Georgia Institute of Technology - Blueprint Yearbook (Atlanta, GA)

Text from Pages 1 - 444 of the 1923 volume:

-.,-.V-, -.,..-.- ,Lxxv ' '-'-,,f 5- f , x - ' 1' ' 7 'T' x f-. , -' I Cf f. ,I ttf! rf f 1 . LIL 51-71- '.?1f f-'var-,'-1-,:l.5 ,L jl-fs.. -- I. 1 ., 3: k - K. 1 'fir ,., ..f...,,-WM, ,H--,' ,,' .xx bv. vw...p,...x.,,,,nh .-bi 5. A . . X X 1 V , , 1 .ff x . '1 ,fm fi , , -..1f'.,'i, I-cy' A I 4 -, 1 4, ' ,514 . V, - 1. ., M., 5 ' M A'-A X .I r 1 W' .,n, 1 -in . .A X I , ...Q - Y Q - My , ' y f f . X- Av . .A,,' 1, gg mx ., 5, K1 '.l:,,j, IM, ,,,,, A ' 'Ms' ,g',.41-.1 ' , -,QVMA-',4, ,A V,- , '..,f ,,,,. - 'V' ':j,. , ' . , 1, 1 1- ': Q Q45 H I ,- .V iff. ' L,-If 2.0.1 . u ' 3 ,f -J -1 . . , ,, -,tux -'.t' , ., f ,,,'f , , f,, ,, -' , .N X' ,'. , '- 1-. . . wmxgf-' x.: H, Q 1- ,,' Ng, X -' ,, ,- f-. iv, , 3 , ff' ' ,1 I ., .V .I X ml ww. 14 Ami. . VMI- 11 fl '. :,1, A I., .. , . , ,3, . , N . ,,', ,, W ,. 1 , ,,,, .I , , I . .W iff, , , -, I , L,V 1 f r X ,IV '-1 ,. .....,- 'Q' 'm . in 1 1- Ax FE. A 4. sf' , n 'x 1, . ,y xwn , ,L '- 474 4 M Mn:-dans-4 , I 1' 1 A 'Q' ,,..,..--.,.,-V...-f H- 1 1 5 , ...gf mu.-v -.-q.-.4-,pp A .vs -V 'f'w :sk -s..4.J:. 1.,, , ...-...,,. Q T 4. ,,g' .., .. 713127 Q-. in., A j'f ' - N ' ' ' . . ' - '1'- i -7iTI. -P. . 'T' 1 J-'-.'-7-.'gl'2-FI? -'--''- 3l -551-5-'-T131fl?-fi 2 -.7-5 ,7 '.f'1 4-31 1,'1'3 'f.'l'7 55'-i QA-7'-'I f-.37 'i23 -11.17f ' ' ' , . - . .. , - ,N ,' jf.-L.. L A, 5.,4,.::.j-Q.-2'--.jx-:g,,.:q:g1:., y ' iw- 2.44-'fa' '-:-179.5 r - gfrfivgfg:g?,.,,f7:ig.:.,jx,jL 5-75431,--4',f1,l-1' -4.37-,,',z, 'Y - ' ..,-.,---. , ...- , 'zz -' - ,'s- 4, -- -1- I- M ' , rg, - ,..,.,,- .- 'f --' '- ' ' V ' ' - ' ' A . V. V . 'f gl... f, , '.' --- L- ' I n X 6 9 s X -C 4 4'9f-'+vw.f-gy. 64 ..,.,...,-,N-nfr.17,...-'r':Q-'fm,-.,..:'..-T.: 17.4 4 ., fu' ' 4 . - , , ? r ? 1 .. 5 J i 4' I I 1 8 I 1 i Z LY- .A-r-1 . ..-- . ,- ...W n. J.- ,, I All X --'A ,, , Y ,--X I F. A A --A-,.--. , fix-f' fr' g mx A f., ,,,f . ww f.-1' 'lQ?j.l .- ' 'N F' ,AV 'E' is-, A3 Q 1 ,.. , ,. . ., .. ' 0 A 9 Ilngllsi.l9gl1 I5'g'i,nur. I-gg 9 ifgiggwgmullun ulmmlmnlmllumuuxlllliuullnmnuununnlmllmdm 511 llllwlll i !l5?3qMh1ulllll1llmmuunumul mlnumllnuulllulullllnlllyggl 17,.. ,, ? ii , A ViJ , q A . Y , ., BLKUH PRIUNT 2 .VQ1 Q XW Pw2bzQS ayU Q N Tkueg it BY E 1 il 1635 i? gi fx u u n uu n u n m n l uu m Qxzfgf Q Kim 5? Q f X' 9 . Q , ' gs .If I U U I Q 'S 4' g hx -V if . Q sQy Q 2 'S 1' 3 5 SQQC xc 09,! 5 V9 .J 1fZf1 x k X KVHZSTQX .iffy Z 1' 4 ik x A ily!! Q' K X Y' .iqfkkkkf X ' 1 mio f 'CM ' Y -if?-iz? i' 1 Y Y i i l VL ,- 3fT,ff,! YT WN ' dx My V , iff ,:1'gfffi? ff:N. mQff QQ 99 Q22 :ff I W M EM if U ' V Y H x K N E E E is 1 1-1- Jai'.?2L ? 'f H 'M lllllllllllllIllIIIIIIlllllllllllllllllllllllllg M R. U id ,fy M 2 . . JN!! li fl, xv Vuwkrux W! ,4M M5H fq1 mNHi Y i n I-, X iii M Q Wx xv T' , X mX?'b2xi:MI . X N Q- Ngll x..-4 v- F' sk, X Iv Q I kqiimdgwyiqig Nwkfl . h.. ! I I -,-... .. H E5 M s w f f We x A f f ' f a l1nlli .4.qAA441r Pg!! A A fi T f- W? LS 'W' T T l H C X Qu, gm:immmiiimmmmmnmnnnnmmmi mm mniimmimimiiim'iirininmin E E 5r .f ' f f f f 2- 5 b , VQA 1 . QQ .G ' ' ' ' ' 5 j Q Marian L, LLDO l , E bf 3 E ' 'Z ' Euilmzngczelf Jim, 2 Q mcammgfgf Qu? thaws mdg j , E E 3 WEE 'Hunan asa EBC-22+ - 3' QE' wi Q i3imcQQnHcsfl iles W Z E ' A , ll 5 L The 1923 1931131151 Lewwriv 'Elm Illllllllllll lllll llllllllll llll lll llllll i s E lllll l liilllliilllllll I lll lllllllll lllll E , sfiggggyas A 1123 N - 'W 4 , Q 55 : D - 59 K XY, W X X fi X' C QQ fe i I . I , ,f ' if 31 :ix I R' A C X 7x 1- fn l Q zqlq, I ,U 2 CW . wr- , li if 4.-- wa J C fgf d L CK X' Q lj X , fd uggnsi !ml . - 1 iz pg 1 .f- 2:47 ! l1ffifQ 3521-gi? if T in Y ii! :gif W . LN 1 ' 'JAL QQ, + A N41 46233 iii ii? I A rx 1 1:1 5 E1 W-I 3, 9 15 E Wi! w,-. E - . E Jin !BHP1nur1a111 ...N Dr. S. S. Wallace. A.M. Ph D. Litt D Professor of Englisliz I l . 1:51 lllllllllll llll lmuulmm mlm IIII K0 ,A 2 X.. LYL H.LiLl lIiTWN?1 5 ' X 51 AR .xi K f' f, D12 ,R A : il W Wagga? X El-A gi- ' X Q f -T533 .. -'55 QQ QW ju . U53 'gm , YN 1 , 'MJ x Q J X MFL! x , ' --4 x- L A gm QQ? 1 x ,1 U T '- im E -IVY-I5'q5u?7y7 9' T 1 -K 4- 9-V-.:........ -nf . 1' El f 'N L !ONLL K'LlVY uuul-- -125 'Nlf' . -I .C n i i , .- , , il :5 1 - ? El i ! 1 -f . X , 1 1 K f Q 3 6 f I ' mf, in fd Q GW . . f, 7 - I 4 ...,A PQ, , ,... ,, wig, l5::B1!!5F' lgiw !',. ' V ww n fn f ' T: ' llllulullInnumlmmnmullnlllliulmllgyllfq 'u g igfgg gy ggi 3' 4f 1 -I' 4' xi V1 5 'rf ' lffff :fg EPXQEEQ-'? A f ' - JE I X if 1 fi! 3 5 ' .,A: fri' - gif NB 3' E F 5 iff Q 'P 5 FQ ' xx , f E T f' L 1' ': liao ' I s 1' Q' H ' 13 kk lg , I , V: V '.'V iw ' ' ' , A XX ' I W s Qff Q mil 3 I , MI ' h i aii b 5 E! - S A 1 '- - i'.V : ' , ' ' E 2 - A , c H i in-2 ' ,, A.2 l ' 5 ' , 1 . Egg ,,,A 5 M 3 Y A, H 5:2 E5-iii Ill ll Um-EmlllllllllllllllllmlflllllIII Immjiiillllli llllllllii ll I ll eq l Y! A . , uu 1 Q -A 5-sk' 1 , fQf W i' NVQ ' Xxx -1 . ' aux, I x Ng, I f ,fi-, Z ' T :fggfi E NssNN-9, , Q,VWJJ-lgpgsi s N viii cp A Q l , -FJ 11 M ,, re 'ff fs E IEE ?S 2 2 ME M4 MW 1, M if ' Q ss 35' L .E-L EE Y p 1 1 E 5, 's , 1 ut-Ag ,W V. U' wg: v, ,-G. 5531? 1 f 'ul Am, 1 IS' if 555 iN ISV ! N sl i lx 5 M 5? X , N ! IJ ff f v N X XX , 1 -,P 'fT: 'i'z1 'ik . M . 1. fx Vx Vx xfff' 10 TI f WEN W1 Xb ,fffzx V , X A' . XXX. . NRA' X42-7 N , NX UU l','4JkL.'7 U11 zd:'x5'.v-f-'IQFQ1 VfW 'N' 'yf ffl 7363- -' 1 'IX L U x-X:xg.,X:kLXKXk - ,f-K'i1f4fffw1 1 A --JA:-,.i,,,.x,,H,, ,J J ' ,131 'Li ?1'Ci'Qta-.,,, .:.'QM,f! 'X mf XX P v R- -N ,f ww ,.,J- 1 Www 2 Qww--fw-H,f'-Uwe --A- x. .i.7 ..., ..-,. , .,.. . . , . X mmlsvz-11, -'V , 4' ii'-' 'ANQT ff,-W J 'L' f- P N lxjwu Q55 V I3llgujqlimxx.mqmny a,m,:m:m .Mr .'., mu '-,' V v1x'mxxxM,xGu-A-m.1...mf,,w',,Gk'fx,au5n-v ,,n1Q.iimnufu,nmUBXi .1QE1-R41um.xr,Q5ummm 5fil3ifggmmmmiLEE5Hy, , , iq-1HH,,3m3d Umm-fq' lx! v W N Y T- I xv 'XX V Tw 'yr Vim fir gif? 3 x cg. 5 1,1 I? 5 Q1 if K I NH If M7 SL 2-7 ' N KW , M1 NW l V 533' 5 A N. V - . , ' 1 , I . 1. r ' 3 X 3 . , 1 w V , ff X '- . 1' 12 , - V -- W- -' v - '.- . ,il ..-J N' 'LIJJ Q lw- - ' l V 5 M 1 my WI , ,,LL . 1 .kfxmzulmmzigtgzigglfgiimliuxmmmtrmrmumnuummmlun f My K S . ji, I , :A 7 I 4 . N f SN f MS 4 X RN w If 1 N . N 5 7 ix f' H ff ' W X. ,. JSI QI N 5 ai N l H g H X n F, ' 1 F N i f N li ,Q I 1 N 1 2 r f M5 Q if N 1 f i 1153 1 r UNI f WWF , 1 Q1 A 1 T V5 , Hifi! , lj SX J Iiiiyli . .5 I J JUNU! WXVT ' 'J -3 EY , x '-lily EQ . ' I - Ill , , r l xfg N 'qi' qf'I'Sf' W I. Kg! 453 A , ' 'UIQ x LE er: iz '.:5i U W ll 1' 4 Miyff m a e 1- , -f ' RL? . Flliiiii ifiilii .- lg U f- if 3 f? , X, V., vf ,' 1- ' '- lx ' xx , ffffh, ' 5 ' ' ff T 1 ' ' I A :mg W , Z A fix , X1 I-J ,Wx I. 19 .,t.4WvF S , ,V W f e Y , Z - Q ,, X.- , .5 ,xiii b Z., X , gif! 4, ,,,3,,Ii'jqj QFQ5, D71 14' 'lffff' A Q. if l'f'f'1 iAf 'f7f QfWJiie2JEE-4-f-f'7 QA 5 fjgjsgvf- W 'HJ ' fQ ' ,Qi f gr, j A-ff''MM'm'4 f w:'Tfi! ' f H fj- f f I ,H , I,fQ,Q,i,?g,?hgulfzjj I Lu, K - A- , f 4 ,ff .1 fro, ,f 1 .' ' I A . nrvvvvrrnvz-fr-,zfv - . psf' f. -.f,12T.'ZZ5JJ.177T77 1.7'f3 3' ,N I -A4 X ,J v---r :cm-2-vn'IwlIluWW'Y , vf'7 1'-41 T' .- ,XA -.,-v-,L.,...A. -- L1I:l p VH- ,,.A-,,,-V,,-V- fffff,-f-fff' A rf-I:gI:fIV'rIrIv-I If: I my Law I I II ff .A - T- f TtI' I 'fn ---mi If I ff C - f A I II ' ' 4IfI '7-ff 'W 7:3 I IT zz I IIQYSLLL Ifgy ffcf 1? ,7 ff if A 'X K, YA X, .I i -J fQ:N, - fgyxpfpkrv-v' firm I IT-xx W1 I 4f?f,fA, ' X I I I I ' if ,ff vfvifvvifw ww' Ir. I I 'ff ' NW vu Im 'A I rf A, ,f -u. ff Q- I, ffVIIriffHff,ff 'IT 4 X I' 1 I 1 A. u ff'1qf ,' A A1 A ,fm-.fr 655 A , II: ,K XXj5y5,,jg,g, ff ,J X ',', I LQ,-.j,4V,f M,AJ f fqki, gg, ni, jf - Q X-QLXI I f y A j A -An ' ' fe IQ,--ff' A AJ'IhfI N '--' mx---if 'X----'WI fl X m UH A9 fr'vTf'X7p I- f ZILI !f2:1J??CQ3f f f1'V GMI XVFIII ITM If-ww? WI Ufi' Qljjigggjggilg A - 55,5 ' 'ALA 143: - - -- .. -E ' -If ,A fl- A J' 14' Eff.. - 'f ff rw-1,L,m,174fms1f-arfskgQ?D,3:gig,'LfAA. A 51 X ' ' ' , ff AA,3,Lr.'gZsf1'i,1gf1asAlg2?4f-T-f.HfJ:fA'-I-f ff wwfwx---' effhf' 4 ',17 'I ',iQfgA ,A f' - A- - 1+ - A AAA.. If fum I I fT 2- I IEkiffflQillirzkfiiisj. f CA X 'f' :aff-Iv: Afl-fwfr. '- j ,ffl Y 1 .VI If-:igjxlh A A Cf-,jfg ,pg ,fi T Ig! 'v:W:'-I -. -f'1iP4f,-'I I Wqliigfb A I UIQ I,f1AAIIy,Q,1f-AGl,, ,iz-gg 1 '32-'-, A ' I I yliwfcljff '1 I Ji I I Yfiiiif if M. I yw if A I . '. -rad' Ll-T 5, 6011: I if f A I I aqui? A Qffczzf A I A V--'I' ' v 'I,1 -. ,ff-:Ql fri I I GZ, ,JCI gff?!'C' Y f1 WfI'qI5V4i5Q-Fig iii: Ak-gx f fl 1 4, If W :lyk ,W C? Q',f-QfVg2Q':-N AA if,-I IEE I '15 41 WSI' V52-I-f-EI 1731 ff' I - Ag ,I-ff .ff- Xz' ff Af-1 ' ' Ifffii-LQ' If .. -1 ' ini -Z 'iii'-12 Pi: I 1232 1 I Iii! 2525-91253 ' I A -CI I .-,fi Q:-'f i ,Lz.'1 .A C ,I--f' IM 'fi' 'X' wx f' .A -i.i' N..'1 X A 'ffl If!-' ff-311'-,,,,L:: , ' I . :f 4 I 'q gf ,aff fff E'Tif Q If A .II Ix'EIIfaqQ-ii-Q: 5 'Jw 'iris 3 I I ' Ax I I' I I Q21 I,Q5Qfzifgfi+ie?.Q2'i1I 4 .1 A I S i A. I 'I'17:JW'- yy,-T'l,g sl.I l:' MI IS, I 2 I - A I A 1 A. I 5 65+ ' - 'I I ff. M-W Liza!-7E.Af'-af-f'I4 QQAQ- 'X' I I .' ,I-. fINQ1v,rVf',f-,X A II , ,msg . x. 4 -I I, , ' N-,A Le, X-'l,fTf' :A I ELA If, I H aw i iff-I IS2',!'V4ES:Cq4T:1A415--ff. ,XI I , .I I A wif' 7q1iA,?fEi7fspT HAQTTE if A Q fl I N IEP I bil Q51 g if--Ng .7 QQII Qcieiezfalifff ,-A13-sry A ,A f-'vyxk NWI ' - I 'ilifl , A ,Af-xg. ,Q IAX! gk I xt-Xxx: A 4.1 J-Tv I 125 Ti9j:Qixlg,'I fg? i -I I I pf -li ,gl I QI 'Q' 5,1 A , x't1-xgv ,QA j -wfiif +2 I WI - FQ I , , TI 1,173 f.illQfj' ' I XETXIX ' A ,,A.ffflfL5Q ' fff'1f- Ajlxfffl --N' 9-I pf- -I pew: jl - I fa-'A Nwff Qtx: I I 1 -I-Nflliff SI 'ff iv X I2 I fifigi I I ' X' 7? riffs' ' 5 I Egg I1Q 1v, A ' 1 1:62 'V ' ff i'HY4'iE' IC' I 1 ' IIE? 953301-izffx ' ggi Q! :',1'2f,'i ' - I V h IIQIE I Q Q. . ,',:1jg,-Qigm,-LY' :xx Y 15173: C - I X A A 'r V' I, 1 IQ, I f7j A Vi..-.T - 2 Q -f 21 17: wilhf 75.425 L33:5 :' 9774- cHi'E1X--1r2I1T 1--- f-A-19 xi N '- A ,I rf AI LII I ,IQF-.-f: ifi., A I f Y A . . I- -F -R, A, df: fry rv-fr gf T W -AA AA w V-Wi-:Q :XJ BI -NN, -X H A, ,A 1- I,-if .A Q-1 ITRI-ITIUT' JTITT 1 VWWHW W 'Y - -W V fn AA, A51--2 ,A-1--, A - Lixfjf I ,K'f?i?Q--'-iN:'3,Ui2':? ' f A522 5' jjT!31?InIxI'-I rf: - , I I 5' 3 'A S, 3-T-if' x Q,jQTf A H il., ,S ing ' A , - 'i Q xi-v -,-A A I' Vx 'ZA A gggggf 2 A: .U-3i3g Ag33 I ,- J Ffwkm I VIII L3 I I - Q: f Hifi? 4 - f A W HQ V, 5+zkQfy-.- I 'I f V' 'If ' Y9'- 1 39 N635 W5wI?'II II I I A A A- X .M , 1 QQ- . o . 1 , I sq, M fy I I -w G few ,fgffsl A I u 7 vii, . 'NWI , fig . ' ,gggfyf xy? -f ,r -it-M ' If-f :: ww -. v- fi' Fw.. +A-'ff -AA- -SI I , I ZW: 1 if A f ,ef ' Q f f :ig KT-BXIQII 33 4: 4 -If 1. I I ffIfIAIIv9E,45- 1 X-A A,7- Q1 .' CQ I 5 .V-A . .L uf .-., -I - - i:f'AI'-5i-13-E3-,sg A A J U9 -q-MI ffXfg55i:,3fgZig. 42 w 6 if AfLjf,QzA,wA5,pA A .i -' 11+'XT-Q,if:if,,' I -W .- A Ip ' 5 ' IGI?-: :fff7 'A, A'- 5 I 'I 'Q i, ff ,,..L. 'x ., fs -,., A ly 'iii 1 I ' I :QI I 67' Q-' f NA If:-fQ',:-.1-'wI'.. 'l:i I III-N' ska I' If I '35 f.?.2n.I-Qw-w1 11 - ,A : Q Apu -15 f -Q-eq 5.. :A- , w'1rr-WWII HI 'NF-X-'Nw W I. fliiiiyrlfi f L7 g - , K L-L5?.+ -JI Au1AKLllA::II.'I '. A ' A I - v- f I-R, ?i -if-x 5 ixv iX-,-xSx..- -AMR TQ Ayr: - -. - -..,--,xx x' Mvim , +ii 5-ff ANI sf I A I Law :E '14'L.Uii ml :fn f! I ' -Y rv- H -....,,., A - -:1 -- .rin A I 1 ' .. . - - M MQ., .,,,,,W-M .. .A- .-.....,,... ...-,.A...,,.,A,,-4. -xx Xfire 1 1, ' -11 -1-x-.QQ- WTA 115915 Ti-'T 'XP - QR . 11131 1 1 11 31171 1 1 g:- V ' I T-N1 .R-'!:Si1 1 fi .Q f1'g'1,1 1 ., 'ff M5111 V -K :YJQYBL . 11... Q. Q... ff -59 . 1-N.,. - .P- - 1 3' Em -R51 ugg V X -'Q 1 .... . 'Q -3 - ' I . 4g 1 F X 'QQ x 1 2 1- 1 1 . 1-1 ' :ix Q-5 1 : X .1-, f XA1 J L- f 'X 1 .-.L....1kf -. 1 LN 1. AL Q Lf, Jn..--11? I 1 1 ,4 '1,, .a5,gN '. 1 1, 1- 1 TX -1 -. r X PEZ? Lx' Ni . -.,1x.111L'-1, 3 1 -' 1 ,A ff? H-,1 3.1 fx. 1 112 A 1 1- 1 I J.,-X --X5,-xghxb, 32,51 Q:L'f1'?x.7 1 12 ' ' 4 1.,1 1 -1 J-. x : S- S X yay., 11g,1 -1'-'TDIX T131-1, 1 21 1 :1g.7X+Lqs,1J 1 1 ' I?- -NT'1'X F' 1 , Si 5 -1 -, 1 ..,. f L 1. 1 .ag -4 E,' 1 1 --Z h VZ-.53 1 ix. 1 1 1 f ffvggh -. 1. L , X: XJ 1. 1-L.. z,3fig-if - . --'-KTA -- 1,1 fx--L ,17xQQ,-fgw-L-1, ,. ,f -1 N.f?bf1'?ff: -f- T Qi'- -. 1:-4' -K-psf ,521 fr. . --- ...:' 5' Ywaf 0.24, 'Q-,yvd N . ..f:-21 if wif 9:21 , 1 1 .,- xf41 1 ' ' . -.1-1' -L -I - -f.. iii- Cf ,, 'xii ' 5 -i'.i:'f1':a:? L if?5Sf -'7EfiL ?3 ff:i2f9 J' 1 3'-'iligif- 'f52F T 3-?YlC:Lfl fi' . 1 i:'- ' -51' 1 J 'ji-1f '712A 11, 1 , '11 2 41'-,f 1 if-fx -4 '..f231.: .. I 1, :Z iQ,V f'Z'1 511:11 1-1.--ff -, Ag., , L:-w 1 1 iii'-Q -1. ' 'fav Jr. 'f:.:4l:i-' .551 'bfi' 1' ' YFMQJ ff: Tffia 'f TJ- ' 1 fl' - 41231. Y -1 1 2f:72 3'1 '-ff fflfffif ,,1 -L . . ., 1 ,,,,.'- - 1 1 W. ,- Sf' 1 1 1111 1' 1' 1 '111'1.'!117U3?fU331'.... 1 1- TTT U'23'1'V1U11'1r1V1T1'1'1' X 1 .1 ' 'af' 11X 1, 1 f 1 M1 11g1iXlQ3 fy If 11 1111111618511 K X 1 x11kkQ111E 1, 2 K I P11125 I 1' J X Tfg1i11 Q 12 - 11 1.1191 ' fa..z'1' Q11 w111f+1g'f -X.- . -1J1111,f1'-1', ,VJ1'L1l 1 -' 1 9 ' ,U 5f1f'gJ,:,5Eg11,1l11g111-1'r111,11-5'1, fi -, 11 -41 1 Q1 L1 .-3.111 11gg3, j..a1ggf1' 331-1. T11'11fE1,Z,ftj1,.1.51,f11,151 .1 H ' ' 1 1 V1 .1l'17l..-1 .V 111111121191 1F 11 Q 111141 1.11 X X gi Y. uf-.2 410111 K 1 1 1 MA' 111 211111 1+ .. af' 111 11'1111111311LQ1111111111111'x 1 11 15,11 111 M 1 . .11 1 ,. -,xx X1.Y.MWA1 -111tWm11I14.Xx1tTkiMy1 -N ,v.NH1x1, Q1 N 5, .QM1 11111-2111 11.1--111. -1 1. '11' 1 1'.1,.1wf 1 11 '. ' 1111 1 1111 .1 11 113 11 X ,1 i ' ' J 1 1 . X f :' 1'-12 1 1 1, , .Y A4 41 , xl 11 1 9,11 '1111 .N J KN 113 1,91 1 1 1 wi X W Nix. SQ 1165-11,11 HW 1X11X 17 VNWPXQ if X Hwy MXH W 'Lx 1 '1 X ' Y1. 01-,1' 11 1w1N1 1?-'K1l11x1 nv 1 1 1 X5 I Hx E1 XT YT N XXXL 115. Mx,',4g,1.'-STX xx -1 .X - I 1 XX W 11 1' 211 1 1 .11 11 10- 1 1 ' , , , .11 ., -11,1 ,.11N,111 .11 .11 1'111-1U,j 11 ,w ,11111111111l111,,,v1111 1111111111 11 , .1 1 1 . . - . . ' ii-. .W . 111 - x 13 Q R, . '1'11xL'i L.. 11 'VV 1 11..:.,,?',1:m .L5.' 1? 1,1-1g'11 11 if 1 1 1 1 1 1 . 5 11.1'111F11'S11112 151.5'1?lEMf-.f.1511131.11.1: X' 1 U , 1 1 YH F ig: --L.- :V 1717.1,.1,.,,,,- ---1 4 ,Y,, 1- if, 11, , L :pi 1 '11 1 - 1 - --f'f 111l111u' X - Qff iii 1111111-'11 X 1 N-w dsiif EY Q31 X. 121 K 1 1 1 1 1 1 .11 11 1 1 1 ,Lf . , ,,, 111151 'gqg-f:ff.'1i.1f'111 '11 '1-5'-uf5iQfff,7f'f1'35?:3?.1. X 11fgi.'1J1111f . 1, , -ij? 2:1 2:V.-1.111 .x 11111'1s111111sJ.-.1.g . vf1151.'121 if -1.1111-1 .f' ,121 f 01111 117441111 5263 yf6fL1vC2,.mJ 1 ,ff '14 , f0q 11114-11 -H, 1-1 1111 X6 11-+11-Zws' 111',fjg111f1L1i 26f11?iifi4'11f11,11 -: ' 'milfrj 1 1131! 11 1, - f 'iw 3,45 E27?g1I1,PQ L2 1 1.1514151115 5,-.5 Q,.W173,f ,, My fjg,-,. 15-1, j11,g17,ftj'1i 1,-5.1 14? 111.1TQ, f' ' bLZ51fii1' R 513.11335f7.3x1QJ,1151',1--12211351 1, Z1 -5,-a,'?1 11 6,1511 N511-if 11 Q1ff?-147953121 1 . 1'iQ1,1 if 1fJ1'1111?C' 2 ?g11112115g15155, ,gn 1?-1 px 81111,-411, .Wig DU ' 1 , 1 1 111' I w.:fg::, 1'I 1-' Vx. 10'.r 1 J w- . 1 1' -- 1f p iq' 13 774131 11 1 151141 1 .11. 5- -11 1' . 11'-111 .f..f:111:+a211' 1397 'fi 1 551161. '51, 52 1 113 1 . .f X . 1' h I 1 ' I f W. 1 1, '-'1 ., vf Q q 11 ' QV' 1 , 1 - 11311111 1f1192H1f2,vQ 1g ff' iQ1'15Luk'1Q w 1 11 fffff 1 '11 . ,gk Q ' np Q' ., , 3, 111111111-2.6 1 1 1411 .511 1 .111 H11 11.14 L ,mQ111g'1S!Y1l 11'4'11.11.- 1' -iff' Q Y- 11 -. 11g7111i159,fQvefgi31 - 11511211 11 U1'ff f131 F 1 11 f f , 1 1 117.2-S ' -25 .1,1 1 E 'J 1135121-111 ya, 511591 fvmif '24 1 1 V1-A1 1.1. -1c..:1:1i..w I ':11f1111i1-111245 11111111ff?I'1-1lp1f wx 11 111,-11 .1-1-1+1:ezesh'-1.51: 111 :21,U' 55151, -515521: , - ., K- ,1,-....- ..k. ,7..,.1,L,.,.l,,-.N IN 4, , .1.v' . .,X I 1.J,h,,,.- 1,11i.1,-,.1-V. Mdq,-4 ,W M ..1 .1 1 ..,x - . ..,.- 1-,1-' Hg' 1 1 1'-f1::'-:-I:-gr.-.1135:-1:::?4E?-H! 2-'1 i 55531117 ,isp 1 1 ' 1.4 J I 1- 1 11 1 .1 11' -1 -gf' , .11 1. im' 111 xv' N Q. 1'1f'1' U '1'111 .1,1, 1,11 f EF O- 1 145. ruf N. - 1,1 11 ,- QfggJl 1,i1?Aff:lC?l.mtg .,1uf1.11, 1 ,1...,-My 1 1221- 11x , 111 1.1 N1 --. -L-f1V'-:l.1'- 'T 1 f- -W ' ' ij1:fT...A.. .iw ..... ...... -..- --Y-.. A , -57111:-1' 1 f . . ! ' 1 . , ' wiv 1'?i.11?1.?fW1.311-1-E'1Qf41214 Iv-Q1-gs.1Q-1w21L7:s1f:1.11H1-if111111, '1A'F'::Lrr51Q.1. A-35132211 f +11 --W W--1 ' Lf- ?fQ ?.?-1Ei:iEiFi', 516 1 , 1-12. 1 1 11 1' 1' 5111. 'fuffiffff :Q Q- 1 . 1' 1 I is11+?f411'!i.25.lf3:3i1i1111.141.1f1Qi:1111 ' 1.1f.1.i11'1 1J1.1z11.g321:1'fg11 1 if ' 1 -gif? 19-145111 W1 2 1 1 . 1 '15 A 41'g1 ,23,1l'1--rv-.ff .' 1 P, 4.117-' ' 'I -1 '.. f-3111. 21 Q J. W , , 1'1?fiLx1 1 1j1Q1V.f1?1 IQ 1111631-fy, k1:P,1VmjQ If, ,111 i 1F,l7f,'M-H1 1.71 .1 1.1f-E1 1 . 11 uf' , 1 1 ' - .111 .- ,1 . 'Q -pf, 1. 115.-1.,' 1 .1 j uf, XAHIEC XR 1 1 111?1111,1r?,11111x1 11111 1.111 1-Q,15,..57f,g,1:1q111f1efgf5511 7 1' A A3254--11 rwwff 11.41.1r+g- 1 A1211 1211i-:11a.f,., 1111r41wf4f++11 1? .. .. r ' . f 4 -' 1.11, -1-,3'1' 11x 1 11 -1 1 . . 115 1 1 1 9111 11 1 3 A ,f111wfv1j 11.11.111,1l1f,gi5fTQ?115'f?vi11Q1f1sag1,1-.121rwg.1if.1.14, 1 1 1 1. ,-5 4, 1. f g,if11.fz1.Q.5 .1 '11a1:21,..1f:11:1 '1.-s19sg11. 1 11 1 EF H -QQ 44111.11-1 ' ,A?f41fs1911' 19f 1 .. e s 1 1-1 V, 1 Q 'i.N1f:11, 14--.f::v1fig:.f'gf -q.1',112ia-,rf 11 1, 3. J ca. 7111.9124f?f5:iq51,Q,1 11 4 ,f 1, C31 -. .. ' 12:-1 11 1 1 f f ,111 Q51 H 5 1y.'113pgf2y,:1.1f,ff:-111'111. ,f f: , ,1 1 3-1 1 9,1 8. 1 111-:xg.fg1g.44,,9.,.1 T11 . ' - 1 1 -1 1- J' 1 ,g1ff'r,+Q1.w'111 .11 1... 1f2f:1?112+Qs2f1f0---2 1' ff ,Q ' 1 , f 3 1 111 ' K9 ' -' fn' 95 f - f V1 '4 .QM 1 q:,-1?f-'.--1411:-vw , ff' -if .V f- ..1, W, ,W , gi- . . '-j i,1ff?f2Q,gQ ' -' '1' '- 'M'X.--1 '1 5 ' ipbyiff..-N lei' 1 Y'-1- 1 ff - Lilff11f?:'f..,? 1' . .. - Y L '7' 1 'Q '-fSf 'l3f 1'f 15 ' X 'Q' 3'S. - Z 1-1 , .4 ' H ---,-f 'L ,,., 1, 1 iii-Lvvr. L - ill-:g.4:N ' 'fl 12jr 7: f f 'iY..:i 1 - ' r, 5 -if r ...M . , 1 ' ! ' K - . ,, 1.1.4.3-. 3.1.2 ..I....- ....z.,.wmv..,.f'-r:1:v:vI1v'11lIl1 1'f 1'-11f'frrmfr-n1f112f:1.vfaf:fZ..7-V.,Exit 5,377 f ' I I1 n I I . K 1:1 ' Y W 5,4--,,,,,,I,,.,If,,f I ,ff F. X1fTI'I??CI'I'I'I?' IFI I' II If! I I I 1 ff ir I ff T71 k, X, -i ,ffnx fl, ff XIX, f,, , I I . .. -I ,rrIIIQ.gL,.-. ,II I-,- XgI,,,,IIf,I,f,, I . - fII'I7'II'I 'XTIIWI' I ' ff'UII'II?f?q??4.gI fJIII M IPI- XI-II .' I' I I I ff ,. .--- , .1 - I I-.VY X' ,I I I,I I 1 .ff f x' ' I ZITI, Iii fI'IIrfI.I1IX4. 1fIi' IfIIfIQziIF5fU'I .IIII S451 I f' I ' f I , ,If , , , ,. ,..f, I .,, I I, i,I,Q,I.q5f,, M U. xx .. f, I If If4,,f.HI f ,ff 9fII fIIIIII ff 'IITIU IIFIIII2 II MI ,ff - , I,,,,fI ,,.II ,II 5,.f:T-IIIIISIIIIII-VQQV .Q !y IAJXIQXI., I,..IAI, 41, .. If 'II1Q.-'ITJI xfl A, IMI ki V271 Iff?'-if 5 I7WJ 'f14' If f ff f . I . iffy, ,II Sai Nw. jf I IIgfg,.,.b-II I IlIuI'I II I YI If-VI I I I I , ?,ILLIYjW LLYV f 1 I I -.f.I. I 61,1 IIII II II HI IIIII I -if-M-- wif I I X 7 ffffI'C It-'Ti,'IIIII IIN I I I W . -I -T-I'7 : .'i' 'f 'f ' ' '-f I 'f ' I ,f'C-kllj-5li?i5? , I. 3 7, QQ X ' I, 7 ff II?lIf'I-QIPFIEI5 L4I5::'fl'?5I f Iii . X. I . 'ff I - II I l ' -AI--f1I. -f,-WYW. it X . 1, . j 31 IW, f 7351-f ' Z YM-V -I IJ 5 A E fit? . V. ff' . I f-f- -1- gf., I . 1 ,Q jf, .Y , If gfjfgii . 1 gkifl'-X I .4f1.I I I 52 ? PI 1 .ff I I III- fi? vi. 1 .ffif-ig, ,SIII W II jf A-LJ ., 1 ,I L., -- I I I ,. Iixf, II- I 24 I. -.III '19 E2 il. 2 QI if .f-A4 ix Im V7 2 I as ff 'jf-f F -PI I IZZII f,2i?.3:?.i I f,,,,f,j Wil 1,7 , ,ILE-I 2,73 7Q'?'f'22Q2.'j KIILQA F JIAIII ,lx I II? ',,?.w,L .??q:,,f'f4'!7 lli f f -L? I. 4-25,11-ffl if 'Q J'-1lk'I TJ' I I ' 'Q I ,fb 5-ij: iff 5 fz' . fff- TI' I Ill fl if 45' 'ff' J: iff ., Iir-1 J 3419 .5-1 CI3 IITIQI 'Tar :2?fQTif- -Q? ef A . ,U f., .,7f-,LN AAI 4,-,N',, IRI 512 Z-1-V: -5' QM I j,,jI J 7 TQ L., ., :I f If . 1 MA, -'fI QI ,YI ,qi-gf ' 1 I YYI 4 ,II Q-Ig Clif- II:1'.. gff If : IIIIII If-. -: 11- ? Sl I Rf: ' L' 1-.ef-'I '1-if -I- l gg I ,1 xV.,IJ,I'I ' f3?qZ,1'L5f-I-If-:',4g, ---fm I ,C I I XX-F ,IAI gif I5 535. ,?fij fxfff I-I-: I fi' fqgn, I7 if-II AIXII rfII I' if .5 MEI xx, fy Ik -P' . , I J ' - N , . A , ' Pr N RIZI if I ,Z :ff I li7Tf'7A I Tlx I.' - I-cilf -' 1,55 . I 95 I Tk? lffffu' I I C III. I IX , I I' '- ' - I I jf- K--I I 7- 5-Q'-QW! . 'V --- '-P' , Q-I+ I f' -NI' g,...x 1-3,-, .I - I, ,, I I 3IfgI I ig f:1rsIiff5f:9 bg-fi I- -I rv I 5.-1,1 -2, -'fI11f'-- X I .I fl I I 'ING I+ Q . -xi I lr I f I 1,1-, -igff ' TII :'!iIIfI,N I4:-f5I 57: N532 X-ii' N' I I,.:gsIIficI,, .I IISIQ- I i 1 iles. I I I- IXQ- IIIIII H 4-I1 fgxy-Lf' - QNX 'I-XTIiiI If I III- p-iii. 1 3 I I' ' 'iw 'Y I flII?' - I I- 'VT I I. II I I me I -I . 121: . I , I II: II-:I -Q: 515-.g- -,V T3 I 'IT 'X.f1I235:I QT 'Qs Tl .5 --I-. 'I I I IF' I 1 II '.'.I II -, 2 f-,- N if - I I ,I I ,L-I I jig .. if ,Ir I I ' ,ff IIT? I iff' I ' f?f I 4. ,V 'V--. ' I I A',',X-I I' ir -fi .IIIESH Mge? I--:Q I f --Lg I- I X- .II T, f I X . I XI LII x :Ig ,II I I IQI.,r'Qf:II'IU5 xfx A IIEIIII X - E J if . Qi-EI S-CiI2II?1g,,g vm -If f I :I .ja Fm- AI: K-:.II .5 .I I II: I:.xIIf2p:1IS1I I I I I f If' I. -34 gig :ik I5 I - 'ff I I ,I I I I I I iI.-.'L.- I--'EQ' I?-QEEIQL.-fgg I :3':i?,f I I K . I if FQ-tl?Q'QgI TI! I R-X Qi- '.'.IxI1Q9f'f-EEEI I -- .'I-f I . I'I 'II.Q:35f? x-L 'I I -3' ' '.Nl,Ni-4 'Y xv ILIH 'L:2eIii5iI.iii I I I I I,gfi ,fQfQS:r5T'SIr-,gf li V - Ing N .:X,: ,AI-dill Iqhwi I I ?.aSgIIfwIgIg-:favfi:,f?II:fI:.mL-TI-LIWJ.II 4,1-..,-.Qt-T W., , M--- . .. .- . I I 5' ' If I I QiI4ZiXIQ4i'IA2'QL ,. 5 IZZIW.. 1-I1 I-51, I. I. I .. 5::I.Q.,: I I I-I Irma? - - fp I Hrs. -5- fL'i.41:.g-iE'IQI'I,i4. ,474 -3 - xl '41 Y -5 -I: 7:-QI 2 -51 Iiff I II . AYJTIII I IW I IT I I- -I 1 ' II - ' 'iffixb-fl , P- X QI' X :Sax 'Edt 'Iiiffff?iIf1'-21-'fig- ' .I --III I Ig .IX I 'QI IIi:I3,3IPIIII Ig'-fix . .. , . ,- Ji 3 'I - 1 I .11 - IX I ff fIIIIV RAIN, I - I- 2:1 1314 '- -.I 5X I, X f if 5145 Ik ff? I . ,I II-'IIjq'III.I If-,I7?gWjIxI I i,Ly:.I,,'- ,I '+I IYII Q '!Qf'Z+i? - ,I 3, -1 2-ff!!- ,,. .1- , ,fl 'FTL'- li, . -,, .-.- l..., , '.4f If 47 I I I X,lI:gQI ,PQ 'JEBSU i fyw,-I fwgg QI In ig N 'IQ ff? 'Q ef IKILI-'I III .Ix,,,,- - I. I I .Aff ' -,I I III I I IIIII XIII. ' I Ig IIIITIIIIII I A I.,,- 'IS Im'-'I j:-.':f:. ' : Z III IIII1II'II2UII IIN e:.s:Iz I., If IAIH.f-,u-f'ff.QrILf, ' IS FII II - I IIII IQ IT: -1, I I1IILfII-Ig I Ifggb-'III-I v x. . IQ.-I II 1 5 I'IIIIIl IIII x . , 4 7- -Z-A I ,,-,fix R0 fr- 4 6: I V I I Giles gA I jig TI III I, If K W 01 .. -2- -f gf-f, Q I I ,, YN XII 4 lx '+I III-II III II WIINQ- I- 93 I f.i'.T?l1:-f,.: , IL , X-if-fig 4-1 ,ge QA - . . . . . R--I f X ,VX X- - xx: 2 ., . , I-x -..- , W ,AE .EMFTT - X, .R X X N I I , I .i w I I 'I I, VID WNNI1xl51Iqjxwg,I,xj1-' V, V A ,WIN N W Y , WIN YIw-Y.,'TR XV I.X,I,.' l,iq.,-'-'-,-.I-f -I. IT., . .W-I-Uf'vr,.Ir , W I WI, 'III IIITI 1 I QIIII:IIQIIINLIIIIIXIQI'IIlIIIIIII'- ' I,IIIIIIIIeI3,I?FfI5?2iI.S?I3gWiI IXIII'IT,I,I- Xu IQfIfLIfI0qjI I WWF IIIII 7 I NI-If IIIIII XWI Is II I ' ISI II I I TI I III wIfIfIIIIIIIIIIXIIII IEIIYWEI I III XI III :Iv I f I , ,LI.5,.IN5'iI ' I QI' Ti -:ff-I ' f'T:f.'if'fI f' E?t,z11 QI I I' WIKI Im, .A II:ITIIIIIg:5I1,IS5IgIII III , h II I IGN IIIIIIIII IIIIIIIIIIIIII IQIIIIIIIIIIIIII IWIIIII I IIQSLII I ,W I . ix, HIIJI g ,,,, ,,,,, 4 - -- - I - ar I---1: of-VN I A? I .II I I lt: III,-II I IIIQIIII, 5531? , I --IT 1 . I , X ' Mf?GM I,,II,,I V III' 'A X SIIIIII I I ,III , - -- -- SQTII I -I 5. CI WW X I --?,4-5- -- II-If --.-'-: 1. I I , In I I+-lk I. , x I,.1I f I-I .I maya ,I f'I I I XINI 1iQyq'i:If,. II I 'if .-.-, 7 III II WI I . 5 I 4'-- '- 2 IFIIWIII ' -IMI 5' ' ' II f. I ' 35 IIQIIIII TI IWIII7 Il?-fiylgk I I IIIXJIIIIA ,I avg 14? I X. ,I . X. QI, fl., -ILJS 1,1357 M fr: gms' I I I III I IW. II my I1 ,H SQIQIQIV- 'iii'-LI I ANI 6 'AI ,I-1 , gQ!45-, k r I Q ' Tfiiix- W I Q5 if I -If: Ig4Ii,II I I II5lIdN4?wI III:4Iz 1 3513! , my ,I -I ' 1Ii '- I ' 'III zlfug'-NE: I 'UTII 'f ,I Iii! I KI I IQIIIEW 5 I ' g2ir1f.I:IfIg..,,, IQ IM-If I :I g iii-Ff':f1I',q I' I f'- + I' :II 169353 III Cf-f '5 I 3f.i-5-h'I-,I.-- , IHA , I.' 'i,I. , QQ 1 K I 1':1L2:II:f IIKIII Z' IIIII 1g'I.5.5,-153II'v-ff' CA , ' II I F. IITQIII IIEEII If- II, I I it Ifxlj Q 'II IIIQU, ,'If3:,3 -I-KK 1.2.7 XQ I, X. II 'QD I Ig, Agn.. I I I I41 ', I,fI I, lil' 1 , II! IJ, I I fifxfx gd ' l J I I. , I1 I I N460 .II . I 2 -1 I ai '11, N' II IIfI+I22II?Q2fI mf AHXII KETN I I, I I I , Ikyibyyfyp I 3,1 ' ES, I . F, Iff-mx - I -Iv ' if. is If I A I 2 III IwfI1I ' ff-if 47 I ' I ff1ff55'I IISQQIIII WWE, Z ': X5 I . I l fa IILII I. XS IXIQAII I I I 'I 'IQ I I IE 4 II I I, I1 ' I I I I I ' 'AIII2,Ng4'NgbIZIIII-IJ7'I Q51 ' IL I ' ,IY ' QZAII II-vIT'IIIf-gfffff'-0f2E9'II3'II,'IP'Qf -AEI I I7-I EIA A QTFII 9' I p4Z3?5gi??fE252f: I ,iv III '1'f 'K RI? I 'iff-'1f?'A,Ig5Tiff. III I' -I P- -Q 'P' It :JI QI' ' iIfQI'IfPIIVIIIx - -2.5:--' fx, ,Lili-WI?-I IYYJ ' I SEQ--IIII 5 459: If -V-,.1,IGZ', '-T . . Kr-,JI :. I I I ' G-E A 4-Z54?: fg -I':3532'ffi'7 '- I if T I I I 4217- 112: :f,.:,f1 J KJII I ' -Iii I -W C' I if ?ggI:,I',.':f 1-131-2I'4f. lv? I , I r I'1fQjI3'k. II II I I,A-jfgj-7,5 fzg2g,1gIzL,I I I I I II lbblq II-I,-,sw . ,IIIC.,,xJI4-I I Ty, I I T42 ' . I Ii .I II 2554! 'I Ifffel 'f:II:I ' I 'I 1, Iijgw I 3213 ' 2,13 I' 4 ' L ' ?,iIfQ II Wifgf-7 :fy-1 Clegg ,3g2::,iI ie, 135 Y-'I ,LTQ9 I I I -I III W .QF I if-3 ZQZJEL M , ,Y I , ,,.,m A , , , ,I T, 93 Q -71, gg? f 375'-:I--1 -if-'-f-v-f'-'f-vfxfhxMI-ff?1IIvI-f,+L3-ifrg-gf:-F'-L.qQ,..:i5,,L'II- Q I' In fIQ113iII1J'II II, 1' ef 1 :QQ f I fi .I II'4X'fILI'!lfl4fLH-' 'I'IHH5I-dXI1'lII'- 'III' I JI MII f rf WWI 1 I I gi I L.?1FI?cIfT'f' Riff' fail'-If I I I Iwfv ki f54i'1I f If Fifkimi' M 9 ii r T WTI! :TWII9 f 5 I4 ,H M . M, A I L ,.,Y f ,M , I NI . I f Il I ,IVLI ,I Ilfx A49 6359? ,I I, If-If ,, FV , ., , III .,,.I Q I fi, - I fi. Qi II I . I-Kuff fII ' If--I' Irf II III I II. 'rf 11514 I I V' 'XL .I I v ,i I I I II yffjzl-I'WII SII1IT'I I ua :gee II+WiT:II'MF'rIIv II III TA, Q Iff---Y ,f il Y :Ip ,I ' , I I I I I .KX I f 6 . II 0 I II I IQQJI,-,EH MZI I Q-an 3-qw,-I-ff1rIvJ'p-SIf?.ffigf III Imfimfw- 11 I II I1 IIQIIIII 'I HI , I ., I .IlIIIIIIbwfIII' KIAII 53926 ' I I fff'I1 Gy f f: , II,3zfIgf' IfIpIz1tIII I Igzgji Ig Lgsif.. if ig? ' , QA I I II I I fy KAN ' I. If ry f'Il:fI 'QQI I4 w??4II1 ff ff If . ' '-,QW I I 3 'L' 4 .! F fl f !I1'I4ff5ffXIIf-' I ' I Q If I I IE: : I I :KI ,III ,f'I I2.f1II.,:If My II5 :4'i:fE.fEIP-Efgiw Jiri- -fZ'ff'Z fb- .'f'fL - 3'fQI'I'1-I I I 'iff Q Q' ' I f1'f'fif5If1L'iffi 'fT'I I If 'I?? 'Iii-i252 fsiriil Ing' ,in I I ,Xf if 4 HI I ,Y A, ,, I I 9.1 Il -U HF, -5,1 X., 1,83 II Ig I , ,-- Qqxy- ff, --If :I 44Zgfii1?:Z I ,ff I III i 0 .- +49 QQ I4I2i? Zf1Wifi?-RQI IIQIIIIII' III! I,A ,rgffjfixlgl I- gg? X1 I yf4eIf21I'i: I :Qi ' III ' ,I I 'g,i-- I , If J A ig., Y h ix I- I ...-, ..-..I.,.... ..,, --.,,.,,, fI I ,. - I --A I I I 594' A T , ,,.,,,,,,,,,,,,.rr-run-r.:-a':w,,a-1.1. .. x .,..,... . . , nw V-'Mx TT1'i':1ifLu,...,. ,-.ki X If f . f,, I . ff 7 -5' 'rf' 3 f dsx- Y -i , ' , ' f mf Elfiffjffff. fry, . ' , ,H -,1myiff2-llafgssgnanl ff?wf5kf .Wm' .1 in If f ,, - N f f- . . 1z:,'w f..1s'feff.1 V1 w ww Yf'KQw,?k-Qfiffmz f-fg . . X 'Viv '!' ' WM g'M f957 Q'Xf'if ,W'?5 !7?Lp'JllffffffLf.f '- f I ,rw ' lik, -.NE1.:.W ,pf -UK XY. Y 1 Aff X 5 E My I -lfT'j 1 ' I l- I, ff' rf:3-5?2ief1.25?i:,f?1T??r?'i5? 2..Jp:f! 11 f.f,f:j ip- 425'-if' T: -f - K' ' ' w ' ylffi, pg tg.. ' A if ' ' 'A K I , Q , 1 ' 3 I' . . ,A A ' Y D 'Q 5 ' Q Z I :in X, r ,m A ..,, V . 1 ' X , 'MK M s Ji 5 K, K fu, If A 1 W Y X ,Q T S .,x, ky , f ?f,iij, fffj, '- CPL-'ff , . ff if- 3,-f 1. . U, ,..J- . , Ji ,ff ff 1- XX' i. 1 S ,f J. I :JA ffff 45: uv- 2 ., , , f.f f f f K f ,WH .r ,f.,', 4 A - rf if 1, f , 4 I ,-- - 'fy-ig ' -C ff I . j. 1 ,yiyrfi 7- K lf ' 5 K: k f, .ff Tiff 2. 1. rr Ak. 172. n-,, '4, ff- f ,, M, ,,,-,f ,M ,,,, ..-. I, ,K , 1, 4, ,- , , ij-11.3 Vai, 32 1 f ' .11 ' f7,m:.i IA, f -J V ,J C4,',e.'Q V Zfxfg, I 'rf' , 1 PX' QI' HF1C'f,,., ij ' 5,' --,, ,ff I ,jqfinx 'fgffj i -ff ,fl gf-461-E -' 1 7 Ill--'ZZ '1 rvfy!f5L-pf-I.,-f'-!'ff',! f' ,f f 1 , ,!f1,4 -a11,,. 4,f-- , flffa-5 :LZ4f 'f5911. f. Vnqvl ' 'flf ?'f'jf.Q '41 , ,QC 1 :fs--Qmxffv, .f ,- f F Lf ' ' ,fi C47 .Zi lil Q Cf 'iff'-1 v, NT 5 f. Qi' .fff.'. . ff gf f'l,'r ' 'fc' , I-,V , I .fl mg.. --. f, 1 1- L' b ' I V-Paz QQ f .X 1 Lf. -f F L f' .- J , 1' -ff :M-.,.,y1jLy,5 ,A-' ffjfifiy-uf-4 fx' 'f UTLAF A17 u -I-:vi-f Jf, f-f ali' fx n' - f f' ur.. I' far, ff . 7-,At Mm-L1 FQ47: f 1' 1' '-A ,k ' - F r 5 cf, f f C Ap: ' v J' . -4 1 . 31iH,1!,.:'f,, H . -f fi? . ,T I .:Af .:jfA f 9' '- P A 51?-,Q2'l+i V fgv . ij? :J 6 ,-,N f'7',x J N A Lvggigxf X SX, rx 31-Qc riff! ,L 5-YPQX M14 Cub' 'dll' rjiflcwx '1'iq 0 1 x W-1, I-'rf-7-5-' 'T'::U'vK- J -'3-fb 9' N5-R 5:1113 A' -J . -fflqw mga? 12 'bij' fxx-xy, , f 'iz- F xzkgxf .ff ,if ' R' I,74QA 4- 24.- 25-1 A .wi : -f i .,f'f54- f . - if e 5'wgfy2i2.:f4 .s . Ny' fXvN.?' x935F5f 1- - : Wh xrvz q,,f5,?:'h--,'M.g4: NJ. Q, X-V35'Q.1'fjvQRx- f M li fi 1 I'.'1-Q' 4 ff 'ijflff may, - 'V if 'LL-'N, 1 L-vii x 'CR -f' ' -N - 4 N1 . w. ,, 32: jx- f fig X In X N If Q-- .sJj 'R,..' 1. 433757 34 if 1 Q fx QN f- 'iwxg-'ix lu gQQ:.:,il!.5E1Qxg VfiI1Pc?Ti9E1f'feWNiC 'f V L: N. A mf- Qu. ,- 'ti' ' S .44 -f 1- if PN-1415 as ' r X L :A sk . , , . Hg-NN3, k'X . ,. ,QA-Tilt 'H hi, ,j X K.. iff? f 1'+5C5fi'f-vi - I-I fy..-+ Tv- -v-- .312 NY . V,-A M x.:' :Qu-,q, -L.--or 11 A .Vp ,. - -----...'-.3 fi- L K-'50 N k X - X ff' gkq + X xx --. X., . Q V.. - 5 x -is P . . . , .. .vw-5 M -X X '- ' T . , - f E '-- ' 'if-.-zgnsugilki' f-sf: s f ' -fx.. sa 1. ff ,- - 1'-vfffz' Q ' Q WX-5 ,-- 1 X: 5 ,Hi Qu-5 4,1 ,-.VT-. ---uf--r , f. ..-if p ' W , rn.: -I Q- -. - + ,lf ,X -V Q-j - ' Z f . 9 W ,f1s9x9 ' + 'Wh 11f Ui??gffw , + i x' 1 ,!,- 1 ,:,,f -74.53 A Y 1- 4 .x N fiqgx. ' . -.z 'f: l -11'f 'Q Kxls X. 'igigtrf X 1 -V 1 Qu. X X .A x.,,k 4.-, , A .i fx X 1 ' H61 :??1f, -X 2-2' , ' - -. -. g X1 x pm, gc. XQQQL D-.A -- it E ,' ...J , I A M .1 , J, T ff xl' L v f nfgfkggnf S N, V 'X 1 i ' I j U 5 W i, fi,xi.:' ,ill Xi , Lf X l'1A:.gqg7iffq. P1 X Q ,Nfl J ,1 N. ' x wx a.. pe: J fwf2 Q .Wh We xv 5,44 rf Q Q 'aaxqvi 1 53-iff ' 1-ES-X Qflff' A-. ,, -- f MQ . y I '- I Y ' . - f1C3:::fS 'EAN'--f wxs XXX ,gf - , : .X 4x-fis-?Rf?ff3i?iff?SiffE. 11ff72E' 1 I lx ,X-lx Q ,. 1 , I I Xx i 1 v 111111 N'1NmN1N11w 11111 1 xx Q -rpg- V A ni-'N 'R ' F 1 x N DN 1 1 1 1 1WY1 fWWW ' VYPTITTY 1 1 1' Tr'1'fff'ff 'fy-Vr'fr6il, . 1 Nl W V X k I 1 Q7Yx X1 7 xb'PN,if 1 1 R I VAN Nav X 45' w C, QMXQ5 .JVJ , Q11i,fQ 1115 R i 231315 1 111 41 H'qSTs.1f,QaifiEM1?fV? N R rxxly 1, S. W fzfl fx 4, QyfJn2PfgZ'Q, Y 1 11111 11171111111 Z3 F111 'If 1v1f1Vfidf1iiTT:f12JJir?w1'iiD9?a1X y 4 4 1 5 fffiff f if V111 1 111 1,1 111111111-1 1 'I -1, -X-X1 N1 W VN H ,A , . 1 F N 'X' N W1 QXEqWL1fg191X1fx1111 f, 1 Ill1U1Lj,,jI ff3f1if- , fm WWI -wg 4 ,, 1 1M V Fglfgthlj 1-1, I 51,L1DN.Q lg,1,'-ENUM' 11, ' if 3- tbl' ,Hi W XX, -11 Q11 y 1x offw 111 1lUlSf1V,TQ upfg 1, Q49 N Xxfgffqmyl Q wx 1 X-'T b U r W VY Ny UTXIQX K1 11 , 1' w 'N I V1 QU 17 Y' If BY' lW7h7f7YDN1 'T-171 'f f 5XAT.KIT?JY 1 , I anti. ' '. Y-E'iQ'i'.xQf 1:,ix'fWSx.xQ XY-if-A 11 K Q17 5 A. 72,12 gk 21 .Xrxfiffr Vgxn mls: if Y f 1 v 1. 1 1 1 ,111 -1 :V 1 -S, . XX Xi. 'f 1 f 1 .- . f.4x:f.. . w Y A 'g i t ,W L 1 1 ggkxy ..,., ,fy 31431 .T ,,,.. Kg l 17:1-rl-.,, K :rf f U' ,I I I I 1 gl, 'HI' J. 'QW T C- lJ?k X ily ' T1 LL , J' 1 1 1 ' - , ,, .11 x.:'xi:.L'L,: QL?.:gg,iQ N ff ' ', 'fx-if Z ', ' , 1-ff -A -.fs r TQN4, 1 i W 1 slizxg Q Fi2:r +- EX 1 wifi J Q,N. E 3. 1..- , X-, -, -U --A ,1 N31 ,diifigii qui? 1 my f N !1, 1 1 111. 4 1 , . 1 f f, .r 1 f:'ji.1Tf A -- WTFI3 a1Fl.fJ1V:':'pbZ 7 ' Wil V 5 b ' f 1 ' 5 EQLQXN Pg I, f ifiQfg1f- A,., f, if 'L .'.' Q13 1 1535 951 Z I , ' f 1, I .WSI :1 ' eil. lj? 1 1 QIQI. I '-., . 5- ' x51 .f A13 A vA2'g..1: -', C- xkgili 11 , Q:-L, If V - - -. Nl- N , 5 , - fk'1 'Q ,-'- Mix? '11 1. 1 .af ., M111 1- 1 Mi 1-fl A fm 1 1, f 'J' I 1 '. .,.:. jg , cg! 1 .lj ' ' 11311 ' x , 'W 31 I., , , A 5,-! lvf- Eiifij w x fr , jf ' HQ - N- 1 : I '. 1-A - liff- .-.- 1 ' X 1 ff ,Q T57 Q R ' A ., .,.f W ig! 1 , .5 fix ' 'Q 1 N '1 - ,Q-' .- 1 A-ei - Y- 1 - .1'-' i-1111- ,-.,'s5fi f ' ' 'X ' 11121 925 ,-,4 ' r '3 - f J . 1 X11 4 - N - 1 L, f 1 fiffxh 1 'F 1 Igjii. ff , L all-Q! ! 1 -I .. Q ,xx 5 N '5 1 - , .xxvrfxq in , 1 NL E I X 2.121 X111 -X nl . 19-Q. wil' . , ii? 1 211 '11 1 - 1 x 1 , . 1 , N -Q K X . fi Ll 31 511 Q L X fx, ff fn! -- 1.-,Q 111 --JN A 5. 5142 1 1 f. f , Xu q 9 xg 'AVV is ie 3 1:15 M51 iz Fl i QQ 1 1 ,:E3111s L-gli: ' ,iii if 'r A 3-E'ji?,: EFT? 5-11 1 ..' -- ' gif, ' .LL Lil X 1' 21:1 1,4 V 31130 ' 'V ' 7fi'a ,:L ,A ya f Q: -, 1 w1fQg,+tg,5111Q'1-3 P -R FF:-1-'ffil' JH. ' 1 'Q 5 L 5 -1 '!1s'Qfsef519l,4g k5g .sd Q ,N 43, ,- 1 7 s, . 41: U J JI 5-,M V ,-rf4'?'1.' F 15:32 -L. 1 V Nl 123 .1 QJ . Y MN. f ,Q-x , 9 CJ XMEXQUEZQ , - W. Mfnj V V ' UBJQXQ 1 1. QQ 1H,wf'QQ-ff' V '.1EfL.1, x,-,jggw-,x,.D' - Wi ' 1-Af-An-.?q,.,-.,,-,-.w -- W1 E'Tj5511.iE- 1. or , H , , , 'ii SEMA, N X1J,,xA,YkVuF-0 if., :Q :Lv-wlwl 2,--1 if ,!.x.. ...lb 35 3 I 11,153,131 A L f 1 4 1 ff11-QJQQ1QXWQ-'21511VW5gW?i5T5-XWREFQSSJTZEJ21T25UF2if1151 13155 ' f 11'f..i.ii.i-.ZlTT V l: iii:--f 4 1 J 44? 1 J:-, '71 fyii -Q 1 , -H11,Z,?111gp!g11f1J1'1E11 1111TfTf'1T1''11' 1Wr:','--:,.,4, L N ,nx111 fgpffq f ,J fic . ff,i'f:1T-cfvf -1 1 I V11 ' 1' Y 'iii' l' 'F if -I H2533 I Q1 1-111 11 -1 1 1 aff111z':f:- W' Q15 -4 - , 1 12 jjf 1 1 ,. 1'1 11 1 l Vfxigsvff 1 ggyifzjjj 17 QAQGQ1 .5 Q Q19 1 69 OX MW 1 11 1p1,Q2hN21,111w11 1 yi wff1mf,A,,fZf1S1fgL,e1f 1111151311112 1 f 6 , ' 0 is 1 J ' ' K' .J 639111-'- If 1 - 1-:'fwf411rf4Y145711521111 i':CFf,11t- , .JK XIX M-Vr l!ll1 NNI ,iaiv .,'.,42,,,,y . 1, , 3.1111 M .AJ J 1 JRPQ, 5 'Q -X11 nxqff. 51:7 1 'A' iii 'iw 92251 5' 2224 , f I 4. ' 1 , X,-1 ,-IIA, 1 f Z vy -1 l, Q , yflj, - Qs 1 X .ff','J Q I1 XfV7Q1'7', 14 5 M' 33.15111 I i'LQ?2'f A f-1. 1 S - -y 1, 14 'mil f'l,l1'Z2A4Z1 1-we? '1f 111:1.1S:-41 'I '- - , , ' ,ff'f1f1'Q','1A'i,51 Tiilbgf f I i v 0 1' !7':'+ 1'ff11'2f1' 11 ' 1 Q. 5 f1fl1i1'Z7 '.'yyf-J -f-ff' 1 1 15.2, '1 ' :QQ 41.141215-14ffe1f, 51111 if -. , 1 I' Q ' fl 23: ffQ f'..-k1i.11f'-f.fx L, fi? 13f1ijfga.gir5 1 1,15 Q 'L 1 159 ,ffl-f,g'1g:j 115,161+ ' Fl, I lags -L441111 I 1 1 1 fl'-.LQLQ44 1 I Ffgg as 1 m -fix fs, ' gi- -- 1 3 , .ax .TX 1 I , - 4 - ' if W.- ,.,. ,,,.,,mh,,,J .W , 7 W, -A.. 1 -ir- ..-NLE. A 'l ' N I . ., -1. IW.: f-' 55-,I If I r.- r.' r -.-I I .-15 f. .i'I I.: n. . . if I 3 I .51 -I Q., ,fo f ., V -.vA N V ' I Av,jiA -,fl 1.- f+'5 S .. 1,33-: ' :'Ac 'f 'f -A -S:-. ..--..--f- M- --ff' 3 ':f : 'V I ,.E.,.. --l- ----A-- ---'----!'--WX'1:--1' ' hW ' I I p PCI m gn- i H ..... ....----R:--'za::I:::::nnr:::::::::::xmI:In:nu::r:::n:m:u:::::::. zz '::::m::::nmIlSf-'Wim' -' ' - I , , , , , A - A . ,,, . ...L .... ..., . 9 I Il Q f 'fff . ' !I W ' ' t' I1 I Admlmstra 10 I Q I Q j. I If I W! A I TEES OF GEORGIA TECH .gm BOARD OF IRUS fflgiiif N, E. HARRIS, Chaz1'mfl?Z V R. I-BLACK G. H. CARSWELL F. C. FURLOWV J. W. GRANT E. R. HODGSON X. P. PRATT I ' 9.1 A . L. XV. ROBERT, JR. ' 'I 14 ' 1 2:3 I H13 Ex-OEEICIO MEMBERS T3 J. M. BROWN U Tx. W'. HARDWX'ICIi G , CLARK HOWELL fW. E. SIMMONS ,SEAS M. M. PARKS i fy. OETICIERS OF ADMINISTRATION JI Hi I AIAIIION LVTIIER BRITTAIN, A.B., L.L.D. H. . . President WII.I.I.xM HENRY EAIERSON, Ph.D. Sc.D ......... Dean I,-,I J IRS' J , , . ALLAN BENTON BIORTON, A.M. . Dean of Nzglzt and Summer School FLOYD FIELD, A.B., M.A. . . .... . .. . . I.. . . Dean of Blew 'FIIOMAS PETTUS BRANCH, B.E., Sc.D. '. , Sem-eta,-,I FRANK K. PIOUSTON, C. P. A .... '. , T,-easy,-er HUGH HIXRRIS CALDWELL, A.B. . I Registrm- I LII? I 'IEW ' E59 I fiij TIE? QQ oS fXOX N EL A W- A A I --' if ' - Q Jw nog?-N YR'RH'r-C942-RIN-:-2:2:1-N '-'waxy .,'- Enzo- iff ,-',.' P 2' V VA, ' I1 7.72: if f-il' i ' ,M 3 ,gg-S' S -:Ex OX. '-.1 I. 1 'KO X, ,Q if ii:--f XTX 1 . Z9 fl 75 I gmfx f 'SPN'-'JA' jf:- , rug, .. if: -'X-' -veil ' gigwhh l .av .'1 i 'ii f 1. It I IIQSREEQ-i ll! lmlmlllllluwmlulmum-muummlmnu m -mi -mn S--,Q --..,--1y m --v-4---'-,-.1v.' Inmvuu-m--n-I 'I1:-n uuuinwri'-1 xvfv- w -4f-------- - --llb I 'l -1 'f '-' I ' ' ' ' ' ' U.: :'2iiiiHg!:Lg1'llHgm'lvlllQ gg , AT! y- Ml' IN' I - ' DLV E., A P PSIN I mi riiix ..... ...... ..:mau::::IIIm:sxuana.f.:. -:- '--- um.-::::a:::::uun YI -- I:l:'.l:l.1x.1r'.:.x:a::::u:u.-zissnsnauu::us:xn:u::::::::I:na:::1::::::::s::::m:::x:::::n.. ........... - .xiii ...... I at E . , N - i, S I 'I I y Faculty , MARION LUTHER BRITTAIN, A.B., L.L.D. I A.B., Emory Collegeg L.L.D., Mercer Universityg Graduate Work, University of Chicagog Kappa Alpha, Phi Kappa Phi President of the College ,. WILLIAM HENRY EMERSON, PH.D., Sc.D. 0 y Ph-D-, Johns Hopkins Universityg Sc.D., University of Georgiag Graduate of the i United States Naval Academyg Alpha Tau Omegag Phi Kappa Phi Dean and Head of the Department of Engineering Chemistry ' gi l Q FLOYD FIELD, A.B., M.A. 5 A.B., YVilamette Universityg M.A., Harvard Universityg Graduate XVork, University of Chicagog Alpha Sigma Tau Q Dean of Men and Head of the Department of Matlienzatics Ii , D ' JOHN SAYLOR COON, M.E., Sc.D. 5 ME., Cornell Universityg Sc.D., University of Georgiag Sigma Xig Phi Kappa Phi K ll ' Head of the Department of Meclzanical Engineering tu I U E R R SP1 W + isr- 1 THOMAS PETTUS BRANCIJ, B.E., Sc.D. B.E., Vanderbilt Universityg Sc.D., University of Georgiag Beta Theta Pig Phi Kappa Phi Head of the Department of Civil Engineeringg Dean of the C0-operative Department, Secretary, to the Faculty ' JOHN BASCUM CRENSHAWV, A.M., PH.D. A.M., Randolph-Macon Collegeg Ph.D., Johns Hopkins Universityg Graduate VVork, University of Berling Gamma Tau Deltag Phi Kappa Phi , T ' , F'- all? 1 vii I - Q 1 glllll' l El 'il I ll Z v 5 7 t 7 4 Z t f A t ,4 I 4 2 Z f 6 I 6 4 f W Kr? Ifead of the Department of lllodern Languagesg Faculty Director of Athletics JESSE BOLAND EADWVARDS, B.S., B.E., M.E. B.S. in M.E. and M.E., Alabama Polytechnic Instituteg Graduate VVork, Cornell University, University of Chicago, and University of Michigan Head of the Department of Physics JoIiN MADISON XVATTERS, B.S., B.S.C., L.L.B., M.Acc'rS. I B.S., Hall Moodyg B.S.C., M.Accts., New York Universityg L.L.B., Memphis University of Law School Head of the Department of Commerce ROY STEPHENSON KING, M.E., M.Sc., Sc.D. I i M.E., Ohio State Universityg M.Sc., University of Minnesota, Sc.D., University of Georgiag Sigma Xig Phi Kappa Phi Head of the Department of Experimental Engineering CLARENCE BERNARD SEAL Graduate of the Philadelphia Textile School Head of the Department of Textile Engineering -501 6 14 O lil RO il P ik?-ZA , N ii xi, al ll ri 1 D 4423 LJ il YE. III all D 4 mf 'Q u Ju 'T N ug 0 in if X kiwi! A4190 L L 0 xt- ' -sv S. o 4 09- I Wuxi' 'i: S 0 ..:::!ilI U :45Iii55'H1-- ' ' - W- -A Y L L ' s A . 1 if . . ' f - Q ' '? 11,177wmm!ffWfWywM1W.zMf11 fffffffe5l?lgo ,E A ,I ,Q 0 9? A .A ' '- , - A ' I Q L . ' f S' Y ., 1- '---I-:I ' . -J .f. 15 'aiu'- U LLOH QL K. - -, - .. vu, I-,539 K .i1.:-- ,f X A -'idx-T 565 Q JBBSQ P II , - yoii an Hi fl 7 a I . F P ........... If 4 f ,1x' .., - . N f q L lx ,, I I IQ , N QI' f J ' I V i ' 1 ff .!, 4 .I A 1. t. -A i , e'- ,QQ ,,,4,,A .,... T I.. .... ---. ' I5--Iii-HH f 'eifniiff-'i'3 ' ' 1 Liv-fill f,,,.. ruin. , ..... mawuwualacw-ff-v--v-v---'ww1 - '- f' P V lik' Il' 1 ll T H E B ................- - :gf-a::m:n:::::.1:.':r:::::::::::::::::::u:maiu::::::::::max:l:::r:::::lln:l:a:::z:xr::lwls:..... .i.'HllI V -y1J1m.-...n..-.,.M..a...QH.W-V--fmV 'i'5 ' 'W 1 if l Wi alll S M E Zi fQi3flll THOMAS XVITT FITZGERAQDJ B-, - ' ' Ph. 15.S.M.l1l., University of V1ra1f11f14 1311 MPP? 1, y Head of the Department of Electrical Efbgmeelmg 5 , I ,ai - ' ' 1 lx CLARENCE EDWVAITD ICooLEI1GE, PH-B -2,5 Ph,B, Ya e DIVCTSI y .gl 1' ' - ' f Head of the Department of Machine Design lfil f Will 1 A B l ia, VVILLIXINI lx'LlONROE BICLAURIN, . . . u , .71 A.B.. George Peabody College for T6i1ChCI'S5 Graduate. Works Unfverslty of Chlcago l If Head of the Department of Incluwffllll EdU011f20Wf T ,,15j 5 if Fifjjlf FRANKLIN CHADWIICK SNOW, C-FH I C.E., Ohio State Univers1tyg P1 Kappa Alpha I Head of the Department of Highway Engineering fl 512 . . 5 ll' algal XVILLIAM GILNIER PERRY, M.A., D.LI'1:T. u llgalfr MA., D.l,itl., Davidson Collegeg Kappa Alphag Phi Kappa Phi 4 Head of the Department of English ngggn ggi, TliEOllOItE SAUNDERS DUNN, B.S., M.S., E.M. HS., M.S., PLM., Missouri School of Minesg Pi Kappa Alpha Ifead of tlze Department of Geology and Metallurgy V ' l 11511 ' ,3,gljll,', JOHN LLEXVELLYN SKINNER, B.A.Sc., llI.ARCH. Q91 'iifif lS..iX.Sc., L'iiivi-1-sity of Torontog M.Arch.,'Harvard Universityg Beta Theta Pi Head of the Department' of-Architecture l 'gf 1 i Q l ANDREYV LEWIS PENDLETON, JR. u i i, Graduate of thi- United States Naval Academy, Major, Coast Artillery Corps, U.S.A.g H. ' 'k g Kappa Alphag Phi Kappa Phig Honorary Member Scabbard and Blade if-:ll i Head of the Department of Military Science and Tactics 5,-if irui 5 HUGH HARRIS CALDWELL, A.B. ' - ,523 A.l5., Davidson Collegeg Graduate Work, Columbia Universityg Phi Kappa Phi lil Registrar fy 1 If v v I h GILBERT HILLHOUSE Bocas, B.Sc., l ,511 Bbc., I niversity ot Georgia, 'Ph.D., University of Pennsylvania, Phi Beta Kappag 51 51 sigma Xi? Phi Kappa Phif ii Til Professor in Inorganic Chemistry , I'-fy 1 'fn , ffzil X i 'IX I u V u I XVILLIAM VERNON SKILQES, B.S., A.M. I Bb., Liniversity of Lhicagos A-M., Harvard University? Beta Theta Ping ESE! , p Phi Beta Kappag Phi Kappa Phi limi! Professor of Zllathematics 5 I Sill Vi' JOHN LAWRENCE DANIEL ill 1 gjil ' , M-A. 1 g M.A., Washington and Leeg Apha Chi R,hog Phi Kappa Phi all Professor of Industrial ,Chemistry itll - N N ' EDNICND WEYMAINT CAMP, B.S. IN T.Ei. B.Sz In T.E., Georgia School of Technology I Associate Professor in Textile Engineering 'Qi THOMAS GRAYDON SEIBELL B S K W, - . J - - IN E.E. N, B.S. In E.E., Georgia School of Technologyg, Phi Kappa Phi Associate Professor in Electrical Engineering S . I -. I :- ill? i 1 ' i is Q E X G vp ' A 50,0 :Q haw W- Th! lm C - Ta + O , 'Swv X, Y- , , aifjf 5 X 4 i - ml ' - 'f' i. '-- I l WLixwmzGSSremwxmNNonEox3r5gwQ9g,,W9,H6,A:M E ,M .1 F, -. if L , Y H H l V V i LPM K' ' ' ' A ZX , I ge A ildn-'wbHm l'f' X 'ifgl W v 4 ' 'H I :!gi5g::H' ,-'I DJ ' 'h . ,QU - H W'-'W -- -- A X C AJ , - .U U 1 A - D is ' - -K , .U . v 'T PLS ... . ., '-A-'gsa-sglgafghz -,ii l H. V fi . f Schools igma, Cornell University f.s.13!4E'5 ' 'fiS!l ':5si1 l 1 F '34 .. .gr . . , fs? ? li-.M:..l4is,.. , . ,fig W J.. eseasssaa3esgi55inIrlIREIigxgsrm-wvmivwvxwIuIl:GlunlunxusnivuusInnuu::Rh l. A A 'N . :f:--1-1f- -mf --xfff mm: ui I I--H Eigiui x::'::q: .xiii Ll!!! . .. lfl l 1.', 'l !!x I llI1LUlilHlH'nllIU' n. Nllllvlflilf! l'-, lxl ll ,l lf. '5' 'Wu x l ' 'U 1 '7 ' '7 V '7 ' l 'H rm' I 3 I E. 'I ' . R ' DLVE: PILI 'i' Qllluhli-i A-..---.-----.-- . .u3E1ZiiIliIIIIIFISill:EiIHFIXHBFIiiIlliniHllilililllliliillll ' IHlili:IiiillliiiiIlmlllIall:2I273:IIllIII:I:IIIII:IIl:II:IIL1:2HI:I:H::11F:THU in':uiHIiuifnnfiiiIiiFiI:HH:IIIn:FHU:f:::::::'i:l::f:i::::' ' Il'l H 'X itlr igi h 4 C S 5 S ROGER SHEPHERD HOWELL, B.S. IN M.E. E B.S. in M.E., Georgia School of Technology, Phi Kappa Phi Associate Professor in Experimental Engineering ALLEN BENTON MORTON, A.B., A.M. A.B., A.M., Brown University, Phi Beta Kappa, Phi Kappa Phi Associate Professor in Mathematics, Dean of the Night and Summer JAMES HERBERT GAILEY, B.S., IN ARCH., M'.S. IN ARCH. Q B.S. in Arch., M.S. in Arch., University of Pennsylvania A Associate Professor in Architecture ' 's , DAVID MELVILLE SMITH, A.B., M.A., PHQD. 1 A.B., M.'A., Vanderbilt University, Ph.D., University Of Chicago, Kappa S Phi Beta Kappa, Sigma Xi, Phi Kappa Phi Associate Professor in Mathematics J. RUSSELL JENNESS, B.S. B.S., Dennison University, Graduate Work, University of Chicago, Associate Professor in Physics CARROLL DAVIS BILLMEYER, B.S. IN M.E. B.S. in M.E., Virginia Polytechnic Institute, Phi Kappa Phi Associate Professor in Machine Design L A E 5 HUBERT 'EUGENE DENNISON, A.B. - A.B., University of Tennessee, Alpha Tau Omega, Delta Sigma Pi, Phi Kappa Phi F.: H Associate Professor of Commerce ' EARL HUGO FLATH, E.E. E.E., University of Cincinnati, Alpha Nu Sigma, Tau Beta Pi Associate Professor of Co-operative Engineering SQ 1 4 XXX2QQ'Q2'2QQR It li 4 W I rs . ,I Ht ma 1,7 A ARTHUR HAMMOND ARMSTRONG, A.B., A.M. A.B., Yale University, A.M., Columbia University, Beta Theta Pi Associate Professor of English . JACK MORGAN SMITH, B.S. IN C.E. B.S. in C.E., University of Wisconsin Associate Professor in Civil Engineering ROBERT NEAL THOMPSON, B.S. XXKXXXXbXXXXXYK2SkXXX3RXXS X . Columbia University, Phi Kappa Phi Associate Professor of Physics EATON WEBBER, B.S. I Lambda Chi Alpha 4 Associate Professor of Machine Drawing D. PETER SAVANT, E.E., B.S. IN M.S. IN E.E. I E.E., B.S. in E.E., Rose Polytechnic Institute, M.S. In E.E., Harvard Umve Phi Kappa Phi Associate Professor of Electrical Engineering x'ixxxxx 5C ifm xfo J O 5 4, 0 IX B.S., George Peabody College for Teachers, Graduate Work, University Of Chicago, B.S., Massachusetts Institute of Technology, B.S., Harvard University, rsity , 13-il I l 17 E 142 45,4 Ji l 0 mu lfll p 1 v UQ nge. A ll I . . .0 In ,. . 4: ' 1 Z X l es 'W NW Y L ' ' 0 xl' ' , -' , o , Q. . ,lp V 'NJ f ., Q -, 'E:. iii? - ,,,,,,,.. is A A A A- .,.,n4i5' J - . i if ' ' 'ffffwffffl E ' A E V '4'iW-'s ' ' X ff,m Wffy!111mfff1Axffffwffzf ,, AQ i rl ,4 I A L , . , fx Lg L r ' - .. ' , I ' I I. Q' :a...::-' . I H V LIONEL K- Q W l un ' -: W 'I , I ,iliiiiw O X 0.7511-f., 1 - 'O 0 'Miss Q ,- t -iq. I- q o, 1 'If 1.4 iff N ,. .-, i i . 4' .U 1, 31:2- - i ,l 1 iw' ,Q ll Ii ...X 1 ' :fr ' ii '.js .,., ' r A , -,, if I i , . A., .... I. ....-- . -..-A- fW- il . .'n..5m-...Z,. '-LZ-' .,.,. ,..-1 -.,- i --.-1 me--v4vv11f1i '- t ' I 5 :' 'A' ' A G S i K gg: gf in Ab L - -si-':':x::::::::::u:uu::.Jlxm:::'.:::a. ,...,. .. .1 ....... Ek, I , ' V l I- am,umm,: g.. ...., ri ::l::::::ImmuIm:.:::Ir.z. ... gp, Q- W-iw FTVVI -M ,,YA,,, RWM, ,A,,. ,... .,.,.1... A ...1. REP- -0' +--- ' ' 'una ' fm! ll il A B PH D fel lift' WROTH - -1 - - . I- : I'-r BENJAMIN BLACKSTONE I i , . - Ph , 'M ' t ' Ph Ka 3. 1 LB., washington College, Ph.D., Johns Hopkins Universi y, I PP gi Assistant Professor of Chemistry if if ,gifif Y CHARLES ALFRED JONES., B.S. IN Psi 'iii ' B.S. in TE., Georgia School ot rooiiooiogy, . 1 l Assistant Professor in Teatzle Engineering ggi, we 3 If iff, DAVID LESLIE STAMY, AZB-, A-My Ph. ggi iiiff AB., Ursinus, A.M., University of Chicago, Pljl Kappa 1 ,wail iliiiw Assistant Professor of Mathematics , ,i F iii: LESTER COLLINS FARRIS, A.B., A.M. , 31,375 is Ali., A.M., George Peabody College for Teachers, Graduate Work, Columbia University H Assistant Professor of English X I' fif. gl fit' l if JAMES ERSKINE lhICDANIE.L, AB., M.A. H d il gf: .X.B., Erskine College, M.A., Columbia University, Graduate Work. Hari ar iifciai, M I University, University, of Berlin, Delta Theta P13 Phl Kappa Phl if Assistant Professor of English I iii? 'asf ry GEORGE HOLLIDAY LICKEE, A.B., A.M. I iigigi iii ,X.lS., Vtliishingtcin and Lee, AZM., University of Pittsburgi Graduate WUT-fi Harvard if V University, University of Nance, France U Assistant Professor of lllorlern Languages A31 - E 925, HUBERT DE GROFEUR SHAW, A.B., PH.D. I 1 iigff, LB., Harvard University, Ph.D., Ohio State University 1 ' I Assistant Professor of Chemistry LS ,K L, n ri I JAMES LAWTON ELLIS, JR., B.S. IN E.E. ' 'Iii I B.S. in Georgia School of Technology E Assistant Professor of Electrical Engineering F55 i I . Q I-his 1 NEIL In BEARDSLEY, B.S., M.S. .f x . 'i U B.S.. Hiram College, M.S., Northwestern University, Sigma Epsilon Nf l l ., Assistant Professor of Physics i HI I D HENRY EDWARDS GENZ, PII.B. ,Qu - Ph.B., Yale University, Sigma Xi, Phi Kappa Phi , im Assistant Professor of Machine Design Q I'IOWARD.YVARD NIASON, B.S. IN M,E, I . B.S. In M.E., University of Idaho ii ' i 14-982-Ytailt Professor of Experimental Engineering, ' 'N P B . XVILLIAM IDENTON MCEVER, B.S. IN E.E. ig 'EU .S. In -E.E., Georgia School of Technology, Phi Kappa Sigma I AsszstantiProfessor of Experimental Engineering f ' . f Y ALEEANDER FELIX SAMUELS, A.B., A.M. A.B., A.M., Lniversity of NVisconsin, Graduate Work, University of Illinois ' Assistant Professor of Physics A C 553, ' HIAROLD BUSH BROWN, A.B., M.ARCH. AB-1 M-Arch-, Harvard University Assistant Professor of Architecture i - 1 l v I i it x II, 7 ' if f 't audi? ' - 5 . 'iii X X ,' Y :'5mT533T?Q19 warez.--. --fee:-ws, f.,.:ef.,e. P' A . ' V l XT mgmi -' P ' ,- txt QE. . N XP X' A mmamo 5 ' B I ' ,-Kyo Biff! 'T f-TiT1ffi1'r'r i IQ-lxkf - X PYP l Lx s : sl-is I' '-:...,,,, V Q PM ' . .. V --in ' '-2.1-.-I. -.- ,. . , , ai s i : 1, ,. K 1 :IX IQ: :iii E353 u--- 4,1 P' J 1-xvl .IN D4 i'.E X Q, s J ,,.. 4e. ' 1 -2 :'lgg5Iiuvl.lnII 1351.151 gg - - :-- - 1.: fi. . I ' ' N x ,fy x N I I V 3 I E l Nw. 1 .. 4.-.A Q. 'D-1-0-:--S if . -. -' 4' X ' M, -.x -. f,-.4-E529-f'1 7' ,,u . A ' ly I. 'I f, A -i..f..s- ,. f.-rf'-f ' - A , .. . --.,., , ,--, 1' 5252525EEiiiiiiiiluIxiiEg5i5i5i5:::xxxnxmuuulmllmuluunumi-nmuunnunluulumim-mm.:u-....um.I--i..--um---.A1----E-n.,i.mno-iii--i.1-.1i..imW1-m....'.f-Z-i.---................m.............:...:.,.1,,.ai51-..:...,.....,...,.......f-...,-..,...4.E,.f....,.,..,. .,,,..,,.. U , . I 1-f ---- 1--I '5'::::li!:!x!1HlD mwfixlx, :fu l , ' , i , ' I. :xii 'll l I I 'I is III 'I xl 1 ll ul i . sz : a In . .. ... .....:..I ... .L . I sr ll Inxnx u I . I I i- ............... . ... ul. . . I ... .-. ..: ul V ly 1 N S S N X is Q X ,- NEAL MADISON LEWIS, A.B. A.M. A.B., A.M., Louisiana State University, Graduate Work, University of University of Wisconsin Assistant Professor of Commerce Chicago, JOSEPH ABELARDE CAMPOAMOR, M.A. M.A., Universidad de Bergos, Spain Assistant Professor of Modern Languages GUY WERTER THAXTON, B.S. IN E.E. B.S. in E.E., Mississippi Agricultural and Mechan cal College Assistant Professor of Electrical Engineering FLOYD HOYVARD ELSON, B.S. IN E.E. B.S. In E.E., University of North Carolinag Pi Kappa Alpha Assistant Professor of Electrical Engineering RAYMOND ,CHARLES 'BROACI-I, B.S. IN M.E. 15.5. in M.E., Georgia School of Technology, Phi Kappa Phi Assistant Professor of Experimental Engineering EDGAR CAMPBELL SCHROYER, B.S. IN M.E. B.S. in M.E., Perdue University, Phi Kappa Psig Pi Tau Sigmag Scabbard and Bladelg Phi Kappa Phi Assistant Professor of Experimental Engineering ROY M. NIUNDOFF, B.S. B.S., Pennsylvania College, Graduate Work, Pennsylvania Collegeg Phi Gamma Delta Assistant Professor of Mathematics LEWIS FOLTAT HILDEBRANDT, A.B. A.B., Johns Hopkins University Assistant Professor in Modern Languages X l n 'Al J ' in 1 I 'MD lijell 4IIll I lj , 5l Y 0' 4 ' W 55 .g. S. 5 ,. Ke Z . ,. f f 2 4 4 A 5 5 Y' 9 f I 3 5 4 THOMAS WILLIAM NOEL, A.B., M.B.A. A.B., Grand Island College, M.B.A., New York University Assistant Professor of Commerce PAUL RIOVVBRAY WIIEELER, A.B., A.M. i . Universityg Graduate Work, Columbia University, Phi Beta Psi Assistant Professor of English A.B., A.M., Columlzia DAVID EARNEST PHILPOT Instructor in Textile Engineering EDXVARD BLAIR VVILSON, B.S. B.S., University of Chicago ' Instructor in Illatkematics ROBERT IRVING WHITE, A.B. gn- 7 L L V 1 Xa A Fi33Z 'I 'I I HIH!l!l l:L...... EEESELE' limi N. 1 Q' S 552 . 'o 3 24 0 ,. 'Z fo :-' .eg ii t 4 A Q. X ,- -I 'Q u 1 lib l l 514' :Ed I kai E. ffm i i f 'BLi LIZ! YQ? N S 9 il i Y 32 . :Q I N J J . . . l A.B., University of Pennsylvaniag Pi Kappa Alpha f Instructor in Mathematics 4 f JOHN ROY BRANDON 2 Instructor in Textile Engineering 4 F9 2 f Sw ,' U W' who 0 v si Y' Qgfdw it ':.. N as aiuitii' so 'i . as M '- --1' I1 I I 5 H -- - X ,,,M,yffmmmgffWf1fffffmffffff ri A Q ,A n I n n S V 1 , LAOHEL K ., - .miihfg g.y,'1E,.-.1?p..i.' ,iggan-. Ar, ,lq? 11.- gf! 0 J' Jess 1 r ,S is , , 6 Q5 1 . A.. Q1 ii -1 1 'i it .., 'x-1, .gf Q1 N. i 1 1 ..1 li li - 1 1 ,. -is-I, ,nil Q ' ' I I4 , ,f,,.. - 1: - -r- ' -I J f W 1 f fe il .nazi- an :...:.. . : . .::T-: n'?.T..-a.........-..--::':f ': A' L N U Elin' T H .,,..,,... ., .Wt-.ti -.....-.. .... ...LE .:::s.-m::::u:::::::::::m :::::::::mm2:n:.-nmmzmmInsnmzzlnzszsuazxrnn-1:m:::mnx:Hlnzz::uzzz. .... . .., -5'L.. . ' v1:,,,1Vn .,,f,,. .. . , Y L.: . ti 1 Q iii 1 A I I 5 3 i A M i Z i i fi PERCY LALIAR ARMsrRoNG,'A.B-, ' I A1 ha ii A.B., A.M., Southwestern Presbyterian Ul'llVCl:Slty5 1 appa P Instructor in IVIathernatics 1 M1 Y A A B W I :1 I JOHN .LOUIS DRISCOLL, h. - I i A.B., Washington and Lee UrilVCI'S1tY tg: i Instructor in IVIathematzcs ith! WJ Mi? DAN BENJAMIN SANFORD, B.S. IN C.E. Q1 ,ii B.S. in C.E., Georgia School of Technology I-14' . . . . - 1 115131 Instructor in Civil Engineering V Phi.: i ' iynri ligffili EIAIQ 2511 XVILLIAM SIMPSON TAYLOR, A.B. il 52.1 A.B., Swarthmore College 11 Instructor in Engineering Chemistry -I 6211 M2121 igni IRA AMON UPDiKE, B.Sc. . D 31553112 541 B.Sc., Randolph-Man-on Collegeg Graduate Work, 'Princeton Universityg ,iiifli chi Beta Phi I Instructor in Engineering Chemistry 121311 il E22 1i liiqiiy' JAMES HERTY LUCAS, B.S. IN M.E. AND C.E. rtggggig 1511 B.S. in CFI., B.S. in M.E.,fGeorgia School of Technology ytlliil .i Instructor in Highway Engineering lt 1y,R,Itl, ' I-19 CHARLES CURTIS HOMMON A Eiga University of Chicago E! 35311 Instructor in Civil Engineering LQ, 11 ' GEORGE THOMAS TRAWVICK, B.S. IN E.E. 1 A ' A w, B.S. Ill Georgia School of Technologyg Phi Kappa Phi I.,.gij Ki! ' Instructorx in Mathematics ing, WALTER DEWEY FERGUSON, A.B. ,fggfgf-,X A.B., University of Pennsylvania Instructor in English 1' 3 ' i 1-' ' U N TIOHN BARTLETT SEGUR, B.Sc. M.Sc. I 'II1 1.3-.1 Bbc., Mbc., University of Illinoisg Graduate Wcirk, Harvard University' V Alpha Chi Sigmag Phi Kappa Phi , lgli, Instructor in Engineering. Chemistry i ic-iii ' i ' VBS' ' JAMES WILLIAM M B S A I 'ith' B S K . . , ' L UTIL, - - iiN' 'I -IN c ' -A U03 C01lCg6, Graduate Work Harvard Universit ' 'N kj! . . .' , Ya Tau K E 1 ' Fhlii in Alpha Chi Slgmag Ph1 Kappa Phi appa PS1 On, 15-1 Instructor in Engineering Chemistry I Ifgijg HUGO BRUCE DULING B S Wi h:'.' . . 1 - - 'Ni Es? B.S., B.S.E.E., Umve,-Sltuy of West Virginiag Phi Sigma Kappa Instructor in Electrical Enginegring' jf' P 1 N l E.1i3RgE.Enpn3R BORTELL, B.S. IN M.E. 11EEi,i - - In 1 - -, University of Michigan 15 1 Instructor of Physics ilggl PET2Hw1G,B-S- IN EE A ' - - -, .rmour Institute of Technology Instructor in Electrical Engineering 1511 .--111 10,5 , oxuq 35566 H O . Til - G r I O J 1fwgxuiif-ifie-rests-11492:-1.:g+:.-.n.1. :.N.g.p:g:fAgm.,.,W,,,,M: I 1 'T' ,P AJ iii V wid!! t '1L K ,, A 55 ? wiv- Q Swan-1-N-uvfgggi -R' -SS' +5 If HK A gig .... 'V 5 -raw, ng . . - :gg -L A 1-3. . O ,-ip!! ,ff E --f ., -i gf g -S NL '. XQA fx .fl f -iftcqw f' Q p? ,jef?',-,O O lll'N -E 41 - s .ft Sr 'i A WIJRIHWXVJ QA it I, iii .,.. is -f L. it 22 Q. ,. V1 an-siuultllii 1. I ---: mi Ri. . ........ I T ll E D LV A ll 8 .J ltlli . ......... ' .ilill I! l:iKilI'lllliiiiIiii' d I 'i'I I l'i'Ill !ll l Illifllllll' I I I lI Il'Il-Il Tl-III5IIl'l'I :SEIU-'lL'lI l 'l IIIHI7 ' 'l1ll4lUlulII fl' I'l'IIIl.lI ' i'I ' 'iiiisu L' 'WS' .::'54 4 7 I X f V M .Jw X N 1 I i ' N . I-V X 1 V 1 W - N -I ff ' M-2.2.3.6 1 I N4 H: K Hx., -4. , j ' 6 ' uf I X X ' K M' N -wr ' il' 7 1 mn' HN K A ' 1 VI'-0 I 4 i QU' 'mul I u ul lummuumim Lain ln mn I I im mmllinulm. uliiiununnini In ne: v new H 4- HHI'wwwIH-All-llllrhm 'I' I? ' L' ' ' ' ' H 'Um ,lin 14 I ' 'I' u x wi lx Huw g t I- -5 gl- I H ,fl mills 9: l l 1 1 .2-5 ll -' I -I --I I .. . .r..............na.. .. .. ' Imax .. . ..: . . .I . :::..... I i..... I J.. ' ............... I I 5 1- 'W f R ' Nw fl ' s is N . Q SIDNEY BRYAN ABERRY, B.S. L.L.B. I w . . . . . , I B.S., LgL.B., University of Mississippig Alpha, Phi Epsilon 'X S :. Instructor in Commerce ' . JOSEPH BLAINE HOSMER, B.J. 2:21 B.J., University of Missourig Alpha Delta Sigmag Kappa Tau Alpha K Instructor in Commerce LEONARD ROBERT SIEBERT, B.S.C. BZS.C., University of Georgia Instructor in Commerce l FRANK W. MERRICKI I V Butler Universityg Georgia School 'of Technologyg Columbia University : Instructor of Commerce ' E f. s X x S 'Q WAYNE KIRBY RIVERS, B.S. ' A B.S. In Commerce, University of Georgiag Alpha Kappa Psig Beta Gamma Sigmag 9 Phi Kappa Phi, Sigma Upsilon- . 