggZ,.?,:ggg3gZs ' , F w 'A f,I mil, Affrz, M Q , 4, - - Q. ' figak ,,g: ' ygggi 4 viii, fzzi, 19533 JT' 6:21 biz- 43L9:z':'f22lL'f2fZQf9 ffm- - - Vf2'Z7f,, ,qfgimvlzzgpyiifgzgqwzzfssasssf 'w ' f - 33535555 'WffffQffiff???ffffffff? f. P M 8 1 J f' ' ywfhl fiijjff'1,5435'fTiZZ2yf'HZZZZgjfgllhwf f T5321f:45?,5,iMjZw,Qif,,,5:3ffEL ?l5l5'Qjj g,,3gw ffijbw iJ!f3yf.H,,'QjMA1 'Ziffflfiijiyjfw-!Z'Z67iZW'3'5fZ2Z359.515 .N , , -ygffiszzffgyiiff,?:gg2,24:?rf H 'zzgzggfwaif?fY:z5ffQ?5'3z:2f::w uf. , 1 iywlifwf i ' V4fZf,' mga iz . Milf ffm' . :SLU ,my 3212, 1555, y .,.-- ,n L. Vgggkgw.2,m2,:3Az,wa2'pgy MM'gffwil,rgfizgygngggwi ggg5,,,f:zQgf, -Amgv :gff Zig A4341 Z:Zgv4ggf,JvPZ3gif'1:?wm'452'ZfH4'S4f34:i,',5gi?4 ' - H' 11 ? iv- I 3: . 2 . '- . I' ' 47541 Ugg, Jim, 515257 zwsazf, ' ' ' K . f. , QM,w,'Wwff'mfmxzziw'zmliwaudi'M'1zJ:h?P:wMZggg50M,,.I352,w ,3'5'3fy4 zzigby 7.522514'?ffiZzff',ff314Z3f2ff ly r ,A 'f x M g f nv , ffiffjh V T335 ,V , 43, -f f ' W ' ' fi'l:5w'w7z4ff 2'202?259wgs:::W?g45V :?N-iii! 53:2 'if?5.5fW43'4'f:Wg 'lsgffzzlq fejffwgglifiiif Akfsfsm 'vigifwiq 4 .. 0 Mggggii w. p 5,issf5,WMf2,f,wm,,-25,5 Wm,gMx,,30g,,gng3g,Q4g f :- 1, 4 - 564 4: f W Qfffww L 5 Af fwzwpsf fl ,m.2,wm,,m, ffm-WJ wm42Mww0 vwifnwmf WwfQM.,.ff'fws,.L gwA,,g' ffmW,,Hmm,4gMf1.v ,wfffMw,A4W, , vwmwg, w,Wg22f,,, vwm ww z. .... : ,fi ffo lwg wg-fglfwfugwqv EAW ' gym' , , 12 ffgmsyff W .gmy qg fmm, ,A gnu mwfysfjzwfwgf ,mi gf W5,,yvM.:,35 ,3,33Mif,5,ig5,giggwmmgy yg,W,, 435,23 m4::, :,, 3 -fb .55 15 ? Ewisixgsfi, wgsgsfass 235435 My afgsigisfisigismisfsi gg as 232521554 liwgzigwzfiigwgwigzgggm ew Q Q34 gf Masgm M gfg2g5g'::?gffsff5?52:55fg5if5::5:f2g5,g5if:h, 'fsfzi:fgiggfasgifasgifgfgffgifsmgiffgfffg. as 'Nix!i:f 353Z'2:3'f:?:'I,.,g3gi5:'i?F '5iZ5?'534!i?Zv ., gwf-.Mx QQWMS, v,,,,Um wggwwu aqwgeghwhfg, N 44,,w.iUf-f W M, E wb M if H -G we Q, Q. N W Rf fwswze Xiifwiiffv wi5vGg55f555a1sg23 :Q::,:2w4:wf2i ffm. ifqgfggms bggggqgswmgrrfw K-mga ,ig mfS,MQgg.s5Bf,mf,W ,wa A . MW Q , ,,,.wwwv,2,,,Wz bf ,, 0 W ,Q ,,0,,-V .,,i-wp. WM rs gm , 0 wg wg Q: ,W MM K MJ, Q1 wggiimisw assi' ffsifgfgagwwzgi fw::ew.f-143:12.25-22:05+-zsigigxgzr-1 gzsfcmsiizigsi ffgfaszniwrr':cz-:,g,g5gzf:.23g:Ig, 3 M: zwgmxg uf fggw, Mg,5g,A my agp, ,A awggk vwgfiggifgg Wagga: Q, ,Msgs . 23 ,Hg A My ,Dawg .ww N, ,W ,., ,.0s,g ,wa lg an 5,3 www ,gem aa, .su f-fvsfw,.m.,m,.f+wg.w,., Q5f'2'W'Z.fv: 'f'yvirif.'5s1 f5, 'f-v,,wy,g w?ggi3S: , , 35:5 S'f?vf?Q52gs gs:gs5gi:s :i2SS'Ss5a Milf: 525,55 fig, musing ww.wsqffwgifssfwfi ,xsifkfes-,vgsmfwiwrfsw 40.2.-f,g5m:f'S-f::.fJzwzw-JiW wgk gigs aaaazziri -rsfwggiggwwfx xv 529 fzszwgwgzxzsggfwgiff255959512145 wsmxmwsim as s3'H?W5 Qwfggz ' QQ :2,gEfwg:25fz,zg: ag Q fsigggsgg iggiszawibggggg Vifiggwgggigji 55,5252 jggm f:.h,gf?gM,1w:,,,'2 gs 'I'M'2:-zz'5.g:.2:','ygfgimffrfsgfigfwzfiw- Kgggfs ssigzw Qzfwgsmw, , '-f2w.,g:Lfg3wigf ff:, X -fwfgfsggsffsggggigsfgrigfffzsgfzgvwmfzifzr?25:gii2'45::,y.gW5:153'n. gm. gmgseggggfgjf dawalgnw ffzg :.f'3:g55-wfin-flisihMft. -w..:'J:. s22::Qm.::e:::2w,isiSb,eQzEa fgj::,, Ssx'f mfzwgiigw iziifsiizfwb a s: 652 , ::-.::- Y?-MN,w'qQ,4S5'u wdwggfjkw ,gfakgw .wgff:fgEfm2m A,M -.:-:E-7.g., M z, w Eiiilfsffffigvgs-V'55gff2?w,, gn-QW Q W , 552 ,qggzf-:Q-.fzguiznmpyfmggrgv-2 11myif-Qisgssfrf,::55555555gg?z32235e-5355534 ,gwgffi gm X45 Q, dwsrdfgwzgyfw mga v azgwzpyfw w Maxim wx, 'w.f,,,,'f,+Q sp gwgwggg wgsjsm v. w,VM4, - ,gg f.gv,,,fm5 2w, gy 5. Q -.,,5fg2',,.15g:y.,fw,g,yy-g.',w.g,.f f 3j21,', gif Q ' gm 12, 1 :s-2:52. ,wg ,Wg,,'5,,-f',,B?,:?g?2-wg 5555555555 2: gr ig mms :f,:2g,ws:55:::n S5z:l2f:S,:hff2a 5:?r5::s?SS52bgJ2g,Bw 1 sf gzqw , ,T aw . 2g,2k5N '5fr1,-Qi'-ha 3 SEM? 'mailffm,:n.,:553:w.gg,21451.:5:'.g'2Eg'g:NM2SX::1 2-:-'es:Qgar:,:i:w5:5fSgf3gfs5:gi,a:,,44? 'ssiigg igxwfqgk WZEN. v,,Na,.,m,,g MWgM,.,M..4 ,N Wfw,w,,W ,3,,Qm5Wg .,,,,f.g,,,,gV w,w,,,ms,w,gW Q59 swam QM, ge,,5,,e55,,r ,,.,,,WQ in pk. Q ..... ,NW , g Q 'iiicffifyi ffswgisfizs .,f::11g'i:gZ,Mf'1f.,w.LfN1f,q212g:wigs if fswsw 2:w'Q1::ifMe31, :M 'Away g p .. EES' H?221:5?a::.:5S:ywQQSrg:5-3:20:six'gzgg-:sax-f:22:1:z:j. g'gf:,:x,fzgzf':ia:: wgoseggzglfg g5232:1ff5s,,g1 65522 g:::i gws Qga : f ,j ?Qi ffffff?,25Mf,K'u r: 552 'f ',iM,w,'2f,,1f,4.,Xf-fe,:mg, 5,s:,5,X,,gf-ra.,,fW,ej - if, mg! 552322 -Eif If -a . 4 ::fi:-r,:- 'Q' 2 N ,X M 'fgg:S,,:W'i yfigfsssi 'mJ33f'uw2I, Asif-fgzwix N221 w'-wgzfffg ,Q M' W V, .:,.:.E!r.:.:: x ri-' H -5'-2::-.::E'.E':f55 : : igigwx Q gg? - if fi 9 fi ,gggkgggzwxfig,Effgj:r.f-fg,.3,, z,, i:esg5s,s:m1::hggg35A gwisfg ?f:g52faf 1 5555 2 - .... .... G U gwgzhw QW wif mfmw ,M ,y 'm5,,,10:,,w.l ,W Q,M,,,,w,, 'elf 2,,,f,,4 x ,,gsE,,gQq. ,M m ,N .... , , ,.,,,,.,,. M up fl V : X,g ,fg,5,3 f gg, . ,gnu-S,,wvg,, ,,,:',,wsf,ga,1gggw A aglzmgwyjm ,,xgg6,:QLj3g5ff,X4wg,Jf ngwSfQ1S,',f54yg4 gi5?,i34.Qgg,xyW Wwg -...,g:. -, .,,,. .Eggs , gag :,,,, 3 -:: ,:,f. , H g gwggs H::--: gg5fm'gf,5sw wggvxg w Xmsggggqilv :si -Xggmyhiidf by2515251'fffwgze-zg6ggQg,:Qff:'y. wg ALMS? ff 5321 ' ::: :.. .Q wwg -: N55 igifxwggisg f E 2- Ngg mgmxkmng Qjiiglggfzggfigf :: .. , ,,- 3 5. 5, E- aww fa mfg, - V '-f-z-36?l 4j xv :ay ww azsggzs fxggffqgg ggwgzvgyg,g5.5'4smy4,xf5k:5,,.fgmg.: ffgangg:f5,:N5geE.gg5,2,5nf5Q5,Ag sg if -4fg2, 3 ,:f 4gE55,Qi 'n . f v 1-agrgvfgkmmwgd d 5 ii : ? ' 53:53 1 , 1, H ,,f. 4 ,, f .,fx , g,, gx w-'fwmgsfiagsfsgggw .gf:Q:'-'f m ,fr 22' 5 f ' Q f :2-:r- -e:- 'fvyfrglvg-W' , :wi-::r: : M 2g1L??gj5f7g,gQgi?,ggzQ 5331, gsggfgfgggggffggwir wigsggsgsgfgfx ,wg:1,f,5:5,i?3agQ,g,iQy1,3s -gf..-V Q , ggigdf - :S 23 w g , 5 , 5, v 52 gif? 5S 4 fs Q, H2 W 252 .-1-122 55 if fzfgqggggjgg ag::: g55a?g.gtg3'f g A as 5 5 Sea ,W 2?ggigg. x+,,f3fM:g'gg ,gg 3:5fgE??g3,5smi 5,ggg gQ5:i2 5- Q f r Y -er , Qi fff:fg:-11f'Qf2:- :-'Q 21 - ff ggwwfg w a um, W W mzifgfgm wig ,X ,v.5:1iRZf5y.sg Qifffsffpfszglfffiiffqsuvifgigifm-wigsfm12? pv+5g5 5gZ5?f f,:g Q 25555334 ?mpwm,52gxs,,mwa,2, gwfqfmgw , Q ,A .N Y ,R ,v ,,z,, M.?, ,M ig, :www W-X 6,535 Q My , , ,gigawgfwu an pw gwg wp 4 ,,.., , 1 ,5fgS?QgggwgszSg,ggf UM ' ,S ,, M f,,f ,, 5. 52- 1-gg ::,:., s5fff.,.,gg,wf3: mgsiew ., 5,53 aqui ggkfiugggff h5.,2gQ,5gQ5mp5g1. -:5-,g:gg -,5g::5':g-.r.:5g:,:-:gf-.:g:.., iw ' A E Q xg? 6 W ggifgwgjsgh S .pggffg 1, 1:9552 M ,5E1::-rs2.2f'.E2' w,wgw,,j .:,, .g5 gggflgoxghigg, fsgeiw :Mg .V 1If:52ffi2:gring-,5'.55'::g:.: Q,. I , W-'Q FQ,:?5gE??2w:9E?gfiwggii eg,-. weifwg H:1'5gQ W1 E5'::E Wim 'S H :rg- 'I-M ::2r::'-if A . ,Q ' V Agffw sg 6-.wiv 1 5 ,w-angxggzffmgz-252.g'::g,gf,5g, Rf- gjfmfzplwfx-N ,W ' 22::515.r:-.- 3,17 3 H ff, rf Q 1 ix Q .:-:E--ga.. ff 3 W M23 gg hfwimfii v g vigsfwriiir n g 59552, - Nga xfifiizfp M .:sE ::-.,s Qgfwgsfg-'Y :xg .fgagmkgggggh Q, 5:32533 .13- -Hg 4, dv 5 2 1:3 W 4 .. s ff:' :Eff:: 1s. :M 52mm 09 MQ fikg :ff -' Ifjfzew-'iffnzggfigsgisizgsfmMi.. Q 'Sh 3,7 R M 4. 'Q-, , ,'1wgggfi2 .. 5f2,g5Q'f'f iimgifiesqgm v Q , gk5+,5?5Qi535,f555g:?s?ai55ggg:sf:5fsg an M f, 4, myieg yn gmgg ggg ggggig as 2 sgg g iyzwgg sm ff w, P f -WM M sri wg , :s::g: gg?ggfWg,Q- 122 V wg,.g,gw1 , E Nw ,f 4 ::gg2egQ,5f55gj -Q W , 1 '59 ' EN Q ala? Q H521 4 Na '21 fifigfi'-'-f Sgnzw :ffi::.- 'ii 1 S g1lfi',a.g:Iig:sf-,.. :2'-H g ' 5555555555 520. ix? 1 ff W- 12,5 13 2:-::::.g:., 25:-'2ff:: .r Hgh H5552 2 '- Q Egg ff f: ' 2Jg my 1 5 QA? rL.fQ d,, r 3A. ,Wm ,Q Mwg N ef ,am my 3 E W M Y. ,. .,.. , 5 5 xr 2 ,f jggyggggg5lgfzgiggiffsmfgigi.gsg.?,g3:f3:,,kgag,-SYagi, +. w -55326 , MM ' --,,s' s:r::::. fiiiigfw ew, mwgggfgaffi Nazi? gffgffnzfgvfighjwn 'if 2, 5: 53g5ggggg:5g555 mg5gggg g ggiigq, my ii .3 :mfr 55mfg:-5zs:.:if:giM2E:-:mm ,zwfsezjsasgezgffi?,Qs,g:k1 2 11 2-Sg '1f, +' +,as- w x if rgfi ''3g,g5H,i5'2f,..5i,ff?,:'5g...,5z2':gm-gfitaig, az 51 'E54255 Qslififsfwsw W 'SSQM :Q N 1i ' :f:: 1 2f?LH:f '2f'Qi'ZfH-,f,f,,'gfiiw:7 WM 2- m:f2gg35::ffg:a55w,:'2Hfg:s.fQ::,ai:q35'fs' wfl2wz:Q,u:232iE.K25is:N 225, WM, M Hg, H :2gw,5:gf fg::25ew,gQe35g::f?5 g Hffs,-f ,gsm , 625-was m,.:A 5 gi ' -rifgwf25232552wseiiisryifreiw.2235372325259 X z K g 13:52 45gZg525:?:?4g355 : :gif jfgffgssissggcz fifswsg bi ?ff5,Q figi 1335? 4535: Wgw f :sz J zfwi img!92:11:22: g::.-gpzfyi-I-qs.-gg, fgwggsggg X mlm! fmywm iw awww-fs wflmiyfszgfiwfsw ,haw ,'f'.i,f3af2E,w5 - Big-wwz,53gf,54,,ggj+.,f,gg, 4-gg,.h,:,:,.::..5.M,.g,.',.A,,,,.z,:e,,M.., QW ': ,z :wig Wifisg 2-LQ 533592553532 7152: mfg z:fri,grg2S2 5 5224056 , E '30, zsnisgfggfigggifyb'5.:2:'ggzQ2E5.I?:nglypzzii. 2':5z53:f5E: mggffi , Siffgg ilwpfmi ':?qg::::p2g'f,i:w'Sw,::1g'S::y.Hz.2wi: mm ,m,,.,1ff:fww:.-'gg24253, 'wyggif-',4,4--y.,fm.emi1 gggfixw s'5'95e2ggff.,eg2:lE::f2?5 I f Mrzligza ?gf25,ff:2: Aw 532255 25:giwxfi,Eze,Q,Wrf:.1,,hq,'fwf,'ffq, .- , A '- i255ifg2f55f2'I'z5S:fg:fiEfef2:5g55ssw'Qg?sgV, A ,, ? .ma , , s A wg 4 :Egg H H5552 vsglggggi .I Q gfwf Aswigzi ffzgzizfifmgw iw g :aww Q . W fi x , ' , Wigzfi , W I A I 4 w16M,M,fga,Q, , ,,,,,p ,ww F, Q 4.1m M ,J ,H ,,, 5 'J '7f:Wf2gfEff'5:w.?f:u WFS ' ' S 2 A. ' 2 5 V E hmmm ww,w,x,, , MW, Qg,..w,,L 43w,,,,f ,,,,, - ,:,,- 1 agbfgvwlwnawm .fmg.,,w. Kqqwgg.-w,,,.,.vD ,M J, , , A gg., f ,, M ' wwsw 11-fi 'ifwfiwfftaiiflgwwf?.aq , p J ff' 2 , Z ,, H x 3 ,. U . 1 ,MMQ f,,e.,,M.,,., ,W Q Mg ,,,.,paXn , , W, ,,. ,,, wg 212214.wsiii-b:gfH::22-gzifM5523 WM - E ze::Jg:Wggsifsfg sfffgm:affgfy.-zg:4f:.f,5::?gwg, f fit V aff , f Q- - 3 , 3 M. M gg, lgma ,,. HW? , .,, ,,, A W, V Nfpgigigggyzkwzay zmfrwfgigfgmgggigg,.vmwggzw f ' .E f ,f 1 if x Qsgw M ,qw MQ UW Q U W ,mg QW ,M gk , -1 :fn ,gf E ' ' ' Q-533 gigw ' Q1 , WgggggEggggjg5Q?ggi55fff5E2f555::?5?ji?: QN W Qws',.:-,H.2gfL:.:W5:4:-',,Sfr::. sf:w:,,y.. ' , 1 , f ,ip 'PSWsg54:2Ngw2g:1g5vffE:gfggf2sf5g,f:s: zfgi ' f I, P :s,f:ggWga:Qffg,,-.W g2gss::Vwg,':.,5?.w,!5 i i M 4 'wk :W W m, 4, hn hsw S. Wifsizlpwfw H Jw QQ2' Q, hm '- , 4 sf? ' z'?.:g,3g:zz:.2gg,,:gag-::g:,fgn..e:f.:g::5b::g,n3 -gy ,mgg2gggg,5W,,wg,wQ Hggmggggrwgsvga 3531233 meg f ,W K y 5 W M f .,. f vw? sf KF :iw gigs We ' 5 wwzgizw Q M ffggzi.,ff:S:s5,:,:5.z.55:f::1z55'gTgmigzzy W 4, . ,SQSQEQHQSQQQZQQ wp S f if 's:pg?i25zV43,5:i3zwlwffgfgzw5155222251555 4:5 ff mu QM f.:' f,W gg jggfwfzfffgzgwzsgggsg, W 255:55 ,5QQg,,::zg25::,5:,gs K fm :5'55,?:E-2 55553: '4 I gegg gggswfpgaigwi' gm mf, -' -53 55545 :sag 4 -. f2 s:i'ff ' ? wg? fzw 11 5'-:fa. :sruf. am A Nw :-5: Q- 5 rw? 2,1 -. :.-,:- ., 5 2: :: . A fi g -- .:-:: -.:'f-: 3 'M ' +-f 55555 5555 155 if 5' sggmzszse .. , gggggg gg 5 W l?5 +3.S1S3ig?fw3?T5f5:g ,Wm . , Q, , , .. , . H , - U . B SW . . V W EM v.s,n M a p , ww aa Wwyg Q Q-2, W Q' K My - x '34 K wk Q 'mm Z ,uf 4 gg g,,g,.i9,, aaggiswfmgggfg,sssgzfwswgwgfggi sQg5Qgf..,s5mgQ:l.y.zsQikwiiswizfzsggmssssmmfipfiifs:swims A W 'wxvg,gfWxf -W4-gwvxvf ,wif-w1'mQvfY'iw BzfwmewvvwvnifSms2i wM? 9:'x,-1 SMMV-nw-1 L im' WNSf Z1'w?V'T .mn W aww-pw,w,pwfw,w.gQ,,.S .wmwwmgwm w,,y,4,pg?igyww'., M? WM:-wwe may ,bm ggggg,iwfzzfgigggmmiwmfm Q,MQigwmwqgwmwwifh'f1fwwWm?,,..,n.f F, -Q, w8w,,w zvswwz www-1.1 Q Mm -awww iw.-M awww 'wig M x'fF.Jg2Hw.9mzMb- WMM 20,gjifi3'5lv-mM fr.13azz:ffm312255::f::4??::zm::xss3efmfifmzwifi?mfigssffm2:zfx.f2:s,2fgHhsmgwcmQ22:m,:::g,..,M ,W ' +S5i351Z.15f,4iQgSWL?3QQs:S3 , iilwgf, fvifvlwwifipgffh MMM M4 ' ' 'x- W 7' -nw ,, ,Q' W V ,:M,wjg',g,gw Qggiw- J' - Awww.. ywe,-LwwmsizwxggfQwmbvfnwhvg, DWPZM wwf ,W W.MWp:.q,,,w',v:s: k asf -,:. . ::' 1 -., 4 Q xx s x , X 1 X N 3 X N , ix S S X N Xi , . :X 'F g Ni 5. S 1. ii E i si ff Q 3 E E E as + 2630772 ggsmsessfsz flgsszmsasz :w5i1fQS2155:2s1 :?E5'2 ,NL-33g,g,,:25'95.f:g:a V mfgggewmm A 2-H Q, 2 5,5E:,,W agggzggwwmmwmwpw gygwwgzg mkszz.Humax:mszezasfrssxigiesififzma ,,..,2ggwffffmm,m EEE ess ,W 5 S3 HSE 3: 6-.ami 7352 i232 3225 P z.f5f5m's ffm' U P, pp H gh, mm we azz. Y 10 Aww my . mais. 9:15 Nagy. wwggya kiwi... A .Q EWQZZ' ,g2:2::'isssw ggwsmgbagzwsnHigmibigkSgswgiyggsiwgggwigw wgwggah' ,f5w.Mg. win- iam: :.:m:Q:ag:::: Sw ,wifin M-4 ?g3Sw fm, M 'amp mghsffwmiib FS 2253? mb, X f ,iwixfli qw H v w v Q H - wp W M2 0 wiq Wig Q hw Wm.. 14351, S 2 wngwgi- . 1 4 4 H mu ggszfghm. gwng .72 I ., 2 mf wg ff A3'f3'2z.. E?fs5ffS5gsf2 .swmzw 2.42 Zim WSE: Q 5 ww 9 niffmmiiiz WZSSQESM , Q,kf if'SbxsZ3Qfww,1,QZ' mia: 559512 Y' Qgwgiz mu mah Qxwf: A . , izffiswiiwigizzis www my nwifib P W. 6 223' ' gb 83555555 53135 22235 2:8 fu em iw U 3. HLA' 1 WSWS ' wg vmswms 1 ,sz MMM , ' iiwxwu y U Q if hz: was Q f-Wg-sgswzsz Zwmillliil . ,f , Q EM , U .. 2331. Q M ew mf! '53 W E N536 SQ 1 wigs Y 2526? ' fwiglgg w . .uf w nf' 9 W 2 R Q Q .GRASS Q53 Z: 5 5 ' 1 vii Q. c 1 J ' Jfwwz. H Wig QS SSEQEAZ' M eqpi M M N Sikivwsv Q ,wwf wa Gwinn rw v 0 5 A S 512 gt . 1 22 U bw Xkefv.. NW. qZT'???i'V.:il?f-TW? ww W 6 igggggwv iw Qs, 53 wg, ,. .... A ..1.- egg H -. ,: b x 5 2 5:255 5 1 5 -:3 5 .... 5 :E'rQ 1ga:' 5 Sfiiggfigii Qiggiigif j fi uf- '5 if -, -. Egg Eisfgggghsif.. giwggg ,gwgdg :.5: :E'?' Q 253353155 3 L sswgw i. .2 ':sE:,.: 5' I. gg E 3 hx wg S5 W .. .... ...ip .... 4... N X .... ..... ......... s ..1. ....,., -- R wb Q, ,ww Q '.I..I .... : :: ---- ' .--: .-.- 1-el-:-.-:--: -.-.-- 9 gKgW e?E5wg-V-fg1s.gw?:fQw Kiwgi? .:. - 3: -5 54,- Q g. :E: 55.5.5 - -2g.ja .:::.g:.: --,:': 5 :2 RSM iwsfl W Naam mmiigs + ' fmisifsi rzem. Ai qirzzmi ww .zzz kmwiiif 543523525355 Q Wwvxubb. v X Q 2 5 .V A. .,?'3 - k My -5:MW.M:312QiA ,Z Q Wwgwbgggigggmq, - XMWQ 5.5.5 if- 'K K 1 'R .. - XMEL- f .. S. . E R J' S. ,K X N N X . if X w R k . Xb 2 5 QP 'ID W ...Q x Q wx 33 X , S ff 2 A K . Q k iw? 'L . S N X X R x Q. X 123. fy QF SA i. ,Wx Wg W :Mg 75224 ?22Zl':fmSfii, : , 3555... 7 2 33 M, ,aeivix 52235223 ,i?2LU!QQL22ZiE , i fi, :cpm 7 337,04 f S52 f . 1 4 ,mgwwy ,WM m.fW,,g1?ZfZZf. swwfnuvixyizwi V 4 5553152144 Wy 5 Awvaw 0 Vp3,s92.',fHQgZZ,,7 ,Y ,. , frmrs'Wsis:zW:A:5swWf awww ,f 4 SQJQ4 E22 zlcifgsfrafrgsizgisff L2 9PW:iW'4E'Z?ia'af seam. Mn, , W , 1, f',w3y www V5 www .0 f A M fwfwzz Jzmzzflg Wiifsi ggeggggvgisigigfwiweffg f ' ieilmfff ??7 '7 5391? ily. ww QfZ,,i3:g'2'1i wiiffiigh ZZZKZZZS. usfivwz' 9' ,N Wwwwwwinw, ,. ,, , ,, , .lmwwffgmW,WM,.,,., ..wY527.m., MMM, fffiww MQ, ,...wm.M wKMm11w,f,wMadam .. , ...L:wfm'Zi'iZ2i ' 'Awww wwf 1wmwwMM.mWww glygggglqgg,AMW!!fvwjzgilwlagggzf Nflfgggsy gg www ,,, , 4m.9M.WM,Ww wfwwm, My 22 M ,fW,,M,.. ,gggggwg f,,5'Z?ZSnfmZf, pf mfwg' 'MW r ff Mx 24 WM gm-1 44 Q I' W Q .7 My agpgagawgpagfvggmvzfp miifzmseszs .5Z 2i'553?33? M r ,241 W 4, W ' WM new Sggggggw M2245 tg, 'ig' w,w,fsgafg52:ezf:ssws:zZ Ffizzifig , ' Mm 2: ,MMM ef fwwff ,,,,m,,,4? ,7.gaMm,.fV , , , ,,. Wm. , xffwfmfiziziy WWW. V ,, wiggigaiiigggggwm 22042. ww, W'W3WZZZfZ32?4'Zm Mgfif 436,12 fama ihwbggqwsvzssebyo A., 2 ww.. M rf iizwrv ,wif iffflfi f?'?'? ?Z m WW.-f avpy , 1 , ,M w, 7 W ' ' '7 ,gg,a,m:2M:,,sw w2k,2Q,gggwgg2f:v,2'a fgggwmwwf qigizqagwm Dwi, Qmmagywz Wwgmv Wm g.WW,M ,WWW A , V V fa 9 , 4' MW MM ,WM WMW,,,,.,A .ggygfggm mgg52ggZ?ggf4W,p N wggfgggg 21.3 ,ww Wm 55f?'g52'2W' Gigs? ff V 2, ,f 1 fs ,W 11 , 9 who jess , f gay .1 M, in ,Z an x nf 5,54 fwzzsmffzgg' 4 Mm .fwwy W Mez? 1322954 wSf2,5s1m5X:9'5w5,am ,www ,fm wawmi f '55 v V ff M wi 14 eg ,515 AS ' 'Q ,pw gagmww my 5 4' 4, ,Z mmf? gssgw g 0 Um-wh,.ff.h, .EW h,.V,,,, mwfwl f 45: 4 ., :am 255552 fa ,M , rw? 5WW,,h,,,m. M,0,M:W4m:t Q . 42i554ZMM N M , 4f,w,m ,. .A 3 Z ff wi 524335 i3 3g5?:A if ,,w.,, 29555 H5 M W VJM., W ' Alf 'U A we ff Q :fx 55 ww fi HRSA W 221225 ,, ..,,... . ,,.. Vimxfu 1 .. tif 3 in Emi? mainhh vin gviaiv M5245 migiwwv W NM f,,..,:zQ.z,: 4, .7Wz?,,,M2lW4fm :Wm , , we .14 MeW..,.w.,,-, X u4wsa?,. mmm? - f A M Q M .. U mm www. Q Q gggggfgggwqm kim. N, e.,,,,t.Z5gs: sh wgzqiagi s ,sew xi - so M RM 3 EQ Q-.il fag? 'M' Q ig? .E .... .., . . W 1345? :'s,.AmS, gm sw aw .. . . ..... .5 fgjxlgkfge MLS 's Awmzzgemrh b'gggqQ.,w W 1 Q.. . . Q wwmm., --.-:4: - - .-::::.:- mwm Q ,AM ,. J, 5 .959 .., wygvfaqsiinwx muieq-aging mum ,e - bmwbw - a QQ 5 3 ,. is Lam. K . 1 Yi- 12:- -5 5 :'1 iw w aw Mwqlfim Wgfsgif vlgm'-Q h . . Q 1 qw xi K A522223 'eg Fix give ,nm 1 .W '-www-Q U xi cw-vas . B. 'mqzfir f,52Ai73Z'. atllliivf 'wif , W W. v Me mmf....gSf12'45i:ffgigg:3E,-53335553-fw m'Sg5gS?SQa W W zewzl Q ' 129362 iggsfe 6 4 fw k2:ff,ff'f?l: V Z 5590 59: 0m00,w..W 'Ch M .fsf3pM:,za53m WWW... ,mlm M752 1,JT5Z'm4zgfANi9' W2 1, 1. S Q wx :tit 3 f 4. 4 5:12'32U 453375 'Z f 51' N, Wwnf mmf fm ff zz4Q g f pf 39 f 45 f , M 5, 61? 2 iff 9 W W .,.,.:i?4?ii 'JPY IV V swgf xv 4 my sf 997454 4 !ffZ4f'6 ,Nik 53 53 fit va VT! f' N.f.3-ZMU EMM 222 5f57Wi'iZ'5 f QW.. ww JAM, ,, WMV! J W iw K 4 f 5,553.44 wig wi Q ey efsiggzzfzgzzic fffzztf ' ' ..,, . f , ,,f?45?53?Q WW'332f :,i lgfgigi ,, :iff L3IJf?i55Z2LZi , N 15222 sl , 2 Z? I I Q5 Z Mywf- Zmzffz 31 Q 'uwoifff gf-'ff 2:2322 V2 rv 'Q I Msn fy f f W fmmf Tirx . 1 M22 w,,WW4w,m ,W s, gif 9 X Zi vi fvlw 1 W A f ww ' ..,..,, QQQQ. 223531. Sym AM wfiiziz 1' fz ff 53'?5:fff9 Wham ' , QQQ, ,Q Wm, ,.,, ,Q z,Wm Q .... mek mink- r. . 3? Q 5 351 awww... ...ww W P, .mggifmg gr wxfi :fm ,UW . t wg, . ,W wiigix U Mm . B J Q W . df iff: 2 .. 315255 f -' sJi,,.m 2, ewmfem H,,W,Qf mga., T3-K .m:ssm.sfz.:.4::'ei' 22 'Vf 1'E M. Maw 'L 7 X ftiifgge A asv 233563.55 Q, gggwwgg Eg- yr g5i TZYT3 Wifi' 1 awww. -M-W, gifs? Q Q. 23133. Sega: QQ. E on QQ. gb, m .MW M .www M QM ei' iw is QLKJXSQZKQ gi QQQHQQM .ggmggi Q ,,,,2.7g5R . . f H QEE 53 55. ME Qi 7 5 55: 1 ... 1, .. 5 iw . 5 , Q 1 Riga mf... . Mgmwygaffsg 3YwW'?fi:::m5Ei5'fg A 5 4 m..fm,,,,f- M Elini 5?ijX V' H :gigs Z wg ,L ' ' 'QQEQK3' . sW,m . mx i -gmzsssz Eizyilmgfgfm EWSWU 'WEE 3355533 . , ,S ,, M. 6g:1::.ar,fiZ:'f ::.Z:f,fff: , 5. U WW EEG: .W v Q :meg W ::::g:3gg,E: 5 7f,fWgUw..1, D.mw,m5m X wiizwifew W, M,,w.vfaS,y:g1, ,LZ . wi iVi wg .. 5 Skyxewiimsw 555 miie? Ifl ff? . 1: 5:?51g5g4gg ? QQQ:FK2',,Ug? -: 5 ,wygf W Q f and Q... ,W 5, , ,M 2. L is asggfgs ,fizfzgwg fwfv ' F am :Erma egg LTU ' mi H ,MW ,, ..QQ. .aww . ,,,. z,,,, M wg Q ni ' im mms Emi Q A was E7 s y W E g ' 227555552 255 ggi 5?iSSWgg33,jgs::, :ss:2 5gZ55 :mg qzgwrs A , , , fiw:ii5?E5EgfffESi5fWmZ5 Q 63 53:5 Wm . ms Hfig agezfzvszzig awawziigigg ww gg QQ: wg 1.-.522 Q s Q2 wzsfff vwifwevfiv gum!! Fm'ZZ'b'W 65, M f 1 simszizms E EI 2555 mhmi,4..,i,:1,,eggggmmgfw Q. ,. L, 1 my EX wp W Mggf2?:::2:5:v::.Q3aSmf?g3 ww ff? QQ M:.T:x,sf.:M:w:gmzvs-W y ,Sauk -fu 2:55 553' 1213? 'T A Ef55lWl??L5S Z1Z2i - 5'l Pf9iW1M3Z2Uf3fi'x313L'f Q gg wi iggggsgfg Er f 1, ifi53Z'25i'22 ::: .-: ':P1 ,:':g 5- .3.f.:. S5113 N. wi KS 1 gina NL QQHQTEW? ge E 52? wi uw 3 ,za mm W . AMW. 2:': ' 8.7 wa : Q .f...::..:.:f:-g: :-,:: WIS? '75 :'E -:Ei-5--a--:2 -2--5 :ii .. Q55 :Ez- ggggegxggggs Jwmsw .: :. :5: g2-Q jj :E SQ 35,2 sm ,EW M M .. . f M.fi.ff2..4fiff sfziff:1f?fff E Q --if: agaiiiifiesllllff'2w5 'f3'lZm W 5552 2i3fig1ii?,i S 1 H gg.-:X ,X EEE gf' X 2 me 33 6 11:5 3 g wg, X 2225: Y V5 5? 5,3525 55221 : Ififf I 5 - -:gif A i f E' ,air 35522 wig ,fggev H ' ' : ww NVQ wk 3 - f 5 sag Q 45:25 55555255 .. ii kggff 2 I .122 32256 wi V 55552-I ,Ta . as 3g'Z3-515553 Z Q Bike? 5 542:21 53. Q L42 ?' 25551 552232,-zfilggg as 5 Jaan Ji si? 5 xg? Qgyi i :S 21353 q 22 .1 5 M 'V 'Q 51523 . Wes, 1 ggvfgmgzw M iw. Q gigs ' E S 4 7 322122: iff' ww fi ff Y. 0 if?-Egg fiifziuf 2 gg: D ga v 42517 EZ Sy Lf, zfzzfesiiffiffi fmlfqaeyghh , ,ffwfe ,um nip ZZ 34 is w,M,,wws A ff M ff aw... .M mifwzzmzz X sa-A V' .sa 2:22:22 ..fzs.fzi.gzE-.5a z5'-f mm ww 2 Wffil' W' ' k M 5:51355 5472 5 mga 4555522 is. mf ww-Egzussagv S H fgiwigxizv iff 5 21 .L Q, if f 5 2+ Q w E 2 Z ' -If ,Z Sz JS iff E53 UE E QE E i K 5 2 is g .gy r Q 1 s E 'sf 4, w fi 8 ig .4 f 5 x E325 H5 V mi. rf. gi ma as ?h1,W5 ig gg .3 ,wp zasiixg szgzgggp Qimms E fi?-2::x???2?Sf????QSS2 .away 1 122715. f.W,,5wm54g 9. .Y 55 M? 2 A2332 K .Wim ,fines Kg: :.:.:Ifj,I. 221.2 ,argzzziagggssias Ziigiffiiia wffs qi? Q23 , Zsiiliagig 5 wwf .aw ra: - -: 51 55? S .g- ' smiij Q .....f gg i: 1- .' WS v.i::2.2:.5g. g:5:'E '-'- :QE S23 .:i:i ::f: 5 :. X gyms? zip -:gf aj ii ES 1Qv1w,.hf s 25 iz .. :a.s: E Eggs Q5f :::':'::: ::E.:E 5 -2- 2 br B2 K ,, 5 'fs iz Magix, sa 4 9 r 2 we ag W55?1:i55-ii 5222 2 53 4 2 J Q A ,ix Nvtfigm 5 1 Q v ' , w . BL . 555255 E 4 if 'S Q , ff A Es 35 Q35 Q u l J J I MEF! E ay? Q D as My X ff EY y,,3?Esx4 43 mgggvi li if s .::-:g::E?E : 5 a- :: ..:-::- -: ::::: iz i ggi im 5 wirazm, sz W QEEZEEEEQE: wg, X251Ye2ffeifWa?5?2Kal5Q21?wmzf:s2H 3 2, ,WW , W : .:'-I .554 A 3 is -'P' P 2 ian? xii, M mf .1 ,SFS ::.::5:ggg:g:' g'ggE?gggBE3?ggg01g gg5. SS N E525 A psalm wiv: --:I-:IE :I :: .:.3 I xg E .22 sg vim, r . Qggwgaaggmz , .E 15 .ax M wk .. W Q I-2.2:29z:::-g: 5,5352 zggzsmssazefgjszsa fiiis s ig nf. . . 5, .5 -5 5. 22,31 I .1 we , Agn ? gmi, J .... .....,..,....... .,., :Z , .,.- .fs E -- EE: ? 55. 'qw Z 5 H T' Q 42, .gg - . .5 ..... Q5g:5?5s22s, ,Q san QKEWS - 2:2':2.2::2.:2. 2 0- ..:2f:2 ,N Q , ...M PA 12 .555 is SEZ: s ,iii gig my Exams Qnwwz . .:-if 9'?Iigfggf?Q?:NZ?i55'g :' ,552 QW? M, X Harish :2:2:::':: - s?'::.5::5 '- by 51.1 W is iziw-1 ,.::ag:-1 - 2 ----- -F133 W As WS? ,. km .. . . .. ..fCF':. :5'-' W: .2 Q32 m fg QQ- 5 5 1 i' Q5 ,ii Q ig gig s? zegzzggrggirfrii ggaggg giifzzis gkzfzg 552 g0.wff gi gi ,z die w R5 ,51',?g?-.N - ' 95 5 s Zi vi Y E. 235 iss Q , 355 gi I Z ,w ii ga ! fi safe W ? Sl 2 Q25 .5 EN! E E - 1 Q12 ,E 225555 5 WE? fax ,.5. si af 525221 ig? 2 ' Q KS 5.22: ,..' E H 5 , E217 23. .2 , juz Eg? 3 g 2 ESM QS .if , 11 . 1 :5:.f::: EM fx . 2523 ,Ng 1, 'i?s0??zKf!f?f zz .: if ' -. W eiss? fs ' ggggg assi? 1 as we-QQZSQEM sy Ywimm 3751.4 2 911250 M3322 . P, af .H fyw'i2?'xA?Q5QzffQ :s :aE: law 5' iw?1 jE ': K ' Q 'H A ' E-.2'.- 10 A mam? A522 :-.-:' af E , 425 Q ..:,.E N Y 6522214 Q1 E s a? if ,J I , ,A ., ggwmgi gg gHVQ.Q w,fgg'Zg31gg5-gg 9 gf 5? Aw W W K f fi 2 555 5 gr 25 gf v .Q massed, ,.Q:.s:,w:zgr:z,:gz:sz.:gw 2333221 wmawa wzszmzwszzy f Rsszzzszf gg V -Zsxsggvisifwzws if I wgsfwggmaggzgsffisaffgq25:56-ffEas:?sz25f550 3 vw M fizfzwfzpiyssx' .fzfzig iwwz ,gggfawzssgy 1Wwifzgsgmgyifhwfisiggsffifigbgzgfigwgis? swyfffsyfz H' M252215:zgzf2vgzsggigivzzziggizxizgzgfwisggzgiiigggaf 9 sig' ,msg mfg? 4 3,5314 r s mAf:2fi?ffm -. ,ew :S pam - vi yu ,egg ww Q a w sf W 'GMM 9 ...:.a2y. ::..... ' H , if fsezsslgwsfg . .,, if ' W WYSQZZQZQQQZQQXE E A ,V ,H,.7..,,Awm22p' :su N QQ 5. EV K3 2522332 722 25? ii ii P Q , if 7242 5 I mm 7 . WWY.. 64 YW.. Q M, 6, , W, wg. Wfiw wfmfiv, ' W' W Q mam 11 ,, ., Qffzf m95lVVP Z5 zzfzifzvwh Vimfffrf Lwmzfff , gf, , , L 25255525 A2353 H Lvvvzfw AMW? QMW 3 gfwz, 7 F731 we V ' 4 5,264 Wg, ,, , W , 0 ...mb W .KQ,,,.., . ,W , 5Z'ifig235Z'ZffZ5fE52w4Z?fM7Sf Q2 , W 40 ,Q 1 Z5 2220 ww ,4 wsu X . s wang? M. m,1s:s+ss::f4:mfiw S , wir 1 Mfffw ,, Vg? M .aww A 552 Zi. SETS hm. M A ZW? aff? gg 55 , fa V 'Q 'gba 4 E 1 ,i M . gf? sf 252: 55. wg ya R ,Z MAMWZT? .wr .fs Q. A My jggglwligggg ,L M, ,. , M ,, ,f5,.,,,f,W,,mWwm ,egg Q ff Qwgmsf fp fE.m,fW:fr:fz. isa 5:szz..V:,ii'ff5s25ES A Q :rf 'f Af 3 Wgffggw' VZ? gg W dvi 305.5 M gf f ww 0 M. 5 W4 , Q 'W wif ,z,swWsW2fafgz y . , gifzmzs z W 9 .9 wx S EQ WEEE WL ag QW f gif.. S EW fi Y Ei? 'N '51 3 :- . S 3 Q5 mfs Z9 A5 37355 Q? . 4 4 Q 5, . Ae .:.... zzwzwys W5 2,0 fm if 57 if 'Q g5vg,qwh5Q 553 gagfmgfp wgiaiih mg Y I 3356? ggi? W .- Wzwyfi fgggiy 15'f5:ny , ,fm f ffifw Wwffywf ,315 WW ,swf fav , , gf 153. 24327 Mif fifzz i9 if' 5 W Y J fwmzfffwf 'P f ... ,Q QMSQWZKZ5 C15 W, j 1 fy f if f 'V f 12 ff mg: iMM,, gig:y5 . y, . ::.. 5,51 My . 4, ' , if N . I ...... f : 4, Fyffygql Mwajfai, gg, A jpg , g , , fffwgw,'gf,:wf,,:,ggy,,f f W ..r E g.,..Z- . 1 iw f 4,,,,.f fm , fQ Zz,,,, api ...... . f Q , 355 ,f,s'?fEf:w, X ,fwiffffffff fi Z pm ,W ww ?w ,4 ,Q me fr, W4 ffiff Z9 I mv fffifwfffzfr ffw 2Q'wg2M,z fi? ff? ff 52 A f E 55 ,fl if fy! ,Q v mf ff gif, My 4 V94 Mwffywgfffyw 4, ff 2 vi ZZQWQ.. H 'ww f We ' ,W 9 , M ? ww ww was was Mays? 4 ww 22 Wa fffx ,A 412 1 W gf 5 f i2Z,2f?Zgs5zffw MMA ff f 'w ww ww ffff W 9 gm, My W 144,421 4 34 jp! 5,5231 ,fy 45 Q 5 5 771' Q? M J f 1 5, T? 3 1 gas 2, ,., 531 fx Ex HQ , M J Q Q f 5 M f 5 ,f 32 5 f ,, f ff 1-W ff J ,W f 1 4 .Z ge 1955 was gy X Wag ,, G 0 V , Aw V ,Q . in J -. 144 'ff f 'jf 1 f f 1 f EE W 3 , , H 4, . . ..1,.. , gg ji ,il 1 f ,ff 4 f ' , ' ,nga W. ff if ,, ,. Wx., .. 5 4' lgffiiw mf : ff. 42:4 ,' ..,., iii? Mzzfwfp M ,uf swf wwgfw .:'f: '. . y,-:f- . ..- .:2: :'2:-' ,.... MfZ9'?3ff,1 . ,4ff,Z,,W', W M, ' ---- MW.-::.:.? .. f:.-:.::z::.' :2.2-.:-f.v:,.:- 255 ' W A ' 4 5522 I ..... ..,,. .... f:f:If'I E5 ii if Q E? 22 W V iw QW, Jig, WW, sz ,W W 0 9' ,M Q, Nw r iff, M, , 4 JJ., 1,, -'-g-f-.1-G- Q - I-I-:f5: .2'2:2 2 '.5,r2:'I,'I2 ' ,ESQ-:E 1' 55'-' .:3::,:1E:fggf:.g-:3 iywffm x - , . W if ' W ,azzif +'d5f? g?i?'if'gf' iff Q f 'fwih i QE' 5221? ,, A 1 Q if ' ,Wm Wig nf we -fggmir W ww sw' Msg 1 5 ,f f W' f V2 5 gm W W Q if 9,9 mf. W M WMM., 4, , 1, J QM 94,1 W Qyswv. eg if U 1, w .-Q Z . e...-:-f:::::.-:.:' -' r 'ff ' iv ffm 'L ff ff W My ', 'IDX :zzz lf , 0 wwf M 6 2. 4 gf? r 255 Q52 E533 55 S 5 21 gi: 5 52 W5 5 ? 5425, ., ..... ....- g f 5 Q wifsmif .- ::: :f 22 5 M4 55 fi -. 2- F-5-i':E-' 'I -: --.'F 2221:-5I',:'J:'E:Igr g-I. 5:'.E:'-g:'EI1,: :. , 525' ': -.53:Ig:52I3:j-Q35-'-55-.Ig -.,-Q -22,5 -.I .-E.5g'-21 5-. 22 , .i':g- Q '-,, w J'f Q ffLr ,f , , 12'F,, 1- Q f f2,'f, Df '-f w 15if ' 1-I Q sgsgifszgisgsgsgw .gigs s ig, 252:-.51 A gg? wk -f 5 w ww-gsvm,Q,,p 5 B-1 ., -- 55 3.5 yww gfsaswggg f:' :'-'-:I-.:-5 2: ff -f-5-M 55555 K :2.:- WM 2.2-:' -::':f :F ' - -:5 -'- ,--:::- .5- -H fSg1?, ::,:5::-,:g' .- 1- -:i.g--:-f:' --.,-- -A653555-QQ., 5, f:- K - sw - '-grsyw g5 I5',E .'-:IE ,Z WM -,-2 51 ,H f '21 .M H 32 4, -1 4:3 -f ff z? ffusf -S, ,-fggzffififzvs'-25 5-- 'i sifzgfzws- 5-f-2-2 .r'-si--me Q B-gf: -X,-ki wi? Qzg z -f5f5E'fs Em-2355-gi-724-30 5 9,55-1 gp - mgdygggx-3?:gQ5g-M55-Jsgfigmg :gg ggzgisfgdiwggmis gggw Q ga, A-:WV H S3-4 -ws -Q:-es:--S3-32- SQ fi:-f-22' 5 - -:g--::- -: A, M ,Q gg , - :s- M 5, ggfw, W .:a--:f:------ 5-.-..:- .r--:: MYSEQ-Zig 55-24-wa-wg:-Z-sie-Qgw-f gmggg- Q-ws--3 395-5 S fx' E p- M-ffgf fair?-W-2:--5 -QSM Eids vsiii- is Hi if-ws -rz5a25?22- -E s::- :- -W - f' 2- --ww sf- ---Aria -f' H W my Q W :5g? 5:5SE,5zm,g?Ef5Qg5:5:Q: ,3:g5555Q- 323553 553535 gg- . ' xiii ,, - H '.-E-EI -fgqswsf 21 ,I .::.51 sEr,5-I .. ' 5,9-1 ak 5- -f , -E if Q -wr 'W-f, , 55 2- . g gi Ez' zgsgfg-QE 5s555T? 5l:55g5555g5i wgggfigggw ' fs ..rE i2':..-2 News-Sgfszfiih gg W -11 ' ,ff Qgzgzis-5 in-:A 2 M W--gag ,H-mfigb:-5, QW ' wseggw H gifs-fww p rg- ::2::-: ---- ::- s':--.:. gmgipms-wffagmggviawggg g .: .:g:- Q, w 22258126-225m -X-wwwsimmvqgf-Wav?-,-,msgg-wws wggigfgwgea Gwfw-'Sw ,,.- -:.,. :,H ,:..,,:-. 3335- QW, wg? . Q gsm .fgwwwgifq gg -ew giwgx-x,5,Mggq, -3-,g3,gg3,gxiQaQsQgf,3w,g 5-m,g3,x-3 b,,,,w,5 .:.. :- 5-wt -iraizef .wg-1?,gw Lsgbwgigg iifsgfgk wy-:v gu :- gmgw- sg-.gwggsf K-mgwgkgwg-wg-,wrmpggmgeagzmswsw ,.: .... ..,. zfgsas-www gn Qu-gggskgfz agazsg-,few Q -fmgws wfgm-H-wgwgfgyw 53,5211 igmgwg-Q55 fmgg ':f- - m r. M525 gm -.'.s: -:::: S ggg ig-1-ww-:ws B ,egg-,xi --2s2g-mfQ55w-??gw-Q we -' gym 5 W , M Eg V ,,,-f.-a,,,Qg23,N-wgw-D, gig, vm. -19,55-gy algae,-My-gy 535, my E5 -: :-:-::.. af -f.:- i gif fgq - E' --.::-.f:K-f.a-g--. - 2,-3,-.gg-ui, si'-v 525.-1 51,133 - mg :.,,.. -gg-Xf-gg-f H5552-Eggmzgigfigmsx SQZHQHSSZX gm M5251 gqgqnmggi, ,Q X ,-::.s- -.liig fgjfsfzwsgigqs-555-1-Sfi -252-S25-5535-if wg-,W-1535 ,. ,:ga.---::E-,za-,.-: 1- 5: ?gkgg,f?,1g'-Q:-,izq,S w dfgggswwgffigagigw '-A2-E-gag 5 gngmismggiifmgg 2:22-ag w zgygg :g.gs:.,-:gs- 4252:- am-5255--s-sffgrgi A wfswzga-' Q--Qgm '- ' , --f-' 5 -2:12 -Grew -2-Q:-555 25-W -: sw WW:-:git -,sw Qi ksggiqi -is BESEENWHK E 2 .-Q-EIIIIQELIF' -'WW' . 9 S -'-aigi-:Q'::: ff SM:-f :Q-2124: 1 35'-52I ' - ff:- if-+--r -. , ' -QQ ?'2:E:'-2522:-2.5155 ':: gn -:I-,: .:-I-':g- ' :g- --zig sdwi W, .1 3,:g-me --3-.,gjg-5, H ,,, B .55-., 5,-,H-5 -. -iii E .-.. E 22? ' sr--:ri 1 ..- a5,:::g-.2.:5:-2:-5:-S34-Q-5-,::',-:::,g- .2 :g,' 2-1-::'--::'::g ,-., 1s::,:-,5r2f:5-2 -W - , W gz 1 Eiffe e2f'1 -3-Q E-iii - 52:5 si ng-,.,, -55-ga: f LL -3,-:Egg 2 F fi - - 525 25? Q da . EE 52545 -K 5 g 1 K 3 5 - - -Q s A , ' EJ --2 5 , gi - 3 Q' as -N L :K 55 if Eiggfi g ,g xg g 5 g ,Q 3 X E : . -1 ,K .IEEE , i Egfgigf K g?g,x3g,Q1,. 'SE 335' ji Q :E-i::15E 1ig,, -'sl' 2 3-5 ' 'E ,Q -QL 45,3555- , 1253 P- ff ig 5? E 3 E 5 Sig? :-' E WMWM- glggg 1 Ex - K E guage-gg, 1- ,M N My 5:5-gg 2 ., I Q if 5 Z is W EE -0 I ,S A -fx, -5-sg 1 51 5 - : K fi jim 'gig 5 Eg g, Zig Q M if-::: X 13 f 's HW X sigfkifgg a, I EE :g-: Q , :-. '--:--1:-5. . - ,ww-may i mfs- 'e-2'-:1-:S 7 X - Zri v 3 -. -'-:-: 5. '--mg: 7 iqigvg 1. sae g ag 3 ii gig 5 552553 If mfs :i: '1:g. 5-z 'E:gg ' ,, g 4 .c.:5- 7 seamgg - X 6555353 -1 5 ' 2 555250 5 . ':E5fE' .,., I- ggi H gi 5 lg www-:Mm 53 1 is N W EE E '-Sf.-25: 2 2 21: Wm-UMW Mm, Ng W Zsgigs jiarz Z -Wmwgimmw 253535 - X - E5 .. ff . 522s:s2f5'-2252 -W -W, I ? E ,xii f-wmwsgyx., 1- :E g5f:5:.f-Q2 zgf1, K f 'Q M My .,,:::-1-3-, -. -f: .:a--5-:a:5-3E:s- ga gggggagwfe-5. :a52wsf-g5f:f- We-img,-,N '-E-.2-:a gug SS5 55g3g.S? ':-S ,,xa-SQZEQTE S QQTHFH-k,rH,s2gg?3? 'W-SEHSNM ? H-S:-s i iii 19 2' W f2' :ff'::Ea25f:as'f2 Q'- iw:-252-'ws-f is ,.., 1Ef+w.v. m. ,. . ,.., 3 .. ,vga , , .g- H--gag --.. , M, ,L 53 , , qw -r -zu -'f f ,gag m f SE? sa . B Q , . . , Us .. ... .,.. Mg W W 2 ,551 V fE',g5' 'Q 2 I si f arf 3ii:2i2.r2g35:i:f:gg-isf-ff-22.352223 3,1 Q 25 .frf 1- zu , 3:2-if-gm wi mm-5 1 'S-2,5 xffgiw X8 .1 ig wgnggggmyg-..,M gaigw, mg-Hg.f,q-ge 2 5 ff E3 gi-2:5555 1352-Esgagsfggg Ssgibzmxg- F 5 1 1, if E ks - -3 5 E :-a?1g::- - E: aspigiggglfggggg 3 X .i:':E E Ig'i-:.:.:E- 35:55--:I g'SiSg: '-'::I-,::gE:,::'E552? ff Q U A-4 -9, gr-:. Eg-,,g gig. .,:--emi-::.5paf:f:: mage,-2,ffgbgV,fLQ - .g.-.QM V 52 1 :r Z-is - - K g53'EI5fIE:jf II: gf'f5,g555I':fgE -ifaifii' '5i:5f- -- T ' 5555 5 lp' 322 :25 IE : -.-5':I-5-':FIi':Fi:.:f': , F'i:.ZI,:I :I Mn, 'IQ:'-'fIE 5'I' -:L-5522: -I'. '5.' I:5-2:2-2522-:5-I -:5I E1,: JW W -E:',:'g::-,:g,g5,:,g hm -22'.5g.:..,-, -1 5.5--I ,5g2.,gEj'gE , gw--6 2,5 - is A g5'55,,jEg5,g5g - Z 5 3 ff fvsjwg-A ,M-,'egW ,ww-ni .135 22.3-:21.:E- '-:IE-,-5 9 Sp-Qi fi,-2-ag ai E Agn-if-W-Q-s-2-2-V Q-,n yze swg wggshg-gs-awsw ws--1-fig-Q me W ag?-qgga-?fg gfsgsazgfq tv :f-5. ---- 5 fs, M2 Q :ya-:gig 1,--ff-mg-gssgsgm Q ggsgg-SgqESg.:gS,g:gv ' r-::gE-- 5-as 3,351-,2?g-ma-,g-556,2-g,1sgi,5,',wg-mags 3 f-ff-1222: --T . 5 is2Qggfiz?fl::ggm:1f-??:f:g2- 5 , -sh Ng-askin, S5 wmmgs Q 5-mg,-295555,-mgmgga ,1-f:b,,QgS,,1,ya --vgvggawg 3-3155 . ,,, iggggfiggfgg553-555:55355sggigggibssgsgsggigig-5:5zgzffyaig''gggaaggiggggl 25 'Q-f g, - in,-wid Wg if g 5g,5lg5,agf- al sag:-sgepfsgzgw QL 1,2-S:'-f'fs:2mgggQ-:mi sg psggggg ggmisggggggfg fzgsgzgsfsgizilggggagigsgs gg N ' 'ww M b'2'2 '-21 ?HSi5ff,.-.W 133: Ei 5,-ri-.4-'-if'S?:f:.U112?-Szfbzwy' -5:-fffrfff F-5 5 2551522222:5-2-wig-sw-2 JS:-:Qsfs-aszfsfz-:wHS2f-v W -f--Els-:sa-s 2, s- Qggl,-1w-.wi-f1sa?:s5fgaH Sgagwgugxsm-.gi-Q-2-5 gm my- ,fvfsyfmgwa--Q-ny fff- -:S if -5 M, -zwizizffis-f,1wi-fzizlg-A522341 2-5515258 Ssifgiffi-1?-wif ,-:-- EggSi225'efg5PSQvSQ?525:33Hsg55552ef'g3?g-2533235525533535552- ff-55:-252 7SiNfM3.3S's:-3-'SQ 32 Egg-giggi--ggigzgiiggg:Safes-sys-15,5 :,-s:smSf:S-S,fSf8g2f2- iiffliesrig wfff' '4 23 ?Ww'ffgw'Z9:'325 f'Jf 'T3Z22:3f2f-531555255235Zmafffffwiffi,'frffeg , 2- - A '-2:-aw?-4-2 S5-2,22-gas-Z-gf-,ga-igms-rwgyzqgwgizagygl-wg:-:fy-Q- 12 -3-2-55 fm 24,1-W-QQ-2-2-2-ms Q-,Q-5-M-,'e--sm-sw-0:42:23-2-2 -w:f-.-.-M:gf-s--:- ps- ' . Q ig 255125 fr: 5:-Q,-'ig gg 552525: ' Qi f V -V V 2- f ,X-ksifm vw, Q we W-,gf -M Q ww -N A-M49 -,gf-A W,-Aww, V-mf , .- fqmwsh-m-4-X 4q,,m.,,a W, - mf vw Q H M. R W 4.