5? i 4 Instructor in Commerce i - . f , ll J JOHN WILLIAMS JEFFERIES, B.S. wiv, L31 B.S. in Commerce, Georgia School of Technology, Delta Sigma Phi I J Instructor in Commerce ' M : STERLING FISHER, JR., A.B. ga' A.B., University of Texas, Graduate Work, Columbia Universityg ,Gin Pi Ka a Al hag sigma Delta chi , L V PP P . l l Instructor in English ' t l 1 - ' XIII Y 47 W WILLIAM LAWRENCE BLAIR, A.B., M.A. l A.B., M.A., Vanderbilt University, Phi Beta Kappaj Sigma Epsilon, I Phi Kappa Phig Pi Delta Epsilon g Instructor in English ROBERT HARWVOOD BROCKENSHIRE, B.S. B.S., Middleberry College, Delta Upsilon 5 ' 4 . . 3 Instructor In Englzsh ff! HARVEY JORDAN POWVELL, BQS. IN M.E. Q B.S. in Georgia School of' Tecimoiogy f . . . . Q Instructor zn Ewperzmental Engzneerzng ,I A . Z 4 HORACE V. SULLIVAN, A.B. . Z A.B., Dartmouth College Z Instructor in Modern Languages f . IRWIN OTI-IO NIARTINA l 4 . . . . Z, Instructor zn Teartzle Engzneerzng f f y HERMAN K. FULMER, B.S., M.A. B.S., University of Mississippig' M.A., Columbia University I Instructorin Mathematics 4 S- J' it Q as of b wx 1' 'Q' 1- LY K Cff 5 O I Q' I L4 N. O xi' f 2. 27. .. . 0 I sb' 11 'W QT' 4 .., . P lg. V .QW hgh' 1 -IW of v X S :Illini UQ 7 o N H 'M A 's ml 1 J f Q wkm, KJ f o!! audi f,-,Q g ,E NWN Q. JK -s i fix Lvfiyg'-i f-O Y LLM, L-4l f7' fs if JO ff wegjs .KZ HFXX. ' P2-wififa - . ix 1 fjo Qu V ,,,,i ,I ,L I' Nt - :al -' me nf R A T' ew ff JT , - se f. , I . Q-J ee- ff ,owmvwffiffwbxwav .X 5, 3 ,PQ Y I fW'f'9i 'f , ' L 'ff' ' I. agi ng' -Qf., gfQ,Qi,m:..wf5 fe Vi- 0 ...5 H A ,H x - . ,rv f X, ?,iq,,,r.l5. gp? 5? 'I 64 4 J S., -.si F4 Qs ' X - ff. ' f ' 3- Y, WW -gxi XXJFTJI-bf-Q Q0 - L x' v I' C X Jessi it i. cl! 1 i , i F i LEA, qw fix I ,A at I Giga X-tid' .ff ...... .alan-I2-133--3- 55975: ' -m f1 i-ggi' 1: Faglalgapf' ..i . - www-wolwelmlmsiniuwvulnum-vm-uw--v 1-I' H --1' -H' - - P ' I i! I I I I I D ..... ... .... ....um,........, ,, .,- .'i',...... -I 2 I l - ,...........,.., .. ........ -...v...,..... I ....:: ' :::-':x::zr.::u::'.:::::::::::::::::' ::::::::i:is::Ainu:ia:m:::::::Imn:u:lx::-'x::m:l::::.:..:..ax:...l.s....:.l... ......... . ,,, div A- -Jim 1......,.. '.' 5i7'f I ZIV I H A.M. '+ vit' AMITO PRITCHARD HEWLETT, B-S-, I f T chem I I E BSN ILM., Mississippi Cgllegeg Graduate ivorki George Peabody College or ea I, Instructor in Engineering Chemistry ' ia J. B. BRADDOCIS, Y . fig B.S., Ohio State Universityi Sigma Chl I Instructor in Commerce I I. I WAL'rER CRILEY, B.S. In E.E. . ig fl l B.S. in E.E., University of Pennsylvania Instructor in Electrical Engineering 'ig' IFE ii if I, ALBERT LESLIE GANDY, B.S. n IMI B.S., Buchnell Universityg Phi Theta Slgma iff J Instructor in English if f :Iwi 1 HUBERT J.. VVOLF, Ph.B. ill Pii.B., Yale University 191533 il . -, . - - 55 , li gm Instructor in Llectrical Engineering ,swf V - fi f SAMUEL CORNELIUS STOVALL, JR., B.S. in M.E. 44.123 E IRS. in MIS., Geo,-gin School of Technologyg Phi Kappa Phi Epi, Instructor in Machine Design it fTsPiQ ' fill CHARLES O. RHYS fa Instructor in Machine Design EDWARD ROY CECIL MILES, B.S. in M.E. -W iss. iii ILE., Georgia School of Teciiiioiogyg Phi Kappa Phi lg I' Instructor in Mathematics , A I I ' Y i GIXILLIXRD B. ESTABROOK, B.S. Ch.E., M.S. H ,, l5.b.LH.15., Pr-rdue University 31.57, Ohio State Univel-Sityg Gilmmit Alpha I, 3 r Instructor in Physics hi -NIOAH VVARREN, B.S. in Commerce ! 1 B.S. IH Commerce, Georgia School of Technology ' ' 5 Instructor, in Conimerce I . 1 I r A lf -EDWARD VBENBOW IMARTINDALE - f I , Chief Foreman of the Machine Shops - I I il f I wg HOR.iCE ALONZO THOMPSON FOTGWIIIW of the Smithshop l ift .3. rl XNILLI V 1 AE, AM AN HOUTEN I ii i? i K.: A ,Q EQ' Foreman of the Foundry N- l it ' x ll , AM I ' V 'I JOHN HENRX' HENIKfX E Foremaniof the Woodshops I .I IQ. l -I-OIIN' THOMAS TOPHAM l Virginia Mechanics Institute I ' it Instructor in Machine Shop S ,ls S ', it ' X fi gl ,aff Q I I gg G35 xx Y 'i G 'ia n I W J- tx ' Z? 2 X:-7.1.9 Q - I Il I U 7-ef -n :::::!E .. - f i LQNLL f- Aw, YI KIRK I - f ij ,-1T ' -Y -J LW, - - .... rj-. ' A ' i +--L-g,,,g F ... .NF ' ': '2:'1 '-I--.uf-. --- -.- . i i ...I ,Q . 1 1 -aw 'o ' Qj lit 'f di LLVV X flea egiisulliillfi1iiifl1'Iixiil1gg1:-rmunin umm : mmmmnnminiiiiiiiiiiiiimi ,.-. ----... 1 ...Anvil-v-viii--iilvimfmn 1,f,- f.T 'dii, -.... A ...... :i.l.'iiIIIi5.'-1. - . 4 Mia- .:..,, mignmi A - - ' ' ' ' -1 - ' ' ' ff 1 'f ' ' - g 5 qimmflslsggj 'L l iii ml ., . l Y ' z::! 1 c laus ...A - ..................... .i.:m:::I:asa:iam:::::::::::::::::z::::::::::::::::::::::::::-x---a::i:mi::.u:::.:xma:::::i::::.::::::::.::': I I ' I'''an:::::r.n::::Ius:::::I:I::I:::nl:.:l:x:.:::m:l:::::::: ::::::::::::.i ......... .-..:i!!. .... E 's 5' ,PW HOMER HARLAN NORMAN Instructor in Wvood Shops i ALEC WALTER BROWNING Instructor in Woodshops 3 U :TOHN EDWIN GETZEN, B.S. in E.E. L B.S. in E.E., Georgia School of Technologyg Phi Sigma Kappag Phi Kappa Phi f, Student Assistant in Electrical Engineering , s N . EMMETT YVOMACK HINES, B.S. in M.E. i B.S. in M.E., Georgia School of Technologyg Phi Delta Theta X Student Assistant in Experimental Engineering W. B. JOHNS Student Assistant in Experimental Engineering sin Y :M Qi 7- GEORGE F. ANTON .-5 Student Assistant in Experimental Engineering l CHARLES E. POWELL, A.B. . - , 'gist W A.B., Mercer University W . Student Assistant in Machine Design 't t I li , HENRY GRADY MILLER 4 , A Student Assistant in Textile Engineering 'ir' . . ly. V , 3 A -is jk E. W. BULLOOH 't Q, m y Student Assistant in the Co-Operative Department E ++ I C.rL. DEADWYLER E9 ' Student Assistant in Commerce H . iq I 1 '. . QU W EQ gift ROBERT C. BEATY, B.S., M.A. . B.S., Mississippi Collegeg M.A., Vanderbilt Universityg M.A., Southern '-if f Y. M. C. A. College 3. , .. ggi? 2 General Secretary of the Y. M. C. A. 'Tj 5. Si gi f f , .Q - KARL P. ZERFOSS, A.B, M.A. - S211 A.B., M.A., Vanderbilt Universityg M.A., Southern Y. M. C. A. Collegeg Qi Z Phi Delta Theta ggi Associate Secretary of the Y. M. C. A. A . Z JOHN BONAR WHITE, A.B., M.D., . if Z A.B., Davidson Collegreg M.D., Johns Hopkins Universityg Q Beta Theta Pig Nu Sigma Nu if 4 School Surgeon ii ' A Z Miss LAURA HAMMOND 4 . i rarian 5 2 Lt ' ,A 4 Miss JULIA HAMMOND f' . . 6 E Assistant Librarian fi f A if V :il 0 og,f:.gQQoQ Q V it ' 1 DQ. u' Y Kilt M' L N I M . ,,,,.. fl . ...H r Q, gi A gr. Wi gg 3 , Io . A . N Q -J 1 flX?,,'3f1.n.U.!,6C rl 925' .,1. ' ' - .2 'df '- f 2 v-,: ..Lff . ., ., I it V P PJ N , ., , T H E so , ceccc cit ,a . 1 .i ia . .,w, ,c ,: , ,g w. M, .,.,.....,.f -, ...,., me -. U Nm, IC' ri F fit I-- 1,1 mu I, 1' ,E Q ,uw I .....,.-.... ,.....-- ff P ' 'N 1 xx 25 x 0, ri y I ,r f , '71 , X , P 5 i 1 ff' x X t fi Y . ,, 4 ..:..,,,,..,.6. ,gs . . , , rr Q N47 1,1 X . I . 4 , mm-mwlunmmnuwulmm-f is nm. .1 vu im- .1 m umm 1 .um--mm 1 in 1.1 1 v -.11 - q ,lr 'K t nn- ' -U yi 1 ' -L i 'A L15 1 f 1 ww , 4. r-r--ta. an ...1 .1-1: ... .. .. s r . - . .. . .. ................. .... .. .. mx.. .......1...l. ... ...s.:... ' ... ' . ::- ' .. ..-- J I -H +- v fp . f 1 f ffy' 1 U I gl H I I X , I Q sf X, , rf 11 r, Y t f V 3 Z l r f . I fa s ' 1 f I 1 f i I fill? 6 1 1 I f ? 4 s V I f f 4 1 f r I E' ' I tif l I gl I f 2 1 4 4 '4 A K ,, -4 W.. Q-1 'n -I 5 si? ! N sc 79 ,gli 'gy Cur Alma Mater ,et tlfi f W5 il? ' i mg Oh sons of Tech, arise, behold! '- ' - ii,g'l': The banner as it reigns supreme, For from on high the White and Gold ,E Waves in its triumphant gleamg The spirit of the cheering throng 1 gy D ' a.-1 Resounds with joy revealing A brotherhood in praise and song W.-if K tv'-A ,yah In the memory of the days gone by. I J-'A' . , Oh scion of the Southland Magi In our hearts you shall forever flyj gg 15.53 --ar' r We cherish thoughts so dear for thee Oh AlnzaxMater, in our prayer, ig: We Plead fm' you in victory W And then in victory we share. Q But when the battle seems in vain ,'A T' E U Our spirit -never falters, '1 . We're ever loneninp joy' or Pain And our union is a ,lasting bond. t Oh may 'we be united IES? 3- ' - , . A '5 ISS' Till the victory of life ,S won. gg! W tea, -1. H. G. ggi: 1.31 N 'EE t E5 V 1 Q n 13321 Q' sis Nw desi 5 iii 5 .iii rig Q Wi' Q O ,,oXf,Q-fv 5C 'O ,7N.7fg mm V Q 7 H Anggrfgo r I f . fi! AVF Y+HQ4:y:.-ram.:sax-1.,xw::+Tsg.:gvmz:+gp,gg.x,M9yIg9'Naff!! I U -if ' B ,, L .J r- i L K V I - A Si A ga 3 K X Y V 0 J f. ' - . G ' 'a e -K-1:-m. -A ' ue.-5-M' A4..,1,-41w.'.,:H-- 0 L:A'q1 -'- -A. vt. .-, , M X Q. , lk 5x w Za? IW fm l H P ILI . ihumf' .az :-:::-: :mx:::::u mnx::: 'n au:-:um n u .:-:'::::': : :r:::::::::::::::'::::: :::::1:': : ': ' .: ': ': 'r 'r : ::::' ':': ':'::...:: .m: ':'::z. .4... .:f.:......Eif'5'!- , , 1 X ' A 5 . Q. I. X N ,gl X ' . ' 1 , -f 4' . ' i .., ' ' 1 , ' t , - 'Y X' -: - x P 'I' ,Q Q'-.:7?4 '-LS. 'o'c': f'C f J .. xi 'ifTi W'-P: E '. J Q' .-' K, ' Nw - . ,L f , .qs?37!:g. ' i HUM -x 'Q - V W 3122:-. - .- --'zu -: - , .. 1 9 ,.l ' :- - . -. ,-1' .r ' 4 mgggggggnw 1uxnimuHgigrr1ul:lul1 a Immun nu Ius.1IunuI1uuulnuunuluuufin-mww..mum-'C-in-1mn--.-.X-.4-...mm.n11nnun--1B--fhiuunv--1-.1-Er:.---.,,..f.-.. .....-...--'-----u-i-ni-f---ING?----F3--------'------mN,..-mH..-.1-mm-Jim... m.mnm...m.5nu luguumuuuflllljli .. fl Mrs Elm I mIglg1lQ,- Q, .:: . 'fa . E 'I 1. H WM t . u X , 1 Q4 5: I 1 A Im : 1, W M1 H, A .M lm! 'X W I -u x an - I :za ... m :s .x. .mn .1 x . 1 : : : .-..........nr:.................:x1...... .l......l z.. ' . ...... 1 .4 . -, ' 'I x rf Q, 41 l 1 S N S A M. v, L 1 5 SW 1 'gl ,EQ yu 3 M J In nq 4 25 Z 4 6 K Z' 5 f f 9 4 7 2 6 5 f R73 I 1 r N 1 Q tv 3 -'TQ ' 551 a n 6 9 SZ ? 'N X IHZ HOW! THEA pn: G 0 L!Ll2Il Siffif WIT? X g I Z .5 X Clyo x ,O ORN Dv P gg :r ,. . I CJR X J Lr.vv Xllllsa O yi X Z 0. Q 91 f I 0' 9 N A 1 mf! 'Lx 4 W 1 'fx . : iv dui! lg ggi' YH. ' W U 'HIP 4 HW . . Ze v' 4 1+ ,Q Q' o g R 'Q jo Q-6,'K:'?uv A' vig 5. ' xi' 53 J X f, ..-may ow i Xfn zzg uni' 'Q A 7 A , ,,,,,, H7,, -hu, w 7 2 Aifk' Wiq'i - 12 '-EZEQM'AwwwwwnmmnvmnananuuwadmnndvwuM3339 'fx .Wfzf.m4Qzw441QQefQ2W 5. ., , s L 'W 1 ' - , , -ir U I-H1 f H A , ,, --7-, 4 xQ.,,,Qf?1L5.15m.1.w 5, iggggf . U 4 M' V X 'Q .,f?fff9 0 4855 14 KJ ff2jX ff U7 Q -1-,W ,.- Qgg.. ,4 ,721 A M VA CV.. Wwslfigkffw i X 61, X Wgrx ,f,f, ,M ,,,,,., . . L., 1 E' A' 19554131 , 4 .4 1 43,1 Q l ,X,N I.. gm ' 'Y :X ' ,+. ,V I fm ,.r f.-jf' if v I -J! in '.'-- D T' ,J .... Vg- , 1 .A . 1 X Agp X1 7, if 1 RD I I Tx L1 -H KM. , .f- 'Q M 1 ---xx 'f k WA J VNV- 1 TL- .1 4 1 .1 fd'--1 I f . 1 , ,,...., ,,.,.,j V 1 4 ,1 . I. 1, 1 .4 ,.- ' 2 .Q 1 iff 2 Lp: V,.,-HN WF--:,...,f 7 Fl. 1 A K I:- X7 16 F' ' 1 1 I2 J ,g ,,4,, -,I Lal KW -rr-in H V V H ,:v.VvY, NY ,YV..,.,A,,,, -.-- ----- ---f':::j A- 7 F1 all '1 1 4 .'I '4 4 iM 4 1 , Ll' f1 .1 V21 l 1,!.1 4 'LSI' '4f , 4 -'E' Citi' tg. '91 - . 4,' .xl L1 31' 1,1 .A 1 N 1 1 l4 ,511 K-.I IN 1 1 . 1 .1 .1 351 .11 .:z 4 W jx 1x 7,1'Y'-K. -,M 'g -, .- ' - xk 1 -.1. . 4-,lyk SENIOR BENCH Z j ,jkygiglfkoxf 'f '15 .24 ,QV K xxxlx. X -Q 1-LL, V f' X V ' 'Z V V .V-,J I ,V V .. N L7 V M., .Q ' ,Q ., +L, fl i ' if ,. .- f'.!' fl W1 ig WWA I' fr 'Wm 127' !J V, 02, 1 Z1 1 W ,V 4 .1 x ' 'VQ 6 11 any V L , :' 1, ., M. - f J V ,Q ' f fp... -. .3 1 1- I' . cf, '-1 V V V 12 'ur 'yf fy .: S , ing y V 'Q QM 5 V ff M '1 QW! , 5 wg ' 1,515 .V 'vig M ,V V . il . 1 U , ,Q ,,,-.4 ,gk l 4 ,gf Q .3 . .4 ,, f , :W- HQ .Wit 1:17 1 mg Q 1 ff' 22 V ta! 1,6 159: ,. 14 W1 V121 1 W, V ,, W4 ' 1 4 I1 '71 1 1:11 1 1.1- 1. Pf: 1 M 1 ri' 1 fry I 'I-2 1 .. 1 I:-Z ! to ij: 1 ff-: '34 I 5.1. V97 1 1' I L if 5 Z fj I 1 f 1 1 1 2212 1 21121 1 1 -. AS 1 li. 'SE' 'Ext 'fx 1-ci X 1 S . L- LJ 1 -Q 1 '--x L VNN. YNnxXv' WLDJ.. 1g:, 4 E? I Nw 1 1 R21 1 1 b., 1 N'- fu h.. Q ':f,2 K IQ: : S11 if-2 l 1 1 ,M 1 1 xx 1 1' ra- 4 RJ K 1 I Amp: 1 Fi 1 ,RT 1 N- 1 F- 1 1 'R-I 5 155 1 'F 1 'V 1 N '1Lg1 1,154 Y 115, .1 xlsgff Wg? ' MN Mrk: 9 -1 I lilgix V 11 ,.4 X, U 0-X fS.fO u wp . V .1 1 111111 :iw ,, fl: ,Q,:fgj?,,w, l r15lxxJw AON K wk xx ,,,... f As., ix ,,f. A. 1:13 i1 felgl I- .Li ' 1 V 1 -vffq 3 rs' 5 1 91 'N 1 ,wg-.Lang-.5. -,ZW N1 Qiljwxwwfv' x ..,.. .1 - 1, --g. W , f-,,- .--.,..,..., . sw- 1-.X V 'a ' QJ T5E'2s f,'EQT-9-L,4J,'E' Y,4'1'41-, H,e.... ':11-,if if - -- -3 V 1. HM ' .V wr 1 g-3510 M4x,X4u:QTV6Lf,-J.:,AEEuD,v ,YJ ,.,.4.Qi,,1 YW Y - ' X. Q XS N yy 14 X . ,ff'?'f42 -' Q3 ..f4?'4..AN,,f,.f6O.M px VQIEQH' 555 , 'i FW ,Y X V! N XN N gi I l, IN 1 5 4 w -'Q xv 'x ZH! I EQ 2 new ' 5 5 Wfzisfl YA sud r 'H s- , 1 r f tx ' E? I IE ,- ss E QW 1 'f H Q 51515 l T x aid P l x 5 yv ' 1 Q f fi 1, M21 J M ,, 1, n gn 44 g, ., W. ixif :ZA T if 'xx U, 19 , , fi f 4' 1 X' b 5 NN-K R x-U ' -H? , s -Q 'hi ,., 'l:1 V' I 45' i - ' .4-: ' -'1:T1: J ZV 'm1Wm1,Hnm11..Nm1nx1mx R, , ' 1 ' , '- -. V -1 , iff1!z9E55f G F5!S ef'-wg T11E: mf nh:-.-mm I . w - 11-'L-1 nz- xy. '11-,.. l lr A I v Z, W- JliM3'JiiEi.- . 3727151272131lilililillliliiiiiikilllllllllif Ml ... ..... . .... .,..... . ...- .... 1 N If ' V N X .-.a 'TV f ' 1 A M 0, 'I 'I - 4,-f f ' 1 E X k Q.41'Z ' J 1 Q 2 EN f x ' I Y -'Q-:um X vo- N P W mf- 1 km- 1 ww - Q fm, Q4 X it H,-'SR 'N -'fag X. Ks X A . 54 nl K X -. -y, Y , x A fs Ng 'I fvgv xl. I H. it 101 X K W vu Inu-'lull-u un -wr if mu n.. mmm u mlnmmn-m6 1 .M . - v m-munun'-unml -5 mm mmmn mn 1 , F I 5 Y! X I u 'HN 1 'W .- ll Q ' 2 AJ' U ' In ' x -1 .n 1 1- v vm x 5 1 1 IIA I - 1 1 v '- 31 I -Q H.: ni, Vu' ny' w Nw 51 1 s V EEA! xi - r X' vb f ,.,l 5 . 'nf H ,'I Y W i .V -1,114 A I f I f ann 1 ,.-' wi 5 1,-. .I1 I V Hi -4 'fi' , N 72:3 ,. i '- O P if 'Q . 3 3. . 5 y Q: . Q . I . 'I ': 'o 0: . -: '- . fn L Q 4 I ', xl. '- '1 my + .qw 424 EV 'N In-r ' JI ' un ' w b , mul :H ' A H4 3 ,. 5 E fi . IE zo 0' S 4 .I ii f?fa'2lg,T,.ffffff'3fj . o L 0 Q., ffq. 1. 3 'V'-f -A x C I Z,u?,f' L2 0 -si X Q , , fi. -gmfbffsyf fn! '- '1l'L! '.!ml!5x1- ' ' V H f' ' -, ' - W I L MA-f J A 1-'ff 1 Aw f , W, , , y fi,- -1- f' 5 V, ,,,,, A ,,., :.ff,,-'wg fl fgg ,,w +' j 4f- ayy,agfQ:q'fff4 951.v 1 1 .4 A, , , ,, f f,,,j e1 Q ff A L , A, my A xx '44 lV ':.4..,-,,,,.,,, -W N-..,...,...,-.,,,4.....- w--.-A P ' ,fzkfvi 4 . gi r. f'1'fj.' l ::W fp---Vg , ' L 1 f 1 'z 'I,mXi 1f31Q fL ,Q' ff J Q, 1 fpp- Q.'J f r 17, ,ya 3.11 rj jr 1593 ff 9' gill' O ,. tw. .1 '..' 53-V. 1 1 4 1 -'4 ff 9 :Ei , Zz U4 TD-, 'Z u V '.:.i V 4 v l el .KN if, il -:-. nfl is i r .1 I .J ' X . . ,Q .ZX X ,, ,,,,,. .,......w ..i::... H l N . A. .. AMA ,-A e . ii.. , f eiar a l i i 'c A D L P ILI . . .,.... ls 'I' 2 T H , .. .- gsm. ..::::::::::::::::::' .::::::::::a:::::z::::.:::::::::::::::::::. ....,.. r...l ....... ggi ' N-,i ,.,..... ....- ...::m....,.......S:-- 'f 7 ' ' llitlla iQ - . -el ' ss- l ll . s- 4 .ff -. i ai Wffgl AT K ' - 2 A I y ll IQ , . . , ' se -a l it Hwl XX s iff sf 1 i . li lib 1 . T f 'iatg-Qgfg iggsgs' r T h T xy X 'V .,,.. ' v - X ,H I 4.353 E Ml lr I-:9f,g?'iaC'! ' -X Yi! ' ,fl gf Illl h Illllll .lt I ug l F:-l t 5, ' -W li, . . - la: V ef ' ' d d P: On the 22nd day of September, of the year of our Lord tliehngpifensilglfl III az: : and nineteenth, there might be seen ambhng, tr0tt1Ug: Canterlnga S U 1 gs , PP gf tal. gmntQ.inb qfpolling strutting running, or walking about Georgia Techs stately 1.1 ,I ' ry - 7 r' 7 ' domic-ile some six hundred and fifty-four newcomers who had been niet at the A terminal station the evening before by Dr. Matheson and brought out to tie campiiis Hg 'Hi where thev met Uncle Gus with Angel's Food cakfi, Custard Plea and ICC Cfeam 3 jg prepared in readiness for their coming. After dinner they were tucked into bed . fl in Knowles or Swann apartments by Professor Armstrong, who. was very kind Q20 Igiftllfw and attentive, bringing in coal and hot water for the next morning. The butler . fviiiiiiy had the valet wake the FIRST YEAR MEN promptly at eleven the following leur, morning as it was essential that they be made to realize that they were no longer l l fl at home so must make a pretense at work in the future. 4553 , Among this large assemblage were both those who could show corns in calloused U L yi , palms ii' you tiptoed to look, and those who wore spats. Eighty-seven per cent wore 1,5 twelve and a half collars and number thirteen shoes. Despite these eccentricities, l l 'ii thev all had one characteristic in common, and that was an insatiable curiosity- this to the idelight of the busy Sophs whg were ever atteiiiltive, showipg the. FIRIST lif t . - Lk l X P..-XR MLB all manner of tlnngs and emonstrating ot ers. Veri y, verily, tiey I 5 Qi learned much that day, but more was to follow under the skillful, we might even S ff: say dexterous, tutelage of the Sophomores, who were ever ready to impress a ,fl point on the reverse end. 'll , sh ee ae ae ee -me rpg! 1' our years have passed. VVe have gone through it all: Freshman, Sophomore, ' Junior and now Senior-through Chemistry, Physics, Electricity, Thermodynamics, Q Experimental Engineering, seventeen thousand hours of laboratory, through Dr. J Perry's sessions, Professor Skiles' seances, the President's conferences, and the or- si ,pig-5 deal of paying our fees nine times. We are hardened now. The old business world l will suffer a jar when we go out and push them aside to make a place for ourselves , and our diploma. Wy. il-Ill? lfiill ' P The History Follows: . i ,..-, , I gigill I Though .the school was Just recovering from the S. A. T. C. regime, we brought a spirit to the campus which was invincible, so it was but a short time pm after college night that we began to pry things loose by electing officers and eementing ourselves into an organization. g. x if. N fl jfwwb 0, ! os ,TOO ,gg Ymgfio 1 W l', . N X '-QTL. Y P - ge ' ' TXXO - K! J 7 - -- 3 ,F gi .iitiazgru --. sv 'Kg ,4 .O XNXmQ-fLX12fIQj 5 -X N..:,2,,,,,Z',A,,.V,:-1 Z. l lj 5 , Qi , 1? x, ' ' -4 Y , hvgiin Y iv -wi X - 1 l g , Again- dy' 'u -sv TJN -1, r..:s - ... l '41 s x x Nr -L Y 0 .,,... 5: W , M L 5 M A ,ml ' E.,5::,:.. 0 -xx , I --X SE -lvvqz-':'7P 'N' ills T A 0 . .A Z' C 1 l': ,fx 0- ,Q'- M xJ925Pl Xa: H . ,,..E,: , ..., , , i ., . .x N , m x , f . Ni X w 'fl 1 P X N Y f f :Jw . if N , vt- Y' -Q xnxx . Y ip K up 2-213.-. '17 Task-x 'T . y .- M1-. K- I -Q dd x 5 M 1 , I , U n mmm: u I1IInnuIununIinI1-num1un1nunnvni1u1lnuniTu.....s,.....,...H L .fiiumm 5 X I mmmummm,,..hif.,u.mm 1 mi. H..-u .. ............. .................,. -.3 . -........ .,......'En .fm-1...-n.u.m...-I.ugliaw gn mmiwuqig s 5 I , 14 x I in .. lil idilux n fi I - gl V0 1 . if xsn..l.xlunnmmuamm1us.l-lmaxmnmnmuzxxl .Ill lx. 1- mnrmn.u: 3.111.111 l : 2 .. ... I S l.....-1lll.r-fltirr..--1 l.... .mmmI....lx:a.... I.. ...Li .' I' nllll.-S . . 'G' Milk QB' S 'S 'S S X, S it 5 1 it 1' . Q , is o Q 'Y 'o 8 0 'Z 'Q e ng Q ' , '2 5 Q F. I 5 .2 r V2 J 2 a 4 ' my F31 wir ha .J T V19 ' V ' r 1, 4 E ' V Z V 1 Z! f 9 7 5 f 5 5 Z, 9 f 2 X 5 V J Z Z Q 7 , 4 , 5 uoum, K- Q ill' -iiir 0 's J- J. McDonough, President, VV. P. Lyman, Vice-President, and M. L. Marshall, Secretary and Treasurer, composed our first group of officers. During this first year on the campus, our class furnished four varsity foot- ball men, two for basketball, two for track, and two for baseball besides a lar e . . . g number of those active in the Marionettes, Glee Club, and thje various publi- cations. We were proud of our Freshman caps of gold, the year ending with the largest banquet ever held by a school organization, a Lyric Theatre party, and a Freshman cap burning on Grant Field, the like of which has never been seen yet. ' II p After a summer of ease, fall saw four hundred and fifty-two of the original class of '23 back with us ready to educate the Freshmen. Three or four days before the opening of school, activity among the classmen picked up, the more provident members having returned with a full supply of razor straps and military belts. We really settled down to work that year, our initiation into the higher branches of mathematics and an increasing number of laboratory periods get- ting us into harness. With an increase in the school work came also a greater participation in activities. We furnished four varsity football men, two baseball regulars, four top-notch track men, and five members of the basketball varsity, besides a general distribution of men in other activities. W. P. Lyman, President, H. D. Carter, Vice-President, and M. L. Marshall, Secretary and Treasurer, were the officers who guided the class through that year. III V Throwing house-party engagements to the winds, we gathered at Tech's old halls for the third time brimful of enthusiasm for the year of work and play, our ranks numbering three hundred and seventeen. We were quick to organize with W. P. Lyman re-elected as President, H. D. Carter filling the position of Vice- President, and J. J. McDonough in the capacity of Secretary and Treasurer. The class of '23 followed former classes in having their most active year as Juniors, so it is little wonder that we contributed about half of the .athletes of the 1921-22 seasons. Among them were- twelve football men, six baseball men, five members of the basketball varsity, and eleven athletes of the cinder path. Many new activities, developed mainly by members of the class, sprung up making for a much more evenly balanced institution. '21-'22 was a banner year for Tech and the class of '23 contributed no small share of the whole. , IV ,Many of us returned for our Senior year with everything put away but the vision of a diploma. and preparation for responsibility, but some of us saw our schol- arship records go glimmering for work on school activities. During our stay on the campus We have furnished two football captains, three basketball captains, two baseball captains, and two captains of track teams, two editors of the Yellow Jacket, and an editor of the Blue Print. The present year has demonstrated to us the fact that responsibility and hardship go hand in hand with comradeship and love for our classmates and Alma Mater. It is with a saddened heart that we leave our mother institution, realizing that we have accomplished but a small part of our history. May our real history be founded upon our training in old TechS halls, constructed on sound engineering lines of the future, and guided by the ideals for which our Alma Mater stands. -W. H. VAUGHAN, 23- ff Z ' ff :F :I ' .5 I 2 X . 'Q ,N 2 2 1 8 F' 'fs 'I P - ' I :ij he my J ' ...gl Qfs l in wi 1, ,6f'XzGWfa6Z7 -.X 159409 ...Tm . 'SQ ' o Q-6xE'a.,4 S Q g x .fx A, wo 4' 5 , -z.. iw L.- ...,.., ,.,. L 0 ---- - ..1::5!Sil' 9 I 'Q J ' 9 ,L , , , . , , N v ii - ' I I7 rx ' ' V w o23a'fff,w,0mf:Wmfmfffm,9msomo:-.oQQsQc4zfqs2mwffffff,ffAe'?Qffo ,E 3 1 . L '- ' ' . 0 X ,. ' - Z L ' I - - .-. ..I 3- 'I i ' I ' lp! Q- 555553, ,O ' H-V A F 'VLH 'ni' O iisin V. ,za - 449 - o ' fl 59- O Q X . Q55 t 0 ,f l xxf Q fern i 4, . by y i r T H E D L ,.,, M .... it , i 1,, . .,.1,, W,, . , 1 K we pr P . ,M X 1 is 1- ' 4. X .A X N K ,- ' f x 1 1. I -:-.ao-.,..., J H4 X' 'X X 5 A Q x ' 1 1 J M-. gx , 1 if Q ,..-. A X hi ,. J lu.. - - :Nun-mnwuunln-nxvua-mno..,mlm. fm. -.11 N f Y -v ,4 ,nm-um qu-ww www' ' H ,,,,. v ' 4 ' -- mnuwawsmmmwl - ef' ' mi 5 I E ' '-1 , -1. - .,.,, . ' 1' ' .. .. :... ........x..a..::....r..r s ....... ..:.. .... . . z x .nr .- U' ' EIL ' ' ' I 1 fri: , . '1-. I2 P... I . fr. . . ..- 1.1 PJ - 1 L N. P4' .4, I f 1 , :-:- II yy' : ff-I I .., . 4 0 5 Wei .. y i T ij E5 I xl! gi Semor Poem yi, if - Vit . A 5 it tttggif Four years ago you wondered how , i , V , 1 ' 'Ji llfzjb' Your Shi would are or our lon ears. i ,Qi 'izgtt ' - P g 'y ' ,544 But how the time has passed! and now 'fig y You hesitate as life appears. or , lf 3: MS' U-. s 3 f' kfiiief y ,iifit fi Too soon, you cry, The end has mme! A513151 5 N 'ff . . . ' , Riff 1 .9315 Anticipation looms no more, ' QE--Qi f I L, l A wigs! ! MSM fflfve planned a lot, but little done- My , The warning should have come bef0re. ' 3- V' I ' A EE S! ...ary ' 1 't - P Q L ' 6,23 III t l 3 l ' w I 'Z 5 rx 4 ' , , ' i t 'LIE mg Ioung man, if all your learning fail, Y' K QL' 1 p u ' N51 4 . 1 And books would bring you sorrow, 4 ,I r 1 VN' Remember Lifefs continuous sailg E WN Forget the word, to-morrow. my 3 , Ni I Qt . 1? J IV if T Anticipate, remember, too, t For joy as such is all you find, ' X gt - But neither of these things yawn do e V , If you delay the present grind. I I LINVVOI A doer o the present be Brzny honors high to Twenty Three IHG X A C 'REBER Qu Nw: my www fgfgg x we XX x OX Q IL Xxx mwmmxmxWTxmmxxgqmxmXmX J 0 1 i, , U 1 ,Eli f' I 'xiii L ' - S it T '-: X - x , wsu N i 3-. v ' ,' ' Q s ' X z . f ., l 45533 -- ' ff ,, X N T iii ' , . 3 5 , ' Q :- llifia S - S I E137 N X i 'ali -5 V sc S i lt ' S gi O Q- W Clio o R 4, . 0 N 1 N F Q Q -..,, f 0 , gf' Q E 5 Q: m I Lkjfowh W9-Y-iffvI-rv-xsszzrzx-. -. H:-r-. -. .rw , .af V fr' A , Q , ', -' Q- M , Y 'K wt . L.S:15L KA ' V-lg F. 1 5' i ' I Y I 9 V ii 0,1 Y K' vi in ' 5 'H .. 1 ' ' -+ 1' 4 'f:- , X A X' -- T YY og ..,- - , A. I - .. I ' f -- --+L -, ,L ,Q Y gin! V ig f P . Q 21' - 1 SAO! 19 'Y ' ' ixii, Llc . .1 Q l YN 'IM I I I x 1 1'-I N. ,Th A V f' ,I .'I. I 2 is fg:'.gE 1:1 'L-F ' U 'I 112 - aa: ll .. h m 'mltlml 'asp smsmhm - T KT,-Ixyix --1-f'- IIQIQIIIIIIIII-53:17 -.:1'f.l:fC.1..I.-.-n-E--I--xiI i.1i ,-.-.. F-412---ii:3-- g57Zi:v'uv11.1I m1u.n1n.:l5551i,gEg5!lumfggnl 'ui , , ll I . -mn - . ' 4 gy ' ' - , . Y' I . H ILI wluauumurasaxzmx..nmI:::l::::uu::::::::l::: H:::::::::::ns:' :::I:::::::::::.a:1I::Isa:::ma::f::s::I::r:.'::::Ir:::l::::::::II I:::::::::II::::::::::::::n. ........ .... - :ik ...... i f VIIQW AI I .II ,I N as N ai If I K ' S I 3, I IX - . I . .1' Q . ... I Q :2 'N W 0 Q i x -5 IN 32 X I Q P A 5 1 . I I I I .' I I K I N F I I ,xv I I I II ' E ww, H I , I5 : 'I' Y I EZI 9.13 Q' 'II -QQ hfunf, DEI Y WI II IA I Senior Class Officers if W. M. M1'rcH1:L1. . . . .Po-eslident Sf V . 3 A. T. HUNT . Z . Vice-lJI'esiclent M Z H. M. CARTER . . .blecretary J f I 2 WV. P. LYMAN . . Treasurer K 6 f 4 7' ? 4 9 f Q5 3 f 6xhA ow' Q ws IIII -I - Y 4 KX oWy,,W MfxfW1cW,m0WWm'mz05mfmW1Nyfxff . 5 .X X L V f . f . LW H EL K. o gb 'Q' Q nl I . liggeg zg-W , . O L LV Y fx 1:75, ff was 5 A I 0 ' 'MO I Q 'J I' '- :E V Iv O W I xc .nil ON ', I, - .I -53323-F S. - M - M , , Y f mn., V , I I .....:.g::.. ' ,,,, Y f W K N 'I . I ' 7 4 j R .- oooono . Q o A I' . I' I Q L L 0 1 4' - ' A ,Qs I , - O al no x :tgp-31 f,,L 'SO cz IV 4 I ..:. 'T EHS E525 ' 1 thin 19 .N I 4. I 1 l U , I ' V273 v .w I g I GI ,u QI-I IQ ' s I III IA , . Q :I N x 'A . '1 'I I . y 'N I A - w..- 1.-. rf. .ii .ui '.A. 1 C . v . f rn. iii .23 , I1-f' 1 -f I.'.,, ,C-fr ,.,. n .-I luv qq I-Iv . . I I I , I -5 I ,-4 . I I I Q , I - ..-. -A I f Q Ajit .. ,Iii 'mlyhl .,.. ----' H 'f'- P- -- 23555 ' ,if I ,mimi I .... ..:..: u I P 5 I H N J L H-W-----':r'rlu:r:::::::r:::l::x::::n.uu::m::'.:::::::'.x :::::'.:.-:L .------ f'-1--- 12753 E 'Rt W i ' ..... .. . .............. 2. ...- ::m.a: ':::::::::m::::n.'::::::::::r.a1n .... ...:..:..... -- H4uEvm.Q.n r...,. , ..,...,,,v. ......-A:-V-L---Q---1'- -:'. Im- YW- lf, I,f42'j.',I 2 I 'T.1 ' I I :Zi I . fo- ,I 'ff I :r-:H , ,. ' . h ' I ' eering ILQ1' S ' . In I J: gfzggg Bachelors of cience 1n Mec any 8' I - , - if!-I IELI JOHN SAYLOR CooN, M-E-i SC-D' ffm I Professor ,, ,, Ig? 2iIf SI ,TT if 'I IRI ' ,I .-If I Wgfffi ffIEf'iI IIT! JAMES FRANK BELL, K A If I ' E51 I I . Fra-nk ICQEQQ., Ill? , I :ETH iffiig Atlanta, Georgia IFIQUI I , ff' V1 II: +I This boy is a product of Tech High. He is quite Tale I popular on the campus, having bluilt many tfrilend- I 'QKQII shi s during his four year stay. e seems o ave img!! 11,3 attgrnpted. the 'musical side of Tech activities, and the I loss of his rich bass voice will be felt by the Glee gi gfji Club next year. 1, QEII1 A. S. M. E.g Technique, '21g Cotillion Clubg Band, '20, '21g Glee Club, '21, '22, '23, Tech High Club. iii If ' Qi .I , LEVI BALLARD I I -,jfs Ex W Brunswick, Georgia .I - I 'ii This young hopeful began this earthly journey at QQ Lexington, Ga., in the early days of September, 1902. :piggy Later he moved to the sea-coast town of Brunswick. ENS I'f1'2QI'l After preppingat the Glynn Academy, he caught the P' M Iigziy old Tech spirit, and came here in '19. igili ,IS c ISQKI It I is I' f. y , 'I Ijgf, pg, ARLEIGH ARTHUR BLACK Mgr y fr-A Squared!! W ii? V .Him Ii? . Lakeland, Florida -,Sly F31 Ks-E Here we have one of the best-hearted boys on the -campus. Uncle Sam sent him here in return for six- iii teen months war service. During the war he learned If H-:SL how to shoot Germans and at Tech he has used this IQIII LM 'iiarnfng to help Tech put out a winning Rifle Team. .Em 'l'1C1 entally, Jhe has already joined the matrinionial MSI ranks. I , gil I N' ' 9 a s , . Q ,I Rlfle Team, 20, 21, 22, 235 Florida C1ubg'Ameri- IEII. Ei: can Legion. . Iii? 's I IPI 'I l: EIS: I TIER I I Ii' I J ,icy Q , + . - I I stir, K. 'msimmw x-ix xv-ix x x wgwqqx,-,W ,ff A Q 3 NI K :X Q9-X -no o FRA? ,Y , o ., .fig got' ' - I O x ' L .. -'A' Y , A B - Q Eiiilliie u N- Gi 4! 1 fL . . .I-:-, C-D-521325 1-, zz-:-.--9,-g.,A V - 7 W 5 5 ' I IF-- 5 - . ,fi , V Y V , e R sew. . H' -A-A A , L I j L TTT '2-as-A is -1 R. X rf ,fs - R 4 I . ,M I .. --....-.- l ugiiw ' ' All. N ffl . ,5:,. , , , iiiiilmillllil un' V ' lill lll I lmlu num -.VTT5 EB.. ......, x A3 umluvm 5 annum u.n,un, q,w.n.4 -.-n:nv-1--.-..--...-,-....,,,. ,-.,., .,- ,..... , ...........,,,,, ,,,.,,,,,,,,,,,,,,,,,.,,,,,,,,,,,,,, ,,, ,N , ,,,,,,,, sm Imaam' mm!! T H!-W :ggi 15 L P Pal ll m 'e'E ' ' i' mii'i' ' : W'lllilll nr::nu::nnxuanmum::n::m:::::m:: : .:::': ':z:aa:::x:x::.n::sa:zzn:x:L::::::ln:nn::1:::::::lr::l:nx::::l: zz ll :zzzmi l L... ...- ill ...... N as :N . 1 N VERNON LYoNs BORUM, 2 if E Q D Skinny N S. Tampa, Florida .- ' y This fellowlis a living proof of the falseness of N the charge that the college football player is there Q only for football and is absolutely unaware of the existence of textbooks. Skinny is a prince of a chap Q and has made a wonderful record in everything he S has attempted at Tech. V gg, A. S. M. E., Honor Roll, '21, '22, Scholarship T , Phi Kappa Phi, Scrub Football, '19, '20, Varsity Football, '21, '22, Koseme, Anak,.Bull Dogs, T '- Club, Captain, R. O. T. C. ' 'Q HARRY ANDERSON BUTLER, II K 'if Alec Savannah, Georgia y This genial youth first smiled back in 1901, the Q fortunate spot of said occasion being Savannah, Ga. While still claiming Savannah as his home, he is . quite fond of various and sundry Atlanta admirers t L whom he has gained during his four-year stay here. . J gm . i Q Rl' IB hu -w qlll- B 4 ll j 6- .1 II l 51 , Y Y 9 5 Z f 5 2 ? 5 5 4 5 4 4 4 4 4 P4 4 4 4 4 2 One or more of these may persuade Alec to re- main in the vicinity of Tech even after he receives his diploma. Cotillion Club, Skull and Key, Savannah Club, Second Lieutenant, R. O. T. C., '22. ' TRIGG PRESTON CAMPBELL, A T A A HT. Pff Morristown, Tennessee Trigg has been a demon for work, holding down responsible positions on several of Tech's publications. He has also been a well-known figure in R. O. T. C. circles, having spent a year at V. M. I. previous to his entrance to Tech. Trigger's curly blonde hair is said to have smashed several hearts of the weaker sex. ' Technique, '20, '21, Clerical Staff, '22, Advertising Manager, '23, Yellow Jacket, '23, Infantry Editor, Barrage, Supply Officer, First Battalion, R. O. T. C. CHARLES STEVENS CARTER, II K 111 Nick 'fSnake Q Lilburn, Georgia This boy aims high in his plan of attack on the world. ,He states that his ambition will not be ful- filled to his entire satisfaction unless he becomes a good flyer, obtains a pretty wife, and makes a suc- cess of himself. Well, we hope we receive an invita- tion to the wedding. Aviation Club, Track Squad, '20, '21, Mexican Athlete. SCH We si f ffl + LQQI1 , IIT V 1 3 '3 ,S If I 'Z E. 1. . . L 4 4 X w 'I .Q : qu I . 1,55 iq' 4' M4 B l 1 JUII 1 'llllv I um.. Y + N' ev ll ii . Q ,Q :- Q J '. 1 w Sf o :Q ,Q 0 ,. Q . ,. Q 3- . . v A I' J Q 5 Xllll si, 0 X ,KJ on X ,.. O Xp l 3 . A I O . at 597 . -QQ, 60 , nl.- ....,, .L ff f-f nur!! ' '3 , HL, f V .. , . r l ' ' Q 1- Y X E 0gxfxy.wz',mfms'faExWn 0wmxxAqQ'530 5 rg, 3 5 L . V f V - .. ' 1. ' 7' 1 L-L - -- LIONEL K' o um: tr. 1 4 I U.. O O L o P' if o , o 1 S171 H. . I '1 .1 r. I f, 1'fr 1. 1 ffl' 11-. - , mu 1 1 l 1 1 1-1 5 -I1 . 1 11 G' 5 . 1 I- F ll E 1 1 s 1 1 . -1 -I-21 1 N' ,AA ,Q --'- 'K 1 1 T ,.,. 9,51-11l11issx.iii1 n FZ:M:www--A-xlUxl'mwlmw en- I ll l Y l!,Y ..,. ..,.... ...., - -1 HH- -- v,-.- M - - I W, 'H -U4 .. .TQ .. H E D L : was::::::.::x:::::a::::::::1::::::n:usm:::a1na::::z1::x:::::: -I 'U Q'-11, Ezgk 1, -Jn in WW Y ,K-: ---- 2:3222 1.i,:':1f31--'Tw-iz.. -, CE' ' 5' ' 'A4 ', 1 mm ' 5 'TPM ,.r.,l f .1 41 5'113 - . Q A 7 HUGH DAVIS CAIETER' JR' I 5 ll?-f 1 HHWQ ia Z1 gjfyf Atlanta eorg X 2 itll - . f' d a versatile y01mg man' Thmigh Here indeed we 111 ,th four branches of athletics, 1511 defiI1i'fClY Connected W1 to there, but P1'0mPt1Y 9295111 he was not Comenylliito is Il song bird, an actor, degllonsisliijili liliil a 1-Ieyis a member of Practically glil an a ' . every honor club O50 thglcagpugwimming Team, 720, 1 , Varsity Track, ' ', 3 . F than Assistant E213 i1.g:,l '21- Scrub Basketball, '20, 211 22, 90 this ,QO 921 :QQ lf1,l '22' Glee 11 1 1 5 ' - ' b- Tech 11f.-V 115-111 ' 1, - D g Anakg Cotillion Clu , 4,5 lfbyg KOSCIDCQ Og . . e-President Class, 721, 'Egg ff 'h Cl b- A S. M. E., V10 w-1 11,2111 223,23 U f ' 1 ' THOMAS FREDERICK CARTER, J R-1 X 'I' 1 11.., 1 nlvickrf I l:j:l1 1 . ' .F:f:i,l 1 ' Richland, Georgia I 5,5111 il .1 Introducing to our admiring readers Nick Carter it 2151i himself, Hgwever, the gentleman here presented IS 4.413 5 'quite tame and civilized. After obtaining hfs degree I3 fin 1 t June as a straight Mechanical Engineer, he 9,11 QE Till rilelurned again for a Year of Work in the Automo- is-LA ieiiflb' - ' ' D rtment Nick is a born me- 5 Ziff uve Engineering epa - , 554' chanic. f , . Technique, '17, '18, '19, '20, '21, Circulation Manager, dy 7 '215 Society Of Automotive Engmeersi American K Legion. , 1 l 'T 1 SAMUEL TAYLOR COLEMAN, 111, 111 A 9 E lt,-4 g ' KKDUCICJJ - ' y Macon, Georgia i i .i This diminutive product of Lanier H3gl1.SChCq0'l, Hi ll- lil it Macon has made a very enviable recor since 11S lr, A 1 I1 matriciilation at Tech four years ago. Dressed in his 5 : tight-fitting uniform and slick Sam Browne belt, he 115 makes quite a figure as he struts along Peachtree each 1 lil evening, the sun gleaming from the buttons that decorate his manly shoulders. 11 l his A. S. M. E.g Phi Kappa Phi, Honor Roll, '22g 11.1 Q fjij Honor Court, 12-1, '22g Bull Dogg Skull and Key: ,Ig 11511 Cotiuinn Clubg A. s. M. E., First Lieutenant, R. O. 1,5111 T. C., scabbard and Blade, 'Glee and Mandolin X1 ffil Clubs, '21, '22, ,23Q Vice-President, Glee Club, '23s N11 Hg 'W T h ' '22. 1 it 111 ec 1 s Hi 5 1 ' N SIMEON BATES COOK, 111 R 2 li lg lill 1 HS- 1: 5 1 flg111 ' A fm N 1 N Sill' 1. 1 . . W1 t ENC, ,W y . Chattanooga, Tennessee N This slender youth began life on Septembei 17 1901 He 1'CCC1XCd his prepaiatory training at the McCallie P ' rep School, and then packed his tiunk for Tech Cook has made himself quite popular among the other members of his class, and '1 blight futuie is predicted fO1 hun A S M E '1rack, '21 Company Footb 111 J of-X! Og, N. VSWR '+.W. kx'-2-was we we xx N. Wwwqyfwf Q K .41 1 o 'K5-11-5?21xN-E1V3N X-X'Yb..i 'K'CQXx XX, 3 oh 1, ?,.gk1.., ' 1 1 1 N tx S 1 1 5 ill? l .. ' , - 7 ' c r 1 N 'Ei' . .. - 1 1 1x lift: in , . - i' 1:2121 ' ' ' N - ' .x l 'Pl ' 1 i 1' ' l Q Wlbil? ' Q x 5 M :FEI l l l I l O D ' l R l' 02:44 'sv' O2 Q X 1' ' A es? H A . Gt I if 1- ' - .. ., cs, C if ' Y ww.. .414-:f:s,,,-. ., 'ass' -.Hmm-w. -1. , L f T il K i ' 4, lv C - Z -f if , W V M .2,Ii'i'4 -7' if ' ,1 Q - . p , 'es , A NN- A X -,L 1,-H Ng N 1 f 1,311 K, 1, G A ' - I J ,-' fr Y 1- -- '13 ',,if : jj'l ' xr' '-, , 4'- f-51 .Ply - .- - I O 55151 ' 0 1 l 1' 1 -'I sk-iv T o ' 'ff l f' 0 l l i H ' 1:17, 1 QFQ-,R s h. N .T ' 'nm ' ' REBEL 0E:'fE?E1-11111: -'1-ww-14-1-u Q luoulilunu-iiidgifmI-.v-.v.i'fi'!:f,.l.,: 1.11. .....- :.n..::.,lfH.1:i ..... AJM...iIIfI..la g1.1f:,.,,,. ,,..,. .mm ...... X ' 'mv' ll' I' W 3 T H E I5 L P ILI M f lkl lllllliui ---- -'-- ----'-, - I nunim Nunn ' ' lmmm llllllllllllllllllllllllllllllIllIllllllllIllllllIllllllllllllllllllllllll L IIlil!IlllllIIIIHIIIllIll!!IIlIIllIMllllllllilllllllllllllllllllllll llllllllllIIKIEIIFIIII-lllllll lllll llllllllillllll-,-. .4.-...- . Jefh .... . il 'V .1 ' ! JOHN FITZHEW COX, B 9 II g Jack Thomasville, Georgia . ' V Jack has not been with us very long, but he has 'Z' been here long enough to earn a place in the hearts of many- of us. After spending a couple of years at Q California Tech, he came to Georgia Tech and has Z' 5 been one of our best boosters. He has done his part in Qelping gnake this year's class occupy the high posi ion 1 oes. - O Track, '22-'23. ' ' . HUGH INMAN DUBOSE, X 111 5 X, . 1 X4 p Venus Atlanta, Georgia Venus possesses a shape that makes the former g owner of that name tremble with jealousy each time she beholds him. Hugh is alleged to take advantage ' M of every opportunity possible, including beauty sleeps W and daily exercises, to preserve his heritage. As an E. exponent of the art of Ter sichore, he has few if P rn: ml: 'mr any equals. in 'Q A. s. M. E., Cotillion Club. tm 65.2.1 W A Iii 'W N' ti U 1 1 W4 'Ni I I , WILLIAM AUGUSTUS EDWARDS, 2 x I rrGusJ: ll! 'mp E 1 . ill! IEE' Atlanta, Georgia I 'V P Here is a Mechanical Engineer who is a darn i 1 good business man, judging by the success of the I various Tech organizations that have been managed l by him. Gus is often quite serious, which is in keep- Ff ing withthe part assigned to him in the first sen- ! ' . pf' tence of this sketch. 2 4 Marionettes, i22, Business Manager, '23, Technique, C-1 Assistant Advertising Manager, '22, Yellow Jacket, g if Business Manager, '23, Honor Roll, '21, Tech High Q Club, A. S. M. E., American Legion. I Qi? :Q 1 Q RICHARD RODDEY GARRISON 3 Charlotte, North Carolina 5 2 Garrison was born in his present home town some Q ,' twenty-six years ago, the family Bible giving 'the 2 f exact date of said event as May 31st, 1897. Gar- 3 IV rison is a big-hearted fellow and his many friends Q on the campus believe that he will be heard from in ig the future years. Q EQ A. S. M. E., Company Football, '19. ' V' I iff 0 lj2,E.1 '1' O M ?'1, j!WWWM,M,,W,MfQ!QW4ffyffaffffmzgg X2 5 R QEVYXXICXXIMKXMZXKWMXZIIIIIKYXIJW l!0VfW!!!H I ,ALi3 i1. if in B1w:7? '.,2g575mif' uw if P? y , A' S I Hu .- 4 ..-.1 4 ' 1 I l ., WY... r I1-4, T3 i -.1 . -.sw . 1 ' 51 - 1. X if 1 A s . k.!Q.,.J -if -.'Wr'Q'f . ,,,.,......... f W - A . ,:tn.i'X mm' M 'wg:mS11'nm,: Lff,gY,Q,.,,,,,, ..,..,.,.., 4, 4,,1. nuuunumx-4 -v1---1 nnuvm 1 YA, Lv , 1 ,r fer '1 ' 5.-i2Q5iE ' 'A A' ' V' mm R ll ' I P D L I RI ----- - -:aus ' :::s::::n:::-.:::::::a -- I , Q ,iq -------4 m:::::::'.::.:::::::::::s::::::::::::x:mar:::::::::::::::::::::::r:lu:m::srlru ..... :..m. .. ..... :R F. 77 , Vg 7 . I -.,-,A' if ,,,,,, ,,,.,... . .. .,,.. ,... ,.1Y.,....... .e..,:,1,.:E,eea,......,.1 fn ,A V331 .' ...... X I, lv 1 il 54 1 I If 1' mai! f I I fl iff' :Zh lflijj JOHN EDWIN GETZEN, KP 2 K ff! was ffafmf 1,,1 i Pendergrass, Georgia 1 'l Skinnl' sighed his Hrst tear and wept his HrSt2 .gill ii in the metropolis of Pendergrass on November 'J Vai 5 1901. This young fellow uses his dhfirildy as 15 evl' ' denced by the fact that he took a post-graduate Iliff! course in M. E. after he had won a degree in E. legally ilifiigg Skinny is a ladies' man from Way haflk, Slmgmg li' 1 .wicked telephone line. Maybe that 1S why he too lygljll I ,- .' ' I H -1' ,gg 1 I Electucal Engineering. yfffnxyl Mala' P111 Kappa Phi, Band, '18, '19, '20, '21, '22s fag- tiff!! tain in Band, '21, '22, Honor Rollg Scholarship T 5 Q-E,-gi, .fliggil R. A. R. Clubg Blue Ridge Clubg A. S. M. E., 5551.5 615215 A. I. E. D., B. s. in E. E. H5231 iiifl fillfl 'igiflf EDWARD WILLIAM HAHN, A K X iff i yi A Eddie IEEE' li 13 fi' ' ' . I :A:'I- Charleston, South Carolina 555V Wilt L :iv . I Porter Military Academy sent Tech a good man when this boy decided to matriculate here. Eddie vigil has spent nearly twenty-two years on this bit of Q51 dirt called Earth, but we are glad that he decided I to stop off at our beloved Georgia Tech for four of Q. that number., He has made many friends for him- . . self in that time. ll Honor Roll, '21, Phi Kappa Phi, Band, '19, '20, it 1 '21 '22. IK l , jg, KARL HERMAN HALLER ffX YH if , West Palm Beach, Florida l 'I X, Y. is possessed of a very quiet nature. It was probably diferent back in 1898, when Karl first N beheld the glow of dewy dawn. But the continual sound of the breakers on the beach near Tampa has ggi probably made him realize the futility of perpetual noise. He is graduating. Em - ARTHUR KWILLIAM HARRIS, II K qw E51 1 Ike 1 , Savannah, Georgia Yes, Ike is from the town wet other places than +121 Nui on the sea shore. Around Tech Arthur is quiet and M . . i my demure, but this is no criterion of how he acts when 5 ..g,. H -xa...I:-- ' ' QW on his native heath, with all the usual reinforce- fw! ments at. hand. Heiis serious about his work, and conscientiousltou a degree which should make him my a successful 1l'lg1l1Cl'0. IF' . - - - . Rskuu and Key, C0tllllOI'l Club, First Lieutenant my . O. T. C., Savannah Club, ji? . . v. I Q O Q-GY -k o i 0 -0-' O L,,,f,,0.4 x dyf .Q -,- fd 5 . K' T T 1' ' ' 1' if 5 . '5ii!11m., x p W WFRQcM2iWiq5:-bzgrgqfz-szzgz-2-:q:Q.551-25:-5:-3-g-g-5-,Nggywmqazm, 1,0 5 ' ' A 'HW' 'W -f .-1 .-. L O Q , . l ' 0 ' ' ' 1751- 4 1 ' .ja ,. I B T .fs il iliia HE? '1R3'i ildrl his JS? Wil u . E. . ull- I 1 ! Q I sl T I K- X 5 I I ' QW x ixfr llxg '-1,1 1' . 17 f W 5t52f:3WKf'Wf .wifi x?ZmmL17 rf:2mz ' 3.37. 'WIEWZI . .6 . TZ5i2fI'.-.442-5r2'2 '.'2 I is 5 4 nl raw . , 'I ffm v 4 .4 , if Cf r 6 F f Z 4 9 X 4 9 6 . 4 X Z I Z 2 f. a r dm .-FJ ,Ili 5:2 Vin ' 'E 551 wi r' 3 r' 5 3 q .,, . 112-: -If . S, fe M9255 N... M T - LV E. 1 '1 54. fi '1 df ??j . irc. P231 wi ,,,, i-,M ,9', 'm ., ,,-, 'Ku . Q fm - qw., 2 .5 . Z, W, Q JT' Y H011 1.4 ,.,-, Wu f sf naar. ow-tr:-:.-:,nf,.-.. -.qw N..,s,, iff? l si .-'33 - l,.. ,n ,J . M. 4 'x . .i . F il 2 -1 5 i 2- . i.. f 5 4' .forma f' nh, -A4 Q., f . H142 1 s M w , . rig ,ww 'me y., 5 X fm' ' - ' 47. Q, M- V6 V, 2 1 fm ?K nz :Jn ERNEST WILLIE HARWELL NE. Willie Amos East Point, Georgia . E. VVillie admits his home is in East Point. Other- wise, he is, all right-Wait! What's this? Ambition: to make an automobile 'Uncle Si' will like. Gee, UIC P001' b0y's crazy, we fear. Well, we wish him lpckt and really wouldn't be surprised to see him t o 1 . Society of Automotive Engineers, Company Foot- ball, '19, '20, Tech High Club. JAMES HENRY Josh Nashville, Tennessee VVe know that this boy will some day be as great a genius as his namesake, Mr. Ford. He admits it himself, though somewhat modestly. VAs you might already have guessed, he is never so happyfas when riding with Henrietta. Evidently she ishis soul- mate, and he says he will never rest until he has developed her almost to the point of perfection. To build a Ford that will run 41.17 miles per? Society of Automotive Engineers, Tennessee Club. ELLIOTT FRANCIS HIGGINBOTHAM, CIP E K ggHig11 Brunswick, Georgia Hig is a rather quiet chap, seldom opening his mouth to express an opinion until he has heard the other fellows give their views. In this way -he has built up a reputation for great wisdom, even as the owl. ' We are all watching Higgie with much interest just to see whether or not he has been fooling us.. 'Y. M. C. A. Friendship Council, A. S. M. E., Technique, Brunswick Club. h ,,.' w DAVID CHURCH HISCOX, A T A D ave Atlanta, Georgia I Here's another one of the hopeless, benighted, and incurable automotive engineers. This member be- lieves he can eventually make a Ford run on its reputation. Personally, we doubt if he'll be suc- cessful. Dave is a full-fledged R. O. T. C. major, having gotten his training under Uncle Sam back in the war days. Society of Automotive Engineers, Honor Roll, '20, Major, R. O. T. C., American Legion. Wg, O 'uuillfii 'l!i!'4' Ill IH ll- nmxu . . R' ' I Illllllllllllllllllllllll Illllllllllllllllllllilllllli :LHIIIIIIIIIXIII lll'l1l l lll'lllll''I'lllIl'llllll13lll'UlHl'll ' 'X Ill HI! I Ill Hllll ' 'l. ....... I--., -Z... U. xv. I . 1 x H 1 I Q R r ' w 'W X , X -'--' - , ' X ,,f . I - X, . V it 4- P, F, Nu-- i, ...Q pn' g A . .. I- . vt, A , , ,,. h Q .Y 1 .I I., - - i I 1... ,I 1 ,H HUMHL lnTf'Ti1Qii 'ltEBEli, 5 iimnf.im:mu...wwi'mnnnmvrmx1i -I I .. , . ..-J . ,.,...........fn.,....-um...-.121-lfmr .., . .,..f:YmJ N, N., 1,1 i, W t- - V- gi i - I... um-ummnnn-up-n-li...-w..-V-1--v----------n11mi-munlnumn-umum umnumnmm mu I ' ' ' ' . iq. ' M L 3 ...... . ig ' 1 ig ,K . ' lg ef I m m W W ' ' 'U ' I I W ll ul ra. ui rss: QQRXI ' - .. .... . . ...:. x :.r..... ... .. Ali' 4 V v K 1 l f r 5 wx N 5 S 1 + 1 A .Q 1' 4 4 my 7 4, ., gr -uu- 'X -mf Y I 1 wp fa! 2, 3 Q 3 3 be O I It OR LLVV ?P fLEg!52' N X' o gxiidw 'ig O , o AV 'v 9' f by 'z. lib 21 iff 11 , ,K f ,W L? l Qn :f!iii5!j5:x.. 'Qi A f , 751- f e s -sf 4. L f . . . , ,,,.,,.,,.,,,,.,,,.,,,,,Q if' lx ,Qgivffvffamwfzo7fxfmffmHMllffffWff1ffW2Wf070345350 5 B l tg ,, E L. ' - ' f ' ' A' ' 1, . 1-+L- t' K 7 V, , f A l In ph V s .,w,,.- l , , ' ' Y f ' .I L10 ll g L K. 0 Y anti 1 , P J ' 'SEQ ':. K5 igliir 0 .F XX Nqfqk m,?,gO C , XX X ,f I X. 'utr ' ' ii? 1 4 nj 'Ci , . ,4 P. r'- 'Ia .v t .t.', .1 4 .l I V1 r' .-, .1 . r, 5 1 i 'Ht .1, .4 1 C.. .,. li - A! l r. ,. 1 I J at F .v ir? A.. O . xx . N -'ip ff-. CXXI- V X N 'alt ' 7 H l l ,,., J If EF3 ii' I T H E B ....-- ..::.:::.-:::::::.':::::::::::x::::::::z:: .::n::s::1:::::r:au:nrnl::r::at::::::zfsm12I1 'umwrdgni ' ui' . wh, ,-.- an .,.,. ,.A.Y, .... ----','-' - -4-f----'- '--'- W H- - - -wt-fe--L Y' ' ,. 4 ' 1 W 5 fig? l ' mg w V' H lil HENRY JOHN JAEGER e tif ' . if t rift, Florence, South Carolina y 96' Aff H. J. comes to us from the Qitadel, where .he 'Q obtained his degree 1n Civil Engineerlng. During igu' the past two years, he has made numerous good iffji friends on the campus, and it is with regret that W3 we realize that he is not to spend more time among 91513, us. He was born in Florence, South Carolina, on iff ,tggtl i May mth, 1900. ,gtg +552 5 ' it 2 A if ' ' it5E5Wi JOHN TIMOTHY KILLEN, JR. 3 gg-E A Macon, Georgia , MEF: T 1 21,51 Here we have a quiet, studious chap. He can 5 usually be found with a cheerful smile beaming down gigs! ylfji, ?' 3 on the rest of the world from his six-feet height. Q 5 The only thing against him is that he's from Macon, tif- but possibly he couldn't help that 13. ' it ' ' '-4, tifm W K Phi Kappa Phig Scholarship Tg Honor Roll, '19, Fiififr' '1-3 ' 20, l21, f22. isis mil, ii Gigi t Eg 1145 i fi' y A ' JOSEPH GAULT LATHEM Jtt. A K X X . , N 9 s KX, 1, ntlayn E Atlanta, Georgia .J. G. came to Tech from Tech High, of Atlanta. ,flak A liast year' he took a course in Automotive Engineer- f I mg and since he entered as at Sophomore, decided to 5 lx, return tor a fourth y-ear and get a degree in straight 'ig E MCCheI11Cal Engineering subjects. Jay always wears 951: L 1 azsmile and is well-liked on the campus. .t - Q, ,ifz 3, V A-' S- M- E-5 Society of Automotive Engineers. hifi? .tif A N Iii .R 5 -' . fr -1- ttz ft iii! pi ARTHUR ENGSTROM LECRAW, X tp i Arthu1 Q 1 ' L . ' ff . .. . Atlanta Gt-tor it , , 9 g c . fig ' ' . . , M W -. . y t'A1tl1l11 Seems touhiave devoted the majoritv of his ,tum A E 4 A bime spent 1n activities along literary lines- ' He has lg 'eff' n Teen. actively connected with all of the 'pitch pub- rations. He also has essayed to trv his skill. with , amen light fanttastxc toev and we heat- lme iq quite Lgxjy 'sz P0Pu ar mem er of th l ' A 1 V53 A S A l t . e cancmg set. IV, Staff, Al tl 3 a ie at , .22g Technique wig 7224 Bosfsyehgggcigznagefi 213 Business Manager, I lg . i V . . I: . S4 ' . flsilg 'H i this a' tv A O F ate' Pr' . W2 X- ' i' Y d'i -f A M' ' ww X . iiitatt.. fs ill S-4.fgfxxifml-Iqgrzmrsrsxz-N:-a:e.s.-t.ss:1-nice:-e.:2st::.:-:-g-r?-Q4'1w5p9p-p,x,M,,,,,,4-, Q 'K . in . , -mi? U libs Q I '--if-it tt . -325 'V ,Q 0 4-'g,.v-vig? ,. ,gg-,E--' 'L:E'::Igi::i.1fl7-tff, -4' Q t mg ' 1 -- , A H' if--ftp--:KV T f' D t '1..gft: 9 0 1 x QQBTJ f -1 -- J..-G1 . 'i bl f ' ' K, i WSW. fm- 'N I J' AX If xx WV ,f x r- 'Nw ,T L, mr 1 xr 5 Obs ' -1 1925, .,.'k .9 is ,,-. .3 K, QS L :Zi fl lj-:-.,,,-,. 'lr e,3i1a ...4 I ff l: ,,.L,.:.f' ,, in ' 'l 1T'NfRQFYT51l'TYIXTY'1'1 N . ' ' '.ff 'Qi V S .- ug, ...MU it ' 1 , , ff '! ' '.-'.ff ',.4 N VK .. -T :ur :r y V. A A- ' 1 f ... .. ...., I I N I M .. .. ., , ,Q . ,. .Al ,ali lump H , 3 1 i uuln nn I- my , 1,1 - -.u.....-um mi.ummmmm-..G,...m-.---.-.n.......,.n nn.-,,,,,,,1,i,.,f,,, ,,,,mmmiin'1 l u H I .B xv . i A . A i g in 1 N . X S I I ' x N 1 I 2' l I 22 . 2193:-51:41. KL- .L ...JJ335 P fr xv D4 l ,. v. ll ll 1. 2 5 iii il 'J 1 :li EE :lil i. . gal f 5 ' . 1 ll vi i 1 l .iw if 1 9 I E. Q2 l tr' xx. u X 1 I I i g iu..m:.:l ... . Q gr I 1 i 4 Yi? 'ff' 4' cr if .... A , L ,,,,,,, m ,,,,, ,,,,,,,,,,, H lllll l I I ll llllllillglllx H sxsii zlgillllxsg l l it .., ROGER WOODS MALONE, K A fllzogli Macon, Georgia u Macon again! This time we have a boy athletically inclined, Rog is also somewhat of a master of the art of Terpsichore. He is a likeable sort of fellow, making friends wherever he goes, especially among the fairer sex. Scrub Football, '21, '22, Scrub Basketball, '21, '22, Vil1'SitY, '23, Company Football, '19, Captain, '20, Captain Company Basketball, '20, Cotillion Club, A. S. M. E., First Lieutenant, R. O. T. C. ROY L. MARTIN Atlanta, Georgia Roy has an all-time, never-fail, ever-ready smile that keeps his face constantly beaming and so helps make the rest of mankind feel a little better. Roy is a good student and an efficient one, graduating at the youthful age of twenty. He has a pair of arms like a mule-in strength, not shape. Honor Roll, '19, '20, Boxing, '19, '20, Captain R. O. T. C. DONALD C. MOORE, H A A 'fD1Jnty Atlanta, Georgia D. C. started out some twenty-four years ago at Montrose, West Virginia, but reached Atlanta in time to obtain a diploma from Tech High four years ago. One day shortly after this event, he happened to journey out toward North avenue and thus saw Tech for the iirst time. Feeling a deep mysterious call to things higher in the educational world, he decided to remain awhile, but is now ready to tramp Masonic Club, A. S. M. E., Tech High Club, Blue Print, '23. JOSIAH PUTNAM MURDAUGH, 11 K dv Pete Bartow, Florida Pete is another Tech man from the Alligator State. He obtained his preparatory training at Summerlin Institute and entered Tech in the fall of 1919. He wishes to announce that his name is not murder, but that in reality he is quite a peace-loving youth of but twenty-two winters. Company Baseball, '20, '21, Treasurer, A. S. M. E., Florida Club. 3 C M UO gg Og2 '666Z9957! t Q 'HH WEA' H ii Xgffoo Slain o XV 4,7-Hggkix f O W wot? , tl. 'ag - iM f, ,mgij U., xv, M fisasaszgr...----V P T-, 'fi 3477 gg - 7 ' K' X ,QX'f!!WZ !M if. ,.. , lg Q QB, . i -I H LV 'P--: - , .., . if .I ,H J, E A 0 Lionel. rf Y 0 E HHN .Vit by U 'XF f . :g Eff' 6 0 on again. - .iff f. 1 . lf r' C. .1 I. A -'J V 1 . .fu 1 i :fl 1 v l ,-.ill . 'El lf, 5,1 '-4 'Il 441 .,. 1 1 xg. I Lx-, Q N .,f I' i YNY , f3'e.:..., iii ,ff ,l lifarkix - -N V- 'I ' 521.2 Qf -.2 :umm mu I - Qvv l ji W Q, 1. Al, ,,,,,,4, -..ma?f. ..- ---M------'H ' 'ii' ' W 'W W ' ' 'M V, fi? -I WH - mlrfnnuu's2mr.immfw--w f 'i '1' 'm' I H I , I ?',lf7'LgLil3i ,IQVEIE ' B L N J , I -.J . ilk: i ....--:------::-:::::::::::::::----'-::r nm:::::.':::::mas:umu:n:::z:ll1::l::::::::xf:::a::1:mmu:::::.:a'........ .---- ' Eff: ,JT W YA: . .'h. Plqt''v,4.. - .,-AvvkQ'Y, M, .,,-,,, ,,,,, F ,,,,.,,1k:xf,1w...-...f.-.walk,,::::::::::::::.. ...... .. ...... . 1 J' la? 'iflfil' W Vu lr-1' yfixl, till - W' NoUGH III 2 A E L3 3.1, MCDO s 1 Wigs ,, 'fJack E Savannah, Georgia ' l till ' . - h Q' 'L it Here is the bramy'R11ot of the gorlnadgeltorlgtlge Past four Yew- Afflvmg heife In ep em fi d ai Wifi ,fix Jack went down on Grant Field and Pfoceehe de- demonstrate that, even though a, F1'6S1FjUilUE C for Served a place on Coach llelsmans foot a I eam' t my gifs, that year, And he got it-and has held it agains Qfflff .ll o osition .ever since. 'Zi f' fl Valigty Football, ,19, '20, ,21, ,225 Scrub Baseball, V523 i iff i ,195 Manager, Basketball, 323g Skull and Iielli Pfesl' . iii? dent, Kosemeg President, Bull Dogsi 'T Club? !5 ij. . .4 g Anakg Cotillion Clubg A. S. M. E., Savannah Clubg W, gall fi A rs- First Lieutenant, R. O. T. C. I 511. 2 ii X ' :gil : 11 R 'A ' - JOHN NEWTON MCCLURE, II K A Y ff l it a . fflmwff Eff? it 'N , . . Lffll A Norcross, Georgia :flu The small town of Duluth was surprised one quiet day' in mid-winter of 1899 by apiercing yell, OH x y Iii, investigation, the source of this shriek was found to Eg lf be the youthful lungs of Mac, then but ten hours old. - Now, at the age of twenty-four, he still possesses I 721' if the ability to bring forth sounds from his mouth, but i seldom does he allow it to take the form of that Q 4 rt. fn li earlier outcry. -'-.Si Second Lieutenant, O. R., C., Masonic Club. ' - l va: 12 lf BENJAMIN JAMES O'CONNOR, A E T ll. 'P VS ffzmkef' 5 A I5 . W li Kibbee, Georgia A A iii 7 . . . ' -. ill, A5 Mike first arrived at the portals of Tech hack in lm! aff- the war days of '17. However, he soon left school V54 353 at the call of his country, but later returned to PQI 5 obtain his degree. Mike came here from the Brew- Pill 5 x ' ton Parker Institute, wherever that may be. 'Q' l I . American Legion, Kinematics Club. A li! E Qi s' -' ' if i if ' - ilgi ,lgzz ix. 'i , .IEE , JACK WATKINS PATTERSON, A K X . .Qr . 'fPat E, l ii Atlanta, Georgia ls' Pat 'was born in some unknown corner of Texas. exact name given to the crossroads there being QQ' SE if Plglnt. Though a long way from the Lone Star I 533 a C, at Says he 1s.very well satisfied with Georgia A153 find eXPCC'CS t0 Practice here the training he received lnrlthe Automotive Engineering course. Q3 ech High Club. x .ss N' 453 Vis D ef? mo r 0 E ' 537mg - f c5w,.:,,g 1 517 5 el im ' -Q N D A I C-FQ-X211:.-Deer:.zz9:-5xfmcaP:smrumaaz-m,,,.x,,,M9,3W,,,,.,,,J0,gx,7 5:1 -' I V A H K f ii 77: :wav Y 5 ' L -. .. . 3 3' qXf .V 'Y 1 ---ffl! V... ix- 7 ' -1 1:2 l ' N '51 ,rf U ' L---' -EH R- I , , ,Y f 0 o Q53 . --in Q. -. -1 1 A 'HWY-. f+5r'm If o ,I ' :f 1,-U al! null au... in ,Q 1 si 1 Rst W. on 9- ' 925J,, E . .. V . 'if r, t . gp,-.e,. , Lfrfr- ---' -1 ..f :.., . if N' Eaguqh 'xiiif ' 1't'l3 ix'Y!T'Y'TU'1'i1il'illll .' Lau.: j h .,:,,1lll It-hbll glm l ' a m i Q ' QQ . ' '' '' fIIl'I'iiiilllt5? 'i5l' - ntl fi: - l I 1 W r gill' iixxl-sits .. .... f1'lEiLLi.L-..L........-ll..gEgi4J1'w' - - fn , I ml g ' V N -Ll IIllllllIllllllllllllllllllllllllllllillll LX Illll'I1llliIllllllllllllIIllIlllllIIHIIIIIIIIIIIIIIIIIIH Il- ll I IIZIIIIIIIIBHHI. , ,.....1 --vf -. ills. ....' E: ll' ,l 4 ' l l 4 p XVILLIAM RUSSELL PHILLIPS, JR. y Goofy A 4 K Atlanta, Georgia I . . . ,Q Q Xvllllillll Russell is one of those students so fre- f 1 quently seen who have to plu for their knowled e . 