-1 QM-UV, -?g-Ng,w. , A M,-X-wx , - . -,-,,,. x?w,Q,,.,1GWm-,0mAfgwkqQ,,,g5W 3,5-.q,.,,1a,,f,5,5,0ig.w,,IV ,w.w,1fgQ -.ffwg , , Q. , 5321.2-5-:vf'Sign'f'-min-'Egrifififiivlfyiwfffzwz-Egxiffizllefsief--V -H 'vifise-S ff 5 -A Qs vim 32- ,W M gm--w-ww-Q .fb-Q H A wm.H'q-,mm2,w4.a- y va - A H my -- Z 9 Mftgfgiifffa'f25fZgEi ?'f2i,f83T'53:32'gT-35573+-5352Z,I'?f?:2:75f3.flSlf5:5gE?f5ff, M-2--, as -1 -fs-:is-Wm hz-413'-25:515:-Ei-2:2gif531:2si:?:f:?S-1:Ifizizizmfs-2:1Zfisfzsf V mi is -ri:-1 EWS www, Q -Q Q --Q W, Q Mx, ,wi R, .Q , U 9 H .W 3 .ff W-,,,q bm K. -.4 A A, A Mmm-S5-535-55-Sgizvs-afgsg-s. ,fs -f ' mags-mf:-:gig 214 Qzwjgfifi -:gpg-gggsgwgrg-gga:-L wa-W 5 ,A 4 422 P--fsiifffff--, . A W-viva-vx,1-wwgkqMgtwgkgwgswg-hgq 2, Ugfjsgsw wggw-55-5-r,,g,g-.U 'vom-vgqgwieggx v 0-P'-fgh:-pg,-,V ff, wh. E, rim,-+,., ,ww is MX ,,,w,-,- , . Q H U.-,,WN-.452 wa, My 6 ,, pgs,-,, bgdwa ,Z 5- .9 V. . .,,,,,.- -L, ''S13553652535525225-fjlffsizfifiisff bzfsgszigzgigilsgiffgfw gs:-sgfggggsgfgiz :Q ge-:5f5s,3:-fi ' , N-SP?E-issfikizfsfes-swzgisi -':g1:2:-sfsilieigigm fjzfgigsfsm , -izf.-isfg-f-. V- 'W-1--mg-fag:-5-align?--,f+.f -Q-mg!-isisiw-Sf:-sw-rgwkfqf-sig A-wr?-5-af?-f X, 'mi-f-m-, , V 1- -as-,Q-,QQ W-xx -gm-,gg,fQLU -qfvf-fy wfg-A-v,f,,-.W 4, up as Ag.-2 -.M43-M L. - V , ,. - M-wpgmgwgaqwve -srfw-M:-,-. azfmz.--M2-ww '-, 2 an-3- 9 --.-,-, :Q , nge- ., 3: M2333-25353325-sgigsgfgmggzQ 7,1-msgfgzfffgi 3'-v f , , 2, gk egzfsggggyfgg-,ggggg 5 D gag, 14 , ,, 5 5-5,25-i-asf:-s-ff:-:M I, Q -' - f Mr-Q Q2 -swag-,v,,w -Q M Q, , Q as any sfw,-,-zu 4. new-, Q , ,, W '-f?52g?ffs5,s-E-2552152-123, -Q Q -if-2593-ZF: YS? X 2 , Q-as-1 W-w,.w2Essy2' WMS Wim-,553-Q, Nz' 'figigigg-hgmigixu ' Qifigff- . ' '3 -ff-Sgeiigigzgggsgzggsg2543152 w532:g,ff? esagkq Q 8 misss:-:y 1 if -23222352 flsgigfzn, - 5: f M'-we,iS5S?Si'vZF5Ev5 k 'ififi-fi 'S-iii z W -245. fliiiiaiiif- v , 'JM F1 wi-fzfg-gsggqw SQ-5-T-Q mc Q 1- Q --Jin -U3-iw , if-7:5-F fi X' in - -52:-H5-, Q S8 5i52:5faf:gl E rf wgggg- 3 Q? Q xtfgggfq. rgggggggp M: 2535143 , NSE ' mg-mysql 5 My gf:-I .'-:iw 1 55555.-2:02 U ' Q , - Q WSE- Qf?Tf2?S:,,252:J j'5f:i-nil, 2 A -5: 2 g P G fE?3M'5S2 --if-5--QQ-myis-:-221:51 X Q M N1-aiiwfifglgigiggizga v -.ggigl W Msglggi, 512 'R U. f J--2222-2-25333 'Wig-:far-5 Gaz mg wi .: gwgamwmwiy Wm W Q ., W wiigimfsw mgszewgyfwsmf W 2 M as Y M W HA w ff KN f wmv Q 3 QSM 4' gif' NN' EW Aww lzil Zz. E 2 Q . . :.:,: ,X ..:. . . .,.. M Q 3,1 N af, .2-Er-:I -- ZW W5 W Q' S5 H H42 Xwwwkisiizlfzzilfiwwm i35fZ2'??5L'b 2m' 391529 H W Q Q 1, .... qs w ,gf if QQEHHZSMEEWQf?52'2?25S2?g:2Df1 WWH'-- ' W .... , , .-.--:--: : :g-:-:Iii-E E5:E.:E'E5?: :5 5::5.--' -:: :EE:,::::: I x ff A Q www in . sf .- uf 'IWW' . ..... .- .,.. via MXWQQ ::-,,-:,..: Ps- -. vg , H .. .: ::,5::3 W. gW.W gb' an Q gg H Mm., M W EEiE2EE5::' Q M .... ,... W N if .:::..:s.::.:..:.g,,.:3-:5::f.5- :f:E2'.:.:: ,sz ,fggf wigggrfi 'fmwvwm NZ Q E Q' 2' 3 M :- :.,ggg::g:.5f gg wg an gg M iw 16552, F : 4955 44 .531 3 Hg 53 fm . . 35,541 F' Y E? Wgsw W ff w M B V , W a s M , , M - 45 Q an Tfw MW,,w2gDf2wWK?.IQ,1T.3ZXwa,,,A :Q Q' ' S Y W. R -- vfww SH5ww::w2i'1fSS555?fa?3'fm My of M W A , M ..,,.... U ... . f. 1 .,.,. .fp Q . N55 9 QAQQESE ng' Kms' ' Q e wwxw-.K mm Q, '94 2 MQ xH3.W5'?ib?m W M fdwwwmizwlzg13Qi'ES:5:sS:2:s:551'5Q22v3igiEe2EWm??MQ: 'xg Q Q 3 ,f qwzasfzwfwws W Mega. N M4 QM :W 5 ggwmgg,gWgg3gi,,,W,fg 1 X 2 sb 9 W 9 ,gym w N H Xi H, , M vm 2 X m q 4121 sf we ,W H .5 .uname wg K ww? 4 ,W sm L R . ,wfMw3g:fQ2 M522:szsfgff2ff2w:s22fx:ax+2EQ1Wmwkiign,2 wi M W E M fg s-fgggggsi. 'yaggggi gf pgsgffagn fem is Q sewage ,M M 1 226 fig E sg gf gif M if QQ 553535 4 w Q if wi Xxx s gs X ,, .,.. . , S QQ gm - ---- ' . .. .': '-::2:2':, 'I a: ' ,. .- ..... ,MWA Q31 X X B YM 'Q ,Q f mf W H53 x 2 -if g Q .Q W ' 15 we?QQ5ffQs52?sgSw w QSKSQ WY ' I wig?-gg 'S' 2 , , ,, ' , .,.. ,Eg'.aE5i',EQ,E1 ,.:,: . 3202 .. 2: gag-::saz:2g2ag'g2zis . . Q 9 9 ' W3 , My H H .- .sl-2:. -.-. : '::E:-:- W Q Q. -:.: WH? , , ,K N W My 1, wx ft' FTW Qf ggE2 5?3?EE 'mEWQVf S ggg3v ?5'97 iEi ---- - - Mgggsmgg A W Q 'Q - :sgQamfsQ.Qat2as3ggasas:3:ss?is5EE53i55:EE?Es2'k5i?5:5ig5?lxssk 555555233 a5.g: ,g-,g:gsg:gg g w 5333354 J??3?W' Y gwszmgg Mgiggifgggfsqsz:ggWBwgggiwwggmghgswszisiiifsfwggigxgsfkzzfgfgizwggsw Wa Q 2 wg 4- 2.1-:I ,www Q A1,a!4ss, X ggwmwifiasm QSQNZQ isbn wfggJuHi.2.Zw2r?w. Wag? ,arg-me 1 ,, .2 :- : .I f. -.-. q vwwmqxiih, M W ,S px: ,,p,:,g,,,,g, f: , k, .1 , wmmm,,1,, Q, Q 5, Mag,wm.,,f,,3,w,w,i,.,mv:Q.4w. .wwsw Mwsmgwgxg .9wm.wfWX.. M ,hmwipygmgg-mwmmggqglafmamgrin Qiigfmrf ww 358' :- Mwmwm, 5 M :1 15f?'T'z2Ms5 Nzifasszfibvszfsfssaw Sstifssffmf 4 '-'- zisksiiiwff 5952? wxwsslsiwff - ggi M :QwHf::sQs...f,?.,h New Azgiszzffhi 22:52 1WF::Kiasmaszsmfiziisgsessaizzzsfffzgz :aes4Aix2sWwWz2:s:swsfimsskiiiiszxWim W wwygihzwmri 12ZmifmfwfdZi:?Z1??53'w5i5'-1?52:0222fAgzwfqwwseewWQfMwEqW:Ufggwf5fMffffwA:,:-v4f,ggg-'f62:,f.aK2H4gg egggwszxfwziifw mfvffvgvggfigywWMWMWE, wg Srtawdigdgawgg ,ffwgggzszwg,W,.:gg5W:gmi,g azsfzffzgggszsf:L5Q:zfvsgifz5523532152:gasan2aarfxlgzwggsiggsaSgmpfvswwiizszwszz?sQ.13a:,?mg:22:,aasgs1Q:B'51:gg:g3,sg 5,3 W wggm,x,,,:.,,,Nu , :, sexmw-xffmWmmgfmge W:.:::,:w-:ww my yW,,,..QW5s ww mw,.Z,.,5..W.YWW:,mM . wfmWM5.wm3,,.w2.q5 wmgmwamwwsiw ,max ,, 3g..m2,5w.bm5S fssssssifaeizsqzssffimtifgizfmgigmwfg.55ggfigziaggzsggssgzsggssgiggmsxzegggszggggamqggggigggiszxgggiggspggsqggasggQs:grsfggmssfmgfsamswugffs mgsagmifiwfggm 5 52 53 P2fS?2iSS2ffS?i'SSff2:: WT: ff a5Tf'i5z21ff2fwizQ 1 Xf ' :g ifts Mgwsfwixifffiifif fi? f':,isS:E:S2'FL XWb'bk?'?3 f wi f::s5P':55S53g,1:s::?:fQfiffggizfzgffarklv-f 3??Mf xA3Iff?T9'27 ' f. W' . A fl iff W: ff W nf' 151. gi .ii fk,g1,::f4,f zffgzagg fgiigfsggsrggzzai f 23523,32my43s5Q45:snagzmiggfxizsbwzzssgigggissggiggggg 5 wx-Hwikmftt 'V ' 2355.5 flifikivifrj .'i4fZf5fG'3T?ZZff?Ji,Z-5Ag1'ZS93lvM5'D'2gii Wifi?l2g3K?ZLKl2b?q3?7JfQ,ff? FMXWX5 VS Q 11.33 , S Elm' W Q w-ww iifwizmbf. ,X121'f::::Q 1 b '-seas:-xffdft-'fn-l1fffE:m::f:f:5?22mIwsiliifwzzrg-ass: ai:SSQEEEQQQESLEESQQsssafesisiiiffwiiiwg gsssiiiwfw-'11 T'f7J'lM X L.A,,gfgzxsfiffzw:imssazzrsrwzzxQ:z:aa:aQ:5Esfm:w:sfmwgrfszazfd-fuznsaaefzgagizzwfeiisgiigfgxfzeisigfgisvs qfgsssvixgwiw x gg 255515355 gf : r. Q5 i m, 1 ws: 1 zfS5QxQ?f :?5qQ5a3sg:m 53? f. :W gzsmw Wssrezgwiiiiiiiiisii mf:ssgggzauffss:s:s.as.af.fmm,,m mg-Esssiirussaa :gvsszfgsigfrfzimsms am: R8 ' U ILE? X V was if QQ ' ,L W sf .ga .Qis2:55533::2f:mg?e:1f5ggsg:Qagepmgfwsggmggg 41 fe? f 5 2 :ew 2.i:Qm5i,::S2fi:sezrzezwxsiziifflwfif?i5:5f5 5Q5 H 1 :Mn MWMM fiwizxlw ga, 7::z:5::::'fv aw Mmm -:A rmifizm, gznivzli'-Www' ' ..mwfwwFW:i:r T5 .1 -, MLW A A wffwq :ami f , U .bmfggmwf . JLZXIZEZ' sw vwfliiiiffi75f?S9 i,if55?55xi:,.523?!5?53??w'mx TA'W' ' - .4 1 .I?5S'SZYI :QfzsfwfrvzzszssfsgszAaisfzsuzfzshziigfisgf?Uiigiziflzfzf f P , - ' 'M I 1 :Sw fi 4 , Q , ' - - ,- , w.,f'52:S:iz:ef:'?5,.A:44,:i:f':5:gngff, H:5,fm57wfS 5255 I . . Q f : Y K 11. W pw.ii::2f5srz,e::z:w:rim::.'fffEz:z.?iNz:5f :gsm ,,.,. Mi 5 . if -- 5 f 1- , 15 Q: f' Q5:z::g:gsJz.m:s5i:f?l9f52fisgfig' ' i I K K .ws X N-gs --S - ' ' L ,ff 57f31?'5??1v,. . ga - X r H bw - 1 ' - Q 4 ' . -. szssmmzisfzmfffzzfSmsfsssf WQQMWLQ-fmig .zff'?M'wxw zmswzzrfgmsms fi mv 11.41 , Q. ,- x . ,wh .wmmk mm Wm.,,ig Q0w0HW:,?i,,ggdyfw.sigQqW,,W.mg.w ,gm S2911 ' -, . mzwvt'Qsf.:z,4y14wA:Szs::s??5E?,:: 'f?f3?E5g5:x:s2'Yf'f'353S5EQ?22Sif55253212 -221121 an ,Q 55255 - ' , 1fgfxff1feff2gf?1f ,mi , , wftizgvsrzmnf fy .,::,:S::::z:::::::::m1:f::sWw:,,,:sf:z::gQ A - . Lvwzzzggwuzzsffzzzfzfwf swrsiiiasis? if ,nf W 'S :::5::::.sE-: 1256 its Q X Q M ' K . ., . HW N X . mf'a33X5f,f?355'737?3Uf335553W5559i?55s525?E5iQ5H 53 W M saw , sais-mfixfsaefzsiwmzgfwzsrrgmwgwseam :r.a-:':f:.- .- fs' S3235 y N -' X 1, 23555350 ug-'ggmfgnvwivwmvbHMMw3vgfvewf35lwfg'Sg:W :I sgzzs :a:.:::9::.:::.::'q:::::aa:- 33 W 'QR f- A, K Jig ,LIii'X4--j f Less:mg:zzafszwzmMwsz:z5:Wifaa?3s2:?55:Zfsligiffffsie me Q ., , 551 g5f,55,.,..,,,,, im QmymsssR,,aWWW,Zgzw2?Q mg,1,mhgw, Ei .. .- -- ...ew MaZff.1',z2,:',:.Q:,W,:::2?32.2'i??p52 'j?,:2f:,Q,:vi2:wSH?Q -2 W H -. ---.- gi 1 X 1 ::-:2:'2:f:2E: -' Sims-ffHS,wq3. fm 'ii?iA:zif22j5'1 Vg, gga ,::E.E. ::':g:g: --'-' 1 - 2:-Y ' XSEQQQFSSU- X LJ ww , x 63 Ei? 'F? E?15T'm f- :.:.-..: f::::-' fm ------ ::.- :-:- -::.a. 5. Xigiai 5352 2 .:ff g: g: .g: rg .f5'2EEZ :ms w::,:.:g gmsgs zzksxwsq mzw iesmzzszz -.11 'S??f5?535?5392l2i C'9'P'5e5SA5MfQ3053 TZ Ewwgizszesfzg Maamzwsmii z f ff P FM s is , sgzasnibsx gkizmfszzssHSH:sssxswivs-giszzzgffszw4W5m.1,5.?n wwssii 825: 32 ag W- X mfmsp W A dss,,WWssz,,M 2 M, y 9 3, ,Wm ,zzz - ...- iiws' iiiiiazszsgasrmrsfz 5 5? 'A' R :f:zf':Yf:zv::-5f:,S,::ze T ,xxx2mfggmzfg55,:gNssKf 1W:f24izes:f1zf:bzsszswmhw E ,L 0 . if N :.:,,ssi:f,z: QsHu,gfifgizgzszlwx fiiqwgii vs' SXSW we H Wiz? .Q. .:2:2:'a: W 9 . I ,i'WM'.X. fwmgjwi-I5L:w'? 5 9' 0 ,ww gwggw Q ,ga 5.23 gg .-:-: g. :, - ' N' L ' 2 f: :- f f- :2::i?:i:??:1i:2'P:f:m':pgg:226:Ziializsmsxgssiszizcsiiim Hiziisasqzvffisssww I . ' is I, '4' ' K ' :: A A1 S . W. A fwgwfwmwffbffqgnmgf-mwew7 ww wwf: Vww fwf2,,,,S:5x,?33a f252WSm22w2m1S5 4y2?m.,::MW:z3:.:ww1 USE551:655ia?25S2E'2l?S2?5EQQQESSESWWSS2 11221511JQfQS222?22SS2i?:ff:agfazxivffiisgazwszsfzsfzzszxziszssizzwfzs:::::f:5?52g Wiizwsyzzzamrszwisgsigzzzsfzszsfegsmgegwzfwfiaissssmfwm.N N Hg 1 'if-T'-ff zsizfgifiziwzzfzz?fzszffcsfzxzfzzzfzefezszfgs: ' -Jil 122??22?PS2ff?3fi,1 ??,.:y-352522335523 73 Eifiifli fzazsmiigg 'f f 3553?2S?55??55.E5SSS25S?33l3f5 :is :sigma Q2 2? 535'SZXSENKZXSZZSSQE3 2??W5?Si?Q2m52i5555fZS5 ' ' gggiewggqawpwffgy MS?-f45wps E Q ,y Z U? W 92? S5QWSff WZ'21i'?fZf5 fifizmmszzif NS Exsiiiiilmug Q ffifiimsgggf ' f 2:,:,ggggm,W. 31 ,.J:::1,,f5ggf5g V 3, Q . W : v:U:'fsf'1fU ' rwsgzzfszzszsz zsw vgwgi 5 ' g WaeQ0:2,s,w.::f:VWWWWWwmm:am:z,szM 3 :gf w ,eggqz , .Mm,W,,,a,,,gg:,.,,.,mmqmzmmWMM923323, su MHwfweiiwwvfvsfwfsissgssizmzwwffmsw 4 wif flggg M215 myzfheggmzzssszzfaiiieisiigigi V yfliikliggwwz 4:2 mf f szbzzzigffhiwsfmziigw if 1 . Y wwwwiiiizefzsezfff-f Wx - S 1 f A - ,, H1 wfffl 15?5f5?fffgQ?SzE , .j- Q :iw my , a:5f:,,ggzggg Q . K 'swam eg - :my-'22 . 2252252125 5 , f f .' ' IW ' 4 W-fwfwf: Mffigfgfvf f ' -' ,. .gzzivgi':3:wg,'if:Z55?HZG5232' Mfffzffg AWWM.wf12f::if::ggffzfiizzgzm ZZYSEZT' UZLSQSJ2 ,film h 7 AiI.2:.??,2:g?i:' WV WFT' Ilya, Miiffiiiii Hzf5:::ff wfff' , ' ff Ziff' , WG' ' Hu- w Hmlfliqlwh f,,N.empm,9f?f ,ikfgg gh mfmuxvw, ,N y,,,.,mm,esf ,ff ' G' Afiiesizw' , hzsfzwweff ywwwwwww wwffzffgi W ,.::g,, A Q,Mf:Qz::f2:f Vfffffwwhsw 4rw:27,wf 'W Mzswa- Tzlfffziiimfz , fffwwfsfgz :::Z3Z?2Z5ZQ.'f wfwwew V' ' 42525, M5Q2L.,3ZQl.i' fwaiw5?iw57. Jlfkwi-Q'Z2fV' 'fiiifijjgjw T9??Z2 3i53t :gym Jim ,,W,,,, ffvggfzgfiazw V'QZ5F527f7i Qfgvfamif' Gaim ,, cggfriifii Y.M5'sZJi .Jigga i3'2'l'?g'?w im4ww.,1 M' y .ffifffiifg ff Mmejm ,mmm -Agff',,3. U NZW?4g,.. , ,vm-1.W, 7. ,U ,, ,fm 4, WAWMM ,. ,ZMWW Q.,N, 6, k ,Mm swwgbgzf , , V1 H fe gfzgww - A ,,:r:za::,, , :Q , fn5Eg?3S5g?5431,'w,,Q42,42239332zgggglgfziggfgggifzzzzzgf 14. 122: QL ,Q , g:,:5Z:Z:gi5s': , Wzgzlsfqrgzg ,xi mefgifs33:93oggg5ggg:f:sfZg5?5,5mZ5,fnraggfggggggg V, x A If , ,wW,m,, , W.,,,mWMf :hw-'MSW 'miiimffivg , ,, 1f:,f:f pi,hgmgizfzgss,zznvwzzgfZzwfmiislgiqH4iff3QZ,iif:5i,i?:f32J:Z5fzmaisfggmmfgv 'Mffwwwmwgggffiizzwmw WU . 1. 'gfgfgmw af W -M '.iiz:1nf:f4,f V fxzfzzigziffpv giafsszfzzgk Q,:,M553gg3g,3gfg:2f,:gHfru:ffE:fZfZg5wg225f:zgz,':f:zzisisiisffsgzigziii'Wwfwy55L:2 fW f 'g 1Hf5S'ZWfvfYffwf.fweM,L97wG' fwffe-Www f 'fflmwpwwffg , .Nmwfggz wwMwwm,w lfxfwww-ww vfw4 wwQe0wl5QvZQIjVZSwM' QWf'.w45'.mZyZgf.5:1'3q 'Jof3?w'fLwf7ivwwMQ!S?Z252f,WMfyf ,5,.f?affh'4 ' M21 2 f 6:'z2f',' ,fwvwa ew y 3',1f'1wfv If :ggiM212vfxfgsfzfgfgszfrwff.45,4 fcfazfsszzrszsffffxzi:'gs,:25::::,1:,sW,,,.,,,451:40eww:iwh,53,fgfm5m,?3Zfm:,mMf5m5W,Mff, , ,fMgim,,,v,f,,,g4,gMyj:,,, XWJMZZZEQEW feiffgzfmifswiwsaiminimimMJzgwpmssmgiissvamweygymawsgugfy33ffgfmygg5Z::?, N m.4n.wZ,2352m,JMLZHMAQQ.-,0a?f5iI .0 L?s2mf2jS52gZ5,Z ,szaiiimiilg53g7ggfgw,w,5Q2f.,f.,,w,7: ygggggfggggg' ffjjggygggm3ggg:f,i.i,W,,g,gg5egg9i,,9,,Z,,,,,,w3w 'MflmffffwwfewfwwfwzwbQ0B10-www wwmaem-www Mffwgzf, Qwwwe' Www Nmmmzwww.mhW,wW,hW W Qwwwfmwm ML,,QM,Mff, Wfgwfflfzfyzgzw ,W7.wW, ,fvmwzg ,, fm:,,,q.s.M,Wim.m,M,1,, wmfm,,,w.w.wA,., 4: 7Mf'Mx443vewVw!9Wr' sw.mwQAey4vmyM02?ew22'y aawM4ef44wvsq4vsz,fv-MMM 1 VWMUW Yu' ewwvjfwokiw me,bwvwwwh,h,fU aff Y ,wmfewiwff f wfwmfy yr f FY f f':fWf7Wl4W' , A ff4w4u,m. ., m,fnfv.n . fr 'WN M' ,Urn Qffwegsimwfq 2 Hwavw my wad'-1 GJ'?4WC0ffv ww? ' Szsggaraofvzvnfawemewwwmzmmgwaqwwwavw Svfewwlf? ',.ev22W'329Wh,n wwwwmwwf 5Q,Yzaf1'wQ2eoiww V ' .VlQ49Jw5vm'L, ,My wif? 'V'iffwWA'4ff04ff5'4 iZi,Q W-wf2m',4' UW' , 1HwL'ff'M2ZL Vkwwi MZYXFA 1751?wfwwas',H0W0ivQhwm'.?'de23wW WA Qf32:wi,13,5WM5ZZw'wwwffm2efWvgfmmm,.f,fvQwpwiiwfwyfmv7fgWQgg5Q,f5QWA. MW,fwW42?.q, h.:,WMM.,,,if: ,.,,.M,hge2,g,,wM, Z , V.zf?1zVmi,g:f ffg:57wMffWg5,,,.1,wmwmzgzu,M,4,2,4,,.6zf,'Mg3g-g,,L1,, VU,M52wjsissgfaaww,-wfZfz,i:6gmmm,.g,,5,,g,g ,g ig t Uffzzzgzfqaff7wms1g,:2z35zcZz4fefw':f:7:3:ff'222'vmf'1A1Qgfzizzzidafffzgwwasiszzgiggffwgwggggz M ama ' Ma w ' 5, wmwfaifz its Af' .W,x,wMm,zwnwwwMw.9asm,bwwf? gggmn Mwggqwawjiig' Qyqwimmal, ,:, f 2 - Wwwz,-QM:,,, ,.WQ6H,waw,:, M ,wM.ww,,Z4ffgggg5gv7w WZ' Qyygwggjgggkh,ws-.2Q.f'gi:gff,gQgggggg,,,2,,,,,4,g3,gg40,M4g4,,,?,L2 , g g : :. ., V ,, 1 ' zsw 'P , , zzshfiygfiwfp, Y in S511 5 , fgfiiiiliffiififf z Qgygggg ri 'LJZQ Qggaigzzs gwf Mm -- ---- - 0'6 Q M -- 7g ggg ,,, mgugfqga, 5 gh3,,v5.51gf35ggW5ggwiawag 2335S5????25ZZE?ev25525e5?S5as,12,,z,aff.4 ,, ff , f 'M4fmW+fuvwwff fwwwww ww my. 0z'14m,Meq.ve-wwfgy,- www Nmzw 'qygwqwwo qw Q- ,r . W pfweQg,,A.,,w,Af, ' . mm WM M wwA,m,.Mw.Mm2Mfw mf, ,sm ,bf f A ,L mm., W fm, W mwmy .gmmmmy 2?Zi5i?fgy5?smgiffvigfggggweg6ggggggggggggggfgiigmsfiewipiiy 5iiEg5fggsgS3f5s1?gzQZ5S55sMZmm,,,My M5324Z1.QSf'li1?Z'fSms1w,f Swim. ww' '2W'Wm22Ef'W wg W gf25gg?535M5f5ggg5gggs2 55223133MQSQT-wfmsS2.f2iSQS.wawN 5?q,m2,,,..zzsfz,,. wif 5 1 5 far W VN -WWWWNW - , .. 1 1-LW 'Qi?5:32'L+'5z 7' W LM- .. ,1 . 155-?? W - 1911111111 -.. , QQQ1-fwm ,LL11-1,1114-L:1f11z1LLs 1 L 111 L11 W 1 we 11 LL' WWQLL1 L, 11 ?'L,-w11'1L,:,1LL,1Lf,,1LL'111 L 1 112,11 ww' .1 wie ,1-1211511 W1 M1LLw'wL1Li ,av-1 g.. LL 1?5111m11i,12a:111:111L521,1 L. W Mwzifewwfkw ,, -1, gy-55511 1,015 W2 wwH1Lg11L211zf1k L1 3g 111W1fhL-'ff:2L11LLE1wLfLgkfSM 111 2313513Q1Lf,-L11L1i1Wf:11ieWL 1211 Q11,Jfvgw,m11L121L1.11'g1,wgi'Q1LgLg WQQ WME1qm11N,1g111-11s1Lf,'1Q 1,. --: m1g'w11ma1mL1111,1 --, 3 , ,151-gg13,Lg 51512-1 . 11553-g2L1L:,151L'f1M 1 1111111 L'51WN?1L5L i1aLL.1L'1?L'W w ig -,w fggl-1E,2LLfmL W- QM' WMLn1LL1'1L11L'--waELLzw15y'x 1Lf'1giw11ffi1L 1w1' L ' 511 'SRSQP '1zLw1vLL3Law'gj1w i1'Ww'1,LS2 wx-L:1-z:Xwww 1 L .- 11-a311111NsL,':11fi1-fav 'LWLS1-fwfi1LfL11Lfw21fL -. 2- 1'11LWMiw 11 - -wwf?.1L,1fi'w,SL'Ew1WSW11L2 1 51113 ML '1m11wwLLV LLf'K11 1, lb 11' W W' we 'w'1w.1LH1L M 11118215 if 3631, m1fL1L ,,1w1w1,,11g111x1'Q2, 15, ,1w?m,,1 1191? ,11L,s?g1L41LL 1 . 1 ,K1af1LQ1,,1w1-5111,1g,1y111,11 311 15,21w,, Q172,,1LW3wLi.Lfi1g1N.,1v,,1y5 131151 121-g,11g114E13,.,1z,1wg,,,1 -. fs1 111fz,'-fnggbgmw 1135Lx15f11aL1Lz1121:5s,1eiciifw Lr:Q1x1'f1LL,f1Lf121wa1LzL11121-L.L1g W1 12116 zL1y1f91+L'11an-:11L2L1ML111S L1 L'S51kw1:'1LL'1LLf.1Lf11LLLL1m-M 1Q1v1LwLL5-f1Lw1LiL-1-1 sffwzb L1 'WL Sf121112na1L:2L.2L1w1w1'fLfx,w k1y13LLx1WQw2Lz11w21i15111111-32S1wL2L1LL1Lz?21-L2-L1111a2'1Lgw:'1Lf5z1z1f 1111141111151 11Sg11m-11211-111L1L11z2'5i 1 LL -W1-11211QLz11L11w1w,1LL511113111622 L-L121L11a,z,1,4L1L1wL1L2L':1115'1 351 1Lf11W12111191111f,111w11w1L1L?-12:1 1ML1'1-11111:-a1iLa-11-111111611 112LLa11, - W-1LL'2f1wL1f1'1w1-L2111-111515 L--1. 111-mg 112 L- L1-1g:M1-1111.-WLLQ1-Q.-21131 1- '1 91'SgLs55g1w11L11-Lf'-L11111g1L1LLx L, 1 'Hw1Lwz11f,-11'--111-LLML1-X -111111LfwwafLm1LL1111111Lff11 1 11-12111121252w1m11'11m1L51iL1 Q1 1fg111LL,1f11L1111L1z-M - LW5 NLL1 11 11 3W'i11v,'11-Lg111f5-Ms11g',.1'L,x.5'L5gfw,31 Q 1w1LLE-.1111.1L1a1L,111q,1w1Lg,11LL 11, 2 13,111 11531111-z1L',1Lz11 3111-5111, 'gi 11g11L11-1161111111 111gx1L-211 'Lfi?1QP1g11E 11xf,11-,L1,g1gz111,1Li1Lf:,11m 12, 1LL,1m1Lv111,1,L.L',,1Q 11211-,111 1z11g111g,1q1-11,-qU,L,1 115,531 13 151 Q11g1q,1xz1v11if.1,g,5i?1 1 1fL3Lg5k'SLL?L1 -. 1f511f11s,1gw,1yi11111-1-1- M211LL 5'111L1LLaw.-',11L11s1L11 an 1gM11i11L21',a1L,11-L::.21e'L,11q11LgL 15m1L1+1L',11g1t1z1-'1Li1',-Lwigsha W1-Lm11'11L11fz1-11511351 Q 121Lx11g511gz1-1,1L:11em1f15: 1LLx511,L12.LL 1 11'x11w,1ei71w1-w ff- L11 11-gL1m1111fLfL1 11LxWLLz-L11-1-f11L'1LwLfL fLLLL-1:11111L,1Ls1LLiLL11La1-m1L1- M1511 11-1111111-12111111-Lw111x-Q11 fL15L121LL11151g1-,:,11Lg111L,1:,115-m11,g1 Lg- TLLS-mfzm-111L11zz-11q,f 1 , 1111-11:11Lff11-12111-w1a.,1Lif1-M1 wie 111ga1w,zLLL1n11:11L1 1y,1'1L'aLL:11f.L11L1,'21-Ls1'232 - 3iLf11-1Lz,111w1LiL-LaLf11Le11Li5 HW-L L1'211f111-111.1-2411-1,:,Lf11c1L Q11-QL1,5Q1,'L,1 511f11'11'11L.2s1L1111f1Lg-1315'1L11gL1g s1L11L,m:1'1x1122L1:1z11L2 1 Q 1wL:1H1'- ML-'1f1f:1zr-,g1L1LfL12g'2NL iw L1111L11L11Lg1:.1'1g,w1-rpg: 1Lm'1ff1'11,L:5LLL 1111L111LLs-1:1-91511111-if1L 1f-15211 1-LL 511111221-ff-11:11-f1LffL 1-L11-gm, L ,--211,1-1511-LL,-1111- L LLL .1 'gi , -w,,1111q.1f1f111a111q,L1,:11- L1 ' 1515-1a211'1f:fLzf-111-asawa fifiz 1,,1S,L:1'1-m211Le,1LL,Q11'1fM1 :.-12-. - - ,wfgffw - fi ,,,.11g:1,--L'L111,a.,1-f,,,11-11 S11LL1'1-'L2-L-,'z11L 1L'fM1- g11LLf 2' A515111 11L1L,1fL2wL21L-w:2',- -fL'1 W1-LLL L- 5211521-1f:1L11-11-M-L'1L 1- 2111-L 11L:,1-LL,1wL1L11L11L11,1-L L -L11-L? L'11L1::1fs- e1w,,1?LHL S2fe11L',L11L-i1w3:1f1LL1L1f1L QM? 1-L 1-LLw'pL11 2,51 L11-511-11-L.11g11LLgf,1-f-L',11xfzLg'1We,1 1131111191-11w,1,5,11 1111111 ,1 W.-1Lf311,,11,,15HQ1-g,11gLx11LLg,. M1111 11,,1,,.1fw gm 1- 1W151,,, -1 LL 11fe,11f1-f:1a51L.z11 -. 11531-Lffz' 11 'fi wie?-L L-121-L'LLL15L1L1-1111- 11-L91 11 1 fs 11-Lisa-zsfm-5112-53 wwf- N11--15,1-L -L ,A ,Q L11 -1-.. Lf,fS-LgfwS1fL,:1w 55151 1, ,S1-5,1 ani me -LLL 5 ML- 1LL'L11 ff-Lgm iw, -. L 1351, La Aff!-5 ff' 1 W1 M1211 ff-fLL'-wi aww? M111 ff 1-WML m'1L,q.1g1's+LL5 , 1 143,11 11 pw 1.14.1 W ,1 Q,-wsgjj WJ,,fgE11,5 1.15 WQ1 f-Egg W +4 -L 15,711 115 12511: Him, 51, Q1 1- Nw f ,, M 31 fgiw -. 1,1 15 ,wf Ln we 1-Le.: ML- ,yi -L42-,g.11e,-, 1 I3 ,LLL L52 Las-L11-W c 5,1 5 3,352 vs-fLLfLLL ff L 'E-2- 2,1 if-'Y ,. 111:12-Lf,, LL ,ii ffm- 2554 ?g.,i'5L- 1 121 113-LLM 11 5,11 15 -. 4121- --1 gg ,1-5 W 1-f 1 311 4 PL: -ff' 11LiL1LL 11,,w 5E . 1Q1gg1f,1-2,1 QLwvx1w1fg11ga11g,,1,gWs1sLg11-gfwg 1 11,,,,1g11e1 .441 -.g:. , V111 ,ww , L1 LW 11 210:11 Qi Q sg, 265115 HL 211,1Lf-5 -L Y5 1fS'Q'9LvL fW.5k'1Li'1,L W wiv, M153 -12'3M,1w-W L., E'L?'11Lg'31y,i-wg, iw? Wim, j'W'?i.-f15,1w'1M 5523115 1331 JELEYEX 5' 1f?1fL2'1:M',?f-91' ZSWQF w:71L9fwCLz1f'Yff'w-W 15 15 VAL .gy , ,, 1 31, 1 1 'L f 15, - ff - L- an M1 ,MMM Q w Mime I-1f2'f ',1Lw,L-1151-Ja Mgif -Lf 1711212115'.LwLwEi,wkZLz11fww ma,-1w1gL1gL .gg111'2quWg1Lg -fS1a1L11f1M-'Lwwi 52111-11-2a1fR1Lf1g11:a' ,LW ,1f1j1Li+, W-w,2L -La-Lxwifi '-fsvg -,H Vigwh 1- 11 ff -,1L-211:11 - '.1gLmxiV7z1gLTg'1LL'1131g11,,11Lg,1, 1w1L111L11 11 '31 YL11'1Xzw1 MML,1L11L,v-1.1-Lk-L,-1 K 1 1121111151-,-.1-iv ,11m11m111Lg111Lfx111 vL111g111,1, ,1w1R,11F1,,.1 1,1,1111,1 11,11,m1-111W ,AM 1 ,1m.1,5W,1Lgg wW1,11,1N,.,,1 v,1,,,,1,1,,1W ,NMM X M 1 V 1 U, 1 , g11,1,,,,1 1 X, , L1 U 19-1111 Lgibifizifzl Q?11Lgig1LfW1vxj'1?Q1QLZ'1Lz1L,w..1wggE1Z1: 51 kLi1mLg11fw1 H1Li1m1gzi1L111w s1g, -'5:11vm1-i.1L21L' M11 1'.XLY1w1-RLLM 1 L LiYL1hLw11-wf'1L1' 1' L1-'1-112111111 1QLXxwiZwiix1L',--L 'LL 'f-L,?1W1yi15Lgf11wgXWw11m LW' f1vi1agfLf2LLl1LL,1L'1- -1- js- ,11E11L,f-P55 34g'ggf5i,1Ug3iV5lgi1 Q12 51.151111551-Ug1g,112g1,,1.3'f1L1L1. gxdgfgieai1351L34gif-5311133,5L1,1gi'11,1Qqw53g155.-Dg11Lg1-V my11.L1Q1,z11K1g,L5, -U1 L-1,1515 gg-11 L1 M 1311 jig-fg,L3,M15,1, L, - 61, gf 11 11Lu1,1g211,',1L H -yg1,1ffLL3q'1-32,511 1,i1gs153g2g,11 Q 1111-1-1151111 '11 13511511wg,1x1111L.2111mi1Qii3,S1,gs'i 11-U1-11.15251 L1-W-111511145gz'ig,g1g1zL111s1qa1L.i11,L11, L:,L11LL:1L151L-i1L:,- 2i1f1L51LQ-,11LL 1LL1-1-1151L1111SL'11r' ' 1-LR-11111 1111L.'LL' fm 1 QQQLRLQQLGLQME1 f'a11'iLw1Lm1 LL,-Lim-Q1L1L1L1 2. 'L LL1LLL1w1Lf1L'11La- Mi 'vw -,'Q1L111uiQ'11i5'L1sP LP L1 1LL L1,11z1L1L1g11LL3LL71'1:' 12 11f.,1L A L111wL1f'L Q11 wiwm-1-'Q f sm 15112-11gL1L:f1x1fL.11'w'1S. 11 W'1W?'E, 111fwg11z1Lx2Lf'1 QQZW1 MW L111z111'.L11.11 L is-LL S1 111' f -1-vw 3 LL ,1 -N'fL31121f1'1 2:1112-, ,.-aw W.1LL2-Q -ziiy 1-,112-P1Lg.11 L 7.-L1Lf.'wi1L1 1 L 211:-1 11 f- L f1M5L1'L1f1--L1 I L' - -LLL-LW wi- 1x1xfi751L121121'13?31 2 M 1 -L Q Ls11,111ES1',1iLi1L111 L-Lf-1512 1111. ,ap f11YL1'ff5q,f'Lf'3.1k2QE1a'13i2V21 11-1111 -, , L- Liiiifw Wi -, - L .,.,-:-. -1- 1. L' Q . 1 ,I ,11 1 1 -. .,-1-3, Lg,-,uf gpg' Lwgiffq wg Ln W 5 3,5411 1i,,15,e,1q11.g 3,14 Vg .1Li, 1LQ Ng 1,-an fw 13 LZ Lf, ,1151-413, QQMNL1 531,515 LL -L. ,1, - 5115 V, gain, 51.1 6 71,11 . Q11 1Lx1gi11,1 -gm-1.15 W1 1- , ,?1i :,fQ-1-LLf-13111 ff311gf11LLs'f33L,,,15Q31 , 225151-1LL111'Efz-13152:1g1f,1a13f11j5::g153gl1a5ggW115,1f115,,1,,151,s15g,QgR,551,g1,,'1A31L11g,g'1A'31115,111,1-,1gffq,1M,g,Q,,1y11515,-L11g,w11,,11,1MQ,11WM1,,,1M5212-i1MgL5N,15,,1.1, W1 11Lf4,,1g5112f11g1-51151 .HA-1153?-QZQL -. 11 1142 1 ?' 35 1 .1 ,. 1!gf5Lgg11fsq:11,-gL,1L551s'fLLL W'gL'?.fL1'?:1fiLL1'1f:s21LL:1-Lgv1y:L1:f'LLL,yL-L1-w1,,21z1z1,1L-1:19Vgfgfax Qi-'U'd?'if Zv' 1,L'1f,-1L:,1-501.1 wL:1L'1Qz'1L'a'1LL1g11-121m1R fly L, a1L:1S1'wff?i1:f1M11LL 5311-g632,:1gfVf111:,avQf1f1 1:-1 -L -LL1V11a,LwL2L:1L-L-1w111L11L':f LL51,1W sf-2w1'LLLLL11-LL'w1a111-11-L:-WWW' 3121 1LL'fLc-'my-121-LL,11a111:1fLf?1-frLQ-Lfw1Lw,f,1f:f2-,1 WLXLLL1- Lf- -1, yegkwf wasv L -L-LWLU-May. L-Luvw'L'11LLL1?2LLfs6L01L71aLfL1LLLL75fv11r'i,1 1 ,,s1Lff3WEf1ff1L121LHL'1?-1 1 ,EW ,1f1fLL1gg.,11LLfL,,1Lf11L'LM.,ffw-La,Lzf-LL111dg'0'SLLL g11LLg,2yle,v,5z1L-wwfvx , ,,1 '?? wfi-Lgyw 1111vfLf1vL11'z11,wz511fa1z,'m11ggf,f2 5LE1 1- L- 1M,1wLz1,aL-21 wuv551LLiw,f,5gf1L '1fY2w:.-Law'-L1-LLfi1L wa- 11 m2'f511-':,5g,,1v:,v1'e1Li-L wfi-1L,fLLs121fLff11 WW 116-L 1-LL2LLLwf1LwLm1w?11Lg1'5LLf ff amf-LW fiwi - W 1 1 1 1-Q1 Lf 1V'f1-11111-11f,1L1-11-111-21 -1 -L,-,1f111,1L-1-L,-ww 1111-1111, 1fL1-Ls,1f,.,1 ,1-fa-11-L,+w-1Lv-L-ps-L--M1,11Lw11y,1L,1,,1LL1L1Lm -Lf 1-L 1'1-f--1.1 W, ,f'sXZfLWfL-1X1-LL1LLf i-111-12-11 39155251 1 1 wv-QYqg5fg'g'?2?1311a1g1iw 1 W1 gvf'S11cg,1w'111'11a1Lf2-L11z1Lv1-15 LL 1S'3m11Q1M1-'.1f1-1f'b.wLr1LvH1Lff21HL,,.ggef1QQw1,g':11fv0'g,.-v 11-g,.,1111ft1s+1,1Lg1.LL1,1fi1-1 ,ff 1411 ,,,wL11f1,1i,.1L-W,,11gfW,11ff,vLf,. ,vgf,,w,1fL,Q,-,,- 1111.1 L,,11..1z1-A111 v,,11w,11:11g1-14115,-w.Lf,1.LL,11f ,.-kg L 1 Wh, -. ,, 11 15 .1,. 111, I -.,- -1 ,11,1,5,m 1 11 wW1vgme,1-1.-g11La11,131,1,3. 15 , -211 1LL1qL:,1q1-y,11g11wgv1,LL,LLf,, ,M,g,,f1g1vfQ111.1-1g11,,1u1L,11f,1L:,1i17,5v ?5'1711-311-5121211fgw51L411'q,1.-z,1ffgi1-f'x-g3,,1LLg,,1W1fL,,111y,sb,w11f2,1-,1g,.,11,1w:,11Q1,11g,s,,LL.1-11,11 My 11,1-L11,.1a1fL --:1 1?2'LgiL:,1,,aJ5LL JLg15?i21i1iiTi1:2i'1131?5 K2 ' N'11::1-L:,w:1-,ww-1w11,L111 1,2 L'11f:1-1 1:1 -, 1-11:1-111,11 121-W1 1' -1 -L? ,L-:fL'-21-11191 112211 f11L11g5Lwwf,1w1-11 ,L,11L1111L11Lz,L'4'1f:1-Mm15,-g1L,11y:1La1-L5-1:511w1aL1-,,LgLz1g1a1,gL,11,f1-5.-111-1 1 L-L1?Lve21s'i 553 X55 WW? 5' Wi' L25L7:4'11EL?1LiWf2LLWL? M Wa31511LL'ii2GZi2i12?11E122 yfQL:L'W1 WRX''111Lw2Y':1sY:1iL.fii'1:,H5W21Lf5iL2f' ff- 1 xii' 'gifwiiwxl-121-L'111'-WYQJL fl? 11315553 fL:W'1?'W L'fz'1i,f'.1E??f5 Nm15'i'f'1e 1iai1'5:W'fL?11,LW Lf ' '- L11-s1L1L1u1L1 -iw wf'15Mzi2-Lf1R11L'21LELsW1'91- M 1'Lk f'ifL LM-L wW1L11H,1L- 1:1-L: :QQLML1-L15 2 LW.-Li1a1f'321 L1 H'1?,1'f-i1i11 11F: 'Y a 1x LWZL., l122LffQ1L:Lm L22zw1'1-LS-1,1-1 2 BP wb a 1 11fg,w.11117,111-fnw1LffL1-1-1, 11? gfvif-Lgiy-11Lf11,1L11i111,1i1v Mivgv- 155w11L,w11g 1N11f,1WL11zgf 5f11L11,11,, Q1-L'L,1wz1gx11 ,,1L,11W,:1 1- , Maw , 313.1 , , 1, 1 11,,,,1-1,o,1111, M11g,q,1,111,1,1L1,1q,1 1 1 V11 ,111 1121511 ,191-L'?1'L1Sw 51115111111-,1 1-111111, 11111512 wi 1111 1111-,111w 12211211 15- 1 L 1 111111, I 1, 1wL,-1,'a,,1 , . 1 N, ,,1,111,,11 W.1,11M1,,,1gw,,1 1x,,1,1,X1,,1, W 1-f1Mq:1w - is w21 mMwLww 35111, L X i1z11W'ifW111Lwk11L,-5121-51111 eh QEQ1-M1' 1- 1Lu1LL wL11L11-wi-W :W 2 411 e -L ,1-,.1g111wu1LL.1f 1 121 .LL1LELP1i1-M513211z1Lg1L.1L 511-g1La1q13xSg113wL1,1L 111- L A141LM1wL,x1Lm,-,1L'11L 1 11w.1LL1w1ggg,i 2221955533 ,L L1i?sx-:,i1f11f'21Lm,111EEg11113g1, g11Qg12mz11i111i:211-Qff1 'fL ' ag Lg1L21L11:1:111- 22, 5 f-Le:1LLf1L3-a'1'1,'L1'-'L,L,1 1 11'1:'Ln12xfL'EM2LsL,5112z1'- :LQLL21-L,11L1'111a-1111-11,1 , 1 11-111w:111-1112111121-,L1L1 g.11L1w1-L2-111 '- . i f :111f1:5,1'11-511gwL:1Lf-L15-L1y5LL1 L2L-L5LLfg1-z'-L.LfaLH1m11L111.a211if112f11Q11'1-z1111'2L11..112,111s1,1211gg5im111152-11-11111211'i-L5-.aiaw411' 11-1111-1L,1111,1L1'.,fL,.L11111s,1Q1i1-h11111'1f11 Q1-1'1gL11L:1aL,gL-1 . , 139151111 y L1 4 1111111251511 11111111 111112 -f Lx, fr-211 f -31151 'WLP1 5553135 f-ga -L -,511,1111111gw11Lg111111L11g11131L111g11Lf11 k1z1,,111:1,1:1,11Q -, 1 -49-51511 2 11Laf:'LggwiS1wLL1K1gss 1 6112111611551511155-f,:15,, 1M:1gsaSL ,,aigg1L-5251-11'--11512-1211-:QJ,1,k,511,f1L'ff11L'Q,H1i:1gg:f1f,z-1.12.-1-x'LQzfLfVLaaQ531LLxwLL.Lf1:if '1L71,1151-f2gfffg1'gs 1f1-Lpg,1g.gf-ffwmixi-5111212 iv' 1:fff5g2z'1Lf1LLfLLL:L--s1v:LLf-LLfLf,1LfL:sL-LfLLmwffm:211w'L2L1,11-fLLw1f1 621 -L Lv-1L,111x,z3f12L,zL1LL:1iL1f3Lf-53 1fw:11Lw1f1Lgm11L,:1Lf11-L1:11L'1L111L 52'fpfgi1517sUgiSi iL5'g51W'Q'i'? 1 1 111:11 ,11-f1w:s1- ' :121LQ'1f-LMS-W Lf 1 1-H-L fi 'ka-'gif 2 MMLffr1-,zfw - giigwwyivwf - N ' - ' 1111 w'L,:11f'.1f:.'5L'f?3Lf'vfg,599 -5:25-gi.:aLfe1f61w1Lfe111Lz6f1i3f1,1 2: L -we WM 42:5 ,1w5,,,w,1g1-51 3425312 ,111-v211+a 11 .11 1- 1 ,, 55,14--,,g11g5Q,gL -L .,.. wgkwufwwv' W of 1w1LL'z1y -ff 111 F11Jy,, f1e5Yfg,15,,,.,,,,,5 , ,Q-ff,1L311.1x,M-3,111 -L 1 F1131 ,WZ1-MW 11 M5 . 14' L -M51 wv-L51-L1 1 w ww? Qf:f?5:ff1s,-M 1 5 55015151 L' 1':Wg1w,:1ff':S-fwLL 11 1 -g:,'11fz1Wi11W1L,1f5,-155 1 11.121 .- ., 11 Q w11u 1' 11:11 ,,.1u1w1f1L 1-faww 111,111.11 L31-11 1 1 .-MW,-1 f m -. 11 -Lf 1L,1,,11-1,-15 1-1 ,F z1LLLwf1f11w- 1? 1,51 11W wg dskzfwfwdvl L21LLLi1'12fvw11sY5g,,w5?L sSWL',Wfg111LLL5wg.1L2L'LLw WW' 1 'L -: , HL.,-fa. 1'21g:g,,1, , -...fa 1-fewk-Q 1 , s11,1q1,1y 111 -...51 1- ,1 Lg,1f1,1- 11, -1,1-1,.,1gzm1.-L,11111LL,1aQQ -g- ,1,ww11,,,1,,,,1-195-g,LL,v 1 sig, ,11f,,1g,z,1L,,11,11 1,11 , .H 1 ,,,1-11,11-9,,,111,,W11,,, L1, ,W E.-in.. I .n W , ,1g,11Mm5q, W .1 -i'm11w,111,,g,1U,111 ,,11.111,,m11, ,,,,115,,1 Ww,., ,,, 1 ,, -1,1,,w1,1 L ,l,, ,,s15g1f, W, Q, ,,,,m,1Q,,LWjfggv gx,11,111,,-,,,1W,,1,,,L1w,,,1 ,,1gQiWk,,,,1,,,w, 1,1 wa -.-Lf. 11 1ML1L1LL w'g1'Q15'LyLM M 'igxgyiegf-s'111g'fQfs, 21:11 F 1: Q-5Wfgf11,j5-1iLv21LL1 :- L51 as '5wyJ5gfgkff lG'1g1g1Jq,y, 34 11 gg: fiwiyia 1Lg gLf2Yiws,1g - igwm Jag 4-L0 111 1 1 1 g1w11111Qgg1 18551511-,211111?-55,1111 11122 - g11vL11211L11g-55,1-11 LLL fi 1211135135 111-LL1f1L1'e3ffgLf1gg1i'iLL1 511 ,15121111-1,w1LL11211:'gg1-11:11,1g1, 5131132115111:11L,11L111,1w-Q1 L- 1 5 - '11-LL QLQ-1111121-L11-gLS111g-. Ly LW-wwf-L,1A3i11i-WL: 'HLYSL-21112521-111. 1 11-swf 1:11-1:iL.1Z11'f11L1,1LfLLw2.1L-wLvLLiw111L'w-f1vw-L-,L1' LM1-LvgL 1, '1-LLL11L1L1f-Ls1LM1 - L- 'L' LL'2LL'-eq LL 1 - LL,ff1i-111-11x-w-rw' ':'L'1f:s1.'1L1LL12'mL11'S:LL'Lv X1 11111:f1f?1-zL'L1'1'L11fL'11-wk Q E! -, - wma-2-NN. 1.-WMM .. , d wg 1 Q1 T 1 L 1 : - r- .: ' L L 'L?E M'1M' 1-:1:,1w,M.,,11m1., ff -ww - ,.::f:. - -KL 142. 1'i-'i1Lp. L11 1LLffx1,1L1,11L'11LL.1LLv5g11'iL g 5 ' 'ggi 'LEU 1 E55 L1 wwf, -- 1 .Ne Q ar V0 1 L- -. 11 111 1,1fe,'Z1,ffN L1 L1 5- E 1 , 312 -51,1 , E- gi ggsgn- - -'-' W1 , L 11 -122-ww gwg1 1'1,,,,1e5,gf5,g Wmgwqg - V z :fi LE EEE gfsz 1 'EL-EL ifgu .mwffznwfflliw 1,1-Q ' ' L:-?.J..,.:?LL :L L 32151. 1112- 2 -22 5 .fm L ,...1-1f ?Zf'Q? f121W3g'wiwg-1 ,,--11-1-.1 1,5 ig gi? , 11 7519-1 W- M , LN V gg R ,, , QE,g ij5?5? e5 ggg- gmwgggimg-gm L 1 , . I . 151 1 In 1Ww1,fzLLz-m-- .5-W mw,1,-wr.. ...,, N A L L ...mmf HW Max LL 14 ymfhg, 1193295521 39 gig24:,,L gig 2 ' ' 'MW gfgggw by L' W NL Y? ,Q Lv: - AE? ff? :!' .LT .. L - 5 V 5 ma f if--L1 1 , f,,41?Ei2v52?55mSfi?gw5 M 3252 Qfgfmgsv-gz, WWEE - 1 1 , 5 . 1 . I 1 1 Q ,, V- L - W LL Km w g gygmwm L 3 L L 1L 2 - I 1, - Q- , , Panama, V M W qw... QE ,,gE 'f ' H , M , H ' - 'Li 5 2 5 ,gig L5 I A 1 ., , M ,, :W W H ,M ,I - I :Z Ig , 1 ,li 419 ,.1f 1 -2:22. L ' 4 ' 1 -- K - ' -Z, , - E 11 L1-.1 - Lf '- 5,1 5 L 115 V1: gl 5 1.51 111- rw -3-gr, ' , . , L --5 if 5 '1 11 L L- 1- , Q A 1 --1 -. wg 5 112511 1,15 - L -, 1 Q- - ez Q , ' . -L L1 1. 1:1-, 5 Fi 'S 1.51:-gf:f1i Q - L1 LM L, L- -5 . 5 1, -Q .41 , L 13 ,I M L. , . if If 111 255 - 5'w11LLB1'L2 '5 2 U Lff' ww - ft: 51522113 L 1 YQ 2' I ' - 1' 1 3111- ff , Lg, - 4 1 , L L 1 LM ? 13:11 L1 - f -L. L -si .1 LLL 125 L L Li ' '- L L5 L 1L,11v ' . .. -,- , ' L 1 . Y Q5 5 L 'AY L H S-X3 5 :':':L'-, 1 ' - E L , L ' W 1 1, L fa -21.1 -- 1 WQQLWWM. ga- . -11 L iyg, -giirzm 5 ,ssgzwskvrh Q 11 ?1z?yZwY:O1 1 ,. 1 L-L mgggswgg Q X -:-55 fl Q 1 1 -1 .1'2-Wv',-ff 1:: ,. .... , ...,. ,.,. , , .,., , . 1 ,, . - ' L an 1,1-,,' 1m L. L Lf I 5 1 Q gi?-11 L L 1 if ' -L L :-.-:1f:L- L-N5 '.: 1 L- LS m,711f211L51iLLiLLS21 . 1 2 -L1 - -1- 1 1 i f 9 2532, L Y Q . 11 A ...S-:-:5 iv .L v- 11l 1, - -' -:yi 5 A: , , 5 L -1: -1.-1-Q-:.f , Q1 -.- :sas -L -ff - L L1 . , 5 L L. 'f ,1.. wr' ?L:.,1.f:,:2 1 '-22-,Q LW ' L i 5 3 5L -1-1 Lf' LL- Lw x- 'f, wg '-:g.:. wifi? , 3 ,. 11 1 15. .,, ., ..:, fw.5,,.1-151m. g,.-.:- 51, ..: 2 - V. 33 Z 2 ' if - ' fi-1' 2 '. 23122 2 EW LL .ffl-fe, -ff' - - 125' - L . is ' ,1 11 ' . 3 , L L22- 1 -mis 1 , 5 me gg E 1, Qu , pf1111w.,L1gv?'W1 , ? If , E x ' ' El .... 1 -Li' , gg: 5 rf: .4-Lk,-. 'vvfsl ,i5Q' x E I 1 12 45. -1 .-,-4:1-: -4311-,-:Wil-1-.1.: -. 1-vm-L1-f,1f, 1 11 g. L ffg qv- L- v: f: - -if P L wwi Linn--we , . L 1 , L ,1v115z1f,,-Lg.LL11fg11,,g1 : 5 221 12 -Xl 2 11.11 -111511 2. -. nf ww -gig - .9221 - 51g1 L Lg:J2 f1 LL1 LL 1W5f':i,'g-3.451115 ,111 ,. ' 111 ii , 5 , L,,La'11g11L1f11'195-ML 5 1 , ,,1L?1g,1 L -5 - .1p1g111,g1L ?,1LLg1',fm,,14,,1L,,11zs1,z51gQ155 - 1.15. L fL1Lm1f.15LL 11112111 L ' L1-1 Lg, L 1fL,mr11,g1L1:,1.-1,,1.1LLLf -Q11 111,f,,1LfL11f'L.W1,1L.,-1-,,1g,':11 , L'L1LLw,'m11L1Lf'L ,1 L3if9'Km11aw:f,1Lfa1LLLfL' - Ls L:L-,:L13Zfy1L5113Lf,My Q-L22 1VkwvLF 3 1 1 fm Mmm' 11111.11 11L1fL1wELLffz'11 g11ga1q' -1,153,462 L ggiimgiig'eg2H?1'4Ei?ig12SgaZ1z1zbrLLLL5mzL1L1-f15ggQ1Lg.yiZgM3vLv pi L' QHLME ,111-L1 5 L'21w1,11 ?L Lf 'Nw-1:2yi1i,f,1Mx211iH1'1f1-M La 52,1211 ' . L ., . , 551 wig 1115111115 L 11,1mL-z,L1-111-11116111LQLWLYSMZ wwi L5z'1:wm 'J ., ., 1,1151 ,QWQVQALA LLLWLLL , ,L,gf,f111xg - 1- 1 L1 -,.'-1 . 11 1F A iq? me 1, I--.,':. R:LAg,4ri,111,5L, 'g1LL,-W L , .f ---K ,., ' . Mm, , 1 1,1 1 1 . -, w' ,L f L 3 L 19 QL -LW L Q',w,1av .: . 1 V 15: - 1. ki K- E52 'M - 'L ' - 'L wggggy, 1 Q '- ' 2- -' -9' -1-'In ' '-'.',1:-ff' Ml 'U 9 'U 1-'M' U- 3 5555... 1-115 , L -- -'L ' .E 5513115 -J: :iii-S -,. ' ,- - 'ZS Q ' H1 , wg, -LL-1 4. 5 ' XY 111. E1 ' 1-L ' 1 1 'L 5 ' L L 1 L- 11 ,L 1'2:S?maq11?11e51g,11f5wma?'1ig'11Lf:11Z1f11fmifvxui' Wkwa-L':f:11Lw11'221L11w1'-,Zyg wig 1yf1LmfL1zw11w1L11Lmwm-1111-11,11-11,,1,1 11 , 1 , K ' 1,-1-1,12 W ,. , 1 L11 1 wi in ' 1 -nw N 'W 1-21 fx 621' M W 5 af - L- .. .. . .. 'W ' LL:11mL1z1fii1,1g11-Li21fLgL2 'L L ' L mf- 1-1q1a111f5111m11111v1L,f 0551-1ggx11fh1a-.L'1 1,1 113111,wg,L111Lf11,ff1 Q1-g5Lf14Z'51 1 FWM1-WK LiLy1w1g51w1L 1 ka 3'1M'2vf.mfwlfmzi-35 .1,. wa, 1a,1gJ1,ifL,1f,,- 1LL1sL,L'1 '31gg'1,11 -LL 1551:1y,1L j 1251 -,,1f11e1y1L,Q:W -1, 11 121131152L,L.MHLp21LLan'ax , Lm'11v1L11:i1,'1f.mf.LgLga21: 1' L-L'mz1 2 V,1w.1q,wg,zg.1g 112 : L a 1'1f':1m11Lg1q11M,, 15 ,mi xuvfgfxi ' L131111 WLLLLLQZE 11111'-11'Lff,'pg-1L1'1L,z1,f11-.11Wf12 ?11?L1W1L1mEL1111-111-,-.W,1L1'1L,1:1m2-111515 WMWLLLYKQEW1fi-111wL11wiQ1:?f-M1351 ZEHELZSEW5,2-1f11:1g.:1a11115iL1'2,3q , , , . s 1 1. 1 gggagfzgiz -1 ff We 4, 14, 1, 1 if 1 1 1 1 . 