8 g , ig but unlike many of them, he always gets what he is starts after. Entering Tech from Boys' High in Um' Goofy, dllflllg the four years since then, has S constantly stuck to his work and now graduates as 'Q 'Y an Automotive Engineer. N Boys' High Club. 1 N ' E is GENARODEMENENDEZPOVOA 2 1 ffjimmyil p E :EEN X ,I Camp-os, Brazil ' SI Arriving at Tech in 1919 and finding the English Q language much more difficult to pronounce in the 1 'ivffffxj United States than 1n the class room of the Campos ,ag g'f1.oi'e,j-..'.' H1311 SQIIOOI, Jlmmy has remained and is now ready o. iylgzgi if to receive the much desired sheepskin. Povoa has Q' 1135, p learned .to play football since his arrival at Tech and.- RKQQQQ made his numeral in the last season's play. 1 V, 1 President, Cosmopolitan Club,j'20, '21, A. S. M. E., 5 l. , Scrub Football, '19, '20, '21, '22g Numeral, '22. . in' v 4 'u 1 + T I ,E CHARLES ERNEST POWELL, K 2 'Q AH f G 'f . Us gmg Here is a rather ambitious man, determined to get 'W an education. He gives us the information that he l first beheld the glow of dawn back in the Middle J Ages, date approximately 1893. In his endeavors 'J i in il to get the aforementioned education, he got a bad HH I -5 start by entering Mercer University, but learned 2, . ' enough there to realize his mistake and so came to Q - Tech. ,il A. S. M. E., Masonic Club, Boys' High Club. 'L 1 ' VVILLIAM VVIGHTMAN RICHARDSON, II A A ffzicoozff l 9 Washington, District of Columbia Reid decided that in order to be able to run the l Government in the right way he would need an 5 EZ' education. Having decided that Tech offered the best opportunities, he left Vlfashington for a few f years, but is now ready to return and seize control ll of the Government. It is alleged that he first in- ' ll tends to take over the Mint and the Prohibition A Enforcement Bureau of the Department of Justice. Advertising Manager, Technique, '23, Assistant 4 ' Advertising Manager Yellow Jacket, Blue. Print' 1 Masonic Club A. s. M. 13. Honor Ron, 21 22 First Lieutenant R. O. T C. Company Football M11 ionettes. X . ry-o all X ' 1 5 4 y If Z 7 f . , 4 . 7 V 9 l ,X ' f., 5 5 9 9 Hg ' , W I 1 f C ' ' S g I ea we of 1 ' 1 f , f ... 2. , f V A o ox 'W -391 A o L ' 41' V X1 .X N, f, ..-s vlsloqmd l NLR' ilil lliiiill- ' Q W f g - A M 'ftlifi T -3 J 5210 25 . Q5 ' f .X Ya as tg Q L . . .H U A ,. Q p A 'e Hof' ff f -Y 2 -. . ry , 1 J ,,, S. ,agaggeefw is A o LL 14 E, L yi fl 5--xg, 5 ' . Y-11 f I Zgi7 9NQ 32i: an U Jigygg? of W5 Cli f, QJ 'LW 5' 48455 Il ,mips r.-. If .u .-X ii IQ .', -15 7' ,i li i.,. .'.:,i 4 -'1 ff: - xf 'f im lifml ' '21 A W if f-s o 'eg .i.. ffl. ..... .... .....- 1 if--' H V. , : I., wn -lf 'nlwlumrnwlummuwumm-mamaunrnmmluuuawmww- V P f rr: J- , 1 :U 1 I sg 'Jill .ar , .. Ei, U, rl in T H B L -- --'- :':::::::::::::m:n:z::mz::::::: zninluzlziiml gmgggmrzlmugmlmml mm- -U-Nm li ' V ina ' 'awwwmum-dum!.um-.M-.gud is Q I M, ummmnh-::ggggg::::::Ill5: A -H, - fl WT :TW . Jail ,gifs 'af 7 4 l Woo Fang 'WV ii slji i h Geol. .ia lfkg 2 y Savanna , g . 1 i 4, Savannah has the honor Of lielng tlffwblrtgggcs l j of this budding Mechanical Engineer. oo g li lg l s been a familiar figure in the Band and R. O. T. C. lah la . -' - 1' 5-haf thus proving that even 'AF ,Q Cadet Coips duiing HS 3, N 1' H +522 though a Rourk he is not a 1'oo ne. , i First Lieutenant, R. O. T. C., Band, '20, 21, Cotillion Club, Savannah Club. ' ilfill' it 5 llffif' 'I I Ifilr If Eiffel, ll ' CHARLES G. SHEPHERD lliiill 5,5553 ,,Shep,, l f 5 Macon, Georgia ' Shep', began his career through this life bacli T523 f in the autumn days of '96. He spent a ew years 21 iwgsiiiii Lanier High, and later decided to finish his educa- sggjlj fill' tion at Tech. Though a few years older than the 'VM lfilili, majority of his fellow classmates, he is well-liked by 5 each and all of them. Eg Wu! A. S. M. E. 4: ' .P CLARENCE CUNNINGHAM SKELTON 'I ' l War Baby Chicken 4 , Irwinton Geor 'ia .K Q ' g , 9, Chicken began drilling shortly after August J , , W 18th, 1899, the late Spanish War being his main Wd l , inspiration. ' When the World XVar found him at I ' Hixson High School, Hixson, Tennessee, he left bl' school and served overseas for two years. He re- -i turned in time to enter Tech with the rest of the class of '23. jg HARRY VANE STARBIRD, 3 4. E 5 X r:Ha,.,.yv1 Y A Apopka, Florida. I 'What kindiof aubird is a starbird? In our opiu- 1011, If 'Elie qulet -being here presented is a fair speci- X 0 men of the species, a starbird is all right. .H. V. is Q rather short and inclined to say little and that little X i 1? a. quiet .tone that lends him an appearance of ii elgnlty. With those eyes of his, we believe that wc, too, could be heart-smashers. A. S. M. E., Masonic Club. 1 n-'fi 1 . iii LH C Q-Qliiv'-Z 54770 O ,- - .... A 0 R- Gif' L Q.,- . E 515 X s V ji g A YWk'4AK:?4:-5:-zmxvfemvavsevgazoy A,-1,1 ,V g f T I 'u 2 ' N in V 1- i rw W ,Y Y . gf Meawawnfi t g eg Q ', . Jezff - -- ' ' E he T2 -R infeai U ,bl 7 Q:i ,6OQf. 'U l .l' s it Wir, H f'N v l l .W li is is .ls lxi X S .E wg Q I S ls fl Til l r Q ' . lv' sw . ann' AEI Ibn ft' l IQ: JB I l A EE 1 f 5 x 42. 5 5 6 f 4 E I 2' 4 f Q Z X 4 4 4 f f is l l I 1 5 K' ' lvl Q' 14? .tvs ' rl' ' Qftiyxif C45-. Q i flly' Ji' - It 1... gy LNV-yfgY35xf1Ygl.fX3 owl' KEN?-1-9-.-f..,...4Jf1f ' l sf? -'fi Un- xg 4 , .., . N Q .h . Y .fa . I .. --TS-,pf .i g ., aw , - -' f,, X V , . . . , - -S-:f . '-vg--'1-.- Ni ,,, ' ' . 'tif ,.u - .,- I . 1 l . -4 , U ,ir - 55233 vm mmarnunu T 1,.,IDX'i'IEEmTimIl1Y.Y'..1i'm1m zulu-mlm i lm -.-nt. ..,m.--,.,,.,i.,, ,,,,,,,,,,,,..,.....l....-i umm...-,..1.,,....,,,....................,........:......+..a--1,-.Q-1....:i......-mm..-1.....a. ,.m..n.2Sl ....,....-mam...mimi ggnqgqmlwa l -:-I . - ' '. Su p . v ' ,,,,,,4 1----imap ' ' -L V . ll 'Cu' 'E --.!....--nn-IL....--..nu..mu-1-ll'.-Kiln-'Zhi'GRIuH35Iml!!-I-mfmuah.-5..--...munl--m-.-um',,.......--.- .......-.. - e-:H . a- saaa - .,.,, . ' lf EARLE GORDON THOMAS, JR., 2 X Kirkwood, Georgia This boy is possessed with a wanderlust, as indi- cated by his statement that his ambition is to ex- amine this terrestial globule we call the earth. Realizing that an education was essential to a proper appreciation of its wonders and to a knowledge of the art of hoboing, he took a few years oif and came to Tech. Tech High Club, Second Lieutenant, O. R. C. HAMILTON AURELI US TIDWELL . V Tip Atlanta, Georgia This beardless youth of twenty summers, despite his classic and aristocratic name, is really quite a democratic fellow. He broadcasted his first shout of joy on November 11th, 1902, nearly frightening the inhabitants of Buford, Georgia, beyond their wits. Since his entrance to Tech, where he has become more prominent in the public view, November 11th, has been declared a national holiday. MARION CRAWFORD VERDERY, A' T A Preach Augusta, Georgia Preach is a jolly sort of engineer. He hails from one of Atlanta,s most promising suburbs and ex- pects to go back there in June and wake the place up, especially the feminine element of the town. He admits that A. R. C. is the best prep school in the world and also that he holds a charter membership card in the Tech Hobo?' Club. Technique, Barrageg Augusta Club, Company Football, ,2O, ,21, '22. THOMAS HERBERT VVATSON, JR. Vlfhitmire, South Carolina Tom Watson four Tom, not the late Senatorj was born in Greenwood, South Carolina, the event being the cause of great festivities in the sunny Southern town. Twenty-one times since then the town has decorated itself and declared a holiday to celebrate the date of his arrival. He will return there in June and become their chief Mechanical Engineer. A N 4 Ijgd fi fi 2 5 A Shun 'w 1 'Wi ll '- 'QE' . I F' ful' K lm ll I4 A . V1 if o o 59,70 Q- x 1' J 7+ X 4 'E 0 rvv .X o X Mas f . X W' ' D gxblgw -fax I o if wg KJ 1' 0 , Sy 3 hge.. t 4 Nga , , , 2 -. iazafllllg . ' ' 9 -M -f - - x P- - ff - W' A ' ' ' ' A. , . V Q 'I ,N 3 .4 ., . N, . M K-A ,Q3Y,ffff11 f!Wi l4f2'4fMff2'1Hffifffffff ,El ' 57 Ki 3 G . a f. as w .ogy X. iLAxfj I i A , y Q, mr .-:ul . 0 ' 3 LW EL KV - f ' 1, ----amii W' 'D' ' ' , 49 lgliisi., . O Clio 'kgluqlq cob- o I I I I I I I I I I I I I I I I 1 I I I I I I I I I I I I . I I I I I I I I I I I I I I X. fn. ff Ikjbx I, Cvqyfyfzihi, rf bv I ' ---.J , Iymf 1 ,II Lg,-Qyugikza ff-Ig Q., 4, ,, ,f f If -f Q-II IIIQE-iilitw 'f if l . I'Iv?! .l: JIQFIX f'33VVxhfEI' .5f.2ZiiL.fi:':.:gl5g-'. Z.. E- I f4F:',T--T. .'ffi-elrfi-'i1g,1'.j..f.f.1Llgf-E.:.-1Q1,.13ze1:.-1u-wb,.,-eh.-,T,,,,-, i , F up f Y fzf- eff, ff- --- --I - -- -f-I-e- ee IYTTE I -1 fi II If I I I 'fx-.1 .jf-41-.sf ?- Zi fl! I , -.XX Ay, Ill, EILI II Y I '- I I I I XIII IjXIS.1l '-:Q:gl1r::v?gf':'f1 -- ,,,g.,,,,L ,Q A LI., .ies 47 ,,.,,,, ,..,.,. ,I 5L 'h un'V I wi N VVIIDF CHARLES LHOMPSO 1 J III, I Os'0m ' I 'I i Jackson, Tennessee Ifif Oscar marched up to the log fire, expectorated il Z vociferously to the ruination of the kindled blaze, and clearing his throat with a gutteral cough, an- II III nounced his arrival with a deep-chested VVaaaaaaI, ' 5 I on the morn of January 26th, 1902. Having thus jf E surprised his family at the start, he has since sur- I 'III prised them again by staying with us four years, 5 during which time he has made many friends who would aptly describe him with his last name, the en I left off. ' Ii i I I I 1 II I p IRA EUGENE WVYATT, CID 2 K I I Hank II I Columbia, Mississippi Hank came to Tech from somewhere in Mississippi hack in the dayssof '19. During that time various and sundry causes have produced in him a total abscence of ambition, he told us. He can usualh' Ljjkf be found playing his saxophone, this is evidently his ISL way ot forgetting his troubles. QWe fear most of Ilfi ,If I I' CS 1 QL! -' --H4-Vw ull - II ..l 41 I. -.-WIVI II ggI, I., , I I -' I I I y I I .I I I - I' .- wi IQ i I III I 4 Iie IFF IZZII -s.I I Z5 I CII Iiji IIFIII :if I35 IQIII I221 I E211 ptifr' I NN l xx i - ...H his troubles are connected with the fairer sex.j A. S. M. E., Band, ,23Q Mississippi Club. fl: Is I I 'IL' O Jay. Iii jp f5af3f'gg,i.j3fI'2f O 7-1 H-5,5 O V Wir ffwif L , N my t I' 'fgwfulf --f' 'qgf' Ilifwmzhl-rjy LQTAQ- ..-. AY,l V QQO ful. 34 A ,Q Qiih-My-Q f IEII 'K it,x..XkxXN?l-Zsxyf I if-NV se +sss H I I lv Is'52?I'f:-Esiff'Qs9fg ' II I K'-xx I .HYs. I X. i 'T Llff-' Q s::'7. :N-4 I'1'gY' --ELL: fiTTT 5.153 -5,-I I 'Zi I 'I ix I ,nfs I i I III' I . I :H IIIQII I .- IIS X Il:Q.I IIf4'I ' VII 'FNIII I k I If I III III is .Ig Hex Q NXyIx hx Qt I 1.1412 . .X X T .. i ll 1925 ..-.. . L L .... - W N 'D'D 'er ' If- Yr N'1s, .,:Lh-V ? .MqFi:.,g,f.,-Z-7 In-5 .ll 'pf X .Q-. 'Y -S D ,Lu .rfn dv , Nun 11- mprllrllvlvll Ill sumnmunmuunumnnnnniuiiuT.L.,.f .... U. .uL3..F-1 .Q'ui-1.1nm-All-:GEMM ----.f- 1v. -I---1 'f-'v-- 1 Wim- --'-' -1 - 4 --'- - '-f-H'-'H --- 'ffl' WT' f ,Wil T l'l D L P PCI N I mime lllllllaa -.....--..u..--. . -i KIlit:XRIiiIIlllRKRillBIlIlllUllllIlHiiillBl ll KillIIlllllllllllllhlliltllllIISIIIIIIIIIEIIXHEIIEIIII :IHUU3ZYHIIHIIHISIHIWIBHIISIEIEH1RuIiiiiHill!lilm!InllklillliffllH1352lllllllilllilllllllllllllllll. ...... ..-.n - Jill ...... X V0 I E B 0 o 1 X ' ' ' X E achelors of SCICHCC ln Electrical Engmeermg .gl THOMAS YVITT FITZGERALD, B.S. M.E. 5 Q Professor X , E . gg . S JAMES WELLS ASBURY, 2 fp E 1 . Sleepy -. 5 Clarksville, Georgia f: Asbury entered the arena of life on September li -, 2nd,,1900. He prepped at Piedmont College Acad- - E emy and came to Tech in the fall of 1919, Where 52 . he has spent a quiet but by no means a slumberous 2 . life. N If you have no pull, WORK. .. . D il 5 Nl 1 .Y K' . bl H4 1' Y' .i l 1 I l 4 E V Z 1 . i Z 4 I- I 4 X 2 3 Z f Z, X, Z' Z 9' Z - 9 Q , I f f!.1 Wm isp L. . 'Q BERTIE LEXVIS AVERA HQDIU Fort Valley, Georgia Lewis first began selling books way back in the year 1898, B. C., at Byron, Georgia. After complet- ing the prescribed course at the Fort Valley High School, he wandered to the Tech flats, where he has become rich off of the graft from the other students. To be a book agent. Honor Roll, '20, Student Supply, '22, ,235 A. I. E. E.g Company Football, '20g Lieutenant, R. O. T. C., '225 Phi Kappa Phi. VVINTON EVERETT BATES, JR., E X - ff W. E. 9 VVayc1-oss, Georgia ' The state of South Carolina lost a good citizen when Bates left for Georgia, after having graced Charleston with his birth. He now claims Waycross as his home. After Hnishing at the Waycross High School he entered Tech in 1919, and has made his presence felt ever since. He is too timid to tell his ambition. Marionettesg Technique, '21, Barrage, '23g As- sistant Business Manager, Blue Print, '23g Y. M. C. A. Cabinet, '22, J 'Ill ...Ll 'O qs Ha l .QI l . 1 '-my P + - M141 I llllr i M f . 5 3 S Q 3 S I Z K 4 6 9 I g 4 f Cl v 4 Q' - V 'A Luv uf M' S' y. X 5 0 xF'4l,- Sgfo . o it j -A. 4 ff' . 194 N - H.. E221 Lg , . ....... .Y . P ' - .rzziflllld U, QR Zfiililgu- N ' -Q W- - - f 1- ' 5 .- ' xt U , xv fWmfzff,yf1fW0m'.vn,f1Qsfsof,zfwgszm fffff fi' I O N 5 ' li Q -' Ii . ' H f io.. .. Q Xseffissa 31 5 . 'P L 1 0 r E3f'1'-, f9 5t Q 4835 'mi t .Qi -r . . Fi s 1. rf, fi l 1 N ku lgq, .,.. I.' - . . fin .34 'Q X. .N 1 Li Z -1 I. .1 V. v, , 1-1- fi .F a 'gl' L. V ' l'. ,4 . -.1 K it A A f' .... if .A... ..-.' 'f- d PHE' H v ' llmlmlllmuuuinalunmmm shawn-n l l 2 ii' N 1 E 5 'T I H H I D L ---- u-rr-'xinr.zs:::::::s:::::.:::::::::::::::::u:' --A- -11' ---' U gig-if mgvnmm -.,,..,w,,.. r ,.,,,,YAA h, ,Y,Y ,,,,,,,,,L,,,L,,w:',......,:......1:.-'u,-f: 2125: 3' V -l llll' :null nm .. mlm- In rfffiv I 711 ff lan , V p f X Nafrgg. gt' 4 . .11-..zm:znLnsa:rz'f1'.-222' I lt! I' fl. . ' 1 ' EUGENE RUFUS BONDS Zi' . ' ' ,,Hick:: , , , i 4.1 Russellville, Arkansas him 1 Hick received his training for Tech at the High . School in Russellville, where he was born some Zi! 'lg' i twenty-two years ago. He entered Tech -ln 1919, 'Z and since that time has been carving himself a , niche among the juice men of the class of,'23. If .yay 5 he lives up to his ambition he will make his class- will lgliffll E Q mates proud of him. .1 A million or nothing. fill lffgl lj Company Football, '23. l ,QQ rf 1 ' ffl? 'l -f will Qi Q SAMUEL PAUL BRATTON, A 2 fr V pl i . Little Lot, Tennessee 256,351+ ff HB1-at, the good-natured electrical, was born in l Little Lot, Tennessee, June 5th, 1896. His desire 53 to enter Tech caused him to spend four long years iifll' if at Chattanooga High School. From thence he en- llgiglll ffl' I tered Tech in the fall of 1919 and he HOPES to be 'H A able to leave in June, 1923. 5 ',t, To develop a love for my profession. A A 5.45, Tennessee Club, Blue Ridge Delegation, '21, A. I. 'Fl li fi E. E. 4 ' g I I A . HERMAN BAINBRIDGE BROWN, r cr A Q 5 H. B. ' 'N' .i 1 ,i S535 Lawrenceburg, Tennessee, Beholdpthe mainstay of the rifle team! Ever since ml. 5 3 he has been at Tech, H. B. has been chalking up ,ix , . pk 5 bull's-eyes for the school on the range. Due to his li' ll ff 1, ability to shoot profs as well as targets with deadly 15. gf -, , accuracy, he is raduatinfr this fear having made a UN .. 1 g za ll J an tix I 3 fine record in electrical engineering. Retribution for four years' labor. Hia' 5 Tennessee Club, Rifle Team, '20, '21, '22, Cap- tain, '22g A. I. E. E.g Technique, '22, VVinner Rifle Competition, '22. Q I . i rx 1 if ' 'NI l hz, 'if i WILLIAM JOHN CAMPBELL , 1 gg. ix ffmzzf' i 5 Q 1 Jacksonville, Florida IL . Bill fi1fS'C 'C00k El peep at the balmy Southern skies ' on a bright September morn, the twenty-first day, 1 To ge Tac? He Spent the majority of his days there is lpn., in ac sonville, graduating from the Duval High in gl 1919- He then became fired with ambition, and so I entered Tech that fall. Bill is well-liked on the 2?0'i1'0W Oranges at the North Pole. Ollfa Clubs A. I. E. E.g Honor Roll, '19, '20, is Q 5 S K 1' . f KW .A L 1' fn.. . .. . A-4 -?1-.....--. A, , . x N ' S O fn X -N Y, .ggLggE3 K if, fa ,500 'Fi Ll L ., X - , Q' 9 'v. o o , Q' 4' X sol 0 . :argon - it w. .k.4T E N'q'?'lmY'm'fR 7':fi55 i:::5X':Q6RE'?'x?3 4'N53i-5fhWW'7N40flA4.sg E K ' Q xii Lac:-si. H. ' ' Q .. .um ff - fu fi - X J' 'HEL ..,. ..., :r gilaihuw 5' - 'NX X . , .2 C - ,im L U f , ,T ,A 5- ,Z To -I D J? N M O i 1 x x 7' 3: .V ,1 , I .,... V fl , if f . : 4 ' D Ea rl 'Il llllllllllll l l ibllllllllllll nuuiiu:il':'iF5'm.nm :il-1: --1--,---,. shunmumu--liivfim-Env-!:.:,L'f.q-Q,mia- ---- 1--- . i:--lZ5-l1if- v-ff-G11--JF?:.:: THnn?i:n'I'Ivan' Inu:-,flln liif- i.llil,,gHl1l !l -lil' ' All t' 1 D L V E. P ll.,I 'IIE Mi ifll 7. 1 ' if ' N3 ' llllilllillliiillllllliillnlIIIIIIIIIIIEIHEIKIIHEIIIHS ill IIHLHHFHIIIIIWHRHLWSFFJWFIFTEIHIHlliHII1IlWFl3iml5lIllilll I IIIIIIIHF lllll .,... 1 .,.-v. .. ...... ,ai Q, at wg - IS I. REID CARLISLE, JR., K A y S ffzzeidff ,. ,S Atlanta, Georgia I Q Reid began singing in the Sunday School choir at 5 3 one of the local churches in the early part of the S twentieth centur -1901, to be exact. Makin a ' s Y g Q Q killing at all performances, he started in search of Q a larger field. Hearing of the opportunities of the Glee Club, he came to Tech in 1919, after a stay of 3 Q 1 four years at Boys' High. I To get even with the Ex. E. Department. 1 Honor Roll, '20, '21, '22, '23, Scholarship T , I J' Glee and Mandolin Club, '20, '21, '22, '23, Technique, Q p A '20, '21, Phi Kappa Phi. I ' JOHN WRIGHT CARSWELL, 2 A E 5 Johnny if Waynesboro, Georgia -I I Q: f The first stop on this young engineer's road of life A , l was Bellevue, Georgia, where he landed on the 19th day of September, 1901. Johnny decided to see the I -. world, so he visited the VVaynesboro High School, Q 1 but soon left for the Shenandoah Valley Academy, V. E Y.: ?' .4 I4 lil 4 1 6552 6531 gli l i --mg 'F' , ' I A 4 l 'f 7 z 2 Q 2 4 E X Z 5 2 2 2 .7 2 7 Q 1' 2 wi? soon to move on to the Academy of Richmond County, Georgia. He entered Tech in 1919, and has been much in evidence ever since. To be a farmer. Company Football, '22, '23, Scrub Baseball, A. I. E. E. HOMER MONROE CARTER, qs A 6 Cupid Cleburne, Texas For a Mexican athlete this man has done wonders since he has been at Tech. He is not only premier in scholarship, but is a good athlete and one of the most popular boys on the campus. Although from the wilds of Texas, he is rather quiet and reserved, although when he does talk he always has a good word to say about everybody. To heat the sands of Texas with electricity. Scrub Football, '20, '21, '22, Y. M. C. A. Cabinet, '23, Captain R. O. T. C., '23, Scabbard and Blade, Scholarship T , Secretary Student Association, '21, Secretary Senior Class, A. I. E. E., Phi Kappa Phi. JOSEPH MAURICE CHAMBLISS ffslimlj Moreland, Georgia Following an instinct that led him to take elec- trical engineering, he came to Tech to gratify that desire. He attended Emory University Academy for a number of years. From all accounts his pre- dominating instinct which was so early fostered will some day make him one of the big men in the electrical world. VVho's Who. A. I. E. E. .SCH 6 .KW ,X lien 1 ,U 4 ei I l 15513 F' ., I ar - TQ H w if 1' I. X 5 S 5 Q .Q Q ,Q f 'E L. 100 0 Ui ok, lf er. 5 1,0 7 JO ,fxc O O Q f OW' . -E. it 5' R24 r . . . Q -ae 3 X X21 esteem ... - CP 1- x v , 1 1 u V' . KX . 1 1 fx. f,Q5gfff,v, ff1ffmAfmfpwmsov-msxawwgymxyfffff I oss X 475 V :3-A F- lv Q L L , .. tion . . .. H i Q --nmeii' 'F W X -'-' Q 'WF' ' L K '- .Q it . -17 p A . ,ff ,, J- .-1.42 Qf q JBBEQ' Cu , . . , '-NK., A 2- fw- - 21925, V .X , -5 -Q-G-Q-ff , -:v, 2' lm , ,,,,,,, ,,,. - - I ---Y- I . u numnnmawlnmmmnumu-mlluulmmuniulklie ..f--f,,A.,--.4- me -3 -H 'ffm 1 ' ' uw' ' .E All T H -.,,,,, .,....., ...- gmgggggg -:zz:::n:::::r.:m:::::::::::::::::::muma:::uma::::::::x:::l::::::'::::::::::::l::: ........ - :1!1,.....i . 5.--.....-.... ,3 ----. . gr' . .-. . -M - v- .:zz::::::::::1:: ':::::::::::::::5::::::.'::::!:-'S2- ---- --- ' ' w ,TH ilrf 5 1 Iii' ' , f HENRY BYRON CHAPMAN I i b W. S. B. y fu i 4 Atlanta, Georgia 2 This radio bug first began broadcasting in some 1 'J Q ' 4-65: l :jj r 2125 M5152 I! In i .f-I EQ: 3 al 1 54:2 It . fl M 1,1513 1 1'2- ,rlff I lin! 1 155135 X:,I34wiGi Jil leaf X .W we R i ,E l 'I Iw- f rn , 1 5. 5 sae. H31 - r 'Q l 35:3 is ,. , 5. P2 ir Eli? ti? IN IQ? 'Nazi IE Z- l N 5 1 ix. l I I Sf -4 2 -omsms-Jams Aga, 5, local domicile about the year 1900- He P1'ePPed at Commercial. High, but soon mastered the gentle aff of Cfbrass pounding, You can hear him nearly any night on the C'fhC1'- f'To become a Radio Bug. Honor Roll, '20, '21, '22, A. I. E. E., Al-Ko-Hall Club. ' . HARVEY RUSSELL CONNELL, A Z T . Harvey I I Orlando, Florida After a couple of years at the University of Flor- ida, Harvey came to Tech and began playing foot- ball on the Tornado. He has made the team a valuable man and has won a place in the hearts of his teammates. Originally quite a social lion, he has somehow gone back on the dances. It is possible that he now finds the porch swing more inviting. To supplant Fitzgerald. Honor Roll, '20, Freshman Football, '20, Scrub Football, '21, Varsity Football, '22, T Club, A. I. E. E., University of Florida, '18', '19. , THOMASLAUREN CORWIN, II K A , , I ' rrT0mJ1 ' 'S Newark, New Jersey Tom has become quite a prominent figure on Grant Field, and in his capacity as track manager became well known about the campus. He is of a vivacious Uf1t111'f'3, having come from the damp state of New Jersey, and is a terror to the ever-present buttermilk. To be an electrical engineer? Honor Roll, '20, Manager Track, ,22- L' t t R. o. T. C., Phi Kappa Phi. len enan' AARTXHUR WILLIS DAVIS I up my . Wh'izz-Bang I Hamilton, Georgia Augustus is the t f . SOI' O a person that tends to his OWU buS1HC,SS, and lets the other fel1ow's alone, This SZ! lgitdui gg hisf being a married man. While he 21 lm Grove Institute or Tech h across they sea fighting the G - , C was is the aDaddy,, of the Class. eimans. Wlilzz-Bang , SCH MW! 6-0 uv. 0 50 - 0 ' ka-1 wot G igi Q .X f D- if 1 A ,, UK .Ll y , , - ---- -.Q , 1 E 5 ,, 3 . ' A A 2. . . . rfb. ' ' Y ' V- 'Q HJ- . 1 9-f'?I'. !-'.',' . - . - - -. - ' ' in U5 'il K Y I- ' o : ggigg E 9-A 'l's Ag. 52 ' '55 I D,,,J V. 0 O Ai. . .. 3 ..,...-..L,....gi g l , 1 nl iw X , ' ' - -, . Ag' Q5 x . - 0.1,- silk. . V A . .N , , I 1155 i t fr 1- hmiwovj mu mmmuuw nuumuuuuummunu1iiinim..n...-.1.i.,.naL531i..eim.--.-.f..i-.--.-Aiuiiiunu--iii-w1Ein1-1-.-123:.-,..............................2:..3::,..,.-uragi-1. -.----.. .-.m-.......-2'HgfiZ..m.......,um....I.,L.:53giH!ggWu,5t!H!!yMagi? ,, .rl . -.- -1: -:l. -:: .n 1 .e ' .:::: l gi-axsneazaiz.. .... .... ...:1is::s:::m::::::::n::nn: anumm:n:::u:::m:n::ux :a:a::::m::::xsumu:::in:xu::::::az:::::::aa::::::::msn::::::::::::a::::::::a:::::suanse:11nnxi:isun::::::nz::nan1ss:n:::::m::l::::::::i:::::: ::::::::::::::. I Nfx rf, X, 41 D ROBERT EDMOND, JR., cb K 2 Bob Q Norfolk, Virginia Q! A whirlwind blew down. North Avenue one day and after it had passed We found out that it was Q only Bob in his new car. With his good nature, friendly disposition, and likeable personality, he is 5 one of the best of fellows. He was born in New 3 Orleans and Went to St. James School, Maryland, to get his early education. . 1 To be a designer. Major, R. O. T. C., '22, Scabbard and Blade, Eg A. I. E. E. , . ARTHUR B. ENGEL Wally P Lookout Mountain, Tennessee N We can't get much evidence on A. B. except that he was partly responsible for the electrification of ' , the Lookout Mountain Inclined Railway. After ringf ing up fares on the Chattanooga street cars for a ' few years he obtained a preparatory education at - f the Central High School and came to Tech in 1919. k Band and Orchestra, '20, '21, '22, '23, Lieutenant, wg' R. o. T. C., '23, A. 1. E. E., Tennessee Ciub. su- m-9 . 5: ROBERT BENJAMIN FLOXVERS . , ffB0b:: A Atlanta, Georgia .L U L .I lim- ' :HQ u- Q N il ml? 95:11 -uni, QB 501 2 4- 1 5 5 .Z f 3 2 f 2 f ff Z' Z if 1 gi 1 9' 4 5 r 1 Q L ,.,. . Bob came into the world at Griffin, Georgia, but reached Atlanta in time to prep at Tech High. After imbibing the fundamentals of the engineering pro- fession he entered Tech in the fall of 1919. Some time when he is in a good humor ask him' about the radio department of Uncle Sa1n's Navy, but be pre- pared to spend the night. ' To be Dr. .Marconi, Jr. - Honor Roll, '20, '21, Instructor Radio, '20, '21, '22. HIRAM STANLEY FOX Tesla, Wincl1este1', Kentucky After four years' hard Work at the Kentucky VVesleyan Academy, he began the daily grind at Tech when the leaves were falling in the fall of 1919. A good man is hard to down, so he is to come up for a dip in June. To Know, To Do, and To Be. Band, '20, '21, '22, '23, A. 1. E. E. w 1 f f 1? in 4' is z, . o J 0' .O A... . i' 'N Q4 'Q 'U I 'Q W 'I 'QT' I 'IIS 4 M ly. V I1 H. ll llllv 1 'I I ,n e s Q Q o 'i ' ff ll w I . 2. 6 O e . Q If . r 50,0 i Xi 2 f6 , P ' 0 x -. . ' o ,Q 1, ,. or ,tg ' f ..x iv 0 .nf N , ' Q-1 4, ' O Qing., AQ A . B-- ..... .rr O A J ...eezw 9 -- 1 - '::eaaaag:..r- 9921 . .. - w' l ' - '. K 'f oggfffwwmfowyfmpvaeonyfmf. Q , . ff tif 1 7:3 ' - 1 L . .. SGML My . .........:s:!5,g, ' 0 L x at 4 15 . o '27 ' 1, ' - ' CQ 0 I! ' O fag- E115 V: 'I ' fl' 2.3 ' 'l fl :Eff Liza- 4:-. ' .mn I 1 553111 Itfzfil 52111 .pq ' failll 1271 finial' ii?i'11 i E211 1 I 4 pp. 1 .' ' - 'eqlq ' 11 ,. 1 s1j:1I .ww 1 iffy' ' F11 . , f: 1 YW: .4 A '. .,v ,1fQ,1' lift!! ' 531111 lr- 1fn' 'Gill kj ' Half 'ffwl V 1-4. l r .1 PFI P521-1 3-4,1 V 1211111 I 1111.1 id! 1 .' , 1 1117311 'ffqffljl .5111 v T 15191 V 1 1 K 1 I If 1 'Wim as .111 ' .x 1 1 11? 1 LI. 1 bf 1 1 'Efl ::.f1 1 -:gf 1 gg., 1 IEQI 1 '55 ig.- C221 1 5.1 ti . EFI 110.1 I xi 1 1 K 1 L 3 S :E I A:- . E5 1: 1 ,Q 1 1 A 1 1 'S ii . g:-:1 5 if ,. SLC T' A Eg? f' - M, ' .f , 'K- -. 'f 1 1' 1 ff. if 1 ' . , ii' ' 11.11. ?1f f- F ' .712 U ' 1 JV- ' ab 3 :si .?-- 1 .aw L. , -Fixx 5 O , A ., , . go -M, ., 94, , , 1- - X lx . N ,,.f -2-G-0 f , .- .m ' , ,.-' ,.Q,-.,a 'i K-3' -..-N . ' I, f '9 fc' -..-- ,,. K ' ' 'Y -g,,,,,.g'5: L:.,..!..!.3-..--W.-...,-1mmmmlumumlmm-mum -4- . , -V ' L --5 1--- , .... ..,...m-1 . X AWS ,Y X ' . V' - -9: H.'':f3:aa-'-1m-1--1-1-vmumuumxuwmiumf-mlumnl--H'-4-1' v' ' ' '- 'mm . 1 1,-A11..'::-::'.x. 1..:. ..1 ...1. .,.. .......... -- L 1- 1-'w .H .1,. Lmsgg K. BYRON ASBERRY GLOVER B. A. . Atlanta, Georgia Glover was born, reared, and educated within the citv limits of Atlanta, and after extensive travels through a number of North Georgia cities he de- cided to hitch his mule at Tech High. Four years there proved sufficient to get him in the Freshman Class at Tech in 1919. Radio Engineer? Tech High Club, Aero Squadron. 1 CHARLES HANCOCK GRAHAM, A K X , ff'Fessor Atlanta, Georgia This is the man of smiles. You will always find him smiling, and what he lacks in other capacities he makes up in smiles. With his genial good will he is never to be found in an ill humor. He prepped at Tech High and came to Tech in 1919. Smile and the world smiles with you. f Tech High Clubg A. I. E. E., Scrub Football, '20, NOYCE LOVIE GRIFFIN, qs 2 K X fIGTiF'JJ h Rocky Face, Georgia Griffin is the guy who is going to broadcast power by radio. The G. Co. has been after him for his idea, but he says it is the only one he ever had and he cannot part with it. He first began to work out the project in Rocky Face some twenty-three years a'go and came to Tech in order to perfect it. Here's, wishing him the best of success. , To broadcast to Marsf' Masonic Club. JAMES MONROE HAIRE .Vimm1ie Dunnellon, Florida This Wofthylstlldent was born at Crystal River, Florida, .some twenty-six years back. He claims never fo have gone to at prep school, but came to 'gech in 1920 with a firm determination to obtain a egree 1n electrical engineering and to that end has been. a very consistent worker. Sixty, pleasef' ffl-O '-1GlKQqsg2:z1Q-1fLs::-:-rzas.w-:-r4x::a:-rl.-fmQ:-r5.-wax-ugQymW,py, l ef 1- We unamu ' ' ' '.:..: u H 1- . - G'- irc' 11 14 .. 2,-T V 161: f Z Z W 1 51? 9 6 .2 .4 9 5 14 uf? , , 12' 1,14 V 1121 1531 Mal Id:- il 1 E! 1 4, 1 1 ' 1 1-as 1 I .wu- ,' 1131 IQ S 'S IN S N S S. S S S Q -L. o f-0 , 1 O I .fgqg Y Y' . ' -- Y, -xal .41 0 L 1 fmwaqimbimixwxmwsqggmbxwxx Q ' 2 1 12.1 if LLYN ' ' ' C 5 X D Q-AX. - . 7:ZxOC 0 1. - 'L f . o ,.:12'i!j' 6741 f , Egg ! . .1 - ' ,n 1:::::::. - . 1 , fr- , , ?5 ' I3 . -A . Y ' X Q S'i:i:f'i?iHiR - 7 H ' q' . ua O -- N .r..' f li.E?,.:'- U 'EX 2230 Q 'I 'tx K A-ft ' A iw X ng , i 'Vp 1 . f ' N' I X N 0 llq x 5 1 4 . ' - - 1 . J V, A A A C ,,- it , f 192 5 J , 1, P . X . A I N.. U N , G g r . , It ,A I S lm rj Qri'f S1Q,,5N ' ,eifigzf Kawai, Y I W' 'P kiiiilg.- I.-. 1 ,J Y, . N .. 1- N-Q.xF.f' , ff ,V r- 3'0 ,4, K'-, 'f F- - ,.,,: --ff:.- '4 . . miuuvhttin Mm. . 'tr' J L . 1- ..- ' ' ' - . ' :smug lf: ,QM ' lm 1 VU- Wwiiiiwgiii Wi. . .. -..- - I.,-...,.f.m............,.,.m..f ..,..,.... ...,.,.,.,!f ,..........................'I:...:....f.a.,'a1:---::-i-..41A----A--..................2m2-iii...............,...............!LF H , 'E' A W im-I 1- ' I 1 .gi ii .1 V .ix ll ll 1 .-I. . s mmm 'W F ' VW IIIILIIIIIII IIxI I II I I .5 , -H U I . mn HH gum, UU Jima .hlgj + J our ' I N 4 1 1 1 ' T H E l N N EH' --... .. ., ll T 'TF' '17TPiFPii 'ii - ' Ill lllllllllll llllll llll llll llllllllll llllllll llllmllllll'llilllll'I!lllIKll1l IlllIIl'lllilllilliilil'l'IlllllllIlIll Ilillllldi I'IlIliIl illlllll IIIII I'X i cm -I IIE: Q 9 S J FRANK HENLEY 7 I uDbc1: 1 E an Atlanta, Georgia qs Doc- is another of those reserved boys, One not EN acquainted with him might class him with the sleep- l ers, for seldom is he known to disturb the rumblings X of Seidell. Although born in Jasper, he prepped at S Tech High, from which he entered -Tech in 1919. .5 To master the Fourier Series so as to occupy -. Q . , , , a S C. P. Steinmetz cha1r.' Q Tech High Club, A. I. E. E. ' E A TQ' JACKSON BRANTLEY HIERS, JR., H A A A ' Jack . Miami, Florida Q' lg This budding Steinmetz emitted his first yell at Q Miami, but this is not to be held against him. His initial conception of Newton's Law of Gravitation was obtained at the Miami High School, ,from whence 1 he came to the Georgia School of Technology in the lip., fall of 1919. J. B.'s brilliance has illuminated the IW campus ever since his arrival. L U 'fTo complete in a successful manner that which 1 have started L . Honor Roll, '20, '21, '22, '23, Florida Club, A. I. ag , E. E., Scholarship T , Phi Kappa Phi. Ein I- J ' ,Egg JAMES JACKSON HIGDQN, fr z K Qin Jack ,. -- ' - We QT? Atlanta, Georgia Behold another man of the World! He was born s . . . - 1 at High Springs, Florida, prepped at the Knoxville T f High School, Knoxville, Tennessee, and is now resid- , ing in Atlanta, Georgia. Since entering Tech in 1 I 1919, Hig has given us the whys and wheref0res of many difficult subjects without saying much about Z any of them. A. I. E. E. ' ' EMMETT WOMACK HINES, qw A e l Emmett 4 Z if 5 5 ? 1 2 ,, l , i X I 1 1 4 P Milledgeville, Georgia Although Emmett was formerly well liked on the campus, his connections with the Ex. E. department have caused considerable furor among the seniors of the institution. Despite this fact, his ability to flin the horsehide has placed him in a commanding g C ' ' e cam us. ' p05lqt1il,l1a?iIdTgey, Cdlillion Club, Cosmopolitan Club, Varsity Baseball, '22, '23, Scrub Baseball, '19, '20, ,Zh BanC1,',19, '20, '21, '22, Scabbard and Blade, G. M. C. Club, Pan-Hellenic Council, '20, '21, '22, Q52 yfo Jfxe ig, 41 1 . i 4 5 Ig. V 11 ' .1 I4 E' i Illllb Inn . QQ. , M 1 ' I N N 1 A. S. M. E., A. I. E. E., Lieutenant, R. O. T. C., 1 Phi Kappa Phi. W lf. 1 o 0' -3650 o ulf' 'A+ Ovgfw bb ! 'I k g 5442 :P A fa asiif gg aa , . P A-rr 1 T -1 fi, ' Qg2.,,, - 359ffo11mm1ffyffW M l 5 Ei ' A L N 1 ,, AX -TY ' f , . I 5 ... W W Y, ,illfihgw ml Hggggif' f- L v L .C 'J L L n C7 -- -, X 1' , Z .x N 'C-1 I -. N. 1. Li ur A fam? ..,. :-rail., N , ,, - , ' f-------- --m----'f-'faigaaagfmf-45 ' ' I, -A--4 ' 15' f-'-f'-f H -'l 3 ' i 'M' ' T ' num f uw-mnmuualmnmbliulio.. .-fr:., H ,.--v mv. .f--w--4-f1v H - 1 ' X Q j I H E D L V Eg, P PJ .,,,...,, , ,,f - it - 'IH ...... ....- -:: -'::: ::::1x:::::.:: m::a::::::::::::.:::m:::::n'.l:::::::::::::a:::...... ..... .. ..... Q 1 Q i V . iv ,, an srv- qnww ,,, ..... 1 .,. gg :::n:::::-.:::::::::::::::::l.....:.. .... n : s rl Y VV : u f T my .q,5Kx',l , g nf? ll' I rail . l E3 'ffel ' i Q v 1 IL TIP KELLEY 5 H . 45 rrlrishf' l Atlanta, Georgia X' A This young Irishman first began blowing his SJVSTLI p l F horn around these parts some.tWcI1fX Odfl Yeglrs dghe 1 li , If he can escape from the 1nst1tut.1on in une. i T expects to go Over and eiectrify his home capltal, In I Dublin, flrelandj. N IW 1525? - Freedom for Ireland. y. ll fi? i A. 1. E. E., Band, '20, '21, '21, '23 V l eff ' . . I EQ i nf ' I A llrigll a .2 .rf ii . ll llfilf. fl -gs THOMAS ADAMS KIRKWOOD .EW l i gl r A Tom rggiilgf 5 it l , Bennettsville, South Carolina 5 ' It was some time before the registrar could grasp if yy 1. the fact that anybody, even Tom Kirkwood, could have been born in lBennettsville. This seems to be l,:l1lE y 3,522 uf ' true, which fact, because of Tom's splendid record A fl .1 Q at Tech, raises the stock of said city several notches. gl ' 'f sc . 97 I ,L g.5o,4,, .ly To be a farmer. .5 4 ,V 'Y 4 l ! 1' rm-y 2 A. I. E. F. QE, li' 2 ii' li 4 4 I l gg ly 1' . 1 , ig 'WILLARD VVEBSTER KRAUSS, 11: A 9 l s 4 Sonny lg' ' ' It b Brunswick, Georgia ,. Sonny first shocked the world by his birth in 1902, X 15 Q was raised in constant companionship with switches, y il: and having been brought up elect1'ically, has con- M . : tinued in that profession.. He entered Tech from I Y' Glynn Academy and has made a large number of I friends during his four years here. . KTO be a lawyer. S F Secretary Brunswick Club, '23, A. I. E. E. '51 N 'iii ,Six FRANKLIN PERRY LEAPHART, JR., X 111 y S 3 Tarzan 1 Columbia, South Carolina. S Although one' ofithe smallest men in the class. S Perry alwaysimanages to make himself heard above S the constant racket in the E. E. Lab. He is a most gl Eidate lookinglpelrsonage, his hair being the envy .of Q, e campus.. t is rumored that he is an authority on hair tonic and can grow it anywhere except on lar: lus head. Pie spent some time at the University of 5 ips' Smith Carolina before coming to Tech. 5 it ersistence always winsf' Lieutenant, R. O. T. C., '22, '23, A. I. E. it 'sr I-. V. x L . icy f 0 9, 5 - . 7 - -- Y, I , , i i f l X , m'6BmrQ.irREEi:sawbasWw:29rq2w6QQamoN1Q5s95e5aQQ99qypafxa.QQ, 2' P1 1 K- - Y 3 ,v , , V . . , , ,, , o Q-xb - O z O X ix Xa , G1 ,- ...gziir ' ' s 3 'tiara A. W0 sq 'f f ff f-L---iv . - 4- 'ii:ezaa2:..:---- P xg Z. Q V Fu NA l f , 3,41 F , I . . 0 L e - A Q A -'WSRQ-1QsmwQA'xmxXQQQqAxxxb.xx 'A WHL K ' e e s Q Q, ' :.' N' Q - -A -A - 'ortimmmnm - L -fr R --QS 21 49 ,iii5 ' 'Q' -GD Y L L v v 74 T D Lf? h - ' '60 Q . W 'v. F h 5' , .V 'ga-aff. on lf -fir S,-55nIgggggggxlrvqggslggffgfl- 'vvI i :iw mmm-mIu..II1.I.uni51115..L.......,.,:..I'i.l?,tE:,g,,,,, ,'.., ..,.,..,, ,,,,,,,..,....,,,.,,,:.f ,,, ,,.. ,..1::f,.,,,.,,.....Z. ................ I mf.. .,.. ,,.,,..,,,.,,, :g:mq.,:.,. ,,.,.,,.,. M, .....,.. .,iiimgW,,,,ggw,,,Eggg J . WK ' ---- - - ----- - 'mmi mimi muzmz mn: izu:::::s:::::::amz:,:::::::::::::::::::::::::::::: :- '::::::::::::::::::::::.nm::::::zz5:::::::nu:Iiz:r:::::::milH:::::::::::::::::::::::::::::::::::::::::::. ........... -, Jil, ...... EEFEEJI i n I 3 Q JAMES HELLAND LEPPERT Jerry , g Atlanta, Georgia ,. gr Jerry missed his calling when he took electrical engineering. He is the authority of Atlanta on Q. second-hand cars. Four times during his career at Tech cars have fallen to pieces with age under him. Still, each week he drags out some new w1'eck and '- by some means persuades it to run. Jimmy prepped at Tech High School. Tech High Club, Al-Ko-Hall Club. 'o WILLIAM ERIC LINCH Willie Flovilla, Georgia He hails from the very quiet town of Flovilla, hence he is of a very quiet nature. After spending four years at Locust Grove Institute, he came to Tech in 1918, when everybody was doing squads 0 right. The strain was too much for YVeary Willie, Q. so he stayed away a year, but came back and by . - M b combining his efforts and ambition he is to get his f J, y sheepskin. .L d F' Success xii 1 , Scholarship T , A. I. E. E. 7' 'gall , in FRANK ROGERS LONGLRY, II A A l f . fflfmyr' fi Qlg jg wg Chattanooga, Tennessee v , 5 ' Kid is one of the bright boys of the class. Ever ,HQ if since his advent in 1919 he has had the profs com- T P2 pletely buffaloed. The question is, how does he do Qyfi ' 11 4 it? One would never suspect that he was born in iw .7 LaGrange, but Frank swears he couldn't help it and ' does his best to smile it off. He prepped at G. M. A. 1 Honor Roll, '20, '2'1, '22, '23, Tennessee Club, G. N M. A. Club, A. I. E. E., Scholarship T , Phi Kappa Phi. Q VVILLIAM PAUL LYMAN, K A ffpozzyff 3 Montevallo, Alabama 1 2 Polly has been receiving special deliveries every I S week since July 12th, 1900, and during that time has , Q spent 3131.07 for stamps in order to answer them. Q Z Nevertheless, Paul is one of the most popular men on Q the campus and is always ready to help anybody that E' 'Z is hard up. We don't blame the source of the specials a bit, in fact, for such a popular man, we might Q suggest two a week. Z Electrical Engineer in a mine. Z Scrub Football, '20, '21, Varsity Football, '22, '23, Z Track, '20, Manager Basketball, '22, Barrage, '23, Z Cosmopolitan Club, Bull Dogs, Koseme, President, ' .2 Y. M. C. A., '23. 1 4 5070 x bk N. 1 Ox U LVV V 1-J Q 1 Z 31 N 0 gxrbv , . o Q W N ,KNOW ,-11 l 'Ez' L 44' M e e ,,,.,... fl mail' fa -- ' . --- '-ew . 1 , -3 xg f ,, 1 i1 ffIffWfWyfWfffMMmQ0w0mwf2sffffff!YQiQ ,EA 1, rv, O L - . ,V , Sl in of xi L AI Y f - f - -9- ' if S' fess:::w'- -- ' I .K L Llorlgy, K. 0 L '--nigga 'I-'I ffl Aoliglss- ' D iqua Aogpfylyo N '4 ' , x8 .., , , 1 x V 4.'AA,AAV i V1,4,,,, ML, ,:,:: mmnm, , , ..,5.'f 'fQi...Q -,., -,--f--.f,.4-, uuuuusvlvirl-557'm7m '! '1 I ' ' u ' g ' 'num F' '- '.. '-' I .- -' nn -, Y', , Hmmm 1' 1 'allwgli ---' X 1 f E T D L gf, -'ggi , ,,,. ...... .. ..m,.--, Egg--ngmnzmm:.. :'.:sr.m::::::::::::::z::nm:n::::'.:m:::s::::z:a:a::z:::::::m...ll::u:::::r.. .... ...- if fl Y ZI- FEMJ, ,,., ,,,,,,. ,,,....A ..,....w... . LL-. L. .-.-,.,,,-. ,. 1 .-.- U V' Leger.-.T 1' iii., j 5' f' ill. PALMER MCDOUGALD MAXWELL, fp 2 K Q tj aL.. , VQA, , V V H1360 Wee!! ' ' ' 2 V ' Calvary, Georgia . . ij' Pee YVee is rather diminutive in size anduhe 1I1- fi forms us that he has been that way ever since he li! was born in 1902. Although very much in love, he 171.1 manages to do Hne work in his studies, and after gil ' getting a receipt for his four years' labor at Com- i 9, mencement, he intends to put what he has learned : A to good advantage. QStill thinking of herlj 1 5 Day by day, in every way, she will love me more. 5 'pfif lg Technique, '23, A. I. E. E. I' it E f 1 UE' 1 HORACE ALEXANDER MOORE, -12 2 K lifg! ' Horace 1 '.: 5' 1 Carlton, Georgia 1 LJ J P 1' t' ai A . 1 :9 -49 This young Mercury Hrst began getting his wind running after the mail down in Lexington, Georgia. .Eff 5 The course was not stiff enough, so he journeyed to Q' ' Carlton, where he was among those present at the U 3 local high school. He entered Tech in 1919 and has if f Q been runningxever since. 4 :jig Q - To break the record from New York to San Fran- Qlisfg' f, '51 A S cisco- Hifi A T1-ack, '22, '23, -'TH Clubg Technique, '22, 2.2, Y. M. if f QE-Lizzy C. A. Cabinet, '23g A. I. E. E., President, Gene Tur- Q4 Vigaf' ner Bible Class, '23, Aero Squadron '22 '23, Blue ' Ridge Delegation, Phi Kappa Phi. , , ' Eg C,-1 1 LAURISTON GREENE MOORE, JR., A T Q 1 J I Hpgwnylfl i ac zsonvi e, orida H ' E l Y- .The junior member .ot the firm of Barnett lv Moore, kia ' G1'21fif21'S, began tra1n1ng for his profession way lg ' i 1 back U1 1991, and since that time he has missed few ,goin M opportunities to fleece the innocent populace. It W 1' has been said that it takes a good man to get anv- Ay' I thmg gut of 3' Tech Student, but this firm seems to Ih vlr have little trouble. It is Larry's ambition to play E .If 1 .E i One of the title roles in the Merchant of Venicep Pl?a'n-Hellenic. Council, '22, '23, Vice-President, '23, ,gi President Florlda Club, 9213 Skull and Iiejrg Vice- . C j 2 - .- - -, 5 ssistant Mana er Bask t- ' Q' K B ball, 205 Assistant Manager Football, '25 '22 6 , Ali NVILLIAM MO 'Si 53' K. X SES, JR. xl ktaxipzx K C 1 rrB,i!I:: I E I 1.5 ' i EE bia Tenness .-1 .':SS '+ 131111 Wm ' tee -l ' 5, 'even mas been with us for a lon . t- . . Ii' familial. figure on the cam Q, lme and IS still a 'xii I one degree, be returned pus. Not Sahsned wlth N 1 . in E E ' . . for a flfth Year and a. degree gl -I 1 BH 1' .,,1n addition to the original one in ML E bi 1 is not only an engineer but ,L Scfl f . . Q y gi note, havin Work d , f I .ll ie o some, S Q To compgete wish tljun all Em Publlffflflolis- Q i its Technique, '19 1206 S?2n' , 22, '235 Blue Pijint 'l9 fl, gm Yellow Jacket' tial' Vice-President '22 Q Q' 22, 234 Tennessee Club- Si' 1511 ,91 ,O , A 3 CIYCSS Club, 19- Rifle Te. y., ' 5 53' Nil , -42, 235 A' I' E' E ' A S M F, Tun' ltlmll No' is A '-sf . 2 . , 'H -- .i.g. l01'f l., N 1 edal, 20, Captain, R. O. T. C., '21, 22. I muy gf' il N , -- we - - o f ' '- '- 6N'3?X95 ?2Q5'p0gX,-' Xxm , Ee 'MM mmmm-we-Wmxwsa 2 1 ,Aix 1 1 Q eg, D QXV iv!! X S QL om 5 wg-Y t 3 x YT A . --f' N ' ' 1. - ' 993' . A ' 5 'Siam gl A Q1 gg, NX'xQT3YN..7QQ,gzgiqg-gfgx-q.g.:ggg9q-me-'581IEI-P51-5Ai-xvgxqyqkfff'U U a fnx --:.:..g5 ., . , S3 ' . 2 is ' ii2p, . 5 ' Wg... . L --. J C ---g - NW Q -::.,u5:.:. E-E X, X C b ml Q sis.-if ,ia 1 H, Y v 5 i it-:Ei-ki ig M. -T Q xg! , Q. .Q TD ' f A are as if . . D 'S' X 0 Q - LX x 1 f, N3.4.. fr! X WI fi' ' - f .' f -1. . 15i!!lI iffl'g Hi!E.lIrlllllIl , lllll l V IlillllillIIllllllllliiliillllifiiiurnliuxxu u ihiigsxx-uni:-1 .--.- . --.. mnuuiixuvinu--liivim'A-uri'-LM-,1..: -.--. E -.-.- l---- i- -T5-Iii.. ...az:n:...L:ZJ..ii ..... ..,, .,.,.-...,. J i mi.. f. - - 5 L 1 ' 'IL'I'5iiii!!2ii9 d-mil iii-5 in 2 17 ,mm W T H E D L p 11,1 M lhuih-2 . . , ...... a.:um.an:::::xt'-::s:.'nl:xnm::a:m:s:a::x:::.:l:xi:::ul san .. :n::xr::::l: : ::::::n.:::: H':::':::::nn:::::r.r:n::::::'.::::::::::m:nI1.. .:::rl::l::::::::: ::l::::::::::::i, ...... ..... :i!. .,,..5gEg-gi! .lxg - Gigi fp . N 5. ig 5 WS . 2 S THOMAS s. Moss, K 2 V' Sf Oleg 1 N Athens, Georgia 1 . 0' This gentleman started chasing the ladies in the Sl learned city of Athens in 1900. They led him to S' Atlanta, where he has been ever since, attending ifech as.a.sidi.1ine. He has a good ambition, so N ieres wisnng um success. S To be a man. N FPaS-Hellenic Council, '23, A. I. E. E., Company E oot all, '22, Q ' S RUSSELL LAWTON MCCALL y ffrfacff t 52 , c Ogeechee, Georgia Q, Hifi 'T ' xQ5Qj .Qi. I ggxgl Q This globe-trotter has seen much of this conti- Lp ii W 'io 2 nent for his age. He graced Louisville, Kentucky, p ' 53 with his presence 'in the middle of winter, 19.01, s il sig lg prepped at Mars Hill College, North Carolina, claims 2 Ogeechee as his home, and has gone to Tech in At- . ,l ' lanta. 'We now know that Dr. Steinmetz, Jr., ac- Q 't quired. his knowledge by observation. , gi FRANCIS RIGGS MCCLELLAN, CID 2 K i i Shrim 9 'gf' ng , . 2 faq W J VVaycross, Georgia W fi' Shrimp came to us from XVHYCTOSS, for which Tech qqgg. owes thanks to that town. Shrimp is a live wire, U P both electrically speaking and otherwise. He told us that one improvement he would suggest for Geor- 4-W' . - ' isn't, he has made the best of the situation, and has taken care of the ladies after school hours. 1 Y 1 To be an executive of a public utility company. K' ,ij f ' Honor Roll, '20, '21, '22, Scholarship T , Tech- nique, '23, Yellow Jacket, '23, Editor, Barrage, R. A. R., Blue Ridge Delegation, A. I. E. E., Y. M. my C. A. Cabinet, Lieutenant, R. O. T. C., Scabbard i . and Blade, Pi Delta Epsilon, Phi Kappa Phi. 1 f G Li Qin I w I s EZ .1 Q? N ,gl HERBERT SEARCY MCGEE, 2 A E E i E f Ullfuggieu ' ' V Juliette, Georgia f ' 5 Muggie was presented to an admiring world on l' July 5th, 1899, at Juliette. He put on shoes and I A 2 came to Tech in 1919, and now that he is leaving we 15 understand that he is going to give the Georgia Rail- ! way 8: Power Co. competition in Dublin, Qlrelandj. 1 Scrub Football, '20, '21, Scrub Baseball, '20, '21, S l V R. A. R., Captain, R. O. T. C., '23, Scabbard and Blade. ,C lo J 1' ff' 0 4 J.. lx O yj sf' f fees i 'r jo f21 fffs3E5fX 1 ,7y-Q I 00.11 I V ,LLL Eg ' i pw, ,Y ,,,,,,,, ..,,, azzlllfii' 814' L-, ,f Kgs :igiiilklh J Q -i-A Ygf. A- -V, - .W M 1 . '-,Zi 4- ii 1,-. U -Q Q V xv K V w X ?vyzgl jg QWJAYXWIXXJQSMOQWKAVXWXQQZWY' f . ,-.Ax 'Ai' ' ' 'W L W ,fo A 1. f 1 ,I -V 'W V . . .. V Y 7 L-C A4 E L K ' f 6' -T 4 I I.,-r'a'7qf?2'?I1l!?-igivl-Lil. lg, 555531. O L -, an if 2, ,Q Ji llc '?frf 'f-Q 235' 'l w gia Tech is to make the school co-ed. But since it I '. V 'rr' n I s , x P.- V. Q. l 'o '- '- 4 l 1 1 1 1 1 H 'li' r , - -I X g I , ,ij-if ,fy 2 , - r , - a l as 2929 s I . s,,,, W.i. IIAI ' jim, ,,,,, ,,,:,,,,.1:..::., .....,.....-. W ,..- 1 -,ff-.- fi f------- 1 f'--- - - . .153 nmfuuIsfml1-unnmlmIl.uunlui4lTmx-1 ,.x11 af ,... u e--J' -.,-1e1 ew '-f--'-'-- f 4'1'1 ' WE vw? I it ' 2 T H E 15 L P ILI N I ' iii' + L - N: i - ---:az---:u:nx::::n::.:z::::::::::::::::::. ':n:::::::n:l:::::1::x::z:::::::::::::::::::::.'::u:::::::. '.. ....... - - ...... ...... J i ---M .. - um --. ... , ...f '-f, V- rzzznm:zzz:::::::xr-...::r'.a:u:::::m.-r.::::::::::::::::::::::::::. ---- r rm Aff I Kia. ' E .12 1 Nw 1 3 l eg 2 I -- . Q Z Q I . y f l, CHARLES PAYNE MCMURRY i T I V Long Distance i i . Atlanta, Georgia- T When not writing jokes for the Yellow Jacket, Q llzf i Mac spends his time chasing street cars down Luckle i Street. In choosing the place for all activities, he I picked the home of Georgia Tech. He was born in Q Atlanta, prepped at Tech High, and has faint hopes of quituating from Tech in June. 'gall' 7 Explore North Pole. 1 ll i i E Yellow Jacket. , 5 .5 P :'. l e E 'I 3 51: is , .- I ' P3 ' A ggi i I 1353 ROBERT STRATTON NEBLETT, B 9 n r A gal , Nqr I 2 ' .iQQ,.I:,Q . Papa Love Bird il? Q 1,1 J A Corsicana, Texas , 1 'Mig-!f'3+, Papa Tweet-tweet had his first measurement made T165 ' li EQ 'X if, .51 for a square meal back in the good old days of the l l 2 stil A . Alamo. Though he has a terrible time with his i ll 'E--It . foundlings, he is perfectly normal, being at home in g L 'Mgt' gf QQ 'L an atmosphere of thermionic valves, electrons, hys- MA 5 F teresis, magnetization curves, input, output, IR drop, ' fg 4, Ai h and polarization. U y a Honor Roll, '21g Pan-Hellenic Council, '21, '22, ,23g it 5 :fp ix. 1. E. E., Band, '20, '21, '22, 222, Phi Kappa Phi. i-ga ig L ' . v 3 2 ,Q -mg, b QQ I Q V E F 4 P 'It T- JAMES TURNER NOLEN JR lb 4 ll ' V . ' P ' 5 f ' 2 J, T. ,f si ll it 1 ,V 'il li Middleton, Tennessee ll' fill ji T I ' Turner came to Tech a natural engineer and a jolly il A good fellow. He still resides in the place of his xy , birth and has been 'away from there only eight years- tl My 5 3 foul at Castle Heights and four at Tech. Q E To fly like a bird. QV Teclmlques ,-20, '21, '22, Tennessee Club, Al-Ko- 'ii Hall Clubg Aero Squadrong A. I. E. E. 1 Q 2 E' Z ii Q 1 1 l E I is r ', .1 ' .52 X A RODOLPH STEWART OLIVER, JR., A T Q N ii L, k rr-Ruddysz N E' ' - Plains, Georgia S l ll: 1952- S-A is and has been the pride of Plains since l - Tl11S youth there obtained his traininfl' fo 5 . . . an 1' N. . orgehof his best activities at Tech. XVe refer to his I ta shmny eXPe1't- As a member of his 2 W Q tri an Oppogitisiflgnllgfggfti' one, he has met and downed , XVhen in doubt keep silent. il ' 2 V52 st . 5? Q N ' 0 ax? ' SCWO . , r QA f 0 ? y L f gy-' -' ccc' - GL Goff ' in Q 'RQ-1 il pg o1 WEK'T1s1Fs'sYiFk2Q1s1s-i'4'A'-Qaswrifvnmiqvameqwyfw g Q - Y ff- 2 V, L , ,Y if Q X A L-ML K 2 2 .1 mi- If wXmwmmm tf L- XX-.aaagg 0 .giESi:,,,.. I . ,, , , - NL Y - :S A, E i ss , Eu, :1 . 'r w 1 . 1925R15 . Egg5EnI5mE EE5ggEEik!IIIINISI ll ll ll lII--IllilINlIIlllimlliialllffliuumneuaiiw1iiiETgEf hl1ll1i11i1in.lYi1i ,..,',..1'f I1nlii ..1v lunlnnnuu um nnznssxxn. T 11 13 15 1. P Pol iii i'ie1ixmsiii ::::::::1:m::n::::a:::::: amz::nm:usauma::::::::::1::::::ra:aa:::un:11::1:1:::::::::::1:::u::::::::::::: ' .1 1n1::::nn:::1:15:1:::::::::::::nl:::n:::z::::::l::::::: ':::::::::::1l' .,.. ........ - :Ek ...... RQ .3 S KARL MOORE PATTERSON S upatn I ' S Harrisonburg, Virginia N . N It 1S a hard matter to do justice to avfellow like E fafi He If one of those good-natured, attractive N ris imen wiom we instantly recognize as a good E He was introduced to society at Elkton,'Vir- g1n1a, on the 7th of October, 1900. Wandering to S Andrews High School, North Carolina, he then pushed l. L . Y.: ii' 1 -xv f . ,IIII4 W1 ill! 11- 4 1 rs J 'gli EU Y Y 4 f 5 4 5 2 5 2 6 f 4 .2 if 4 4 4 fi f 'K i.. on to ,Atlanta and askedvto fill a vacant chair at Tech. To rise. There is more room farther up. ECE-op' Clubg Lieutenant, R. O.'T. C., '2-Ig A, I. ARTHUR PERRYMAN ' ffpewf y Atlanta, Georgia s Another of the home town products. After emerging from the throes of Boys, High, he noti- fied Mr. Caldwell that he would drop around in September and look things over. He has seen things around the campus pretty thoroughly and expects to move on to a new locality. , ' '4Lineman for a wireless company. ' A. I. E. E. 1 GEORGE HOMER PORTER, JR., E N . . George Atlanta, Georgia f George began as a rookie in the service back in 1900, but soon left the ranks for higher positions. After walking guard at R. M. A. and Dahlonega, he came to Tech and immediately demonstrated his ability as a military officer. To take General Pershing's place. A. I. E. E.g Lieutenant-Colonel, R. O. T. C., '23g Scabbard and Blade. EDVVARD CRAVVFORD PRITCHETT . Theo Atlanta, Georgia They call him Theo,' because he is purely theo- retical. Pritchett is entirely a local product. He was born in Atlanta on January 4+th, 19041, prepped at Tech High, and is now finishing at Tech. He is the mascot of the class and is graduating in three years. Phi Kappa Phi. P31 fd of s 'Q .1 1 1 .MEI 1 1-521 I v YH. ' 2:25 41 Ui! I 9 Y M11 I4 - 4 Io .Q ,o rffffibt s X 1 1 Q1 I7 1111 '4-emu 'Q ig LW' rv O2 f o Q-gx ch Q ' , , o Q - Eff' -i sa, V . 4- ligliiiizzz.. ' A . 3 f - f azznflnl . I - 'f' -------se-H ' -, 1 Yi' S W. G 5 -V., '. N IQ! Ogyffnl niffyfM1mfWMlfff1f f'ffffffVMQQ in f ' ,' l-E r 1 ' 1 ,, 1 - -f ef Y - -- -1 - 4 - . 'f U 0-Af , o'Q Ja. x8 111 lr. .., In X -12. :lf f 4 F1 1 x ae. 1 . o .21 tis '-xi, '.b if ' 1 Til 1-3 1: il ti 55. -X - Q,fh .... 1- ,- x V' H -Tjzrdjy O .xfsu f,f'.Q ..,,, Y C '1 'ia -1 v 111. .11 11 -f 1'- ,I r:.f::, 'xf'-I 19 1 fm 2 . -1' ' 1 'f'7t1Z'-wfll.. , Q' 1. .L-Qflw-1' 4 p ,fi :Q 'ex ' L..,.,.,..,,C..J . ' ' ': p V 1- 'V .. f--- --v--1' ----- 1--1---'t:15iigEg. - ' t..A uuu m'u'Hmnm.aE4wm,m,m,,,, '.,,1.,,,.,,,,,,.. ,..1 ,, .,., 1111-nulxlilmnavn J' X ,- A 11 R D L 1 IU i - - - - :u::::::a. - '-- -'3 1- --- ly Y .vnr 'lr' WFT 'hzv W ana: M dggna.-4::xxx:::u::::::::::1m:::.':1::n:.nx1m:::.:::s::n x:::nl1:ll:::::::xnag1---- .:.':..:.r....m: 5323 .. 11311 7 HARRY'WILLIS PROUT ,gl Pedro 1 .1 1 N -f ll virginia if, N O1 .O. i, . ' fter A2551 ' P1-out showed his ability in the social 11 e soon a entering Tech and has playedna prominentdpart ugh? 1 majority of the Tea Hound festrvities purpzgient .iff past four years. However he has found su IC Q1 time from Nunnally's to devote to his ccgpgg worli. l 5 He says everywhe1'e is his home, b01'H IQ - arms Q pi 1 fiif Illinois, educated at J apkspfnvllle, F101'1d21, and HOW 111:51 hangs his hat in Norfol c, 11'g1I1l2J.. If 'CTO amount to something. E12- 155. A. 1. E. E., captain, R. o. T. C., '23- gil GEORGE ANDREW QUALLINS is rrsquin tu gli 51 ' Y I 1 ig: 1 Taunton, Massachusetts H1311 ff 1 1 . . . . ffl This young man, who claims that ambition IS un- i' known to him, was born in Lebanon, New Hamp- Mig: shire, but his family moved to Massachusetts and liking Squint had to follow suit. To keep from having ' E to go to a well known technical school near the city . f,'ij1,l,115 of Boston, however, he broke away and entered Tech 1 111 1919. gil fi A. I. E. E. , 4 1-Q1 , , XVILLIAM THOMAS REED, n K fp 1 ' 1 Bill 1'-'ss 0, 1 Portsmouth, Virginia . 4 gy, We present to you now, ladies and gentlemen 1 1 ' Qladies especiallyj, the only original, untamed, and ml incorrigible lady-killer in the class of 1923. Yes, he y ' just slays them right and left, and doesn't even stop ll V to see who he has made his victims. VVith his fair 25 hair and rosy cheeks they all fall naturally. He was i lf fy born in Richmond, Virginia, and prepped at the , giff 1 Portsmouth High School. 5 Company Football, '20, '2'1g Vice-President, llgiaifonettes, '22, '23, Captain, R. O. T. C., '23, Scab- 1' arc and Blade. s, 15:31 IN 1 iii: E 'HJ-.1 X I ERNEST CAMP RICHARD, E X 1 ET' , Rhuba1'b ' Q 1 ' Miami, E101-ida ggi: This, young prep school inspector made his pres- E' H1 ence known in Elberton, Georgia, on July 241th, 1901, S and thereafter followed his greatest mistake, for he S moved to Florida. Then began his career as in- Q 121 1 SPffCt0Q f01' he prepped at G. M. C., McKeas' School N' E i?f1L1Sli'E11'lignGg26Ir Cove Springs High School, and Q! 131 A ,mlm 11131 H01101' R011, 205 A. l. E. E.g G. M. C. Clubg Florida 5 12111165 yrfechnlflpuea '20, '21s Marionettesg Lieutenant, ii - Q . C., 13. i'-'4 1' A X T Qg3s,,,,.,,R.,,g.,.,.,., Q ij H' 'S litliill iig pp p ixrqg .X-4' L tn -f- - NN -.1-Ah-'-'?-.COC:44- IQ D., Q X, HW I i, -Y . Q-hh'-R Y Y '1Q, itxgqlgmta ,y nf 1111 iv 'H' Xes5J il 'I 1.1 '1'Z .Iii U11 1.3 .Inq . 11-3 3 M2 ij: 1 . 1113. iizfg ,. '.1g-. R25 I.-'S' PEE Q 55 1 A WV 1 1 1 '1 , 11 'iisis' 'Q'-Y 'HSI 511:31 1lkE41 '1Nl lm p fgjil 'VNU 1K.1 ' 55:1 1 1 15 'lt-51 XWQ11 Muff: 11551 'itil 1iEiQ'? IQ Nl 11911 lug-ji? ,.. 'Q ' Nx HN, EN, , .1 'i 541 Y 115 lit , I1 .IV ' 1 Q4 rg 15 .ss- -J Z gy 34' .fi -LN- .S ,, 'v x y . -Q Wins C 'iw Q V . fi-925xi f ur .A Q. l io si, 'ks is-rQ..'.i'.'14 ' ' W K.. .. ' 14 - 'Iii ' , ' UU1 1w1m-S311 1L11y'ti1nxr1i.Elm.KT' Jil :rid I fx 4 A trsif w 'AVI'-:Q 'v ,1f 'l :i i i .'e. Ill I - 3 1 slain A 1' A' U I ' T' ' ' ' I Imnmffmffxinnrmrmfhfisn . 1-- - ..... ,,,,,,,,,,,,,,,,mig5,,,,,,,, lm, ,- 'h v Fi mul. - W n .,' 1111115 ,L YQ I .- , I .. - N . . . 1. 1,1 A' LAM A' I I 5 1!wU'O ':l W ' A' ' an ' A 'U' IHS we we ..nm::'.:.1.':a:.mn::a::a::::m:::.::u.':::::x.':'.nl:::u::mmul::::::'-:::'.:za::'.::::::::x:::::x::::s:::::::',. ...... ....n - itz. . - We ' 5 5. . x I 1 Q Z N f E WVILLIAM A. Ross, 1- T A y ffBi1z 1 1 S 5 Atlanta, Georgia y . IE Bill isla rather quiet chap. To 'look at him you Sl would think he was quite bashful, but well-founded E 6 rumor has it. that he has his Sunday night dates reg- 1 E lr- 1. ularly, occasionally in one of the suburbs of the city. S I dh ?Ve51aven't heard yet whether it is Hapeville or Buck- X mea . . A. 1. E. E. . E FRANCIS AMORY SAXON, cp 2 K Q' rIG0at!, i E Augusta, Georgia , . 