1 ,, 1,511 .1 ,A 19,,W1111,W1,i3,1T,11M,1f11V11Z,1g11g,1,w1q1,1U,:Gm-M111,1 11,511 MM wawgw 1U 1 ,115 gsm, 2 32:11 E vm .MQ 1.133421 11-11 1 1 1 1 1 V-1 1,1 U -..... , ..,,,-, .- ,-..-, 1 1 ,, 1 111,111 1 M h Q L L 1- LWLL-L1 L1 LL ,111 1 ,1 1 1 Sw 5154 L ,1L1 L: L1 1, 1, 1 ww if M ' L A gi M W' LL' L' 'al' MQW WW 1 1:1 W VL 11 11 L J 1 L 1 H if M9116 A M2651 1fL1,,1f wf'w,LL1ffs 1.111 15,1 25 1,51 115,11 ,45411 afww Wi lim ,gf 1142 sf ..,.. 1 -. - llll- : Egg A L W g M '41 M111 Q 1 11M ,,.-A 1 S352 'WE' ff ww- Nw ,MER ,, , , 11114111 1 Wi m L'WLzLL z4 M22 '21Lffi:,1-1L,y:115,s1g1fLi1,fw111f,13,L511fL'Lva1-1'1L':-1Lf,x.,-111 1 1. , 11 1L 11 1 , , 1 1 51 L' , Lv 11-5 11 gg -L'g11,1 ,,,fQg51:,41,!fgy15,af5' Q 1,,11 11L121-egQLg,,,1fz1bg,a,1L',,1-f,1,QQL . L11 M1-L 11,1111 1 1 1 , 1 L - - W L, L LLL w 3 L 1 1 'Q' iwqwsmwfsf fg,31W11y,w1,3:s-v'Z,,,LL, giwgfvzgpvfpgzf Ls, my wfs-11f,11Lfw'f1fLd ?N,,w 115,151 . Lg L, ,W 1 Lp M 1 M1, W V1 f L -L 'L 1 1 , 11 Swv -, m,fg,fg,1.1f'g,,,4.Lf1f6q,1ff ,,1Lwf,,L5 1-4- L , ,,w11Li,,1Lff,,-f1 11-1W,-11 11Lfif1M 55114111 .. .. . ,-1 111-1 if . ,. W Ls? 1L f,1,,1f'SffL-W M 1 115251 1 - 1 1, W W -11,164 ,M 1M31 1 ,yd 1-,15,gfz:ggwfmW 1L':1L1e.f,wf1-1f1g,j'iQ,,,f-11 'f w3'1f1'1LL11f, ,1f,1-ea? 11- ,Q 1 1 11 ,1 L- --LM -L 'Z - W 1 fgwvwvww 9,5WQ2g111gfg1f,,,53 43, ,1-gf? W , iw My - - - 1 L 1 . , , - .... 15 551511 L51 , ,, 1,.w5L,.,1Lg,s'9 G,Q,,1,-W JMU - -L+-L -- -- H -1. ,VL 1 , 91 ffl ,1 1,11 1 Q1 L1,11f1,.Q,1gw 'Q 1 1 1 1 L L59 it Q 1 L 1 if 51 211' f 1 H1 g 1 ak 1 1 L , L' W it Q 1 L L1 Q , ,1 , LLWNHYZLGYWLQHTS -YL ,1L m:1-LwL:fw-iffwwfLaL1L'1f1LL1L1af?La-LLL-1-L1-111 11 1 1 11 ,1 ,. , ,f 1 ' L 2 1' gf L L1 ,1w4i1'fL'LH 21fLWL11wW5au161Lf L' 1, L,1a1L1LL.- La iff,-if-5,1ih1LLY35151fLF6E 's14,1ff71Tz1 -g5,m1pm12L,11f1111?11a qWjg11g111gf,'1g11Lp111M11111116111111 11 ,111 1 51 1 W111?IL5Ls'z15,1ZwL: ?L11g14J2U,,' iymfkz . 11 1 1 , , M 5,11,1fLWQ,i M M5 MW ,1 .1LQ,1L1-M,1LL,3115Lg, ,i 1? w'1W,.L,1 my 11 11 W 1 11 111- 1,1,1w,,v!W1-L,11i,111Lg49,1q152g,11b5 11111 ,101 11,1l,1- -L YLw111,5z1L,,1 1121- wma? -Ma 11 11011 .11 L www 11f1q,h 1-L1 1L11,-.1LLU,14,1 11,1 ,1,,11,,13yg 1-W W 1 , mlmw ,J-1 ' W. R 1 ' LM6,1m1qiLq110amq2q1vs L1 1 'fLLL1L11 ,2q1W ww 1 N2 w N L' 'gl ',:,1Lam! dawn,-,WN 1 5 ,, ww, ,1,1w411g11n113-11 4, 11 11g,11i,15-1 w1m'111 ,nw ga R 'L Lgggz15W,q11Q11,,111m1gg M51 M' ff' Lf 'Q 1fWM1Lg,,.11Lif1'i11-fg1vL- M Lf' WLfMLz1f1.f?15ZfM1AL1.11',gs1q11g1L1151,,1-5,1-Z Eggwg. a111g,gJw.,,g5,MLg1 A 5151A-,,.1g1a111g111Q11g,11 LL, 4,14,,5,m1g.p1L511Ug,1g,,LL11Q?3j1g1iLs1XA '1111411511-111151131.1-5-.gg1Lg1LgLJ1gl,11fL,,?Zf,1 HM1-g11g11,q,gw111:1qz124121113 A , ,A 1 ,A 11 if 4,1 ,111 w L 10,111 LX,1,,,1w1 1,11 W1,11,,11,1L,w,,,11L413,111 1, ,41g11,,,1, 3 wma 3. H 1 111 wf ,mf 1L 1111-11 1 L Qg'E1LfL14,,4-M11 4111-1112,-'L-111, W 1 111 11 ,W M 111 -My 1 ,Q QL ,L H5911 151,141 1 11 11 ,1 ,1,11,,,,5211a,tgL111 11,5gA,,,15Mg,.g,.,1i, W ,W-55,1 , Q ,,15g,p,1L 1 1 ,QW 11 N 6158, Y i 1,1 A ,1 1- 1-11 1 1,1Q,fff,1gW 1 . 1 M1151-Q,,55,g1M1157,,1y? 1 A 1 f M 'ii ' H W ,ww Q1115 1111 LL' 1 111 1 1-as Lzsyg 1161! 51.4. ...r . .M em . 35-fgi1w W ,1LL g,5w'L ,wfffww-,,1 MMM ,, ,,wLf,ff-L,fs'5Lf,1,-Qi,-Lf 15,-2:1-M14 111W 1.1,..f'4 . ,ff 1f'11LL'V,111LfL11Lf1-LW ffmgww ,121 1 Wlf yw 'X 'WM ,wwf M321 Wv?5:'f5 z :A ?Uv'fM'k'A1'f'vm WW if-5 wwf 1mLW ,f5. , 'fi ,Lf - 1 11 - 11 Q1-L 11 -1 , -1 .- 'gg W 11- oy, 11 1, WW 13, ,X , 1 - ,1 1. 1 L- L V fi 1 M ,111 .1 .1 1, 1 L1 M, ,,,-LQMY1, fa A gy.-,,,,.g1yj,,gj1g yL'g f'Lf 1 wi X351-Liw-1: . v Hg Q ,M 121 -j-I Q ,1ig1g1Lff'2 H gf, W R, 15,11-3.1 w3u.,1,f1qp,1 9 ,,vLL Maw .1 1 ,111 11fLW11L1X3?f,1112111L1a,, 2:1 ,11-ALL,-.1111H2i5-1 211511 1Q,1f511?5123L7-Mafia'-,ai i. Wm fag ff ,f ff HW ' V my fm WMM .ff WW ,,,-K My , M' WH' in I' 'iii ' Wifi 1 f 'af H' A-f2'f A 'f 1' W' ff W ff mi a 0? 11 f M Q fe W 1,-5,7 ff 1 Mx 'Eff 'W wg 145, -5 1 ' :.,.-. 5 - f -'-'. 2:. z :Vi- z i ff Wg. vgpgnv 5 ,531 Q My A , mv, ,, ,iw MM? 1 1, 4 ,554 ,Q gg, E.. .. ilzslqms f vfmgff w.-EW airway W ww,f W.ww w www ww ww., -MNH, Www WW. M .,. .. .. .,.. . ., ., . , .. . , .. S ., , ., ,, 1 wg. ws 5 ' W' aging QQEQQAQNSQQH gwmriiggigai5gQx5fQ'+e5 Vf5gQhQj5ff:gh.if.swigg'534 Wig , V 1 ffm ff NYM A Qigwww wg. wg Wai M ,zwqgw N ww 'Q L wmv B5 5351, 1z.'1f.1vSQ mm 41 ,,-M31 3 M, aw - wfiiii Q, , . wg. ,5 ww . W ,S .A 1 ,W wa.. ,wma 0 . , ,Q QL ww M, ww Ma Q , qffqffaw .iz WW. 5, Je ,. X . 412, ,, . J I H Qwislzbsg if N1HLffNmw1i42K51.gw 'iqifxffw P zig,i,l,x1.w,fw,,ngQ' Rmawziwgiiwzigbzghi www rims. mgwifwifz, 5 iffxiitff if gm, 2 wi v . mf 'ff g'mwEf,Ei1v 'fi14i'wM wvf:.wm Hwaiviw www wE1fHff.11LQ1w1+151M1 far, 'NMMWXJLW Miiieibwgiii Xmfabzvxialgfxlw W ,aww 3 mwmwifkia .ur 135 H ' mv-f .siwwwZwWKwmL5..iw.1 A554355 wiwviigiizk vw Q'sm1mN gwewiamgwLwmiw ,ff w3,iM,Tw,?w,. :1:1xw:w,Awg.g5'4 aim ng.-i,gygf9f,g,2H xjw g fiaikvilfvzbaabi aawg11gc1gmQ-.ygaai Qfvfffgq RJasfnz2r.wf'v11?w7.z1m :,w,w.g . M5 22514. 'E ff -.L-., I' Q 9,,,m,,EHa,w1w Km.,W,,,w.e,,W,W 1..W,..iXW,.,,fgg., ,.,,W?,..,,..,w,,.,,,dM,,9WwH,gw ,.,w Q,wN,,,..H.5g. , . sw.. ,kgggaf W . . Q . wfssfw ffzfwifzaaiimwagfzw 51'221mwv,zw:r Fmiwws.sabxwrwvfeifwazfsaeflaizwiiiuizs W ,www W, 'ff :wwf im. My-vfiiiffiifr11wfg.fw:,zim9is,aw EziiffawQSggfvf,amz2fg3-Wvgsfiwffzf.f12?:.w-.:fwigwiig,fimmiQ ysf,:1w1Af's+3H'11xug.fgg.Q1b,. g'1?2.fw5w,w , ,Q ggggif if 15 :Y PM 1x'W.f1-1 1 ni 111' fffirmfiffaiwfx fri Ligwwy a - :Vg F511 gl 1: fmm12551rE,Qg1iHarm bfgaxysggih 1-3.5 .s bi 'Q-.wg:,w. u5mHgg:g.'f..U new wp1,1,?. 5QfiEgii5z,3.-153, qqxg. A mg qi.. f,gag,,-A. .g,.f,,V4 ,i,,95,g ,duggQ-.fix.Nmmd.-5N.gL,V5x,5Q3Xf5.mgS+5? 4. .. L,q, ,. . L am 55i if'.-pi'f,,. f-25 W iafzfl- 15:91 wi fi . s-FIZEHJ, 5 Nw. A Q .AQL-fi,-likzfinfifaif' 7Nf1iviDzw.fiJl1f 5 wh'if'5 iff 1S5552'2f3f'R3ffK3 gigg3i5'.'523i7f g:f1+iiffg:vq?vx.e11,a21?s1ff':1:2g3f.1: 5.575 J wtffkzfisu Hifv E1w.?1?f1,rfalaff 1521121511 zsfimfminw Ffh-'eiswwfefwi 9:1221 M , z..i ,,,fx2mms,amxmw Sa2mwQ,xw,aw1aa1iaswfFiwmwmMXH m.azRWa5,q,Wzvif.,?,wgg.555515,2135551sexigslgmzgggfsgggwiYgsxgiiaqagxgsxggfgs : 2 32,1 :U N: 3355iN-,?f15'L1vfQwHfwxw 0312 Mir- 15 1, 1'SwwQ12xtEf,j +w5ffg'isaY1Q1v W ..., A - Q M 15533. Q-.wmggi-12. K 11,311 1x:3J5,,gxv,?vib51 am 'ff fc: Q I lwf 115' 1 - ' ,wffwf i45if1-fiwyi 2Ai3'1:.3 ?J 1Y'iLSSN'T5f 4 ff Y , . an ZX, , , , .www img - -we rsggffgn :vw X-f.aw- .sxsw agigmxfg :iw ' N., if if, . sf -M QQ V. .. P--MLM Wm W -. , M 0. ,,,, , .fam 1- ' ' .. w.,, . 1' pf , angina, jqiigimmxl if S, x ,L 2 J E L . . .,.. ' Y ,Q f w 2 . .laik if 25,-V211 Wiffxi 5:46-i111v14H..',x1f1i,Qswf? ww E , 1 V ,: 59? 'N5m5.'-ir51QQ11f1f.1yffwefwiixiil Hwiibiiwxwwi Q qw. Wwe ,M H K - . 5, K4 . Y W - 'N O' emi Qi:ff:f1a W::2w ' :?va as A Q mf, -.wwmff,Qwx.:,wgs1,, Qkfmw ,QQ vgwgm y ' SY42S'11zPwiz,5Q5Mwf:3::ff.2'5E5'ifw:1fz'f5 :mir fifigig ,ff ,f sgfjmiiwwxyfmggz Efifewiii f QQ 1- - : .Q , V vi :gy m ,M . ,Z ,, ,Q Q. L K - ya ,Q fif1isNw'L WYE? ww is a -V I ,N ,, 9.5.51 f m5g,, 5,5.,. we I ., 3 ' Y -, 9 'K ES! X ' ' 'ffaiiki 4' - vw M Q-5 1 ' Q ww .wp 3 W L iz ' wfgw z 5 E if 2, 2 I A 5gyJ ? 1vQgjf,3 ,2g 2, ,335 k:,,35,2 E w X. gli . f ,. ,MWM www , , ...L 11- . ,mn 5, H , . ax ,w,a?1:ffmv,Q5?: .f1 b22 wyezngebf 1, QT- , XE 3 1 .f r -a g QE 1, u 1 ii, zsfm2,i,l M' 121'-g3? ?:, 515 the ,X I X 5 521 1 rggv' 11 . J 5 ., M g 2 15. 5, . 5+ Q 1' Y- ' gif . 553 ' gE .gf.i. 2wQfZlcS.13 Qfw?g55 g3 3 gm , 1.15 15 2 .me gg ' ?.g2gfi8f:.,e will 2 62 EA A ' W If WE, f1 ,,,fwf wb., Q ham , W' N776 L1 ' gg , f fli' if fiqk wwifaiggwi y f f bsgg g gixfi wsai iwi xfiil 1-:fy ,JL ..f ,MV 'Ll wri jfwgz . gf-5. 'H 2, 4 f 'I ,, Q f '?w .zLsW ,M ill s2fI'4'4 ' L-i-.'i:- L , W , ,ff . .22 IV , ,. I 5 3 si - f w M' ,M E iii fgzlf f .552 - . Q -5:12 140 9 5 ii -2 Ee 1: if .fm 1 ff ,f. , ,pw we f N xg. eg ,Q y :,.:. , 25 1 3 455 , Sig fm , ,, ag zy zfif lwm f '1j..-r- 1 1, , , . QM kiwi wifi , f yme L. M Ma, W f aww w,aQww22712He15gw5w1w1em ffl .9 S - Tiff V' :a ww wws'Hwg,a,5,gzfaAw,g ww, www Kjwmfif V wg I kg mwzgv ' ug,5,, z?,,M1f,,g zfgqf x gvwwgyggzg if - .:-'-f:- WW? ..'E,g.g.4 gip wpm? gwsw Ngjigzww, ' a zazw ,,1,5g,,f4w g ftifisfig. - Y si 9-g.:- PM -' ' zggzisw 95 454 3 ai? f Eff .A A ' 241 www,w:1,ww.ww,ff:fm aww ! ,fwza-M 2:15 '51 if wsgg51f.h'a2u m1K512Wl'1'gQHQ,1ZTw w'Mi3f53a1g54W 4'm Nw u,f1w.'ff'7,,a5f. ws' , wk iwwagziiwy V2 ma,.pm'z Viiyvhzbffwbpfiijiawiazi V w naw? 9343 . ff . w,1z,:w5wgwJ5?s5g,,,1,w ffffmwfgiwqw -Ei , A' A --ff A 5 fffvwgfafgzfwffvmf ,M . - . . aw 12:42,f,m..2W:'f,,:fff-g,.: .Www ,. ffm if Q 1' . H -f in K- . fmagfszzx J W 1542? 2' ,Q fv Q, W 2 My,Qzwsswcfwwmfzzwf, www fswfsw gm ,Z v v A vying g,,fw':fgww1fvw,'4ga. ,w w zgwxgww Hg. , 1, . , V, pf fjJ'gwfd,w5W,ym5g gfgfggvw W:-i-1 sg . S 2 H W um a i f aagggg y , WZM ZZSQW W155312' si! . , ' 'M .-f'.f,f ' -- ff' ffzmwlf'iiswwfif11mzfwifmaww:Q,',1W2111mww.m nk ' V' -' ' ' E, . f 'g..:fgf, Qfiwzv :Ulm ,WNV Ufwmwmiyix vWifgfQMMZ'Q2Wf32fQ ,wig wg ., . M P' 1 -, w , f , ,gawk is S y , 5 v .. ' ' fsgiww,zf'iu'if+2i2xwv'f:f5 WZW www: N ,, . 1 W- Q . W 2 . f wg, ,.m:wam,m,Q,wwwifwmg9?w.wwfggfg5,waRm, aw W -. ' N ' ' . f' 5 'Q 'Q 1' IW L MQ '- 42? 4: 1 XL ,- mf Zw7V3'f, 'FWZ fl W' 'sw ,SMW 2 -' 1 Ed 4 ,wi ' ,N hi I -I A ,V f V ..,,., ' ,ff mf, Y VV' if ,Moy MWYHQQ fr, :hwy I ,vwwfimg l i a wgqgi vi fx? 7 E vzmwiiggiwfg',3'5b?15fvfH32?27? f5 A N fe,1E??f'ygi 5 5 ,. , ' X, ,53,0ff WEE ' ' 'W ' 1. ' 5 V 9553?LHfy,19'wQ'3f,if wfwihlfzw-f,f?QnQWV Y W.Mkfifxkqigthilliggfwwflgleg, W wif f ' A MQWWV13wWlv2TiW WWiXWUVSVWPWM' gsW?33512Vvwv5f?wS n32U 'Zw f , , , . ..,, .. , .,, W., .... ...M , ,, .., , ,. MM , , ,, , . . ,Www,ff,fazwwaimmwawf an ,wwwjwwq Z if if W 1- V WW-H wwvbfww 1'-: WW fffff' yZ1'V'WFA2GM1x 3ay 'fvg?1MV'w'yV ,VWWWWW f-.: WNW WM' W' N W 3 ' My 2 , w2.WHf'rf?s5?1ffwf'51221xiii!ki2'f33L1M7f,T'h65ifw 2'f3f41?WHf5'?W3f'fP?,5i551wi4512 'tfWi 12?5L'?'w2WWl'7 SWA 12Wf?,WiMfLi14' N372 'F X ,mf,.w.fw .,5w,,,e' www,wmwwwfn I 1, , iff Awww, W army., MM www,mwf,'xmmf f,,wwm,q,,,Mwww,m1 wwgm, 4 ge'v,,g6 ,,wffW,., MM ZW , ww W ,,fvu,- Mwzff,-Af V s.U.f,.wz,-w,'w,w A, 4 ,ffm M,U,,,fMfa7?1,Mf,f,0 5wf1.'fmzw wma, m1M,,wwWW,Q, Q4m,w,wf,mww,bgggfifmf ,km ww Wg fmm.W,3?w,1 ,MW Maman 1f,w.,, vs,mW:,,Nf fwmwy wwvmwygqwWwffzwg W Qjwwif fS,f,,wM5fMx1yw www' My www xww WSW v ffw gfwfw . .,.--.,,, -H ., f ,f W I aw wfwsikmqfjlgiiw' 53,52 if Mm myww.vmLg1wg.V,,wg2f5lm31,wfw,z1?M ggzwg Mwdgw ,,fgz2:,fwwmf wwf5Q?f..51Zfg.. ,wmif wgzw ,ff ,wg wgWp,gg,,a5,gww0f ,wwwizfiffisflhzffifi ,fmfw'wwfffm2fw W ig, f ' ,mag - r w .f wjgw fs., 1wff,xw ,wwivmMWmW,miiw Hfffifxiiiii?'fw.'W'fW7'34f53?'?6fmK3'1i1M?f',,ZZW75wQ2,W,5fifyrv'QWC1'LJW?gpgQiwvffz'.3?,1dvff'x'Wff15jZ?5f?N if, f'ma.1Mff wW . fwf . ',Mw4kf4f'K,v 5445, ii f' N Q, N1 g,g3, Miffgfzjs' ,,W6g,.3e2'gQy,,7Q 25553374 553,53 Aid ?,,JVg?5gWm,,M5gQ Wkkmji v I , .,-:fi , f gg W , Eff' . . ,. , ., ,. , ,M ., N... ' w f?viWWifff ? SW V51 1 ' f 5255 1 ,f , , 1 www, lwm 5 , , ,yfzw w mf, 'JM W -, f ' V, -ffm. ig, -124. M , ,WM , 365,04 Zfffw my 612774 . fgfgmfg xgzgzwg ,, WW , , I g , y wi ,- fa a emf W mmwif, M ww www? W1 ,awwff WW w f,,Q, ,ffg,5,u5w M , Q ww, . fwggsfwa www wzlzfwem wmm www wfwmmwfgwwfmm ,www ,,mM,wg,,1:f,W,e,,fgwww , wxwfg M M 1, ,ga -, . 5 m f. , Q ,ww ww w,,,f,,4 w,,W1 fe'e,g.g1.w ,13Wwi1pg1g,,w ,W M4e,,mgg,,g54g,.1,Mg5f7fm4,M,WuWgqwywwlwww M Mfwf.wgfYg,Uy1Z,4W,,4',5m .famgwy2,,mwm w,w.4',.fwq3?i ,MMA ffi,,,j,,9a .ffm , -5 WQQMM ,, . Q W 1 5 W-7 . -, Mimi, vi 1 1 1 W .1-,P-. , MWM ff www' wgw ,A ww,,f+ wxmwae ww w,,,mw 3 .www w,wwM2n,w,wM ,,,f,www W fm,,f,,g wgi fgxwg w ,W,, w,m, M- M fg, .5 fi ww, fg , W sW0 v'5w:ff:1gf2ffq.,-zfw1,2,ff'fQb vgifwf W N'Mw2 wwg:Q af-vwwf ffmggwi' w M4ff32,Zf?v',i5Z ' fwxwf W ww SWE? f ,w .1-4 if gg , M 5 , J ..,.- g,Ay,gHZ5gN,, 5 E, ,Mfg ff ,f W M y X , YJQW, W My .Z .E Egg , .QM A, zflw N wxf mff' ' ff L ,gf , wf wwwf? ww ff T. 3252? My-p,f,:1,,m w,wfwpz,??fZmm,H wfa , fx1'491fg, mW w,,g, ' Ww 1 9.54, M ,wggzh ,Qgygzwz y,M ,g,,fw,Af,,1 . ,ggi M . M w w gmac., gggaaznilw www? , ww, Maw gf ffxygzmwqs wwf ww f ff Q ga, 1 .g,,fgfW51V'f,,f1,wf ff1f4,ffffqfq,,5,,,s,,,gm'24 W., m 4 .zj,ffff w w iam, -q w Mft W 555 we ,W - M Q QMEFQKH 5, Q, wgwfw i my Nw? wg' 127141 Wmgmf wjfgw ,ww v W 5 ww: W Wygw mf, . M3 15 MQW' , Wf xmgiaf v wwf, - wk - ,ff L, M, , Z, 5 J, ,Q .54 38 .-M. fa ,7f ?f 71? uw 71 , 1 ni il 'Q W 2 I 1 ,Z-zz? f 2-ww fw-f,i,4m,,mf' ,W . . .- 5 , A 0,25 1. - :fm W g- M -Q -Vrm,weygi153zzxw4Ag?2.ZiZg'Q,Wwffifwffw f f, 359 1 , , aww, ,fi if 5: ' M W 1 :F .,.. I w e My y x g, ,-4? -41, -, ,Y I - 'I' QV ,. ..., , . . , ,. ,N .,. , , , ,. f' ' --wavww 7, wW -.v--Wfwqggg ff? ff X fvgngg 1 -ff W? V Q W A WU Q W f AM gi M ze M535 Ish Q y lf , X ..,., W. .-,- .,.. W . M, Qi WW W W ' sf' 2 H f .ii af. . , , W ,. l g 5 . is JFS 51 ami ga .1 ....,., . ig ,izigggiggi :. . . . , 1 1 Q ,, ,, ,S ,, .... E: ,,,,,,, W ?QfgAg55? Lg 55: :a:..a- H fl 23Lgg7?Sg12ff 9155523 .,.. . .. :.. . ,K N A ff::.1 ,.5.g:..-:am gpg' E 4 J 5 1 ' ,, 1 E , 1 A 1.1 Q? 3:5 Q ' ,Q lik y W 6 7? 152591 ' 4- , ,Aww fi' Q5 2 .::.:g-,s-wr M s1.s-,s- W: f-:f::.:s:s- 43 MQW N ,awww 'KWWTQ M .6f?E,f?M5S W2-fsgfzezff 21:21 Wwxzwzws W aww ss: was saws 5 rm 5 wwf mf E 2 gg as ,'gg2f5m1,,w5a1w-. M22 11 . ,g:,: gf . .gf-W gm.m:Q.111 wmmg,2:m:1.:g,qg1-1:5H12211331551L:swgwsgwHssmsggafwfksfffn.:Mwf::fmsg,fw11::5H1. g1xf5fw.1:4ww.:.,:Wfa Egg , .... 1 .... f -----. . gg- .yggwfmggg wwggfssxgggizfazggfgm mm:,f1q.sg,,,,,gwQ:fQw2f..gg.1smgfgwqgmgsgfiagawsiiizsewewskgkiwgzwaw msvwgswggwwwmfw PM ff'-af' Mfiwwgiwiwwmgm:QW55?QfS25?W525S5i2'W W5f2:52:w 2lvziwsiiygaasqfgmsv Jw:-'TQQW Wwswmsswi? 552 5:5255 .. .s :m?,1 gWz:.,,,, ---- . 5:1125 5 2112155 52.3sffggigesgmisisiggaQggmsmiggs52259252552:1225555wgsagHfaffzggfzHgsmswgskzswfiwgwg-2555555515561zwizhgifmiiffsggiisff285915. W M21 me J sy Mi S'6?1:f,:k E 22:4 hsww 2' Wim, M 'x'i?i.gi5?3W wifi? 91.555 ws, -zwfriw 2S2zfW. 1: Uf:Gf:P,2::-wwqww 1:25 .1 i s 4 :. ,5:g,.-..,:,5,g5iE.g E:,,.:. ,ffm -,165-gf... 11 E:,:,-5 ,M ,, ..,. -:-L: Wi, .:,g.., x A M . M, Q., 11, M, 1111, Qf1.,.,s m,su1m.mW.www1m.,.w mfsrma.wr.29fw.sw1,2,2s21m,w:wJfmplfwfwiiwwm Qmwqwiwwsfwsgl M myfqf fmswiizif W K0 W is 4: M A' H W x '55 M M ' U n N Q H 'Z' W5 JSM, 11ffE.Qf,,MffZf?f1Qff5m,f lfefliwiigsgif -wfrfifmfymfgfg 1 gg. 1.f.-.g:.a:::5-.a-:.fg:g51- ,:,:g-.g-,...:-g::.,. :gm-::.5:gg:: ::..:::g::,g:.g :::.:..:.igigfg-.g:--.:a:g:-- .5-12.3-1-5 :fg:'g:52:5-.5:'.:5-1:19.5223 5 W w gf S Q fi ISN'-'? Q ggzgwnf 1' 5,-5 52:-.111.f' ' :1.fQ?Q5fS'5.15 9ag'95 -'i-12 ffzwiiegiffbfiiiisfiifff:'fRf:55i552:: 5:52 513:31 fmg vwSfigmfwzgfwisgwwazgwiszwm-s5:f , L--we, rg-1.2: ::.:':::,g--::-::: .: -2.:.'g:E'-:::'-.'.:' .5:::' .f:::-:- 2.::' :2 .- 5? Mw g miyi-W2-iiiwmi 255321232 W gifil-'fggg ggggiiafigfigif 21232 5535259515 2f1 w1Q5::.,g5?g, ssfw 1g,g,g5s:g m ,Qg1 1, fifsaf 'I - -1:,.:::'::- -..:: . 21 .. 1-ffm 5 'mm MW?-2 E,,ff iSa nw Wu1..::m1...,g1.fffW..1' 2:53. ,sm . sf ff-121' 1- . , , 2 ggizsmgssggfoi azz-wzzwzsssz ,fffszwwsfi 1:24553 ff'.:g,::Q,1f2fQ.E 2'.:' ,2r':2g25E5Q.:': .r2' Wigwam me wivfi sg 3fmfQ3:::ffg12S:fw?f1:3biff: f ...... wwwieiaisgw iswizwgwvggswzsegmsgaswsw1W,1w1.:QW:,:gm x . .. :::..-iz.: s.m531.3,g5fr.,g :: . ::.:agf,. W5 .::-.:: Q1.1.,5Qgms1fy5..::,5wN Pm, 55-wswisggmfif ggwffgg 1.25 me Nga.. , , g , A .... . fffw:g fgsswwgs gg:5':Hgm 3Milzfmwsmfls:wsfPsr:M4wSS2mfiS: ...,.gg,g-:gg.:.:..:..:,,:g- B 'A , ., . - ...:.:5: :,,:g-,- :,.ggg-:- w?1?.?n .':'2- bfi!-ffl ' 'six aim? Mswsiw 5 .35'v'iSgw5122? 8 P :f:f::5:1 gf farms? Q? .1-15:1-gf :sn gggggggigggsgg giggggziwsz-figzgg S5555 rm szgg ':j -.-. : 3:-:ig:',:5' 15: - , nw fa -. ,wha ja gasp? 49,5 r,.J53',a if .,15?4 'am...:,:g5fSs.m. .Qszifffsa-blewSiicfwigsizfffr?Sfflfskimfzl 11 :f'-25.'.2'e2.2E' 555 -12 .2 .25 :: A 5 b :5'5'2'22'.2:' 5v , 5'3??'5gSEZ'sME?52?+f3? 9551? 552 M5 5 Y 5555 H g5w.sw5Qwf2 21..5. il f::g?55f -1- QSM 5 535555,Emsfrssggvawligegiffssis:wgsggiz ff,-15515 '2:.:' ,-g 5:' Q ::gg-gf .2.2:2:'.g:5: .. ww gwig n w ghwgmisfmif rgjwifi .. .... 521 M1 ..... . my .:: H: is ...ew Qi Y ' vw 55352155212 Q g 11S'..,?5,5?g Q 2,3g5. .... 5- wfiaiggfg f . k eg pg Wig? -gw,-135,31 ..g55yw ggm,gQf,,,igE H5313 W 5W,,.,.1 gg-1- 1.-. .,'.:f'5z2: g1-,1Qg3:::::s-:- az 'S mfggiissm gggfwi Sswis wf sexism 5 QMQSSSQ ' X Q' if 12 if 512555: :-fhf+?.:.:+2:a- -: -.::' F:a.af- - - wg i qsigw aggifigwg .?.? ?afM52.?5ggg2tME. .f:,M-wsw 2 2 X :1-I f-.g :af--5..2'.'-.5-g:2'I5'.-:I E - :g-45:5-E2' :g.g, .'. ,g5 : figkfffe . EH ,S 1 s A 5 5.52 5 5 if i.. f Qi. 3131.5 sisgif' Q-,A fziii gm' F55-: ,...,. . V : L Q 1 IEE! 1'fr:.'f': -If-Sf . 1 Q Y 'Q' V x 'U -A - W 1 Y Mm,,,,W..w...-11 A w V mm. W . 11 11.1 1.. 1, .. .. .W , , 1 ., . 1 -2'-5:12-:-. .V-.-::...f.: .gy-: .1 , l ' 5 3 .... . Y' .. ..... if 4535- M513-,E .1 ....... . wwmmmmwwwmu fmuwmmmffiisw MWWM 15535332 E was W .... .... , .- ,:,,.k:--:::.Ww .g-g:-,-g -. 1-,--. ,E- .-: as :.g.,g,:,::-, ffm 1 1 z 3 , .. ,MM ,.,,. . 2 ,5, azz Z ig gr- 1-11.121-E-224 ' 1 f K-in Ei? gms., L ... Q ' . , s Lgggggi 5 f 5 59.11 oyw wa .me a s f E IE:'-I:.5fEI:-J far 1, E. gg - ff 2 , - .ww m , M a , . H-,-gy-.Es s 'L :.g.:...: gE..: 3, as 4 .- 2 1114... 2225: eriifiiiiiiii 1 gi. 5 ...,..:,g.aga 5 5.1. , ag ,:f:3gggg5 45.2 . 2-E2 ' F SIZES' E22i22:i:i:..? 1 E - ...I , asf 1 .1 2-:-1:-pf.: S , .ff ..,. , '-. ., gi , v-.-,: ?WA, . 1 .wg Q? IE? gg, Q55 Q:-. .1 5,2 P S Q EN E119 1 . 1315 ga, 1.261 Ugg if 52 'V wwf 1 .1:-11:-sais-:a- : . . f if 52 5 TE? 'N :r::::E???E5:E:fi:Eff f ' :5:.::QE':fEQ: ff 1i s5i5g3E5? ?f 222 231 , 1 2 fa fi. X --- g,5g- H' ,.., vw.. , .gr .g:'g5E:525 4'? 'A 9-'il g-S51 -.:: -1.525 :: .5.5::4g 2 5.5.5 .5:.E:5:1 ....,.,g::- i n Q, 5 ' ..:-:: -:::'-' .5::::E' aw.: -:4-:-.a.:'.:- I:'.gs-F-: 1 Xi ., ..... .,. ,..,. - . ..... V -:5:-e.' , ...,. : .': .J g N , fish .. '- ----- 37 3 . .,.,,, . .. U ., 11. X 1 my 3 I ,, 5 f i .. . , ,i ,.,. , . 5 51 2 E g 1 Q Q 5 :. ss J I 42 , , -'-- 2 -i.fsQ,j1g1, .,., 'J ., 1. is S 32515: 5- I -. 25252-2 -: .. .... . x :. '2:' H 'S 'lik B1 9 'R ' -1 G ' 5 x 1 Q 7 5515:-I-:2:.g -g' g-.g-.312g.5:5:g:-::.:5::g:5: 255- H 1 W 5 A 2 :f'3 : : -:'5QIiIfE:: I -2 ff' f RRf'.: . 5?g A 5'?:-.:':5K 5: iv f5.: 15' is .':-F'-2 f 4 ' .I?':':1a3-33 EFZISWV mi ,EXW 'WS P FM Eg wf .:-.1-.1-1-:...,,:Q. if .1 :W Eisgprwgg wx ws1,, .16 gggwgg sffgmfm S55 gg ,f 2 2 A 1 .1 Z 9 'Sake gi X 1 ii I 1 5 iv ' Mg M E K 93 6 iigxtgigi N159 3 Q6 ik! a!sg.fS.1Qg 1g wig Niwfssi W iv? iifiiwiagl ggi? 1m 55 ' , 55? M ff gil? E as my 12 mf sf 1 5 , gg - is 5 We Sfffggf A Q ZW 3 1? 33:4 Q55 V YT 'E '-- 2' ' E 5 gg if-'-4-K-'-ih'2I'ZI:.:g EN 1- 5515 fkfgffi 51 i ,, N Kg? 621522 5 , :N W1 ge ww? Huggy Li? QJQWWSQ4 2 w wghs 491 35351844 fx Q . 1. .f:'g5.5'.gE:'E5 2:5 :Q ,M .- Him .,.. . 4 qw w 'ww dm-.1 HgLmS,,.,g3i1,q 'w,?g,w55Mq. 1 5 fa .,.. . ., W .25 , ,, 2 XTKBQQ zfsflssyaisfwsaw Q51 -I ', -' W p Mw,,2,,y My 6152.1fgkgfggwyggvffgg Egggyjg , H 61' -fs fnmgggmiw ,f13,s::,E.1.qw figw.. 1 A f 4 ....,. 1 f ..,. 1 1 1 ff 5 f 4 1ff 1 1 X f Qi 4 X X fyidv 'vt 4 1 ' 1 My J fi, K 21? . .... ., . , , .. Q21 , 1 j :g g .fqsfiwsn M 2312 gai wisgss safnkg gfihigwgiggtiv ff: ----- : ...L 512515355 55 .. .-.-.-..... :.- .-.- . .1 .,,:...:.-,. , .... ..... MW, -:-mg: .:::-1:gi.:-:....:.:,:g5:.E..:.:g- -.-..,.g.,g:::y.:,,.g::g- ,lg-w.55,,:, : :g:.:..,fq X A fm , 11 Q .12 -:-:i'2.'.:2-2: '- E:,:5--.f:2E.::-'-2 ----' 'W ' g-.g5.5.5g.:2:5:- skgfm sk, '1 Nb ,MQ bg W H - K ,wk - - 1 wa Q js 'mm 'zz 519551 wg' kg 55:31 A ....... , .5 1 33231355 f1m5g,1f Si .. wgb 55g k5gg gM gm? Wzgga5E ',:-5:1--:.-.:.:.. :g5. ,, -.5-4..:..: my .A .H , gg V W ..,.... '1 5, ' ::5:'j-'., ff 1 .1 sq, g , P gm g M.. v ws 5 55w2? Q.3?5gg22g4sfw?5222'P 21:53 MEM? Q z g5mssg3gas,sgg11mw1gmg1.1:1 17 , .1 1 E1 1,3111 ,, gm.:5f1,,::.:,w..::gf. Mail M125 921. 11.51335-f az1w2?..s1.:'g:..azsmzigfsfrg 2? ,W w:,m':?.fH,msg.s M Q1 6 5,2 M? gg 41351.31 ', H f 2 faxgfiifg- - - Q 2 ,, 3, f 1,91 .1 m.:2:.Q,,1wf ,WN W sit? ws N y 'JH MH 532. 451::,95f1ii??:5:i1gsSK5ixf.5:v.M szsigsairgxxsswqf W U .. Q ' m 11 ,va 0 . 11 U 'V L11 1. .... . Q gm Jsww.1 -Q H 15115251 1 2. ' ff U .mf , A 41, .1 M1 :W , A 5,111.55 wsisfmi Q2 Qigf if .1 1 Swv 8 sew 15135 2 11 M2512 1 1 ?38H5??'f SH Maw W Nw Qgwaafgffmgfsg M X gsm W ...,.,. Q Wm is igwpgffiaw E W 5 ' wi.. .f.:,:- ...J - 5. 1 25? M 1 awe? RV :S fmfisff-s.M w :5 :Msg we f1',.2::. -21.52-521 -1 W? f.E:EE.:f:'::5 II ? E' QQQSHSSW E .rr Aww? , if-....-1: isles? , mm. , H.. g.'14 fav, ww., - . , - ,V wa-M W ,,-M ,W,..31 H .1 ass. mwwgw sbgwgm wP2..HE3i:fwfigsggiiezwpzssggiiizgggfsgi'iazgggsmgfsmgggsggg5225555552 2 H -H1 ?Q2Q ' 3Qg3?f?f5f:352?5?ffS4MS M., ,B Q H, 091,33 W M my , w,.,,w. , gm,gw1, Am, www is x pgm ,,,011f.m bm.,,1 3 g 5 .- Mr? wwfglfvsm. 1 W aSx?Q.,,2ffQ?1g,121f,,,q.-11 .1.,,1gS,g.1,,Q,wg,2g 5.:,fg:Q523,,g11. ...:.:,-.,:,:,:g-, 1.14, 1, , U , gf ,q mg, X X3 gy ---H. .... : .:- am, , Qwwf 'Zig ' .gg . as , W .1 1 wgaggggsgfmgibw 2 ,1-Shes? ?wg,gg: Swggfdk W gm L .,, Q5 .W ., 1,,,,R Q 19 R34 2 1: 3511.-5- 52' ,gg,5,g.,1:'.,:gg5-Qgr.2- we ...,g52, f-2 m.,m...,.1 'ezfegl Y me wgssfiigiikwwmkieiwm 3393525 15 W W Q Bw SW w w ., , 1 '2:.,,4g5..3:5?::1f2.g gs? 21, E5g13:',2:gR'E5W'sg:g??2g5ps:gY.gp559:gH ,,, i, ,.,, 11 ,Q f A ww 5? f if J I aw 1 ,1 1 f 1 1? Z V ,,,,,, , Z 9 . 1 1 , 3 gf' f f f 11 . f V rf X 2,5 1 ,K 1 M 1 1 11? 1 41 iv W 1 2 f ' Z' 1.1, 1 1, . Q X , JG X M 11 F 1:1 , Q 21 f . 12 32:22 H1 .1 .. wszfni 1.31, QQ ,, wi- ssggssmggsssi :we 15:6 Wt 31:55 2515122452551 5, wsifamrgff U1555.gf:1a::sjNS.::'gQiiisiy-if 61 .Zggg?g,i E Wa, . Q... 'X Mina fzmiiim FN' wgwgd 1 wwflwgzifbs ,Q2?2iSs:mQH5g.g,5,,, w.-fw..1:fw'::w Tiffrf 5 95931, 316.2 ..-M Q Kgs, .'.,,,kk:ii:.1,,41essef1m .11 . A 4. WW ,Vw L, wg? mg In all W 5 S525 1. .W xigffvw 1 1 2 W 555. 5 B, ei? ,,gqm1 gpg iggiiiggg j .Q Q 5....51,1,. 4 . M ffifffiifrfifsrfzgfffi' H f2?5BWfSlZ:D I swiss. ' N.-ws3P'ws.v S V, me 1 ,,,, 1 , 1 M511 fp N gsm .-psggm, g 15, H3113 M pg 0. wa Q gown 55 221 55 Q,.::ffm,. 7 .W www Na ez 296. mf 1: .. . zgwmisgwq x.m33fgs 'izafmig .ss H2 mug? f , U W wws 1,fw3.5wzws frfmgw 1' ww .95 ' R qggzu- ,AP r .jmm., Swwifiw fgmwi H2Qwasaid!wfifszsizs5:11..g.,,::ef: f We -5: X Hff 'Wm Gjgggzss 0 Y:rgmgigif5.'.':gg35::fgQfgfggmfffi Wiifif, 1'f5,g55f5::,g ffffffssig , ' ' :gwm5g3f:Hwagfsvhfzggwsff wifi555811.43325A:gy151235125:mm:gf::g1.Qg3g5,,g Q. 2 fs 41.Q2f2:Dmw1i::s,:25sv A W, ::gf:5w:1zsg12:H5W g1..,ssw2w5?2S sfgwzwisgHH2ewgg:f2h2gExam .sslszws Q. M sf M Ph ,sw HM., :wx-., 2 1 1 my N M 1, ' H ff-' . www 1 S W. .552 if , 2 be Q. ,w,,2.. .w1.Nsg,1s:g :wg ff 55655. A'1'4m'h'Yw 553 - W: ,11,1..,,, , Mzassfiffsgfssgggfgw :s:.:f5:::450?2: 1 ...gyms .+1H,4Y , qg5:?'f5NQ ggi raw? if QEZEE 1. ..-.-J ggi? J YQ H N. 1 ---- 5.36 aw si, 51.3 21 -m g 5',..: ' yi?-5 5 ff? 'f H 2 .2 ag' ---- : --v Q 'M 5 H :-eg.:,--.:.s-.gi K 5 1 859 ws z H gsm ,W YE Mig? 5. 5 + . Q. Yjs 1 My 22 qg ggggifif-ggi? ggiiiz sfflffsgfggmzifaegis'-1q4s2E:ffwfQf?::frgsgvrfawfsgfywsswqfsgkmsimwgzsszgs was wr-. p H -Y 1 Q rg f . swggzfggss 2 53 fm + . Q X ? In E 15:55:f',E',E'iE's5if?.g: E5 ,g i 1 N ,f 'A 1?fSf gdg,X3 95231 il, 1 5 5 5 . Q 1, Q 1. 'if' Q Zfwiiizw H5WS32w EfYw,,3P S1 affine ww Q 1 mix S M wfizsmf ' zfgigsffi555125:555:523:?v5J5f:g5:::g?9?f?2ffifiisffiqfim?ifffiizgiiiiftzfi' ' i??5QZE?! kb mv, 'ww as 'www wh, we 4. www 'X-wif 4' DJ? 'ww,3llf5P :sf .sasvsizw1:1-fffssfssssissafzfwigsfzssfwmzskff..5'Qs35,1,.:.:::::::Am1,s ms., M .. 1 ws MN 6126 fee- hsgiww , B sw ...sg 2:3 fl 1, 1 W 4 114 4? 1 W ' x X f 5225 1 'WLS 5:53 , sg 1 . '? 2 . A Q if 3222 ww Si Fil' 1. 'Wa W 55:5 gas: 5.42 :E fig 1- 23? hw 1, m:gem.:,,?gw..gglwmw..g,m-111ww'fbzfv,,, W :H 1. ww.1,ffw,. fm.-1,,e,1.,.ww-.5Qw,wf1A MXZMGQ,,:51.,1Q.1:w...,.agf.m ,f.,,,gfm.,, 1,5,,1g2A gggnzsxgq..1gvm411:ffe1,,5m.5.W -g1.1.,w,g11.2f.2 mmf,-., Aw Q ' w::ws:'gf:H:A ' was 922, WMS. 0, .wk wwf? gm,,mysxwa1SJ vfsavikxisff' Hgwxfy nz: 7 1:::,z:fw mwmgw 3, ga E N555 his 1. . . gp r wa 5 Wgfgw 211.95551 5.5 , 1 vm, vm 1, mf 1, 5,3 M, ing agm:m,'fgfW:,w 1, , .mrs gfiffzww: sfmfiw Rf: 3555523-Q::g ::. S M .N 61 ,. N 'Y'-1-ZPNW' Hsssirgszmsf:sisgzsszzffiiqi. Rf w gk2,-,,g'ffmms,,:wef,eqemggm 5112 'fl-133 TW? Higfi .522 ifssiggsiwas 55S3::E:m5:'755 Qwgf, , ,,.. . , Wm Q rw mu 0 W., 1 FQ -.W 11 Qqlimifm' Hg555Q5:sseS?Qsg'Qww3:95215ss::s?2s?wg::5g:5fS M V , WW H v ,W W , , .,, Q, M Q, ,W W, ,Mx 4 N, N M Wm., W ww v V. FQ-mm. N5www5s?4? -fzwass V, .,, W, ,WW ,..Ww,, ,W ,W ,,W Wa ,Vw ,N Wm W,-fwg ww wwe es' mggmf ,gmzwza gf QQ. K my -ff 5 ffm S-gay .wwf dswawzggg Q HH-figgwi, g,wQ53F1w3X SN-3592 NSS? QW Mgr? g 4 2 W -M sm sigggggesisr 'Q , Qpsisbfgmmfvgsi Kgsgjggggugsmigif 5-wggiggmgssqgigig , -Siam W sm-555 -15-fm NP ff M 9 W 5 Q use-GSE- X1 34 2 M - we wk: -m ixes, Hxiiwwrwsgsag -H 5536-9-wwasffw M-Wm M-Q- MYWW mm . M we ,f ,A MW Si g Wm W wi' 5 Esmssqzggbsw-fggfwg mmf-155652 Rswgga.-gums? Wsfmw 53-YS? gxgf-1'g5Eiv-'5?2bfg-fywwi ggkigssy 2553335355 mm' fs 2 , .. , Q , , . M, mb . 4 5 W, ,ew 1 , ww --Q 6. MH w.,.'Q' f H La ff'55ww2-H'-f'E3'N3 Q2-Eslff 'Q-'Q aww Z'-ff H5fii2Mf?5?Q'-f5'3 ,fa-1 gggwmm 1:58-mzyiizsarsgiswifsssmegfgfpmem,,m2?:WWraifwwSwfxwfszimzsfm,:Nz5Z:'::.:s-Slmzzf wif www 2 vw KV N E! H I I ff' -ff Qx ' I Ag,g,,W E. Q -NS. 5 X X X 2 ..,- - 1 ,MwMmM'ew A' Mm, sim m, w,,H:z :wwf V' X xx :g,gi.2-'sw Q5 xjigig W A. --WWW-2--fwwww w- P .,.,, U M ,.,,,,,,,, ,.... ,.,.,,, I ...,.,,.,. ..,,. 6 ,,,.,.,..,. I z Z ......,.,,,:, Z ,Z .......,.,. ff , mzswm, , , , f ,, F. x R ,,3. S v X is X -NT ,: :- ... . -:. wa Q: 5. . mm ,, Mwgw:s.1x:w::--i2'i2g5::- M 2 WM K HM, . .za xM-mgfwU.,'g:s.5W::gf'w.gwi'3gwfA.: - M235 - A Q ' assi? .mssssmf , gk W 82 we Wm ' W Q Q-5 525 : - --1,14--x:.:-.fs-Ig ,femAswg-m452's::xi452, ,, 1f.4swff,f5::es'szwwm-isssmssszpsifffm: H- - -' mmgsm vm, ,w,,.,, am :ww vga-ww am fx 4 W Av W., 5, W M D Q, M ,mb Q 'W MMS www, M W 3awwL..5wm,,5-gf'M-1w?f5j-twfvexp wmgwfzssgfm 925555 rwzggwb :::V5?Q?S?:5gfu --fiswsfz - - :mn A: Nszss- --f:s:::5?112:,,3 nmggfgggiz-fgrzfzgfiz545-25125 :ffl :gb 1:5 ,lgjJ':'gQ?2fIfiffQ5Si5S33Eg'1 ww-wiisgggwfzfz F-fmfg-wxm5,ggwM13:z-5352: : Hwiiizfw zftsxy-M1545 mwizf- fm:1.fg:1ym :YW W-IEW ---,'f??x2.g::SH 6-Mm?s:w 2 ww Biff:-wmigwazimwQxsggsgfmgkfw-145 sm r.:-ff:-fm we We-H Q wigs QzsqggggmsusggA523235553A3sgggiy:PPgg55ia?35::5g1Q55ikggiisiwlirsswhisrs:MQSign5515:::hg?i?:ff'fi255?S5?:55:-59255-215-Qi 5-35:45:54-asssfzsiffsg-sffgrgsisggass:-as-fi:Simsm::sseiifszff?1Kf:mSSf:::::?S5:g4::Simcaffszz-Mmwfrsmfwars:-::??f?f Vsge-:wm:g.fw,, gwww wmzrvw-Wk.-ffmw -gMW.,:gmz-1:14 -megggmg,-:U :,:r:-gw.5,,2gw.,,, w.,3?33y+n Fs5H?L.,3r'-fwifgw....iwgm.,,25'1?'g 22:-f WkM.,gnwmm,gf+fUmv-fu.www Iaww-nw-Mshvmmr-awwfi W, fxwwfQiz,.ngmQ:ffEffHw'f - QiamfwstngL3v5.f'--wififw 2L.Q:ffw'.g1:z:,zmg:w'-Siem-',':Sfwzf25:::f-fiiigf-f-LUEQGXM-ass? ww M, WMM wemmg wW,,ng,'ww1,,'ff,.,,,5wM.q,fwm5 w--aU,,Pm , JMm..,Mx, --f.M..1?-1m,ffi...,,,wg5m,,, qmwg gfvqwyjfumhkgyk, 9653,5i3M,.,gW,,,,WvqQ,MK UWM, ,Mg WW, ,:,Q,,M ,MQ.,Xw,,xm Mm, 3 wm,,,,f:.q,w1.Mw ,Mmgff-we www, Av-www, Y vw-my 2'-ww.-aibfffwfq.-.s,f3gsfw,,-.kzwwngi-wma gwniggg: m,:g:sm,.,wf--I Luiffw-Mg, zywmgggr-4536-fm.s: -My. -'-Wfgzif-W -Wfwwfsmm W,-,gwgg -gUfm,:vf-MMU,,wf...g,g3wk.g'ggfwZ.,,gMw wmggmpwg-ww.,,,-awww:-'ive ww? w.,w,,dw.mPgSzwVW mwffigm-.Uiiwmmfawyswfi? ,gykfzi-imgggggmfggqgsgQmisgggwvyggggMmg,pgvwgg5 mgfggwm-gfgnsgmi Wgymw S.SE,5F,,,:e5SsGg :big5.f::f:W-firsg-ww if-Sf, 5-,wiEf?rw-f?i:?,2g1w15'?,g13vgS:5.f--Mgsfsgyw. 5531255155 --3wizigghi-fifgggwz gggmsffff-sim:-eg --.:-m.,,g f um Q gw 'gfqggxm wfgfgiffisgg-Y,m51:.z,ififfpivfgg,ey-2325--4 Agggggssgvmipfg-A m93ws,g W M ,fyfr-gggfw 'm,w. 15,5 ,f-yfpmggw.. .155g,w 5g,.,Mg5g..e:g,,M, 1- ., if-jp. I ga A 5, H.:fggQ..:: gf-'Q:1:3,X,,,::3zg,J .igmss QJSKQMQQ-:gg26,f-,.:f3i3,K, lm ii- Vswzjghifgsrpfwkzg ,wfffrffbiszyfif Sifsswszssskffs-3.mfs:-1 Mhz: Q y Kirfmgplgsxffggssg fm, W W ' W V M -'fs A 53 fi' we- Lfjjgm. 4:4 U Mg, tiqlfwfiaggggif. ggifgeg 3,,.2,::f:552:r -jfgginv yliqwk 7'1'f'f iz-fffffsfiffwffsfgiif fsziffvf MM 'wif www ,,,if? S:2w W f-.,35gV,,-- hysgq - .:S'Efiq5g:M:.y4.. ,.q:Qi:::w vwfl g WJQ352 T k W zzjy 1.-3355 7- iiwxf - . 55: M Zxaigggrj, M 5? ,3:,:eig,.i?3,:5g:g,. ,,,zv.f,-,wk mms M. U gggwiis' -an M 'ik ' Qx , Lzfiffi A ,.,,, ,gggrffg H nw,,V,L Mm 5 35- -wx., .2 -1 Es, F aw, I m,.:b,a 5:51 315-51 v,W,. 5 Qhsf gg giffgg ws,-2 'x,-f-eg 45 , -A 55,5 Qs: -255525.52 gk .52 5551 x f 1 735' 3 . , gfgfiif '51 3555: Q 5f?22f::95,f' 'H::S5?2 '?5?J2'v5f' 3-Piq:?7E? iff mfg -55523, ,Leif-gfdz m .WAN WSIS, ggmsaasf- VWQEJQ-Jilzsfiiisiifgiiisg., ,Jsie.5ffgq:sw2s2,2i:ggigf firm ?f5 if53,5fl V -1f52225555fffffszsiisssffgfissfgs ffmfffffzfffgssfgfzzi 5'P'M:3Q.2,g',52:ww3 ' w,S'f-.,nU.AQi?qiwg,:jfQw5q bkvvpg .,gWowS, wg,-Sbggff1.www 0W'sw4-JS ,-?,?3zwf,,.Ag9Whg-- wg? mawbmwgpimfzrw '.::m,., M,MH3'ig: -,fv.,g5q5i,W-H zg55:5'.:w?-'Gigi' W- ' - ,2i53'5'ff- Uiiigvirz 2255- ' '2gwvJi2:i5gw,:'zi:S ws?-'-' V Ewa .5 fn ,m.5f--- N334 4fw2Z:a2fWH2f?5WfM em: -fiwip ,Q ,.:52Z.:in fait .iran ,,::'Ugw1j15Z'a :Effie Jfjjk fggg iiiiiiiikisfssfqwgzx-M::::sf52:::?555ZQ55f5g gmggg-5wm,,ffg5k3.,ggg5p xszasww kgwigw SSM.-shsiiiii 0,-5faW,,ws we fa 5 N :ww w,f?f- kr' 'M ws:-wx Arsswm ,, 0 k mm feggww W ,:::':g:i: -f ,E5:::zg::,m:':35wffSfs:,:ggWgms? Sim Uffzf , 5 mm. H ww ,,mM.1,.,Wmw,w.Q,,,M M, ,U.,N.,,-vzwgm gm Aw :Zia-fy In 24: 5 E M 5:5missssiseamggg-Ngm?M.z:::fssmiEfSs -.g:f- :- :RQ-Ss-Q, 2-51 s .sig AQsssszfssimsmffwSffI?2fs:::2-:sm 52265 f- 51 Sw Www wma ,WW . SM -Wegwm N.wmsgfsgw-m,,:MWm,gg15-w3mg -- - ,Wm W M2255 'ww asv-'-fkzmffyizgmlsf,-Y'vis' :,,gwmm QQ 25 if - gsgwz, 23: r 555512: : 4 352121355 1, M fydsgwffg ILESSQM ,Haggis 3 W:2:fM.,fgfM. ,-g1W5wm,,,gWg.-wsgmmgggm gggmwzgg, Nm-M NWS, Q-4,,,-,,,.vg,.b,gv fmmsuew-swag 'wma sm2fw?Q..,,'u'-Nw.-,,,1 ww .-,:...-6: fm .7 MEN sms M 24 9 sg,-M ,Q M. ww, M E93 Smiffymw ss .- 5555 -- afswgfwfgigawsi -Q 2?f?5 .:'S f s ,:'::E2- gggfsfzz 5 55235232 555 bwjgzg-f fry Sigh Q' wsggggg M5335 M -9Sfg:g1gv??ff?5fyg3'ZEZ:gZy..l'HgZg?5:Meg,1 f3govv1 2':'fmN9LaW0?-335:MM-?g:Aw2'i.Z' -2MSs5.:ww.2',?5 -- w 'ww.sA3S.i'Z,2mW:S5k?m 'K z gigs:szsgiggsgfi3isQQ-giiqgfgfssgigssssgffzmgfix -saigfgggrssgw 9551 gwwsfgw MQW: ' M5 swf f'5S2gi:9'M,?6 g few ,Ib sm QS' ex gil? ggfggf 5533f?5S::S:5:555Q2::g321M555 Wgissxieifrsff ,iii gy ssafsf-viesw-U W::mM,.f:wf2:Hggxff fxffiiii? 'im ww giggfgy wr-F351 f -3 lf- ,,,5 53523233355952-55552-rs:sszfiiggzzzfswggigs- ,gw,UW,, . nga., Q. ,f4,,.Q.:.:gggmJ,Vszzsfqusgygg-N3g,z,5gg7MDm,f,g-A-w...,zq, mf. 553025: 3-fggqwgg -f klzzmggwsszw 'wggiesfsiegsnsrsswfb w3i'52'5wi.,i72i1gi' ff-522525:w??sgg5:::w2f:2?'WW- SQ'----sgfgwsys 31,1 bzmiwsssbwsiws, . .Q ,iifsfgw fwiiizig-wsifgm 0 wiggsgggfh :QQ R2 W 3 K: -gg: 2 -f Y ffQ??f:5f?2FS2-sf-312555 m Msssggwzzsss -255-Yflfmgirsigf - - -Liiififi fffffsfglf MM Y ssgggsaziifzzszi :Mi f , ::ggQfgf:rg4z-ff23?S::1 -, 25:-gqg::ss:5:5Q5S-5253: :gg:gf.1,4.x,:,2s:3 my .mg sg gg fs m:f.:5saff:5 ws?-nw M sm w -sggm ,sw X -qqgzkfesqgfbipxfsffs' 1- .w2i5'-fm-22:2--if ksisswu M sssmnzssssg vggmy mm, W2 ffVM,,m4? ,J my T W MMM , fisigfirfsii iggss: .wssgff W ,smflfsi vigffififff' 3753-25575, -MSF: f-32?-mid. ---Rffzqr fwilzvf-fisiinwv M..,:mPi:f+W,liQ'-wi! ,tw W bpm, NwWwgh.W,,q,e,W,.4,,:m,,w.,,z.. ggsmmggw wmfzssw -wqsswmsaigss-ws wsamgss W, Ws?5H,g6?aw,2s:-Mws-5 --ffm -f '::?gAf ixsgsssgwxss- -wwkwsvfm :ess -'f Wm-sgwksgsgggw ?