1 55,1 Goat, after breaking three-fourths of the hearts of ' is 1 Augusta and capturing the other one-fourth, decided :gy IPS to enlar e his s here. Havin' h 'd tl t A' H I' I V g p g eai ia gnes ,psy 'Q Scott and Cox College were in the vicinity of Tech, Goat made his appearance here a few years ago. 1 HL.. There will be much weeping when Goat graduates in nas? une. 1 To bring Bessie Tift to Atlanta. I ,L Q lg. Company Football, '21, '22, '23, company Baseball, if '21, '22, '23, Yellow Jacket, '23, Barrage, Lieutenant, R. O. T. C., Freshman Military Medal, '20, Sopho- 3 I more Medal, ,215 Junior Medal, sae, Rifle Team, szo, l l .Y 'I '21, '22, '23, Augusta Club, Radio Club, Hobo Club, 'iii I . Y qi, ' , A. I. E. E. l l --n V, 5 um is 'I' JOHN TROUP SHEIVMAKE, K A 1 ' . if fflufomfeff M fl if Dublin, Georgia H s' I l ,Z This electrical shark first began pushing the little if I' volts around back in 1902. He prepped at G. M. A., 1' . where he heard of Prof. Seidell and immediately de- -, ft cided to get his education at Tech. .I nl ' To rival Steinmetz and Seidell. Barrage, A. I. E. JAMES M. SUTTON l ,QQ ' Jimmie 5 'il .1 Memphis, Tennessee I s ' 1 . . . T Saw the gay lights of Memphis for the first time : on New Year's Day, 1901. He stayed there long ,- W enough to finish at Central High School and then Q. came to Tech in September, 1919. Since then he has iff . spent his time kcepingat a safe distance from all 1121 skirts, but Jimmie is a terror to all Freshmen. if '1'echnif1ue,'21,'22, '23s Assistant Business Mnlssgsn iw 1 3233 Captain, R. O. T. C., '22, '23, Student Instructor, I Air Se,-vice, '23, Tennessee Club, Life Saving Crew, UZ . '22,'23sAe1'0 Sqnnnsnn, '22, '23, A- I- E- E- V fo l- 'J ag, ug' 1 - I M11 O s My ,ff Lax Xxx.. JJ O-W-. Z-1i',si':f f Q' ..!!n... .fP-, A A Y 4 5 fr - A '--If-1si...f:T ..fss:1ffi sflflf'-'J7ff'?1J' 3 1- W ff-J P- 2: - lr K ' 1 : -V . .ff:0ssfxf:ooQQrs5of.- ' Y ,Lili Q .R :Wi llglg ' ' ' 23, XA , -new i-i i is 7,1 fsis:51,,,3IfaffE'.g..s.,,,'g,,.,sa a W . - l!'.::.7'lLinn,,f?yOj! ' o ' ,il KX? j O Fjxi feewjs ' .'r'41'. n 1 ls. .! 5 'Q ' 'fi' f i T ar. 1925 f l 2. if L -J VND fir 1 ae T H E .... - W 4 - - ' '1:::::::::::....-.....-....... .. ...- f f' s I A , I X k xx- x 1 , Y .,. ' 1- ' 1 jr 1 7 f ' T ,C 1' ,nky D A 1 'V ' x , I -g 1 1. I 4 I 'L' , i .1 .. 1- H . 1. I im 1 N mm .nun-mmn 'mm,mmmlmmnun sn luggw H Klll'fll lnlIlIf u'.l'.'.klil'Wa'llIlf'Un llixvuil U 'I 1. um 11 :nu vw lu nl! 4 Til ll 'U 4 'UV 1 I I I ll ani' V. ,I I .Q mv- ..-u - 4 .- , 1 I ' I' ,I ' ' ..! K I' ' .. .5 if .-- ---'- : :. '-:'-:-'::::::::: ...:::::n:l:::::::::::::u: ::::::::::s:. .-1:1...... L-.1 1. .... :aa-a.......--.. . I ' . ,.- , X L I -xv w i 1 2 u L Z I 2 7 ' Z , .4- '14 s ,. L 5: I' ' 1-- .,:, ,., Er? X., . 1:2 1 JOSEPH LAFAYETTE TORBETT, qs K 2 X, um.,m ZA-O -gagg- v h fgchicku 2 Columbus, Georgia 4'Chick began familiarizing himself with the brag- ging points of Columbus early in the twentieth cen- M2 tury. It was only after he had spent four years . M53 in study at the high school of that metropolis that he '53 realized that he must come to Tech to enhance his 'fe chance of getting in Who's Who? He breezed in in September, 1919, and is now rea in his reward. 7 la .. . P g FJ ,Zi A Free beer-wild women-and the great out- H doorsf' . ' ll? Honor Roll, '20g Columbus Clubg A. I. E. E., 1 E '1echn1que, '20, 21, ,225 Rubbers, '20, '21, '22, Lieu- Eliilgtggg- T- C-, '22, Maj01', '235 Scabbard and 1625 ' A if Lai GEORGE LOWRY VICKERY 1 .' . , 1. N ,N Vzck' Highland, North Carolina 1 Vffhe city of Atlanta has never been the same since lick decided, to move to Highland. However, Vick WSH pecideid he liked the city of his birthplace, so re- i l L glsuulecanhere for four years under Fitzgerald and QI, UTP I , ' ' as A im.: 0 e an aviator. 1 Yin A1'k0'Ha11 Clubs Aero Squadron, A. I. E. E -Ea ' 1 ' 1 ' -I v-, ml p HOUSTON LONGINO WELCH, B 9 H VR' p :rL0ngy:: litx ' Collins, Mississippi if Longyqfirst began clearing the eleven-foot mark to 4 at CUHIIIS, some say on March 12th, 1900. He is best ' known for his general good nature, lasting smile and magnetic personality. He has gathered many friends ' I3 SIHCC he has been with us. I , S d 1 D He leaves us, but we hope ml OUIC ay t0 Scephlm clear the Woolworth buildino- Fw Honor Court, '22, Vice-President A h ' D. sociation '23- Track 120 a , , ' t letlc AS' . . tain 'zsf K , ' - 3 21, 22, 232 Alternate Cap- 1 5-sf E, in f Osemes M1SS1SS1PPi Clubs z. z. Z., A. 1. 1 Vi 0+-ew - -- 1 5 I 'Qu is-1 f L gl' A 2--il 5 1 5 'iw 1552 Nl. H E it is 1 . 0 x ' 5011 : OQ9: ' O l Q 1 s Ni99Q-55b5?RkW5TG?N9?fRlI-?N'NY ww -ghq., . at J' Qs ' Mt ffmfffffffw' 'QQ E F ff . f -A H M 11 D Pr' 1' !'5b 0 Y LLVY TLT , . 4 M ew.. 1 I I I f.. A .v .,f q , Y X' N X X ' 'I It A i'- , l l . 2 , 3 'aww nlugumpr-I-llwlvixum Ill m l n minnuununiiiiaiiiiiiili1..n.1.u-3..EiiiElif .Auuint-in-51717373:fra--f-1f '-7f5 '1'fmi:g:'d 5 'WEEE? Ggjgwull' Riff!! . N. -, M Nik A F rii l H E: D L V E Pc. N i Qx lllll Imzimmm m un : .m:u:mm1ur.r.:x:m ::m:::::n::::::::::::::::::::::::::::::::'.z:::::mx::::n:::::'.:m::.m:::a::::4anmmnnzma::lna:lu:l::::::s::::m::z'.::::::lu:a::::ma. ..,..-i .---- - Ji-1 ------f 55555: iii? I 5 f I N X E B h 1 o 0 0 0 o 0 I ac e ors of SCICHCC in C1V1l Engmeermg ' I X ' ' Q 1: S THOMAS PETTUS BRANCH, B.E. Sc.D. ' sf ' L Professor , 4 S 2 CARROLL BRADFORD ANNIS, A 2 T 2 Mifflin . Laurel, Mississippi V y 3 I X ' C. B. says that he has absolutely no scholastic x honors. However, he has played a little football and ' if baseball so he need not be consoled. After a few 5 short years in New Orleans, HC. Bf' moved to Laurel, 'E ' Mississippi. He graduated from Laurel High, then rig . if saent a few ears at Mississi i U. before comin ,O 1 Y PP S , to Tech. C. B. says that some day he hopes to 1 i know as much about framed structures as Tommy. X Qg g Company Football, ,20q Company Baseball, '21, K ! First Lieutenant, R. O. T. C.g Mississippi Club, Am. ' L L Q Soc. C. E. ' A x ivl MW kia: at I WALTER BLAIR BINFORD, Ja. 9 ffwazff n r . Ma 6531 Griffin, Georgia ,iii li Having tied cans to the tail of every dog in It Griffin, and experienced all the excruciating joy of mil, Q-Y? kicking up the dust with his bare feet on every road i , leading from town, Walt decided to investigate Fink E' trusses and listen to words of wisdom from Tommy. 5735 5 pi You never can tell how high a good man might go M1 A so we expect Walt to be Griffin's city engineer some ' day. if T sc , Am. Soc. C. E. 3 S7 . LEONARD MASCOTT BLUMENTHAL, T E '12 r Z Blummy 5 New Orleans, Louisiana 5 Z Athens, Georgia, claims the distinction of being S the birthplace of this old math shark, this important If event taking place February 27th, 1901. Shortly Ss Z afterward, however, Blummy heard of Creole cook- ' ing and moved to New Orleans, where he prepped. at Z Boys' High. The favorite pastime of this budding 2 Z 4 Z 4 6 4 6 4 4 Z f f 5 7' -,'RR-Kai x Qu, sux Qwia 1 L Math Profv is taking summer courses in higher math. Louisiana Clubg Am. Soc. C. E., Honor Roll, ,20, 121, '22, Scholarship Gold UT. SCH W3 z 9 .1 my 'tie S, ' ' so , f M K., - ,, . Cs, l!HlH!f HOY!M'AZUM5VU HH9SIMf!! 5 I 3 m xox-pwwomfav-relviwfowwzofmqzvfaw 'N .B ef - -A .Q 'fn ' 4 -' 3 . . ' ' JL435 - O Q-axial Q 9 O L xi -A f 0 J i, - T 'a-. - t f LAL! . gg .......... L .9 -- Quill' . 1 A - ff' . .g a . . a . . 3 w LLQHEL K. 013' W-i, ...:'v digg,- 2 o LLvy. , Qnqfifrf-- 429 0 P . .-,. ...Q -. l 14 . rx' AN , . X . 1925 W I . X ,Lag E.c...,.,Y,f-.,J a Jim- IL., mx....m...,..,..m.l,q5mgw,:-rgwixsgg .6 -v-Psa ' g,7,9fP-:Ev Y .ff 4 Hmmm,,,,,,j-,,g,g,,,,,Q-1- ,:.... ....... .. .... ..,,....-.,......,.,. up N l u,n:.i.. wmmaumnmuvuwlmnvmnmmim - ' L v 4 l an-: 3 5 'r lfn 1 . . , - , .-. - 'Eii!::.:15 -1 - - - -1- - ' .. 1 .- ..1i.,-aan - 1-- 1- mn' f '5154' 'ti -. -.ag - :I ..,.,,.,--..'--mmmmam-...--mana..N... . 5 savsmaxasiinmmtav..-.me---'-m-- ..m - - .. .-EJ ...--3 JQESYEEL: ' 'L ' ' Z H D L .---:1-imma::::::.::::::::::.::::::n::::::nlu:n::::::m:l:::::: : r ::............ .. ' ,,. mm-::a..:.,,..,,.. .,.. .,.,..e.....v..,....,....,.'.Qf .:. . '.:..............--- X . 1 Jig , .I l .VIH ea A. s '. . ,Q . TA., I , DENNIS WILLIAM BROSNAN, JE., fp 2 K 5 Z f .. Z -' I 1 WilIze'f Albany, Georgia , This little Chip of auld Irelandw was born' in Al- 'E 5 bam' Georgia, on AP1'i1 mth, 1903, Pfeparlng for 1 Tech, at Albanv High- The biggest thing that hap' n 3:3 .11 1 . 1 Pened to VVillieH during his Senior year was that 9 grapple he had with old man appendix. What we ' are gradually leading up tO, h0WCVC1', is tl1C'f-act that the nurses were so charming that W1lll6 001115 ia: hardly be dragged away from the hospital after he 4 had fully recovered. . 1 A fl W Civil Crew, Honor Roll, '19, '20, Am. Soc. C. If.. E urn: JESSE HAYWOOD BURKE, H A A H . ' 5 Boots Ant T 'il' Ai N' W ' Atlanta, Georgia -:-1 1 ' , , . Q f V Boots Qsome say his name is Ant'j is one of YZ.. I USES i Fiwf- the crack shots of the famous Tech Rifle team. He il W jl , .. was born in Atlanta September 20th, 1899, and be- ' . iygiil 'i fore Christmas had started crying because he could p A iwfiilyy 1. fkti. not go to Tech right away. However, his greatest ambition has been realized and after four years Lg F5151 sojourn in our midst he can laugh at TommV's jokes 165, - - - -un, lp fj H as well as the best of us. 1 t l i i'.. K'To teach Ex. E. . if Am. Soc. C. E., Rifle Team. Fill l I l-5 gm-fl ANDREVV JACKSON COOPER, JR. li l Oo0p ' fig ' V Dallas, Georgia ,I i l l , i l f, ' Andrew Jackson first attained fame along about Q 1862 during the Civil VVar, but since his namesake gh y came to 'Tech the name has achieved new laurels, for 'r1Coop'i is one of the shining lights of the Senior c,1v1lS. .He IS a shark in design, being one of the S3 few,men that can design a concrete bridge and draw E , it upyall in the same afternoon. Nl NJ, Am. Soc. C. ELg Scholarship Gold TP 4 Xu. ,Q E Q GEORGE ROSS COSLOVV y E VVah Hee N Q Jacklsonville, Florida Old Wah Heefpicked Jacksonville as the place x ,i gil his birthl and gave his first Wm--whoop August S 1. fb1,f1896. He prepped at Duval High and spent S I aylou. 3 Yea1 1U the army under a certain sergeant ' X! I 11 IP IST now h1s classmate. George's chief occupation . 15 H? arms to Pay back the favors he received during the war. T6Cl1fllqL1e, 52.13 Alu. SOCVCI EJ Civil Crew. . u x iii? W 4 O -QL -P, 5 527. . E A0gEs'sx1H-SLQQ-z::a'sr5'4vs:oz-mx-:-azz:-xg:-'-Amr:-rxgrsx-.,,g.g15,pfy,e-yq,,m,,,,,. Sf' iv: ,Saga-'B' ' I - gg V ff ..,. Skkwrwgj . mmm KA . Q gg .g A ., Q : A , .. 9 ff., 9 V Af ' li' Zv.a. i'v I ' at - -- 5 .-... .i , , E. . -, 'WT lx M-MJ lgm .x HEK1' Ulilllllilllllllbl l ill llnillullxximiiifmli -.p...z ,.q.,1,..1.-. 1 Ll: ',.. --.1,v ..1..,..,,. .mu ,....,.. , 55u1n!5ignug,guwlu!spE J.. 1 H P ILI is 11 Tis! ...... - 4 .-.... .-IilliiiiiiJEIEIIKXZRZIIEHIS'-E'-SJIIBISIMTTII'-i ' nil:iL'13lR8il5RlI53lRllf2lill'lllIlR7I!IiiIIlIII In 37'Il:liIlWFliI1If-725625131333I3liiF:lllIllill.'Il1'1ll3lllI355iII7II IIZSIIIIZHSZ. ..,... ....- .. ...... Qt? .ri S 'gg A I DONALD DALE CUNLIFF, II A A I D, D. . , Los Angeles, California 5. I D, D. should by all rights be given credit for the E ' 1Vorld's Fair, having planned the whole thing in his Q V precocious mind while musing in bed in St. Louis September 23rd, 1901. As his present home is Los I Er v Angeles fnot so far from Hollywood and Mac Sen- s, i net's bevyj D. D.'s motto is Back to California. A L Lack of experience maketh for susceptibility. ' 3 Phi Kappa Phi, Blue Print, '23, Civil Crew, Am. ' Soc. C. E., DeMolay Club, Honor Roll, '21, '22, I scholar-ship Goid KT , Y. M. C. A. Friendship ' f ' Council. GEORGE HENRY ECHOLS, CID E K '- Babe -. a Atlanta, Georgia This eve1' flowing fountain of wit and humor origi- -Q nated some twenty-one years ago at or near the State . Asylum in Milledgeville. He has exhibited his happy smile at various prep schools in the state, but ob- : tained his diploma from Boys' High. During the A . ': - past four years he has won a larger and larger circle Q 3 a Sr I S If- I 255 E . I +25 s l 'z wk . O . E3 4 III! nl 11 MQ! 113.9 n l --.. A I II4, W5 EU 59 S' Y, ug P -A14 ' '. M I of friends, all of whom unite in wishing the best of success to Babe. To be a Hydraulic Engineer on the Sahara Desert and get paid for it. Technique, '22, '23, Associate Editor, '23, Associate Editor, Blue Print, '22, Staff, '23, Pi Delta Epsilon, Boys' High Club, Am. Soc. C. E. CHARLES GREENE FLEETVVOOD, A E T ffzzedff Savannah, Georgia Way back on January 10th, 1902, the city of Savannah, Georgia, was all lighted with big bon- fires and resounded with the noise of whistles. When a stranger asked the reason for the celebration he was informed that the advent of Red Fleetwood, the future Tech football player and artist, was be- ing celebrated. Red prepped at Savannah High and entered Tech in the Fall of '19. His ambition is to be a sanitary engineer-wants to make a big clean- up, y'know. Football, '21, '22, Scrub Football, '19, '20, Assist- 5 77 L, sl .N i 1 . 4' . Q Q . ILE, t a -sa FI iii I -I Fl allllb 'mm' I 553' ll 1 Y X 3 H -- . - 1 ' - .us LIONEL K' iQnhlliilx 1. A AU., 'O 6 ant Track Manager, '20, '21, 22, Manager, '23, T Z Club, Honor Roll, '19, Art Staff, Yellow Jacket, Q '23, Am. Soc. C. E. X A ig CLARE A. FRYE, 2 A E Z Bully Z Oklahoma City, Oklahoma E This cowboy from the Golden VVest dropped in Q pn Tcgi inl-'ihel fall-Iof '19 lafter precppipgtat Oklag H ioma ity ig 1. e was orn in me as year o 5 the nineteenth century, May 10th, to be exact. Clare Q has made a great success in football, playing center Z on the great Golden Tornado of '22. He won the ex- ? ceptional honor of being chosen on the composite All-Southern team by an almost unanimous verdict. ff , Football, Bull Dog, Kosemc, Cotillion Club, T ,e um,.fm. oc. . . ,. 4 1 Cl 1- i s C E 4 : ,f gi O Nb' 507' o .1 W J W 1 - 0 ' , QOE-in illiiiiE5g:x.. ' W. og3affffW, mnffy,5-fgfynoffesavf , U , xwfff 3' ' .X Qqgdpq 7,55 ,..., E 7-J? 1-1-'Hoo X JSM? . . J., 1 -.1 , Can 1 1, X . r.-, -.1 in r-.- iii .,. .J no 1 ' 'n w' 'A ti Q? Li ff ir, v 5 r Z-0 .TT-is QQPQQO L r. v v -N 1 q 1 .13 . ! i - 5 V ' V ,..-r,:- ,HI f, ,X . f . A .. .,.-' wg -' 'RIgg,,..,,. .. 1 .,L. I iv 4 edemgzrff .,..,, ..,.. . H V KUQKZ z ,,AA,,:A1 A,f .,,, .., ..,.... ,- .... 'f ' ,... A ', 43.3 I N A F1 I V 1 'I ld! l I I E B P RJ A.: .n 'J n 3- ' W .........................,mg:nr.. ::z.1:::..1:::::::: ::: .lu:l:::::::m:l::r:::::ll::l:1:n::::' ':::' :l:w:::::::.............-., -..a---3-1 1 -la.. ,,.. .fm ......,.. ..... . .- .... H .,.,,... -, ....,,,- ...... Wap , WM - --- ' ---2'2 -----' ' fy, wfiilgl ll ,Q , ,... ..,. M.: ,rw , : :1s: g:.. .V ' V , fri 'q.f f V 2 , EDUARDO LOZANO FURBER ' . ' . -'ffji i ' HTOTOUA I X Guadalajara, Mexico l A .ffEd5' hails from a land of revolutions and tamales, ' . if each equally as hot. He is from a country as foreign 5. as Hoboken. You see, Ed was born in Guadalajara , Qcall it Jonesboro and go onj, Mexico, on October 4, ' 13th, 1900. He prepped at the-well, the Jonesboro J High School. From there he went to Meridian Col- fififll' lege, where he won a' B.S. degree. Edu then de- gil cided that he must be a Civil Engineer, therefore he f 1 entered Tech in the fall of ,19. Q if ' Am. Soc. C. E. 'fl 1 Wifi ' . ' Qjl , 23123 f . lx ' ffl ' f E45 JAMIE CLARK GooDE ,lg til!! ffaoodieff gl 'f Ulgpfyl Griffin, Georgia li-:QI 5.22-EH . , 21,51 ,fill Jamie's first peek at this terrestial sphere was on Q' 522' May 7, 1902. At an early age he moved from Con- qgggl ,L yers, the city of his nativity, to G1'iffin. Went from ' . Q31 bad to worse, so to speak. Our hero prepped for '23 ,, ..fj.m Tech at Griffin High and started shooting the profs E, iiqff-'Ali of our cam us in the fall of '19. From all re Orts A , . P P as 3,5511 that we are able to gather, Jamie is known in his LA. native heath as the Sheik of Griffin? Eg' .lrfgm Am. Soc. C. E. f lf? ' L- A A. .1 -V4 'g . LESLIE EMERSON GRADICK II K A 'tr-.1 ll 'Y' lr 5 'll-al, fl' ' Shrimp'J j X Jacksonville, Florida 1 'fShrimp'l first started surveying the surrounding EE y 4. f landscape down 1n Geneva, Florida, on December 6th, y .qy A 1901. And from that preliminary survey he found 'MSJQ' I that nothing would satisfy him but to be a Civil En- , 1 I gmeer, so with this end in view he entered Tech in fthe fall of '19: Like all true Florida 'gators, Shrimp iii.-A 3 rates cold weather, hence his motto: To the South lim 5 Sea Islands every winter? We firmly believe, how- My ever, that it IS not all climate he finds so attractive. Civil Crewg First Lieutenant, R. O. T. C.g Am. My , 2 Soc. C. E., Florida Club. I ., 4 N I FS: :iii f N ' ,gig ll EMORY DAY HALL, II A A : if ETH X: rr :J ' S I K Savannah, Georgia I .523 Emory hard- D rv ' ff 5. .iflt . H . ' al: llghts H2111 . . - 5 dal!! hard llght Passage, the three words wha a pllssqge, Q E-it manner ' h' Ich tYP1fY the Q IS . In W Ich Duke has g0HC through Tech. Duke if IS one of the lads who go down to T bee Q A 1-E3 mer and have thrillin ' ' -y every sum' ,S A ri b . g experiences with the mermaids Q .fix efore taking the trip to udl, ,, Atl n - 5 . gli. aWet,, Geeches y anta long with Q Savannah Clubg Am. Soc. C E r ' ' ' X . . 5 .Q 5 l.' Q K x gi OG x F i V ,,,,,.,. 5,1 ,d,,..,. nu ' ,L S A Q' Q V- L' cd in A :C In K, 035- N ao: , ,..jr2xK zcuf,? 5, gg 0 L i XX i , W, i Q A A 5 s 5 4 XX. L 5,-.M r I ., HW ' X .-N , .i. i 'I l . -I' 1.13:-.. -1 - , . l' ' 1 .. xv :L-1.5 11, ll' A ,. , .,Z,,, .,A glgigiliikilll hm , pnmml IlmululmmmmunlunmunIuuin1Tn.i.m.mu.E..'iiiifimll'--11.--,M.,.,,,,,,,,,,,,,,,,,,,,,,,,:.3ilwma..,5,ajft',.i..,,,....................m.SiJai.....::.ms...1.1..Ski.--.-N.V....-.......1l11Hhf'i':.-H.mmm-mm mm.. .- 1-.l .l ' I 1 EE!!! - u .1 . , . l ig! ll :IQ Eg N . Aol kv, ' I 1 W1 ly, 1:5 l , ' , ' I Il-1 Enllllt itll MM lil x am-mu x:a...:mm: ll Hlu I l 4-El un ,X - 1 - L ullil In I u :mmmuxuunuu.m:.:m.mu au .. :::::x:l: nan. IE : l......'. . --sn ....mx..nm.i....... .... . .. . ........ .:l........x':.::::.': ..... . -I--........ si . sr 5 ' ily? Y 5 a t ,, D LV E P PJ N -' .H lggf-numnugz e 145. . .1 li 1 I . ....... .... . .-... . :mm I - . .. I ::..:::: 5 .1 H ...... '.:,.,. ...... 5... . ........l....'.n..rm.r. .... 1. ........ I. , ..::...:..:.:. .......... 5 . .-'.' ,mb -LQ. ui,-,,, .lfvv S is JOSEPH JAMES HILL, K E ,Z E Joe P Bartow, Florida E Joe was born in Canton, Ohio, October 16th, 1900, ' Q but shortly after this great event he heard of Tech S' and decided to come South. He prepped' at Sum- E merline Institute and claims Bartow, Florida, as 3 his home. Joe lays claim to fame through his witty 4- 'Q answers to Tommy's questions. 3 Tech Aero Squadron, Civil Crew, Am. Soc. C. E. HOMER AUGUSTUS HOVVELL, A T A X g Happy Augusta, Georgia Mr. Homer Augustus Howell has a classic name but a jazzy smile. Happy made his debut into this vale of tears at Raleigh, North Carolina, on w January 15th, 1903. However, he claims Augusta, Geo1'gia, as his home town. It has been predicted i that as the ancient cities fought over the birthplace V of Homer, in like manner will the modern cities con- L 1 5 .I M 1 -Y L Ill: A4 A 1 -tmp 653.1 131,13 Q n .W y gm 2 22 V 9 5 ? Z ? 5 7 9 Z f 5 5 4 2 4 5 I 4 2 2 6 2 i V tend' concerning the nativity of this genius. Barrage Staff, '23, Pan-Hellenic Council, Am. Soc. C. E., Augusta Clubg Company Football, '20, EMORY LEE JENKS, A 2 T Vondy Atlanta, Georgia c VVC always wondered why Vondy never laughed at a joke on Griffin. Explanation: He was born there on January 19th, 1901. At an early age, how- ever, Emory saw the error of his ways and moved to Atlanta, preparing for college at Boys' High School. Vondy sells insurance during his spare time, which explains his classic motto, Make 'insurance' doubly sure. VVhen interviewed as to an ambition, he stated that at present he had none but that his fu- ture was insured. Scrub Football, '19, '20 5 Varsity Basketball, '20, '21, '22, '23, Captain, '23, Company Baseball, '20, '21, '22, Y. M. C. A. Cabinetg Am. Soc. C. E., T Club, Boys' High Club. WVILLIAM STARKE JETT, JR., E A E ' Billy Memphis, Tennessee Billy first attained fame upon our fair campus by his sea-going hat, however, some time last sum- mer this famous hat was stolen so that Billy now lays claim to fame through his peculiar antics when lead- ing cheers. So famous has this budding Civil be- come that he was mentioned for All-American Cheer Leader by Waltei' Camp. To have an Ambition. Tennessee Clubg Am. Soc. C. E., Cheer Leader, '21, '22, Head Cheer Leader, '22, '23. F4 5:-, L it 'N s ,. 31 1 s 3. . tx , 4 I 8. fi QE' l Q21 45 l . All 1 'IEP 1 nn . LIE! VJJ' I4 w 2 I S. . . . S V1 S .SCH 6 44 5 'il I7 51 1 '- sf N o , ,. ,.. cs XP ' I 'O O H J ...Ol -, 197 Q '- 'i:.. JI L52 . L.. ..... .. 0 1 ...:.ez!i5' 9 . 3 - f . ., 5 ' , ' , 'Hyf.4WwWmffWf 'w?ww2 ywfA 'QQ 'E 3 - Q1 5 : of - M - 1 1 f o v 0 L . . .- . 1' I .if ...V L. - H LLOHEL K' Q -i -:I-iullgllx O , , j o igliilin- I L fs '?'Y j1. gy' in Q - Q., -may- --f-V --- --I -- --.. - ::..:i'fi31?5: ' ' .. . G AJ I la. --LV A 1 Hlgrw liek gs!! Ifffi , ' :Zi I 5 . I 1 I I I Iii. I F., F2 Ez. 1 f 'xi I 42 I I I I ii I . 2.5: I II Q53 I. 1155: :I ' ,I . .,- I' . 33. .X lg: n :FI I li It IlI IQ l Q l I Y NT 1 -.1 I l 3553! I 531 I Er? A his x. N. Q3 I I'E?I A-l 31 IH IU .Ni .Fall I- II I 1. I I I 1' Mil ,ka . l I F ,un 4 'f A -'- I Ax 'H' l::::: !VA 22WTh.ms-Rkevlmwmmrtmz-mx-mxx fnf I Z 1 I 1- l .- I H ,, X9 , s tr N I , .. X , ar- 1' - :-.-15 -,Q :g:,,,. ,'- 4' ,-.f- '--,- . -- - '- ' - - . f '4 2- N- .as '-4 ' -. '. 1' .1 - 1' ue! Q Ml, 1 .M -6- '7 5 T.. f5,,,g,,,,,,,.q:g:.,.::I......p...-....-W..N....-....-.mmn-mmfnm mm1.1x..l.f.Ei.f5Hg!.?:i1:.lw.1',g4lg? .li-Ei ' 'GX '. L ' 1 2 . .... .-..mf-innuiiIi.mrvdum:mmu:m..-,r. .I,,-f .-- nw' ' ' 'L N N ,.-.. wan . -.-.1--fm - 1 .. ull? , Hui: iilllal wluliliilhunu N.1 1 ll 5 'I .. .gz- :. s ......: .. .. ...lr I rg.. ru , .. .fnri .ia ... .... b -'+G lsllu -M . I . fl I I f, 1.i'f CHARLES EVEREST JOHNSON, fp K 2 I 'pg 1 .. , 1 W: Papa 'C' ICU' Wilmington, North Carolina 'Colonel Johnson, possibly better known around the campus as Papa Charlie, gave his first command in the latter part of the nineteenth century, the ex- act date being June 26th, 1897, in New Orleans. Charlie is an old football warhorse of the great team of 1917. He is also a veteran of a more serious game, having served over a year with the Marines in France. Scabbard and Bladeg Varsity Football, '17, '20, '21, Scrub Baseball, '17, Skull and Key, Kosemeg T Club, Z. Z. Z., North Carolina Clubg Captain, R. O. T. C., '20, Major, '21, Colonel, '22, Am. Soc. C. E. ISRAEL HERMAN KANNER, T E CID - gflssyli Sanford, Florida Issy was born down in Sanford, Florida, and says that as soon as he gets that old dip from Tommy that he is going to catch the Royal Palm and go hack to the Snakes and Alligators. Issy's only failing is a slight laxity with the truth as far as the glories of Florida are concerned. He is, however, :L great believer in the teachings of Tommy. To be Tobe Edwards' star pupil. Scrub Baseball, '20, Am. Soc. C. E., Florida Club. CLYDE MARION KENNEDY, JR., B 9 H Kanada Bi1'mingham, Alabama -You never can judge a man by his size, but you can get a fair indication by the size of his head. lxanuk wears -a 7y2 hat and his ivory isn't an inch thick either. He has led his class .for three years and no doubt will set the pace again. An example of the type of man who lets books interfere with his college education. Q Pln Kappa Phi, Scholarship Gold T , Honor Roll, 2-0, '21, '22, '23, Civil Crew, Captain, R, 0, T, C.. President, Am. SOC. C. E. , ARTHUR R. MYERS If-Ruby!! IAtlanta Georgia COtme1.AltlfU1 R Myers was boin up in Poits- mout :Virginia somewhere bacl' in the te1.ti.uy 01 nnocenic er'1. He first came to Tech 'Lbout sucn ago' and P1111 ed football undei Cofich Heisman R VI-2211 he decided to retuin for his sheepskin Ubi IS qulte a shark in conciete 'ind steel dcsin-n because of hard w Y U A oik and r'1ctic1l ' ' ,lmbitio . ' . P I evpeiience H15 U IS vaguely connected tl tl ' of the 13. E. department. W1 1 ie destiuction .SCH 02 X l f f f 2 f, .fr Z Q. V'-H --4 'H P 1 G3 0 5' i :E 5 :Z 25 'S .gi .,. rl 4:1 -i '7 I zz. I If 1. .g. si 1 4 so I 0 I Eu? 'nb I 1 4' 'hw illvf t Al' 1 'III N L. U I ff' II I 5, ll-I . li!! 'Q N p 3 9 X' l x l ' ' . V - . , L s I , . X C , . C x I , C 7 A C 1 , C S . - . Q f - .. ' S 1 x c . . C c 4 ' t . w ' Y Sl N W N xx o GQ-gi' A . .R 0 Q . A . I , - Q tml l E 5 O l5 . SX 'I X l . . ..... mu , -g Q ,. YA , p ,QD V X Q V - -f ' ' ' S mf, 05, S' dump . :gggg::-- ' O , -W ,x g Xx X - - v'Q '. ,a55f f' 74- 0 ,V -. 149- iLi'x'. .4 - f 'Jf -:A ii ,, , . Rex as 'L 'il 'ss. A Q, All lic ffm ....... .. ....,....... . ... ..l , ..,,..1,. ..,A. .. .,,,, ,... . .. . . ..... ,, ,A .M y . , 1 xk f M ly . A K1 X .A .,. ' 2 , -1 dj.. S . ,,.f7,.a....., . X ' -1 'z as. .1 .gs i H- 'q X -- ' X - Ac ff .f4m 57 ' :ceo M- 'H ' f' -' i 'A J W .. ' ' , K-T'-2 -'-:fEfE'E ': ' L sq HM 1- - ,,:::5:,,mQiExggniul Hgiglvrlluvx l I u uma-In u ll in iuliuluuuii.miu.i.m1 u-..i-kl.-f.....--,-.4-,-...H....4..I1QIH...,..:1S1.i:Hm,,,,,...,',,.1'Ql'.....,,...........-.....,.........Ifi.1:J.....s-1552755110--.-fm....-.......1l5Q2-Zfhmum vm -mu. 1 H I xi Q ull A nm-1 1 5 :lux 4 ,i l x E rg iff iii lull c n an . .zn mmm I , H I ' V 'X . .. .. .......... in..x........................ .. ....... . ...:.. 1 s S . .- x X N rs X w ,. GEORGE MCBRIDE, cp A 9 Little George Newnan, Georgia Little George is a round example of the all-around man. .He is equally at home in the classroom, ath- letic field and drawing room. Gawge designs 1. shaky S Fink truss, makes a mean tackle, and shakes a wicked hoof, not to mention the other parts of him S that wobble at the same time. A good engineer will Q leave Tech in June, 1923. I .Phi Kappa Phi, Scrub Football, ,19, '21, '22, Co- A t1ll1on Club, Bull Dogg Civil Crewg.Am. Soc. C. E. 's I- . DONALD GORDON N1CHOLS D j Nick Savannah, Georgia ' Though born in Augusta, Nick moved to Savannag, to enjoy the proximity to Europe and all that it means. Nick has a perverted idea of how far his gogs will take him with the profs, but he is right M' there when it comes to getting under Tommy's skin. A Savannah Club. l l HOOKER EARL PEPPER, qu 2 K M 'fPe7J', gig Belzoni, iwississippi I , VVay back on September 9th, 1902, the sleepy SWL, little town of Belzoni, Mississippi, was startled by a big Tech drum yell. Its author was none other than Pep and the cheer was his first one. He is N4 plugged along through the grammar grades, always I with the ambition to go to Georgia Tech. After graduating from Belzoni High he realized this am- bition in the fall of '19. Pepis desire is to put Belzoni on the map. ,f Technique, Yellow Jacket, Civil Crew, Missis- sippi Club. X LEO KENNETH PERRY, II A A 5 HL. Kf' Z ' Atlanta, Georgia f Z L. K. first saw light of day Mav 3rd, 1902, at Z YVest Palm Beach, Florida, but decided that he was 5 too far from Tech, so he moved to Atlanta and if prepped at Marist. His favorite occupation is chas- 4 ing Bugs, down in the C. E. 38 Lab. L. K. is if a good student and we believe that he will continue Q in the brilliant way in which he has started. Herels Q luck to you, L. K. Z To he a corporal in the Salvation Armyf' 5 Second Lieutenant, Officers' Reserve Corps, Am. x Soc. C. E. ' Z Z yi . fi. A U Q-cwkw 5 121 ! O l Y-W7 ,........ O ' - Glo A :-l iggiiiiiign. S , ' Ylf Hx?YfIAWM099Y!'22999i?'V,. ' W. my Q N Q ., Q 1 1 L L Q ' 1.7 0.5 ' - U 0 E K .O ..4ff.ffO. '1 5 - l 1 1 . 'e.. 1 f . X ' I 'la I I . , , . . :F ' - .TX . ,M , , -ff:-A 1, , - L.,.a.,.,-,.f A ' ' . ,..1' ' ,f.:f- ,- 1 1-,. mmf. ' ' x t-X 4 4 ' in 6, X 'E S ' 'TH' -- ' '92l..f.......m1nn-unnnilnm-urinu 1?'5.l'E 'ifilfl 1 Ilzily I T31 ia 'ali . 1-H I if-111 L, 1 . liif 1 lf-,sf V125 1 I V35 ,.. 'Fil 1121! I 1 9'-' Cf1Egl 61:11:11 1 15-Z4 f11F:fi 1 1:54 i l'I'1 1 'I-In' 1 1' lfizv l 'Fiji T IFIL? 1: '53, il -:-1 11 lv. 11 Eff l 11 .1 5, i 7215 1 E221 f'l:f:y 1 1 vc- g illslifly 'iff 1 Wi: 1 hliifl 1 we-. l ., ,.,. 1 Q 1 l 1 ii-il1 I w'1,.1. '-1:11-'1' .5551 11? ' A lb iq V21 Q- 1 . l 1 qi I itil . iii 1 1 - if I i E il. l 'J iii lv: F- .jg T .51 itil 1 Fil' . 1314 1 gil 1:32 ,-,1 ve' 1 ',1 -.1 1 1 il. 11.- 1 Q81 I 1 .L algnl .ip 5,1 38 f Q 9 ,, ri 'ily' -in .r up -'- ' T'mIN -T: .1-1--..,1,.p.1.., .... f-.1- 1 11annunnllunmnnftinjgiiaggzih f - - ' ....,.. .... .1 . 1 a as --1---1 1-1' 1' - ,. , - mnumnmmwulln-m-man-1 --.1--H--vm-11 . .v 1 1. nl U, X L -- 1- 1- 1- - '- ':..L.:x.L.1agg.1...L- D r' rn .xxx..:: tit L V . . ,1., ' I A I H E ...... ..... ............... .. .. ma. Eiffp' U W KV., Tm, ,HWQ W ,IVI Vnll V MJ H . ,-,, m,,M ,,,., m,-.,ma--.- ',.- ma:-.::.-.':'at:2zxa::!.-....-.....,......n..mrr 1 r'x 1152'efff'52L' at 1 ' .I 3:5 V 1,1 Qi 51 if AI 3 , , 1, ,. -' 2.2. A -, 1.1, 1 yo Q.. EAS' F. N CHARLES PRATT RATHER,.K A ffo. P. V Tuscumbia, Alabama They moved the capital to Little Rock WllCIlll Iigzlit pulled on his fighting boots there October Gt , After prepping at the school in Tuscaloosa, Alabama, for a couple of years, he came to Tech and l12lS made himself quite evident in la short while. Along with good work in the classroom he can plunge the line or the water and has equalled good records on the cinder path. Besides this Pratt is no mean ladies' man. ' ' Freshman Football, '20, Nume1'al, '21, '22, Swim- ming Team, '20, Track, '21, '22, '23, Assistant Mani ager Basketball, ,235 Anakg Bull Dogg Kosemeg Skull 111111 Key, civii or-ew, Am. soc. C. E., coniuon Club. HENRY LLOYD SKANNAL, JR., H K A A SccmcZaZ Shreveport, Louisiana Scandal wassborn in Sligo, Louisiana, on Novem- ber 23rd, 1900, but moved to Shreveport and prepped for Tech at Shreveport High School. Wlien asked concerning his amibition, Henry answered naught, but drew a question mark, hence we gathered that his ambition is rather questionable. As Scandal is already pretty 'good as an amateur hobo, per- haps he intends to enter that field professionally. Phi Kappa Phi, Civil Crew, Am. Soc. C. E., Louisiana Club. ARCHIBALD YARBOROUGH SMITH Miami, Florida Archie'i has had rather a varied career along edu- cational lines. After graduating from Southern College .Academy he spent two years at the Uni- 'Yersity of Florida, there deciding that he would rather see the Yellow J acketsi, in action than See Elie slow mov1ng 'Gators.'f The greater part of his fiigeicfioiglifailp in the design of a plate girder bridge Am- SOC- C. Ea Aer-0 Club, A. A. E. EDGAR SCARRY SULLIVAN, II K CID rrljeten K fkllltllltil, Ge01'gia Pete first began developing his lungs on Sgp- tember18th, 1900. After getting plenty of wind de- Vciloped in Mobile, Alabama, he moved to Atlanta x - . . ' xl! ere he-has been a fainlhm- figure in various ol,- c estl s ' 1 . , a in the city When not plavlno. ms violin or cornet l - - - ' . C , f Y i, 3 le flequelltly finds time to indulge in his aiorite indoor sport, dry humor. CC Glggeliiluebtllgzwfggfl i llttle better than I found itf, A s 3 .Soc.C,E-S-.11..d. Bl 1 1 B- 1 . I m, . -A tfmdl and Baie and, 20, QI, 922, 235 MEIJO1. of Banda R. O- x 6-4' Xp? f 1 xwey 1 ....... ..'2!z...... -.gr X Qt x. 1 2 A 41 Z1 6 f. 5 f 71 .41 5 y 1 K S5 - 5 1 1 '52 1 I -'J E13 14' YS ef 1 . 125 1 1553 1247 S292 1 1 P4 ,- P1 Fi Sq' 11341 'U' 1 mg' 1 1F15 15 1 W, 1 H if N 'Q 5 E Q A S N N 1 S x E Y A 3 A N N Q N S S Q1 -S. N tg Q L mam yymvm sam mxmxxmqxg-i,mXmX . A 5 1111 I . A U Q- Xp I fic ! O2 . L01 A 34.4 s qw ' N .I , -- -- - 0 -A -- U Q V- I 0 -:g:,. X J l ' , ' ' 'A ' ':5:ElEF:sx... - Q R41 N'555KYfBE3S:I, N,1.313:31-gpg-Qgakqg.y.N.?x,:,xS9?gkx,?ogLMl7lW 5 Q 3 ' V' L -' ' H- A f - r .A f - ' . 1-9 1 1 4 . '. ,- ' ' . f- A L.Q '. 5 L A - D nu m' I Z 1.5 ' A -, I L . 1 .A j ' Km. F' - I - . J iq-aka 0, -. ' ' A , 5 - -- A - -ee 7 'Q -. v I --:,g X wg , O Jggssv- - U ' , ' 'Y T A3 K u ' 53 -7 .605 'H L Lx' x Y mr! gf . 4' .ia X ll ' w - . llllllilklli I, 'mliiliiirunr X' MYLLL ...WL-A .-- W 'i '--,-. 21 i I l m0l!nwfilI--I llllf u1uumn'x-x:w.mfan num- nannnn 1 uuuunnnnfn ni.-,715 ...', J-2611--12:.,,,...12....... ,,,,,,,,,,.,,,, ,,,5,gg,,f,,nu,,, ,,,, ,mmmnusiiiigglwumunllullgme E I ' l D LV E. P Pal N T Xl n IIIIllIllIII:IIIIIlSSIIES!!!IHS!!!II!IIIIHIHSIIF3253IIHIFJ?liiiHI:JillF1317Hill!IliIII:IIIlllllllIiiIIi:ll711556:IH!!IIHIIIIIIIIIIIIIZIIUIIB .......... s-..,,..'iE'-x ag.. 1 GEORGE ALBERT THOMPSON, JR., B 9 II Z AZ .3 White Plains, New York 5 Al was born in White Plains, New York, on De- 7' cember 8th, 1901. It seems that these VVhite Plains boys are Wanderers, for Al came all the Way down to A. R. C. to prep for Tech, where he entered in the fall of '19. Al is a Warbler of note for rather notesj, as he was manager of the successful Glee If Club of the past season. Glee Club, '20, '21, Assistant Manager, '22, Man- 'g ager, '23, Blue Print Staff, '21, Skull and Key, Co- I tillion Club, Civil Crew, Am. Soc. C. E., Augusta Club. g ERNEST FRANKLIN TIPPETTS, 'H K A Tip St. Petersburg, Florida A Tip decided on 'Lake George, New York, as the V' place of his birth, and June 18th, 1900, as the date. However, he moved to Florida, the state famous in these Volsteadian days as the one closest to Cuba, although We won't say whether or not the latter fact W Q caused his desertion from New York. Tip prepped . A at St. Petersburg High and entered Tech .in the fall of '19. V Ha Technique, '20, '21, '22, Associate Editor, '22, Pi Delta Epsilon, Civil Crew, Pan-Hellenic Council, I ! Am. soc. C.. E., R. o. B. T., F101-ma club. n lug' JOSEPH THADDEUS XVATTERS, CIP Z K Minnie n ' Hermitage, Georgia . Minnehaha, or laughing Vifatters, called Min mi for short, was born in Hermitage, Georgia Cno kid- ding, really, there is a town by that namej. Minnie - prepped at Rome High and first honored Tech with 3 his presence in the fall of '19. He is a regular lady's ' man, which explains why he always had a reluctance Q to go home for the holidays, his fair charmer being S a resident of Atlanta.. Phi Kappa Phi, Technique Staff, Barrage Staff, Civil Crew, Honor Roll, Lieutenant, R. O. T. C., Q '22, Captain, '23, Am. Soc. C. E., Rome Club. S Gonna DEAN 'WELLS ffoodfislff p Bowie, Texas Codfish entered Tech in the stormy days of the Stick-Around-Till-Christmas organization of the fall of 1918. He is a good engineer and a practical man, but he has apparently never become educated, for he still longs to return to his native Wilds where he first saw the Lone Star flag August 26th, 1900. Am. Soc. C. E., Long Horn Club, Masonic Club. fc as 'Yo 2 0 6 jim LA mul 0 is . s V L U 1 1 ' 'Y 5 '1 X rQywffffffwygggwfffffimfymgfffmfffffffffzyff fffrqgxgol E G . :rn at irvv X am ,fo Jfleisio N v O NOQQA ' ' X ills.. will 9 , 4 -2 . j K W- r. .e....5- li - - - . sa, ' L' wo O 0 xl ' affix xfflxxgj I ffl .tennis s Il Wf fm , i L. , ,, . ' P . .' --HQ n'M1?f1.,-rs-'f' - , K... J-x x X 'FX M, . asm-.- or i sa ,vp ml K ., 'L I . X? , ..:. -- 1' I ,All ' - , lu' ' W, - ' i,.. r-A-vw .llillllll 'Hill' FRANCIS LDWARD NVHITBI AW H K I f'Tec' Charleston, South Carolina E52 17 K ,vi : 1 Q! N , we k we 0 'yi Ai!!-V7 Lx V E5 V4-X NX' ffjh , 1444153 'N 9 Iffe. X i ,S in-ZW. JL rki, 6 'Q My A xy,-515: J K! f 1 1 nrt X . X ,,-f If HW , ,Q ,, iiiyr, X bx Ly- -1 Alfa , We , fe-of Wffff UWM i if Nr fa s Y WA if- ffm M-mm ff g,e,gg.f , f' r'-' ,- X -j ,f 1 i yi ll I 'V V 1'-Hi ii 5' K, W -R-f 'Q Y :Id I Xu f lg -Ah ix . fi if ll ii'-X-3 A r ll t ,fri , I , 1 I-ei - N 1 lf II if , Ii I i r ,i 1 J . 1 ru ,i 1 N -'J r Y fl X ...L -1 W 1 Nl 'L ami in-YFFTP up ve-H vi- .. L .la A i - ff 'I:if 5 1 ,A I.. ?, i fi I ' i igli i I 5 I xngys i f' ,1 I an i V! 4 A 3 4 J , cm ai! l 1 'fi 1 ' Z W 1 Z, all 1 4 .Zi 4 i , i - 1 ii: i vii ..a my ith Ted Hails from Chawlston, By the Sea, BYDJKIN3 'fm f 'f Sea, By the Beautiful Sea. He has the carriage QU if and air of one used to associate with the Henglish 1 nohility, and such things as sea togs, yachts, port- :iii holes, etc., must appear through his artistic gogs. waxy' He is musically inclined, playing the Victrola with 'l a clebonaire grace and charm all his 0wn.' VVe have paw i a faint suspicion Ted', should have been Percival. QMRQ1 ,Scahbard and Blade, Civil Crew, Captain, R. O. T. AIU. SOC. I ' . Wd! iz iii if-3 HENRY NVILCHINSKI WVILTON, CII E II WMU - wqgfig 1 1 3 , 'fSh'inSkfi', l t Macon, Georgia - ' i '?:'.!N ' Shinski', first started falling in love down in Ma- y fijggi Vg lcon, Georiga, on iDecember 29th, 1902, and he has .Q-Chl - - X . i S l iz'-MN heen falling regularly ever since. Xllhen cornered he admits that Macon is his home town and that is ig? where he prepped, entering Tech in the fall of ,19. an :cgi Henry started his course in Chemistry, but after a certain little explosion, of which he was the author, l he decided that as a chemist he would make a good l fgtrlgx. civil engineer. Honor Roll, ,2Og Macon Clubg Am. Soc. C. E. xg y 4, in iii!! i4.QifAf.,i'l P N ilu 1 'df r 1 fry 'Fiillii F i fl ' if 1 i 'LI I y I 'lil 'L' i , I 'i , ': if l h ' r 'ie limi WSH l E-: i' UW' f si so in l if Vigil wiv fl lsiiii sig, i pgs: me l MEM . lil i ak 'Q Z.Q2' 1 is l wish ll l use ,itil A i N, 1' wi l M si i .Sly 4 Q at-Q N i 31 I , get I xi X 'TQXI77 fb 'Q'i'fTQYE' to i sc, s s c c viii . V i ,'72.,l.lQi.llJ if - 'KX iii L' N31 X0 .1.!l' Ig-Ki5J-- v ::-i4l:,4.llii-E in .X-rw. wr fr f 4 ,U X- -NL- Q i ff ' ggwseunsss in: - : ..,, . im a xl. ,xx 1 'VI w ! -is ' ! E x ts R S x ew li- it!! '55 .. ll! pl! li x l ' H Rum: n 4 nn.. .... ........... ..- WX. as Q- l ,f19z5WQ f 1 .- ktfsx ,FN t . , ,' 'I 'sr-1 ., ,. ,J ., L Q - X - .N - K -4- rf-.lf ' , M -.,.v H Ai. - , I , 1 ,-..-..-.,, ,4 A. xs I N X , rin., . Avi. K xq.-:.-:s:-.1-,-.1l 'href ifafiiff'-.-i f ij: ' Tm WT mfllmllm -'11--' -- m--we-1--mummmiuilu--ii'uih7-' -'iw--iii.,---,1 ----.....m-H .H.1I-mliuiii.nm-EM?--.SFTfail... ...... ,, .,,,,.,,,,,,,2Q 1E11,,, 'THE ' .nm mu :nun 'im , ,, ..... ,M , . !!!5!!t! i'!!Q!5! iii? se! V . . . .4 ., , 1. i... . . .,. ,. . ..,i . 1g, : ..5, .,ii.i . ,, .. , .,. ' 0 Bachelors of Science in Textile Engineering 2 5. I I it! 4 Y.: P! ul . grill' 1 1 mf? W1 l l ' Y 17 ld 5 5 5 Z f Z Z f 3 f 2 4 6 2 K 3 Z 4 4 .2 4 2 5 f T.. L CLARENCE BERNARD SEAL P10 essm JOHN INZAR ALFORD I nzar Gloster Geoi gift P ' Inzar, the Mountain Boy-born in Gloster, Geor- gia 120000 feet above sea level 1000 miles from civilization . He finally escaped from the walls of Young Harris College and has spent four of his twenty-four years here, trying to grow a beard. So far he has failed. Masonic Club, Vigilance Committee, '19, '20, MAURICE BEVERLY ASBURY, E in E Squirt Elberton, Georgia E Woinenl Women!! Women!!! And, of course, Love! Squirt is in love, has been in love since Feb- ruary 16th, 1902, and will be in love the next time he is heard from. He squirmed through Elberton High and hooked a Phi Kappa Phi key here, which he wears in his eye. Glee Club, '21, '22, '23, President, '23, Mandolin Club, '20, '21, '22, '23g Sextette, '21, '22, '23, Marion- ettesg Technique, '20, Phi Kappa Phi, Cotillion Club, Textile Society, Elberton Club. 1 SAXON ANDERSON CONNOR, 2 A E Hs. Af' Marietta, Georgia Born, bred, married, and yes, b'gosh, still living in Marietta, one of Atlanta's star suburbs. He al- ways gets by on his ability to chew tobacco and tell about the way he felt when he saw a moving picture for the first time. He shyly admits he was born in 1901. Textile Societyg Varsity Track Team, '20g Marietta Club. Clyo o f' ,ID 'Nl lf lv J- 4 -F' + l l ly' T!! Qi tml' 'mf UT! Soi' ll! ' 5 ,, 4: .. w w ' 2' . . , Y I , 5 , 1, A M ' R.. 0 , . . 1 A V L ' O L . . L L - i.-r aigczgen W 5 ' A lf an I H LW Y ' T . , . 2 O xl' .1-1 -E 9 o A Q9 .4 . -vs 'Q li.. ww ' 1, .... ......,. r .- fiat? Sf, -- KJ 11' . 'I 7 X . QEiffAv1,m9yf1iyfJfAffi0'f1Sof9S29' F A ? ' A Q' L 0 n i 0 o . o ' I k H , ' ob o 'QQ ill in, . sa. . I f-v-N -z ' ,I Y i... .. - I C N. N 5 - . ,il 3 i 131 AVQ' do -A g ' ,- ' Ag , lj, w :I ' ... s.mrlrnwuls531 : . 274 ':,i'r1.. -1 ,.1. ..-'- .:.-. MI '3f,3'f-me-,4.., ,..,. , .,.. my4o.uuinmu-Sim-mum-vnu:vI m..--fn-4--' - I --W' 1 V, D L V E P L N H , R N i lvllv '4-'i l'AA.-A4--' .-'A.l - M 'WWW-pg hhv. Jigmimi - :sz::::::u::::n::::::::::::zaasn::::::.nn::xr::::::::::::znan:nxnxm:slnazu:imma:u:isz::::zz:mr.n::::::::::L ...-- bb... :V 3 F iigifw 1 ' f J Y' 1 E HAMPTON LAMAR DWAUGHFRY, JR-, E X il .E E Hump i 1 'ig h Jackson, Georgia fy L i . , ' f military tac- l f , iii. T1 Voun . exponent of the science o I . 'I . iii' tics lslates that he was born Rin Jackson, Gemglfis went to Jackson High School, and h0P?5 to Work if there. As he spent one year at Georgia, we feel f llgql that we can only grieve with him and say no more ' . ' -' I . ' X ' 1, V 111 lmmng . , - t '20 '21 Ma'or, M' ii R, 0, T, C, Captain, 21, AdJutan , , , J '21, '22. 2 iw - lliyi if l VICTOR MANGET DAVIS 'Mgt 1 r:Recl:: l i If 4: 1 M Cave Springs, Georgia mgw ll? The Registrar' shook in his shoes when Red swag- LV. gcred into the office, laid his guns on the counter, i 1 shifted his tobacco to his other cheek and announced i in a loud voice that he was from Hearn Academy 5' and wanted an education. He now has it. fSh! Red i was born in Marietta in 1902.j P li' i x L il Textile Societyg Rome Club, Honor Roll, '21, '22g ' p VH Phi Kappa Phi. ' KSN THOMAS CHAMPION DREYV, E N 5 iff, gfT O 21 Macon, Georgia T. C. is strictly a Macon product, having been born AAG there and having militaried around Lanier High School, of that city. In his four years here he has - J' 2 attended Shorter College almost as much as he has Tech. It must be the uniform that knocks 'em cold. 'il lli Textile Society, Commander, Scabbard and Bladeg liliibzj. R. O. T. C., Captain and Regimental Adjutant, '20, lg '21, '22, Major, '23, coionei, 23. 5 L L' r N Yi . E lf? i . HENRY BEVERLY GARDEN, II K qs Fritz 'von-der Blinkden Heifein-Stofein Sliinger- if T Shrausshornu M i Macon, Georgia tgp . . . i Ni' . Hemricht was announced, It's a boy, in Macon, WN .p Ifebruary 8th, 1900. A Week later, having organized N his first stock company in Dinty Moore's garage, he , pg? starred in an original melodrama, 'fVVho Threw the N y ,X 1 flo Y Jim Cveralls in Mr. Smurphy's Chowder? After winning 5 initial success in hisahome city he took his company i 15313 1 to the next town, New York. VVork became boresome S ' ggi tolone of such wit and artistic impulse, so he came to Tech and has been the comedienne extempore' of Wim the campus since then. Singing and dyeing are his 5 specialities. ' Q i-211 a 9 N ,gil Plibapgl, 20, 21, 122, Manager, ,234 Glee Club, '21, ,22, S ml V . 5 - my mg hcfltl Mfmagel, 234 Technique, '22, Blue Print, ' ' ' ' - r - . Algal ehib 1fll3t31U, R. O. T. C.g Textile Society, Macon X. '. :fi - X IU. 3 .Sgt Q N N sa , f i. J' ' ' A' U-if ' J . . . ,Q aww! ix-4,1Og'2WHEN422:2:-ries-:-::rx-144115ix-rc-seams:-:-xgwgqq,,5,w,,,.f,,,f4,7,,A,,, g 3 F ' ' - ---1 - , H V. i as . ' - . 'WWW - wwastmasswssawwxsx R fr lv -J hu 'A P - -3 55,1 O ' -' f K Y -xv lv- XXXXX XX i ,ri Q icqiful, A w fi LIKN J ' W V ,iii ll sggasa ,L X up - i k ififi '::': A 132 R:Q1 ' Rsp. E l925lNl! Wg -1' + sm, , f . , 14 -1: .W 1 1- 'uf -- 3-I -- . 11 . .' 'L '.f,' '- .I . -L x t -A Z ,-.Ji at -f 105.001 'wh it lixgfgistsm .Msg :H 1' fl W,ffn:.:j 316 J 3' . . um 1. .uit . limi. hmmm. '1 . r' . L -- . ..l ' '- .... , fe- ' :limi nr: mmnim Twp .lfmu 1 1 H111 u I mmm 11 nm u-um 1-1mm.--1--1-1-main.:'ui mm, -1-,i,l '..m,,,.,, ,11-,.mfI,..g,,. mi....1.-...,.......m.i..:mnra-1576---1.1315312,-H--1-.m....-.....,15,3HmGfafnmm-m1u::-ummemu ll ui l Q ITH LVE iz., N lm E W 1 il W luilliasillhwu lhhhhi i 'Salim nn' ' ' 77777717 ' l llililll l Ittllllllllllllliilil ILIIIIIlil!IIIlII!!!BEEIIHGIIIIIIIIIIIIIIIII 'I HIT! Eli:Iii!!!Il!!IHIHIITIIIIIGIFEISIIIZIIEIFZBHGIIIIIIIIIZIIIlIRIIlI:IIFIII:ISl .... ...a ..-. .. X X 1 1 1 1 1 1 , x 1 N S N S s s S S S S Q E 53 it is 'Nl -1 1 PA M! Ill r fx 41 lg. 4 b. 1 lt l l El lull 1 , E I A 4 I 2 a 'Z f 4 Z 2 X Z 2 3 5 f 2 5 7 5 5 7 2 a SHERRY MCAULEY HAMILTON Shelly ' Dalton, Georgia This hard-working young benedict land, incidental- ly, a proud fatherj was born way back in '941. He prepped at McCallie and the U. S. Naval Academy, then went in for learning, and so came to Tech. We have it on good authority that he made Phi Kappa Phi on his undisputed ability to chew tobacco and drink dopes at the same time. , Honor Roll, '21, '22, '23, Scholarship T , Phi Kappa Phi, Textile Society. RUDOLPH FERRILL HAUENSTEIN, B 6 II . Love-Birclf' Hattiesburg, Mississippi Rodolph Vaselino has nothing on our Rudolph when it comes to having the ladies after him. Rudy rushes in where others fear to tread. He gets by, too. The town of Hattiesburg celebrates on the sixteenth of March because of Rudy. So far they have celebrated twenty-two times. Textile Society, Glee Club, ,21, 322, ,2'3, Mississippi Club, R. O. T. C., Battalion Adjutant, '23, Summer School Club. - MARION KELLY HINDE, A E CID Kelly I Atlanta, Georgia Kelly is only a vest pocket edition, yet he takes Textile along with the big boys and smokes Pied- monts with Zack. Born in Columbia in the terrible winter of 1902, he moved to Atlanta to go to Tech High. Textile Society, Rifle Team, 322. JOE LESLIE JENNINGS, fb A 9 Joe West Point, Georgia Joe became famous on the Tech campus when he offered to take Ty Cobb out in Peters Park and feed him to the groundhogs. Ty cooled down and offered Joe a contract. Anyway, Joe went to high school in West Point, having pitched his first bawl Qdeep stuffj on July 26th, 1901. Baseball, Scrub, '20, '21, Varsity, 322. .wg-,Y 6 AM' Q4 4 1 . WQ1517 nm, , ,.........L, -- Hlllilli-fllllilllll :em 1I1lw,:'.lI,,. ,-4 s-Massa E all --I: . ...naiiiiiiii ' A ' r11. QI S Z I 'Q .LJ Ing 4- ,. 'I' . i l 1 W5 059 7 0 W. 11 1 I4 1 3 . , . I v J' O f- 1 IRQ ' ' PA' 1 limi! Q Lvv X 2 6A Fl' , cz xb I - bl 5 . O 9' 1' I X X 1 f O , QW ' . 'isa' 1 '45 Q -g safes' tl 1 ' I '21 -- ' A A - , .. ---- --'--- ' A ' , ' . 1 - Y T' 'X ' 'Q 'J ' - f N f - A fffff. I 1 ' 1 .. ' Og M - ' - A NQyffnfzymiiffyfffmfmfwffKffffwfifW1W Mt'-gg A . 1 ' H e V O , s I K 1- .f f. - ...aa 1 eu W . ' .. ' ' LLC H EL K' Q Sl ' 5. ,ni .V .1 fb .il - O' if L-. if 9 0 ' '4 5 5 ' I N'-' 2 I E -, u'.4 f- 4 ' its v -' .-, 4 'Eli ' .. 'W- s 'I Xi . I I V f ix ' K , 3 L-J-G-cw-1--'X - - fufff' g i- .b f.glgi:Z?.l,.w a1uxa.q-.ZLL ...11: 5-iii ..... 5.'.I5:1g-i g1?S,n l,g. mmn-multi , - Wpgginmw, .!b' WMM- 4,. ,'. W '.'V.v M-M A'wl mm, EW' ,V A ..- ' ::::::::::::nr.::::::::::::::::::::::::::::::n:::::r.::x:::x::::::::::: ::::m::sn::::::m:l:::uzaaaeszswsz'-:::::::::::s: ..... - - ......... L ffffffi W ill' xi,-1' Z , 'USU l -. I ' V ' l ' 1, . ' CHRISTIAN FREDERICK KOHLRUSS, JR., IIKQJ , y Augusta, Georgia I John P. Sousa and Paul Whiteman have shadowed 'Q this trumpet-tooting demon of music ever since he 4 came to Tech. QBoth John and Paul ,were heavily armed.j He is a confirmed exponent of the theory .I that slumber is more sweet than toil. Who's Vifho y states that he was born in 1898 and prepped at Rich- J ,. mond Academy. l ,W , 'rexnie society, scabbara and Blade, P.. o. T. C., 1:25 Captain, '2o, '21 Major, '22, Band, 120, '22, '23, Assistant Director, '21, '22, '23, Glee Club, '22, '23, f Director of Orchestra and Jazz Band, '23, Director 1, Tech Orchestra, '21, '22, '23, Technique, '20, '21, Mili- tary Editor of Technique, '22. f 4 - , FRANCIS MARION KIMBLE, JR, 23 111 IC ,ll l FP: Count If? ' ' ' 'f ' lil! . Poulan, Georgia Ig!! Poulan doesnlt sound exactly Anglo-Saxon and ac- willy cording to the way he is '4Counted around the liallvfy campus one would not think Kimble is either. 5'Count VBR has been painting little pink and blue squares for l p some time. He was born on December 24th, thus Q. 1 gfyi i t makingihim first cousin to Santa Claus. As the QQ, +I 'S-'J population of Poulan lncreases 25 per cent. when 43 fi-J an beg 1 .' f'Count goes home, we are sure the city is proud of laws? '. - him. Y' I T'- NQ . . . f- FJ SWL, Textile Society. . lqiif' qilllx ' E ,' GE 'H ' - 'P 1 , N JoHN FLETCHER LOWE, E A E FH 4 1 ' . A I Doctor A Ill ' 1 .N '- S Nlfashington Georgia ' ' 5 13 gi n Slowly unwinding his long frame and half opening S V one eye, the Doctor sighed heavily and told us he was E born in Washington, Georgia, on the second of Au- HQ gust, 1902, dozed through Wasliingtoii High, and is :QQ 5 HOW flesperately in love. A few seconds later he was l if sleeping as soundly as before. Textile Society, Sleeperls Club. ni: s HENRY CRADY MILLER ' i ffszfckff gli I Calhoun, Georgia l gi 1550153 bornminA1899 near Calhoun, the exact E MES eanemglunliwwn Ciweper to. a few revenue agents Nfl ch u exp orer who died in his efforts to penetrate 'E C Wilderness. However, Slick is now quite' tame S V and speaks the English language Vgrith ease- ,93'1e:it-ile Society, Masonic Clubg Technique, '21, '22, he S-irilctijfllienant, R. O. T. C., Student Assistant In- E HPI' S f .s TO 2 gm!! val -WW '-he x'-ocsmvwofzvfffff -I K Oi! O 3 -O Q l S L, . -5 O Oo-if? CILOQ o -2 - if 51 4 - E, M A K s V- - M' H Qi of . Q ' 'W s,.Q LWWWWWWWHMQ .,aa.e we as .ska . . -5-A 5' w ' H ' ' L.-:.:r ri Y D W .W .A . E Q I - . ,E . .mxwmxxxxxxasmmwmg 'xxmxxxm- X if-, Q. . ,f O ' ' f 2:12. Q, If-' 41,60 G Luv ' 1 , Jgieirsftf a an Rei A . '-' i na s f f '1-f -iff . QNQEQEBEW ssc 4 .af '- fill T1 , - , f klaweqeg-Q iuggfilzignm lcnrglggigailrrrlllnnmzsu un I mlmnnummmnnuuisii iuiiif ..n .giQff 1f:--um -.--.-- 1 -.-gin-n-1-mn-lih :--- r m '-'- 7:1 ---f -1 1---- ----- ------ -1 I:--iff'-'Vi - P'5i' :'i '5 i5imf 'y 'ffm 'f'f gx -- n 'L-rg: 1 I . .m.,,....:,gu. H' LE 13.25 - l 1 n Q IHE SL E: Pkl m u. EER.. ........ ... .... .::n:,:mm:a:. V -... - -W .u:::s.-ar:::r.::::::m:u::::m:::,.-m::,-.::.-:-...-:'.::-..'v-..-:::.aa::.-:::::.'-..s:aa:r.:.:::-.nn:::::::nsa.-r::rm::::r.:'.:::s::::::.'::.'::ramI:::z:::x:.':mu::'.z: -...:'.::'-':::'.:::.':::':: :::::::::::::'.f .,... ..... - .-ii, ...... 57 ,rl 1 ,E 5 as If ix XVALTER MARSHALL MITCHELL, do A 0 Mitch Tifton, Georgia ' Tech gives thanks to Tifton for sending Mitch to fi her, although he was born in Cordele, Georgia, on the second day of August, 1901. A good athlete, a 'l good student, a good fellow-in other words, a Man. ' si He prepped at Tifton High and G. M. C. , S Varsity Baseball, '20, Varsity Football, ,21, '22, -' N Varsity Track, '22, '23, Vice-President, Skull and Key, Koseme, Bull Dog, Anak, Cotillion Club, Sec- retary and Treasurer, 522, '23, Tp Club, G. M. C. Club, President, Senior Class, Secretary, Pan- Hellenic Council, Student Council, Textile Society. 4' 1 Q. ROBERT VVILLIAMS MCKINNEY, K A 4 Bob ' Chattanooga, Tennessee sv Bob says he matriculated in Textile only as a means to an end. His ambition is to join the Internal Revenue Service and search the mountains of Ten- 'F 4 le nessee for moonshiners and bootleggers. He is num- bered amono' McCallie athletes and has smiled his b gill happy smile since October 29th, 1900. Q Textile Society, Cotillion Club. P' as if aw QQ! ll ' mn W ,A LLOYD KELSO RUSH : Radio Rex 1 Bemus, Tennessee T This diminutive Marconi owned his first crystal 'y ' set at the age of 3.1416 and has been broadcasting since September 16th, 1900. He learned his multipli- cation tables at Union University and later grabbed if a Gold T here. f Textile Society, Scholarship T , Blue Print Staff, Q '23, Chief of Tech Radio Station. Q XYILLIAM AUGUSTUS LONGSTREET SIBLEY 5 CIF A O 2 HBUV' g Milledgeville, Georgia 1 Y Bill must have been named when the family had a Y f ii V if reunion. He has only been with us two years, having come here from the Naval Academy, where he was a f member of the soccer and gym teams. Lived in 2 Milledgeville since February 12th, 1902, so he Just Z had to go to G. M. C. A darn good fellow. 5 'rexme society, comiion ciub, Glee Club, 'za 7 5 Z 7 1 'j' , MQ, 'mf Af he O sg! 4 Y' '1 Q 'Wi W 1 :rw Ha:-. 0 8 A . r M il '- 1 tgal QU ffl l i lllllbl nm, 1 UE! Y, N. ll l gl . . gl ,. fo Q ro 1 Ju 'E .5 . Q I O W? f-1 l T LVY . af 1 f ., o 6xPlZ3F?.,,D O dig' LV aa . .lL Q ,arwc4a.9fFaas -. I '-'II-5' ' V 'L j,,Xl.f QN ,L Og , . . ' .k Z!4.6Q' ii ry H. 0 Www. .aaawf .. ...'? '?L K Y 7 ., -- - aj: xr' O -,lfij-..:f rag is Q fats? 1 X Ill B X 5 I . . e ak , , - fi X , I ' if i N KC , I' 1 ,Q ' c 7 QQ.:-. 'I NX t ' S 'i 1 I 1,1 1 M- L i . . I .,.11..1-wut aim.. f.,.:. ..... Q .1 - .. nm.-,,.f...... ..,..-.1,....,,,.-- ,- .1 if---usvuw'-4' ' ' ' ' .mu ' ..v , li XII! 5 I it .I ni i H D i I ii I I 2 I ' I I L-, I I I III WI, I i nl nnunln - ' I- V-1 4.5 I E at lg -M . ..................... .......................-: ':::::::::::::::n:::....:1::::::l:::::z::::x::::::::::::z:::...:s:.......ae. ...... JPJQ' ,,,,. .,,,,....,.. .... ,......,...,.-,....:. ,jg V' .v-7 ... .x 1 - ......... ........... . , VL 'W fn Q- , 'RHSSB A I I I f.:E?5mrvr:' D .... -' ,-lf? I Qrfm.-.I II':1l!II tt? iEif5?I I I IIQQII H3433 ESI FE I I I ':ff I Iii: II Ezji lu' Ita E127 y I Fi I' it f:j:I I I:f5j . IIEIII I I I I .. Il-, II . :izi I IQ Iiifr I II'.:Q .lk I I I I I ax, Q,l1i 4-4 I . I I X-5 if-I I -- I .-I I .1-1 Ilia' N535 I itil ' if:iI u. I I l3,II I iii? 'IQQII I EEJII I HI up II5iII ISI .Iifif I ELI ,I. I Ii I S, 17-I gc, DANIEL MCQUIGG STONE, H K A D0ct01 ' I Chattanooga, Tennessee Doctor Stone, the Dean of the '23 class, ideal of the set, and All-American Hart Schaffner and Marx model, now makes his 'debut to the world of working men. Doctor became the pride 'of the family on August 17th, 1900, in Chattanooga. ,Battalion Adjutant, R. O. T. C. I TERRELL HARRIS TUMLIN, B e n ' Tum Atlanta, Georgia Terrible Terrell, the handsome six-foot brute from Decatur, now stands ready to receive offers from any young thing with the right amount of cash fstock in cotton mills includedj. Born in Carrollton, yet he graduates with comparative ease. P. S. Age-only 20. Textile Society, Boys, High Club. RICHARD ERNEST VVALKER, JR., cp A 9 'fPonzi Brunswick, Georgia R. E. tasted the salt air of Brunswick for the first time' on January 21st, 1900. He received his train- ing in managing periodicals at the Glynn Academv. Dick is a cheerful individual, and is well-liked every- where. Despite the responsibility of managing the Blue Print this year, he managed to attend classes and do his school work well enough to graduate. Textlle Society 5 TCChI1ique, ,21, '22, Assistant Busi- ness Manager, Blue Print, '22, Business Manager, 239 R' T- C-, First Lieutenant, ,2-1, '22, President, Brfmswlck Clubs HOHOI' Roll, ,215 Pi Delta Epsilon- Phi Kappa Phi. 7 l -A NQQQQAX X6 A O ,R IL XXX mmxwmwxxxmmsisis .2 QW Z IZI Ig' I? If fl Z, QI Z 5 .2 I Ia I If II II 41 .VS I I Pb 96 P1 1. YJ' 'I EE E I I ly. I 5 lug .Q CEI iff' I'I I il S if 'Q is jx ss S E N s IS S N' E y I . 5 I D ov? A' 2,0 1' O V '--- f 61- f .321-1 R? 4 'I i Iiinag Gbxw-YQE i-Q--w -Y . - l ' 4 ' t--r 'N QI C A ' P b'7':'55 NN Ezifx'7'f'7J9?3'W-'Pkvrrfwrv-YN'c-aff,-.vig ui Ch l -'H ' - L-C:-:L r I ' .. F .. A , Q , , ' - X . . ,n Y w? Q .:--Una uv I I ' I - L iw - A as -. ' ' M. -f ..........I- f .. ' ' V' 'T ..-' - --. N. IA I - ,Q saw' - ' ' 2 gxv . w V I .' Y-:W Q ,P I .160 0 KLVY V , .bg 421 MQ Q' D ' + QS E 1 Q' 'Fi GQXYN X Q, e' lx 925W J- ' 1 e4. M l't T H E D L H f. Lf-. ' .aa - : . msmaannassas n -- :::'- ' -' :-' : :::-:: :::- -- .m' l ll'l'I 2i' -rr-'ra ':::x::':':':x:'x::.'. ::r.r:mr '::::-:. ,:f1i......,.s.: -11' 1 l ' .- f S ., 'Qi' w M I x -. ,. .1 21 - - Y, 5' if 1 -, . , 1-'ww X- - ' 0 01, Fw ,W 1 Q., ff. '- ., . .,. : . - , . 2.-.5 ' -:..:..:,.C. '.f M . ul -,N---x -'.1, ..,: - H F'--L., V' . l' ,-1' V M Y - -.15 3 7 -W H z ' .2 ' -ff' ' Af .-3' ei: i'.:L'Y'4k - H'-134-:lr ..-1 '21 H-R ' ' '-- '. ...