-2 W 'aww S '- wave,'iamswiwwsfiiww-w3w'5 1 -' sw, 4 mi' waigg wang 55ga2ggg55:g:s:5?f,-353 E fzsggapgz-sg-zgwgwwWgfgggm sg: s23a?::.g5gw,3?gw5g , Q ,ww-17 Q,-fwifw-ff, wif: Q :eww 362555, 0,9-ig-QM,W::-,,wg:,:2Q igtjifwffi-15i25sgff3fw54:5 is- -www z 5555525553251 Ziigffif wfggllzsg - - - -W '-wffgggg553iiEg'5:5i?5Af2'?E35fS 1 ,sffsgifp-,s:e:,, ' kgmzqfgsv wa:.f5,,f. i.,y,,wgf-1 iq, A-fs- A 5 1,3 gre Y. :B 551555 -7 W, rszlsbyweiewsfs asses :-:THEM-:mem sig ,fgmgg '-275525553 :Q-:5?5:::ys:s5::5fgg S15 2315432552 :gg mzssgzg ,mas s:gWf:g,f-m':zfif:- esmeiflfrsvifs- Kew- v0maA.sfQfwfS5?a5 Wifi H 55555: ew-Sim? '- Q, fe Wsgwmf-rzemx SEEN 'wfoggmm 4 :wW,g:w,e aw figfivfs- - ff fit'-xiii 65555553 ,::::s55m:::z:sgQrs?gf-sap wifzsiifzfsf lwgggm ?85rD.M H Wi'Pfgwqik.llfweefi:wx--5-5kQfg5yl5.'.fgg1:5. :U-kezvwai 553211 :swf Q D W 4, - 4:55 ziZZ,:.t,L?::gMzVf ,Aim W , , wx L..gU4'f4..fffu-,.3,'1'H':'Zf4Z'wU,-igjmr .LQfw?4Q I-Mw'.f!'Z'U'wfH'l-H misgm JW- , 6 my UM . , me . W.. , M. 1 Ug.,,5gp5ww,,4gz--W.-f.yge-wwvu-W ,Jw ggmftfa s,..w5:'J- 'ggf52??'iH'A ,,,,gym.5.,,:gg,-,Y fmigfw M- QYZYQZW - -sfsggfsm f :asm Q sf: : A M5254 I Mssw :ssff-fi, -' U N, Q ,,1m,., -gm, i:f:5ffj:wfS'im55 Jssrygzgm Am EQgj21:'i:??5?,' -Sf me 'N 'iiifif 5: frgmssg , . my-WQiszizgfsagsszsgwiias zwzzgwmssg ww 02 -M5222 W fn ,Q , rrsfgazff L. ,121-zm :R --zz gy: U gfifzffif 4a:,,:::ggfmgf.:,, ,M.,w,,,3z fs, ,, MM 523555552552 if ifgkfgazjgfyf 2Pf?f2s2-53:52 -.Mm ,MsW.,.,vg,fag5,-59552 , Qisggsfqsf:f:sg?2:-33315:-Q iwi-733 ggwsefgy W ,fwzm W5,,5.b:,,,, srrgffggla,-:sw-fire-.-22:51 6 Y fff5S2f2':555Q5:1f55ff4': Sw? jf' '-Ssssff , 'W ' giligqghfggsisii ,h.3W,f.,:5:g3,WM,:, mgzm, mwg WsvgfgwWfrsgsmv,5,fwEP:-1-Q3z:gw::w f?,:g-M'-xviifw 5, 5 zwwfwwlzg yas: 5 frslsfggj-112 - w HQQWQDJQ ,qszsfizifssms-'iris ff' .. gn .U Q. MW,k.X.,.f:: W . ffsufgegfa, :-5555: 'zgfbfiszssz ,fy -MZaf.2'fg,ffff2w,5:vz::7 1- -aff! 655555 ' ,235 f-m.,,p-- U ,gf M ,iizzlff efiitffi ,,,m,,M U WMM ffm Q. 2: :masse f 4:3214 2: 2:3 P, ,gg , . .W Wu: .ggph Ls, ,,4gQiJf5?,i:-sqfw 5 :Q-2655? fiisfgggfffffgszzsfifw F5915 ff2s:-Eifrifffsiiiziii ,,5,3am,,, .D Z7 , , L, 4 U 4 J sgggagflsg .5--V I W 'Jig' -'tw 551, H523--1,'Yfpg9:6:.2g:fmf3gvf4.':?g0w5,5g 4, , , W ,svQirsfgsfsM4552-ff:::fvfffZ,iSSi::ffffsziifffiigifsifsfs ,, ZJM- .wggw U ,Mm ,Agfa ,,A,g4fy,,,,.,5- 1fW,,g-wfm,,,,,g0fm- 6 ggzggwa., MPN Ugwzyigy'wfxfif-fQ:,:Uf2wf2'wf.g:v?42-WM.wiiiwwf -mzggmf':::m,,4,,M,,q5g,MmgfggggghimgggwfmgggggW,5:ffmQ::Yg::::ii!a:::f:::f12::5 Am , . w2fg5ff,f5i2gg5.4Q mfg:-ff:'ff'ffe5?f4' e:QQif:iff'::fz-325255 , 5w,,.,iy.0m.,ym, ,sl ,qw ,M Hv,::,,.m,,f,Wm,sm9W,,4 fA-mf., 1551,-Y , W ., ,,f.,,,M,,-4 .ggi-f fwawf 'bmw Wg, 1 ,MV W, -y f-9f.,,a ,mm ,Away Mfrs, Pho M . my Www,-5, ww. awww, .wwf-Jw 5 H.4Y,,h' f G , f. van, nf. ' I 0, an qflwxw :wwwWw924,:-vm-,,Y:zQKmfgm, -fhws'gfMf.n::ff ., N .J f W W , ' 'pw ,, K -Ma W: nf' ,, MM V,.:fm,,.,,U 13255522 fifggmgffh- Lisw ,,v244f,, f mr' Q , -Ayn, af-fm -ff'fr?g4f2z,w22sfg-sw 1'v!W4s!if wi V' - SVP- 'NY 'h' 'WH' 7-751' vggfih' 'aff' 'ff 'fMfH mff,f! ,, W'wH ,lweut -'wif 'W'3?'P:f- . 'Qui ' f flfff., 'wfffw '-QSM-'5A 4S'Z3Ufg.eW'f3 ':3.f5Zg:,, U Him Lf fwaf -zifyzxzswwfzizagffIf45ifffg,. fggwiiiijf Afafyfyfgi, A:-:,::::gM:::-4-65225-A QW, zfiiwgzsgzf-4:52514mfmw,wgfgfzgfIv HW Wm- f ?:2?!'Z M f73Zf'fT27i?f?g7ff'75 -Wffffff'Wff'W-Effzfiiifg V f x 1 f f' , ' ww b,W,q.Mw ygwv,9uQ.5fnQp4143105, Aigmff, , Mx, ,nagging -,gif wif nj' ,wffff , ,'4'h,,if MN fa M- fgwwjlfmi , U y , r M ffm, 52414LZ'j 6:fwW,'jf,2.uW,Q-QQ-W' gyfgmjjzw ' ' we gb, mf, wa X '51, 5,Z56m,g,,j 4755 fJ,..,,,Kwe.5:j: ,Mmij 'guff' 'hgjwff jp 7 'wg-Jfzfm ww. V, Vw Qyqwnf, A,azwigw?H,'fy,?-femM4z:f'fd,4,z::Misa,-fW,:g-f2-mx: -emim-Wmiffzvg, f vim, r M qw- ,, 5, . , . :mmf nv- , gmfnf,,,3:gy4.W,,Qwfw,,.hFvffzmfw-,WP10fm.g'ww,,,hff MW Y, wh ffffmgh , WM 4 mf, ,, ,71 my , , ,nm , f,'D,47--7, .fgiggwuwff,,,f,,AggM1.nmgnfwww- WM, -4-mm 'W ' f 'fwm -fm my - V, wp -Hggf' f gm, 6.'4fff,,. -ff W . . W 3 wwzwff 4f,3f,Q?7?:f:Z.w,,,ffW1252562-w V h:Z,'5fgZg,,,w.f,f 'jflfj' 'mf' ' , w::f,N, isZ5z, X ,lffy-f. ,fgyzfw ,ig Jimi-'yyw2w,fL'W4:,gw-5245litmsf 1-wwpwzggrmiifigwiifgfwwi?2f,- 'Hsu f ww, hm., fff-3' Q M ei, ,-MZEWWJZQZWffngffw-W Mfwfr-M.Jw?.2'sf:'Z' ,Nm:,f?, 4:35-wid fvw-fwzvagiiqifizwfffvLin- ? --w-.NW Q55 ,, U. , f-W A, ffm, 4m,,fh.m,,f ,X .Q f W,,,Q,,.mm,.wfwV , My ww - f wym V azvwgfw Wggqfm 'zfwsfgx-Wgmf.,mifzfz-f figs-hf:,g-M, few C, , '- Jew, ,, may NW J ,gwmg fmmm. , wm,:gfq5,e,,,-wsvk ggqmg,w:Qww.m,,,-- 1 - fgmajy ,, A ,W . MZ, q,,,Hff Agmw. ffm., ,,Z:5zf-V r zemffs' miwfmp aw ' ' wif: 411222-M, .wif-fg: f' wwwww fwsaiif''W4423-Mvmg,q4yQhMig?vf,5,-mgvzfew,vT?0zm471 QM, -wmv :ww mm- my ,ima eiww -IWSZZM wwf -miffw-ififfvf h 2.--5 wwf. 4-,ff4:g,vfNWgwgsg: fw,gmiJ:n5we4Mw ,5,ggw,,,,gggf3m.w3,.f:ggy4,,,,f,5,fw,,hfvgwggy.-5QZZZmt,Uggggm W 9 . H wg-I J 'Wap vig-DJ ,.gg-pp: nf-,agp ,whip ,mmzz Z,3,'.Lgg2q,gjf2fMW-m:,,',,'-v MZ:3w..,L:m,wgg,f,2g'Wim M25-..,girigmsgr-,,'w1.7J5ff,a-20,3144.5Ww,Q,fgeqsUgv,gg,Sggwggg fixfiwvwififw Uwfwwif-'ff-mfilzrfszif-moi?'W myf'-mfyiwfz. .V , f , ,unify wfzgwwyQ:4fw:q5..,w:,g :-wi? .4221--M,:-w5w.s7:A-fy 5342?M-ff2wm::g5g,f44,gMmswzm:gig-'m0f:g,,ggw5Qg,:fgew-ggfwfiefsfwQzdgwgym'g-'5Q42?,wggm-MQW! - W 'fzwfmM5555S'5f5???55Z'-QgiififfZigi Swifiiv-Wgiixifiggwggmgggfgflff' wmv 0?W553f53ibf55? 'HW' f k -f-ffqfikfg555539ffzwSiigfvgii?QZ5'2?f2AffQf?5f:Q292252A5ffree:-15-fm5522525544Z:2:,f2f:5wfff::sefm222:,' Q-Qswim:ze2,-ffmzmsffm,-zf,z?1fshw4fff,w.VA,dd 22:51,5255621553552,mefiizzffvfsmisaizsmgsmzgaggzewsfsssafiyfiwsszymmkx, ,f:2fMm,ffm,, M A -- E is 2 Q ,s Vx v x . S ii gs ai 22 2 Q, 1 ga fa E it is EE 5 15 ? 4 E si 1 4 E s 1 K 2 QI 2? ia be ii 321 EE E fi 5 E i ,S 15 ,Z 32 ggi 22 Ei gi QE SE si 53 5 ii Q? sg 3? 5 W ,ai EZ i Q iff: Q is , 3 an 55 EVENTS--- Abroad And At I-I 509311 -gg 1 gpcaeffervx' 'wwjecw-1 V090 we I ' i' 5 O 5CbxfYNC-2 L05 5 CCLVN U VD TYNSV V W, ,ff qw. ,, in in ,.?Zf 4Y', V, s if QQ n EW ff ' ' EF, ,, , im fy ff V '- f sa . f g 622 ,w M9514 Y f S Y V 1 165, ff' 'j 'V K, V M WV. 1 fm . ,gi 4 , , - Q . 2 f gag' ' fg '?ififfLz 1 - , 4 M ' ,f inf: W ff Q x ,1 f,f' , 33, nhl - ffm. f fge f ' 4. QM .1 , 2,3 2 .V kk 5 Vg Vila 2, 51 , is 'Alf ' I ' MQW A lf - ', Q '1 f , . S es' . M?V ':, . Ag , . ,,,w+11g3,, gg ,ff A MQ, ,, 'mf'-1 5 .fg igif?,i'5.. , 1 I K f W MM 5 . Vff n ilf a wl....M,X - 52 Q 51 i . V, 'M 1 ' ' 1 1 I, L V, 5 A .,a, ,, f' f' V2 if 'J' - A ww 1 4 L I , f- Q ' 3 2 i ff , ff ' wm kw . T14 7 in M-, RV L? Wg 3 VV M X V. , an E., 9 Y Q ,NX ,fix Nm., . ,A,,,p.-ff' N W x ' Nuff :fx if 5 A -1 ' f 4 - ' W2 ,!f?f. I ' J iw' 5' , X . , 3 V 'Cf' . I :V ,ji My 17 , . fix mf WM, V 'x,g:iw ' , MQW' ., ' , jf ,Nw .f ,, ' .M , mf ff X , all ' f 7 MY, ?f ' V M, M0445 . ,7 eg '5 3 v , A '?' 5 N. Mr S.. nw X NXSQ X .wk X mm wg ,W KMX-X.XX..XX,q XM XQXR 3' Wx X., - , X ' 2 X X N 'S x X X X X X X' X X XX Q, X W Y ,X X X N X X is 'f 5 kk EX XR 'k-..k , - ' X . K X X S' , .S . X an :wwf M JW? Www? .M n f 5315! 27 ,X M. , 'i-, 5 A 43 X ' f f' J ,. ,... 5 , , F fa ,.. ., V' S .ww he Heidi Adams plunges along in the race. A Mountain Fair Homecoming: the return of a group of people especially on a special occasion to a place former- ly frequented or regarded as home, according to Webster's New Collegiate Dictionary. People that have graduated in the past come back and visit every once in a while. Since G.M.H.S. is ony ten years old, Homecoming is a time for the students who still regard it as their home , Some day all those who have graduated from G.M.H.S. can come back and visit the Home of the Rams. One of the Homecoming traditions everywhere is the football game. To raise student morale, a pep assembly was organized. Crazy things such as plunger propelled skateboards and class competi- tion was a part of it. The faculty band played a few tunes. It was also notable for the unusual political campaign speeches. The homecoming game was played against Columbine, but our score was a little lower than theirs when the final buzzer went off. Through the years, there has been a girls pow- der puff football game where the Juniors compete against the Seniors. They don't train as long as for a regular football season but they work hard to get ready for the game. The whole student body gets out of class to go down to the field, sit in the grass along the sides, and watch the flags fly! The Senior girls won the game with two touchdowns to one. Tami Davis, Junior said, I liked coming close to beating the Seniors. The Sideline students weren't the only encour- agers of the players. The male cheerleaders were there also. Some had balloons in their shirts, while others didn't wear shirts, and all of them had hairy legs! Some new Senior cheerleaders, Anthony Flores, Tim Walmer, Greg Meyers, Burt Nelson, and Rob Spykstra, help root their team to victory, The Homecoming game vs. Columbine. Homecoming - 189 .gif Marching band members get in formation for the parade. t Q jg A? Q was Q , L P , .sky . . T i y ff, 'Q En' , -. J' W' yami - it af X 1 75114, ,M fi 1 V The Juninr's merry-go 'Wi?, ,f V , round , WW am, ft fe X, -'it' 'W' m V .4 I 5, 1 190 - Homecoming The Homecoming royalty greets the crowd. s x Q 'l 'nl' , tw 1,1 f - WSH: ,gg ,,,Wwt ,, Am W K Alumni, Greg VanDyke, Val Hepp, Cindy Johnson, and Bret Hardesty, return for the special event. Prancing fancy in the Homecoming parade. A good view of the Freshman float. ' A Week For Remembering Homecoming week at GMHS was filled with many activities. This year, there were only two spirit days. The Seniors planned their own 'Senior Weird Day' in which some punked out, others wore pajamas, as well as anything else they felt like wearing. Senate planned a university T-shirt day. In the middle of the week, a float display was held at Green Mountain Plaza, under the buzzing neon lights. Refreshments were sold by various organizations and floats, decorated trucks and cars were also present. The Sophomores received first place in the float competition. The Juniors were second, Seniors third, and Freshmen fourth. The next day was the parade. It chained its way from Dunstan Jr. High all the way up to Green Mountain High. Students From Dunstan, Devinny Elementary, and GMHS were all let out of school around twelve to watch the moving links. Waving at people, looking for a car you know, and scram- bling for candy are details that make the parade personal and exciting. There was a unique truck this year not by a club, but a private organization. It was a Solidarity float accompanied by a public relations person handing out flyers 'advocating the violent overthrow' of Senate and the power be- hind it. The individuals participating wore masks over their faces and a dummy hung from a gal- lows. The Homecoming dance was the rounding off event. Everyone had been talking about who was going to ask who to the dance since the second week of school. The attendants were presented at Thursday's pep assembly. The Freshmen were Lucia Toman and Tracy Ellis, the Sophomore cou- ple was Karen Parsons and Tim Wright, the Ju- niors were Julie Chavez and Vance Stillman, and the Seniors were Sarah Cappelluchi and Steve Rons, Sheri Johnson and Joe VanDyke, Sabrina Forrest and V.J. Greco, and Annette Vitry and Chuck Reid. The king and queen were announced at the football game that evening. All anxious anticipation ended when Annette Vitry and Chuck Reid rang out through the stadium. Reid said, The queen gets a cape and crown but the king doesn't get anything. I cried about itf' Senate organized the dress-up event. People listened and danced to the Western music of Horse Thief Can- yon. As 11:00 rolled around, the week's activities ended along with the 1982 Mountain Fairf' Homecoming - 191 Christine Smaldone asks if she can breathe while playing dead. John Byers listens for the Broadway director downstairs. 192 - Fall Play Mm ' h 'Dwi ' Eric Fry and Holly Ropes peer over the couch. Gary Anderson ponders Juli Gammon's ignorance. John Byers pleads with Linda Akey. Gut Cf The Frying Pan Out of the Frying Pan was writen by Francis Swaiin in the 1940's. Little did Swaiin know that his production would hit the GMHS stage in 1982. Auditions were held early in the second week of school and by the end of that same week rehersals were under way. The actors and actresses rehearsed every after- noon except Fridays, through the first week in November, until that long awaited but nerve-rack- eting opening night. For the first time, the T.V. class taped the show for Ramsview on opening night. While everyone was being seated, Pattie Sutton, assistant director, led exercises backstage to re- lieve tensions. At exactly 7:30 the curtain opened and the play was under way. lt proceeded with only a few mishaps, like when Eric Fry Cseniorl, alias George, fell over backwards in the chair. Gary Anderson, alias Tony, saved the day with, George! Will you sit in the chair right, for Pete's sake! The play continued and everyone entered on cue, even the landlady. Curtain call finally ar- rived and the first night was over. Both Friday and Saturday nights went smoothly, as the audience carried the enthusiasm and laughed until they were blue in the face. Saturday night at curtain call, Chuck Reid, sen- ior, gave every cast member a yellow rose in representation of Senate, and Andy Alexander, senior, handed out red roses. Then the cast, still clad in their pajamas, presented Simmons with a director's chair labeled with one of his favorite sayings. They also gave Sutton a sweatshirt with Out of the Frying Pan on the front. The play itself was about six young actors sharing a New York Apartment upstairs from a famous director and the mishaps they encounter trying to get him to see their play. The kids includ- ed George iEric Fry, seniorl who was the fun- loving and jolly young man, Kate lDana Kerwin, seniorl who was the cynic of the crowd, Tony iGary Anderson, juniorl who was married to Marge but finding it difficult to pretend he wasn't, Marge fHolly Ropes, seniorl who was Tony's wife in secret and the optimist in the crowd, Norman iJohn Byers, seniorl who was sensible and the cornerstone of the group, and Dottie iJuli Gam- mon, seniorl who was the dumb blonde and in love with Norman. Other cast members included Muriel Foster fChristine Smaaldone, seniorl Dottie's snoopy friend, Mr. Coburn iSteen Gilbertson, sen- iorl Dottie's father, Mrs. Garnet iCamy Michel, juniorl the ding-a-lingi' landlady, Mr. Kenny iDon McPhee, juniorl the gay director, and the first and second cops iLinda Akey, sophomore, and Bruce Cooper, junior.l Bud Simmons directed and Pattie Sutton, senior, assisted. Fall may - 193 Snow Likely Tonight and Christmas Ev Forecasters Say Saturday Holiday Will Be Sunny and Cold in Much of State l Storm Dumps 24 Inches of Snow Removal Expected To Take Days, Sl Million Jack Swigert, Ex-Astronaut, Dies at Age 51 ISRAEUS U.S. ENVOY IS NAMED BY BEGIN T0 SUGGEED SHARON Photo Shows Man Watching Woman Buy Tainted Tylenol 194 - C rrent Event now on Cit nd of Riot ades in 131111 Coiorado lottery Sugar Ra calls it quits John Paul Is Hailed In Spain In the beginning God created the heavens and earth. Soon after this, we were born and now we are in high school. This yearbook was created to commemorate our 1982-83 school year, and now that the majority of the academics is behind us, we should take a moment to look back at what has gone on before us. Close to home, we can remember the record breaking 'Blizzard of l982.' The snow pushed Christmas break off to a great start while strengthening ev- eryone's snow shoveling techniques. The Lottery added another dimen- sion to Colorado living. Everybody seemed to be raking in the money. At least one GMHS student cashed in a 310,000 prize. The U.S. Today news- paper also hit Denver, giving the city its first and only national newspaper. It