-u-, -5 ' 2' -' i ' ln' Egltillllilfll ll ll llnlIIllIIlilllllillllllllllllllllilll lllnlilllhll ll xl Lin nz l. Nitin intl 1 1 u lnhfxtlllIIllIlill-IllIIIIIIIUHIIIHI--!'n'-in I-'tvlnvhlA--nnnlunxxluumnmlunm-'nm-'-w-yn-mana---qnpnq,qwmq'n1nn'l11Iuun1l Ellllllllln iii 'Lg Egglusla: ' 'rn i 1. In-,, r I ll' I lylli 5 . l , 'HL lu if z , ,M ind 'mi l. 'ft -is ..... ' -- rw , . menu-n... . mmznesruunsnm I uznsuuaa m..u x..uuxn.u::xxxxxm..n -xanax . sa r : : 1 ............. ......... .r...i... . ......... ... .. .... . . .... . w 9 ' IIE? s N N I s Q X S E Q t s 1 is Ya liar ll, I 'Ji' l lls, ' :grail ll 4 Y llil va 1 l l 1 If if xiii 1 il. at ,Zi 14 fl I .il 9 f Q 4 fi 4 4 9 4 if 4 Bachelors of Science in Engineering Chemistry VVILLIAINI HENRY EMERSON, PH.D., Sc.D. Professor GERALD EUSTLER ARMENTROUT, II K 'IP J0lmny Fish Augusta, Georgia Little but loud could not be more aptly applied than to the gentleman here presented to view. Johnny fears neither man nor devil and will tell you so any time you wish to know it. Though weigh- ing less than 15-O pounds, our hero has stuck with the football squad four years, making his well-de- served letter in his senior year. Phi Kappa Phi, Anak, Koseme, TiO2, Emerson Chemical Society, Vice-President, '22-'23, Honor Roll, '20, T Club, Scrub Football, '19, '20, '21, Varsity, '22, Asst. Manager, Baseball, '21, '22, Man- ager, '23. EDGAR ROGER ATCHISON, JR., II K qs Count Tullahoma, Tennessee Roger is one of those quiet manly sort of males so rarely seen in these days of tea-hounds and flap- pers. The inside dope has it that the Count is quite a lady-killer, especially when arrayed in his uniform and Sam Browne belt. A skin you love to touch. To be the best Mining Engineer in Coffee County, Tennessee. Emerson Chemical Society, TiO2, Technique, '19- '20, Barrage, '22-'23, Honor Roll, '20, Scabbard and lgiade, R., O. T. C., Captain, '21-'22, Lieut.-Col.. ' -'23. GEORGE PRESCOTT BARTLETT, fb 2 K Ccm'b0na Atlanta, Georgia This atom of the senior chemical molecule is noted for his ability to digest everything in sight on the Low Temperature Carbonization of Coal. Despite the fact that appearances are against him, 'and he has a distinct tendency to string his gum while chewing, he has the ability to produce in a way which will undoubtedly make him a successful engineer. Blue Print, '22, Senior Editor, '23, Technique As- soc. Ed., '22-'23, Emerson Chemical Society, Tech High Club, Tech De Molay Club, Honor Roll, '20- '21-'22, Phi Kappa Phi, Pi Delta Epsilon, Scholar- ship HT . I fit. X . If 'Q S e 'Q 2: . 5 N : 'e 2 1 3 2 '54 1 Sh.-1 5' '1 'Fw 'E' Y O'- ofs , 4 U , I l Idlllq 'i Hi W X 51 5: N, it x Q 2 5 , K C' lf V y,MWMawwmwmmmfMwmWm Jw 'B off QL IU Ii E..-O Lvv Af of OX S' 486520 H ' 4' ' LW I5 ..,,n Gio , RQ' 5.251225 ir' fp ---- - ' ' ' ' i '-. 'ig f'1g'j - ,-74-W,We-'?9'?iQ:..E,.49,11 .. ,, Qi, . O? ,Ng -' A ., V G ' Q -x 15 fa . -f. L - ' , . ' ' if X, , ,g,gg,1gEj-- i 'jg r,,'gl2wV -.i,,,,::-- W U - - L . Lzong ,. 'f T-enxlbx ,' '.o'v' --'?f'L,5 fi, , J if , ' L Y ,,j4.,.-J HO, , .,, ,f, I A, 3 'I yi . .' x ir! v, ,ani v w '- ,. , L., r.- , , r. 5: It ff, i 4. x 1 3 ,A -1 Reb? V I E X r S . i 'wgg i A -. by 1 AQ Y fgixfli XX LN!-C-f-29259 x - - .... .... , .... T ........... -f-'--- A P 11,1 Eh ! H B -- -I--' -- r: ''z''rn'-ns1::r:::::nr:'-lax::::::x:::n:z::::::u::::::::::: z. .-. ..- ...... awk, ,,,,,, . ,,,,,4,,,x,,,,,v,,,,,,,,,., L ,,.. - ....,, v...,.. - . WW.-,,,.a .ma ,ag:ang---im.-:mn:a::::::'-2222H221:mf-'ff'--- '' ' fx if M ratify sw. 1 y Q34-qty'- 7-rf'-f'-f----1-we A rf- 'YY- 5 i - A A - il 5 iii? ' EQ ,, ff f I. I HOMER PARK BOND, A 2 rr Z y ,L Ho1'sep0we1 ' 'l if 5 3 li n eor ia :lf sr, ta, G g dl f i Behold! The Sleeping Beauty! . This boy's chief X l K il occupation is sleeping, his chief diversion studying. 74, lg It is our prediction that some day some young lady 9' li will wake him up and then he will set the world mf? y afire. Perhaps he has already found Her, else, why 2 QQ, 3 the beautiful moustache? , gi Vyfifgll K, 1 A - Emerson Chemical Society5,Honor Roll, '2-Og Com- 'pany Football, '19, ,QOQ 521-5 Company Baseball, '20, A '21, '22g Captain of Ordnance, R. O. T. C. C25 I 5:24 Q. 541 l 'f 52 u Mgggw CWALTER, M. BRANCH, 1' tr A lxlizfj' ' Q f'T'weesda1 'hifi L ,sq ,I I 4, J V l 9,4 lf 5. Cedartown, Georgia 'wffju W' iff ig A I . . 1. lygjigi 5, This noble descendant of the ancient alchemists is 'QW , . , i one of the quieter members of the H2S inhalers. 1. Vp Nevertheless, he and his motorcycle have been far- famed and his frequent absences have usually been Fjqgl lg traced to motor trouble. It has been rumored that the cause of his trouble was due to Walter attempt- i owl 1' ing to run it on his new compound, 'fH2NO3. 1 , ,- 'rl Emerson Chemical Society. tl , in 1- luv' lf - ' iq, . if ' 35 .zl 1- 15' 'IWI ' I 3 1 Y' ,, Ex - ALVIN L. cHAsoN i v 'B A .Q UAF' Chase gl iv Colquitt, Georgia, lg Chase-on is one of the best-liked members of ' :I the chemists that hold forth every afternoon in the :- W -I fl back lab. Ali, served with Uncle Sam during the rg late war, .but entered Tech later and is one of the 2,31 V ybest.men in the lab. By his extensive researches he S V3.1 1, In has earned for himself the well ,deserved title, The Q glflil Great Peanut Chemist? ,jifiji 2 ,S Emerson Chemical Society. an-1 -E1-' I llff' 5i.sf,r - QQ is lil gi 34339 fi A llfill 5 J. IQIEUSTIS CLARK, 1- T A , y itil, Q Useless i fngzfi li? I Birmingham Alabama N pfEgE:3' E .' A ' A IE ga ,This yolfngfnan WHS b01'H, 1'aised, and educated N 5 Q cd' In B11'I'f11flgl12im. Clark states that his chief ii INIIIJOSC fu hvmg IS to live up to his nickname, but l FH? A Sucha 80QCl student and eificient analyst is bound M A to piove him If . tion i tl se .more than useful to some corpora- ,EQ E fl ieccoming years. X, mefson iemical societv- Phi K1 Q Phi- H sl ,gg Roll, '20, '21 ' ' 'PP' A 'mor S li: , ' S ' 'lT7F!l3'1. -cf -aww. :fr ,Ia ,wa 317 .x N LW' N Hliig V 'S D sip' L30 S ki - C1 ..a s,O v. bW?fhkk X ' xl - P Y bil :1 ' 5 Q El i R ' . a:S5B:K-.:.::Q::.5:: X:-. x e,.-N,.,,.,,,,.,A:,5,.,:Q gf 1, Qn M Q? -A Qgil - ' :' 7- H ' lf 'ax' - VNS' f-x f YY Y A Tis wil ..-L -. K' cf y XNYNQ-hh-i?xRXxQ:.Q do Q T!! TV YT lux TALK ,V SZ a 2 5 5 i .gr 1 42 bf 'fi ' M E4 3 Qui OR' 'L,7,.J XJXQQ-f 1' . Ill an Q, um lllllgll u nuuuus ii-3 5541: .,..... . . .. - L: X lllllmu-mam ---- h.lm..m-1--1., ..,.,. mmmm-m-.-ul v-f-. uumunu-.-.'....i. .--, ...vi ..-.. xllffl ' --1-----x---.---f-.'v- Am ., - mm- -n..-. .,-f,,.. f -1.'..,.....1, .1 nusn,1,E qwpqwE 'xxx I :vig ll 5 T H D LV E, P ILI 'E---- - a ------ -IHHHIIRIHSIIU-121165- l?' ' - .....: --' - - x::svmm:ux::xx1'.1u:x:::::::::Lrx::::a: .. A w:..-.:'..'::x: ::x-'.:.:',::.-r.:.':::r.::::::mama:m:r::a:'.::::::x::::.::::::::.'::::::::m::::::::n ...... ..... ,. :iia .... .-3 - 1 is if gg l 12 H WILLIAM EDWARD DIMMOCK, II K 4. ', is Bill Dilly S Augusta, Georgia S This individual is a quiet sort of being, origin Si gg unknown, destination equally unknown. The rec- E gig ords have it that the Academy of Richmond County S f 21 prepared him for the higher education. Dilly is Q , X 'V a likeable sort of chap and will make a success of Q - anything he attempts. I ,. dil, my Emerson Chemical Society. Q il ,V ROBERT HENLEY HUTCHESON 5 Hutclz N I Douglasville, Georgia . A , 5 Every morning, rain or shine, Hutch can be seen N1 q 52 ' swinging off the local train from Douglasville down 2 on Marietta Street. He is quite the best distiller . . known, always having some distilling apparatus set 2 iii up on his desk. He intends to become a distillation ' if 5 engineer. QNote: He confines his work to oil distilla- y ' , tion, e. g., peanut oil, cocoanut oil, alcohoil, etc.j gg Emerson Chemical Society. l limb, Gila' ' E. CALHOUN EMMETT MINCHENER , ffmnclw HP,-ofa Atlanta, Georgia ,Qui Minch believes in announcing his arrival. At least, , 4 his number elevens will hardly allow him to approach QP ' ' p silently. He has gained fame as a physics teacher Hi ll fProf. Genz said soj and as a ladies' man Q Prof W Minchener said soj. However, Calhoun usually in- ' troduces himself as Mr, Minchister, of the Gover- H A nor's Horse Guard, a fact of which he is very 5 55 proud. if Emerson Chemical Society, Tech High Clubg stu- 2 dent Volunteers Bandg Blue Ridge Delegation, '21. Z LESLIE CORNELIUS PRITCHETT 2 Z Elsie Z Atlanta, Georgia Z H This boy, probably the smallest one seen land 'Z heardj up in the lab, is always on the job and work- ' . V ing hard. He has done some mighty fine work in Z the past four years, entering Tech from Tech High Z in '19. Elsie had the honor to be elected to Phi Z Kappa Phi on account of his excellent work, and Z he is very proud of his key. Z Emerson Chemical Society, Phi Kappa Phi. f 7 Z V D Q,oE'3:5'gSqQ2 O .E WE g , ..., W 0 ' ' aiilmyf 4, ka li lzhxm' Q 4- Y, 7 ZX cg3f19affw nmffyffff1pfps'f99Q7vmqwewswmwvfffffw Q K Jones. K- V Y YA W ii-' ml 5 W . '-nCT!i.'4i ,'5d? ' I In L Y , .W Yvv,,, -I ,AQ-U.: To ,?q: ':L-Vg-rf fi slabs? 1 A fluff. V ' ' 'A '. gh. I f 1 ,AH .ff ii 1.1926 'A 'GC'-MAX X Q sk .,.,. , :G ,.., '- - H' ': ::1':,,E,siH+-1' - fr ii is W D . . . T. WALLACE QUINN, E X NT. WalIie Atlanta, Georgia The mystery of the twentieth century Centers in the riddle as to what the T ifl Qllimlls name 1'ea11Y stands for. The ladies will no doubt say it stands fgr Terrible , due to his heart-breaking abilities. However, his fellow chemists will tell you in strict- est confidence that it honestly means Titrate, which is what Wallie doesn't do nothing else but. He was born in Macon in 14,92 QA. DJ. Emerson Chemical Society, Technique, '18, Blue Print, '22, Freshman Oratorical Contest, '19. CHARLES WALKER SAUSSY, JR., X111 . Savannah, Georgia Walker is a,big-hearted cheerful individual and is quite popular among those with whom he is thrown in contact. He always enjoys a good joke, and the old Chemical Building has rocked many times to the tune of his loud laughter. C. W. finds time between his lab hours and study hours to swim at the cen- tral Y and has become quite a fresh-water shark. Emerson Chemical Society, Cotillion Club, Marion- ettes, Captain, Swimming Team, '23, Second Lieu- tenant, R. O.. T., C., Pan-Hellenic Council, '23. WILLIAM HARRY. VAUGHAN, JR., B 9 II p V D1'agline Clarksdale, Mississippi It has been said that good things come in small packages and here is living proof of it. Any in- dividual with so much self-confidence and self-pos- session coupled with practical knowledge and lack pf -conceit is sure to make his mark in the world. fl11S is said, not because of, but despite the fact that .he is ye humble editor. . Phi Kappa Phi, Pi Delta Epsilon, Technique, '18- l95 Blue Pfillt, 719, '21, Asst. Editor, '22, Editor- m'Ch1Cf, '235 Captain, R. O. T. C., President, Emer- son Chemical Society, Honor Roll, '19, '21, '22, Scholarship Gold T , Glee Club, '23, Y. M. C. A. Friendship Council, TiO2. BERTK HARDEN WELLS, A 2, qs ff-Red!! K l Kissimmee, Florida Here is Exhibit A in the Lau 73 Known to the world at large as g:l?PiinIlgeEJlh,i? 912232 and to the fairer sex as my Kissimmee Kids, Bert ffm always be f011nd with a jolly radiant beam on ns face. As a bass horn tooter Red is Su r bar none. ' P eme, Emerson Chemical S ' tv. , , Cabtain in the Band, 5 , Band, 319, 20' ,212 ,235 5 o Cb' ff' ig 'Log-'w h' V -o f 1, ' ' 'iiiizaw ,qmgu Q 3' 5 - -vi : ...... i A V fffg-.5 A -- L c L A I ' '6 1 D A-3 V ' 0 Yi. X llvy -I 1 l limi . 'NL L. ,MXTNY uric.. 41' . ,tmi....EC,:.if.Lw px - 71 4-' 1 'T gn-1 X ,TY VN is-X it H5227 it , I ,,f4?e1sx. 1? il PYW'v'1 km13i'3'i'! P' K - X XA S- N - 1-Ks-hw' 'WJ fx!! fl - 'vu mmm?-ff.54 X' 5E3mmWlxii1fiQ' 'Frgr5rqw:Q.nii1i'rtramimi'nimirm .miuizmtivinniwxiirvuiinmnn.unlibfuimnmiiggsxrr 'Aw P' fKD LI:iELnr.... ff ' X? Ti-'EHQFPPTW ..iLLz, 'V my ' -Q. - -1 - .f-X- . A- , ., W, , ,, ,, , ,W .Sk Y, ,efw-1 ,,,.,'-9::1rf1g,q2 :Q if 1. wi. im ,V in in it lr hi if L... , i , ,, i , .--fm , . , , it 9231 'ei Q1 ll JM-L I- ' 1 i 4- r lm, lil 1? Q li .,' T-xx , l l 5 f 3 l Z B. JOSEPH EISEMAN, 113 E II y -N f'Ic'eman 1 g i Atlanta, Georgia :X R . 1 N. Q N S S S Q 5 S Qc . 'Q 2:- 90 x . fi 5' 1 x w . so fo I A ez ,,,,l!a hx 1 .1 -Em D 4 .4 4 i L L .I 'Illllv 1 xl l bi IEE! , Joe enjoys the distinction of having gone through Tech High and Georgia Tech in three years each, or a total of six years. He expects to get his B.S. degree and diploma next June A as a birthday present, Commencement preceding his seventeenth birthday about ten days. Joe's hobby and life is chemistry. He is also quite a tennis shark. Emerson Chemical Society. I X, i.. I A ll -v Ty 'ir K Q1 - 1 VQW. l A' ' . ,i X W - i, l em H O99 2 l XV 5 Q6 , 5' be Z E f Q Z Q f K Z it f 5 s K ' 4' 0 C9 0 4 O I L X V 6 DQ-444 . 1 h ' Lis. -g W Qi W Y, ,,,A,,,A, V ,AL GL'-Q ialfmi' 9,5 E ' lgiiiii ,-. W -f - -f-- f- :Nh-Ai W: 933114wfff1 fWffygffffffmffnniiazfffziwfyyvyyf1fffffmsffqgggo S Q ' 1 ' ' l A V, , Q f -. A 0-. 'IR 'QM .iff lgqgg L- f . O ' H d L L x f Y Ji ' L no H e 1. ni Q f' 'Ti ITN , O',siii ' 1 Q. W .eo , my I .,. , -ax. 1' I X, W I.. ,l .,',.,x I ' W I 7 n ff U ' .-:Q-' N. ,f- I 4 . - '-, K JV.. . , IWZ5' -' .L A,-,pix I . -- It . A MS. ..m-Y ,A1-,M,,,............-im..................II mi V my f-',,.,. x:I,:-- r . '--' 121511: il-.--.:,:.:I:-nzzzzzzmz .- -I --. un? . -ff--11--.-m.-I--I-me ennuum - ? I gy! iii! -1 H E I D L - - --- ---x:.rns:sr:::::::::::nanunmsax::l:::l:::::::x::::: I Al ll.: i .......... - MI, -1- L,'A-45g,,Av ,.,.,'v,,,,A... ,,,..,',,-,A,,,,,, , f ,,,.,.,-,,, A ,,,,W...-+-, :,:,:::ww::::vL1HHf42f-m'f f'f---'ni' ' ' ,WI ,f,QX'I 1 IMI' ' tQ,II T IKIIE 'Ii:-'II IMI W L., -fi .fi NEI, I 4, I .-1 I I ff, 1, :gi I:5fEiI IIEIII IIEII In ,1 II IQ. I I I I I I1 I 533 ll, .3. I I 4 .AI I I II :PI fl II I'4f I I. I..,I II 'Z-if'I I. ,MI VI I,I1'1i'I I II Iii -III, ,,.gf,, .4-I 11551 2,1 I0 ,AI If' 7- 'I I IL i It:-L IQ-N, F!! If al IGI III I Q I ,I I S II Iii? Ia. I .4 1 Itfzll EE. I 1211 It I I .N 1 -51' I 'SIM PJ,-I IN, Iwgh ,IRI 'I III I IIS, I E11 IIEXEI ,NNI I IIRQI .IIQQI Bachelors of Science in ArCI'1itCCtU1'e I ' -mzannfrfmzz v-'jf fix' r 1 't !, gn , fi' fttiifrsi If 1 A15 Q- x. A 4 -xgyzmg, . 41 Q ' -, -. ,v..A,.. , ..., g I, I I, 3 i-.tI.'q4..1, Q2 Ii 1 I ' 4 '11 1- '3 , -I I . 1? 7, I . 5 . I .45 ' J' 15. V492 J In I li, , t1 F s b. I , 1 r : T'f f'f '? L A-4-vg,1':3'1'ef'.fm4rTL'-:if 'I. . - 1 ' Y ' JOHN LLEWEIQLYN SIKINNER, B.A.SC., M-ARC E V ,ggi M, .Y , , . .. I,-TI-,-1 gif.-L Q ., , ,Q ' -ff, fi H. Professor , I 1 RODERICK sToNE BRANTLEY, fr 2 K U1-Bad Cutie Boston, Georgia Here is Le danseur, Egyptienne supreme. His exhibition in Sneezer et Cleopatrick 1s.beyond de- scription, so likewise is his performance in the mod- ern dance halls. If Cutie learned all this in the city of Boston Qfieorgiaj, then all we have to .say is,I Lead us to Boston. We want to see his inspira- tion. 3 Marionettes '20, '21, '22, '23, Vice-President '22, Yellow J acket, '22, First Mention, Beaux Arts Com- petition. I - ' ' HARRY LACOSTE. ELLERBE, E 112 E . , EIurb ' Atlanta, Georgia Harry has made for himself anenviable record in Tech dramatic and literary circles. As LaCoste, he has contributed to the Yellow Jacket, and as author of Sneezer et Cleopatrick, he has also gain- ed fame. He has won for himself the title of All- American lady by his unsurpassable impersona- tion of 'feminine characters in the various Marion- ette performances. , Technique, '20, '21, '22, '23, Yellow Jacket, '22, '23, Assistant Editor, '23, Architectural Society, Marion- ettes, Board of Control, '22, President, '23, Presi- dent, Tech High Club, '21, Second Mention, Beaux IArts Competition, Pi Delta Epsilon. ' I JOHN BELL GILL, JR., 2 qu E I Johnnie Statesville, North Carolina With age comes wisdom. This boy is rather quiet and therefore very popular, since he gives the other fellow thekchance to talk. He made one mistake in E55 y011th1.by starting in at North Carolina State, but T01 rea ized the error of his ways and came to ec . t 1'illow.Jack,et Staff, '22, '23, President, Architec- tiua SOCWIY, 234 HOHOI' R011, '19, '20, second Men- 10I1, Bcaux Arts Competition, Marionettes, '23, Qffiiqx. Z 2 2 Z f ? Z 6 6 ,4 6 ff' sq' Z 5 6 II. III il' L5. ,rr 'H vs -, .Q sh 4 R I S I I I .41 I I I-JL. LIU I N' III 5 3? :I s S 5 IS is E S E E S 'N gs, S B QI -Q .I ' 'I-4 I I ' - ,Ig , 'AN 'Y' -:::::fgu.. B 4.QQQYIN:-sr-es1ez1Qeaxx!3s:-:-sim-rf -. x x -rs:g.sq.g95g5-we-,,,g,f,g.,.g1 g I, 3' 1 F t L.::.gL K so IRQ-EI - , I I1 'II vu I: X f f x9mWWWN35?mWW'WNmmXmxxix ...kr . . . I to , i A I I L S XO O ' ' ' f 7 Y Y .af Qi' '. H . V 51 ' QI'-'J ' tE5iEi::.. 1 I .. 1 ,,, 13 . P-IQ V ax I 'Zig-1 oo swift L VV. D J 'ia m 2 . . .., ,....'f.fl1n ' 1925 .Q --' i -. X, , Y - Ne-a.,.,.,..ff I ll mmm unmmnumuunmmEthier, ,.... ,,,.., .azlgfm ,... ,,,, ,,,,m,,,:l,:,Siii!g-Eflgumggfhgggugiig u llE DLV E. P ILIN iitllllhiseii -.-. -.--as a:---.. -illliiiiIliIIIHXIEGIEIIXEFISGEESIIIIEEIIIISIIIBIFIEI HRHIlIlllilllillllllllllllllllllflilllliilIIEIIIIHIIIIIIIIIIIllIII!!llIll!!IIlIIlIIll2l:I:7lIIIiil!'p2II1iIIYIZTJITFIIIIIIIIFHIIIIFHIIIF nuJ5FIIHIlIE5m3:!3I:ZIl5IlF:5l::IlHI' -uhm.. v N it N ' 'S y' IVER HENRY GRANATH, A K X w A Lord Knoclcemoyfv g Atlanta, Georgia Here we have a youth imbibed with the spirit of -the poets and bards of old. Last .summer Iver T Henry became inspired and brought forth the new S' Alma Mater song, which is beyond doubt the finest Alma Mater song a college ever had anywhere. Also .Q under the name of Lord Knockemoff, he has been ., the chief prop and contributor to the new Tech Q cemie, the Yellow Jacket. A Marionettes, Technique, '20, '21-' '22, Staif Poet, Q. '22-23, Tornado, '21, Yellow Jacket, Assistant Edi- tor, '2l, Editor, '22, Pi ,Delta Epsilon, Tech High ' Club. A Q . VVALTER PERCIVAL GRAYDON , . A ' Percy C N Atlanta, Georgia Here is a big fellow to be so young and shy. Percy is inclined to be quiet Csomehow all these 0 , architects seem to be quiet-maybe they think it is I ' in keeping with the dignity of their professionj. 4 Walter has done some good work up in the drawing it h hall and received a Beauxe Arts Mention in his V J gn Junior year as well as one in his Senior year. VVe 'Qzfli wish him continued success and predict a bright fu- ,L ture for him. 2 t , Ski, Architectural Society, Mention, Beaux Arts Com- .ggi Q3 petition, '22, First Mention, '23, .Company Football, ,QR gig Tech High Club. jll i l l I LIONEL K. LEVY. 1 ' Killarney 115, Augusta, Georgia g Levy has the talent of an artist, but his only ' 'yi claim to the temperament is his desire to draw from W ' live models. Killarney has cornered the art work . on all three of the publications this year. He is a ti1'eless worker, contributing much to the showing f of the department in the Beaux Arts Exhibits. . Band, '21, '22, Glee Club, '22, '23, Marionettes, '23, Tornado, '21, Yellow Jacket, '22, '23, Art Edi- tor, '23, Technique, '22, '23, Art Editor, '23, Blue Print, '21, '22, '23 Art Editor '23, Pi Delta Epsilon, Augusta Club, Member B. A. I. D., Barrage Artist. Smyrna, Georgia 4 This scholar entered Tech back in the ante-bellum Q , days, but at the end of his freshman year joined the : ,Q Army engineers for two years, serving overseas for 2 ,Q nine months. He has made a splendid record since Z his return to Tech, and we all wish him the best in f 3 life. 52- Z f Z Z FRANK VVYATT MANNING 4 Z Z ,Q 4 ' Band '21, '22, '23' Yellow Jacket Art Stal? '22 V 23 Phi Kappa Phi Architectural Society Treas- urer, 21- 22' Honor Roll Student Supply Masonic Club- Marietta Club- Second Mention, Beaux Arts Competition. JCI, Q 4 Z , s a r S 9 A 4 ' 1 ' V5 f ' , X 7 9 . y . Z 7 5 . 9 f c If i 9 ' 4 7 l .- - e. ' 0 0' . O o R l ! I O9-4,-1 V L ,Ez .0' ifegj' WW, ,,,,,,,,, G Q -- , elf A l ' a . K ell T- e, v Y P 1 -1 ' Y V K . , -V 7 1 . , . V p - E Z , ,, Q Q . V s 1 . A X l 5 P - . A e '-' 'E .1-4 3 ' K P' . , MOH EL K e +xji5i,!g,,,-R 75 -- L oXi Q14fLu .type in 0 xQBxv . ff11f1 yn'ffyffff1fMnawpfffffffwfffy2Qfff9sffffff?9 Qo 1 5 0656 ,JO 're I 1 . n 1 1 l if l .4 .-1 ff tl. '- fn ' 'i t ll 'K' , ., X . C l 4 A 1 l ' 1 i li ls qi - ' ' 4' ' - ,,.w:.u.... . Q C - - . .- f 925 . , , . 'QS , :. : Q....aa:a:...::t my ..., mm f: - ' Tgi. .1 mlmmuwuuo-.nuwmu ' . Y 7 P A I , E73 l V' li I I I : D .... .......---1-1--1 ---- 'r:mx::n::::x:n:l::i::::: : .xrrm '- M ' -i g W V Y Y A.v'-w hw.-A A.Y'- mq,,,,,,,,, i-....i -- ,,,AV : '-.::.-zu:r::::az:-.I-:m::::::::::::::::::n... ...... x .......... .............. WEN' g d , iff!! I 5151 Z K H: Q. , h-iXTZ.1:i: ' ' i PVP: A 3 135 'I 1 ' LEE C. MCCLURE u A A 3 41711 U . Ffa V J. ac Fort Worth, Texas ' if Old Mac is one of those brawny heavy-set fellows i E lg Q that hail from the Lone Star'State. He has a. broad, 6 55? appealing grin that he quite frequently, dlsplays- 4 3 which partly accounts for the many frieridsrthat E- 1. he has in school. Prior to Mads entrance 1n.I'6Clj, QE, 53 ll ti? f he lent a helping hand to Uncle Sam .and did his A share of the fighting, at one time having been on 1 ff . - gg fi ff the casualty lists. ' I . 3 Architectural Society, Honor Roll, First Mention, 3 Beaux Arts Competition. E? 2 f 5:2 ii . s , , f'- ,PENROSE TERRETT 'lEAGUE, L C12 ' ffpaeff J. Kgggiii, Augusta, Georgia y ,lim Augusta and similarly the Academy of Richmond 4 -li' Q County are here represented by no less a personage P4 H r than Pete Teague. Pete is a quiet, unassuming boy, -Q, Q but though he doesn't always say how much he is 4. 4 is F. lil ll l.'-Q. ES- ! 9-:I ' . l 'J l '4 I 'fr I c l 'I WE! k C-:A v 5:1 s . E311 1 '- 1 li? 1 'L r L. li' lg j x 1-' li 153 HE: I5 ,. IC . i in V doing, he can nearly always be found to be right there with the next one on any architectural work. Architectural Society, Augusta Club. HOYVARD RAYMOND WEEKS Willie 'fRosette I Abbeville, South Carolina VVee Willie Weeks belongs to the heavyweight class. Like most of our 'stout cousins, Willie is quite a jolly individual. He is ,trying to oust Santa Claus from his time-honored job. Like Santa, He has a red nose and a little round belly, That shakes when he laughs like a bowlful of jelly. Architectural Societyg Second Lieutenant, '21, Major, '23, R. O. T. C., Second Mention, Beaux Arts Competition. V Fl . .9 r eg if 1 .1 , i' 1, 6 , ,y .2 fl H 'f E if .' 'v J - , . 'I Z, 3f iV 'if' f.-:fe , 1 L V if .YM ,H ,inf -f ' ..1r13ffs.,1 Q, . - - xxx, 1 -.vu M N. - p. A 1... Asn 7, 3 mf., -15 - -f'gage.is-4..:i:.22Lp:,:4.4',:1-gr: ,... -gt..4s.s. fml,i lmtxznn. we 'fl 'A 'wg' -if 2 S ou, any i ox SCWO P1 ...al of s W l l t l 5 ' , -lm- UU 1 + Ni ll W 4 'N N. is 1 S N. S Q Q E is Q- s S S K I LLXN -'Fr F , i l l i 2 1 1 i 5. x s S is Q E Q 'X S S S s A U - l 0 rf ' P i ' ' Q' Q ' Q O ' i kg K Y , Q . ,,.. ..1zrEi?u nfcifl 1 25, C ilxo sq! , f- . , ' '---if V: -H 'sz2sassg:...f--A ..P 1, xx'-K'3ix.,m.'s:25.'1:m .s-.xx..-.,..,r1..Pfef:a.....,.x..xxxsofxw:-.r?vf,af,-:,,,.QSO I 4 . . g ,S 1 L V. K D . X- ...L 0 G , , Q , mmxwsmmxxwmxQwQxwmxX LLOr.5L K, Q -f L-:ngigii iv ' 'LJ g g Q -::m::::u I . 9 , - :ill ..-.L Q Q Higgs- I Y I 4- Y . s A- -,1- ,V ,gr G l S E' C ,ff q , Hx S X .4-2 an X 1 ., in 192 Ti .:, ., . . 2 will sv . 9 2 .. X 'l kwamil . v .- ll- N A 'mm 4 ii- ulllfpz. I3 1- . lllverupl .xazfffzl NIJ yr rnu mmun nxxvn u immT. . n nnniuuu -ii.-....fI,.u'i.5fKX1Q-i......,..,.,..,..i..i ummm-i..-.3i'l.1hm ,. -,..1'Jf':. ,.s.............-.........I...EA:QQ...'.sa:n:...:,R..h', g,?i',l.n..........m..:..m.mm qmqmw. muh.. s. if' W F it P ILI N 'l' - --::. . WN 3, 55,5 G ii,qin.aiEa....,.. .... .. . uauam nm W- ' ll ull Il an in ra an::::::::::::::::::x:::::::::::.':::::::::::::::::::::: 1::z::::::::nsnnnlisr:nu::::nz::mnI:1:m:::::m:l:::::::::H:::az::::::::::::::::::::::::::::i ,. .... .... - -, ii, ......,. tb 1 , 4 o ,o ' 3 9 f 7 f 4 x '7 f 9 5 4 5 f Livv ' X 71-Ju. ,,.-fic O O If Bachelors of Science 1n Commerce JOHN BIADISON VVATTERS, B.S., B.S.C., L.L.B., M.Acc'rs. Professor g DAVID IRENUS BARRON, 2 A E Red . Clarksville, Georgia 'tThe man unconquerable is Clarksville's chief -. claim to glory. Red is the type of man that pos- :, , sesses all those admirable qualities that make and If keep friends. He is the possessor of a sterling char- acter and always uses his influence with his fellow students to seek and attain the highest standards of . life. ' if Ambition: Fulfilled Thanksgiving night. ' Football, '18, '19, '20, '21, '22, Captain, '22, Base- ball, '19, '20, '22, Captain, '22, Track, '20, '21, '22, '23, Marionettes, President, Athletic Associa- tion, '22, '23, Vice-President, Student Association, '22, Vice-President, Student Council, '23, President, ,d Freshman Class, Honor Court, '19, '20, '21, Secre- v l tary, Junior Class, Y. M. C. A. Cabinet, '18, '19, HC L '20, '21, '22, Koseme, Bulldog, Anak, Delta Sigma L Q Q., Pi. 'p 1 JOHN EDWIN Brees, JR., X qw i i Hjiggsu ' K-'Il: ' Bramwell, VV est Virginia lullflj Witli the g and S left Off of his Christian lg , l b name, Biggs would be fairly well described. After ' I l l entering Tech he met Dean Vlfatters, and finding lm' ' that he would have plenty of time to pursue his .uit main activities unhindered if he took Commerce, C they struck up a bargain. With all sails set and ' Ei fi plenty of fuel in the bunkers he can turn out some In if wicked stuff in the literary line. A ' Ambition: To graduate. -. Technique Staff, '19, '20, '21, Editor, Yellow Jacket, '21, Cotillion Club, Alpha Kappa Psi, Pi Delta Epsilon. S 'l NATHAN ATKINSON BROVVN, JR., II A A 1 .' Na Columbus, Georgia 2 The Columbus Enquirer-Sun on Julie 6th, 1901, Z was notable in that it mentioned the birth of Na S Z the day before. This youth soon developed into one S 56, of those versatile chaps who conquer all fields of ' Z love and finance with equal ease. After demon- 2 strating his efficiency in the finer art to the 2 belles of the village, he came to Tech seeking new 'f fields to conquer. A moonlight night, a girl, some W Beechnut, a porch swing and Na. is in his seventh A heaven of delight. I Advertising Staff, Technique, Editorial Staff, Blue Print, Columbus Club, American Legion, Tech Aero Squadron, Shewbow Squad, Oowah Club, Yel- 9 low Jacket. , O Q,g.4 ' 5 'f? l o v Ni 1' j se ....... , 0 zsfisisf' '1 '+ O e X' o23BfxfyW0Mf9sff1f:fffy,o.vW49f ' Hfffxf V ' 3 if L. I , - , . . L . . Q M- , 1 2 -A E Lionel. ne Q '55iigg fl' - O',,!5?P ' ' e ,4 Hfo x8 -Zia qt iC? iX -III ,tw I Hu ai! .,,l ai? ILIII I Ig:- I .- EI I - ,-Teva qw, .. . L , . ..f 2 sg--- , X fvviyl ll -.a l i uuIIIII a 35Q .,-.I.fd. .. -..... ....-Ernie.: iiliiii iiiaini- 2 L hu?i::i.1-In--I-mll1::T'5 4 11, VI ga:-1Q2I5z.,I' 5 Q: All -ni., .--- L P W V! I L I I I I III III .Ia . - w rl' Y -I - ---I-::x:::::'-1 ..::::::::. -:.'::.-a' .Azusa-::::::I: -1.x::m::::Ima::II::::xmn::::::::::::u:r.:u:::s:::::zz. ..-.- -.---- - -- I f l ,.,.., L , 4 , ,,, I ,. E ,, , Q A ,. L ,,. ,,. U. A,,. A - .. If A-A if I 'ff' III! I ' WILLIAM BONEY CARR, H K A I H f sz ' f Ball I6 Bainbridge, Georgia 'ffl' 1 ' ' ' but early I Fa' B'11,' was born at Caesar, M1SS1SS1pp1s ,I in lifle chose Bainbridge as his home. Here he hlad Ig his first experience as a modern heart smafiher' IS line creating havoc with the hearts of the-fall' ESX dn that beautiful little city. Bill and his l1ne na 52 came to Tech after two uneventful years spent a 5 If fd . , . .1 Dzglesoglub, Quartetteg Pan-Hellenic Co'unc1lSPC0' Zi tillion Club, Honor Holl, ,2.1',-223 Delta Sigma 1' T if I IIEQI WILLIAM BYRON COHEN, fr E H I f 'I I HBIIV, I5 I I Norton, Virginia IF ,' II I-Ie of the cheery smile and complete understand- ,If In ing of Irprofsv was born among the heat producing Q I' 5' hills of Virginia in the village of Norton on QC- II! I Ii, Ioriei- 15th, 1902. Riu is 3, disciple of the late William I'f.1?II Tell and on several occasions he has presented the IRIN! teachers with large red apples by which means he . 4. rfflfff' hopes to save his grades as theulate W. T. saved :ini his son,s life. . E Ambition: 'STO be a Pawnbrokerf' HIIE' I I ' gi-, . swf. I-EI I . I II' I II I THOMAS RICKENBACKER CULLER. I f Iii Cameron, South Carolina Tom says that he has an ambition, but so far he seems to have kept it a secret. Anyway, the II Y' profs say that he doesn't seem to demonstrate any IE, ambition in his studies with the exception of insur- ance. In this he ranks supreme, being one of the S iff 'ibig threef' We freely predict that Tom will con- X I., quer Cameron without a struggle when he finishes S Iggi Tech. I p - I S iff? Captain and Adjutant Fourth Battalion, Oowah Club, Shewbow Squad. I I . si + .I:1:I I A F E552 A ERROLL RCKFORD, 2 X E I V nejoeu S I ' Atlanta, Georgia ' 3 Joe', is one of those likeable chaps, who has that - I rare. faculty of making friends with everyone. Early S Iii in life he discovered that he and basketball were 'EI the best of friends and hence soon developed into one of the best centers that Tech has so far produced. S , Freshman Basketball, 321, Val-sity Baslietball, 722. S 23, Cotillion Club, Delta Sigma Pi. Iii? IIEI I NL frxid Z H X I - S I . sc x I o tpf- -QJYOX 5 .D 4 , on ' eq rg . - I I , wi.. . 1 I . I I I '--'- e L ' 214 A Q kg,9,2399?-f-WTKWB:-:2:S:2ff.f-wras-Q-zs5QEQn.sI,1:,:9p.,.,M.m,9g,,.,5,,,,UMWI-if Ei V13 ' V C W if W' A 5 . I I.:-. i L ,, f . Q , dm 3 HI , fi gogemsf 'gmtWf2i99Q2sXKf32szs:Q911Qgixx5xg5gQQ,x,xQRQQQXQQOI f' - -mai? X, N Ln. ml rc ,T-ul: . . . --- . ,Ki ., . -A-- A . - , ' faire U ' - .1 L .f 5 r Lx' v C ' - .., o S Xt OX 9444 x5 5: I I I . . FB. 'PQI E sit .H IIE IQ 'QIXNXYYKVXK I I 5 . I . I I III I I II .9 3 f f IZ I 4 Z I ,a 3 I I II I II . III III' I -I I 'I I. IL' I Iii 'WI II I IL ji 5 3 I ' Q IE! I . z... a Y ll I I I I I I . ' I N ISN It I IIg7' I IRI bi I. 'I IE I IIE. I IIN' I I III I IX I I I I I I 'II 'I I II I i W a I 1. '.: . ,Q ,Q ...-er 'J N E. gk x x l Z ,1 f ,lv , ,-H, . g., J . ggg'g5illSmm'i:nngL Kmaxxaux nm ll u I! Iulluunixmuuiiilhif:in-Irma '1 E?f h,,,,,,,,,,,,,,::,f'hh ,,,.,,,7'j: f,: ,,,,, E,b:l:,,,l, uQfQ d s 1, nz., ' -' ' ' ' ' ' F' ' f1 rlvv n- Irnnz:e-x1u::r:sr-rx:unxnn 1 mm S. ,.,.,,5iiEgmE25Juqmaillea! Q T .rw T I-I E' - ------ 'H ' n ' '-' ' him'iiiimimmiif-FmiiilaiiiiliIma:!::::::u--:eau-'-un .. . .::n::::::::x:::.::::::::.::::::::::::::::::x::: :'::::: - - :uan:::::n.1::a:n::::::::::::::::n1 :m.::::::u::z:::::: ...... .- git... - - lf' ' H fl JAMES THOMAS EDWARDS, JR. ' Tobe J Fayetteville, Georgia Fayetteville has produced many famous baseball players, but they will not produce as good a first baseman as Tobe in the next hundred years. He has scrubbed hard on three different teams, but found his own on the baseball team. The American ., League will indeed be lucky when Tobe decides to ago upiss 3 Ambition: To lead the American League in hit- Q ting. Scrub Football, '19, '21, Baseball, '18, '22, Scrub Basketball, Anak, Delta Sigma Pi. 2: I W LIONEL JOSEPH GASSEN, A 2 'IJ Sulphur, Louisiana ' A f - Kitty - i Kitty hopes that he will not be so close to brimstone Q 1 , in his after life as he has been since 1901. He is i I :M . fad Y ll 2 P4 ' A , -fill u- 4 I Ps il 'hill wg? mud, WE DEI Y l rs VY 3 1 I Sf 9 .4 Q z 5 Z X 9 4 4 .9 4 7 6 .4 9 v I mainly noted on the campus as the Uncle Gus of the Delta Sigma Phi's andlhis ability at wielding the big stick and high finance. Demure but un- erring with the ladies. Ambition: Making money make money. Baseball, '21, '22, Louisiana Club, Honor Roll, '21, Delta Sigma Pi. CALVIN EUSTACE GIBSON Ulm Thomasville, Georgia If the ladies will give him enough spare time, we predict a great future for this handsome personali- ty. He was born on Independence Day, 1899, and we hope that he will be 'able to enjoy his independ- ence for a few more weeks before he takes the final plunge. Prepped at Norman Institute. EDVVARD EVERETT GOODLOE, JR., A E KP Bijou Big Stone Gap, Virginia . This patronizer of the Bijou first developed his theatrical inclination at Big Stone Gap on March 18th, 1901. He prepped at the local High and de- cided to become a connoisseur of theatrical produc- tions and the commercial world, so he came to At- lanta and Tech to develop his talents. The sudden demise of the Bijou somewhat curtailed his activi- ties along theatrical lines but latest reports are that he has reformed and is now a regular attendant of the Bonita. -if of ,X sa lil! 'N 0 'Nj rf 'Q Eli .r. ..- .- o 1 ,,. ' . . , 16+ H H i Q. L lIlll:I will U13 V, N. lx l , Q s , E 2 . 5 V 'J A, .V 7 0 JR0 jo + i.'A 'iS'!Qc4 O :QQ dll, wo 4 I ! wig , rw ll JL .41 ..,.... .1 . f' .rzzifififl 0, J ' N 1 Q11 - . 9 YM VY Y VY M '?m-.br Y ' ' U - 3 V KL F I X ,X ' Fyfffff1w ffyfffWffwHUffffffffffwfgswvfnffffffxg KE z ,, A I L . X Z Mc .. V V' 94' . - f f - -- . . . .. '1'm - 1 'J Q' . ..:..:- , ' ' ' ' LLO rl 5 L K. Q il' Q Nj A .5'EE5?: a 0 L V ' rv. ' , - I o ' 'A' ? 1 0 Honor Roll, '20, '21, '22, Phi Kappa Phig Phi fI .gf C :Qi 'J 4, Y'-5 af II H925 F :-., I s t h ,,,, --11--f---- A--1 ---f E 'ml . . 2,553 mx ummnlmowmvmwuuumnnwmmaoumnmn-If wr--ff-I I II v R P ILI a Jie. :I V V A .... ...... .... ..... - ...... .. ----- gn1:II::::::umu::::::::x::: : '- :::::::::::l:::::::::::: . '... ...--f- - 512 ' ' 'I I 11 Uvg- -W vw w mv g, 1m,,,,,,,m,,,,,,,,,,mm:::::::I:::rvHHf' ' '- '- ' ' i If Y V3 g I- - V .i V -W 'f'- H - - ' ' -- f W 'QI I, 'ff.?f?.fIi YIEQIIX WI 4 I ' EDWARD GORDON GOODLOE, 2 X ' Z IIA HE. GJ: I - - G Vir mia ?' I gf! Big Stone ZIP, .E ' ,f. I UE. GY, first began his career In Bag St0pe1iTPL X I E2 l ' e Institute before conquering t 6 W 54 II Ei3iE:3unIa1'1'ied. After this he decided that his edu- Eationowould cnvgt be cpinplate 1331551 ggi 131:32 to Tech' If Ambition: ' O con ro ' e - 55 I5 Alpha Kappa Psia Shewbow Squad- ij I . Iii: I ff - ' sf IIE ' A LOUI GREET, K A 5 II Judge 1 II . Gadsden, Alabama II , , V 53151 The Judge hashad such a wide and varied ca- Ifizg reer before coming to us that we hardly feellab e I IIIEEI to write his Tech career. He prepped at Dlsque In II High, went to Vanderbilt, Where he made quite an V551 enviable record, and then startedl out Ito goicigusrtlihe X? III? world. Germany got the same 1 ea a ou a IITIC so Loui went over and conquered Germany Instead. I iw Judge', has made a good record at Tech -and he A I gin will carry the same amount of success with him 1: VQTYI throu 'h life. If' I g . 77 Ii 'I Ambition: To learn to spell the word. , Ak, . , Delta Phi Ulanderbiltj . I g A JAMES ROBERT GRIGGS, JR. I A D Avg 5 ffffiav R it QQ I y A 1 Marietta, Georgia III I I :I I , I I4 -PF: I-, I 'I I fi. 4 -Ill A : 1 :mb Ci l l N ,Q Although only twenty summers have passed this Q I N ambitious youth, he has already tasted much that the S' 3 -1 , world of Commerce has to offer and has come to be I regarded as somewhat of an authority on insurance, Q, real estatexbonds, and the post office system. Kid is a native son of Cobb County and prepped at E E53 Mai-iam High. I S' Ambition: To be a financier. ' 3, ' x M55 Marietta Club, Honor Roll, '19, ,20, '21, I I J WILLIAM FARRIS HILL ' Tom Watson I F'- WEE I Hartwell, Georgia IES I I S S S ., Q E S X IN, This disciple of the late lamented Senator Thomas E. VVatson ave his f' t A Qi I h g Irs version ofthe Civil War in :S a s ort speech delivered at Hartwell, Georgia, on Gctobel 22'Ud,.1894f. He later participated in an- other WHT, bemg a wounded veteian ' tl 1 S . :E ' YVorld VVar. I m le ate Ambition: To be a Senator. Ia is I L23 N II? I .N SCX, Y o XP ' Q F H55 ' oc? .9 H 1 SLS L LLL,,, I Q AA-- O: : M + L- to , A NI I- L 4 - - 'I' :::::ii5: . Y i M YA I,wlxwwwxyawenw-mwSf+5weFamn2-mwavi-2266629-2-zvoezf,-Co1f 1 fx: 1. Q F L. I N - - A g 'V : Vi L, 1,7 - LICHI. rc- 'C Q i' ' - - sf . Z .... : - 'I e - A V I' ' I I 'vs ' . 1' asses c t- 253 ' 6.9 'W' To ' L LV v L G J A ' ' O S '?:bb?o2Qx Qx'KNb1QxYrbXWYQxXXYXXXXXQXXX X os, ,10 I I I I I I I I I I I I II f. Ia ,aI I fI Il I III II ,, If III ' I II IZII ,,.4, I I I I I A I MII 'ESQI Ii.P , , QQ! I 41 435 , I1 Y -N X S S S E IE US' -is N ,S IS S I af ' .1 N , V 1' -' .i, i f A ' -5 ,Q , ' ,. , '- H... ...,, ,.- 'K ,,,,K,,, ,,x, . gliiifliiignggsnlilriggigggiz-SUIUIIII Ill I llllllll H llIllllllhlllllllilllllil Illullmltlll nunun imma lxmn umm --nl1-: nm-u --1-f- nmmmllvlullvu If-uv-Imulunnl--i nv-nn 1--,fuer-Il I I nllujggigggawllllgig. ' :Egg ii. 55, ' A Hi, I H E: DLV E. P Pal ig giiiblllihlilgil ......--.a-..--.... RRI::EHRiliiiiii:ISRIIRSIERSIIIiiaiiiiikallilllil H1111lil!lilllilliiiitiiliiliil5231512213:IIll!!!Illia!IlIll:Iillili'-3:2HHH!!IIIII532333115531HIZISIFJIEEZIVIII315:31lllillilllllnllfiilflllllliii Tviliilllllllln IIIIIIIHIIG. ........-.-. .. :Eel ...... 'EET if s E S XVILLIAM MERIWEATHER HILL, JR., E A E Z I Q Minnie ' Washington, Georgia :Y Minnie was born in the sandy hills around Wash- ington about the time school opened for the fall f N term in 1901. It was some years later at Washing- ton High that he decided to become a great sur- veyor and baseball player. The first step towards 'Ez the big leagues was taken in 1922 when Minnie . very thoughtlessly tagged Ty Cobb out in an at- 2 tempted pilfering of our little sack that adorns sec- ond base. To be a movie magnate. ., Scrub Baseball, '20, '21, Varsity Baseball, '22, '23, Cotillion Club, Bull Dogs, T Club, Delta Sigma 8 Pi. A EDWIN WALSH HODGE, fp K 2 ' Ebb ' LJ P fu. b -4.4 YW f f V 3 'Z Z A? f 5 9 2 6 9 Z 5 3 Z f 5 X 'J 4 1 1 Wh i 'ii' ,513 I 9,511 I U ' Ruston, Louisiana Ebb began life under a terrible handicap, the old storkdropping him very roughly at Arkadelphia, Arkansas as though disgusted at the destination of his mission. Never too full, Hodge says that peo- ple have been Ebbing him ever since he moved to Louisiana, so he is about out now. Having stood the campus racket for four years, we predict that he will find that he is not out yet. Alpha Kappa Psi, Oowah Club, Shewbow Squad. CHARLES FRANCIS HOLLBERG, JR., II A A Duke Senoia, Georgia The Duke surveyed his first domain at the rapid- ly growing metropolis of Senoia on July 10th, 1901. He started to Senoia High but soon knew more than the faculty, and having broken all of the hearts in the vicinity, he came to G. M. A. The rapidly in- creasing population of the capital city opened new fields for him to conquer so he decided to come to Tech where he could appeal to the masses through our numerous publications. Editorial Staff, Technique, '22, '23, Editorial Staff, Blue Print, '22, '23, Editorial Staff, Yellow Jacket, '22, '23, Coweta Club, G. M. A. Club, Oowah Club, Shewbow Squad. ALEXANDER TROTTER HUNT, qi K 2 Pinlcie,' Hodge, Louisiana Pinkie made the first pony backfield in Sep- tember, 1901, at Arkadelphia, Ark. He prepped at Staunton Military Academy and came to Tech about four years ago. A hard worker, likeable and am- bitious, Pinkie made good from the start. Senor Hunt is also a Spanish shark of note. Scrub Football, '19, Varsity, '20, '21, '22, Junior Baseball Manager, Skull and Key, Koseme, Bull Dogs, Secretary T Club, '22, Anak, Honor Roll, Vice-President, Senior Class, Alpha Kappa Psi, Psi Kappa Phi. :CHO -Vt J in-. . 'I' i ll w' 1 4 l i '39 'M r 9 ii gf Q . n 3 fe . V qu 0 ti O LVV f', sf o 655' . 0 ' A , f OQ- ' , N, T 1 P. -, ,,:.gg55!'1?f 1 'P 5 XM 9 .W A ,I I5 if ,KM ,,,,,, 1 , ' I 5 F QW' 1 f fffffff if f ' 92321ff277 WlffwimfWffMl40'1f2ZW25WfW A ru, J' , gl, Q L- L ' 1 , , it boi' ' 'A ' Q ft' liiliiisirl A o 0 LLOHEL nb X '1. -- .' ' I 15 -' 0- Af -2.4 ,,. 'q o 2 6 1 1 1 .1 . .-1 .J -4 .e .4 .1 . i F 'Yx G., Q L V' X isi Jf! S 'dl I 1.45- -T k,.x'.'mli'1-i . .F fl? . - f M - NMMA ' 'Q ' 1'A ' 4 . X 7 E P R I u '1 E L' I I I . 1' i 1 ' i :ra . ' ' . Zi All 7 X , Hz! A LA ' H -- ---:-.mans-:::::::::::1::::n::::::::::n::r.a:i::::m:::: ir:::::u:n::::::u::lll uzsnlnlwie.':'.::::m::m::::::::::s. ,... iii. ..... 1 -Q .L i V ,,,,, as-...,,, ,......,..,... .... - .....Y.... H W ,,..,.,..-. ma--an rw- v12W2 W ' , 'mis Yfvfll ' 1' ' Ji ,vii-'fi,v - j xl rf f jgij Z 4: fill i- X I iii' ' . 9 . E55 JAMES L. KEEN, II A A Z i il 'j Lam l il ii ' A ' D blin Georgia 7 l .5 1 - u , 919 D blin sent forth I j Back in the balmy days of 1 s E1 ' of hi her f I . i ,Q s this loyal son to delve into the mys'er1es g i V 4 3 . education, at that much-heard-of institution, Georgia Il f . . Tech. James L. found refuge in the protecting arms ' Z l ' of Dean Watters 8: Co., who after four years of -. EZ' I if A careful supervision, have now decided that it 1S ri lliffi time for him to go back and demonstrate to the g tiff it towns-people just what college will do for a growing j ' .jj 1 I . ,ff I V boy- . n A ig tif 1 f'To get married. i y ,fx t Oowah Clubg Shewbow Squadg Masonic Clubg G. Z pl M i. , J l if if , MARSDEN LAWS MARSHALL, B e rr 3 .5229 if A Ducky L, gs 3 ii . Meridian, Mississippi ' j gt Ducky is one of the scintillating stars of the i ' commerce department, being an authority on all T Q2 questions pertaining to finance and investments..He i,,i32lJ. , hails from Meridian, the city of eternal springtime. IL jj WET It has been that way-these twenty-one years. since fig. has Ducky came to gladden the hearts of all the - tbl?-ji countryside. Time passed and so did Ducky, and 4 , lj , ' l one fair morning found him clamoring at the por- Q, W' :i tails of Tech SEQ A i Secretary and Treasurer, Freshman Classg Sec- M un ' : I retary and Treasurer, Sophomore Classg Alpha j Kappa Psig Des Moines Delegateg Cotillion Clubg MQ 4 L Fi Skull and Ke f. A -mv - - ' Nfl? 5 E15 'fxl Wi A ROBERT H MATTOX i . ' it AE, ' A 'l 5 47 'fl X rrlgankyv ll l jx' St. Augustine, Florida .N Lanky first began to rave about Florida at his Nsiviisisj Georgia, where he conceived the idea of is E enngratmg to that state on the nineteenth of Octo- E ber, 1900, and he has been a little prejudiced ever S smceiin favor of Florida and the ladies. He only ,Egg practices on the fair sex of Atlanta, but they ap- QI TQ 'ggi preciate it just the same. ' iii j slgiarj To .be a retired bootleggeiai' E' My Florida Club. 5 F .East ALEXANDER ROSS MOORE E j Durham, North Carolina j E llgigl K Moore decided early in life that his ambition was S to become an authority in Financial Circles. He S j EOTEI found thatithe best way tojprepare himself to M Cu l his ambition was to come to Tech and take N S, f0mme1'?C- lhe World War occupied his attention RV 5 rlflefcha UIUC, but failed to keep him from entering To be an authority on Finance S N if ws, . .... ' I A iles! 2 Y .. s' . E xl' 1 f is N Qt 9 I Q ! EQ? , el . f 6 ' 27 'Dix 'ig s ' K e i b:':NS- ?1qf:5:3:9 :::f'- 'N'Q'?I'ZjZj.j3.-,gygj-yy-44,-,3,1,:. H j? Y Y V L.:-,ia ri ' Q - glh g g. .fijs5'i:,il:t'ASxsag's-X7BgtsXY'bLXiX5g5XNTS5XXXXLigXg'gxy3 ' is 153'-Q gi 735 f fxi C Y ILKN :W I rx sfhzf 4 f .f ' 'N I, x ,4'. - ' X 1 'fe 1, . ' . ., 1 . LD' fr, M .i - rf, ' Xxx' t . T-JI-' I 2' KTM' ix , T n is tv er. P ici ia, .,, nun. P ,, . f3llJ4'U1'. ' L..ff: '!H'1 '. -,li-.m:1,,,,, 1, N P - N, N 1 JSXNI WM' J ' ' 'ummm ' ' ' -HHHFi2222flH-W2r:21u::nr::1:a:r::::x:.'::.':::'.::r:n::x:::::::rr.a::r:::a::::-.::n::::::::.:::x f .. ... WEN nn u - - -.--.v-.. ll . N li ,,-1'1 is . ' EDMUND RICHARDS MORGAN, 2fN 'Eg Eddie ' Q y 'Q Macon, Georgia 5 N, l'gMercer lost one of' the South's .most promising E mseball players when Eddie decided that Kid Clays pasture was the place for him. Time has y shown that Tech gained the South's premier third J N p-itseman as well as an most .promising financial genius. C plepped at Lanier High a few years. Sp Captaln, Freshman Baseball, '20, Varsity Base- ig PHIL 21, '22, '23, Captain, '23, Secretary 'fra oiub, Q 225 Secretary Athletic Association, '23, Skull and S Key, Cotlllion, Koseme, Pan-Hellenic Council, '21, E '22, '23, Delta Sigma Pi. 5,4 E EDWARD POPE MURRAH, 2 P E is Ed . , ' ,, Q, Columbus, Georgia , AA In conformity with her usual custom of producing ,' . great men, Columbus welcomed Ed August 22nd, S 1901, ,with a little more than the usual celebration, H 5 . for he was destined to go to Tech. Always a magnet ' Mg! for the ladies, Ed was a great success at Columbus Q 'lggi High and an even greater success in Atlanta. Scrub Basketball, '20, '21, '22, '23, Marionettes, . p K A First Lieutenant, R. O. T. C., '21, '22, Captain, '22, helm as M. . . J H J 3,133 l l 1 ' Ill' ' UE Y WV! nl '23, Commerce Society, Water Nymphs, Technique Staff, '18, '19, Columbus Club, Shewbow Squad. JOHN FRANKLIN MCINTYRE, JR., E N :rBig Boy!! . Pine Bluff, Arkansas The most impressive thing about Big Boy is his mouth, containing as it does an array of ivories like a pool room. Besides pushing the opposing line back a few yards every time the ball is snapped, he says Commerce is the best course at Tech and really believes it. No man in school makes friends with such ease, so John will some day probably have the farmers electing him to raise the price of pork. Scrub Football, '19, Varsity, '2-O, '21, '22, Captain, '23, Anak, Koseme, T Club, Vice-President, '22, Student Council, '22, Delta Sigma Pi. ., r i ' r Ln.. '1 y '1 'Til Kllll' , 4 1 1 ' .11 1 f P l eff ' 11.4 I 1 RODERICK STEWART MCIVER, JR., A T S2 Mac Greenville, South Carolina Z' This tennis shark was born in Savannah, but soon 1 Q emigrated to Greenville. Early 111 life Mac began Z his career as a tennis shark and a lady killer and Q K soon became quite expert in both. He came to Tech 'Z Q and at once began making new records in these two p Z' lines. Mac is one of those chaps you can't help but Z A U like and the more you know him the better you like 5 V him. it Not to work for others, but to have others work f an 4 for me.. '21 Tennis Team, '22, '23, Manager, 23, Oowah Club, f Shewbow Squad. 6 Z1 2' A 1 560, K1 U Gxktjwmilioh o x X ,fwfr so i 2 ii 2' ' i s' DZ' w 1 . ,W , 1 N. .A ,. 2 1' ' ' ag 4.f5,,,,eX.osoQ',4zssxf.40S.vzwo4r,.af,zx,t . 2 N-'.k?fS,g,Q., .zgfiso Q 2-lass? sf: 61 ,. 551 1 .x O, il.. .1 -Q1 N -2' rf- . - -vw... , A ai - l .4 5 5. 5 Liomei. 1 , , N - l -.-f., ii-w...i,-iiiiiiiggggggnuwgnewi if ' ' - --4- '- it A ' ' 1 ' X w g1 n Hamann, lawn-nulummlmxixiuauauii-fi--Aw' H f ' ' ' had ' . , -' H ...- -H-:::::::::::::::::::: ...::::::i:l:::::::::::::::::::::::::::::::::::::::::::::. ......,..,. - -.--- ' N li r .ill i i -..-..-.aw-H--E, , . .....: ...- .....m:::.. .....:::::. ..:: .::::: .... ,fl I R J ii 'm ' G 1 5 1 f 'LQTTF 1 4 1 1 1 Z lc 1 7 I i E2 2 . D l at ' 1' WILLIAM LAMAR PARKER, 2 A E 1 1 Q Kid A f 45 A K L' w 1 Thomasville, Georgia N 'FF . 1 11' ford f 5 1 , E This able - Contemporary of 'Rulggl Wflifenglater l Z 1 l Sialdfed fffidmg ad Wa5bclecsJSSat1nThomasville I High V I Z, ., , t mar , . . ' 'f l Sslqappege lbzecsamizn well known for his ability to get Q 2 1 tlieellieest of the bargain' Having Studied Huang? alt 541 f A 5 Tech, Kid promisgs to putbthe well knowfli .a ' - 1 Iino-ford in the sha e. Q gf A fl-O get rich quick. l 1 X -5 if 21 , 0. Wg 4 1 75' GEORGE GREEN RILEY 1 5 A 'rrGe0Tge1: .V ' X t ' -1- Americus, Georgia G It l gif Mtv 7 , 1 ' ' ' K d back 527 . i f lgj George, first made the Riley famlly p1'011 5 H 1 5 H225 if -1 in Arlington, Georgia, OH APH1 2nd, 1902- dTQ?y 1 163' ,1 l soon moved to Americus and-managed to hol 1m 3 Q! 5 there until he finished Americus High. He Cattle L Q. - Jljij to Tech iii 1919 on the coiiciiiion thai-they lf-it hufi gs , g . ll be L come back when through. specialities are Bul - , b H gig ing and Singing? His ambition IS to become a suc- , I ii 1 R t cessful business man. -HL QI I -4 l df f - , a LQ.-H nw-14, 5 Q ' Commerce Club, Company Football, 19, 20. IME I K . P 4 1 . rig. t'-'iii 1 , GEORGE PERRY ROUNTREE 1 : 1? ' f'Geoa-ge V Summit, Georgia H 1 .755 O , ,Wil George is a native son all the way, starting at lll if lm A Lyons, Georgia, in 1901. He prepped at Emanuel County Institute, moved to Summit, and found his A Q Q, way 'tothe protecting arms of Dean Watters. He gg. hopes in the course of. a few years, with the aid of 2 'Ei E a vigorous political campaign, to be elected mayor of Summit. X 4- 1 3523! 1 A i llrsii S iff' 1 E lit Q CHARLES' MITCHELL SEWARD S I ':l:' i, Li A tx Baron 2 l washington, District of Columbia A Q, , . as ii ' In spite ofkthe fact that the Baron was born at . 1:3 Washington, and served as a major in the army, he , E . isfone of the most realistic-looking anoblemeni' and ' gi. is second only to the Prince of Wales when it comes 1 1 to breaking feminine hearts. It is generally under- f lb Y stood that he is single 'tat presentfp ' Q 1 S l To grow more hair and break more hearts. , 'S N4 j Member Yaarab Shrine Temple, Masonic Club. 1: S, I 5 4 ' V' ., R5 A i C vgw jygz 0 X 1 1 'V i ' 0. 1 - A if S LF, ---4A -- O ' if 5 1 -- Al Y - - - ff-nf. r:-r:-an 1' ' 1. 1 H i 5 .1 -' K ' . V Y Yi . . lf rl f' M 1 E 110?Qs.w6S!QExm-as-x.fz-saw:-.7...fr-wa. .amz-sa:.,Xp5afr9fffff,4o rv X 'Q 1 XSQgm1KKXKXXXXXXXKXXX , Minn Y Q v.. -'. ' O l - -- RLVY' YJ' of Af' Q ' f ' . 6ONc , ,, ,. 'Q fl 1 X. -'Si Vx x . bf N x N. -Q i I 4 11.6.1-gre' M, . X , f , f-'X e.L9..2. 5.1 ' 'rim ' llUaglf'i 'UlllIlIl m lldu lu innu iildlf T?? Auui11u-11-JBidi-fm:Lf-.1-TAf 73.q+1n...:Z2 Mm vmlmmff ' ' mag f l X , ish I I A um VL--Hum I I - noi' -1' , I : ', w it ' M 'J I 3, , 1. - 1, '12 l. 5 rlr . l ll D L V E. P Pal . Hill V' ....- ' ...iIlHill!HillIlH 5iFWll5l3lmll3iiiIilElmlmHWmMWll3SImTdHHHSl::HIFIII!IIIlIlll::llll2lWlII'ZII S 11iifiBi7Fml3mu'iII3l:5Hl3F'-5:25 ?5lm. .... ......n - Jnh..-Hi ' 'J To 1 1 . X W, N DUNCAN SINCLAIR, K 2 -I Q 1 . Q Shine , Q I Moultrie, Georgia p l Shine,, is entirely inconsistent in his nature. While . 2 most of the time he is of a quiet, reserved nature, ' he has the audacity at times to emit terrible noises - in company with some others who call themselves the ij Glee Club. VVe would like to find out which of his at- 1 titudes he uses with the women, as he seems to get , the desired effect. 2' To be a ladies' haberdasherf' Glee Clubg Mandolin Club, Alpha Kappa Psi. 'S' D 551 -' FRED RICKER STOKES IS, ll Covington, Georgia 'IS' I Stokes, after participating in the late war, came y ' to Tech, but was unable to start another one with lu g, his former success among the Profs. However, he did shoot them successfullyg and now, armed with Q ,gil the old sheepskin, he is expecting to become victori- ' ous with his fight along the highway of life. RQ? i ' SA gg E mnf . 'HE' QQ ALFRED AUSTIN TENNISON, n A A 4 HL01-Cz Alf?-ew' 1' Texarkana, Arkansas ll W From an Arkansas Traveler to a B. S. C.,degree l i Q23 at Georgia Tech in four years is Alfred's enviable ,mf , record. In the good old- days of '19, he asked if he may be permitted to tell what he knew about ac- JE' lp, A counting and the other mysterious subjects of that fm gl A A department, and since that day he has been one of 5 V the Commercial Sharks. Alfred expects to go back I K to the old town, and there put into practice what E these four years have taught. He states that he has S2 no ambition, she's already married. gg Phi Kappa Phig Honor Roll, '20, '21, '22. ,N 4 TE V THOMAS HARLAN VVATKINS I Tommie Z Decatur, Georgia 3 X , Sa LZ This is a man with a smile that never wears off. ,Z His smile is so cha1'acteristic of himself that it Q 2 seems to be contagious, as everyone near him smiles 2 g when they first lay their orbs upon his handsome 7 young countenance. Tommie first came into fame 9 I when he awoke the drowsy village of Decatur from g y its peaceful slumber with vociferous yells of joy 5 5 in 1903 Since that date the villa 'e has never uite ' l 6 5 4 2 2 5 Q 2 X . . g recuperated from this shock, and the old-tin?ers insist that it should be classihed as one of the nine wonders of the world. VVon,t do to tell? 3070 B A' i Q' uonei. ' gr, ON, LV' :bail o Q'6X?JfTS,g, gf O kv M Q ff- f 0- . my :.. h E 41 D. ..,,,,.. A D 0 f..sfisQ's1, X . e 1- .fe 1- . . - -5 f- ' ff fy ' .. .. . 1 - fAf5B37Z7J9YM'Af!09Q'.WA99 Z??QiQQ950'jkV.s29e9S2S6Uxf!Af I , lE, M5kp5g.5,5y,3f,5.5g, 5Q.I.,-12g5.g.g,5,42Q3Lkq.g.X5 1 L K- E ' ' ' E x iii .. io U L P T 0 Pfilfa.. i-5150 Q x 71 . 3.-..--1-. - . I 'i I 1 ..-I 0-' N vw 4,, sf J 'r 4 7 . i 1' i..!9-255.1 I kgkk' 'nel t ' mI.I..1...,...z::. ..LT',...,,.: .... fl .... ..,.. -I11 i g!gfU mamnm1mwImumuwmwmrmxml:mum-:frn-uw-'um - f- I P Ili V 9 T H D .. ......... ,m,m..,:..:,:. --------f:::x1.-::n::x::u:::.::::::mm::I1J::m:::x::u:a:::::::::::::'..::::z:::::n:::::::: W A I ,F,,,,,,,,,,,,,,,4 ,,,, ,, ,,,, .,,...L...,,, ,,., -.e,.... -, ,,, W , ::::.:. ----- ,U IQQXI . ix fi I W, X21 Zi' is 7 CLEMENT XVALKER WESTON, E N 'QQ , ' Clem , I, T Logtown, Mississippi ' XVe cite Clem as an example that a state doesnit I have to have great cities to produce great men. 'He 1 54 E was born at Logtown on March 10th, 1902, and after P1-epping at Columbia Military Academy, came to y it Tech to study Enginee1'ing. He soon saw that En- gineering didn't offer large enough fields for his Q activities, and so changed to Commerce. f, .5222 ' To be ma for of Logtown. ' gf! ll 5552! Cotillion Club, Skull and Key, Kosemeg Bull Dogsg A Q ' Shewbow Squad. , ,,, . t 1, , ,Q BOYD FRANKLIN WHITE , fl Q Dean - 5' y V Mableton, Georgia , 3 This Commerce shark Iirst saw the light of morn gl ilgfgj at Temple, Georgia. The populace of this thriving hi' l, F metropolis werecamazed at the scholastic ability that 5: he demonstrated. After finishing D. B. I. at Drake- A gi town, Georgia, he came to Tech, looking for further Lf? fields to conquer. . VVe firmly predict that in the it-4 irfil .I future he will be known as a Professor of Commerce X 3 in some fortunate institution. Q Phi Kappa Phi. wil LW.. E 41 riff' WILLIAM LEWIS VVILSON, H A A E! p Bill 1 , l ' Q Thomasville, Georgia 'f 1' . . . . 'E 'fa Bill has been a native of Thomasville since Sep- 1 , ' temher 28th, 1900, where he Iirst smiled at a good- Ji ' looking girl. Since then he has not coniined his may smile to the fair sex, but has a cheerful smile on 1 , ii his chubby countenance for everyone, it is even said f,'f fl N that he smiles at hard work. At any rate his rec- ,p ' 3 ord shows that he has put outi' and we expect him i w pg L I to have a great success on the uoutsidef' W A E E 1 To be a Certified Public Accountant. 5 - , S HOTOI-O Roll, 6120, '21, '22, Gold err, shewbow S 2 quacg owai lub. if I 5 VVILLIE CLAUD coUcH 5 gg I 5 ffzamff i HB' 1 79 Turin, Georgia ' F i llls father first boasted of his son's arrival is 1 ii on September 4-th, 1895, at Turin. He was loyal to gi, I p . the old home town and prepped at the local high 'HL' ' ' 'M' Mi-'-4 Sgliool and Woulcl Lfndoubtedly be the tOVVI'1,S leading , S . . Cltlzfll 'C0Cl2lykhad It not been for the war. After Q ieclng that little matter settled, he came to llech to become the leading merchant in a larger E ' gig own. A , p ALEX RITTENBAUM I I Little Alec' S E5 Atlanta, Georgia S Alex got away to a bad start, but it wasn't long before he and Kaiser Bill broke u 'md I Alex left Munich and free beer, and since has been trying, to find Something- free is ihis country. He is of a most humorous nature, a d l t d ' - C is rm fmment of his ambition n ras en encies that point toward the ful- N Lerdmg merchant of the city First Lieutenant R. O. T C. Alpha Epsilon Pi 507, 'dd 5 4 S I Oi ,fob 95155956 bkwvmxmxxrmxxmxxNmmwxxXxxxm Oki?-xxxwfm iw 1:-.-1 xqq.,-gy W, , 1'- I EEE! - 1 if, H 1 ' . . as g '. c . . '- ' ' ' i Q ,Egg S F kill! C Xp ' O S 6 V - L 0 :qs . ' A - oQ'.'4 5- Ref ,, 1- I ' - Q31 - S' 4: , '- 0 Hier., X f ' ' ' t't - -A A -1 'ii2aii:g:...i - . Q Q94 S-41 t - 'iffk-.4652-:-:Irs --,-izgzgv-',q:q.9s1-Q:-gpg - 3 35- f ,,,,.44,7A,- tg ' T 1 7 X, - S ,W Lmhilh K- Q V V V - -H 'I rf, I I I G L . 1, X -v , K H Q-pg v g f A In , - -- , ff mf Q i 4, if Q .,.....,:- O - . . ' --- - 'i-. . . ' 5 ,O Ii3i ' 0 ' Y 7 5' ' D Pg- . - ,into xux 4 ii' ' ' ' ' '3R3L. 'Z-'RISK-'il '. S Rl' 1:32121---u ': i '' 'I'KI'1l 'l 'TIIZIIZIIRT! IiI'2I l-'li':I 2 ..- i l i f 3 : lm? iigfzgi ' W2 1. E ' fi , ..,.. Z ii f- ugly P ILI 1 rn' I ny.-1+ ' ' X V . x , ' . i .:.E .': K l - - - - 'JC 'A fs, Ns.. '- Y If 4-1 ' -Q-Q-.:R,.,.,ff I 3 - - v ,: l a E :g: 'KW lmlmmlmlmlInnuIinIsunuIulllwlnuuludiin-tim-.ni. mi ixiimunuiuv 1--aim,-an-'vin' 1.1 if l 1 --.4 u--um 1- nf- m v 1 - w vw- mm 1333 -iuwum nnsmvmw valine- I 'f' I n n '15, 1. ffm H f ii i t ' ' 5 3 ii .p-r i. all l I , ri -- xl 'ir' 'iii ii -n 'Q VL ii x ll...-. .-:mn-.-. ..a..-... -au. r..'l .... .sr 1 :t::'......-. .-.-m -...-...,............... . .. -...-. .... . .......... - -. ..- - Nr N r N N is N is Q B w7,w-7w77,.3m.,Y .,.,,,.,,,, .... ,,,.e,,,,N ,,..V v.,,.,,7,7,, H., W..v,s,7,,,.i, achelors of Science in Cooperative Engineering THOMAS PETTUS BRANCH, B.E., Sc.D. Professor f f ' -H -V ' f --num... 9-. I . u ,LN UONEL K. 0 - -I, , ...G fvxo X W. Fvyfo f-1... I Qae5Jt 'ZX 3- 5 JOHN A. AYCOCK, JR. ,O Johnny Q. Bullochville, Georgia 5 Many thousands of people have observed the func- Q tioning of the South's Best Football Scoreboard, on , Grant Field, but very few of them know that this 4 little man is largely responsible for its operation. ,IQ I Johnny has been the life of the C0-op House for five years, and his absence will be felt keenly, especially 5 at the bull sessions. ' To know, to do, to be-richf' gf Company Football, First Lieutenant, R. O. T. C., 9 '21, '22, Co-op Club, Vice-President, '21, ,22. ' lit, i L 4 Ig ELLIS XVAY BULLOCK gb' 1 , Eastman, Georgia Ellis experienced 'a great deal of difficulty during I his early days as a f1'CSl1l'1'1ElH, and now in his Senior Jil year he is making a specialty of getting freshmen ggi' Will' started in the ri 'ht Jath. In fact, his duties as gm I 4, 8 l . . 1 1 Assistant Co-ordinator consist mainly of guiding the new men's feet to their proper place on the first 4 rullg Of the ladder to success. Li a! l To navigate deep water. 3 I Co-op Clubg Aero Club, Assistant C0-ordinatorg . A. S. M. E., A. I. E. E. N oscfin DOUGLAS CALHOUN 3 V P frD0,ugv 22 Atlanta, Georgia Z , Here is a man whose specialty is running. He Q C has been running around Atlanta for a long time is Q ., and since entering Tech five years ago he has been Z L A running around the track. Being of an extremely ' s Z 1.52 destructive nature, he has smashed records on the 5 Q Q track and hearts in Atlanta with seeming ruthless- 5 Z ness. His smiling face would never betray him, but D xg in spite of his innocent look he is one of the most heartless heart-breakers in the known world. ' A Track, '22, ,23. 5 6 2 4 f 'Z X 0 6x o gi Z Q-414 ' at L' i- Q , . - .... .L 0 - ' Voir ' K 1 --- -V-5' .. V w og3a'y4mvMmffwfmpwwww Qwwww 3' 5 Qsxsoir k ,nr I-I X 1.4 's .lu u -1 -.4 , Q N I P1-I A-I-' R, K., E g. .- 11 f- --w.. ' 'n N ' 1 . L- ,., - it-., ' , ' ' N f f M I gg. 5' 1 K . HF -x n ' 1, , , nga- , ji' :X ,Yr--IL - AFWHM'huu'u'Hnl3:::5?m'M .IIA Ranma-.A '..., ,,,, ,,,,,,,,.,,.,,., 1 ,,.,.. ,. ....,.,.. .-- .-..--.- -W ----..--..-----,..-v--v-::vn-1-: v--r:1-fIv111 nr iw Ilillfl ' H ---X'-1 - - ' ' , 1 -' llllilllurfrw-1v'v 'Sl1'f 'f1 'H - , ,,.,,,1 . . fttffi T ll 11 15 LV E P Pal 'J , , , ....... .. -:ng-,g ---- -,:g:::::::::::::::::::::::r:.nnx:::::::::::::::msn:mm:::::l:::l:::::::xr::a::s:::::::::::::ma::::n::::. ..........-.. Q......5 .? L V .. 11.,--4.. .-.i-- --..-----'A-v- -A - v-v- - ---,-'- - --vv -wqzi. . S Aw 7' 3, Y W nil l Lili - Z gig a I Q COLEMAN LAWSON DAVIDSON IZ .45 IK-Davedfl If Ei 4 AEI? Shelbyville, Tennessee l A 3157 - f ' Few men at Tech have. had 'such obstacles to sur- l 1? mount as had Dave during his first years. It has Q been a hard pull for him to finish his course and fig he richly deserves the honors which are coming his way. Those who know him best honor and .respect gg him for his hard work and perseverance 1n the face 555 Utffj of great difficulty. He has done his work well and 5, is ,sure to reflect credit on 'his ,Alma.Mater by the Wffjj work he is ready to do in his- profession. 1,1 ll IE31 Co-o Club. 9 llrpgx p f Wil if gggp JAY LESTER ERANKUM ? HH t 1' U l ' A Martiiiis Clgeiurzia p T 'Be not deceived, gentle reader, by the appearance Wg!!! of this long, lank, hungry-looking individual, he has C flfffl an appetite that lwould shame a self-respecting ,ja igfiii ostrich. Now that he has finished his course he 'is fig perfectly happy, for he has also found out who is ' Qijxlppllil boss of the scoreboard. Although many of us are 4 ,ji lf'.fff'i' inclined to kid Frankumy along at present, the time is surely coming when we will be proud to say that Egg he was a classmate of ours. l p Co-op Club, A. I. E. E. it pw 'Y ' - ASBURY BROADUS GREENE, A K X if S ' X., DL, ff . JJ 'I GK , Rasbmy fi, 'ff Valdosta, Geor ia F-in 535 . g 1 1 Ou, most subjects and especially in class, Ras- tyfgsk bury maintains a profound, silence, but when it p K. comes to formulating alibis he is undoubtedly king im' l of them all. In other words, he is quite the berries, M21 Q if you catch our subtle meaning. Questions regard- EES 1f1g'.h1S many escapades and his frequent week-end FTIIJZS to xthe. metropolis of Windei' are invariably imp -llffvrwltoh an imperturbable front and a perfect alibi. Q f - Oagtail wEatOSIrIEOeXRectS'n Sf .N W , .S . .. ff-2' A 5 2 I, ,, WILLIAM BEN JOHNS, JR. !S I A ' ffwizzie Ben l A I., .X N N.-, 1' '4 Farmin t G ' dh ! . ,i-rw'-1 Y gt one eorglaf Q 1 ... ',,1,. VVillie Ben s tl - . Q .gf H, ,-gf.-,A , A pen two years in the N d - e l the W0r1c1.Wa1', 'and 'Cries to convince ixsytlialtmhi S 'E'-' was a bad man in those d A . y .S if . EIYS. He has been sa uno' N mtg ever since he came to Te h th ' 5 'O Til he was bold and tough is if al In years gone by S I -. - , u o course w d Ft 'Q . b l ' e OH . hi y of that Slug- We IWPPSH f0,kn0w that E ver in all his life committed ev ' Q A ,Q act that was not entil-el b en one little N .Phi Kappa Phia Cosrgroplolitfnllgrliicbicllt X R Nl - N First Lieutenant R , ' ' f - -5 5 s - T C . v N 1 - Cold it ,,, ' -, Honoi Roll 19 '21- I.. 1 . T , Treasurel., Tech Bible CUSS ,EO R, v ip Fresldent' ,QL President, ,22' SCC1'6t'11'c' C , lice- A b 1 5 22, President, 723. ' ' 5, 10-Op Club, S ' 5 X ki: O b-sw' ' 5650 o S' y 41X053:-:-.'-SESESQ-iii,-25s:-:mas-cw:-:r5f:ff9ssozsa:-wgw.,:-.'x-:oORS668?,z2:2-7Q9ffxfff 5 I -..,, f i V i C C T A Q ff.-' ' . T3mWXmXFWYYWXXsXXQ O 43 ,520 e nu Ei? p qf 'VN 'CT5 1 vig ri dgmhuq www -' - '21, K K-RQ. x afwyy . .-9 I 5 1, Q rs - I 92 1 4 A i - , -f qu . -. -.-.W 4' '- ' - A , 1. f-, 1 Y., '- K Q, 'A 'M ' 1 .N r ' ' ' Q, Y 'W' 'D-2-:coed .RET-'iff' fa., .- r ,us-f.H' ij' .. . ' ill -,:1.:.::f .. -Sf' - I sk' ' 1 In ' . ' .I .W H 'X' fd V nu giilllllill I I mnIllIIInnmunulluuulluluruluullnammrmulmr 'L-nm.,-um.-.,.,,,,,,!mf,,,,,u,,,mmf' ' ,m,,,,,,,,,3r,3.,1ff',.. ,,,,.....r.....m.,.........II:.,1:Q...,.,1151:...:QI2Q.gILl.......,,,,,,,,.,,,,,,,:Qg,g.:1,,,,,,,,,, gr-:,,,,m2:,, .. -as , . 11-- . 54' 'rag :a xx ' ' ', W' if E: N :il R' I l, 1 rv, '1 ii U '-------2'--H - --WFFIFFFFFFFFWFFFIIFHIHCFIIHSIII mlmnmx::::mzu:r::x:au::m:uuu1x:m::n:::mam::u:::::::::::::u::::::::::'.::::::'.:::::e::r:::'::::: .:.. ::::'.:'.:m:::::::::::::a::::::murl:-'::!::l:'.:::::::::x:'.::::'.:::::::::.':.'::'a:'.::':l, ..... . ..- Y A - 1 N Q -- 2 V Q w X 4 rf . N I E ff ' :J 4 X . s , 4 Q cc - ay 7 , - xr . - - - S 9 V s . Y l Y' s - - Q I . 7 . . . 1 . . V I . . . ' V V N, . .' i 2 ' l . , i V . . . Q V I, , a , 72 , 1 a S 3 , . . . , V , , , .... , . 4, 7 'Q '. rr f 71 32 cc s ' , ' 0. . O 4 .. . . 7 Y C . . , N . ' ' ' cc 79 ' , . Q f C rs 1 - ' K 1 1 i Q . ' 9 3 . 7 . ' K4 - - , c c , . . . . 3 , 'IL Q L - , , , , , . Q47 E a 9 3 '-' 5 3 ' - ' ' ' . isles 'num . ' fm! uf- P 1 A ' my A .il u 1: 1 lf' 3' . . . . N- ' f 4 ' lm Q' j as an - 'ani ny. 1 Y . . . oil... ml' , c e c dim 'Sh i ' ' ' ' ,mini 7 q ' . Q . .' . . . . V .T A 4 ya 1 1 - - 4 ' ' . ll wall . . , ' . - X Y ' 7 cr 1 - Y in , , , ' ilu ' I KAI P .1 -'R DV I0 1 un-J 'P b 4 4 2 5? f V' Z f Z 4 4 2 S 4 4 f ! 4 4 4 4 4 4 I 4 4' lv 'Q THEODUS KIGHT Kite Macon Georgra Krte spent a year or so how errng around Sparks College wherewer that rs but Hnally saw the hght and came to Tech Although he rs not what mrght be referred to as a hrgh fly er, he has drstrngurshed hrmself 111 sew eral lrnes of actrvrty As a play er on the company athletrc teams as a shave tall ln Maljor Pendletons arm5, and rn the rndustrral field he has come rnto promrnence Company Football 20 1 22, 23 Company Baseball 21 Captarn R O T C Coop Club RAY MCKINLEH MATSON Mat Crtronelle Alabama Wlren Mat' rolled rn from Belort Colle e he was slrghtlw peewed because Tech drd not adopt Belorts Alma Mater song Howex er, he soon became recon crled and consented to stay wrth us Mat IS wery promlnent m relrgrous crrcles, and rntends to be come a mrssronarx to Korea He rs workrn hard now so he xx 1ll be able to teach the Koreans all about the Rankme cs cle Technrque, 20 '21 22 23 Lreutenant R O 'l C Phr Kappa Phr X M C A Cabrnet 23 Cosmopolrtan Club Honor Roll 'PO 21 Treasurer North Ax enue Brble Class YVILLIAM 'IHEODORE TVIEALOR Ted Gamesvrlle Georgia Ted IS one of the chosen few among us who hfue been 'lble to make pr 'rctrcal use of the experr ence garned m Uncle Sams serwrce and to derrve therefrom the 'rclx anta es and profrts to be galned from bemg rn close assocratron wrth the Mrlrtary Department of the lnstrtutron Note tnat we care fully refram from usrng the common term graft In sprte of hrs unquestronable superrorrty rn thrs l1ne he has nexer seemed any thrng but one of us, and we are proud to own hrrn as a classmate '10 do one thrngp well forget red 1nl Companv Football, '20, '21, '22, '23, Co op Clubg 1Vest Inn Club THOMAS CHRISTIAN MILNER Tom Cartersvrlle, Georgra It has been sard bv some emment screntlst that there are onlv some five hundred odd bones rn the human body, but Tom stands as a lrvrng proof to the contrary He can pull more than that rn a mmute Durmg, one of hrs numerous soljourns rn the wrlds of Tallulah, where he has been domg hrs brt toward drspellmg the darkness of Atlanta, Tom contracted some peculrar allment, the srgns of whrch cropped out on hrs upper lrp Poor fellow, he has never looked the same since. To be successful wrth a moustache Coop Club, Masomc Club, Road Race Team, '19, '21 CH' of if In f Q 5 O if 'fl V Slhlllfh O Q-A-A 4 iw 'Wi 4 3 Ei b s S S Ne it V J o Xb ,hw , O Q- 4 r, Q0 f' K uh lb 0 i ,g 1 La 4 si. ,Ll . B K T f K O2EyffH.6oW Wfo',ovm'1y,oz0929oa0Qcs0Q9w2Q22wQCfafffmgi339 S Q Q 3 ergXwmQ w'gm ,ygr-wygqpgg L -s A , .fa , Q, ' fs L L MOH EL K Q mr t 3- I Q vw . is Jigs.: s U L 752. 7 rw OA D f' Q G 1 Jimi? - - c... wiv- l I. Em., L1 .pfl rftja I':'f111 T35 1 I IQIII 'IIEQQIF 'IZIII I1-1 21 I IDI , I :WA I I?fI'I ,IIZIII IIIQQM, II1i5:'1 I?-If I IILQIII IIIH-'11 ,K-2,1 3'i35:II III 2:-1 II I+, I IVI 1rQ'.I' I I 1Ifi2'I, I5-5111 IIJJIIII .IIEIIZ 1'lj,III , 4 ,-11 . Wx: I 3 II III 3.1 If IYTKI, :I ff: 45,1 f:s,,f'p. ,,,,.,,Y -.. .1 Iiff 3 CI I1 Sflfft If! '41 Ifggrilyl IM9 alll Ix ' ef lfflil if X gg , fi N , ml ,dw J IH Y lgltixhgi-is I WFTW,v 4, , It I I 112 me-clli - I' ,II lk FI? tiff A It 'wfwffcr as ff 11 X - ' - I 1 -- f .ef f f f' L Q!-iv .1 aa, Ii I ..,A.A . 7 I P5 Mg. TT -7 VTMQ y I M: gi, I7 W I I, II I I I ,fe I , I 11 I, W In IJ II 1, I -Txi T-i 'I N 1' ,wuwn ,I I f ' I I I I flat W- I WV IME Ig IIRJ I 1 II IIIII IJ -,I If II 1 ll .Lip II III. IIIIIII5 g ... . im.. - . ,.., .'!'IFl'S '. T ' ' ' ...L lin 'Z 234,12 3,11- 15' , , I? ? 0 I 5 , Q . E 9 ig E 'f 5 I2 T 1, ' I I. II 5 ,4. .Z :I-5 l. I 3-: T , I 1 1 I I . ,. , ,, , X 4. , , I I ,--, , 1 -- aa--- ..-,. - , , .. . ... .. .. In 3 cy Lea.. '1. '- J Ai,,,,,,,,,u..-,,..,, ::a:::n::z::m:u.-::: :aannamm::::::x::ln:ulua::.:ma:.i::5..m.:z....:n.:.pw:'.::n:::::,.: M,.A7La:' W '.T,:12'5m11'm.Z'ifTli2f:.r:'.2'g '- - - eu.',z,:rr5su.:1g., . .f . 4-':,l5f-4: ,. ,. gg .,. ' c I I LQQI CURTIS FLOURNOY STEPHENS Steve Renfroe, Georgia Steve,', the demon electrician, has managed to acquire an astounding amount of knowledge during his short stay at Tech and can tell you more about wiring and sub-station operation than is published in the dictionary, the atlas, or anywhere else. Steve is an all 'round good fellow and is very popular with those who have been associated with him. I LEE MARVIN TAPPAN Little Tap Atlanta, Georgia Tap hasn't grown very much in all his twenty years, but he hopes that some day he will be a big man. ln spite of his diminutive stature he has shown us that a small man can sometimes amount to a great deal. In fact, we are told that somewhere in the western part of Atlanta he is regarded as thc only man in the world. Company Football, '20, 32-1, '22, '23s Company Baseball, ,213 Lieutenant, R. O. T. C., Co-op Club, IIIEEE I ,I My XXXS3 I II I I I I 1 HI ,ly 11, III II f Z :IgI QI I II I ,I IIII. 1 I 1? at 5 5 IZII, .II 1 1 It IIZIII IIQI ISI 1Ic1:5II , 1 1 I I 1- 'I II- I ' C-'4 ...il V 1'-LI-igNI '. 1 , A ELI' :Y -.N 'fx i. L I Ist Y 1 gmf' -- uh, ,'0 l'x ,3Iv -mi--1 nik- f IIWIIII 1.1 , 'IfiII II l I I I I I IIm1 1' I II w I r- II Q51 ISI ISI ,bn C. k I MII I 1 I-HI IV., V Iii II III HIFYEII I ISI ,IH-I, I ,I , SUI I?f:I1I IIQII' :III-I I It w ' EEIII CZEIII I S 1 su N Iyj , 221' I . S1 IQI1 S EQII 5 12:15, sf I S 'CEIII I Q Im s I ESI: 5 ' 5311 - 5 In 'S E X ?9 -- - Q . 'ti mkfggo 5 x.:':+:'l':: '5': 't5'9'5 'N'V'i 'V9 'Y-W.-N if 1 f 'f1fx AGA fl x 1 T Fink shura YV , f- c - fs -- --'Ar-awvxffea fn. : Q' . X' S ' nf:-f :W , , , I O, .,. . ,'fn '- I ' '- --- - V ,, W '- Y N- - - r. J L51 , I W an 1, ' '-L9 :LP-Sao 'Il' ' -ffl I Q1 .D 1f'I fn ' LA .X J ' O L L X X' ' knee Q 15 mmm., A frfkls. , f ., -' M225 fe. k.....ic.,?u..2 - u ! lil X 1 II1 P?m ith 1-'pl Nl - X gig s! Y, R 3, Ulnmn-umm' 7 lmilm IIIII I Illlllllllll HI 4 2 1--4---I v mmn lrz:u::u35 1 ' all ll ' 5' I :M ,-.U t N x' 1 , 1 l 1' mi '11 1 1 1 lt le D ll W A 0 p 1 N 1 1 'l':t'm '.. qm. :: :al umsun - . - .. ... . .. . . ' Lv- L 1 'ti itll M11 kt' It 'lt lilllhiiml . . 112511:I:-lll:mxl..l1..:.:::n..lu..1.x:lln.lnlll.x1.m.lxm.u.:l.lll.l:: .... ::::::::::::::::::::::ll2.1:::::'.:::::::::::::::::::::a:::::::rs:'.::'..'a'm::::::m:l H- :ll::2: ' : ' 'mra: l ..1.. 1 . .. .. .:5l ' IE, 1 5 E lg XZ Q - . . , . - X .s 3 Bachelor of Sclence ln Industrial Eclucatlon 5 is ' 'X a E WVILLIAM MONROE NICLAURIN, A.B. E 1 Professor E . ALBERT HAMMOND STATGN, K E , .5 AZ Atlanta, Georgia 8 Al has the faculty of doing a number of things 3 at one time and of doing them all just as well and ,N usually better than anyone else. Al returned to Tech after graduating last year and alnong many Q other things has done much good work in organizing the Student Council, which has replaced the old 'il Honor Court. Varsity Football, '18, '19, '20, '21, '22, Alt. Captain, '22, All-Southern End and Tackle, '18, , '19, '21, '22, Vai-sity Basketball, '20, '21, '22, '23, l Captain, '21, Track Squad, '19, 20, Glee Club, Blue 5 Print, '19, '20, Technique, '19, '20, '21, '22, '23, Phi 2 I .4 I. P nf- .4 1 15 ?' t L l l Q.:-2 will ly' 'lu --,mg ES QE li 4 2 2' I Z f Z 1 6 f Z x 3. 5 5 Z 4 f 2 Z 2 7 2 ,li R621 Kappa Phi, Pi Delta Epsilon, Cosmopolitan Club, Boys' High Club, T Club, Koseme, President, Anak, Honor Roll, '19, '2-0, '21, '22, '23, Scholarship T , Valedictorian, Class of '22, Honor Court, Dele- gate, Des Moines Convention, '19, President, A. S. M. E., Y. M. C. A. Cabinet, '19, '20, '21, '22, '23, Assistant Secretary, '21, '22, Secretary, National Alumni Association, '23, President, Student Council, President, Southern Federation of College Students, B. S. in M. E., Editor Georgia Tech Alumnus. is I QCA, 6 KW S K X mi. JB- 'V' '-41 -x 'I' . 51 : my 4 lm -u 4551 W 1 Qui ' K ' ' ll 1 31 3 S 2 Lx o XP- ' 2 , O 'Q rf NOW . ' Hs. - , , -.- ....... . .. f., , :Still of 'Si5?!eg:l.. -0 .1 . A ' ' 2 ' U ' PN ' ' wfwy mmmefffxw Q9ogyvfffffxamnwfmvnnffmvfm4xX.sQQwf:w:2s0Qf4afxfJ9'S1-Q 5 E N , af, foo. .. , , 73.41 I L I I 1 t sg 5555- Y 0 LLVV Y v o kk 4. 5:34 60 c 'fi - , 1 r .i .3 , f 1 'Q , W s. 5 9 331 ' is-4' L , U f . K .. A ., . . , ..i.:.-:- ' .1 - - . - .- .1 ff .-1.8--4 ra... sf- A' ' 3 I FRXL -p Q k. ... I .- - -g-:-.e-1-..-..v 2 r. - . :tes ' ' 5' ,X-e - 3, rgjqggpz-A F ig I p sf F- p as- An... 'u ww lIm......mJ 1 'vu .gpm ,ci 4. u IIII In ,,,,, ,, ,,, , . ,I - , ! 1:11.-:,g4.Lm:' CT:::'-Q5:r:..::ui:- --1 i ', . .... ,..,.:-,Lielrif --Q wa- -----.-- ...4,m..u4uin xl-I WUI' ' ' 1 N um ' , - In I I g lydl 5 I H I L V E I ll! Ll I A ' . - - - -:: :::':.:::m::::::::::. ..... .. .- ...... -ml E VY 'v-. V-im'MK.-mumh'hWwwvrdfwlgwlniliuruit -ur' l :msn -l urggmgg-l ggmggmnmirzzzmii..hliiliillllm-553' 'r 'm H Im' I H 'S r I if If 1' 'alll legit Igfgill 'liilil ,Eel rg A i ll l V 22:- 5 rj W 54' I 1 ' 25? 5 ' 551 l 5 E325 lliifif ,I 1:-2-5 1 if w :-. 1 ff -Al li W! V l 512 I liiii l . 155:11 jilfjgli lllffwll my guilt? fl l if' l lfgig, '-fiffghf. pd 1:31, X 'X .Nl W lk 1 i , I' V ,ie :SEBI lisa' liiil .liffll zlfflpi igiil 151+ ' ,P-23: ' .figl iiqji 'fell NDI. Certificate in Special' TeXUlC CLARENCE BERNARD SEALS Pro essor f Q. JOHN HARDMAN BARNETT, H lip df John ' Commerce, Georgia Realizing that an education is a valuable aid to 0ne's good looks, Johnny packed his Tuxedo and left Marion Institute for Tech. That was 111 1918- ,iu spite ofthe handicap of being. born on April first, John is nobodyfs fool, and in his twentY'tW0 Years he has made an enviable impression upon many peo- ple, both male and female. . '. President, Skull and Key, '20, President, Cotillion Club, '23, Koseme, Bull Dog, Pan-Hellenic Council, 122, '23, President, '23, Student Council, Textile Society. JAMES DAVID BREXVSTER, A T Q Jimmie Newnan, Georgia There is little we can say in addition to what the newspapers have already told you about this young man-except that he is the unanimous All-Southern Social Lion of the Set. He was born in his present home town, the date of this important event being January 9th, 1902. He hopes some day to become a faculty member. V Football, '19, '20, '21, '22, Basketball, '20, '21, '22, '23., Track, 322, ,23, Skull and Key, Cotillion Club, Textile Society, Newnan Club. x ZACK ST. ELMO CARNES, A 2 qw rrzackn Atlanta, Georgia This tennis playing demon of the Capital City boasts of the fact that he helped Uncle Sam as a gob durlngithe war, and still smokes Piedmonts as evidence. Zack came to us from Tech High. 4 To defeat Bill Tildenf' Textile Society, Tech High Club. f NJ., X- H N p , 'ii A A 'iz ' I fSW.s:wx-xw:1:..axxxxxx'-kwa xxYm.xmsxmxx x -L 0 N, 5 L' ' - xx J, f 2 4 .1 ZS 9 'Q 4 5 . 2 5 2 gi 6 22 gl :ii .fil .gi 262 lil rf l . 9 ' --uv- lima -'Iii 'K 1 'Q Q50 Q2 QQ lil ' xi xx X 1 1 X E it N 'N Q .E as S s S 's Q x 3 S 5 S N. -E S S Lx 'TQ K0 ff o 1 L LQ' l VY 4' A NEI ' l - Sc Xpxf . r' O . . 1. -2- Q --lf G' ' 1 O 1'- F- - e - W . - - ,.--Hu , . ::::.. S. fw' I --- . A v -1- 'gggggggimh W rx jxOb9N-:-s1-a-e'e:::::::c:-S:rs-:-:-:mf:-:--:-:-rc-at-Y-:-:-1-rx-'-x-'- 4vay.-f,.,,,7.,- l gf 5 Ng 5 t ' ' W' - 1 T -3 l' W ' A x .- 5, , K R - LA- -'-- rx Q ':::z,g,Eg v 'i' gm n!'- 2 fum: r H 1+ ' ' . X' 1 ,Z . -- lg, f ' D . e D .2 . -yo 0 QBEJ ni. fi? 7? ,fo K 3' , Il H.- x ' S' X My gliliimml unu mmmun TIPIFRII Y - i llliiiiiiiuuhih-ii... -l34L5g5if.,,,,,:,..,.., .,,,,,, Q ,,,,,,,,m,,5gg, Mmxgml wam.S .:5Mm:M ':i: ' ' r ,.. .f.,.,-. ummm ffn- . mnumgmm.,,,:l,::Egb:uugL::?um m.!?g if -Eiiiiiliiluiifa 1 i:n:ummmn:sm - L I P N I T rf?-EXW M ' Il I n II llllil ::::::m:::::::::::::::::::::::::::::::m-':'::: : :.: m:::::::::::n:::i::.:::::a:na::I::::::::f::mu:r:::::::l:::l:::::::::::::::::::::::::::::::l:::::.'::::::i- ,. -:IQ ff, xy Y A ' x , STANLEY WITHERALL CONVERSE, qu A 9 Vermont Burlington, Vermont ' ig Stanley grabbed a B. S. in Commerce from the University of Vermont and then caught the first , train for Tech. Now that he has an education, he Q will return to his birthplace, Bridgeport, Vermont, where he has-er-friends: ' Freshman Basketball Squad, '22, Honor Roll, '22, Textile Society. Q JOSEPH HUGH HILL, cp A 9 Buck S5 West Point, Georgia I Q Buck started at Auburn, but heard of Special Wg Textile and came to Tech. He was born in iVest I f l! Point, prepped at West Point High, and has a girl I- tqtgzy in VVest Point. QHe believes in patronizirg home , ' J . . uw 1I1Cl1lStl'1CS.D A 'mm' 5 t r QW My A mf' is viii , . 4 5 JAMES BONAR JARRETT yi' 1 : ffrazff Illllv Residence Unknown M , For reasons which he can doubtless explain Mr. I Jarrett refused to divulge any information regard- IQ, ie' ing his birth place, date, home town, -activities since entering Tech, and his honors. He also would give us nothing regarding his ambition. In fact, he said x nothing but, I don't want to say anything, and let . it go at that. So far is he from saying. I am also .a Phi Kappa Phif' that one might say he is super- S modest. , f 2 E g E f R: Z STERLING PERRY JENKINS, II A A Z fifenksf' f N. 5 Miaiana, Georgia 5 ,Q 0 Hailing from Columbus, the city of cotton mills, this boy naturally took Textile, and some day hopes ? to run one of the big mills there. He was born in 4 Z Midland, Georgia, April 22nd, 1902, but prepped at 3 Z Columbus High School. ' 2 Company Footballg Columbus Club. f -1 2 2 'e 5 fl it I - . 4 0 exit' D . ' 5 . ,LQ g . V Ogwaf'-'PP64'0AVf9YWf4'YffYfQ'ff'-W9'. - -A-WWW 5 i ' Kyarmzxezfssfsxfgaxsxxsxxwfawagwxwom-'w '- ' I J - X L REQ! rl Z O L Q , , , ,x,.ANNQXQXWQ4 to ' Lam K, i i 'q ffisiesia '- ' H im Rx I ' D l'5 '5?ix 'i,3, Q waajfb ,Q--. v l . I. I I 1 fi I ri' 'N ' 'jk 1'-1 .aw 4.5 5,1 S. ,. E ,n 1 I , f I - I g 7 J X ' - 1 fe '-A- S - f,6T' iN er . ' 6!.9,,2, .51 . A - ,jg 6' I .- -g y. ,,,, .,:-.--1,. N-mn ---1-1 53553525-irJeuw:g,:.g5p1:zsfe:r . xi uuumuxwunmu 1 P I A if I I ' ' I b R , - ,551 gli T H I . J , N, . ..- - - :mx:::::::::::::nm::m::::::::2::::::mu:r.:::::::::::::::::x::nlxz:r:::.'::sma::::::::x::u:::x::::::::x::::xl::::::::::::. ........... - .'ii1......Vi:s1E222 gggimqg, 'Y E. , ,,,, ,.,,...,... .. .........,f-.,. .... --,,- ...-. ..... ..-.......-..e,4::m..----- - , . - Z-Q' . gig X .5 CHARLES DEXTER JORDAN, fr A e Dew jf Columbus, Georgia 5 Dexter is something of a Bohemian, as he has at- X tended the University of Georgia as much as he has , gf Tech. He was born November 24th, 1898, and has already won a place in the Musical .Hall of Fame g by his banjo playing. . I Company Football, ,183 Technique, '18, Second l 5 Lieutenant, R. O. T. C. . I f .1 QI - 'i 2:5 ' ' I I 2522 f I 1 I E551 s-: i V JAMES DONALD LEWIS, E N . Jimmie L L fl 5' Eg: y E Concord, Georgia ,' I ,fi ' ' H-3 3 Jimmie is the youngest graduate man in the de- MMU, ,,.,,v,, partment, having been born on April 26th, 1904-. - I-Ie -tossed the old ill for Concord Hi h and then r .. . P . 3 ,FBI K came here, where he played baseball with Tech's :E ? freshmen. 1 , Freshman Baseball, '22. l l wig l l me , . . will Q' W t W3 5 ' l 1 -mv, h ' O 1 ' p ERNEST DUDLEY NEWTON, A E fb gjmi fy 4 l il ,,,. I . 1' fp ' ffEd 3 H.-Qi 1.5 Jackson, Georgia I ll N1 f 3 Ed and his brother must intend opening a mill, X? as both are taking the same course. This one was born on September 6th, 1901, at Jackson, Georgia, fs., .4 and prepped at the local high school. That's all we ,H - could glean of his past. i x f Frj: ' ' ' N, 1 I . 4 s X 3 1 +I-I . s 1 Y X WILLIAM ARIS NEWTON, JR., A 2 ep .,.' rr 3 1: ' Q M Kid Q . Q gl , Jackson, Georgia Q Kid, ,the other Newton boy, was not so bashful 'Q 35? and told us he was born on February 24th, 19041, 5 g1eda1?g33'Cg Qilt Eihethfreshman baseball team of 1922. -5: a 1n1 e at h d t - - . ' Freshman Baseball, ,25 PTCPPC a Jackson High. 5 as L . N N , U Xu if-fffc D IY -'NNEiQca9:1fsmruEws5:I2xfrqcmzzgsg-rxx4',YXxP5-.xEP5c'2v.:wq,1.4 Hs- , 'E - - 7 i A ii V? in Y , Qiaqibiv. X05 ,:,-f TWV ia - ' i 9 'J 2 J v 5 ' L -95114. ..--ny-4 3 Z 5 is I. x 1925ull is 5-5,gn-gg. - Q 2152 I n O: , f..u. - X , Q , 1- ' 'U' , . . . H K ,Nxvh ' Q' I -:-:-1:-.,-,tj ji- .-Qs-s f 1 . -4 - .1 1 1. 1 ' - -K, ff I v-1 4 1 if X lllillll mi xlnxpli Ill mm m nuunmnllmninu1m1IuxonnnnnlummmmH un-mm. . 1, ,. . mi ...hum un :-wmmuumm 4' . . . . .U H .-um. .Q .H-.. ' - ' fm--mmm in-5: n-nr-111-Ivan:-H H I mu .luv l!'i':' 'Hin E W.': H T H ml L ,T ' .. x!:. , ' ' 1 - s:z: l5.llu:x .a.mu::sz:::::::u::.':::r.::::-.-:::::m::.-::::::::::x::: :nine.::.::..:::::z::::::::::::::::::::: ' ':::::::::2:::lm::::::::::::::::a'.::3r.::m::::::'.a:.m:'.::::l:::::3:'.:::::::m:::w:::::::::. :!!.......i-fm V N, 1-1 I Q r1-fve-f-:vfs--- .... M- ,Q l - I Q W-9 E a - -- i- -f .- 0 LV' 1 ngy, ,. -TNQ Lili 'l'f.,hf'i' -' . . CM ff ' ' N S HOMER WHELCHEL ' 'CaZiope Y Cordele, Georgia. R I Tech is always sure of points when this old war- horse enters a track meet. Caliope holds nearly all -. .. the strong arm records and is also a corking good 1 --., football player. Born near Dahlonega, Georgia, De- -3 cember 31st, 1899, he went to Tifton A. 8 M. for A his preparatory work. 3 Football, Varsity, '20, '21, '22, Scrub, '19, Track I Squad, '21, '22, '23, Z. Z. Z. Club, T Club. I ISAAC HARMON HENDERSON . ff-Ikeu Anderson, South Carolina X l! ilnlspite of the fact that Ike is married and the father of two young Hendersons, his one -L 4 desire IS to be Sultan of Turkey. As he was born in 1894+ at Abbeville, South Carolina, there nlnb QW is small hope of his ambition being realized. l Textile Society, Matheson Literary Society. fil l wil GOLDEN SANDERS HINTON , ffnockff . . me Dacula, Georgia , The writer learned more about geography when he found Dock was born at Dacula, gf I Georgia. It must be a good town, judging by its representative. Dock will celebrate his X l ' twenty-third birthday on September 26th, next. . EARLE G. JOHNSON Q5 ffnickf' Z Atlanta, Georgia if . 2 Tech offers to the world the most dignified Special Textile graduate in many years. 2 He acquired his dignity at Tech High. He was born in Cedartown, September 4th, 1901, 2 and is now a member of the firm of Lyle, Johnson 8: Jenkins, Textile Engineers. i Z LEE HAROLD LYLE, rr K fp Z ffl,-mf' 1 Atlanta, Georgia Z Irish, Atlanta's famous All-Prep Everything, announces his graduation this June in ,Z Tech's second hardest course fCommerce, firstb. The '4M1ck was born in Atlanta on No- ? vember 23rd, 1899, prepped at Tech High and helped out in the VVorld War. Z . Z 5 2 4 Z a I . Sq-,Y .1 , O oX .f '-F3 Ox L i. ra ...... L . . - . - a. ' XogE14M, W,,W,,WffWffwnzffffqffgnpyffwff1xff z I f - ,H .. .' ,. g 'L 12. 0 ' ' - .i ' LO F 5 ,P SZ! 0 Q 'film ' . 9 K ,ggi l rf .7 fi fi .C fi .:, 4 I F9 . i .QI I3 lik! -'.' -'J -H -:v Q-1 5 s AI,- 5 , ', .-.. - gig i ,V 1. - ' 1 1'.L..a41 gs,,is.1' . - -I- irrie DL i J --f, ..,,. msn Y..Y 1 ..,..,.,.. ,,,, - 4 .,,.. ..-., .1......,, Tuma Ei.,,.-...,.--fjzw, - - .....-sm.-:::r.::m::::::::::::::: --'-- um:::::n::ni:::::::::::r::ms:r:Inam:::::mama:::::xm::.1::::::::a:m:::m::::::::::L 4 ifQlZ,,,l .N LEM H iffy I ig: rp . , . Q iilit' 'ft' S al A h ...if Cem 103133 111 , PCCI rc 1tecture JOHN IJLEWELLYN SKINNEP., B.A.Sc., M-ARCH , 5,5 Professor A ' fi? Ez, A. THOMAS BRADBURY il E3 Shorty ll 4.- 1653 Atlanta, Georgia if A. T. is one of the two seniors that have stuck fhfff with the special two-year course in architecture, but i' during this short time he has shown the boys in ,iii architecture by his hard and consistent work that fi he is going to ,make good when he gets out on his 'Fig i own hook. Shorty is capable and thorough and loves his work, all of which assures us that we are going fiiff' to hear from him in his endeavors in the architec- tural field. ' A Architectural Societyg Beaux Arts Mentiong First lib: Z Mention, '23. is-Nfl? 4 . petit V151 'xiii MARION TAYLOR DAWSON Bon Dutch SIip,' 'A , Atlanta, Georgia fy' Y ' , M. T. may be his initials, but he's anything but empty when it comes to gray matter. This does not necessarily mean that' he is brilliant. He is a plug- xh V, gC1'. and 3'SJClClfC1', for he' is the other of the two l senior specials in architecture that are left of the . eight or ten who began this difficult course in Sep- ' N tcmber of the year of our Lord, 1921. ' Architectural Society. nf! I 5: X , 4 :fi i V ifiy 5,2-it :IEE l EE: f , M 5 I ,if .52 153' f ii? E weed 1 A ' li' . TW t o Q f vie A ah- s if ' : V l N.'-:-?'3xY'-:RI:425.Xj.f6gv-3.:-1-:g,gN4.35153531.33-Agqgg-5.N.5Y.:,:,:S,jx,999, is QQ.: MGE- I 4 ef - f-X 1 a if Y Limit K' A ' e i iz. 5 - 7-O 9Q9?22w3HhTvsXN5b2xRwbmwgLxxxsQs.xXXsx o PJ Q 'I QJO O LLVN I El is 4c1 'W . ,,. 1 f A t 19253 'K' 2.2111221511-11 arg - .- . - 'Q 1 ...:.s'wffuf.w H5291 . I 4 X f x K X ' P' ' ' -. 1 'A 12 ' 'A 1 1 .Q v N, , ' Vid!-4 '6 no-:-0-Q N4 Q N .v ,0 I 1 J ' ' 4-... 1. - - 1 1' ' H 1 , nu 1 1 En n uuu lun IIIIIIGIIHllllIlmmllIlinnliI11muluullu1111111111111111111 L 11 lf 11111 11 111141141.uxiu1hrn115111':111m11n111vL11171.11 -war-11 -1.1-11111111111 111.11111..11111-1-111- -1- .---vm-.111-11.111-1 11:-111-111111111 1 11mm 111111 211135 , .I I ' xx ' -1 ,,El1'y WH,-1 '15 I-'fl ,tl I 4 E ll EE. .as Wi' llli E 3' 511: ullliil!Ea:L...1.1-nu..-. .i3II:llIliIEIH:lSi:3: 3W5I'u'iq'iEFl2iiiliiiF:iiIiillG 111311I1Tvimlllallll5131552222132Ill:II233522::::::l:E:IH:H:::::3::HHlmsiiniunniifln:::::n:Hl::l'::::23f2::::::2:n 'n:-'Inf:::::::::::HH::::::l:!l- ...--num-. 1111-.sp-:ffifjl 0 19331 T S 2 Q 5 E X Bachelors of Commercial Science x ot .4 I. ' 1 b limi! P ii 13,11 1 b Wg ' 'I V1 INA Ill 5 4 4 Z f 5 4 5 5 K K 4 5 4 4 4 4 4 6 4 fi 4 4' is 1,1- 1 Y JOHN BIIADISON VVA'r'rERs, B.S., B.Sc., L.L.D., M.Acc'rs. Professor JULIAN WHITFIELD BENSON A dmiraf' Atlanta, Georgia A 'fAdmiral hails from some part of Georgia, but has been in Atlanta most of the time since August 13th, 1900. A born money-maker, he began by sack- ing gold for a large bank. His ambition is to live a million days and make a million dollars. Commerce Clubg Treasurer, Senior Class of the Evening Schoolg Alpha Kappa Psi. ELIZABETH .BAKER Sis Bake V Zebulon, Georgia Sis Bake graced the metropolis of Zebulon at a date which she says is unfair for anyone to know. After attending such places as the University of Wisconsin, Columbia University, Simmons College, Valparaiso University, and the like, she realized how little she knew, so entered the Evening School. She holds the unique distinction of being the second woman to graduate at Tech. -Her ambition is to keep someone's home budget. Commerce Club. ' EUGENE GRANVELL ACREE 'Genev Tucker, Georgia '4Gene,' was born at VVin0na, Georgia, on May 10th, 1897. After prepping at Tucker High, he came to Atlanta. He entered the Evening School in 1920. Gene is arsenic among the fair sex and is indeed a likeable chap. His ambition is to become king of the advertising world. Commerce Clubg Executive Committee of Senior Classg Delta Sigma Pi.. off J L lla is O X 5 5 0 ,Q ,- ,Q 9 r 'o 'o k 1 'v A O 9 O 6 x W ima -my . 54 --4 Qi r fn--Ii I ff l '55 lllllrn WE! .zu ll My 5. 90 3 ' . N O f . U xt ' - , o ' L ' J -s 4 OW' -. 9 ' W 6 ,Y-g .-,-,,, V V, 3 - I ..::if!:.' O, 1 Ja' l ' :-:i-:i55F'- ' ' ' A ,, Us 1 W al - -0 !flZ'ffl.ZfWff!lflfQffZZfffffl'Xlf259'!5QS?ff2'l72'fff!XffA A , ' k 1 - I O I L 'A , - -' L - , 1 ' -A ' 'I ' ' . Q --m:.::v' . , I , 1 - --111:e.- g uf. V - uh Q- :5.,,.f o L V MOM K' +41 ,QR ad l 4, , .1 C- P' 'Q 11- fp cz E5 F r l l l If -:J -: EU: 11 4 '-.N V 1 n.-1 H1 .v. in .-1 ,. .V iw. , . UN.. E 'K Xt wsfsf' l ,Y I - lf1'or-N.. i n ' 1 I. ........E..-.,....:.11.'Ef:-.R..... .-... 12 ' ,.,, ,Q .... fl ............... ..... ..ag..:Z2.ii-----n--.m-----i-3EG14-- -------1-- it I A .E 'I' D L V P PJ Xrxx : 'V 'N H E ' ... ...wa-------:fr::::uzx:m:n::::::::::z::: x::ax::uu::::::x:na::::::::.':::rr -'-'-' ::::m.:::::::::::::::. ........... - :EEL ...... . 11. 'V lr , ., aaa ...,.. ... ,v., -v-... .L.... . ,.,,.. ......:. r-,---1531-v v , ' ' :533:m::'mr m. ' A ' 7. V E Z , 4 3 . i ALSBERRY LEE CHAPMAN X Q Chap h L Atlanta, Georgia Q W 7- I I 5 I Y. bg Chap doesnit talk much, but is giyen .quite fre- 55 quently to deep thought. He began lns trip through ' life at Dunwoody, Georgia. He entered the Even- ifl ing School in 1920 and has made wonderful progress in his studies. His ambition is to become a Certi- fied Public Accountant. ,gf Commerce Club. V MAX M. CUBA 4 -Atlanta, Georgia . gg- This young Hebrew was chartered under the laws of New York on December 10th, 1902. Realizing if the keen competition, he wandered south and stopped Z im, here. Having high ambitions, he entered the Even- Ez: ing School immediately after finishing Commercial High. His ambition is to become a Certified Public 'Q Accountant. mi .l Commerce Club. I l 4 ' :fp PAUL ALEXANDER DAVIS 'it In 'J ,- ll my frpaul. 1 ' Atlanta, Georgia 'illll Q . I , Paul was born in the Seacoast town of Brunswick, , N but moved somewhat inland soon after this event. ,JN 'll He received his early training from a private tutor. Au . His ambition is to become one of the world's leading L E pipblic taccoplptapts, but we fear he has too much N in eres in - e air sex. a . . , VgTefl'SU1'ff1', Junior Class in the Evening School, 5, 1ke'P1'eS1:clent, Commerce Club, Alpha Kappa Psi. I' K, fa A V CARLTON GREER GEORGE E lg.. Lloyd George E Atlanta, Georgia Qi ' - x T0 22181166 at him one would not think that he was ' lrsi born in Texas. Howeiier he has .. 5 dart of 1. If , , spent the gieater ini l HS 1 e lin Atlanta. He made an excellent fgecolidtlat BOYQ, High and Commercial High, en- .efis TC Evening School in 1920, and has special- R la lzecllm financial SubJeCtS- uL10Yd Geofgev just nat- - Mgt Elllilbiiicfkaiiifistif algytblng that pertains to iinance. His limi. finance 15 0 CCOITIC anxauthority on international is ZW l ' , -I g Commerce Club, Delta Sigma Pi, - 3 . gf' li S . by ll 0 xt- '1 SCWO 5 - OM' O X ' l 'iA' ' O Y -9-A Isai ah : -xg-F P LQ? Q4 Owe:-DMTsszvrmizkfs-:-:-:wm:P5af:-:f.:-sa:-:-we:-xx-za-Rsczhz:ff,o:fz4,g,4., l 'Fl u V ' f - M mf-ii K. ,gcc el Q as' VWAM?W9Q'm9QN?r2S2QSmv:Q,xmxiQXRXxxxxxxxxamxxmg'iQ,q Orig Mu? .... V . .. , f ,,x X HS kr' I TQA f Lk '1 'q C ,.- .-w. il fri . . . ,--1 21- -.X . im?-F X Nm!!! 'Ii cligg'-til 5.L, iiilqmgilill :gm um nmumnmu w ma. Hiuwm..zsL - af-3171 4---. . -.-- ....:. Q..:.I..Zii..::....ma1r- fa-3-3 gH3ffvH'P : - 1 sggggsaqmwiglagggglqgi mv 'IW T H EJ V ' M H -....g:::55?:x-M ? fon:1u-nl ik 3:11 'T' -Hun3:::::'u:-': uoE:J::'-4'::3f::::s3u':a':'n?u:E:T11H:::ii:51:33:31Riagg::mmfL'm rJ:::::::: ::':::::T::l EL ---.a. NORMAN L. HAILEY, II K Q Lizzie Hartwell, Georgia . Here we have one of those deep thinkers who is always looking far into the future. LizzieH hails from Hart County, where he was born on Decem- ber Gth, 1899. He prepped at Hartwell High and entered Tech in 1918'. His specialties are Water Nymphsf' and his motto, Speech is silver, silence is golden? Track Team, 518, '19g Co-op Clubg Commerce Club, Gene Turner Bible Class. LOVELL C. HARVVELL Rufus!' Atlanta, Georgia Rufus is a fellow of many accomplishments. He's a basso singer, student, teacher, and last but not least, a bachelor. He was born May 13th, 1888, at Friendship, Tennessee. His ambition is to become a Certified Public Accountant. A real man. Commerce Club. JAMES PRESTON HOOKITX Lp Hook - A Augusta, Georgia Hook was born in aristocratic old Augusta, re- ceived his earlier training at Richmond Academy and then carrie to Tech. WVhen the World War came, he answered his country's call and wentoverseas as a Lieutenant. Being fortunate enough to return, he determined to finish school. Hook has big am- bitions, and we know he will succeed. Commerce Club. ' DANIEL COOPER INGLETT Coop Atlanta, Georgia '5Coop', is purelyan Atlanta product, having been on the market since September 19th, 1899. He prepped at Tech High and then started on the one way street of life. Time and a little experience im- proved his judgment and he entered the Evening School in 1920. Coop's line is ladies and insurance, so of course he has to wear a smile for everyone? Vice-President, Junior Class of the Evening School Executive Committee of Commerce Club Alpha Kappa Psi. X , 50,90 si IQQII 'N -4 of s W gl lily . iv 5- 'III fi 1 4 I Imp LJE 7 o Y ll ll A 3 ,B vi X w H , A 1' H,fmwWfyfffWffmvM ff,ocff-SMSEZQZO fl. 3I , Y O K R AIVJEQ X 0 5 5 C 0 6 P' V ww , o Q- 'I ' 'N Q X NL A K so 1 ' ' Of, ' ' 'fasaasagihm------' - -. if . -4, 3 7 ' l ' ,oc K . t ' - 1 We ' eases:---' 0 Lwv X Ox -'i.a2 1 0 Q gf' C -'1 n. 5.3 -A rf. 4 -C4 .- .u .fn V' Fr' ' . I ,f-as , .A isle-7-M9 -rf' . L I '.',A uen, ,Q ,,,, 331 .,,,, 3 ,,,,. ..,. ----'-- '- f- -'--'- f ':l'j'jigiLg4,j H? '-Q ni 'iilzuiiut am' nl6ll!llFlll4ill0inn14R!iiiildllltilB2illlim:e21-er---un'-n--uv-mvfl P 'hi A 1 T - E L .......- --- ::::::::.:22::::::::nam:::::'.::::::::::::::::::::...::::::::l::::::::i::::::::::: ll:::::::::a1. ..,. ........ - :.:1........2 ' U-A ,ea-gg-W.., . .,,.v. w.,Ma-.WWW-1 fm'--- g f 4552 ,Gill ' f-lr Q m.. Z 5:51 Q I ' E53 r CHARLES ROBINSON PERRY 5. I . ,, V7 A I' , Charlie V Atlanta, Georgia A y Charlie,' is a native of the? Gfitle Cilifgb hjgigg 2232 y here since February 6th, 189 - CIP PP ld W g y 55, High and entered Tech in 1916. I'ne.Wor ala Y, one thing, and another Q19 S. marrledl delaye Q Charlie, but having determination he returned to gg school work and will now gradu,ate. I4 iff Band, '16, '17s Glee Club, '15, 17 4 Treasurer, Com- merce Club, '22, '23, Vice-President, Senior Classg Alpha Kappa Psi. 5 JOHN MONROE PHILLIPS y Holm 5 Vi 535 Monticello, Georgia . v 3: iii I A 132 On the morning of February 25th, 1901, there was if much excitement down in Jasper County. A babe , ff' had been born who had all the ear-marks of a world W I 'gi leader. Entering the Evening School in 1920, John has taken a leading part in all activities and will soon be the proud possessor. of his degree. His 115 r ei, 4 Us img' z 'YL 1 , 25 ! 532 f hifi glljj 454. 1 :fri I E12 LZ, girl 1 E531 l Hi! FQ: Za? 1 if? Q. , E33 . ,cg . s' I N fx. '51 wtf. l.n', as 59 55 I S I 5? N. Q. N EX .s 1 i V ,- favorite indoor sport is Bull Slingingn and Heart Breaking. His ambition? Well, you can count on John. Secretary, Junior Class, Secretary, Senior Class, Secretary, Commerce Club, '22, Blue Print, '23, Alpha Kappa Psi. CHARLES HAMILTON PITTMAN I Pitt Atlanta, Georgia The country Jake who said that a real man could not be produced in a city is Wrong, for here is one. Pitt has been here since June 3rd, 1896, receiving his earlier training at Tech High. The war held him up a while, but he later entered the Evening School and has since married. We will vouchsafe that he will be one of the worldls leading account- ants before very long. Commerce Club, JULIUS HOOVER RENAULT rrjuleu ' Atlanta, Georgia M 1 fillltsepiember 2th, 1892, at Orlando, Florida, it Got ef ES fhffugh Julel' was destined to be an Alli- sa 01, Ht 1115- folks moved to Atlantaand he has developed aspirations untold. He prepped at Com- fcfgggaihglglgzi then tried singing basso. He en- , mug Scho 1 1920 y ,. doubt is developing intooalgeal Ad1c5?o1P'?50nd any Commerce Club. I 2' 50,0 A Om2 e E4 1 ui-' .1 ,, , Ig. 'riff 52 -ug L., l 12? P Ig.,,,,: sr ll n ul? EIU a' li I4 l x L E 2 S IS S N S S E Q S 5 N. A M Q L 1 V, I xQQQRS6NLWA7NXYiiXXXXXNQ.XKXXi N a P' - VX Qsa , f A , Q 9 ' as . o 3 7 J' voir - l EX A ' K Q .1 .ui QA to 'siezabg L6 l i . i . 2 f I 'F' .::::::g::.. --Hr - f r W L , W6-Pxxvi-Scrfeizvsssz-55:-3-:-zzixwisfizizkemklc-bl-rxcX xx fowl:-f44fZ-1-1- ' ' Z I X Y W I -, 1 Q, L ' x . MORE Y Q g gi' WO, W' . ' asians - . o --:,x A J- 4. ,Q gavf' ' . 2, N V ffm .1 D X X 0 0 qi 25 I ' I Af 'M ful X ,- ' r - ' ' 4'-r. .. ' ,Q-- 'Sh . , . V- x I - g I. l K , A , g - ,Ag -,fy fi n. LPQX,-5 N Y t v-O-:-C-.,.,.,1j A x 'hxfg w' Wt? f ' 4? Y,.a,1-1 - '-'-1. -4 -5 ' x ' Nr. ',.g,,.., 2- - ...l.gf'- , 1 A H, lg 4 I R N' P' l ' -. -, .-., -.GW '-1 7' . 'J ' - 5. . 1 .-4: 'illumggiii5E2:::gns:vx::mmnlsmhuurasumsvnI1unninuxnnsniinniumlivamem...nmhii-I-llwmm-.1-..-.-...Mi.anQiI1111Q11.....af 'mum.m...w- nf M.1..-............H....................m...-..n.------ , . . U.,-.mf-mm.., ..... ,m.u ns 'li:1E1Ef.::5E! 'Big T 1' Iii' ' 4 i - 1 ll 'l in f fl' I are 1 ix I il l , I H i i 1 1 5 lwlv Im WR ,lil I I y A -I 5 ig -'ll hl liillfiza A i l 1 I ld l rlnT sfriiul Riu u u I 'illunluusfulxiu :I 3 I l In rule' I 15' W ' ' - ' 1 V if I ' l ' X v S N 'Q 'Q 0 in Q o Q . Q .Q ,o ,Q 4 Q 'o . z ,Q I 0 E I Qc X Vo 'I 'Z 'S 'E - I ug I .T P 'if-f 1 PT 54 r 9 pw! mfg? un J 5:53 ' l NYXNNXNYAQxXi.'isNNbP56CkZ'C'62QQf3ZSx N NEZSBRSXXYPSPA . YS-?Q5Z7ZQCx QQx l l ..,.5.: . . JULIAN MURRAY SHROPSHIRE E J, DIur1'ay l Atlanta, Georgia E . J. Murray arose at Rising Fawn, Georgia, on i August 19th, 1897. Evidently the place of birth had something to do with it, he runs like a fawn, too. He could also make it interesting for IVeismuller. All of this was discovered at Tech High. Aside from that, J. Murrayn can sing and is quite a uladies' man. His specialties are reading funny papers and arguing. - Masonic Club, Commerce Club. RAYMOND ALONZO SPITLER, A E 111 rrRa-U71 Continental, Ohio Although Ray was born in Defiance, Ohio, on Thanksgiving Morning, 1895, he inherited none of the characteristics the name might imply. In fact, he runs as smoothly as a Red Seal Continental. He prepped at Continental High, entered Defiance College in 1915, and served in the army during the World VVar. Ray's ambition led him to Atlanta and Tech Evening School in 1920, where he has been an outstanding leader in all activities since. President, Junior Class, Vice-President, Com- merce Club, '21, President, Senior Class, Blue Print, Masonic Club, Delta Sigma Pi. IVILLIAM RICHARD TURMAN Dick Atlanta, Georgia Here we have another Atlanta product. DickU made his debut May 6th, 1900. His hobby is school, for he,s been going most of these years. He prepped at Tech High, graduated at Tech last year, and is taking some special work this year. His ambition is to make a Chain Store out of the Home Office through good management and Bond selling, believ- ing that the Advertising and Sales Manager should be one and the same man. VVell, Dick, there's noth- ing like trying. We wish you luck. Treasurer, Senior Class, '22, Commerce Club, Alpha Kappa Psi. EDVVARD BLAIR VVILSON Eddie Ripley, Tennessee Eddie', is nothing short of a mathematical wizard. Aside from trying to drill trig into Frosh En- gineers' heads all day he has been coming to Night School for the past three years. His ambition is to know something about everything-evidence of this is seen in that he has attended Vanderbilt, Univer- sity of Chicago, Columbus and last but not least, Georgia Tech. His hobby is fiunking freshmen. B. S. and B. C. S. 7 'filo z 1' 1 . 'ofa' nl i l f 2 N 1 'x 'Es 'Q l , , dna --il k-9 m .J gi: gs. is X as I if S .. s '55- P 2 Q Lu LIONEL K 5 55444 PPI, V' o XK1.'.,. . 0 1 i' N ,IX oQ'4 'a . Q -, ra. E E 4' W, -,-,,,, 7 ' .4 - A-9 - -We ' f 3 - - - . , , . K . .. ' 1-A 2 ' - - - . .v -.:'1:r',.'.': AC! V, , , V QQQ 5 V 5 R, 10. f'W4N 7'?9' 0' 3 L ,, , ,I ,A ' 5. 'in A! a- . ' ' L ,. ' ' t . +l't'tiii5555i go 4'-,. f c 0 ' X ...R Q -- ,- - ,F , o ' gi'-V , '50 0 ima? Yearly Expenses .... Fnvorite Movie qXc'treSS . . Biggest llootlieker . . Most 'l'imicl .... Lzizivst Most Popular . . Most lntelleetual . Prcttiest Greenest Best All-liound Athlete . . Best Football Player . . . Best Baselmll Player . . Best Basketball Player . . Best Track Man .... Grouclxiest '. . . Luckicst .... Most Dignified . . Biggest Roughneck . Cutest ..... Most Conceited . Biggest Eater . . . Most Modest ...... Killinest Lady Killer . . Most Moral ..... Biggest Grafters . . Publicity Experts . S417 Polly Peachtree Moses QRe-electedj Little Elsie No nominee Red Barron Cupid Kennedy Love-Bird Hauenstein Hunt Barron Barron Morgan Jenks Daves Fleetwood Quartermasters Hines Armentrout Papa LoveEBird Sutton fby landslidej Fleetwood Carter QHomerj Thompson No nominee YValker Gus Edwards XV? X:-:JZQ-f6ss:::v:-'Q::2:1s-:-:frm x ,-.-rz-1-My-1-1-1-:- 7' H' I7 ,J Ag 'Q Za K q L L K ' 3, ua,-s-vm- v- 1' i Q- , . Extra Cheeks S1,133.625 Sally Springstreet Little Elsie Fleetwood All of us Mitchell Frye Walker -Hauenstein again Staton Davis Edwards Staton Welch Frye Blue Print Staff Staton Sutton Moore QLarryj fBurke, '24j Armentrout Q Killen Krauss Beaty Moore CLarryj Unanimous 1 1 '4 E ' . 3: V V-5 , It i ini I 4 I 'lm' Um .4 i ', is Q N N, N. N E S if s 3' S X. S gl S N E S N N B N Q s S N S S S s . 5 , C Q- Q J. No? l - I ml y L Q L: O 51 E x. X. A rp wail, X -.jf - , 7, S ,154 :QQ X is YW? gee.52.325611.AXXwX5X:EiT2,mxyS35 4'N 'qfiix Oil- Q -:'. ': 31rf5 rziiiii' 0 ' ' f WW Mun fi -1 'L BQ, ' V A -' ' I 1 v x G X gg 'If' O fx ifffflf-gijyy fo in '- E 5552? . S F11 . . . I 1. 'Eg'-'33-EUZW ' h l . ,EP . E E Dinan. ',E:' EAST? . wiv l . . . . 2 - C 1 3 ,Z R .. ...gf-wg F ' if., -f 1 1 . i y, . . E S . . ' I in V? : i - . . . Q ,D . . -1 Q --J z 5 5 : il 2 l ' 1 U N 2 '. 519 . . , me-,ECQQQ-gE,ZQZg,-1 M. 122 39 gates' X geo,- 2-I -HMM'-205 UQ H u f n-1. 7 if C ' . . D -574: 52 Wen Sl -lil 5fff ' 5 sn: 3 i-3 . . , M ' ,.. 5 .: . cf In H 5+ . 1 E ' ' ::'n1' Z. . Wye? ro - 5,45 Q1 K Eg El if ll ilu ? l-E A LQ can-4:--H-ir-ai-U:,QU1 - I gaeeeegiigg -' Ku' ' ES.D,::v:sv:1,::,ZZf,g'632l I H Eg it i-n-i-e-1-e-f-v- .- , 5 ii! gg '-ugh? t Q'-I sw Q05 EL U2 - A r-1 O ,,,, Fl U Eg 5 -at s 2 5' wcgrs g N . S 2. Q. Z ' gy!!! H - gk? Uir, rv N Ek K l-I 2 'H r :gi C 1 Q ff . , 2 U1 a H :P ,, Eg 4- E-- F i-, If og ,iS32?3'fS1:-wf.fg -:2Qs:r.v:i2xassZifNb:mQwzQ.mmt ' lf- t QE ,L M L Lv? H A- . A A A 4Ef-5. tltllm: ' we ee -e --offs S W - W - Y X fx. xx ff' ff,-V,--N . gf f vff, wf ,, .tm-,W R ,,,,-- - was f fi-,fr xg., I xy, -Lgg 1: 71 AZ-qty 1 - A. Q---Q, N,-1 :,fZfT -Y-wigs v, 'W' Eff -44'-X-W--141 ' X'q?'-----:,J-sir ,U 'P -fx Q. .1 W. i . V N X. 41 5 f, '. xg, 'J Z'J M mi 1 Iv sa ww M iief NJ fy 'fx 1 ' X maiiif:-. k I 5 I Y i Y 4'- EQEAL .,-. . X2 --, , . ..--. , A - 1 I , L L . , if ,jffgg 'pk ...- .A,. .. W ....v... WM.. , ... -...,w-,.-H. ,,.,,, 4- , A , T vw ! . llgrixl 'gl new S W 445' N 11. A , WSW S Ixfsil 12,3 S5 f IE R A. , 55 Q' Q- iii! 'V I ' i 2212 l 4 ,ENV l 5+ ! if 'Q ! AQ ! ig 1 QE iss 5 32.7 1 1 1 Q v 'mv 53 GJ!! W A vw. r ' P.. I my . f sz 1 1 'Y ' Uv, 1 ' E N 524 532 Q3 ij' ffl 1 y Q 5 Eff V , ff 4 3 4 Z 5 ,Y JL ow Q Q f 2 K ff 0,34 V --f -.X 1 M ! M .,,, , 1i7 ?ig2' .Ci MA:fw ,Wy 1 R529 ILg?bZb:aayfffffMmHf24fizwlwmill'???5E9E555f-'fff?-1-545i?lf?Q,3O 155 1 H 1,3 Oggmf:-1-zlsfrz-:1:1:::-:-v:ir-1-szsipbtmifzizlf--:-:-s rp'fgxa-:-xmxxwc-axxxx:-:-rxwQQ .X 'A Qjd A' L V W ' J' 31m f 'fm'Qf L 2 E44 'IC 1 u -f .13 :Qu NH . . .if . .fm- 1 ITN. '1 f - I ...F ,,., I 1' -. m f. ,,,, Q ,,,, j,,,,,'f...jIIIu.fa.z:: ....- -w1f---15Y'f--f-4 - ' ' ' 4, lwul1-l1numuAlldlui1L-:?iToi.- f-., .,-I..fi1:.AcE??'--f-m- ---v-.,-v-f.v .4--,mununu--A 1v 1 UW' ' M MU, ,W ' 5: W 'L P ILI te fi 'hh I i i Z5 ' l'll3f.3lui2:u33:l3:1:ll l31:E5ZlIFrnnlilfliillililillllliHI331533132I5lilillffiilllflifnliailslnlgHFIZL ,.....,..-- -.,..-nn-T' Mi an ' J m ...,.... ,.,.. .4-1.1-:,.-...Mmrfm-v-'fgr':u:::: ' ' ' 5 T-V K fs A 3' X if? V' 5:1 , if f , E2 A if 'ff E25 f I rf f E it 25: gay' ' W' I V' ff . N 1 in Wg: i sae. :fit 51.3 r .. thi: I ' -I ,X tt? 'le' ii-if 1 N 5 Htl - N Nt my ' 'Qi' rgit, unlor Poem 1 0 it . . f 5 For two long gears wehve gone the gfllf, J A X ,K .-1 zcearg, heart-rending, studious state lVhe1'ein the rnettle of the man is tried IVitlzstandin,g tempting pleasure long denied. Khin' We shal.-ny, qzmlfy, ignorant freshmen were ll- ':-, When 'rst we met our ro s without demurg 2:5 is P k And then 'we lordly Sophs perforce became ls No whit detractinr rom that lordl name. r J 9 N l f N 4 . I I X 55' :ind now as Juniors we have thus become F e-1 , , . . . 1 m ig. Zhe backbone of our social life. And some ,QW Have bent their energies to stand foremost Q Among those heads, amid the struggling host, ig! If-4. . NI That lead, and in that leading strive :EI To lace our Alma Wlater in the drive re-it P . X N For those ideals the best of men hold dear, The criterion of a finished engineer. E , .ft - ' N , - A N Accuracg, thoroughness, service, honestyg Q E53 Four building stones for future prosperity In after life, for there again we score Befitt-ing a man of twenty-four, a -1 W. H. V. 1 , . x jc u l X mfeaqeaseaesncqggozwmwsammvgvawkifsmvxevfxfwgg ? A- 5 V -, 'i ' ' mu:-' ':-. . I ' A'-' Q' :E .... H-- LC.-: - Q -ixxl-x.2g5!L '3i-.1 1 , I .5 A Y Lum Z0 Q 'x,+f.f'+W r0f X nge - XL HW g G -J if -1 ' + f e. Q 7 g gg g g M V Xe t A f - ogy' FLA ii -et G - 1 1 . , L Y m JF' , -1 - :x L L pg I' O Q! f K LT T 1 , Y D ILQFK - 10 0 .T I 4 ., Av txt...- J A 'H F-7 , F. R ,114 1: ...- iji: ,-,. 1 -'rl-fr 14-.-q,,.!t: I- I X. y ggi.. -mununlmn lxurrn IIHIIIIIIIKIIIHIIISIZIE an ' ' Ziff: ,., Qi V :'1 J ' L, 5. .. . . .. ,..'.:'2.--I---' I - - 22- a WL '-ifg' I5 LV E: P ILI f- X ' ,H i . E 1 , 1 X , x if iq VA 1 Q. , .,.,..,..,.,..J I .- . 'P f , f ,- , N f 1 n W n L x ' ' 'I I 'l 'I A 5 G 3 l u u 1 m : :ir din: rung x-ann. I lu i an u luml umm L n u nm f e fm-um mum-ul mmmmv ur an F nw n- ummmu-mmm rf 1 ------m mfmnm-mmfn-fmmr-zazf -unru 1 ..- L 0 z 1 up I 3'-5- .: y , 1 w M LE - W Y ' 4' fl 'lx -1 -,Q y 1, J! 5. ,Wx --L .a. ,U I N w ml -im :Egg Eunli-me-... . . . ...sr-:::::s:::::zszasamaanwaazmzzaaz::mm::x:x::::n::m:::x::m::::::::::::::::::::::::::::::::::::::::mr.:::mm:::::: '::::::::.:1:::ara::::::::::::::lr::n.'.:: :::::::'.:L::::::::::::'.:::.'::::::::::. -.........-.- ....,....a.i.. -:--1 'O M 1 x 3 E sg. :IE 'Q X 'Q O , P ' A f' ,J A iv 54 Y L A W W p if 1 nulgmg Fir' :QQ ilu , mb l 'II! V SP 1? I, J V! ' in J ' L-1 P . 4' Q yo ? 1 'i x A ' AV 'A A ' M 5 , A -If -A -2513! -'XA X. 5 ii 5 5 5 f Q- 2 2 9 A Z is Z X- P:- f Q, 5 Q f 1 Q i 5 C.:Lc-eTwood 4 sf 5 V 44 55 f ,- O rx ',., 'ycffo W 'J woq-itl l I n En. Q LA , ff --------- -f-AA - O ' f aauifim' Q, 55, ' A' ' Q11 ?EgiiE!5:::.. 'A - ,W '- Y ' . f X ' X o ',v1of'z5Zf5em'9yfWov09ow z2sqz:s4QQQs6Qzses2QQoQs4UAffxv E 3 2 V 1, V v 1 ' jx J - , A 4. 0 L . .. , ' f . mm K. fl -5. ---' , 0 LU -V . ,,- 1.-,IA I.. I, X-X ,PJ -4. 60 cz 1 C - ' 'Q I ,mx ,151 fax ,,.3'd ' K h i . .mg . , , .,.:v l H -bl l , I I ,.,tg,:4-..,, ,ZA K Nix D J! Q--' ,1 . - -' . -- ' 1' 4 'A ,.,...,...,..-.....,-.msg :Syl mn... m 5' II -SH' .Im-luih-u In JI- Il n -uv 3 ' 'R 'RM V' ' S- N ' 'K ,C if :7 G --' -11.11111111..T5f ,1.1:-,......1.................i..:z..1..am:-.-r---J--V+----1'- ' nj, mr .V - - - , ..-..., ,..1 1 ,. . .. , 1:::1:,..,.....f,-1: -1.1,141f1L.. 4i'Xf'1.::.1x:... :zum ' 1 . lluemmm- -nv 1-mn-w1---1-vmnmuxvnnwmuvv F 3: 55 ,ELJIFEQ ' ..- A e H ' . .... :.:., 1 . .. . .. .... .. -: gg--gg---::. -- -- V 5395, uh ug--ng---gr - :'::::::::::1::::w.:m::::::-11: mzzzzsmmm. . .si .: Y 1 . 1 , Y- ,.....+. :u::::-.: ':: .. .... . ---- - ---75: ,.,. . .... ,,..- .... 'W-- f'f - , 11 yr- 'Tiki' - Y HV V, ,.. ..,,...,., . H 4 1 r 1'-Q2QQ,X f UM Y nf ?'?ff1' f 2. f , 5252 1 7 iii ' 1 14' ,. , .IU A4 M. -..,,,h....,. 1 VI' ' . 1 1 , 1 . . 1 ' Z, E4 E gf r.-. X 2 4 ei' l ,7 1 ff' E 1 .75 1 1 Q , iff L 1 I FL 1 I 1 1 ri j . L4 1 1 1 1 ' 3 12? EP - r.' M 5 1 1 A- 1 f g I Y 27:2 ' 1 5.1 ll 1 f-gl Q il Frf ' ' ' NS 'H 3 1' 11 1 11 i 1 'b K.-I 4 e-if ' 1 -fr 1 1 1 r 111111 gg HB1 ' 1 - A P4 l b il I ' 'R , I 4- fx , U , 1 um., 'lm' Fig H1 1 umor ass ICSI S 5 ' Cl Off' - Q .Q A E TFQ . E . . ,uvrroan . X . . rem en A XV D H Y P d Z E li. O. XVILHELIWI . ..... Vice-lfresident ,531 F. 0. XVALSI-i . . .Secretary and Treasurer ' 55:15 N :Eg R Q 1 154 5. 'El , .N Q S x X N . - N EF ' S 'Ni-.,,4CloG O V 3 A W 1- f9Q:zcQsywz,2,zQ,a,XXNaxxxvbzm3xxQgggx5,S9,xmxx Q fl' 'x O 'EEN J A-1-D L LX x J 4'1...,.f- ' my ' n ,f-, N 1 Q-W1 '-bf ' 1 O4 Y X E. 1 1 k jo A ' w,,f X Q gi- M A-, 0 X 'gf 1 - 5 355 11: --. - X6 VA' It0g f:-:-.-wwsszamvmw-:Naxv:wx-fs9QQ4:66a:-vx.-r:v4f:.-s5oQQ95zs0'2Qo:1yAoaQg0 5 :. 1 , , MQW ,V , A w T 3 1 1 Q if I i jjxg -at .Nu ll 1' , ,.w i qv H , L-C552 K- C' 'u::f'5:5!'5 ' - FJ. :A ' .., i5:i:::1:' ' X ' ' , 3145 5 'nk ff 'T' 71' .few D ' D '3':, r '60 Q x N S 3,3 K' . r LAI My Ill! :WA l NQJ 'ml will .mtg III! 2 A Q 2 57 Q- 3 7 X SE.. X aj,-+R ,1,, Q. , in .X , - . ...A - Bm, 9:5 ' : .qw A 'gg' 1- 1 1 L.. .... P A sv' 5 'Neg . f . N l ,ll . - .-4 N 1 V' 1 Y fa V I ' 1 ' sl 2, N xg 4 if-A xy. I Q Aw- x. -ov:-0-G ,J lx 'Q - - K I L X . -.ae fw - A .. an A ' ' ' - 555555i55Em:3: gm, hm I : s...5nInsnulmlulmlmmn mnnulumuluRwul1m.4.,s .un .uint - . . A. 4- - , ,,4,,m., .nil-mymfuaxnr nf. I-....lm.......... .Am n A- ----m.-,mmifh-f-n3m,.an- am 3 , A u .A z Q., gm, :S i I nv 11 Kal ll 4 -' I w lllw l' fill: ' in ul , gl ,-gg I lin x-nm... . m.. mlm: ...am-.::..a :mu ..... .. .s . misss..- mn .. :xx -a ..:::.... - ' r 'qi' l ln ' umor Class Roll W. G. ADAMS . . . North Carolina . . . Commerce CECIL FRANKLIN ADAINISON ..... Savannah . . . . Commerce HOUOF R011, '21, 522, '2'3s Captain, R. O. T. C. r Skeeter 'KENNETH LOUIS AIKENS . JAINIES GERALD ALBRIGHT . Phi Kappa Sigmag Bull Koseme. JAMES MCRAE ALFORD . Phi Sigma :Kappa. L. K. ALI.EN . . WAI,TER HAMES ALLEN Kappa Sigmag Delta JOHN H. ALLEY . HARRY RICHARD ALLISON Sigma Sigma Phi Epsilong Baseball. J. I. ALLMAN, JR. . Phi Delta Theta. HAROLD ALMAND . Baseball. WII.I,lAlWI AMOROUS . Chi Phi. . . Atlanta . . .. Atlanta . . .. Dogg Cotillion Clubg Scrub . Bonifay, Fla. . . . Clayton, Miss.. . Greenville, S. C. . . Nacooclmee . Asheville, N. C. . . Hartwell . . . Conyers . . Marietta . . VERNON L. ANDERSON ...... Fort Pierce, Fla. . Beta Epsilon fMontana Statej. 5 6.ff NEf, 5 A . Mechanical Engineering . . . . Mechanical Engineering Baseball, '21, '22, Football, '22g Jerry . Civil Engineering lCMaCk77 . Electrical Engineering . . Commerce Squirea', . Mechanical Engineering Dock . Mechanical Engineering . . Commerce Minnie . . Commerce KCDOCH .A Electrical Engineering Wild Billi' . Mechanical Engineering KlAndy7, Q 'Q A Q? -Q ll' rl ll 1 E, 15,3 'Ill il i H4 E. l lim? 1 I ulllln A Hi. 5 up 1. lf N. :EPR Xb X lf O O ow- lv Q 'S 1 D f 'V fl 1 , 'Elf- o .- , vi, -1- A 1 '3E?:E:::.,, ., Q .. H, ' . .......,. . L, 3 W rl V 'K . fsexsooxoczf , Hxfxlcx F A 2 3 yfWf .- -x-A V- .H 0 L L . .. ' f --. ., . S- 4 Q ...naw . L E L K fs +Nli lui 0 - .. .W-K ....',. O zsgsg.. o Q L 1 2 ' E' .9 Q ,f f-A.. .yy 0 Q as - :-4 '.'. 'TP' l . rf 54 1 4 Q. x. tw: .gi 3 A Aix.. , , .. - L.,.,,,.,.-.H v'-- . -1 AK, , P' ,if 46.4499 4 Q ,..- 'J' ff--1--- -- - ff' , m,mn,Q,,1':533m,,,,,,v,g,,jQLEr,iEg..,,,,, ....,......,..,,... .m,.,.-.....zsi-..-,m,..,,,. ..--... .... ...-,.... 1.---- - , --+- ---- ---fA--- -- -1 ' ,,,,,.:1:5aaQ.v 'f .Z qllill- L3'U'uHW ' ' UIIBHFIUIIHUUVHQUHWI Y A l I 5 ' - tl gl I U 5 'll' H E ,Y,, , D ,,v,1,ci.......,-.,,,,,,..,:,,:,, ------- -1 g ---uunn-u:nna:m'::::::: r.::::::::::::::mu:m:::::n:l:::::: f F Fiifmuii- ' ' 5:5 ,,M ,,, ...........u f 'AM-'r'Q 'r'-a'r '::: i!lL-I-f. L T -Fi! --- ww!! .y .f it j -:Elf . - - ,A Gzonon F. ACNTON . . ........ Atlanta ....... C0-Opemtwe En-qmeermg 2 9 . Cosmopolitan Club: Secretary and Treasurer '23S Student Assistant m EX' E' 4, - Fl e-meal Fn memng ' U2 Joux R.xNuoLx'1-1 ARMSTRONG ...... Albany . 1 6 J 9 .LQ l A Sigma Alpha Epsilong Swimming Team. ' A 1 5 Ouvrzn Cut-ronn Arrnrnma . . Augusta . Engineering Chemistry A I Phi Sigma Kappa. ' 'SD-ago Q I l J . - . . Janus Eu Avrzusrr . . Columbus. . . Co-operatwe Engmeerrng fl: - ClKId'7 'E iii ' . , . , T Cam. W. B.uui'r ......... . Tampa, Fla ......... . Cwrl Engzneerzng ' Kappa Alpha: Company Footballg Barrage Staff, '23g A. S. C. E. - Carlos T Aan-nun Bnaxcn BAKER . . Macon . . Textile Engineering Quartermaster, '23. Bake '- Egan!!! -if . - W 1 : L.uexas'r lxm.1.xzn Baxxmz . . . Fort Worth, Texas . . Civil Engineering 1 M D ipi 'll-cliniqucg Frienclsliip Council YY, , p Furla NI B I - - ' - '59 4 . . . A .L .......... . Albany . . Cwzl Engzneerzng 2:2 ,u ng Alpha Tau Omegag A. Sc C. E.