also gave us a great many new and unusual shaped paper stands. Speaking of national news, the Ty- lenol scare shook all of America for weeks. Almost immediately after this, poisons were being found in every type of food imaginable. Current Events - 195 The Viet Nam war memorial also caused a great deal of unrest. Some felt it was inappro- priate because it was unlike other war memori- als. Anti-war efforts were also evident this year as nuclear freeze rallies were held in many places across the country including Denver. At one point, a radical in the movement threat- ened to blow up the Washington monument unless the United States pushed disarmament from nuclear weapons. He was promptly shot and killed by the government while leaving the scene of his crime. The Environmental Protection Agency had problems of its own this year. The agency was accused of fraud and misappropriations. President Reagan ran into his troubles as well. His new budget met with overwhelming criticism mainly due to the deep cuts in social spending. The money taken from social pro- grams was given to the defense programs as he promised in his election campaign. Unemploy- ment soared to levels that may hurt his re- election possibilities. On the international level, we saw the British bring an end to the Falkland Islands conflict. QQ Vietnam: the T Memorial Recall 1 e 33, sssiiiisisb 5 igggiifigiii --- bbii it 553 Reagan Weigh 96 - Current Events 1 i fees Burford to Resign Ne Cantt Put Away I a KQOHY of Long Warl Plans to Create Jobs Stir Congress g N-Freeze Votes Called Mandatel Moves for Speedup l On New Nuclear Plants Urges Falklands tTalks I Resoluuon Gets U.S. Support Over Opposxtxon of Bntxsh g Retrrement Delay Suggested A To Cut Sooral Securrty Costs S Nuclearl-Treeze Proposals Passrng 1n Most Contests Tax Hike for Jobs Current E t 1 Poland finally lifted itself from martial law. In Pal- estine hundreds of civilians were slaughtered by Le- banese forces. America also continued to send mili- tary aid to El Salvador despite increasing demands that the aid be stopped. As the world tried to tear itself apart, the Cosmo- polital Hotel in downtown announced its closing and subsequent destruction. We did however see the completion of the 16th Street Mall as well as the opening of Southwest Plaza, the largest mall from Los Angeles to Chicago. Along Union, buildings were hurled upg with the opening of the Sheraton Hotel being the most noteworthy. All over the country technology was reaching new heights. The space shuttle was launched several times proving space travel may one day be feasible. The computer explosion helped the shuttle as well as thousands of businesses across the world. Time maga- zine went so far as to give computers an award. People from coast to coast jogged, danced, stud- ied, and warped out to Walkman type headphones playing their favorite tunes. Surgeons whistled their own tune when Barney Clarke received the first artifi- cial heart successfully. Unique atmospheres blend at 16th Street Mall ' SouthWest Plaza to provide jobs for Jeffers l GM prepares to under 198 - Current Events 'Man of the Year' Computer Bests Thatcher, Begin, E.T. Hsraeli Panel Told of Massacre Pearl Democracy in El Salvador GDead' 2 Groups Cite Arrest or Kidnapping of 15 Opposition Leaders , lPolish Martial Law May Be Lifted lPoland Will Free Walesa li 1 County, I Cosmopolitan rings out final years' l 1 v - Q Columbia Gets Down y To Business Astronauts Deploy y Satellite for Firm l l North Central evaluation Current Events , 199 Brezhnev s Dead No Announcement on Successor New Soviet Chiej INFL 'mei Smssoti Goslis ON I t NFL's Strike Progress Seems to Be Waning J hnk De Lorean Bail Cu I Attorneys Say N.Y. Apartment, Cre a S 1 MeNiehols Still i Mayoral Candidates Lining Up j 1 1 ndropo V During the last year many unforgettable names passed on to another life. John Belushi, Ingrid Bergman, Leonid Brezhnev, Karen Carpenter, John Cheever, Henry Fonda, Leon Jaworski, Grace Kelly, Leroy Paige, and Lee Strasberg name only a few. Gther big names found their way into the courts. John De Lorean found himself against cocaine charges in the midst of his failing car empire. John Hinkley made his way into a mental institution where he attempted suicide numerous times. The Jahnke family's murder trial in Wyoming became a field day for local press speculation. As usual, the local nativity scene controversy was re- vived this year. Football found itself in unusual controversy this year. Although few people remember the Superbowl's Win- ner, most people recall the strike preceding it. The United States Football League was also formed this winter, birthing the Denver Gold. l From Hollywood came An Officer and a Gentleman that proved chival- ry is not dead. For laughs, Tootsie was born and Airplane was reborn. ' ' Er-T f'1brr k E. Ticaid gfilaidilrahuscf birlabgievdzassthe -1 . best and most memorable films of To Stress Conventional Arms the laff A150 ffm Hollywood, this will be remembered as the year M A'S'H ended. L if .gi 6 e r go S5 Million Line on Business at Stake Van to Beat i a Livelfy '83 Campaign l Varsity soccer takes the League Textbook Went? exjpiilcooflces l World's F air Ends on Festive Note I Winterfest highlights season frBow!ingrtaEes S'iii'ii8, Bins, 828 Yards Give Him Jeffco Rushing Lead Harriers domi GMI-IS Poms exhibit new This year found th W rld Fair in Tennessee, as well as Way for new groups, while The Who made their farewell th d f D b y but the beginning of Bloom tour C ty dHf1A i f A dd f Tho C fP sid lltdf btthdkgg g p lyt b g lttl lt t E y td thb db th f ldb Cld hlth t ftdthNW dAg thqllgtth tb Th sf yC f M 202 - Current Events tWkTh Cl hp dth th t t fy ggl h ldb blt Championship i ' ew olidarit ' float creates Homecoming controvers C . .- . 2 ' Who's La t Tour Hitting bstacles Show Goes On Despite Family Death, Flu talent in music receive birth control without parental consent. The courts tried and convicted draft registration dodgers, yet the law was found unconstitutional by a California judge. A war developed over textbooks in Jefferson County but it did not seem to spoil the easy-going atmosphere at GMHS. Trees, benches, and improved drainage benefitted is the school grounds greatly. The Cross-Country team, as usual, did fantastic things under the coaching of Dennis Shepherd. The boy's soccer team also completed a very profitable season. Few can forget the Pom Pons and their musical involvement with Steve Kelly. Current Events - anki g on G Sl1owBiz enforces tighter securit A eagan Says 'Big Spenders' Ended School Pra IFLO Says Israel Must Leave Beirut First Soviet Ships Came Close, Navy Say. ckley, lser ous' after Cost, Risk of Nuclear War Too Great, They Say Senate can be commended for putting together several successful activities such as the Beach Party, Winterfest, and the Air Bands Contest. Winterfest Royalty includes Fresh- men - Rick Grant and Laura lnzano, Sophomores - Duane Sutliff and Katie Gleason, Juniors - Doug Lawler and Su- zanne Clark, Seniors - Julie Campbell, Julie Hall, Amy Aren- kiel, Ann Morisette, Gary Henderson, Ralph Suarez, Jeff Mages and Rob Spykstra. King and Queen for the festivities were Gary Henderson and Julie Campbell. The Seniors cre- ated their own fun with the Senior slumber party as a prank one morning, and nearly perfect non-attendance on Senior ditch day. Now, as summer draws near, we can vaguely recall the 204 - Current Events Valley Girls, Frank Zappa introduced to us last summer, and one must wonder if the punk and preppy fads will return next year. Reagan's proposed subminimum wage may pose money problems for teens this summer but it will probably not keep students from playing the ever present video games. Next year everybody will still hang out at Showbiz or McDonalds, and the Seniors will still run to the Gold Rush or Thirsty's. The rich kids will still have their hotrods with loud noisy engines, fat tires, and pretty paint jobs. The cheerleaders will still be beautiful, the teachers will still have unique personal- ities, and God will look down and say it is very good. od Organization l a l .- Us n AID: Huge hike in El Sa Iva do r Undies weed MrArsrl-I: Fans color themselves khaki for finale o How to get regular again 1- I' r I l Checkers' Smaltlone on his way to prison nt Events Kristin Coburn adjusts a copy sheet in the typewriter. Debbie Margrave types out one of her articles. Rambling Cn . . . It all started the morning of August 10, 1982. Four GMI-IS students were heading to Yearbook Camp in Ft. Collins, in a green Volkswagon. They stayed in the C.S.U. dorms with students from all over Colorado and nearby states. They could specialize in writing or photography. Bruce Watterson for North Carolina was the key speaker. Kim Dry- janski said, He gave us ideas of what we could do for covers and more creative pictures. The camp gave information on trends and recent developments. The students went back to their schools full of ideas and ready to get to work! But.. . . the new techniques they learned were sometimes like tying a cherry stem into a knot in your mouth. They tried new things with lines, shading, and featuring people. New members that contributed to getting the book done were Kristin Coburn, Debbie Margrave, Gabriele Mehnert, Mitch Smith, and Nancy Gonring. Margrave said, I joined to get more writing experience. Being on the staff helps the students become more familiar with their school and its activities as well as putting a yearbook together. Coburn commented, 'gI've learned a lot about photography, such as knowing how to print and develop, and the chemicals involved. I've also learned a certain style of writing. The yearbook itself, from its Table of Contents to Autograph page, took from the fall until early spring to complete and send away to the Josten's plant in Topeka, Kansas. Then the spring supplement was worked on. Dale Bartkus guided the students but let them make their own decisions. He said, A yearbook sponsor is somebody who cares about the school and likes editorsfl 206 - Yearbook l l i l Nancy Gonring selects pictures for Kim Dryjanski and Terri X Carter to print. The 1982-83 Ramblings staff. Dear Fellow Students, Finally, the yearbook's done. It's all done. I can't believe it. But it is. No more bugging the custodians every Saturday morning to let me in the darkroom. No more nagging at the staff either. I bet they're glad, too. When I take this final page to the Post Office to mail it to the plant, there's nothing left to do until we unveil it at distribution. flixcept the supplement, of course.l And then we just wait for the reaction from you, the students. As editor, I hope you like the book, a lot of nervous breakdowns in the staff have occurred because of it! Anyhow, I really think this is one of the best yearbooks at GMHS. Wefve tried several new ideas this year that we thought would improve the book. First of all, if you'll please turn to the color section, you'll notice a pattern of lines running through the whole section. This was also repeated in the Academic section and on the division pages. Also on the division pages we incorporated student art. Chris Harris put in several hours drawing that Ram, which is the same as the one on the Senior wall, and the same one that will be on the graduation programs this year. On all the class pages is either a story dealing with something affecting GMI-IS students, or candids of the students. In the sports section, we featured one outstanding senior athlete from each sport. We realize that there were many fantastic athletes this year, both seniors and underclassmen, and we would like to commend you too for your hard work. Due to popular demand, we kept both the Student Life and Current Events sections from last year, combined them under Events- Abroad and at Home, and enlarged the section. Hopefully, we at least touched on all the major happenings of this school year. Ilf we didn't, and you think something else needs to be included, use it as something to sign in other yearbooks.l Anyhow, I would like to thank a lot of people who contributed in making this book, Chuck Reid, Ralph Suarez, Pattie Sutton, Chris I-Iarris, Carol Vanous, Sonja Roemish, Steve Chase, Mike Lane, Whitney Seymour, Gary Jugert, Scott Roberts, and Jared Saunderson are just a few. Then, of course there is the staff, which dedicated themselves to the book. This is GMI-IS' tenth anniversary of being open, so the flashy gold cover is appropriate in celebrating. We would like to dedicate this book to the teachers who have been with the school since its birth, those faculty or students who have passed away during the past year, and finally, to you, the students. I would personally like to dedicate this book to the graduating class of 1983. Seniors, this one's for you. ISee you at the ten year reunionll Juli Gammon 1983 Ramblings editor The 1982-83 Ramblings staff included Tammy Borgman, Terri Carter, Kristin Coburn, Kim Dryjanski, Teresa Fortik, Juli Gammon, Nancy Gonring, Rod Griffin, Debbie Mar- grave, Gabriele Mehnert, Kim Scroggins and Mitch Smith Letter From The Editor 207 At h W Ubogmp S Www qou an ,wth Usurcul- Q Q-0-L9 wwhLu9iguJQgQ C5CQJt:Lurc.tDUf.Q,Lo'0.U1 ' HMA qmfWMgUCmwi, b jLOUl 7-.Orw 333 ? 4,53 :B QQKS 3 i Qjfp 7 1 C EMC J 53 5241? ww LA QJN-LCL,Q QQ.,-ki.L,Q aa plgnnx, Vu.o,p LIN wwqnouuvq Q,0d.lrvv..o, YL f0l'i33q3o?.X JUJCLXQ WR? QL-PQ Aahvuxq 3 F ij Jig? xii ,ymg El 2335 gifs N iw? QQX2 : igfv Q 55 2 w'i,fwQ F V515 Q M7 I V' A1 I , , YMEWWVMQ u L'l,!4 i -V if fy . , E.N I ,J K ff B . Q gf f . L u f if ,- .xx g 2: VV fait 4 ' f . xywfib 1 TTV Xxx . , 1 it ? i, f Lf XM ffm, ll 2 W N iv? ,WWW . N ' ' 5 ' M Qu ML, ' 5 QV A EX X, I , V '14 7 G 1 1-x ' ILL 1 'Jr W W, f . 'Vl Pzg 'Q .. .7 Q +3 ' 35 ' B I N N Z - 3 ES 3 NJ JQL ' K 'ILT' Q v Q f F5 7 Q Q-1 . -- A X L, F . .J 4-2 X5 xvjg Z- xx Da5QT+iHfNw ,??XQ,, QLx15 -- 'U cw CC' A ' , Y N thiglk E 'fs Q N., 91 QL- f' 'IL 4 L 'Of 65,3 gl C. EQ: x35 ACA- 'A - X -5 O F . ' f XJ If -5 ix?-bfflwfx U' ,.. 'S' NC, N 3 igbiff iffigiwf QSM N3 'Q - L, f- ' Q'iQ JSHMQS? -l 208 - Autographs E , faujyatf Q V NOX ,ziw ,qfxmwvww lJJ2fU3u4,9 aww ,awk UBDMQGMWM me Eiiuwnfvw GX YQQ SOVMWM ww W M W ww we my My 5' Ubouk 0, fwwq Quin mam- 2 Woes awww 'lb CGM SU-H!Y1rvu'fi9 UA Z QD f,J4Z2ff0?1Qf?jgg 4490! wi swweax MJ QM 2262556 ffmv Peolllj Maw ak povdg 0.3 WM CDO! 17,24 A MM MQW Nm Cebu? cw My LW we www MQ ig b Y! 1 gXqJb'SE' the sLgiMhJr+k4 bMAI..,, . 1- mm + ,, mp C obln-LYHW-k5 Summa: aiviilkff C. K ' ' Y 'K3'nJLYMcqQaxxl9gg-2936! VYXQJXQQL eq Hffw ' U jJ3JdUv5l1wme LLUJULQQ pup 5Ql?'imQfLU dum 0,2 fN fpifiw ggiwm G3fm3M?iJ'TYCM JLU 'Hub poJwip5 5295- 8036


Suggestions in the Green Mountain High School - Ramblings Yearbook (Lakewood, CO) collection:

Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection, 1980 Edition, Page 1

1980

Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection, 1984 Edition, Page 1

1984

Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection, 1985 Edition, Page 1

1985

Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection, 1986 Edition, Page 1

1986

Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection, 1988 Edition, Page 1

1988

Green Mountain High School - Ramblings Yearbook (Lakewood, CO) online collection, 1983 Edition, Page 34

1983, pg 34


Searching for more yearbooks in Colorado?
Try looking in the e-Yearbook.com online Colorado yearbook catalog.



1985 Edition online 1970 Edition online 1972 Edition online 1965 Edition online 1983 Edition online 1983 Edition online
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.