- . V4 rvfi l ' 't l 7 N . . . . E J. S. Bnmo . . Havana . . . . . Cwzl Engzneering N 9 . ' ' . . . E3 H. I . Bamox . . .. .p AUICFICHS . . . C0-operatwe Engmeerzng Q Travk '22 '93 5, Q q -1 , . Davin A, B.a'1'1s . , Elm City, N. C. i u Commerce E Q: - 5 N 1 J -v P A' -' A . . . N oux INSON BAUH ........ Atlanta . M. ..... . . Tervtzle Ewzgzneering S sr . , 1, . . n N Ei Delta TM' Delta, rlechnlqlle Staff, '23, '235 Quartermaster, '22, '23s Honor Roll, '21, '22s S Scrub Baseball, '21, Varsity Baseball, 722, '23. f - aJOlmm,-- S ii ' . ti B 5 lbf C. F. BE. ' , N ASLEX . Alabama . . Electrical Engineering ' is hz 9. CHARLES H. M. B - ' . . . M ' V v EXT! . - emplus, Tenn. . Mechanical Engineerin.g i kappa Alphag Oil Canners. K Q X 'Charlien N 1 Q if S 5 fi cw- Civ 1 Q U 54' Z Y' ii Q- I N5392Rmi15BXNAYX'KQR.XXNbb.XXXXX . 3, v' Y I V . l 1 ' O - NJ ' ' 0 5 ., DQ' ' 3 -. 3 ,. l , 0 , 5' .5 vw 5 -. e::., X - . , -- ' ' 223-Fi A , Qa sawi EA,Oklmiimtai-znxvgwrs:-:exgwt-fcszxvmasax-rx.g:,.wxf:o,:9y5:Qyp-p99g44.ggf,,- 5' , rg 1 17 V Y ' ' ' ' '- M Q, .,, . A . L z':'-EL K W 'V Q ' iiim n v 'I' ' -if 'I G 1 Q . 'H ., . ' .- ,Q 19 LL O ,, V , u . A 439- Q s it Af I li l H it : Q fA,.. , ,. 4 ,Z W Q! lllllllllll I 'M f- ' k' .'Q 'i 1i 4 L ' 'S '. ' lmrraunmggga .. af. .. .... .--.-- .. ' 5' U - ' ----- - :::a:::::::::: .ra-::::::::: :zz:::::::::::::::::::::::::::::::.'::::::::::::::::::::::::::::::::::::--:::::1r:::::::::----:na-::r::::: :':' ':::: ::::::::::::::...:::::::: fI:......:ge-ml' E 41 , i 1' I f I .. rx 50 ' -' gl N, - ? 1 R93 if , 5 f . 57- . i' s incl X 3 5 l 2 lf. ii 3 ulnuilllg .Z:5'fz7ZZfV4W2W5W.' 'Z .5492 ll L f. 1 '2i!.i ll img li 'll nlllllal WE IIE! iii I Q 4 5-' ARTHUR OssIAN BENTON ...... Fitzgerald . . Textile Engineering Fi Kappa Phi, Pan-Hellenic Council. Bay OscAR LEAH BETTS, JR. . . . . Rome. . . Civil Engineering Sigma Nu, Skull and Key. WILLIADI P. BLACKWELL . . LaFayette . . Mechanical Engineering ffBi11 LAWRENCE M. BLAKEY ....... A11burn, Ill. . . . '. . . Electrical Engineering Technique, Yellow J acketg Marionettesg A. I. E. E., Masonic Club, Life Saving Crew. Bud JOHN H. BooTH ........... Atlanta . . .C0m'm01'G0 Sigma Phi Epsilon, Company Football. Johnnie R. J. BRADFORD . . Atlanta . . Electrical Engineering C. T. BRASFIELD, Jn ......... Natchez, Miss. . . Electrical Engineering Q. g 'Q 'Q 'Q S 'a 4 o 'o N Q .L W J . 15.1 Gamma Tau Deltag Honor Roll, '21, '22, is fr ANDRAL BRATTON . . . . . .... Atlanta . . . . . . Mechanical Engineering ' ' ' - . A ll 3 Kappa Alphag Varsity Baseball, '21, '22, '23, Oil Canners. Andy ml . . . M 'A 1, WILLIADI OSLIN BRLTT ........ Thomaston . . Mechanical Engineering y Sigma Nug Glee Clubg Cotillion Clubg Oil Canners. Bill 2 G. H. BRoDNAx . . . Hapeville . . . Electrical Engineering Q LYLE A. BROOKS ........ . Atlanta . .... Commerce ' Company Football, Baseball. Elm6I' Tugglen E if 5 . . . 5 I J. J. BROUGHTON, JR. . . South Carolina . . . Electrzcal Engineering I MILI.EGE HENDRIX BROWER . . Atlanta . - - Commerce 5 JOHN H. BROWN, JR ........ . Louisville, Ky. . .... . Engineering Chemistry Gamma Tau Delta, Emerson Chemical Society, '21, '22, '23, Jack . N Z. ,,,Q:ffx.Q 5-CHO ! o P N AE U bx'f?5Q'e9f5w929'?5i?5f409Yx1A5oQ45515.Q9' LV Lionel. A 5, 'f 1 9 l K QL 71' OO il ' F,....,.L,,' 'Z rf-I is -sz 1 W ,. L-' U. -5 Q-' L-. N .u no V . S' 1 JMQS. .1- 0- 1 -vi 7' it 'Nb l.. : .we . r e , f 4 Qs-393.5-5' ' , .... . ., ,...., .... ,,.. 7 ' ', Z ,....,.. ....... ,i k ...m ain ,.... , .,,. ..,.....uwm.....1a1.:5m-...,.,.if,..-i, ....... ...... ...- .-..m.1II:.alz: ..... a..,. .,... ::tI.-f-2----- -.----'- .---M-5 ----f---v iffvln---wvfm-1-tl': Q' it f U mmvw'W-.MWAmwknwwwmmsl -:umm,::,m:m,:,Mn5m:-,-,mgmglmngggnnmzlmlnzuannmaiHEIIiilllililillillilifmf 4----- -'- --- '5' ' - V .4 'T all I-.' i . 1 . . ' ' X A Fimsx C. BRYAN, Jn. . . KiSS1mm99, Fla- - - Electrical En-qmeermg xf' P' 5 IG 79 g Band. F' C' f 'f I n . 1 1 lllnwmm S'r.iNr.ux' Bumocxc . . Kissimmee, Fla. ..... C0-0190?'aU'U9 Engmeermg i J i f Swimming 'l'e:im, '22, '23, Manager, '23, Company Football, '21, ,22, '23s C0'0P Club? Z C . , 'l'cc'lmiquc Staff, '23, HY Cabinet, ,235 President, Tech Bible Class, '23s Blue Print Ei, Staff, '23, NNW 5 I- f fir , . . . , 5 L l'1mv.um I.. Brfiu-:rx ..... 4. . . 'Washington . . Iilcchanzcal Engineering in il ' i , Circulation Blanaggcr. Technique, 23. ij,- if? i '1'mm.xs linaxn Bnsmx ....... Fayetteville, .............. Commerce gf I 1' U i Pi Lambda Di-ltag Scrub Football, '20, '21, '22, Scrub Baseball, '20, '21, ,22. 2 ig Bambino A I 5 il? , ,,. , , . 1' ll. G. C'.xl,nw1:I.l. . . . Kelso, Tenn. . . . Commerce i I A J. R. C.umuc11.w1. . . Jackson . . Electrical Engineering , Wil .- f .-Xu-' I.mns.w Cuznor. . . . .... York, S. C. ....... Electrical Engineering . ' Q, f l bi Kappa .Xlphag Honor Rollg Company Football, Pi Delta Epsilon, Technique Staff, XY ' , . . . . , . . u -4 i i 21, 22, 23, Assoc-late Editor, 23g Assistant Business Manager, Blue Print, '23. ,.,1 we flffc x ccA1n lllllvl ni 'll QM G R- Cfml' - Sparta . . Mechanical Engineering If ' is i . S . . ,, 5 ' V , Y XX H. L..isu . Atlanta . . Co-operative Engineering i L' 1 Q: x, I !:- l' 1 Q P- C-'WLDWEU' - Atlanta . . Meclzancial Engineering S fiii ' ' Q, . lF0Otllflll. ccJeSS Vyillardxa 4 2223! 1 .3 T ill . . . ll. S Al- L- CY-EWELABD Atlanta . . Electrical Engineering IE it lg J- 0- C01-E - - Atlanta . X . . Textile Engineering S g v . I . . Cr.so BIAURICE Corom. . ....... Gibsland, La. . . , Electrical Engi,we,.5ng 5 I Pi Lambda Deltag Technique Staff, Louisiana Club. ' :Pi F ' E. T' A , 7 ' , , X REDERIClx Coxxuvc ..... Bay side, N. Y. . . Cwzl Engineering gg Alpha Sigma Taug A. S. C. E. ,,Limev,, 5 ' I Q .- V K ,,,, V Q IQZQ' 6 MQ . 4V.9?'?+9s':T55111P1-Eff!-:Pr-5S-Izrsssz-1-smnwonz-sean:-wx-pm.p55,,Q,.355,Nw:4,.4, , 'l V- Y nf if f Y- 7 Y- A Ti-M . L.: ,I ik H . ,,ee,, O in XR. Q Q, jg Og?-L ,.,. N-WecfSSifezv.9xfa2s'Qi5:mxxxxxXg5gwRxxxxl X H was -'-- , ' ' T -'til-P--iraq 51 goo .LH -AJ, . Y. .. 4.,. mn -. llllllll illl ll llIllllllllllmlllilliiliiuul ,... s.I..:'Lill? h,,,,Hlm,,5g-g,ZQhmn,,,,.l,,1-: fQ Il,l Ilisxlyz mn mn niiigmgmiu hvgggumsae ' ll E D L P PCI EE: .. 'A-'---'.' A-mmm:Emi'mmur'u'r m:':ml4liilil::::.:::l: :mu 1. .1 ::a::::::::s: ::.: ::::.:: ' L-:::::::m:::::::::::::'.::::::::::::a:.:r::..:::::::::::::::r:: ,....... .- JL... .... 'IS R F C - Q -OBEW1' - 0011 - Oglethorpe . . Textile Engineering . E ffsaiior Bill ROBERT L. COOPER . . .I ...... Arlington, Tenn. Electrical Engineering N 4 Phi Sigma Kappag Track, Cross Country Squad. EDGAR M. Cos'rLEY . Atlanta . . . Temtile Engineering '- S Q B. C. Cox . Atlanta . C0-operative Engineering J. J. J. Cox ........... Waynesboro . Mechanical Engineering -0 Phi sigma Kappa, Y. M. C. A. Cabinet. Ja N H. B. CROWELL, JR ........... Columbus . . Electrical Engineering V Sigma Alpha Epsilong Seabbard and Blade. Flip - S ' EDWARD FAILEY CUNNINGHAM . . Savannah . . Mechanical Engineering 2 xl Yellow Jacket staff. fmdmirair L y . A ' R' I , W. C. CURETON, JR. . . . Rising Fawn . C0-operative Engineering r ATM ' 'ma V J. F. DANIEL . . . Anderson, S. C. . .Commerce y . ry U, 4 l l Jimmie I N WILSON FORREST DANIELI. . . . Beaumont, Texas . Civil Engineering 'Im' 1 Technique Staff. Babe Msn' .4 ' E. L. DARLING . . Blackshear . Co-operative Engineering A A P. G. DAVIS ............ Cartersville . . Civil Engineering Varsity Track, '21, '22, '23, Captain, '23, Koseme. Pi,HkCy SI A ALLEN HILL DAvIs . . . . Byhalia, Miss. . Co-operative Engineering 8 f , Za C0-op Club. . Sergeant y if g 3 H. L. DAVIS . . . . Magnalia, Miss. . . . . .Commerce E PAUL RoEER'rsoN DAVIS ...... Huntsville, Ala. Electrical Engineering Kappa Sigmag Scabbard and Blade. 2 WILMER CROUCH DAVIS .....' . . . Atlanta . Mechanical Engineering gi Kappa Alphag Cotillion Clubg Oil Canners. S1iCk,, 7' . O r- 'lcffo v 'Q o f X 0' W M' , . ,...,, L 0 E--f tif' ' 4 '------ Q W.. L. . BV! I ' V .eww it ji' Lion Ei. K- iiuniiiig, 0 'f l- f o f' . L X' 1, pgwgofxo Jqef' I, I ffaewitx w 1' 3 I X. W 5 D: X x fi, ' X X I f' 9251Qaaa e. ..eHae Y' -- X , 'gg 4-nj jf 3- ' A , . N i ' , -. K I Q ,gl h' I -4 .-N f ', -J' ' :-'.. J 4 -., . '7 . Q 'Im,m,,,,,,Q,,E2,3gg......::::...:.:t3..f..1 ...... .,...............z.2h.1:g.:....H... mmm....i5::.,-ii?1um:-agsiggzeggggg xi X I nu unnannnuma-mavmummmsnlilluiimm iv: I' '-it-File--.mi ----- Q-P-,.,.,.....unm-1-mm--1-1-fvsvwiuv--Q-'-w f ' ' mn, : - ..:q'-5 . F vs , Ili III .5 ,I . I I I I ' ., Ill III ,, E xt - I , , ,,, . . . ...... . . .......:.x...m..m...x:.'..l...... x ...:.:...:: .. :.. .L-1, W., 94 ll'l-3853311 T 11 E ,Tw ' l ,, - War:-4-:vn........... .... ,..,. . ,.. vv,.., .....,..e.....,.. rgzrugnwsa X, gl ,ygsqw I in .I , Jpeg Yi11.Ll.m1 J. DHBARDELBBEN . Georgia Tech Golf Club. 2' , r 5 Jour: lt1cu.xnD DIIERINC2, Jn. . I . I r' XV. K. IJl'2FOllE . . lechmque Staff. .jf gg Joux lt. DEJ-XllNECl'I'E . . Z4 gg. Cxuuannce DELILAE . E232 fl. F4 Sigma Nllg Scrub Football, '2lg Varsity Basla 1 :Xl'l1IIISll -2l!X2'33'3lSZ:l'3: . Atlanta . Atlanta . . Macon . . Norcross. . Macon . Koscmeg Pan-Hellenic Councilg Oil Canners. f 'Tyr-71-.35' .'. R. A. DENNY . . W-fm H. NK. Donn . I I I I M.u.cm.ni Rui:'r'r DoN.xl.usoX. I I I J. M. Doxnrsox . ' I ' A- I-l. P. Damn' . . I I 1 I Grzouon LEROY DICKINSON . li. W. DIDSCIIUNEIT . QE EE? I I I:-: 1 C. If.. Donx ..... Delta Sigma Phi. - lVA1.'1'ER PRUITT Donovan, Ja. IEE? . Delta Slglllil Pi. KC XVILLIABI O. DOUGLASS . I Track Sign-Out. S I 5:2 'N ' - - Nl usox HUME EASTMAX . V221 N It-fr N . Rome. . . . Arkansas . Mt. Pleasant, S. C . Blakely . . Macon I . . Bainbridge . Atlanta . . Atlanta . . Atlanta . M 1 I . Atlanta . . . Atlanta P if 'A e rs.. l Q Q. f . E , l- It x ' N.. .. .- O .a:...aal bg 1 Backs:-gk A-.x'-.'i',s.x:'-Q.., ffaazyc.s1Qv.m.fos.e',w2'A1fm.9A.?,1a.0mufac252Ss'nQS4z4c014345530 E . . .g V , A :X ill ' Z ' LA.--L K. - Q --.:.:::iiig!qE wb vga. V I . X x I all f m . etball, '22, '23g I .Zh- .... .,.. ...... .. .,... . . Commerce Bill . Textile Engineering . Textile Engineering DePhie Mechanical Engineering Zlleclianical Engineering Scrub Baseball, '21, '22g Electrical C0-operative Electrical Electrical Electrical . Civil . Tewtile . C-icil . Civil Skinny ' Engineering Engineering Engineering Engineering Engineering Engineering Dick,' Architecture Engineering CGRedH . Corninerce CCPete7l Engineering ccAnd3,x: Engineering Mink,' l Liga L L v v Y ll 5 ,X i i if gt 3 if J' 'II LA, n il' 'Tw 1 -. I 9 qv . I JI 'yur' I '13 bv I I P' ill LLI 'I III I X E S Q S S E 's s S N E S if X- N S N S 'I X i , .JZ 'll B if '5 'g 1 -:::::::.5ii.5ii:-- 35w,::L,,,::i ' ' ' 'J ,,,. ,.i,.,,, ------ x A ' - xw ? N HH q 1 A f. - . . f -w . ' ,,.,, - L I H l - ,X . xr - . !. 1'--v 'I-5 Y , z11l i bv' ' 'rf J ' 5 Q , e:e1.xxx,c.f - . 449, ,gh - I L V., A, ,., -. X X '-Ma -. ,a..f::-mtv' - A . '- M Q --.-., A '.1'-r--:- - ----:-:-.lcv - ..-PL... , - . .,..,,,,,,,...:7a,.:....1r+:-'G1---1F-------vmmmmmmnf mmm 3- 1 459 in ,man I 'Pl' fX1!'!ZlIZ5::::5:5:5:5::giHHll'l'lllfWllllllifillgIhulIIfllllIlifIllInlllulinHll!Hl:X1'UI!X!!!-ili:'.!I 1!z'Zx2!!1'!:'x:3: 7':l!1hllilIlliH:i1i5-45 7 'T1I:l'-:Flux l 'l'l f '? n ' n n' :HW :Q jimi :.......... I I .su ,x Q L x nu- ll U S 2 1 l :I ,i l t 1-1 Ig!! t I ...- hifi .mum-:..x ' l - - -rn ---- ' ' ' : 1 V 4-1 l l l 'C 4 n l lg' 1 1' , l fir p HU-r -uni' ting b J 1 'A l l ll .1 ,EL Y is X Ltvv X 7.5,-ff. fo ,. A. G. EDWARDS . . Marietta . . . Co-operative Engineering Louis ENLOE . . . Atlanta . . . Co-operative Engineering SCROOP W. ENLOE, Jn ........ Dillsboro, N. C. ........ Textile Engineering Phi Delta Theta, Scrub Football, '22, Scrub Baseball, '21, '22, Glee Club, '22, Skull and ., Key, Koseme, Cotillion Club, Secretary and Treasurer, Class, '22, Blue Print Staff X '21, ,22- Scroop Q K. L. ESPENDAHL . . . Daytona, Fla.. . . . Architecture s S V FRANK M. EXLEY ........... Savannah ........... Civil Engineering Pi Kappa Alpha, Cheer Leader, Pan-Hellenic Council, President, Bleeding Toe. Frank J. MACJ. FANT . . . .Santuck, S. C.. . . Co-operative Engineering HL. E. Pharm J. T. FARGASON, JR ......... . Memphis . . . Mechanical Engineering 4 Kappa Sigma, Free Body Club. '24 is-'Q' . . . A aww JOHN FARMER ............ Savannah ........ Electrical Engineering B4 i i Alpha Sigma Tau, Swimming Team, '20, '21, '22, '23, A. I. E. E. , '- W. C. FENN, JR. . . k. Dothan, Ala. . . . . Textile Engineering 'I ' .w i - JOHN FRANCIS FICKEN . ..... Atlanta . . . Civil Engineering Freshman Track, Company Football. .- S. L. FIEGE .............. Atlanta . . . . Electrical Engineering Gamma Tau Delta, Technique Staff, Mandolin Club. Ich S. E. FINCHER . . . Atlanta . .A Electrical Engineering X 2 4 J. FINKLESTEIN .... . Atlanta . . Electrical 'Engineering EARNEST ARLINGTON FoR'r ..... . Lumpkin . . . . Civil E-ngineering Company Football, '20, '21, '22, QQ HOWARD A. FoRTsoN ......... Augusta .......... Textile Engineering Sigma Alpha Epsilon, Skull and Key, Cotillion Club, Pan-Hellenic Council. Bully 1' 2 . I 7 1 o cxF:,l.w '? 0 l o LZ O Jovft q - iilliEEaa :...'-- - ' if .M ff K P 'I 1 ' A- aww nWnffyfWmfWw .V 1 , .awffff 5.9. V- A - O' J Mol in H , Q W4 4, 'li .-.v l otniiiii... a 4 1 W G V' Y It 1 s i l 1 I l v i I I l l . V w u n i 1. wuzgggv .. I V. :an . JH, J. 19 W vii , 26 1 .'f'li2,x --'- 'm , fern is XM + if A lm-M-if-f 'I x i , .. .J .. vwvltl Ill 1 Aa.. - x ,. ' f f' ' -1, - ,.... .pw - -2 ' .-.m............. - - f' f 9? Db, - ' f . 'R A ..--r.gn ',f,,,,.,,..............-..........II....:........,.,......-..-,.N---- -- mf 1 H M Magis. H .. V- -- n-lnmomuuuxmMI:nunQnm.w:.- li-am-1 - 'm'm'. mmm mmm H r uv' '-'J' 'n. . L . .. . .. .. fx- rail A if EFS l r 1:4 if 4 E511 ln iff' 14. g r 1 Q ' 5:31 . 4, 1 'I . It ll if 59 r'1 I' 1 l ii 1' 5:5 I .. ' lffjl 52:2 5431 , 'Z-f 'fl It 5:21 ' u. r s i l:f:3 4 .A 2: . 1 ICI- f lllgf Q ,ag--1 A lggajllv x'-Nglghl' sim f lvl .352 w A 4 tb! I CHE, lil l l 4 l I it I-I l i 41, 4 'af 2 . A fiia l E21 I Efzl 3 gl 5 iii? lf-1, 'lin A1531 till l ltflvl . ir.-I lg-4 qi 'N l:fi8'l Fw J. XV. FOUNTAIN, Jn. DoN.xi.u M. F1u:mtAX lIr:n1.14:n'r S. I um:MAN ..-...-.m -Q.- W1n.i.r.ui Panxciz Fiusmxax . u 1 - b. Ci. L:.xucl.x . G. C. Gannsun . Atlanta . . Atlanta . Lemon City, Fla. . . Allanta . .. Havana, Cuba Sc-rub Foothall, '2lg Varsity F0 l:1u N l'IS'l' G as Kixs . W. W. Gussox Della Kappa Chi Iclirnnux .X. GLASS . .xl.IH'1lt'l' li 1-: NT G Lovlfzn Wu.l.x.xM LIULIYSMITII, Delta Tau Dcltag li. A. Goonnunx . Mum H. Gonnox . Tau Epsilon Phi. D. J. Goin: ..... Delta Kappa Chi. C. XV. GORE . D. T. GOUGE . JR. .... . . . Atlanta . otball, '22. . Willacoochee Thomasville, Ga . Atlanta . Charlotte, N. C 'G1'eenville, S. C Scabbarcl and Blade. .'. Miami, Fla. . Macon . lVilmington, N. Yllilmington, N. . Atlanta . Cf N35 - ft 4,O w:-IE 131-Qg.5:g:g:g.g.g:g. x:'.::::-xxhrx-1024 itli 141+ V 1 1 5 ., ' I F 9 Xkiq klliiq 1--1. . ..-..,- A 'n l.' 'lL?'.',x X4 V- ' vf QSC!!! pf? - 3 4. ,,-, . , Q-'haiiix ixokx 'D A mega., e.- .. ' 'Y W YET: X -- X, . ,qc . -- . '----1-gf. QH 1 .fg3, ??f,b,13!, , ' . C.. C. . Pwfrff C0-operative Engineering . Civil Engineering ' Engineering Co-operative SCH S 77 . Commerce Andy Gump' Oo -operative Architecture Engineering Engineering Chemistry Electrical Mechanical . Tewtile . Textile Electrical Electrical Electrical CCCupie!1 Engineering G6Gip97 Engineering Engineering Engineering Goldbrick Engineering Bobbie . Cornrnerce Mike E'ngi'neering D. Jack Eng ineering Mechanical Engmeering rw, C44 XNXXNX 'W . 0 'ff Y s on ooo x '... .... - .'..'.'.m9A'.' 0 'f . A Elma -is ' v Q 44219 qs .. ,L il nga E' IK V, - 0 fl' . l 1 uw, i M l ti' if l-ulrf l -mf ' PTE ll l Q S S. Q S E a N 5 S iw S S S S Q Q X 5 X S Q. S S S ifbf SE. Sn-:ED at ia 42 ' vn 1- -. w V if 4: 'fzmfyxliff?-5XFf'?'9N9E'WNkNEB1 XX X L- 1 ll.X 'BE 5 1? 31: 1 I ykv 65 2 f 3 5 4 5 'M 'E 1,1 1 1 5 Xa fa-1 pam iq Q umm nlrmwmrmmvlwshxlu A 'HS f A ,gl Ilan lliillllillllllllilllllll l Wamrwe-a ll E E LV S - : ':F.Em -Hr-'11114': 1:::f ':'?f- 1+11:r:.':'..fE'7 11 J H GRLCG Honor Roll D GOWN C W HALIELBELK Beta PS1 LEROY W HAISATI Band, Y M C A I'l1CDC.lSllllJ B R HADITrIOND P1 Kappa P111 EDWARD CAROL ITIAMJNIOND HAYWARD SHEPPARD HANSI-:11 S1grna Nu IRA HADIILTOY HARDIN Delta 'lau Delta JAMES OLIV1-:R HARRIS Beta Theta P1 DON HARTFORD Atlanta Rome Atlanta Lharleston, S Ounul Rome Atlanta FO1t Bennlng A tlanta Car1 Ollton Deche1 d Tenn I' lectrzcal Lo Opez atae Illechanzcal llechanzcal lu Zectv zeal Mechanzeal Meehamcal Iyngmeerzng Lnsjzneei uzg Eugmeez mg Halhe Engmeermg Shmty Engzneen mg Comme: ce Engzneeomf Poss Engzneeamg Oommev ce Bloate Temtzle Engmeee mg Slgma Ph1 EIJSIIOD, Scrub Footbcnl, 21, 22 Xa1s1ty f1E1Ck, 21, 22, HOno1 Court, Presldent, Jun1O1 Class, Skull and Key, Koseme, V1ee Pres1dent, Y M C A WILLIAM A. HARTBIAN Kappa Alpha H11:RBERT DAIL HARVEL ROBFRT LEE HAYS, JR. . . Atlanta . Electa ical Engmeering Buck', Delray, Fla . Industrial Education Mechanzcal Engmeeoing Beta Theta P15 Pan Hellemc COunc1l. June -Vu 31 OQ' I 44 as u 4 I 0 .- 1 o n o . Q o 4 1' ,Y I l O : v w, 115 Af' li L, Q w jilkll Q 4 E L 1111111111115 OH., ,Q 1. L v 1 XA ,f O k 'Qeea DQ l O 6020 ' 412 D 111 I I , ' 1 I M 0 I il dv A 7 5 Nm YF. h X ' 5 u I I .1 ,Wffyf,WfWn4a,2ffxfffwf,',f0yfovfffffm4,-350 5 Q r 3 G 4???'cw-mvxxvyvwwwxwmfffwow af A , 1 Q 1.10, 0 ' W ' f -1 ' Sf gi. 1 0 K Q x 11 J 3 7x ...lu 1-33 Q , Na+. .nh X 1 I a. J I. fi i I A p x 1 Qui. A ,,- A , ' '... - r x, X Ka-xx .. -,X , J, ,Ml 1 Q . , A , U 'Q .-g'7w'l sl Q -T D , - ,Ac S .1-135' 'occwjfo V K -.N l ,f1f 'f:1? , A: '1:- ' 1-. i:-. - 4 ..-. .1 -' - ,,, '22 Q ' ' . . . - J gn nr... Euan: 11 . '.2 L1E12.ie-31121114111---J-l,,,.,,,,,,..,..,1.1.,,,,., ,di1,111mu.2...1u-nu1:111a1:.1-...?.,, --.1 .:u.....1...m..1.....,..n..rm1-1s2Z1-f--ia--------m-v...amm ' nmzszasunugnuzn I -- 1: G. . .. u an EL-uv ,,..,, 1 is 115 ll ' 1' 1'l 1' E ala. 11,11 1 , 1 115 3? W ? L A' li :s.:'1':. ' 1'11l Q' 1 1 : S ui ...... ...Q.... aaxaazr ' - ffff-f--1-----e+-11f-f-1f---1- 1. :F ,, ,, . 1-- 'ft .va-M, Y A - .' . . 1 . A '11 . . ' : :'.:.'::::::.4 ., .... ....- - .ia -... '11 B1 -in 5 :X 1 . 1 1 . . -- ............. 1 . . . . . I ' ' ' 1 ' 1 Z'.-' ' l 3,2 5. Z 56: :' 5? 1 :- A If 7' ,gg . 1 . .... ...... ,, '- 1' , A A ' ', I GS - 77 - , . , . . ........ , 4' . C. . ..... 1 ' ' ' 2 :EX ' . . . . X '. 1' ' C 'l , as . aa g . . 1 ............ . ........ ' ' ' ' 1 lv 4 . n '. 'QL-. ii? 27 1 N2 ' I . 3 J . ...... ' 1 - N QU SKF dw I ii li 1 l .ul - l . . .... ' ' . . .... f ' ' J' l hh 1 Q' im l ZF J l 65, 1 - uv 1 . ff 5--1-1 11111, 1 111 ,1 gg 1 ,1 1 1' 1 ' '41 hw l 1 Q VL. l alma, , , . 1 :lm , 1 jim A . . ..... . ...... ' ' ' ' hlllvl V 1 V 1 1 11 lllly' . - .g I 1 ' sc as A 1 ' C PS ' ..-... . . . - ' , . I n -..... 1' . . '. ' ' ' ' ' . A1 2 1 . 7 . ' ' . 2 1 , , , 7 xfi ' - . . . ' . ' - - . . . I , 5 1 p 5 V ' Z ' ....... . . . . - 1 ' 4 1 .1 C4 '.'. u CC 1 f 1 L. h N a + ' ,,,,, ,.... ..... ' If. .,.. ,.... yilllggugiltlwigi il uunnmluuasus-nonw4uinnaoiivua1avnhm,.... ..,.. ..-., -.1 - -um ------- .--i --i-1:-mf 1 -- . 1 Y I' '-33 7:21. -ZISIEQIIIEL'-2I221CII'l 323521233532322221L:Iliilfilllliilililiilllillll u -IIHHIIIHI S IIIIIZZIHBSH. .........-- .. JY.: ...... 252551 and -LJ ' .... .sa -W-WW'-----11---Av'--- r'v:'f'-1:2- -- ------ g Y V9, M i N . ' ' 66 ' 'Z C. Ei.i,1o'1'r HEATH . .......... Augusta . . . . Mechanical Engin ring Z Chi Phi- 'l'i-vlmicuc Staffg Murionettesg Oil Canners. 1 55 , l 4 - f -N I -d' Co-0 erative Engineering 4 Cniixiiuzs Ig. Hnxmucxs . . Sal IS . - 10 1 :gs ff i H4 .Lmuzs W.u.'ri:n lflizxmixcics, JR.. . . Sardis . . O0-Opemtwe Engmqelmg Z-' Isl, 111, IIHRRIXG , . Tifton . . Mechanical Engineering . - if 1 , , , , . . .f 5 II.xuoi,n N. Him. . ....... San Antonio, Texas ..... Electrical Engineering if-Q' oz: . Pi l.:unlwd:1 Dcitzlg Bilflfl, '21, '22, '23g Dellolay Clubg Track. A 32 1 5 Y E212 . .24 lgff I li.-,Li-ii L. Him, . . Dawson . . Temlzle Engineering Ang, I A. S. llii,i,im.vrir . . . Atlanta . . Mechanical Engineering iiill , , , .-Xlphu Sigma lmi. xi v- fi tgfgsfl . ' if 4 ,gfki .-Xncumun D. I'lou..xxn . . Atlanta . . Oo-operative Engineering if' il 4 , 'L , 1 . . IVI . f AH v . .gig C .mm it oi.1.i.n.is . . ..... l , anta ............ . . Commerce ,bm M . - . , . . F-ig? Phi lmppu Signing Alp kappa PSI, Manager, Football, '23g Koseme. Qs? m- ,, :Fig . I ffm. 1 ' J. C. Homuzs . . . . VVoodbury . . Civil En ineeq-in ,Qui g 9 in 79, Pi iqappu Pm. Jimmie gg? i X X ' ii tv Al ii J. XX i:u.ns1sx' Hoxoun . . Atlanta . Electrical Engineering s .: 52' i Gsoncr: Ayniznsoxs HUBB.ARD .fILCda, Va. . U Electrical Engineering f ' . . 1 - ', ES: Phi Sigma kappa. , uB00tS,, y Q E E i mm il. HULL .n ...... . Rockingham, N. C. . Mechanical Engineering li Company Football, '21, ,225 Friendship Council, '22. is . :fs A N li: E i. I .' ' :za NV. XV. H '- . J . . . . Uni' R ' Atlanta - - M- - . Oo-operative Engineering Sr ' A E XVIILI-XDI HUYTER 'gf lg ' ' ' Atlanta - . . Tervtile Engineering 2 Sigma Chi. nB.1,, . 5 'Q x E 11 1 5 is Enw RD O ' H ' ' . . ' N R A in ILLE LSSE1 .... Fitzgerald ..... . Co-ope,.ati,,e Engmeewzng :Q , ig Company Footballg Co-op Clubg President, Fitzgerald Club, ..Ed,, S 'C X Xt 'Q V fi K E . x E' 'J ! X A - -1- E 0 LF ' ,A Q-- . .v wi Qt - ff - - - e X 'b N mnubh' M ' ' LA LQ 1 k - - Hs:uE62w c?i.W.-ffZ6?9?1fAQkbr5.-PJQC'.xNSMV.Z5V4af4m 5 Q Q A ,EEE g A Y f ,A , Lions-,L y ' Q i-: nil ... ' Q L ' Xi X33-NQk . . X ' .. C I . 4 -1 X -S v' Q4 ,,. 'b Na A ' ral- xl k Y- X V X I - J, jf IV I 1--LEE-x.-, ,gill - WJ II!!ggi!llnlnlu1IIInlumm:unInransxnlun1lolIE?:? ll.,.Si xfuy I 1-41-,1- f 43595:il 'mni2lh5:'uW'mm '1:t :llEggg?l1qgf lil I HE. DLV P PSI i lu ::::u:::a:::: rr -- ::::.-::::::::::::::::n:::::: . :-.-.-... .:-asr.::a....m:a. .. . . ' :::.'::l...........-.- .i,..,5 L 'yi ,N X fi VN. P. INISIADQ ............. Augusta ......... . . Commerce Chi Phi, Cotillion Club, Glee Clubg Golf Club, Augusta Club. Monk in , CARL N- JACOBUS . . Tampa, Fla. . . Electrical Engineering f CYRIL N. JOHNSON . , Egan , I .C0,,mw,.Ce o' I Punch , N FRANK J. JOHNSON .......... Columbus ........... Civil Engineering Rx Cheer Leader, Secretary and Treasurer, Gene Turner Bible Class, Y. M. C. A. Cabinet, y ,R Friendship Council. :I , z. J. T. JOHNSON, JR. ........ Montevallo, Ala ..... . Electrical Engineering A , Phi Sigma Kappag Bandg Y. M. C. A. Cabinet, R. A. R. Jimmy fc ,ha la- :fi ' F L. NIARION JOHNSON . . . Columbus . . . Electrical Engineering IE L N , C' V' JOHNSTON - - Amite, La. . . Mechanical Engineering 5 z Delta, Kappa Chi. 4 : N f lv 'lil I-fl 'M I RUDOLPH G. JOHNSTONE ...... Winnesboro, S. C. . . . . Tefvtile Engineering En-3 Chi Phi, Pan-Hellenic Council. Ruddy M , l EDWIN GREY JONES ........ . Florence, S. C. . . . . Textile Engineering H - ' I Phi Sigma Kappag Company Football. Ed QS GEORGE GIBBONS JONES ....... Florence, S. C. ...... Electrical Engineering 5 if Phi Sigma Kappag Company Footballg Scabbard and Blade. Gibbiel' XVILLIAMI ROY JONES ........ Bainbridge . . . Commerce 5 Pi Lambda Deltag YU Cabinet, Band. . Pinkey ei S- V . Zu XVESLEY M. KAYI.OR .......... Desoto ........ Mechanical Engineering f Z Pi Lambda Deltag Yellow Jacket Staffg Blue Print Staff. Q t 4 5, 5 XVILLIAMI F. IQEENAN ....... Brooklyn, N. Y .... . . .... Civil Engineering 5 I Alpha Sigma Tau' Companv Football, ,2O, 5215 Am. Soc. C. E.g Honor Roll, '2O. 3 5' ' , V Kenyon 5 2 , , Z NIILTON LEON KELLER . . Brunswick . . . Commerce I . Z Tau Epsilon Phi. ri f V 'QI SCH o 'pw O X 5 X v 44 um. K. xiffsugg, L t 0 LW . O XP ',,. A A V , Q .A f wool , Q I 'i::., Kg! 0 .--- ..--Milli! U f 'IL ' z Q1'lEl5lliF:::. ' ,Q rf, W - - - - ........ .- - --gal, . . '71 lr 5 Li Q , KL . . 3,1 Ig, xv 0k:f417Wwm1mffmfffmfAml,ffzxffffayzzvynvffffffneggb Kg I 1 I 3 gn 4Q2N6RZ'0h Q??4,!H'AQ?H.JQ . L . H D ' 1, -'I I if - -- -- Y Y l I S - ff 0' I-fJ? Q:.,, fo O 2837! 'lg AAVZ X 'x f t925,f fan ittfu tigtiw 255- V E. P .i , i. ,1 i g,, i V i n x x X 4 , -. x ,lf . - - - Y' , X - ' - .-. , X X , , -f f 1 , 7 Q . 61... . . . ff' 1' ll -' ' Yi . .... . ftf f '.. . . W, Q' , Q, , .. . ,O V .I .K .T P-it Q. . - - . N Q W ,G .4 .:-.Q-60.91 . ,I . t ,, V. .,. ,J Q M-Q 4 KJV! nys? :., Y , Z Ax . - . ,.f - '-.' 1?-L I ' Q.. ,,, ., -. .-I -'gots' . . . . . - ,.r..: , A . ' f-il, ,,, ,,7ff,...,,,..... .i...mm-.Mumi...:...v-.ax-..----,I.................-....-......-mf-H.,-mlmmy-mumn.m.i.,,,5:,Hgg4,nu4,,ggdUmaE4 q n u:lmuullnswnlmmmuwuw-ounummlmnnllamvaem-m-my..4m,.,--..-.n--nm--.H-.1-...-in-.mu-i.1u. I-.im -.-min.. . , , g 535555361 ., .w , H ' ' Fu' S 1 I .I 'I f 'I' .1 L ' ...... . . - ' 2 ,Q D , 3 . ,tw , u in ,A ,,,,, . ...... ...:.....:::..... ... . .. ... .. .... ...... ' 1 X ., , I V .-Q r 'M . 4 I., H as vi N. 51 x. N . 1 wi -N QI .3- K. L .X 'J . Ei: ELS , g pu Q, 1g,,,,,,y, JR, h , Ensley, Ala. . Electrical Engineering Z i Professor', . X. l 1 ,' . ' .' fl 4. .loux W. Ilrzxnnicx-: . . . Atlanta . Electrical Engineering Q .li-:rm-:u:sox E. Kuna ..... . Ruston, La. . . Civil Engineering 'il . .EE Kappa Slglllilg Glen Club. CaPtf11H lla-zxux' ll. liuxann . . . . Epworth, S. C. . . C0-operative Engineering 'Fil - . . . . E3 Wumfn ll. lilxo .... , .... Wilmington, N. C. .... Dleelzanical Engineering I fi - Kappa Signing Scrub Football, N223 Freshman Basketball, '21. 4 V I . D.wm .luuvs Knucunc ...... Key 'NVeSt, Fla. .... . . . Commerce I 'l'au Epsilon Plug Glc-e Club, '20, '21, Technique, '20, ,21, ,22, '23, Dave 4-itil I VA' 1 ,V Ax.m:n'1' C. lixlauivox . .V Cuthbert . . . . Commerce ccA1n J filizj., It is . A A lg., C. H. lxvxz .... . Atlanta . Electrical Engineering aug . , ,. , Blue .Print btatt, 22 QED g, maj: l r I t lil-Il'lilZN lumn, Ju. . . , . Columbus ...... Mecha-nieal Engineering l j ',,,. l Pi Lambda Dcltag H NI C A. Cabinetg Company Football. ' 'g l A p lllll-' , linux' Iaxnllsl-:lc'1' . . LziSCa, Ala. . . . Commerce . .w Ili ' :N 'l'. G. lnxxn . . Macon . Electrical Engineering X 2 . . . 4 ' W is A-It lnaeui C. Lim . . . , Atlanta , C0,0pe,.ati.Ue Engiueenng 'N i Alpha Tau Omega. l K ' 'Q 'C-., N, W 1' L it w 0 A ' : ' ' ' ' ....... . - - . is HL X H LFKOFF ' Atlanta - . Tewtile Engineering S Tau Epsilon Phig Company Football, '22, '23, aewoffiei, S i X' E55 t -'Q B100 S. L .... . ' ' ' X . . , I M IDE Merldlani MISS: - - - . Cwzl Engineering Q E3 Sigma Alpha Epsilon. , Q w. D. L . . , X 5 IDE ' ' Decatur - C0-operative Engineering will JAMES ALLEN LINK . . A . . . Haute ' . Civil Engineering E A :NI . 6cM1SSlHg Link I . SI N -3 Q if N N, v o ew' 50190 N Q ..r's,OQz frn QV-cgi XX TI x'6REc-ramen:-5-.12ww.::sg.'+:f:2:29w1,6szI:2:hN-px-:QQ:. ,3caQ9off9QQfLBoro E 5 1 A J' 1 5? A H vl A ima K- ' . . A: i. O3 f'02f60ef:+. QSafoQ Q2QSf5fQ5m.xwxxqixmxxx3.xm,5xu t my . ,iii Z f if i o x?N .I 0 Q lLkX xg! 1 T 1925 f 0, gu....L..,! it A yfff-'rpg 3 . .... .. l. c 1 1 H P ILI ,f . , . 1 , X x K i , 1 . . 'Q I ff P-X. X I fe 'Q j' 'H is D 4 -A F, f .A -1 ' K N.. , ,. -2 -3 1 ,.. ,. , Q Y 1 I Ian X I B 1' IliUi-I1.-mlnlmmlnmlums limuImmlmuulullul-me-n my I ,me . I rr mu--nm . um vu 1 1. -I mn I 1- 1 A W ,if ,-, gzhzm, ,L ,I . l ug mg, .- IL G I rv' I - E 3 Ill 1 51. i .1 it ' iii' ' 5 li' ,iffy xghnffx ' li .. .... .... ...............- .. . ... ............. ' .T . - -.....-un..-... ....-.......u.--nu--una---IT'-I-551518. 5ZL1G1:?42S3:LS'3H3.? ' '? '?'uT- -T '7.33:BI:h'A'22:I!73:1l3GZI'X3I:Zl2ilIlZI3II272E!ZII.'L ......-.--- Zh...-...-71:11 N N 1 N 1 R l 1 N V 4 is 724 QE I l 5 CI-IARLES PELHAM Locxwoon ..... . Columbus . .... , ...... Civil Engineering l Pi Lambda Delta, Company Football, Columbus Club, Am. Soc. C. E., Bleeding Toe. ' A ccpeln A. B. S. Lowny . . . . Atlanta . . . Co-operative Engineering THERON W. LUISIRY . . . . Carson, La. . . Co-operative Engineering ' JAIVIES HERDIAN LYNN, JR ..... St. Augustine, Fla. . . . Commerce 75 Pi Kappa Phi, Delta Sigma Pi, Barrage Staff. East Lynn CHARLES A. LYoNs ......... Harlan, Ky ............... Commerce Kappa Alpha, Cotillion Club, Glee Club, '22, '23, Marionettes, Yellow Jacket Four, f'Q '21, '22, '23, Band, '21, Assistant Manager, Glee Club, '22, '23. 'A R. L. MCDOUGAL . . . Philadelphia, Pa. . . . . Mechanical Engineering 2 Pi Kappa Phi. Q 'Q I 7 2:3 1 l fz I 222 i 'Q ll 7' 1 . . . k j JoHN FRANKLIN MARLOWE . . Pendergrass . . . Electrical Engineering LO -nn eine' lf' P HQ, 1111.3 11.711 'W Ig V w 11 ' a:Redav 'WI WILLIAM HENRY MARTIN, JR .... Sheffield, Ala. . . . Commerce nr- .. . , Q Phi Sigma Kappa, Marionettes. 'NVinkie ui 1 . -xv . . . -ll' KENNETH GORDON MA'rHEsoN, . . . Bryn Mawr, Pa. . . . . . . Mechanical Engineering Kappa Alpha, Basketball, '21, '22, '23, Tennis Team, '21, '22, '23, Technique Staff, '21, - '22, '23, Athletic Editor, '23, Pan-Hellenic Council, Blue Print Staff, '22, Scabbard D Q1 N: Pm S I 1. K I t5.u E' --X I -. O sl 4. l 'I .1 V 1 , lg. V fr fi, V lm'-11 QE' E ry N. H1 5 and Blade, Treasurer, Y. M. C. A., '23, Treasurer, Student Council, '23, Pi Delta Epsilon, , Koseme, Oil Canners, Treasurer T Club. ' CCKatie!7 1 Q CI-IESTER MAYNARD . . Winder . . Electrical Engineering Q: S! Masonic Club. g THOBIAS MOORE MCCARROL ..... Charleston, S. C .......... Civil Engineering 3 Z Delta Ka a Chi, Mana 'in Editor, Yellow Jacket, '23, Bleedin ' Toe. Mac 5 Z PP 3 3' 8 2 f J OI-IN FRANCIS' MATTHEWS ...... Quitman, Ga. . . Civil Engineering 5 Sigma Alpha Epsilon, Am. Soc. C. E. J. M. McDoNALn . . West Palm Beach, Fla. . . . .Commerce CCMaC79 I V. E. McDowELL . . Dawson . . . Textile Engineering I, 507, If O If U 5 Q 'N 5wWmmwf K -' ,JOOOZZXX AI E L Lionel. x- MM -.-.,., , -' W 'Jar . ' f . 0 xi' ' . 0 o 0 44 5 , v J 1. Q' sv -. iz.. V 1 5 Q x rr - K f 1 2' 5 Q-s L 'X V .' ' , 'W L ,. i Q gi:Hlg!i ab :Ig I u .gk iiggsuxz. 0 L Y . V fm rn 'L' L- IVJOO 0 iw .-. .- 4?-11 L-. 4. UV.. it X' . Q 5 sp w .l, ' . , as 125,35 N . ' 5:-an fi' 's igaqxvl . .' . ?r g? mimi? -.-T.fi'.-1, ..E.: 51l:ii .-.. fflffff um-mx allnlx W W't W ' E e T ii 'ue , if 'fig 1 1 .' it ill! F F li 45 23 'i .. .... ' . ' ii- 45:25. '!' I , I um mu, ,,,..... .m as ,mggggngmnz::'.:.:r:::1:r.-.mamnn:muzmz::::::::l::::::::x:::s:a:::::::::: x:: an : ..... ... ...... . .....- ...........2' -N Vg V T . A ..,,.A .............,...i. ..., ..l............... ggggggngw '--'-Q V t P' . ...eel - ' ll17'+lwl 5 l F501 f . .i C Z J. M. A-IcEr.u,vru . . Macon . . . ommerce r' xc 19 If A Kappa Sigma. Mack i W1r.1.1.xA1 BICPHERSOX MCINTOSI-I .... Elberton . - - Architecturg 42 . , Sigma Alpha Epsilong Architectural Society. wroshn I if i Grzoncu S1-i:m.rxo MCKEE ...... A . Midland . A. -Dlechanical Engineering Tcclmique Staff: Friendship Council Fannie Ulf? E 15:3 . . u. xVll,l,lAJl Tnoy BICXVIIORTER . . . Atlanta . . Textile Engmeelmg l Delia Tau Dc-lla. Mac gg J A Fa- ld. H. Miaxuows . . Fallston, N. C, . . Electrical Engineering ' 16525 liilflf I .iii I . . . . J. E. Mmxs . . Atlanta . . Civil Engineering ll'-- X X W , . l'1mv.um f3IlAIIANT M1-:IUUTT ....... Atlanta ............... C0-mmerce L 4 Kappa Signing Alpha Kappa Psig Cotiilion Clubg Pan-Hellenic Councilg Golf Clubg Tech .11 E' .725 HB 'fi' High Club. mar J ., m g i - . fi W3 A .Ionx BIILIAAR ......... I . Newport News, Va. . . . Mechanical Engineering l Al VJ. ' I l v A Frealunan Football, ,205 Scrub Football, '21g Friendship Council. l i W lllllrd W - . . . 'ff' lik Joi: L. Mitxrm . . I. Atlanta . . O0-operative Engineering ,M g Cu-up Club. I N c X Jonx A. Mzxou ........ . Macon . . Electrical Engineering . Delta Sigma Phig Track, '23, Q n H acotiev 1 F: N, 4555! Honms ouann 1 ITCHELL . . . Bartow . . K. . . . Co-operative Engtineming 3 Delta Kappa Chig Track. W f.MitCh,, E e--4 - 5 1:1 N CH-mugs Howum NIOOYEY Atl nt - - S ' ' A ' ' 3 5 - . Dlechanical Engineering I Q Tech Hi h Club. 6 ,, S Q tl. g Rllflt li x FRED Bracken 'Moons .......... Macon ..... ..... C' ivil Engineering g Kappa Sigmag Varsity Footballg Basketballg Trackg HY Cabinets Kosemeg Skull and Keyg coniiion. . . . A Q N 5: S 5- Aqv O -E1 .f 5 i O cw' 566' u o N i k Q oi. 4 X 1 0 ,aegis gf ' gil l- iiizajg ' l 1 L '-'-- f -R , - - 1- 'aassassg:l.f-- 7 V f 'W A g ' -Mmnwmwxmmmwrwnwwwmmvffffx g at 1 ' ' ' 5 dx? UOHL K it T 2 L' I , .. cf ' S '-N ,M - fxO.1if ' ' Y -. . 4 D W - ' 'SO o ' ,fl '5 X 5 IJ f uw .4 . 1 57 54 'QfQx'i.XY,. XQxNk 'i'5TQQR7Qx .23 33 S. 45 .J L L O A D f ill? 'Wa i!!1 133,13 QQ Wink, LD CFI . , . I l I EENQXZ 9 5 liT3:a.2,5Q .X J f I ml: I 9: i .,... N Ri ' Nil . . - -.-v . , X X I 4' I 5 N . - . I , , -ff 5 1 . iff.--, ... - .. . :et- X A y X - .5 r L.-.:.3 -, . H A-. :dwg - , ' . ,l- 'I ' x a,,, .Q - xzgfgkw - . A -'. fig.,-' ,J -:J-:-c-.:.,.,f I , Ia., 1 F-5.1 at-F-5, ff' ' . . V .-ff.,:a'7 ' ' ' I' 3- .4 ' ' , ' , '1 ' 11:1 ,'.. .' 'A :z:g. -. .g' ,I ,..,:5',:5'-'r ' Q ' 1 ' I'-. S '-'. N, D .gl 1' 3-s' 1 A :,:55,:5-5, Eisugnxny: -3 gxmnulm ximlIIImm:ulluslInIimnl1inuanAImainumm,..hmR1....use-nf-ll-.men--,g..f-.-...Au.I.uism'.::RiZ5?fumumg,5..,gf'ii:l-1ef.a1.n.-..u.1.....i......5A1125...a..11:1---145515-L:--.-m-M.-.mnilikliinmnlxffwumwaniizii - u I rr.: .R f.- fQ'i 'hw'9-21 Egir' R' R.:-5' ' -'IH . 5,,,..-1, E- sg 'QE ll . 'R l ll I ' . 1: will 3 ' 1 .il 1 'I 'i il w --- -' E . mlxun I . . -I---Im -----vim I --- . . ... .........r...... . ... .. ... ...... ... ..... . . ... ...... ... . : ' sf 1 Vg. 1 'QQ 1 i ...., .azzaa WYILLIABI ALY'IN MOORE . . . . Atlanta . . Honor Roll, '21, '22g Company Football, '21, '22, '23, RICHARD BUSH MORRIS Pi Kappa Phi. ALLAN BENTON MORTON, JR. . W. H. MOTT . . JOHN B. MURRAY . E. M. MYERS . . ERNEST GORDON NABELLE .... . Atlanta . . . Atlanta . . . Butler . . Fallston, N. C. . Atlanta . . . . East Point . Alpha Sigma Taug Varsity Football, '21, '22, Track, PHIL B. NARMORE . PAUL M. NEESE . . G. J. NEIGHBORS . . Blue Print, '23. A. V. NEILSON, JR ...... . Alpha Sigma Taug Aero Club. . Atlanta . . Marietta . . Cleburne, Texas . . . . Oberlin, La. . GEORGE DAVID NEWTON . . Atlanta . XVALTER B. NOBLE . . . . Atlanta . . G. D. NOLEN . . . Middleton, Tenn. . ALLEN JOHNSON NORTH . . . Hampton . Company Football. H. M. NORTH, JR ......... . Augusta . Technique Staffg Marionettes. CHARLES S. NORTHERN ....... . Atlanta . Chi Phig Junior Manager, Trackg Cotillion Club. X ovifvw 'NK' .N I . M ...-..... ....K ...I A . .- - - V W' U - 1 - ,wow -- s Z 1 C Q Lower. - ' --525 'J O X 2 ,,f 0 -- :CHO Fimwwwzsx 0? Z U G 6. N' , . . n 1 If ' i' , '-X Sikh 5 Am I5 !g5' .4 l. I1-' .. . ... .. -? 5' . ..... .... - .,.. -. Electrical Engineering Company Basketball, '22. Alvin Electrical Mechanical Mechanical Electrical '21, '22g T Club. Co-operative . . Civil Electrical . . Civil . . Civil Electrical lllechanical Dlechanical Electrical CL . Textile Architecture Dick Engineering Tadpole . Commerce Engineering Engineering GruCle r Engineering Monk Engineering Engineering Engineering Engineering Mate Engineering Engineering Engineering Engineering Engineering VVang Loo Engineering T: N :N , x 31 X. is E is Si R R NX li ln.. 'N 'N FN ! g's . . It il ui -11 1 + 32' lg. V W i 6 1 M rl w my 5 1 i I V . I A 3 f 5 14 23 .Q . . Q L YQ Y 7 1:4 if-1 54 3' f.: li 5 J. 4 5 l -3. H.. .gii .J - .NN LLXN 1 ! I A i 1 I, -if V - 1 '15 ' H-.1 l ht- A W-NwQgN 'e' -..---f-:iii-5?:Th..a11f i.i..z ...,,. ........., i-me ---- ,, :muwunmvmn V ,,,,.-. -.. IHEPDL PCI i- - ............muu:::u:n ----'--' W ------' A-i-'W --'-' eff-:.v f'53!:i: ZE N-'vv-'+?'L --:a::::::::::::::::::::::::':::::a: :::u:::::: r az::::::::::::nl:::r:.':::::i:::l:i:::::::: J' lima ' ' :L i n i ' i it 5 i-1 . . . 4 ., . . f .rg lrlexiu' P. Osnonr-I . . . Lavonia . . Electrical Engineering g l I5 I5 Joi: PAi.M1s,xNo ..... . . .h . . . West Point ....... - - Commerce :--1 A ,, r gg Alpha Sigma Tau, Baseball, '22, '23, Freshman Baseball, '21. Bad Joe I 6 Z Dox,xi.n M. Plxnicrs . . . Johnson City, Tenn. . . Electrical Engineering Q 95 Hauotn LHROY PAnuo'rr ....... Fitzgerald . . - - Commerce if Assistant Manager, Yellow Jacket, Fitzgerald Club. KPOHYU 6. , Q1 I 5 ' 1 . . Z L. K. Parrox ...... ....... 1 Xtlanta ....... Co-operative Engineering 54 . . i Y. M. C. A. Cabinet, Technique Staff, '21, '22, '23, President, Tech Bible Class. Q Piui.r.u- Suiznwoon PAUL ...... Dallas, Texas ....... Mechanical Engineering i Hi y ,, I E52 ' Delta Tau Delta, Honor Roll, '21, '22, Company Football, '21. Fat 3' '9 Cii,uu.i-:s l'i:,insoN, Ju ..... ..... A tlanta ..... . Oo-0 Jeratizie En ineering Hyip 2 g J! ,Delta Tau Delta, Technique Staff, '21, Associate Editor, '22, Editor-in-Chief, '23, Blue 'f 1 Print Staff, '22, Pi Delta Epsilon, Student Council, Co-op Club, Marionettes. 402 . .C - - -- l l l l Chollie Ana, Lvl , g.. SS. n.uu,i.s .'Xl.liE.ll'1 Puirvs ..... St. Petersburg, Fla. ..... Electrical Engineering 'i g ' VX - f . . A 'ndfl img! Pi kappa Alpha, Pi Delta Epsilon, Scabbard and Blade, Technique Staff, '21, '22, '23, Q ' . f x Managing l-lclitor, '23, Blue Print Staff, Associate Editor, '22, Marionettes, Glee Club, W ,ii Yellow .ilu-lair Ftiiu-, '23, Ai 1. E. ciiy Eaiioi, Tech Publicity. -. lii . is . 2? Lizwis Gounox Pirrs ..... . Cedartown . . . Textile Engineering 1 Sigma Chi, Cotillion Club. , N 'i A ' l Cecil lvl-'-XV1 R Powri ' F't i ld 2 6 U . .. . . .L . .C ..... 1 zgera. .............. C'ofm.merce s Pi Lambda Delta, Vice-President, Fitzgerald Club, Blue Print Staff, '22, '23, Technique 5 Staff, '22, '23, Company Football, '20, '21, Basketball, '22, ucecil-, Q N Fimo C. Pnrrcnann ........ Memphis, Tenn. .... . . Commerce 1 1 -'i . - . , , t ' ' 3 Phi kappa Sigma, Alpha Ixappa Psi, ,Honor Roll, '21, '22, '23, L E P t 6 A ' ' .. . umm . . Atlanta. . Electrical Engineering 'Y F c-- H. R . - ' S hugh S ,nrsm ........... Albany ........... Civil Engineering xt. l 'm ' ' ' ' - I - is 1 .ignia appa, Technique, Blue Print, Yellow Jacket, Marionettes, Friendship l Council, Am. Soc. C. E. , 'i Vaso'i I: J o f B t A mVN3 lHM g V .u fn V - ' H - msg 60. i X L -K X -X lf p .. ., ,,,, .,.. . , ...... .. ,,,,.,,. . ..,..... .... ,. . . - ..... ...,. .,... , .....,,:,,.. .. ,,,a .,,,,, - ...... ..:..i , .. . , I -I ' ' n N 4f'J x I. ,, , ' , V1 l Y, - I, X I I 1 -A If xl,-! L 5 I I K1 U X g l,..1wj:5.,x i I . . 9,3 : N , , . -A , A , -W if-i tw r ,I 135: I .' gg ,A . x .Wx .c.c.c..,.c.,,.J llrbgai -X , ff 3 ,2 J A .. . . . i, . - --'-21 , . - ----14:-ace ' u- .1 ' 1 '--.,., , -Z if' X ww ,Eh ,---1--H-mann:lm-mmumum wIonIIinI.IInIx1Riizuiaxiurm..l..w.....u.u-.ic--m-mf..--N-.-.-1me-.iv.iv11Ri-if,--1mimm-::-ni---- -.Til---4 -H -----mm - I-if-X-L 'TT - A . ,m..,'?,3Sm.-sn... . L W., H , f mx gf M.. nun' I ,,,, F-,I , 2' I II 1 .1 1 . 'ii 1 Hlll 1 L. 5 sqm., , . . ...... .:.-....-r: ......... ..... I ..... . n.:. . . . .. .. -.......... .. ........A... ... .. 'il ' '- V ' r 8 fi -. . :-br qi ! 1 Q o E- L- REESE . . . . . Electrical Engineering HENRY L. REEVES ........ Chattanooga, Tenn. . Mechanical Engineering Freshman Football, '20, Scrub Football, '21, '22, Koseme. Henry JAMES LEAK REEVES .......... Madison . . . . . Commerce Chi Phi, Delta Sigma Pi, Technique Staff, '21, '22. Leak 2 S FRANK W. REILLY ......... Chattanooga ....... Mechanical Engineering Phi Delta Theta, Assistant Business Manager, Blue Print, '20. 8 FRANKLIN RICH . . . Wilmington, N. C. . . . Civil Engineering ,t Sigma Nu. P x W. A. RICHARDS . . . Washington . . Electrical Engineering Gamma Tau Delta. ' A Y A. W. RIPLEY . L . . Decatur . -. . . Civil Engineering g li 'Lv -l E3 HENRY C. ROBERTS, JR .... ..... A tlanta . . . Civil Engineering I ,- zzns saaas Alpha Sigma Tau, Company Football. Harry 1 HUGH R. ROBERTS . ......... Savannah ........ lllechanical Engineering , ku U 1 -. Clip Delta Tau Delta, Technique Staif, '20, '21, '22, '23, Business Manager, '23, Blue Print 1 Il' AI Staff, Business Manager, T Handbook, Pi Delta Epsilon, Cotillion Club, Pan- Hellenic Council. . ffnivierei' vi 2'7 s A . ' P. T. ROBERTS . . Alabama . . . Electrical Engineering M W. W. ROBERTS ...... . Atlanta . . . Commerce DEI.MAR DARRIN ROBERTSON ...... Atlanta ........ Mechanical Engineering Q Delta Tau Delta, Technique Staff, '21, '22, '23, Managing Editor, '23, Marionettes, ' Pi Delta Epsilon, Barrage Staff, '23, Blue Print Staff, '21, '22, '23, Associate Editor, ' '22, Assistant Editor, '23, Company Football, Honor Roll, '21, '22, '23, Scabbard and 3 Blade, Freshman Oratorical Contest. A DW JAY EDWIN ROHRER ......... Fitzgerald . . Civil Engineering 'K Delta Tau Delta, Bleeding Toe. Rip u a I GEORGE PULLIAINI ROSSER ........ Atlanta ........... Civil Engineering Kappa Alpha, Marionettes, Varsity Track, '21, '22, Y. M. C. A. Cabinet, Swimmirg team: - ' eorge' D Gtr-' , ' Ho f 0 fi 'T-A 1 .-nw 'I 5 ' Q, . .1 X' ', - -2 '71.,...Lj T ' Q LV L o EL K OOAPIV P H .W-X - 1 T32 xx fi an 0 .... ft -.,. fm' -. ..... ,4'- - WIIIIIIWUIIDIIIW mmm u v- D: n ot E 1, P R.. N 'I' 1' f E H B ....... ..... .. ...,,.......,,,l - :za ...... V l 4 ii! QW . Y JAM, ,:,,.,..,-,gg-,gg AV ,ggg.-::m::::::z-Ar::mmnmaazan:::::::::ar:anIx::m:m:::::l::::::::x:::.......::.... .... .. ....... 7. R V H--nv H .l....dg .,,. ..., - ..,..... , ...-.. .V., .. ..,. .......,....l I ,.L.....--If--f - fi JW , H ,.. 1 -I.-wx flax! 'f55T':'t 15 5555 Z i 5.2 - , , ' -' ineerin ,f PIAIKOLD F. Rozmn . - npdrtd ' ' Llectlwal Eng g . gi Y . ' ' ' eerm X. Amotn Ram Rumm: . . . . . Macon . . Electrical Engm g l Pei? a , -- 1- H Operator Tech Radio Station, '21, '22, !23- Rddm Ralf 5 z' Fl t 'cal En ineerin . if J. XV. S.xNFouD . - Augusta - ' ' GC M 9 9 Q ll.IJl-IFONSO S.xN'r.xM.xn1A . ....... Havana, Cnna - Dlechamcal En-qmeelmg Fa President, Cosmomolitan Club. 5 l ,Cy I :Q I 5 . J' 5.3. 5A,,,,E,,S, Q . Atlanta . . Electrical Engineering ' S. G. Sr:r.si:n ........... Alexandria, La. . . Civil Engineering I Sigma Phi Epsilong Technique. A uB1'0ln0H 'ti Gunnar: Fnaxcms Sizvua .... . . . . Savannah . Co-operative Engineering I Delta Kappa Chig Savannah Clubg C0-Op Club. Frank 27313 Q 5 C .dill . . . . . 'ggi F. lx. buaw . . Atlanta . . Electrical Engineering l . A 'wm- lJf 4 Jmuvs Ci,.xur:Nci: S1-uw . . Cartersville . Textile En ineerin l l Li V Pi Kappa Alpha. , Country at I . ' . - - ' ' -4 ' I-I. XX. bm-zxxrox . . Atlanta . . . Commerce ' 1 1 4 . nm-'L pw W. 'l'. Snmnxnn . . .Atlanta . . Civil Engineering I Qi! S? l Y 'w , , , 'l A Xl11.u.nr L. Sicxrzi ..... . . .. . . Savannah ........ Engineerzng Chemistry M Nh . , , - lpl Lambda Deltag Bandg Blue Printg Lmerson Chemical Societyg Honor Rollg Orchestra. N scRedsx JOHN ln. SILVESY . . Ohio . . Mechanical Engineering xiii ' 3 N: ' ' Y ' W . . . E- L- SIGBBER . . Florida . Co-operative Engineering 5 F W S i ' ' M-Anim - - Savannah - - Engineering Chemistry S S JULI.-KX EARL1: SDIITH ....... Reldsville, N. , i Cfommeme S EE. Pi Lambda Deltag Delta Sigma Pig Yellowl Jacketg Technique. HJ E if gl N 'Q' P ' R. . . . . E A1 L SHITH . - Atlanta - Electrical Engineering Q R . Y . J . ' . , - 95 ICHARD sxnox SWIITI-I, JR. . . Brunswick , C0-0pe,.atwe Engmeemng S C0-0 Club. . , Q P sKDlCk!! iii S 5 5 X Omg! an' '7 X wr-x'RQe-'-:tam-4 xxx, 1.-vase NNNX -. vm -'J-'ff 1 ! 543' 'x OK fbgilgfcascfefcatvqyffvggawwpgpw 5 U P ' ogg:-' i s A O A ' z - A f' H ' -- 'ff' ' . Q- P 'wi' W Jima 'U .... ' :-2-:-Q.. Q ' 2212-. '-:iss 1:-25 J..-S .-rc-, C 12' Sv F L Y Y . V Y, ,, . H N ffmi M l t - . -J ' - . a t -w .A J. ..---Wxwwwwwmwlm Lxtfrtiy, K. Q W 'i' Q' .... - jg 1 ' - it - , . .gf V 0 t f n I . Pa - , .45 ,::' , . D X V A - 0 0 X Q, ' ul mll 84 Af 1 f.iQ fri, , A 'I KN. f . xi Q, q , rg ,- X ' V' '. ,fr -. .. X . . f , .,.-' it . A - , g - . 1 ,4 ,.'- . , ' -'- '-'C, E4. gf' ' ,r . Q 4, . can ,sw A - ,, ,44f,1' We-C-3-C--2-J fs .1 A .. ,I -M. -, .,-Q. g.,,'. t ' L, s., A - i ' -- ' ' L aug , 1 '-I ' - ... f - Ei-giEEK!EgfulllqgmgsggllKIIINIIUIINIIllllllllllllllllllllllilllllllIIIIIIIIllllllllllllllllumlnnumml u-e-N--unnm-,--1-.--mi..s.i.4ninw1ni.nin-'-lmEmnv:-r.Gm-4-mum.-H-i.umm.--.....5a.,. A-ma. fi- -wf.....-maailz-uri-fu :.m..: . f--ni -,Q as mn- - a N ,. 1 1 . 1 M : V iw :qs f 1 l H 3 ...- I ll 2- I illlllli ll 'llllilu EL llll lllulll ll E X57 la x.-me . ii .- n I :-amanxsxxnm:x.mu.m. nes, ll : - --- unnul'I-ulZv1n.l..Jn...':, ,,.., , ,,.,,, .Lam .., ll 4 1 -QT . 1 2 I E 1 ki I Q ' 1 ----A--- f '- -ii ' ' mm' 'I' ' ' ' 1-:::::::: :::::::::::::::::::::::::::::::::::'.::::': :::::: ::::::::nm'::: :: '::- -. - - :'. .: '-::: .: ': ':::::::.':-.::::. ..,......,..-,..I... l l . D ,Tyr Q MII-TON A- SNXDER - . . Marietta . . . Mechanical Engineering A-ff 5-E SAMPSON SNYDER . . . Bastrop, La. . . ,Commerce Alpha Epsilon Pi. S. V. R. SPITLER ........... Indiana . . Civil Engineering Delta Sigma Phi, Tech DeMolay Club. RICHARD JACKSON SNELLING ...... Pinehurst . . . Architecture Delta Tau Delta, Architectural Society. Dick JOHN CURTIS STATON, JR. ....... Atlanta . Electrical Engineering 1. Kappa Sigma, Varsity Football, '21, '22, '23, Composite All-Southern, '20, Track, '22, '23, A Company Basketball, Sophomore Baseball Manager, '22, President Freshman Class, Glee Club, '21, '22, '23, Publicity Manager, '22, Y. M. C. A. Cabinet, Deputation VVOrk, . Blue Print Staff, '21, '22, '23, Associate Editor, '22, Technique Staff, '21, '22, '23, f Student Council, Honor Roll, T Club, Historian, Koseme, Cotillion Club, Pi Delta , l Epsilon, Boys' High Club, A. I. E. E. Good-Looking P is A A '- ARTHUR STEIL ...... . Fernandina, Fla. . . Civil Engineering md, Technique, Tech Crew. Dock T I if P4 Editor, Barrage. O. P. STARK . V , IIIQ B' ' wyglli QQ P - mi 59 Q' 0' WALTER CHANDLER STEVENS ...... Carlton . Sigma Chi, Technique Staff, '22, '23, Yellow Jacket, . . Russellville, Ark. . ATLER F. STEVENS . - -Meigs' - I WARREN ASKEW STEWART . Atlilntil . f 2 EMORY XTORHEES STow1TTs . Atlanta - 2 5 THODIAS F. STRINGER . Columbus .- CLAY BELKNAP SUMMERS ..... Asheville, N. C. Z Technique Staff, A. I. E. E. Z F. L. TANNER, JR. . . Atlanta . JCIYO Lower. g 1, sg X 2 2,10 el 0 Electrical Engineering '22, '23, Marionettes, Athletic Electrical Co-operative Illeclzanical Electrical Co-operative Electrical Electrical Engineering Engineering Engineering Engineering Engineering Engineering Klsleepyil Engineering ' f rua it lv 'W ll -auf l 4 E 'XL' N 1 31 5 N O 6xP,4.,v 5 . o i . OQ-of Q ' 1 'A L, 'Ig Z L .-.. A- 0 - .e tilfli 1 , lf' 2 - ,O L E A i3.Z1 .- - Y Q ' . , 6 , - ,X ,- I - ,?34,y,y , I 1 . . LOOCXYA E FV! 'F f?!'mY2iQZi7:3'5X5Q!f4245Y9MQ,'?5C6'JW9'53'5bOQQ4SZ9t'QS5Ei66c . pyswsfey A 1 an . G L- L V . , . l K- i...i ::ii5g,gi- 'is Ll I 5 .. Y Y L Q 5' h 5-ff I 0 4 3 . ' Q' I L . 4 4 4 4 g. P . Q n 4 55 V 5 X . ' 1 V ., l q. 'Ffl ' V V 'll - ', : X 4 . 1 f-Fw '-'- 2 ,, Y V.. X . LQQZQ, 3 4 I I' ':'l -nigga. ., MIl:'.i-M51-Rn., ,q,,, ,,,. ,,....I.Q.'IfI..:f5.a.. ..... ',-- g.g!g11i,3gQ:WHl Sl llllllMHl-Bilnnuultmaiulumluunfnn- wan... un, . . . mn - ' V -5 l X15 2 l , . .' 1, - , 41? li lib: ' 5. i l ' . I f .. lf: 2 li V' N l ' - ' -- Y ------gmzzzzm-.:::.':::::::::::a::::::::::aa- zz::::::::::.::r.u::::::::::::::::::m:::l:::m:m::x::::::::::r.::-':: ::::::::::l:::: - 1521 ---- -E:'9'?E55 l W T . z, ,, t1 f . . Commerce Q ' f E21 Jmiizs H. lixYI.on, Ju .......... A an a ..... 4 . . ' A . H. l Kappa Siginag Alpha kappa P815 Glee Clllbi Golf Club' J I h't t . lg JOHN Scorr 'l'uoM.xs, Jn. . .- . .' Rocky Mount, N. C. .......... Arc 1 ec ure . E lg Sigma Nug iXl'CllltCC'TllI'Zll Society '1ll'C2lS1ll'C1'y ,235 Blue Print Staff, '21, Yellow Jacket 3 P . A cclraysr ' 4 Staff, '22, Associate Art Editor, '23g Marionettes. , . I, s 5 . . . .. if H . . . Electrzcal Enmneerzn 5 ' V ,Q li. S. liumubom . J g gg 5 1 V ' l ll. C. Tuonufsox . . HuntSVillC, Ala. . - Electlvical E77'9i'nee7'm-9 if E Delta Kappa Chi. 1 i . ,H . :A r I l Wnnmn 'lkrmrrsox ........ Forest City, Ark ....... Mechanical Engzneerzng l pi: , V, B1-tn 'l'hr-tn Pig Yan-sitv Baseball, '21, 22, '23, Student Associationg Skull and Keyg 3 j -I ff ' . lei. v . . , as h-new f. 5: Bull Dogg Cotilhon Cluo. HHS 1 5 s , bg. i ff 1 fa' I' f-' I ll fill! Lt- film' P. 'l'nonx'rox . . Atlanta . . Oo-operative Engineering wp .lfililll A Q gym! .::: .1. n. 'i'n.'..M0Nn . . . senoia . . onnz Engineering 4 , ' Q v csBuHv gm., Lvl 'EV ' Y MIP i an a I ii Till ' l i 1 li 5, fl'1'1-1-mf . . Atlanta .P . Electrical Engineering ' 'mg Q N C. J. l'unxnu ............ Cedartown . , , Commerce 9 ev ' T ' i , . . , , , ' 'J V Q Sxvnunizng lc-sun: K 'impany'Fo0tl1allg Clee Club. l Ez, L ' l .S . I WI T1 Hmnrov E T ' Y B 1 . . . . X l . . . Ln- ER . ...... rac entown, Fla ......... , Q Civil Engmeermg 1 P1 kappa Plug Smluharcl and Blacleg ,Scrub Baseball, '22g Varsity Baseball, ,235 Am. I Y SIT ' - is soc. C. E. l Q if x von Humbugv i:3: X, 1 t-r he ll ig li My i xriuxnsi. Tuunn ....... . . Macon . , female Engmeeymg N E I ' x' l Company Athletiesg Captain, R. O. T. C. X ,,Bear,, . FI X 'N 3 Josrvn 'X Usru' Tl X l . . . .... . . b iompson . . . Dleclmnical Erzgibzewing E i W V ' ' . 'UL P- l arsity Football, J. I ,Baby Joeu Q: 'Si p -s Q X 'X Q Enw. R K. Y. pw -Y - . .... -- . 'E N . x n xx ix nu: . . . Atlanta .......... Textile Engirzcening : E . . u , I l 3 X , Chi Phi, Tennis, Team, ,215 Glee Clubg Mandolin Clubg Cotillion Club. nRipn S , Q '-1 ' N. X N, 1 . T S A V . ' S 5 . E -if Nl? l l i 1 H- . f---- - O A.::iE??' U,.o ' fi A' . X915 qi' ' J l -pf r i f .A N X34 ...::::5: . 97 i i I W L6 ! fmx'-.'66ZBZ'P:Q::4a14:21f11-:-1-:za.w:-srfuzemvmrm-rm-:ggpx5,Qp9g-pq,44.x.54.-V- 'QQ I5 Q . I 17 X A ,, H Ewlli-W 17 -. , . I x A Xb Vi fi? .2a it A L .H--. ., . ..... . .im mlm- -I. ---- --- ---- ------f. , ,,, I , V m an ,z -EE----as ,. ..5.iE--E-.ati IT X I -. 1 E ' er- ' f .,.,, ,E if 4' A ' X 0 F13 1 A -.M X N Viv,-.I 7 H 'gs X .fs A 1 l I Q -. I J 4 .1 1 av mu 5 itil: I mn. :IlllllIIli!lllIll!HUlHl i1aIIIIIInslnuumiumlumnm. mm-. 14 U H , ut ...man fs- I- wharf-In nu ,1 ffl . -. .I mi mu... A . ' ,,,.-umm? '-1-:mr I I 1 wx ,mgum 1 1' H I' 3 T.: H I , , -1.-1 a ' a:assua:az:aa:::::::::::::::::n::n:::::::::::::::::::::::::: :I::::::::::::::...:::..::::--::------ '-------------------- .... . ' - .. ............................ ' ::::'1:::::::.::'.:::::::::::::::::::: Ii- ....:::r:1l'.:'.:::m::'..:::::::: ::::::::::. .........L-,.:!!g...... - I 1 C' B' VICK - Seab0a1'd, N- C- - . Electrical Engineering Delta Kappa Chi. - FRANK 0- WALSH, JR .......... Atlanta . . . . .' . . Mechanical Engineering Sigma Alpha Epsilong Glee Clubg Mandolin Clubg Assistant Business Manager, 235 Marionettesg Scrub Football, '21g Class Secretary and Treasurer, '23g Kosemeg Class Vice-President, '22g Cotillion Clubg Oil Canners. Frank EDGAR CARRUTH WALTHALL . . Atlanta . . . . Mechanical Engineering Delta Tau Deltag Bandg Swimming Team, '22, '23g Cotillion Clubg Oil Canners. Eddie ROBERT CAMEIION WATKINS . . . . . Atlanta . . . Mechanical Engineering Pi Kappa Phig Cotillion Clubg Skull and Keyg Oil Canners. BENJADIIN EDLIUND WNHATKINS . . . Indian Springs . . Mechanical Engineering RICHARD S. WEBB . . . Atlanta . . . Co-operative Engineering Bevo JAMES TV. WEEMS . . . . Rome . . . . Oo-operative Engineering W. H. WEIR . . L ..... . . .Chester, S. C.. . . Engineering Chemistry Emerson Chemical Societyg Honor Roll, '20, WCafY', TI-IOINIAS A. WELCH . . . . Savannah . . . Mechanical Engineering WILLIAM L. WESTBBOOK . . Mississippi . . Co-operative Engineering RIICHARD W. WETHINOTON . . . Atlanta . . . Co-operative Engineering LEE WHELCHEL l . Electrical Engineering ROY ENOCH WHITE . . . Atlanta . . . lllechanical Engineering E 'l I 2-2 -2 J' N . 2 ll 'N re 1 lg fl l fi? li :nf ' l 512' F a, A , W LIONEL K- +A ':liE'5t O 'Hr-w':-'fm'-U JOHN JAMES WHITFIELD ....... Hawkinsville ............ Architecture Alpha Tau Omegag Blue Print Staff, '21g Technique Staff, '21, '22, '23s MH1'i0f1C'f'CCS9 Secretary, '23g Yellow Jacket Staff g Architecture Societyg Pan-Hellenic Councilg Honor R011, '21, ,22. ' Jimmie, CARL B, VVHYTE' , . . Arkansas . . . Electrical Engineering Delta Kappa Chi. i I f I , O exp' s ilo ! O Q1 ' Q' H E5 W 'gl V lpdpp AV 0 . '5 1-'L' -' 'fa W. - , nWmfawfwgw0Wgegr ' N i 1' 'ap L O, ' W , I L J . A 1 X :QR V I Y' Oigiiin. o 19 1 cy. f., 1. .4 1 if- r. K. -'1 5 1 3. Q S 5 1 E 1 S TS S Q 3 , i x . if' A' ',l A-I - I w. I fe F , T iff? I - 3- ' 1 .iiffibfi Xi .f f 1 ve V if-. um-W -me , ,, 4,,, um ,,., ,,4,1,, ' .,.. , , film..-H ,--, W N-+-----im-1-1W 'f1 i ' ,..-iii'-1522.-.i 3 -5, f 1 1 i ' I1 D I .V E: Pg. N W Y 1 X 'VAA u-AEM--hr-uwmmiuivH hmkrm w M-am:m,,:,,m,:,,,,,mmm,,,,,,,,,,,,,,,,m,,,mgimmgiiiiimiriia-.:::::::::::.-iiiiiliiriiiiiiwl ----H - 4551----' iff' Z :Ziff . 7 Fig EUGENE J. XVIKLE . . Atlanta . . . Commerce 1 - Ros 5 Blue Print, '23. y 4 2:2 . . . Z W Ricuiuio O. W1i.m:x.Mz ...... . Wapello, Iowa . ..... C0-operative Engineering Technique Staffg Y. M. C. A. Cabinetg Co-op Clubg Brlarean Society? Class Vice' f Q - - Dick , fr President, 23. if 2 Wir.i,I.xM .'kI,!-IXANIH-IR XVILLIABIS. ....f Atlanta ...... . . Textile Engineering Ka J ia Al ihag Indoor Track Team, '21, '22g Varsity Track, '21, '22, '23g Skull and Keyg gi F11 I l l E1 Cotillion Chihg Sophomore Football Manager, ,215 Marionettesg Honor Court, '22, Bill 1 ii: A 1 E12 is 1 R. S. Wirsoxv, Ju. . . . . Lyon . . . Electrical Engineering YVillie 1152 E :if 1 ' Pun. C. Wixsnziio . . Atlanta . . Oo-operative Engineering U11-llj 1 1 1 :ffe14f.f1. . t J . . if L. fly XX ixr,'1'i:n b. lV1'r11uus ......... Atlanta . , . . Commerce i I l l -7 Chi Phi: Assistant Manager, Football. Walt 1 ,E I' Y 1 .. . 'il l 11 1 . ' -4 NN- 1 V 'Eu I ' .Xilinx G. Wooonmrr, Jn. . . Savannah . . . llfechanical Engineering iw Scruh Football, '22. ffjjinyv l ' ll 1 1 ll iq Y . FRANK R. Xl oonroim ....... Little Rock, Ark. . . . Civil Engineering N . . - ' Phi Sigma. lxappag Svahbarcl ancl1lBlade. ii A is , , 1 1 h.. H. XX onus, Ju. . . . . Nashville, Tenn. . . . Commerce , Phi Delta Theta. aRam,,Y . 1 :is 1 S xi PIE S l 2:5 , . N fir, GEORGE BICZELXYI-IEN XVYNN ....... Atlanta ,, ll , ,iih O0,0pe,.ative Engineering liiaf , . . . ,i 5 Delta 'lau Deltag Marionettesg Technique btaffg,Briarear1 Society, g , uMack,, S 1 1 x 'ii S Tsmiizi. Hmnox Eos ....... Pensacola, Fla. ..., Commerce if Pi Kappa Alphag Delta sigma Pig Teciiiiique Staff, '21. ' ..Ted., f 151 2 A 1 E35 U45 xviiii -V E. Y .- Va IAN ox . . Atlanta . . Electrical Engineering E f :-4 US? IT X :1 Q99 - -T ffo z O 'X gli fa -in-Eiyi kl? i 731. 177, ' ' - 5535? .-1 ' Fx -vi ':'Eifii53:,,-jx-. V f lies? N'NNM119519-226:-wasaw:ears:-:vi-mziezfrx-pxm-:gg.y-gpogg.pq-244.g,,g4.gi1 Qi 5 F-Q I7 L 1 ,. Y r - Q - .K4 WHL K. A i n i L. I Q ., mQwQwmwwQmiwxmKmKxxxxxxwxx U 213 4 A,- V60 G invi- B ,- . , X 4. . .r q, V . fx ' , 'fifli X4 - X - --'L 1 ' F W V gi'-3.9. . 'i- - IN' '-. 1 gs U, i M W , 'lg -qua il. u 1 ,.. m hliaii fu ':n.1m.u,EQ.H'ma-n- L-..-.-..uQr4uFnum1' 'lifh-mm-.1nfE. IF-E'HJRIlr!I-IIn:lx1lul:unn3E1lxHEi5?--:t unnglmx1n'aigE!l?:'1 Em ' T L VH Ga I H I 2 N ish mu .... . . ..... a::n::::s: IIIIIWEBBIHKESIIIIHDFIHIIBIIIIIIXIEIIH n :mummm:n:::::::::::ln:::::::::::::::::::::::::::l l:r ' : '::1'.:::::nr.n:w:nm.':mm:xmm ::w:-.-v:!::a1'.1'.:::::.'.. :ra:ai ......-----. -iii:---f f N X 5.1 1 x QP 4 S r N f N 4 ' N 4 1 'Ce 4 Q 4 S 5 A . Y E 4 N Q , 5 1 Q6 'f I Nl ' 5 S +. , N 2 N Q' S :E fi 2 li ' X 1 iq 1 Sf Q 'Q 'X 5 '-ull' 'lb .4-,Q yd -xv 1 :- bmi 1 A w fi 5.1 fl 5 Z 4 f 4 5 f 2 4 4 4 4 I 4 4 4 4 4 4 5 f X J f 5 fix: 454 4,54 , ' Q V ,464 A, ' Y. iixii. I ff' Gig Q-Cxwf-M' f If ir' X O -new O?391ffff1 Wffaff11ffwfM,fA'ffWfffxyffffffffffM:i.gQZO 2 F' L- f . A ri? rr L ,,, LLVY- i ,Q ,fb vb 5 JC 1 o X ' uwgfz t o L w ' lx. 1 Y 1. ' 'i:.. . MA , . I ffo l 3 X41 ' F ' ' 'Q -- ' ' ' X X mimi-V H A Y 3 Y lf ,ML 1, : ,rf A ------2 ' V 1 T Q 1 Q f f , I j g gg 3 ?pg.1:ygfz4p5apw,wo4Qsas29Q4-,vzwfwx . A X Ji - 'W ' jg nv . 'A' U H 51 ' idx? ' ' U ' unzip I , g,, ,.... 'fe 'EEF' 3 A LLC ra gl, K. 'Eat X351 Fl? M .. f A 'wihl , :Pb 60' O O xxx53 X'L.1.n--' 4 V X183 Ip JN K 4 m ..-fl -4' I JL: ION 4 4 I egg E O 9' ll gf X E 5 Q2 5 4 Zi DE Q S X 22 5 4 E w -x fi -2 s x. . .4 LLVM Q55 eq' w 6 'Q u I , :XFX ' V, A f., f -X :U l I I-1,2-5,,A 1-H Q X - . 1925 gA V595 Q, ' K-bmw I .2-5 A -I : '6' J Q ,,.,. ,.,, ..... .... ,. .... . :x n sm mauwuu-alumuuummvlumm-mf-W v1.-- mn.--n--1.1 -,,, W.-, -.,. ,...,,.-... m.u-.,u-Au-v 'fH x B I ll., dw'-vgvnm Y-.ah-NLM' ,V-nd.-.uk 33'- W -5,.,,,,,,,..,L,,,.,, W -1 ugl.'3.1llI'.:'.:2ll2lBI35i::::i::L'll's:i:FllIIKUHHFFIIXEIISH InIHIU5nailsIUla:IiuiillfilgiillffnzaifffFIFIHFIIIIIIIH- .......--:A .. JUL ...... ifgsgg ff yi V134 f' Z 9 I i .3 I A E35 ' L4 M lg , I ?5 Q: 1 :- I sf. E 'fi -: if , Q O .fr 33. Sophomore Poem , . di ,, My gauntlet s run. Ufzthout a fouoi 555 I'z'e hail e.z'perience in and out. 'ifgij Plane analyt ancl mess-hall fare And flunlfs- that icatch you unaware I ' J Are all behind. xl I ee learnefl to shun the ways of those 4 , , , , . -qi. l'I ' IVho fall in love with every Rose. 4 ? In one short .year I've learned with ease im The methods calculated best to lease ' 3 , . VH. ' ' The olase maid. VER 1 , I , -mf V Its more than true that last year-well, -I I Q ' I I .Fhe za' f er-classfmen cave me-. . QR' W ' IP J A U . f kx But Oh my wora'.' ,A greener crowd . , :- N I never saw before, endowed i Ufith. such ungainly shanlcs X 'I E5 If ' ' I-ls twenty-six, a mkotley sort gg IVith high school wit and boyish sport And homesick dreams ofxpretty Nan E W , ' I 3. :Ind mother's pies and Uncle Dan :Q And all that rot. X E353 - . But wait and see,' leave it to me, Before 'mild June will set us free I'll have this bunch so broken in K W'ith trouser-seats worn flat and thin They'll educated be. ' I Q N, , For if a Soph. sat down in ease ' -:- . . . 3-, Anal freshzes dzcl much as they please . iggg What would the school be then? I guess ' W'e,re more important than the rest- UE: IVO es verdad? I -5 S -W. H. V. x . - N M I 4 5-Oli' n ' U Y O fl l?i.:.i5E:::..5- f ' .Ei T V r.:-auf. '.s:r::-:-- 1:2-rn :H rf W 11:3 Fi' X Xl YY ' A ' A- i AXQRLAQWZ- W'6.f'Qc-K-n. xv. 742-Q-:Sak x.xxx1s'9:.2w:,A-N4. ..fZ Le-exlgw ghfg f66S6ffA9vfy49Q9Q90pQQQQm1Qi5656bQ51b1Q2Q2i5RxXXK2Q5.X?QQ4R - K, Q Es, , Q so ' ' e 2 A 'J .Mg 65402 O ,A e A -, - rx!! N -by . .ii N.-C J- US ny O X Vx C ,754 Af JO . , fl X frnx M -.im - M i -N': 'xxx FN' ' k xr-tis? A r : ' I V ' f . MY1'XQ'EiNESwfQRxSiQ5', - 'Q lk H144-1,315 si?-f - . ' 4- ' L - ' z- x. ' lv , f , ' Wt 1:2 11 1+ 'm .-' -'ix yi In . A I ' X. ...NEW mx main..-m .M vT1nXiYrnTnf1111trJP:'m1m1nx1x. ' , :,'-x' ..,.,,,, , , K H F ml N .- . ' rf K. iihggx . H i 5 1 l 'r I IH' -ff uw ----- v nn-u.--.-mum muliffmiinn.-ziG5,f.::.,. r'-N .1 I .53 A .. N - , .... m...,.,,.f.::,.:: .. u..z,.mw,... .. . 1, I ' Q 1 X - 5 ' :.. 4. '- W-1 . . . , -.-m-'.w.1,v::-1-uvrzw-rr -vu-1, .. 'E fikuxm. :::a .......... . .... . ...ns x a nr s..L.:nuu -mmwlm ,1 , mm umm n m-qu ---.. ' 5 T? ... .. .... ...... ::::::x::::r.:::::a1::.::1::'..':x:mx:an:z:::x:::x:::l::::::' ----g-----------.- ...... ...... .:, h--- Tfg ..... ...... .. ........ . .... ..... - - .... ..... K l 7' W X 'x -5-' 1: S Q gy mg - ,ff . N 1 9 N , 9 Q E' E 1 X N Q Eb S if N 5 Q o E Q 5 K Q x S L--Q , 'wx fi Ax I iw - ' A V f 1 ' 1 F532 -v 4 455 4 , w r ' A :ssh r +- Q W R 'i Lge: Y' iii 2.3 u vi W .4 N- L f' wx I Zinn wa. I 4 -IW 'imp' ' v I V AY I M 4 gg 3 J if cf 2 Z 9 , Z Q g Q V Nj c,.c,.F. ' ,J 5 F 5 Z 5 f 9 4 Z Z X4 6' 4 , ' 0 60' '-.v 0 v wx X637 of mf! XX lb A 7', f. , riff! ' ,, -Q - f f ' 'L w -, ii ,. Q' fl V H Y A , WA' A J UK I xff' . Y . - ,099QQW-9gv,y',09ffp2HqoQQ'S.QQ21So6LQ5C9Qi . . . ' Llc 51 5 L F - ' - Y ' ,xr t x t ' X-,,f1'Q,1,q xijgigvfi' - 0 L 1. v v4 1 2 Agp, 15, G mes? E. . r 142' ..,. I F'- .23 f :S-2 -v- f .3 5- 'NI .N vu Q ,Q , 1 L1 : . ,I ,V .1 . ' 12 ?-' A.. rsgmszegszz 5 H J!! ' 'V +MyiHf5'l W I 2 I 1 p P L Q LIONBL q f .5 : S A , .-1 . ll I all is A- h 7 I ..,, 341, Aafwax ,. , - 7 'Q ---- A ' , X L'-- ri b , -' I.v'lml::q..'m,M'..1:.rWd9:Lm':4-ilu: .',, I :HQZZM ,:,, ,,,g15:...1:2Z..ifL.............-.mf..2Q5iG-3f.nn--....,..-mmtxrfgi Mauser mlm, ' - uanmmlmHm..,..+w-.,,,,...m.-.-..--eww -'--'- ' 1 1 u ' X ,HH '- P P, N . - 'fx k , :A ' gil ......-------1------------::::::::::::::x::::: ...::::::::l:::::::::::::x:::::::::::: ::::::::::::a:. ........ ..- A.'lz....... 55'Z-'51 W -vmwnwhmmbw-M V .. M P1 ::-.:.. ..::' '-.:x::::::r- --'-- ::: ...... -------------------M A fp WF, M- Www 1 f Ml 1. 1, - 5 nl '7 X ,f .Q , 6 . ' 'a Zw V' w 1 5 r 7 4 E55 Z T - f I r - . , .. , . r 3 'iff A i I , . , 5 r 4 - , ' IE I Eff r r 51 r 5 f . , 5 , Q, ' :f:. f fs: r 2? V! a 7 V 5 F5 'Ii 12 r. ' , '.1 . I ' 1 r -m-- 1: L' f ,' y N H ' ' ' 4' W J w Eknxg W r W eq YZ'-f Y x I - MM T' A ' 1 ,f .1 'XF' ,Qy t l 1 1 mg- thru , P ff ,W :- n QI V'-N 1 . 3.11 , ju? L ' V. J i 1 g , va b A I ' i r 'Qs Ig ' FEE 'Ei in Eg' r 47 , fx ' H 'Z n 1, W , r Sophomore Class Qfflcers r ig .11 .z ' E59 F. D. S.xNm:us . . President E22 Y fi . . r r r 2 , P- O. HARRIS - . . Vice-m-esiaems X' if . Q T. 5. BLACKMAN . . X Secretary and Treasurer V r E 5 ' E251 W 2 4 1 X4 1 x E4 5 s . f ?' bl: r u Q 1 X o Axis ' ,- 'S ilo O Lvl oo., o -'J i' 1 A on . Y -M E A to -. '-5-1-1'-1-iq-. ---.5 -. -1 v- ' 'N-ww--. - 'gf -0-n-my f.-xn.'- h W EG i - 'Z -W h P :H VY V K ' - Y I .A.. :Q.,:x.xs.m..pQam-. -.... axi,..w....5. .au ,... Pig 3 V, V V b ,A V Q V 5 XXXXXKXXX MEL V Q zinr A Y . ' ' uvv- tx' A 4 NQXi'E3 z'6O -1 0 , . S! glH37ggiEEE:mfii5iWiHill31IiiliIlilIlllill!!WSHlllilliUiiiiili1i!!L5E!IThS fsffzixu I. .1.,g mhfui-1 .,,'-,,,,,--,4,1-,--,., q,,q,g.u4mu:mx-Euif5Rmve'-e','-ff. r-f- Q -::-a:.- - --::::::::x:::::-x:1:: 1:31:21-5' -'f'- -------fffhfwmfrffrffmfnfmrrfgliflfnf135 .'ggEll'r l!i5E' if ' -n.:- - ---- 1 X ,,,,. . 1 IIAIWI H E: DL P P..IN'I' Tig:-His?-illliilllia-... . :.a... .Sli2:32GSHiiiIi -n:5 nl'l:L'3iiii?- ii:l5:iiI1ICISIEIEl'J-'SM i 'i:'.23ZIlZ'.:21l:!:lI-1' 32:l:T3lf3I'33I?2i 1iiiiiii3IL1l E:S2'ui'-I ? 32'.n7:3:T-S ...-. -.. nf- ' .I . A Sophomore Class Roll ?f ALEXANDEII, P. L. CAJIPBELL, E. N. ELSAS, WV. R. ALMOND, A. R.. CARLISLE, H, L, EPTING, H. D. ANDERSON, G. W. CARNES, O, N, EVANS, L. A. ' ANDERSON, G. T. A CARPENTER, S. M. EVANS, M. T. . ANDERSON, M. H. CARR, J. J. FAGAN, T. E., JR.f 'Sq ANDREWS, W. H. CARTER, L. C.- FARGASOX, H. F. Q' ARENSON, A. CERP, E. A., JR. FERGUSON, N. N. S ARWOOD, E. D. CHANDLER, B. E. FIELD, P. H. A ATHANASON, N. A. CI-IANDLER, C. F. FISCIAIER, W. P. SQ QWTREE? S. CHANDLER, G. A. FISHER, VV. H. ALL, . . - CHANDLER, S. VV. FLORENCE, H. BANKS, F. L. C1-IAPINIAN, H. K. FLOYD, M. D. BANSLEY, J. D., JR. C1-IAPINIAN, R. L. FORESTER, G. C. S ' BARDWELL, G. E. CHEATHAM, C. VV. FOIIIIESTER, VV. R. BARNETTE, W. R. CHESTER, W. F., JR. FOXVLER, VV. T. A BARR,.T. CHILDS, E. W. FREEMAN, C. F. BAIITLETT, A. L. CLARK, L. G. FULLER, B. B. Q , BARTOW, P. L. CLARKE, E. C., JR. GAINES, J. S. M. Q BATES, L. E. CLIFTON, W. M. GAMBLE, S. B. . BEAN, C. L. COLE, L. D. GARDNER, E. F. S , 'S BECK, E. C. COLLIER, C. F. GASTON, M. H. tx ' ff BECK, L. R. COLIINS, C. D. GATES, L. E. E ' BELL, T. D. COLLINS, E. T. GEORGE, J. E. W L BELL, J. T. COLLINS, J. B. GIDES, R. S., JR. IO? JT L A BELLAI-I, L. T. CONKLIN, R. H. GILKESON, W. R. ig! Q' BENSON, O. CONOVER, R. J. GIVENS, A. C. .m 31115 BERRY, R. C. COOK, L. M. GLENN, J. E. ,925 BETTS, R. H. ' COOK, V. M. GODWIN, VV. H. P221 BINFORD, J. S. COTHRAN, T. VV., JR. GOLDIN, M. I. nnfgg BIVINS R. S. CRAWFORD, W. R. GOODWIN, W. C. W g f BLACKTVIAN T S CROWTIJER J. A. GRAN1' J. W. Q4 5-2 ' 'N O. ,JB G f,DG WM 'mg BLACKMON, H. . UMMING, . . RAKES, . . ,mp h,,,,, BLOODWORTH, W. H. DANIEIJ, R. G. GRAYSON, J. H. Emil BOAZMAN, A, D, DAVID, H. S. GREEVESSVWPL B. QQ BODY, T. D., JR. DAVIS, A. GRIER, X . . E73 A f BOGLE, F. DAVIS, A. 34.11 EARIFFISI P-JMC HI U BOND, C. A. DAVIS, J. ., R. IIIFFETII, . . ' BOND,AS. P. DAVIS, N. K. GWYN, C. B., JR. BOWEN, J. H. DEADWYLER, C. L. HALL, H. E. E BOYD, O. D. DELAY, G. R. HAIII., R. S. V. BOYLE, G. A. DESAUSSURE, R. C. HALI.., W'. W. W BOZARTH, R. V. DICKSON, C. O. HAMPTON, C- W- 3 BRADLEY, H. P. DINSIWIORE, R. M. HADIILTON, W. F., JR. BRANNON, J. R. DOEES, I. S. HADIDIOND, C. K. A BRASWELL, S. E. DODDS, R. D.. JR. HAIIDAGE, VV. T., JR. BREITHAUPT, C. C. DONALDSON, L. M. HARDIGREEw R- R- 52 BREWSTER, P. H. DOWDIAN, W. F. HARDIN, W. R. ? J' R' G L BEf?..'ff:1.?'i'.' R' RITTINGHADI, . . , . . I - - . BROOKE, G. W. DULANEY, R. E-ARRISONJ P Q ' BROWN, C. M. DUNKLIN, E. . ARRISON, - - 5 BROWN, H. C. DUNWOODY, H. R. HARSCH, G. D. 5 ,. BROWN, R. L. DUNWODY, J. A. HAWKINS. L- A-a JR- , BRYAN, C. M. DUNWODY. R.. R. QEEARDJ M- A BRYANT, E. DURDEN, E, ENDERSON, I . . BUFKIN, D. W. DURI-IADI, A. C. HENDEIISON. J. W. I BULLOCH, H. C. EDWARDS. H. C., JR. HENDRIX. F. S. I BURKE, E. L. ELDER, H. O. HESTEIIA J- S- CAI.DWELI., J. A. ET.I.IOTT, J. B. HIGGINS, K- B- , ' I I U VGXPQW AJ F O 4 0 gy vt 0 J fb ..,,.. 1.1. r.:. .7- 4. ,. Y1'!' L-I -5 .5-. L.-. -1 .I lv We - ' N ls! ---- . A , - - . I.Q.-:QI . K ' A R .. .- . P rim ... Z-T .. -....xl.....:..j.R.'.fI...iH.1::..,...-.me---sail.-i2 h.-.Sm .... .--...........,......,giQgm '2.5!g uZf W H .lzz :Y Vvrv - -I :mum-mmImmlmunu3Q?aIeIQ.nSn.giI. 5W-m --evw rv--1 f' f ' U' ml ' 'w fi A I H E D L , l, , ...... ,,,,,:,,,,,::gg-mga:-,g:g::::.:: ..m:g::::::::: . 'Iull5IIIll'-lIl3IlIIIl!Il!1SZIi22!ZII2IiIIS :I J-51 -- ' ':if':: ' ,,.-v Q wV,Yww, WM ,,,,,q WMW,am.-,,m ,,,. .....,.,-,,,, -- - . -- -2--I - rf . I.- 7 I Z . :-:J 5 N c-.- 1 I 1' , RJURRAY 1. F. f HMS' S7 I-I 15 R:-Zg5RC'J. K. MYERS, 5- A: 5 l'ilGll'I'UNVLll, I . - . - Eg X NARELL, E. Cx. W: 1'!lI.I.. C. '1'. JR. I-HB1-F1 - I ' 1 f' J .14 3 3 E B NASH, J. L. f I'IIsI:s, M. LEE- ' ' . , NASH J. D, f gg H .,,. N. LENIAY, J. XX. , 2 T F 1, . -R 0m : . . ff J M BEVYBIAL, - . - ' ZH 1'1UGVl'3, 5- C- ' NEWTON, F. IiUI.lH-Ili, A. O. UU' 1, - Xi, NEWTON, W- C- K I-1OI.1.I:x', H. L. LIBDUK, J- - NORTH S L. . F S, LI'I'I'LE, R. S. 1 ' 6. IIOLAILS, . NORTHRUF B. J. :QQI I-IOl.'r, XV. K. I-UCKI-IX, J- G- NORTON Ii C. :f-f LIUICNII, C. H. I-OVICTTI A- H- Y N , ' F :-5 - .- N I.I'EI'IliBI.-XXX, A. W. ORVELLJ ' ' - f' 94 IIOIII., I-. B. O,BmEY E D , I F53 LIVIJGI-'YS J. N. I.YNESa G- . A ' ' V' 7-513 . ' NI. -IJ NELI. J. R. OEIKTINGJ H- - - 1' III!-I J. M. - .XL 0 I - . ..,f ' ,, . - . H OLSON, A. XV. 55 1 7 Hi. .mfg 1, XX , MRIIOOR. J. - N .IE .. . . OXVENS VV. L. .pg 1-1,f,,,,, A-X, D, MARSIOR, E. F. 1 B R J 1.1,-UI' F, H, N1.xR'1'IN, H. VV. PADGE'3T'H ' ' f' I-II-.Sm-, I-I. R. M-v1T1N,R- B- EAW' ' J'I 1 E131 flvjllf' 'I' XXV. RIRXRTIN, R. E. ALDIER, I ' 51,1 ,. H,..,.,.,,O I-In NIARYE, J. N. PALMIISANO, J. I 1 'W lm... IS. R.. JR. A-I.I1-Tmzws. T- F-. JN- PAPA,GE0RGEf1S 1 A Q: IM-Kwy XX' AIATTHEXVS, V.. JR. PARKER, A- ' 2 :1i,q14Q.,Q: Y.. I.. R'IAUI.DIN'. J. L., JR. PARKER, R- Jaw J.xm-IS, I7. D. XV' 'fp' J.. XV. CT. . RYO, . +1 v' ' A I FRU C. AI. M.-wliluvwi. T- B- PATTERSON K- M- ,QI If-QQSQQQV' JI-zxsox, C. BICCAMY, R. G. PAU1-K, D-,FM . '- --R Juuxsux. C. U. R'ICCl.INTOCKa R- PEACOCK' IM, L'i RSE., JUHNSHX' P. W' MCCOXNELL, F. PEIIDICORD, 5. 1 . b ti Juuxsux, W. L. MCCOOK, J. E. PERRIFSI Q Q, .IOIINSI-Ox, F. l'1..JR AICLREA, T. R. PERRILEI - - '53 ,Q ,,.,,,,,,-, fy In AIQIJRNIEI., R.TB.T IIZERRY, GO Rm. N- ' J NH,-' 112 RICIDONOUGH, . . . ETERS1 - Y - fi 1 J Jilxn-zg, S. C., JR. MCELWEE, J- F- PETTYI J' W JR' Ugg' M J l'S'l'IL'l1, J. '1'. MOGARVEY, C- M- PHU-UPS, B- R- ,mp ig? KEHNE, J. .X. McG.xvOcK, H. K. S PIEHSONI J- E- Kk2l'l'lf. G. P. BICCJINTY, L. J. PIKE- H- H- T G ' 1 KI-1I.I.I' J. I.. MOGLONI-1, A. J. POINDEXTER, . . H A' 4 1 I ' - I ' IQHHX, 12 G, RICIXENZIE, F. C. POOLE, V. . F. L Kpyxxnnv, J. P.. JR MOKEW, H. A. POTTS, VV.MR. I I V+ '- -f ' - RTCNIURRY H. D. PREwI'r'r . M. ' N Ixhx rv, XX. H. ,. KII.ROIfRx, J. F. RICXVIIORTER, NV. F. PRICE, F. IQILGOIKI-I, I-I, XV. NI!-IACI-I.fM', S. J. PRISANT. I. L. :Q K1M1g,yl,l., I., RI!-IRRY, fx. RAINE, Q21 IQING' J, R. R'IEllR'x', G. HQ RARISEUR, E. D. K xIO1I'I', J. J. RIERYBRE, A. L. REDWINE H. H. IQNIGIIT, J. L. RIIKELL, R. P. X REED, R., 5.5 Iq..m...N1-Z, R. I-1. MILES, M. L. REGIN, J., Jn. 2 KR.xsNOI'r, I.. I. ' NIILLER, J. A. REID, G. G. Egg IKYSER, XV. D. NIOORE, F. B. REID, H. G. E g, IHXIRD. H. E. NIOORE. J. V. ROBERTS, C. J. 5 Ri, Lnrn, B. E. MOORE. P. ROBERTS, L. Q ' fi LAXOERS, I... J. RIORGAN, J. L. ROBERTS, W. T. 5 if LANG, J. NV. RIORRIS, R. H. ROBBINS, J. B. LANIER. XV. J.. JR. RIULLEXIX. E. Hf A ROCKW'EI.I., R. B. H. E 1323 LASER, L. MENGER, H. P. ROOKS, VV. A. R II.-XTIBIER, C. MVNSOX, R. D. ROSENELATH, P. F., LAW, E. M. RIURPHY, C. T. ROZEAR, S. P., JR. Q M2551 LAW, XV. F., JR. BIURPI-IY, J. R. RUEIN E. A 1-:II ' . 11531. ' E IEEE! 3 EQEY S I ' x J Q J -,..-YC: X - o, O X . Q I , 7 'Q 1 . QR .W I .7 1Ob+:-:-1-'WENM---rx'-1-.-I-:-.N-.-.-. -.-.-1-1-v-N0-5-2-55 X. -.- :-'-:-:-f.f.-.-.ff.-- QQO EF U .. D Y J Y V A ' w R1 M 1 R41 5 A' ' ' ' ' ' ' . ' I EH, ,,.Y:g, I J., .Ogffvfawsexv1If4Revs-25:95:23aww:-sac-:xxfxx-z-BIKE-.xxxxg.xxXxxXx9 'N g . L:q.,5L K, S -- X357 . , Wi L., L -gi K 'XZQ3 - .- LLVY .. 4 s, 25 is -- 5 J 5.47 cc-: ll' 7, 4' If f 5 I ,. if Q I -,I . I 1 , 1. I ' 1 5 2. N W JT J. QQ. n 2 I 1 'wx I -VI ' f Fill Llllllvl 3 '. Y g IT! I 1 . S I I I Sf I N. 1' S . 5 I 52 . R x E S 3 S S Q X ,IR , ,JN I: I i E E Q25 5 YJ ff I . ix ,Fixx Y 4 I I R I 'u .1 I ' 7 .Q . I If 323 I 'f . ,9 :Q . , r yw . M BJ E mn rm? IF.: ',g.Ql IQ? l wi WS, 455 Il' Y 1 129. w 5 .2 ew ,. ,. -,.. If., . I. -,eq Hr- .n........ 5 4 I . Rlfil-liiiiiilllllliilll l l!i!i!!i!lllilllm:l':RYT jliHiEQ - ,...... . xr .. 1 If- H ---I1-V-nn: e :--e-re-Ising:-nf,-...L--x! Irlfpf .nw-.rn--fr-arf-1-e?u.I,-.m n:1xx.-..-..1x.-..::.- rv-,-,,-.q- mmm, ,m,,,,,,,,.,I,,,,,,,,,,,,,,,. rgglts .,,..,Q,ni,L:. , 1 va i ,ln Uh . 6' ' 9.3 r W, 1 IN .::::::::z:.::::::::r-mm' .'1-f-1-+1F'12fw--3g--- '. -I ' - , f?1:.mH.w4,, I , 1 X ,.-mm.. L .. :,,,, -mg 'W - an Y WIT RUCKER, L. STEPHENS, H. D. XVATERS, R. E. RUNDELI-, J- XV- STEPHENSON, J. M. WVATKINS, B. ! 7 RUSH, W. H. ST1I.I.wELI., R. B. WVEAVER, A. V. Q ig' SALE, O- H- SUININER, J. D. XVEBB, VV. R. giiDERS, D. H. SWING, J. E. VKZERNER, A. Q . nERs, J. L. TANNER, G. B. XTESLEX, J. 'SX . Q SANDERS, M. TAYLOR, R. L. XVETALI., F. SUN' ,F.D. T ,F.A.J., XV ,J.X. I sivssifni. Tiifi, v. ' R wiliiiiilf G. iq. w TSCHER, S. S. THAIIPE, M. M. XVHITE, A. G. . 3 SESSIONS, L. M. THIGPIN, H. M. NVHITE, C. J., JR. 5 SEUIVIOUR, J. H.. JR. THOMPSON, W. D. XVI-IITE, J. D. kk S . , P. S. T- I J, W. VV. XV . ' M. . KEZITDA. J. W. G? N SIBLEY, A. B. TRANSOU, C. B. AVILLIAINIS, J. B. SIVIITH, B. M. TURNER, L. M. XVILLIABISON, XV. L. JR. SDIITIII F. H. TURNER XV. H JR. XVILSON C J JN SDIITH'i R. B. UNDERWBOOD, W., L. VVILSON, N. SNEAIJ, J. H. W. UPsoN, N. VV. WVINKLER, T. Q. 'N SNYDER, J. B. X7EAL, J. VV. XVITIRIERS, WV. S. S SOWARDS, C. C. XVELTRE, F. E., JR. VVOOE, H. F. SPALDING, W. F., JR. WAITE, A. F. VVoon, J. A. SPENGLER, C. VV. WALDROP, J. M. WVOODALL J. P. SPOONER D. L. XVALKER H K WVOODS D E SPRADLIN, A. VVALLIs,,T. J., DJR. VVO0LV:'IN12J, 'W. R. R I SPURLIN, M. VVALTON, W. T. VVORD, G. L.. JR. STANIEY, W. M. VYVARD, J. P. WVREN, H. B.. JR. STEBBINS, A. L. WARD, R. C. XVRIGHT, A. N., JR. QA STEBBINS, C. A. VVATERMAN, M. M. JYOUDIANS, J. VV. f l 4 l ly. Q-'Sf lm' l b lmglf 5 L 5 QL ' Q 22 S 'G if Z R2 JC j 6 A H04 , -V IE if V . QE' Now - XYDQVMMM 5 2 we Q' LIONEL F DMM Rfyo JL8352! I,-4, W 'Y ' o XIX ' .hiv 0 Q- .-1 I- 'N O ,fl -sf' go 4 5 1 ' 5 A , ' X p ' ' ..::5..:!f , : W - 4 ::::::Ey:I.. -- - - - - - - V xt H V . .P ' 'v jx - . , fb L ' --R . - .- .fm . cu 'L Fi.. -gy in o 'I NL X -41 gl a m' 2 Fi 1 'lx Q f f ffl ' ' 1Q25 .Af f X 1. some-J 6 :f-.1 ,4,,., ,,gjj' ,.., ...:....ll......:....-llI...ii.i: .,.- ,..wm:---1:22.-5-5-- .---. .. 'n 11 mummy il :Ulm ,W mxmawnlnsmmuuuwu ummmmumxaasam..-Lf--I .---. me V--fm ---- 4 ----- 1'-1'-'f4N ' ' ' r R 1. .r..... .. . .. . :..r J. .x I N. H . ..,. ..z, lm r' sf 't Waste Not The years ha-ce passed since first you looked in awe Ont campus of Old Tech, each thronying year A canvas many-hfued with ever more Rcsplendent glow. Ana' now the end 'is near- Too quickly, quickly has it come! You might delay But ceaseless falling flow the failing sands of day Mis!-slzaclecl are the years so nearly pastj Still closer will in future time be drawn The vurlains of this precious year, the last Depart-iny glory of a coronal borne Too carelessly perhaps, put by with scornful haste, Too liyhtly trampled into dust of days you waste. Then cherish ist, Y e Class-men! Cherish each Fleet 'moment that with pace relentless bends To overtake the month of June. Outreach A yearning hand. Soon nauyht but memory lends Her doubtflul radiance. Do 'well in this last hour Ere you forever pass from Alma Mater's dower. N -C. B. W. 5, , 1 F x Dc Q59 ,rw H n I of' SPE- U X Q-Cizeof K' O :mmf -s 'm tu.v AO o 5-J vi LLVV' v S xg . lg, ff e, ,648 ly 1 L 1 W 1 1 M ,i ,.., ,,,,., ,,. ., in . ,. ' 'mg W, , 11111 .3i Ei ,,3 .,i,i 1 3- 1: ----: -ikggzu 'gi ,,1q ,N ld I 1 r 4 Q x, x 01 1. K r 4, K , ' xy N r x ' J - ', 1 - , X , 7 1 , mi n N, Q, ' Qu , -0-:-o-G.,-,J -an 5 ' -4 , I , ' , - ff . 1 ,.. ,Q ' '- 4 .1 : K 55 mlm, ,Jima mm: , 1 I u In u ul 1 ni I mu-1 m-.n.n.uL n n Q m 1 in smua-uxvuuxfiu-u fn . ...A L mf-......... . -f ,f mm, 1- mmnn-mn: .n x nm... : I-n:::: ' 5 it :uhm I all 1 .:: I1 11 I1 1 1 1 -1 . 5, IM 111 ' EJ , :5 2' Eh mm-E. ..l .. .. ............: .. . x:...... . ..... ...........-................... .. :.... ... ........ .'1:......L:.f:-11 0 1 1555 ' I 5 34 S J 0' . 3. ,. . . ,. 13 . . 0 o .Q r P.. 4 P L .AA l DI' L 1 I. 4 1 A 1 1 1 1 1 1113111 1 1 QQ 1 W FU Y 1 f 2 3 7 4 Z ? I PQI? A ,yd- L'-x :,-,..rv ' ' f 1,5 f 5 r Ejgfqw jizz: . -ping, -V? ' 2 1 3 5 1 Q ff 1 f X Q 2 FQ S FS if 55 Q S 15 12 1 13,1 M.. 'N 144 G I 31' . 1 1 1 fs- 11? Q- ' 1'-and : illlln UH I 0 Y. 1111 I4 if 1 1 A H A 1 , , X , 1 1 H 3A .., , ,, 1:...,.- . Lmonnl. rc 0 'i-354253, o - . U. O gif? U ' X Ib 0 Q ., .., Wwe... 'SY 'L X Z 1 Mall E 94 5 . 5 Qs 1 5 ,. 1 . o Wcxgh f fg t o b NA' i i Q k .... .... 0 Ziesfiff ' ' W' M- - A M , wWmamM Namm 2' - G Q V f -Wffmw' A ' Q .x . . Q O 5 1 -. ,wa ne , x wr r A,, 1 q 'rf 'Q X e all 1925 1 in it , fa 0 G -V K X . . Q ' ? Qim: lvun un-W:- -will inii. .-ia,'l11...2 v3Zl......,,,..,,.-,mn3:5l9'5 - wx:l:l ' n M 'H IllllllilllllliillllIllllll!ll!IllXNl5 num., mm- .. . X xy! X V X X i ' H D P .. .... +1 N gamma HN Ylvvv. W ihhv VFFLQWLAW-.5 'AAF' :E V, ,,,A mama.. ,,,, m I g : : -.:i::: ':n. ':-an::::::::I1::::mn:m::::::::::'.:mlnluililiillllm'--'-3'5 W' '14 l .ef r y r 2 tri f 2 Z rl is r fr 4 9 -? ,4 4 .f if 94' ? 5 5 Q X x f Z Q . 1 Freshman Poem . 1 If I jbgliwu W'e're Country rats, City rats, yy I Rats from all quartersg 1 A il Laughably insolent VIIIIQ , 1 , Careless ccworters. 4 , l y Widely conversant ll m f Uf facts scandalizingg b .va , -4 i l PVH think to run rampantg lx Oh! Somewhat surprising! yy nl , ll Ms, Some lessons wejve studied Ili 'R . , r , N S W'hile other we ve not. X E The quickest wzfve learned E E Was quite rudely taughts S 5 Adieu, haughty spiritg 5 Perforce are we parted. . , We ve learned to belzafcek IE sz E From the Soph tender-hearted. N 4 K I V 'VX MC. A. P. S S f S r 5 r 5 E E, S Jef QQ 7 Hg -Q2 PJPXX-, fo X lux r NV -mx, xx Q r N1 ,f o 'r , W ' .I xt l r U Q if if ' .. Q yy L e' ' ' M59 fi .' ,A . . m xR5xmARxmXw5533'5K'S.'SB.X ' Lxonay. K. ' ' Q + '::fiiii5li1 'Q-, sr A f xgg5g5::2f U ' ' ' ' ' 'W 3143- I ...K ,xv II IN, V1 , , or A- 1.,- V L10 Q -'1 1 5 a 1 I 1 l 'vi if ,,., 7. liiiiiiiitliri X .58 LI:-R-L zz'-xxx . 935 . .1535- R.. .caan .2-. bias-.3-.'-. '-' . . -. . 'IN WN' X -'R+ 9. av XX.. li -2 nb 2 Es l r r w v . FQ' Ugg Es 9 F ln. A: 5 L S' N 35 lg If 132 'E Sli EP i , -R 1 4 1 LIE 1 ni r JE 1 4 if 1 .: ,N wi? r sq: A. I .H- C is Ig' ,. if , l li 1 I wi 1 :hi E I if ' : I . 1 .: If s 5 9, I ,E iv. VL ,QS S Lwsgl Q V 44 4 .V-. -Vw. .4-V!! y vw 'wb . Wh ' 2' 1 'H . Q NX, Kg, v X wt - V J, .pf-QC-.,.,..J E -I-.X I , ' Lf: H...-. 2 ,V ...5-tii .' ' ' 7 ' I , ' s, 'Q' -. ' ,j..1 ' I 11. 5ggggQ55EgglgiiiiisnrE555Emi:::u:as::mulnllmainIIumIasmmmlmunmuuifxdn1Efna.n.mmx.V ' LQ'JDl1g-mm--,--1-psfIQianmm61915 mninx1-IHLVQW--u.aw-x:umm-J3alSVmHra--:till-mmm-nL'm?9E:nmmm::m.,E5gE 5553. .... .-A ,g!:.X::::.wH .- 'i gait, FM E i S 7 E ' E IA , N :E liiniEx........ i4...., .aa::muas:::::m:::::.':.:::z:::::::'.n::::::a::u::s::n::u:I:::::::::::::m:m:::umn::::::::::::::::m::::::::::::::::::m... :X V Fan , . 525' , ' ,, ' Q , ,r . ........ ,. .-a. 55?-E , , 17 Y W' ' X' FT ' ' ,S 3. x - Q-: X V: ,-.- xz ' ig X J 5 V . 2 ' .' 2337 4 v ' - f' Ll -. ' 1 , Qfffw fiff' if' J' 1 f' V , - H-WR V1 ri' -e , ,, ,. f , V '- ' ' .y-' , wi , k f- vx C ' V A x ff. x 3 1 f V -'- N -1 Y ' A--- ' -A - L A , 21 ,A . . D 1 I HVQZ7 I V 1' ' f ' - A' ' :5 iii?.7i1Lq:?3f7f '5f77?ff'Z'2?T47-'izi ffm A ' PfiLg'VV U v . Z. ' 1:2 Vf fs-.zur :fa 1 Wifff?P'2VWf2125:.11::f -::afI 'Jw m .. ', Nfsfzf.-ggi:-V, - W - 5 fi Q' - ZPL . ,gZi5,'S2J':'--- vu: 1-- fs5ig.V..-- - 1. ,Q X, . h e -Q fWfff'42?5ffV if4l?'5f 33 f f?Ff'f1E 3 hy, V. A ,. .ff , V -V V f1,f -- V V V fu V . V -f -.v f. ..., ..- V. . M- ,V , -, 5 ., J 9 . ,VL I 7 V LV R gi. , , Y 'V 46, E va Z, V555 if -L, 1 44:5 7, , -Q-5 . f y f jfgr . I ATXN' P ju 8135! vffggif sy: 1 : K I ,Q 4 .,,,,:V,,f:yA,,: V gi fffwy I 5 rv 7. 3 Z ly 'F' I' . , E V V: at .pg 5. . - 1' .V Q A 51 , .- . A V -Ygx . ' Z? V -QF' 34-:fl '-?'zfl- al L fn-V LJQ I AI-31 -H f .vs fl-t' 2 - ' 'Q in J V ' 'V i N ' ' f. ,fVW ffVf N,--,- 1 . ' ' . -1 'V-1lr ' f v ,V N ' M ., , ' wfffffh ' w ' J X - A. '52 N 3 N21 Q :. z- l : N S 'N MC L V? 41 k 1 'allll--' '--ug F 4 Nm m y uf L s,,. .-n f-'73 is W' f' '--1-u V un ,P W ur ' J 4 W 'M - r + 135 V H, -Q-'Q 'W . . IIIIP 4 :Illia , 4 Jllllvd PV 'llllf v WI 57, 1 ,T xl 'Y I V 4 5 Z Q E Z 3: ? 5 . ff V C.F1-Eirwooo 2 21 If 2' ? E 5 9 f , Y 'f V O 6xF5,gL:Q o v N J CW? 1 . his 'Ez V wx LA -M ,,,A, 0 V .wmv if 2 f- 'QQ -- Q KA. ' ' ' ' ' I 3' , . V W OgEaf wMmwfpmfmwmwwmswWmawNaxfx451.Qg250 5 ' cQ1Q4c-mmsoo!4'1fwe.f2sQf'f:-Zbffff-'Km-vi - A Q V V 3 I J F. ,E rw LW ,. K , --...... . W V 117 Q ::.V..u- LU, now er. K ixlnlfllhxk f- +..A ,'A-55? ,539 U V ' 'V - ' .' A' ' O 2j'3'EqkXi1 5fj'5O C X Qeizsif - '-1 - I . JiQ'Q'., fy A - , f ....,... 111 -3,213 ,..i :za ...... ,:,... -'-'- ---f F Q ggiimgiisnlgiggggggiirsisza:amimmn1imlnM-I--nnunnnmn,num.,.es e......1 -.L- -X 1 ., k 3 .ev 1' N I E A5 ut H H E D IJ um.. ..-'-- .-.-.' H: :::m:::::::::::.. ...... .1---,H 1 1u::::::::s:::m:::n:::::::::l: z:::::::g: :::':'s:::::::::::. ........... - :YEL ...... 5. 22 1 E lf: u!i::: ...., ..a..... ...s::::u::aa::an:m::::::::1::x::::ma'a:.1a::::n:r.:::m:::aaz:m::::::::r.:m:::::x:::::::::::I:::::l::.... ..... .......- Q- fig, l ' ,lf ? ? 6 4AAAAA,, NM A,,.1 6 ef 1 , 5 x 3 fi Q , 2 yi, A 2 . L -. -. .- - L A ,... E 1 :EL r 1 ya BQ! 'wi M' it gp tx null? FM' V gs! UW ' um-' IEEE! ' 'I , I , 4E 4 'lw . 5 Freshman Class Officers S N E h. marshall . , , P,-egiflgnf N C. JC- OHTYOH - . . . . Vice-Pfresident E 2 'L 21. Wlldffl' - . . . Secretafry and Treasu re'r E w ' X A N :H X S . S S E S Q-GX Scif o S O P' O O ' w ifi Q M f Y Mfr ? :N A' V- L 7. , K - Qi2.'5YhX 3KYxXX55fE.gXX'KXXXXXRXXXX D J ,A ' 0 mu - D --m,,ii.3m 4 .. - - rg- IAEN of LLNN I E . 4 I ! . Z 'f -,4 ' H ul ,H 'Z if G 9' 4 155 y In 3: .23 W I H , + O 5 llllla rIll P I v 1 IJ. I I-Q7 FJ! IIIIIQ S fllllv Tl Fl 1 4 1 W -te 'o'- 211' . 1.11 . 53. 3:31 go. FI Q 9. -'I x 1 , S X H E l 2 E i HE. ah ,.. 15: IE ff :E , drew, ' a W, .... .r.. W 'S , 2 - .f.:, .,. , ' ,,. -. . ,. , . i,Z:Z2 :ag : , ,2: 5Z:,, :::::,::,: . 2 new---as: P , 1 Q -. f, . N :full x x .f X fc' 1925 ' ,. X . I , lf U- Ex , X ' 1 'C-:-sag.,-,J ' K f -xx x js X , J 4 ' RN 42 ,J '- 1- lx x ' f , .. x 'gf gi . . . . - .ffm f .mfg -.I -ff. . .-- rg, .- , 1 5 ui xx IIvhhuilIIIIIIIHIIIIFIIIIIHIISIiiiliIIIIII1IIIx!IliEliuiilllhnsehneueu-n.41Lx-1:5-lsr-urn ----- .-----1,-111-2.1a1eyrua:::-EEnu:---um.inx-I-.14a.i.'r--1smws-.4-ann------u-:::::6m:'+11'f1----F--------w-fnr,s!:fu:f:-rri1nx:rm1-.v:- -x 1 rm L -. an an : I ix ,g,,g,.'f x ...., -v 1 ':l ll lm B IJ W Plm Q i. . ...J iylqsxxmm 1. 1 ,,- , ..,,..,.. , , , ,., no KK '1 11 X -.4 32 45: S l.., A W ,H 1 42 1 I J o L fe A E E Jlllll H twull P an l s lu .li K Q' 'W P v . all -ilnlb l El Y o o 9 A ' .6 35 , 3. ,. .fl 1-' 4 32 3. ,. ,. 2 Ie by Q aaron, r. g. alford, b. a. - allbritten, r. n.. allen, d. r. 2 allen, l. h. allen, W. f. allison, g. p. anderson, W. e. anding, l. archer, g. e. archer, W. b. ashmore, g.-h. atkinson, c. cl., jr. attridge, a. a. aycock, t. b. ayers, s. m. badenhoop, a. g. c. bagg, b. c. baker, m. h. baker, p. h. ball, j. e. barker, j. W. barret, t. barron, c. t. hates, d. b. beatty, t. c. bendenbaugh, g. f. bcllinger, f. berger, e. bernath, bickers, c. W. bickerstaff, lj. f., jr. biddy, j. n. biggers. c. e. biggs, h. d. ' bird, d. W. bird, r. l. bishop, a. h. bivins, a. c. black, b. blasingame, gr. c. bledsoe, W. j. boling, j. e. bomar, j. c. bookhardt. f. b. boots. m. h. borden. j. c. bostick, W. a. boston, j. e. bottoms, c. b. bowen, h. W. bowman, e. d. boyd, s. W. boyd, W. s. bozeman, f. c. bracev, W. c. brandt, m. h. p reshman Class Roll brattain, j. h. brawner, g. h. breedlove, r. a. breen, W. li. bridges, a. W. brinson, j. c. broach, e. s. broach, h. h. broadhurst, r. s. brooke, lj. p. brooker, j. l. brower, h. cl. brown, c. j. brown, e. h. brown, g. s. brown, e. brown, m. j brown, s. m. brown, W. c. brown, W. m. bryant, h. p. bryson, W. h. buchanan, c. h. burks, c. e. burns, j. c. burt, d. d. butterfield, W. cagle, j. W. caldwell, li. g. Callahan, W. p. cannon, h. j. carlton, j. e. carmichael, W. carroll, W. r. carter, h. li. casteel, j. b. cate, r. n. chapman, p. chapman, t. g. chason, a. t. chathan, o. l. cheshire, j. b. chestnut, t. h. christian, t. b. claflin, j. m. clark, W. r. clarke, d. c. Coates, h. a. cochran, j. s. cohen, i. cohen, r. m. cole, f. b.' cole, h. cole, k. o. collins, j. h. m. l. comfort, j. f. cook, f. e. conn, j. h. W cook, e. b. cook, m. a. cooper, g. f. cope, j. l. , copeland, a. li. cowart, c. r. cowart, W. j. cowle, a: e. cox, f. h. cox, j. W. cox, j. W. crabb, j. e. crenshaw, W. p. crew, J. cross, b. m. crough, t. a. crowder, c. r. crowder, W. n. culbreath, c. g. ' cummings, W. f. dance, s. W. daniel, c. y. daniel, f. a. daugherty, g. W. daves, f. m. david, e. davis, h. h. davis, a. davis, a. davis, m. f. dean, j. e. dean, m. p. dee, W. s. dews, h. p. dial, W. dickerson, f. m. dickerson, W. S. dillard, r. m. donaldson, c. l. donaldson, t. q. draper, g. o. VV. C. 59,0 Q9 44 I of' Qu., LLVN LKONE :bug :foo 4 dubois, c. m. dubose, m. m. duncan, g. l. dunn, f. b. dunn, j. dunnam, a. h. dupre, w. a. durham, b. g. durham, C. l. durrett, t. g. L I' :- N . . .QQ 40, in . Q ,- at 'v , 3 Q 5 2 Q A PQ is -V4 al l ' I Kill i I -lf' RW l 15' El i !. -ll I 1 lil? 5 f I i 1 M Y? ii :Q if sf fc if E2 f 0 xr ' , . o I .C 1 I E5 W ' Q . - fjiitllif gf '1 ' i .P Q -f f Ml i W A ' -., l l-F- M294-Mama w W f . . 1 ' ' -S9:f:4f.omm.v94::wQ:4-' . jW5'M9Yl KSSZSPQQQQWMWM'-i'2?S0lE - :V-V 3 , 1 W i W L. A L dn - . .. ,,. Sn . - ,Nr Q .........--- . 1 ' ' K e ' c Q +l 'ii!!iE, 4. -. . O D , X ...Q Q I A ,N o ' Q V Jf I 0 , R I r gr? - I , , IQ- , I ' 5 Q fl me .. ' i QlQ.s'fLf . . f I '4 'N'- 1 L lliglfm ,,,,.,,.jQf,.,,,,:..-J.. ..-.. -Z .I .--. 1i,Q:i. mi-1mi :,3.J..il.,. ......., ...-...U-.1-if-il ' :::: tl ' Ll ' ' 5, 2---1unlumnmmnnnmvmmma-mmnuuimimnmulm..mn .... ........4 --iv A--m-1 m- -w1-- --f-1-- V, in ' 5 gg I 1 . ,nu I r 1 I il mm ...x:..l . I 5- ' ' 'mai' I M :Egg-1 KL H I W w EJ :gun ur -. , 1. .. I.. :x:n.....: 2I-- ----1'-1' ' ' y f wh 1 4 1 u 4 L ,ix I , -Imm ig.-n am--:::mxnml,,:: ..... mu ...,:.....:-.rg .....:..,., .r um-I . nalllgg -zmmmul-:.::n: . r ny ,..... .. -, -1- -L h m lm., , , -..H Wm.- .,.., , . .....-. v cf' 1 1:5 1 ' f 2 '- ' f. 1. W, i tj eager, h. h. gimlh C- 1- t, j, 1 east, c. p.- QJUPJf0U, E- W' ivey, tj. w. edge, a. b. . edwards, p. m. h211l1'1, Q- C- Jacksjon' 'Z J. H- 2- -42351232-.sz gg 2 eincrson, r. w. Tfllhbgr' e rjohnson, g, b, . english, j. e. lliiguigttl 1.1 pn niohnson, j. 1. bf. epperson, 1. r. humrick, nl I.. JOIIIHSOLI, ?-ht- ' epstein, j. 1-, hankins, d. cl. ,ggh2iiJO5e,.r..C. V6 fs estes, j. t. happoldt, a. s. -jones, bi d. fr harbour, t. W. -jones, i. 1. ll EGF, W- 1'- imrgtns fi- .1- iones, 'r. c. lg armer, m. c. mar ln, . s. '- 1 . l ly farries, r. c. hardwick, j. c. Jose ' H a Vg. fincher, j. cl. harlow, ni. v. 5.1 fincher, w. h. harris, a. 151221 Lg h E fisch, h. w. harris f. . ie 3 - ' ,i b fitzpatrick, j. w harris, h. c. kehoe, S. P- 1151, ' flanders, c. c. 1li11'I'1S,I1. i. keith, g- il ' tleminff, t. harris, r. h. keuey fl, d, Q 1 2 fletchezi-, r, f. harris, r. rn. . keelebfs wi hi If?- lf, iillowers, q. e. hartsfield, r. s. keuum, m. I.. 2 1. NU fgxcilhtulbf' Z lc. ke1ly,.h. 1. 'M foster, h. b. hawes, p. S. kendrfck, h' S' ' A gg. foster, J. C. hay-es, 1-, d, kendrlck, m. e. 1 foster, r. c. heery, C. W. kennedy, P- S- 6543 f0W1C1', E- 17- helms, W. e. kennedy, t. 1. MQ, frain, w. j. hendricks, f. S. ku-Sey W, u, . E-ig franklin, s. henges, f. w. liiker, ,ji e, 'Y ' Wil frilnklifli S- herrick, f. s. 1- b' hi ,WL l l fraser, g. a. herring, r.,1. 'King' 05? Ill! . . , , king, e. p. v 1 ' irazler. C- 1- mu, f. m. k.,b W J gym-. hiu' r' a' kiikifind' 1. V Q gantt, e. q. hillis, j. 1. . 9 ' ' 17 ,. +'. 1 garber, i. c. hinrnan, t. p. k110Xa J- h' 'Ili A garthslde, g. h. hipps, c.-1. f, li- Q getzen, r. n. holcombe, d. lacook, j. h. x gill, T- j- 11011imaI1, C- C- ' lambert h. o. . xg gilreath, j. w. hollingsworth, k. e. lanfordj C- K.. 5 Ed S, girardeau, r. b. hollingsworth, 1. e. kingston e. C. In S giover, J. u. hollingsworth, o. t. 1 . I ' I IS ' goff, o. k. holmes, j. b. laglel' fn' 1' goldman, i. holmes, j. p. fl le' fl' 'i, Q 2.2 gooch, b. e. horan, t. y. iaug1l111'1a.J-la- , E a f - aumus . Q. gordy, w. 1. hoiton, r. p. , J . E gould, f. s. howard, g. r.' law, f- 13- S ,4 graham, j. t. howard, r. h. lease, d. Eg graham, lr. m. howard, r. C. lgffler, 3, -.E E grant, at o. hugg1ns,.g. W. leonard, h, E graves, J. f. EughTs,1.ts. lesley, J. 6. S , graves, r. rn. ugu ey, . c. lewis, ji dl A A 1- green, w. jx huie, m. b. . B , green, 1. a. hunter, c. p. lide' m' a' E 2 gresham, W. i. hurlbut, h. d. iiggn, h.f w. S griffin, c. rn. hurt. a. ln C13 - 17- . if griffin, h. v. hutchings. s. c. IIPSCY, V- P- Q I . griifin, l. w. hutchinson. t. little, f. a. 5 griggs, f. h. hyman, m. little, 1. w. ' 1 N Q N M 507 f of ' u 6 A woamxwmxmxx m2.NNxxxxx-.,mxxqxgx-xgkgwxx-if Ll.-..5L K ll lg, Q 5 -7 0 0 P -E, CY . - - Qfm wkfk .Y 1 . 1 ag' v ' 1. 7 - E: ' , v , -....., , V... M . M Y V W .V , - . - X - W., - -y fr-4 . H9709Vl0!fb if' . 1 .' ' . - .- 5, Y- - , Y' f vrv- rig -3 r K 6 L.-. , . . .4 ,lx A Q, ,- f. .. 1. - 1: , - ---- -1 --f. 0 umtiii ,. 1 y . . sl Hmmz. ., l .. . -- Wx A. S . ,- X --.Q -'--, 49 Sign- X o um- . A - K gy. - -. . ff ' d9?ff'3e.- . -+P -. X415 , ... A' ,IJ F-L. . . Q , vb Q 1 J 1' Cn? 1 'if I 5 iw Ci? g 1 illfi ' f -.- cliglll Q- - ...A -..S -EEESSIIEniiR5iiu'::gigigggii:::lBWWWWHKIIIHIIIHIlfllll!IllfiiiiiillilihilliElllllllllulilli:Emi-,mm ,,,, mg -,,gf-,:L.-,,, H ..,..,.,.,,,,4,1g,q, 555335 qqqgq:.:sxr::: qqgqwgxsz.-g'gr-1.1, .-q,s,,::-xs'-:-.s sllz rv llxnxls r: : :::::x::x mv-I-1 1-'-- ---w mffmgiggmnnqggfggng ,-an ::,,igj:?E55eu-ugiwuai,-E 11. 1111 -Q r im T li 15 is 1. P Pcl xgihi -i lsiA--.....--i..a-... .623H3213IIiiiIIIRIBZIFQ3'-Tiliiii'-GLTIIESSSYIZZIZZH535ilII3:3112iff:--3'-lIliililllzlllll33:253225215221:22:23:lil::E:TSFl ' Illll'3H:IiIl2G'lI2i I'-h1I'.iTnTu'in'ili3lFlin n-3lF?3i:n'3:i'J2'llL:li'I .3!Il: ':' ' .-nu--. Jil.. .g-, T 5:55 l n little, f. h. moore, b. m. phillips, j. 1. 100146, 1'- moore, b. W. phillips, l. W. . 10I1g, g. moore, c. pirkle, a. g. . , long, o. W. moore, c. b. pike, r. W. , -10t'C,- W- t- moore, c. b. pitcher, f. S lowe, r. a. moore, f. pool, W. o. V . IOWIICICS, W- moore, m. post, r. d. lunsford, j. t. moore, rn. r. potts, j. h. ' luter, j. g. morgan, b. g, powell, h. e. lyle, e. l. morgan, c. o. powell, h. W. ' lyon, 1. morgan, d, 11, powell, t. r. morgan, h, d, preuit, g. 132 maddox, W. a. morris, c. l. P1'iUCC, 11- S- malone, m, t, morris, .j, 1-, prothro, j. d. .- malpass, j. p. morris, W. 1. Pfllitf, S- Y- S marshall, j. h. moss, t. l. QQ marshall, s. a. mulherin, j. a. race, g. W. 5 massey, c. h. murphy,,c. e. Vagina T- f- Y mather, r, mul-I-ay, el an ragsdale, f. l'1'l. 3 mathews, j. b. Fiiilley, 1- T- S mathis, W. a. nabers, a. m. randolljh, .1- d- Ti maxwell, t h. nabers, t. g. rasmfkes W- 6- may, j. e. nance, j. e, ratcliiif, W. 1. may, S, C, napiel., 1. mn rawlms, V. e. Q I may, tl C, Hash, 1. rawls, J. b. ' L mayfield, W. r. nash, r. r. read: E- 1- - J A mccall, k. k. neal, g. h. Teddils t- g- ' mccathern, j. m. neeson. h. l. reeves, r' e' :mu mcclave, h. f. nesbitt, ij, t, liemaliilq, W- 3- ,SEQ mcdonald- .1- W- newman, f. b. ICYHO C S' 21' ' An 'gal mcdouglas, 21- f- newton, e. t. rfeynolds' -15 121.12 mckemiev W- nixon, r. g. r115tetSO:1'H1'd' 9:51 mclean, h. El. nottingham, W. m. ridlggab W' ' . mclendon, J. f. nunez, jl hu fit h -..l- - 'dw ITICITIFIIHUS, f- k- nussbaum, h. h. gtgh' J' 1 mcmath, b. h. , 7. ' P2 ' V Q mcmillian, g. m. oliver, W, 11. rllgelf' -16 it 4 7 A Incnlillafl, 1'. In. 07neal, C. C. Iiobel S, .I 1- llh' mcroberts, m. d. Otis, W, mbfeson' '11 ' 5 mcwhorter, c. l. ro insoni -1' robmson, W. e. meadors, c. W. page, d, p, mckweu C S meadows, h. d. palin, d, a, To ers XL fl ' ' meadowS, W. r. parkins, W. Cl. 1.055 1' bl ' .V meriwether, W. g. parr. c. h. 1.OuSfe',. 52' merkle, a. partee, i. 1. rumbie 'el miller, e. 1. paiterson, g. f. ms-dn QV- C. - miller, j 6. patton, e. 1. , 5 5 miller, h. paullin. c. bs. i Saddlel., pu W. sg milhcan, c. w, peabodv, W. J. Safley, W. W. 6 mills, s. f. peacock, d. Saggusy m, 0, 4 mmcey, a.. r. peacock, J. h. Salts, i, dl ? minder, r. j. penland. W. h. Sahel-L k, rl ' miner. l. W. pennington, c. r. Sampson, g, 9 mingledorff, m. s. percy, W. W. Sal-Sfield, 1, mitchell, C. c. persons, j. h. savage, rn. s. 1 mitchell, j. d. peters, j. 1. scarhorough, p. j. 5 mitchell, r. e. peters, j. W. schell, a. m. 1. moatgi, m, Q, peters, t. j. schell, W. l. Z monheimer, W. p6tl'i- 1- 0- SCSSQOHS, 1'1- .f montgomery, h, e, phillips, h. c. sessions, t. h. 4 , 5 y 5 A 1 O Q-'sfdw 35 0 4 O L w RZ' WW- ,,,., H ,,,, W 0 ----- QD 5 ,175 N--'W ' W.. .- f V - 1544 - Y ' Q Q - is m'. .1 7 X 0MwWwfJfmffffpWfWmmwmWb6WW0W in '-I a l L - -- . n fp. - - - L, K LlONEL K. W 7 Y Y U LW' 0 Yi 0 0 2,v.,, 4 5 N , J -,.. - ., -, in 1 1 A ! . 5..!l'lglii.ll'Fi. 2-5521 H ':::am mnm 'M Hum main 1 ...M .- --lf'-1 .ew .i f. ' ' ' .iw zm ':::: : ' ' Z! . H 5 :En 'l'i'H':2l 52:i: ....:-, - 'rggnl - ga..-,.. . ' .... ..... 9 1 N 4 I I N -. ' in 192 ' Y ' ' ' , . K . x g 4, E i ds.-. X Q: 4.. . ko-no-W-J .1 Q 3 W ' f , 1. . J ax X K ,4 -. ' y , ,nl ' ,L H 1gu , 1 . risk, lu ... 11 lgnnnllil xl i mxuiuuaum 1 nm f 9. .2 mn i M n num 14 win-n.uvnynm,vTu .4 1- u - u I I If IH- HHH H- ' 'Um' ' ' ug , I' nj' U I 'f' :uf f' 121'-' ' -nu '-.4 ' I n .. ' l il 'X 4 I5 ' ,lx l ll :ggi 1 ll X I l ' I! 'I I un I IITIIL ,, , H 3 I H I. 3 I IGH:FIH5333FillliiIIHHH:IHIUIHIHHHH!!:IIIIIIIHIFLTIHf'p5l2l1l::::3l:IIl3:5:IIZ. '.-...,n--- Jul...-Ia -U I- 4 r - 7 4 A Al I H l r, ga . ' . Z Sheppard, in. shumate, m. Sibley, l. 1. Siegel, h. Silverstein, i. Simpson, k. singleton, W. cl. l. Skinner, W. cl. Smalley, f. stribling, s. g. ,N Sharp, t- 3' stribling, a. b. wear, j. h. 5. Strickland, J. Strickland, W. O. h. strickler, g. b. Striplin, W. a. Stroup, q. d. Sturges, e. c. Sturgis, b. k. weaver, 0. l. wintraub, d. Welch, p. d. Wells, b. d. wells, b. r. Wertz, t. r. wheary, j. W. Widdon, j. i. 2 f ? 9 f 5 .9 Y Smedley, 21. ij. taylor, W. g- White, C- 1- smith, a. in. terrell, j. t. Whltel h- smith, c. e. tel-ny, g, ru White, C- ' Z' smith, c. p. thmfms, 1, en Whitehurst, W. ni. p Smith, C- W- thomas, s. m. Whiteman, e. r. Smith, fl- ,i- thompson, b. Wilde, g. W. SIHQH1, 9- ll- thompson, n, p. Wilder, t. a. smith, e. t. thrasher, b. e. ildin - Q, 0, Q tl 1 f - W g' E: gmftll- ll- I- timberlake, g. r. Willloit, H. ff 'mf l, f- - tombhnson, j. s. -H - - d Smith, J. t. mole W. bl ' W2 gms' ' , smith, i. W. ' Wills, 3- J- 5 -. , - toretskv, W. S . 1 Sllllfh 1, ri - '. W1llCOX, f. f. - A smitl '1 i t'abe1 'l'p' williams f 1 , S 1, . 1. t., 1 D ' ' - - r smith, ln. 15:13, irhg h' Williams, i. K smith. W. b.- tuna, d C Williams, 1, a. 1 Smith' W' C' t -L , - -' if Williams m. r. Y 4 Smith, W. mn u1ne1.J. W lu. , A . , wi iams, 0. e. 4 Smlth- W' V' vir 'in c W Williams 0. :gall Sflllllllflfly fl. h. g ' ' ' in-qms, e l l 'ai Soloman' 1' f' W1 'ener f W W'11?l hd pi c l l 12,3 Sowder, m, g, ,Lg 'j ' ' Wl mg mv ' ' ,egg QQ SOWell, a, g, Vlyaffsi J' t' Wllson' ff m 'mi Spooner, f. a. ua X611 C' b' wilcor1,J. d. rg' Stakleyy ju 0. Wagrer, C. fi wilt, a.. f. 053 fjlj stakler, W. g. WH Wg: W- 2- Wimberley, a. p. QUE CW stapler, l. zz. Walsh, t- C- Wimberley, i i starnes. u. 1. Walfhall, C- Wine, l. r. ' steckert. W. h. wardlaw, a. b. Winer, m, ii l Q. stephens, e. 1. Ware, W. m. yvinkler, m, m, A stephens, Wallace Warnock, r. , Woodbury, 1-, t, Q stephens. J. william Warren, 1. pg. Woods, j, 1, gelfhensv 1- C- Waters, e. c. , Woodside, r. rn. X Q2 i elensonj e' 1' Waters, h- 1- Woolsley, W. b. Q7 Q Stewart- J. a. Wfzters W e ' t Stovflll li C . ' ' ' Wflght, f- 3'- ' i P- W- Watkins, r. 1. , .5 d t 1 vsyco , . Stoll 6- U- V- Watson, W. r. Q 5 S reef, h. Y. wvayne, W. yeornan, S' j. E M S S N ' x it 2 Q. Vous 501 0 I lj 0 ng' 0 ' . , 'o , A ' -,O O l Y V f Q 'V g f., 1, I '. M N sq 1 . QQ . 4- g 1 f e .S 5 QQ. . V MG '3 5 'E ? EV' 3, 1 XA Q H I: f P. u- 'Q , . Q., V Vu? . 0 g UONEL K4 I 'fd' mxmwxwtmimm W ii 2 A Y i- A-Q, jo L LVN E S f f x J i ,f v X i H 1925 ' ' 9 . M X ,- sq. ' fm 'f D -1-9-:-o-,JI ff x -Xt I Z 1' Q W vie x ff A4017 y ,.. ,l ' X J 5' . ,li u z n x -Si1.Iluinltl-silluinlw 1 Hwmx m .su ilwm-in mt 1 il X ff- v H 1 H111 1 '- ml -1 ' ' ' 'a ' ,,?' Pix: K 3 fu wah H -- l 1 .iii 4' ' r H ' :ggiig i:'f'Ei'2i i2ii:aalEEi..... ......... .Q::::aaa::::::::::::::::::aa: ::::m:::::::::::: :::::::::::::::::::z::::::::::::m::::::::::::' '' '' '' ''' n::::::::mm'-:.1r:::::::::::::::::l:::m:::::::::l::::.. Hr:.'::::::::::: ' :m::::::. ',...........- :E!z......i::-::::: bl' ' . f l w 4 l R w 2 . v ' Q22 C53 y. A ka -xv -llll- lq M O 0 1 i l'i :HIL rg l cs ,Q r' 'il vw, 'r l 'El 'Fl .O Q .4 f The Evening School of ommerce 'X OME ten or eleven yea1's ago, the Alumni of Georgia Tech became interested in finding a way to secure some sort of business training for the Juniors and Va ' Seniors in the school at that time. Under the impetus of their interest and co-operation, a series of talks was begun by Atlanta business men, one each K' . week during the spring of 1913. An Alumnus here and there may recall on that program, Fred Paxon, J. B. McCrary, Joel Hunter, Edgar Watkins, VV. M. Fram- brough, Bob Gregg, and many others prominent in Atlanta business. The Alumni during that summer got busy and agreed to help finance an Evening School of Commerce, whose instructors would give lectures on business relations to the Juniors and Seniors. The Junior course was never worked out, as their schedules did not permit an hour when all Juniors could assemble, nor did the finances permit a series of courses which Would meet the needs of the individual degree departments. The Evening classes were held that first year on the campus under the leadership of ,Vlfayne Kell. Among the lecturers on that roll were: Dr. Wallace, Dr. Crenshaw, Ed Green, Homer Watkins, and a number of informed men. Up until June, 19144, the Evening School of Commerce was nothing more than an experiment in the eyes of the Board, but that summer they adopted it. The Alumni are due all the credit for this, for it was they who had the original idea. The basic idea is this: Every engineering student should have on his schedule or should have available on the campus, specialty courses in Economics, courses in Finance, Personal Relations, Production Costs, Organization, Sales, Advertising, Accounting, the Law of Con- tracts, of Negotiable Instruments, Realty Values, and the like. With the coming of Dean WVatters, the department began to lose its provincial form, and the development into a sizeable day as well as evening school has permitted it to take a place among the leading departments of the school in keeping with the place already held by our engineering departments. ' ' Now the Evening School classes are held in a downtown office building, which permits young men already in business to obtain college training which otherwise they could not get. Students have received credit for work done in Columbia, California, Harvard, New York, Northwestern and many other institutions. The scholastic standing of the Evening School has thus been established on a par with the best in the country. The character of the work has possibly been best attested by the fact that 95 out of 440' students enrolled during the past year have had previous collegiate training, 39 colleges and institutions were repre- sented. Many men, having graduated in the engineering departments of Tech, find it advantageous to take up courses in the Night School. 59,0 4 x lil .I , N '4 I' -A 1 5 3 'Q 'Q S 32 :ok 4 lb 1 I f i lg, .V ful li. ' 4 P -1' -mn l Zn.. ' 4 gil Q o 1' I 5 'S 14 I Z4 '1 v Q, V l Lrvv Y BELV Lower K f 2 0 60 V. . o O X 1+ -, ca ' . 1' 0 ' . 7 . '- 'E::.. i Q nw 0 , -- nxlflllll f i K, T . 1 qv' -- ' - -- - . + a s -f Q. zWfmMI . 'V'0'j95 iQ0 ' 'E L A 1 t' .V L - sl. - Fx 'li 'ij seeggul ' o E L . Q +Xxl.,,iEigk u Q 6, - O IEW.. D . P 1' ' 'Q . , s 0 -:. -: I .- E -I I E i 1 I N' . lb.: ,V I 0 W I ' s I 'Alf' h w :3z...vA- .. - , V N 1-J e-I arg, ff gfn It ',.L- i ' -- -- -ff f- f ' .-- - M ' -P1 ':m.. .:................................ - . Q-':1:f .R 1 ,,m-- Ipmnzg-'-ggggzsxxuaazau nlnamaTmIlnmmamnunuuiaaanRE5EinLQIIIII.-at-II--Milfyf-:Q .-!,, ,ff-.WI-ra.nh:uIn:n:n:-LIlsEEurr1i1--I--mn. -svvwv-x.....-mm ------..,..... 1 -...-.. .1I-.I----v--I-rv-----fr-no--vw-M' ' - 3516! EIiff 35m?iWg-2'121un W 0 5 ' .Ip I H E, I B lg E N 2 A il' III 1, PI ' .. . - JR: Y. 'fix :a:num::::::r.mmmamn::::.-anmznzgmmmmmag,mgmmmgmgggmgummmggnzgg :::::::-.::u:I:::::::::::::::::::::-' I nr 1::::: InamumusnImaam:xsmsus:::::I:s'.::::u::::::::::I ' .... V.- .-::2......, ' -nv' 1 517' ' VV- 19 I 5511. f K 1 .41 I f I We ' I EQ 7 I ff? acu ty 2 , IQ. . 2 Z1 I at E. 'I Sh I fC if Vefllng C OO O OHIITICTCC Ziff 6 1 4 Q 5 ' JOHN MADISON YVATTERS, B.S., B.S.C., L.L.B., M.ACc'I's. 'fit Z Head of the Department of Commerce Qi!! ,Q . A I 92 W1 gg HUBERT EUGENE DENNISON, A.B. Q4 I .Associate Professor of Commerce all , ffl x . 'E f I g NEAL MADISON LEWIS, A.B., A.M. fl' 3 Assistant Professor of Commerce y, - . ' P74 I V I SIDNEY BRYAN BERRY, B.S., L.L.B. ' , It 2 Instructor in Commerce b ME . fl Q fa I ga 4 gt JOSEPH BLAINE HOSMER, B.J. 5 I! 1Instructor in Commerce 'I 5' ,LI L LEONARD ROBERT SEIBERT, B.S.C. I JJ 'fab -I . .Iv P A -. ' H .Instructor in Commerce ggi Ag 4 ' .- EIS 'Wm' . 2- ' ? Q'T 4 ' FRANK WI. RIERRICK 'HE' Qi IM.: . - ' QL ,-ifh, Instructor in Commerce N!! mfk fs-JL F . I f VVAYNE KIRBY RIVERS, B.S.C. It: ' i Instructor in Commerce t l ' IR E! JOI-IN WILLIAM JEFFERIES NI' A Instructor in Commerce I j A I - HI 'AI '4 is THOMAS VVILLIAM NOEL, A.B., M.B.A. 5 ' i S Assistant Professor of Commerce Q' I S JOSEPH B. BRADDOCK, B.S. Q I E M. , . , k Instructor in Commerce S R x' N. . is K N . NOAH XVARREN I E Instructor in Commerce S E SI X , WALTER s. KELL, M. E., C. P. A. S Us f - . N I 'Q Instructor in Accounting I S I 1 ' . S 3 iq E . OHN R. BYINGTON, C.P.A. S A E 55 Instructor in Business Administration E Q r N ' Q . N I I get NORMAN E. ELSWORTH, M.D. S if I Instructor in Life Insurance I E N 5 2' z N J. R. ROBINSON I S E2 Instructor in Income Tax I bi S 2 X I S 5 E Digg? O o92I?nI 0 I Q I I KR it -'i-R 'D ' fft -'ki5fIQ.145?'I2 .....f7.Q 'Kitt' fl' I Z5sf179:0wxooQQs9v:f09o9vxwsof0QzmsQQsmcv99vfnf2f4afL'Q9 EK II A --,I V, . .. XY I LIONEL K. R 0 ix' -5? ., o , X .H uf -X 'gh Etta 'M gg, 'C f .s he .XX . A -Taffy . I ' . its lu' wt - mi l , ' , ' 1- Y X .1 . Wiggaiapunuxunu -ri. E1'?.'D.1Wm.K1'.i 6.l. nl.'il2,,R' -fm ..,.+.i. . u 1. si vm.1iliw lum ., fi'l', -.v. 1: . .. :........ .... ... l f -n- r ...,.,, .,.:.,,m,,,,4E,,,.,,. ll ig. , . -E .... an y --,-,1 Ump1:x1xu1 mm . .. , . , till T E is rye. P roi l . W 'E A ' ' F ' T' 1--f- ' - -.:2:::::'-nszsz.-:::'.::m-.:::amz:::.::x:r.'::::mr.m::r.lmv::a::r.:'w::.':::x:'.::z:::::::::::::::::::::'...4 ,,,,,, ,, -if, ,,,. we I t ffl' t Q It Q WS . Fyl 1 1 '1 ' E ' ' ' T Venmg School Semor Class History Qff. ,N N our humble opinion, it was indeed a great day for the Georgia Tech Evening b Sm L, School of Commerce when seventy-five forlorn specimens of humanity marched Q an into the office of the registrar and demanded to be enrolled in the class of 1923. 2 0' Xlle say demandedg two or three of the more forward ventured to get through ' .ie -9- without stuttering, but demand sounds better than the actual truth. This was in the fall of 1920, and marked the largest number to be enrolled up to that time. T. Time sauntered by and members of the class dropped out until at the beginning of the Junior year only twenty of the wisest of the class were left. QAgain we present our humble N opinionj. At least, we-felt considerably more important as uniors than we had the 'year 'Q t I before. During the next year the class fared better and most of the men thought a year l . A as a senior would offer an lmprovement to their poise and dignity, so they remained on the if roll of the class of '23, p q The class of '23 was the first in the history of the Evening School to form an organiza- . tion during the Junior year. It was an entirely new venture, but there is little doubt that ' Q1 practically everything accomplished was a direct result of this class organization. The Junior L J ggi Class officers were: Ray Spitler, president, Cooper Inglett, vice-president, John M. Phillips, I Q Fifty secretary, and Paul A. Davis, treasurer. The Commerce Club was organized, and through the efforts of the class of '23, resolved itself into a vital factor in school life. Three Juniors AL ggi held important offices in the Club. They were: Ray Spitler, vice-president, John M. Phillips, l l ' ll secretary, and Charles R. Perry, treasurer. . l i , Q, During the summer intervening between the Junior and Senior year, the Class sponsored ml a banquet given in honor of Georgia Tech's new president, Dr. M. L. Brittain, at which over one hundred students and members of the faculty were present. The banquet was a ll fl great success, despite the fact that most of the students were out of the city for the summer. w if The Senior Class was organized at the beginning of the present year, with the following officers: Ray A. Spitler, presidentg Charlie Perry, vice-president, John M. Phillips, secretaryg y and Julian Benson, treasurer. It has been the policy of the Class during its Junior and , Senior years to have wget-together suppers every two weeks, the purposes of which have been to promote a feeling of good-fellowship and to cement its members with a fraternal T bond which has molded the Class into a better working unit. g As the Class of '23 goes out into the world, leaving behind all those things we hold so Z2 dear, we want to leave something which will serve as a bond between ourselves and our Alma Materg something besides a mere intangible memory, exactly what has not been p Z settled, but plans are being formulated toward that end. x g And now, old Alma Mater, our dear old Georgia Tech, it is with throbbing heart that T we salute thee and bid thee farewell. May thy banner of White and Gold be borne tri- umphant ever, and thy glory of the past be as nothing with that which the future will unfold. 2 5 .4 Z Z 9 ' 4 4 4 . fi Z. 'ECHO v 54 E A O gli -w w . - ,l ug rllliljf? L' TIXXX7 xg! O A V 0 W i-.0 -1.4 o ,, .N Q-64,4 5, wwf s uw LA wo ' 1 f J hifi.. - Q . -. KIA -- 'I , ,Yr ' .fs 0 ' 'Y' i.::.:E':n. ' ' tgw - ' ' 1 'V C A J A if 'A T1 9 X71 2 VL W ' - 'frwrofszwf 'A 1f11mmHHff0WMyffWf1A' ff14Mfffffff4f4zig,-' 2330 5 G ' ' Z, f f f . ,Ar ' ' . wart K, a 3' Q - ' -.aq5.1.. ' ' 0 U p 4 . ' 1,4 F'-f A , SA ,1 f, f ':ig-Q 9:2 inf C A35 any ,,, ,g E ,, i : 5- ,ffm Zfg, ., ,,fA 5f?f 2 :l. . Z . ' IL he aa. N' umliinmslmiiiflliv-m.ni'ur'i''rv in 1:-1--If---I.-I I---f . V - . P L1 I sill Fl A 'ties-H . 'WT A ' 1 1.411 E AN Bli- , '02 - ' QI N: -, I Q xQQx.L Hm.L...s3fE I Ir I 5 . 212-' ff' . . 2 it . , . Q 5 I :- fl Ji 5 4 'fi 2:2 ig 'I I .4 5 , 5 , . , ,. . Q I 1 W 9' 1 KL X . I . . ' i A H Evemng School Semor Class Qfflcers 52 h . s.. 61 - , 1 RAY A. SPITLIBR . . . . President I Cl-IAS. PERRY . . Vice-President ' L S -mg, JOHN M. PI1II.I.IPS . , Secretary 1 1 s 4 , - JULIAN XV. BENSOX . ..... -. . . . Treasurer ' I ri Eucnxn G. Acmam , . Member Ewecutwe Committee qv ' 'Y : J 'N J CARLTON G. GEORGE . .......... Historian U A N P sl I E ' sh lS ' Venmg c, oo emor Class Roll g I S ' -1 J x ' E ' AGREE, L- G- INGLE'r'r, D. C. 4 . ' BAKER, E- PERRY, C. R. ' BENSON, J- W. PITTDIANJ C. H' . V 7 CHAPMAN: A- L- K PHILLIPS, J. M. CUBA, IVIAX. M. RILEY, G. C. Y DAVIS, P. A. ' RENAULT, J. A, GEORGEI C' G- 1 SHROPSHIRE, J. M. HAIL1-:Y, N. L. SPITLER, R. A' ' E. q , HARWELL, L. C. WILSON, E. B. Hook, J. P. :Q N M O +25-4 ' J5 O z O I ' W .- Q P -vf ffsssf' W E' - I N M ' MW 5' 5, 5 - . P U0 C'- ' I H V P mf.. :L , P . b X' 55' ' iysf N I I , .xv .ll I. V QT . il 25 's ff ,. . 24 .g. 2. . 93 . iff . 5 .jf F I .O 1 A .fa I K 0' I Q' E If! r.: Q .,. I 33 I 'J , 2 ' F U O' X OA lllll ' un' . Q -'I I 1, U B u New ...5 -'llllv W a n 'Ni , S Y N X lx . 1.' A X A Nj L fan ? .... ... .......... mpg- . f -.:::-.. 1........... -iL.......Ls.'+' ... . .L ... ,i .gm1, , P IU ' , 1 -. q .. GN I Q . gnilhix-L I- , 1, -o-Q-Q-Q., 114 426 :LQ pf ,. , '1f:-:?,1!A J Cf, IR qi I, ,,, If wa..wmlunswinImumw g,mmuim.:.Q.,QiZQ'QQ.... ,... f A-.-..,---5-1r1.f-51-nv-f ..,..... L 4 --.. ' 1-1 4' --- -:E:::..-:::Smagg2m. K: I , ..,- JI: 1-' 5 4 r -ia 'A 2 v 'Ill 3 'li ul If IH' 'IL 3 'WI 5 ' 'J .. ' ': K. If 'P' 1 Y I N A E5 :W 1 In' ,F -Y K' . 5 lll 4' L I 4 15541 'HIP 5157 .. 9 IIE! CW I I Q 5 . . ,f :Q In 4 P- 3 x Commerce Club Ufficers V VV. T. WII.I.ING1'IAhI . . . . . President . P. A. DAVIS .... . Vice-President B. T. EGERTON . . C. R. PERRY . A COMMERCE CLUB ROLL ADCOGK, O. W. ACREE, E. G. IXIKEN, E. P. ANDERSON, VV. VV. BARNETT, J. E. BARGERON, B. A. BAKER, LELIZABETH BELL, L. A. Bmw, C. A. BOND, R. H. BENSON, J. W. BLACKSTOCK, T. F. BROACH, C. A. BORCII, H. E. BOGGS, B. B. BEYEA, R. S. BYINGTON, J. R. CAGLE, H. A. CARROL, J. R., JR. CHAPMAN, A. L. COCI-IRAN, H. VV. COEEER, H. E. CORRETT, M. L. COLLIER, F. W. CRAWFORD, P. W. CUBA M. M. DAXIS P A. DE VAUGIiN A'. G DORSEY E. L. . DANIEL C A. DE FIREESE, J. C. IDOVYDIAN, G. F . DOWNING, J. R. DOWD, T. J. DUIIDEN, T. E. DYER, E. M. EGERTON, B. T. ELLIS, E. C. ELLIS, VV. A. FOSTER, W. E. B GARNER, H. GASTON, R. W. GEORGE, C. G. GRAGE, H. VV. GROBI.I, L. G. GROSS, C. J. I J HARMON, N. HATHWVANGS, A. HARRIS, G. C. HAILEY, N. L. HARWELL, L. C. HAINIIVIERS, F. HAYES, M. L. HOLLIDAY, J. E I'IOI.LINGSVVORTIi, C. J., JR. HOOK J. P. HOPKILS VS . HODGES T. L HUNTER N. H. INC LETT D C. J EWVE'1 1', MARGARET JONES, A. C. LADIBDEN, C. E. LINANE, L. J. LEE, N. H. LINE, O. T. LIVELY, C. J. LYNN, VV. J., JR. MADR1', J. G. i MAHONE, VV. H. MOORE, J. L. MORRIS, E. E. MCCLAIN, J. A. MCCOLI.OUGI'I, L. L. . . Secretary . . Treasurer ILOTHER, C. SANDERS, A. J. SHATZEX, E. SI-IROPSIIIIRE, J. M. SCOTT, O. E. SIBIINIOXS, T. C. SPENCER, H. C. SPARKS, J. D. SBIITH, DQ M. SPITLER, R. A. STEVENS, S. S. SWANN, J. B. TATUBI, H. A. CPHERREL, D. H. MCELIiANNON, M. E.TISINGER, G. E. MCLAUGIILIN, E. C. NELDIS, J. G. NICHOLSON, J. M. O,DELI., A. M. ORR, J. PARKER, F. PERRY, E. VV. PERRY, C. R. PIXARR, VV. E. PITTDIAN, C. H. PHILLIPS J. M. POPE J. S.. RII.EY G. C. RENAUL1' J. ROBBINS E. M TOWLES, R. L. TREY'5'I1IT'f, G. TURNER, E. F. TULILIN, VV. G. VIRGIN, C. A., JR. WADDY, VV. E. WALKLY, E. S. WVELLONS, B. H., JR. WELLS, J. A. WILLINGHARI, XV. T. WIISON E. B WATKINS R. P. VVITTING L. VV. YOUYGTREE L. B. 5C can Hof X X my Ag' LIONEL K 'V i w: -sz: ' '- 'M ' A I ' ' l.Lvv K 2 X O J , FE 2 R R 2 1 5 R R 3 E 2 wJ Q , 1 I u 1 3 lg? :GEN Wi f' I 1 ? :Ihr ' , -um- UE! fain' UN I 5 E pf Sq J J J 'Lv-J ' I v f I ' J J A J Q ' I ' J A I , , JR , . ' , A. . , ,y - 1 , . A , . Q5 ' ,. :?: , O Xb ' V . Q l -4 l. QQ 7 0 - . .- 0 ' ' ' nLI:5...'f 6' to - egiililals zx. W' 9 1 . .. ' ni f M N ' Q K D ' 1 --If I- L i H., sinh, u- I4 - - O X wk V I . I55. O P N' ' 'fb 1 c ,p ., 'n :lf K ,srgliff .Yakim a W .,, 1' ... . 1 fl ' 'f , mm' A ,. ,,., .. + -3 H-5-55555::::::::: ':'HiIllii'1'ilml'r1lln--Illlu'mla.nml l-, e 5-Q --12 'H ' ' QQEETEEE.-.113 4 ,, , ,, ,, .... - .. . .- ..g,Z . .: a Nw' I, G I I x 1 H ' sf 'f f X 'I A z I 4 K ff I r M-FXX 2,-T: -'fi' R ..o.a,..,, .J J X 5, 5 1 , I Hn X I ww xL -5 X .E dt. 1 l U Hu M i A :nv H A A in lm U mm' , N 4 n 1 my .mmm 'I .ni gang' ,mx un mg, xguxx .1 1 1 n v v I , v Hum lg 1 u U un. Hu 1 m 1 nm wmv I uw. N K 5 I L ' I M '. 5 2 H E - W, -wr! -fl ., B 5 4 : '.-' - - :. . ::.-.'.:.'. :.-.:. rr:.s:.:.:.'.::...:.s: . as:r:::::::m:l:::::::':'-' ::::':'.. ...:....::.... ...- ., -.. .. K, ,Lui H . mn r . . ...:.. ..........:..... .1 .-.. s. sn. 1 : . : ::. : N w V M ' g f V Q 1 S: 1 V E.. 5 J' f K f ,fly E2 -ullll P 4 Ill' 1 R44 L 4 'gal MB u.. 1 QQ l '?'A D 4 .J 1 o r Evemng School unlor Class Offlcers YV T VVILLIXICHAM Preswdevzt GI-0 F DOWMAN Tue Poeszdent NIARG XRET Jim ETL' Sc GX H 9 X 1 U fi , .oar ,, uonnx. K i O 21. Secaetaoy and loeasuoeo x WX H -.3-qmxgugimmwwmixw, 'QQ' 1' 4 'mi iii ri-a .-,. I X 4 o .ll I If ,I A Iii!!! LLXN aff 'Pl 5 N 1 x T '51 I I Q 1 5, I 5 I ,x 1' ,-.4 V 1-6 . :Z 'xi' ,gi .. ze, 0.0 I Sgt .,. '4 A14 5.1 . sg 1 tv. 'Q , I4 I . . V I Q . , ff' . o f ,Q .,, fe 1 1 'Q E' Oz 1 V P -E, IB I Q! 0 II? ff? Jil X 2 ,' mu'1':'V ' lm... - ,... ,.,,, 511212. ,., ?, ,.. A --J' - ...DQ 1. --'Z'vk.,.- -if ,gg,:,,,,,,, , 4 A -h-'HAZ- . I? uf, -..,1-.L , -gr' F,.t,, -oo-O., I-Y ,xii 3, l ,., ,HJ H ns x, I rr I me -.:3Tnsnn-vs.mzuxxls1S:hg ,L pr fill f 1 1: 1 1- J. -L..--HJFKJ ' Q-i---'ns--? u ' .viii ,f -. ni' fmv EIJE.-anime.. 'X H .... .... cg: ,,.......,.. EE ....... H... ..... Am L P I J if L . FL ' . l E li I 4 Wg' ti u 'Rial 'Sf 'wpfii 1 W .III cgi rid Fm, v 4 E ' S h 1 ' Cl ' , Venmg C OO umor ass ' I ' J J 23 CLASS ROLL -' ADCOCK, O. W. HOLLINGSWORTH, C. J BLACKSTOCK, T. JEWETT, MARGARET .0 BARNETT, J. E. MAHONE, VV. H. COLLIER, F. W. MORRIS, E. E. 1 CAGLR, H. A. ROBBINS, E. M. CRAVVFORD, P. VV. SCOTT, O. E. Q DOWMAN, G. F. TISINGER, G. E. Q ELLIS, E. C. XVELLS, J. A. FOSTER, W. E. WILLINGHADI, VV. T. zz GARNER, H. B. XVATKINS, R. P. HOLLIDAY, J. E. XVITTING, I.. XV. 5C x 'Y ful' 5 Y -- . Q ' ' ' LLONLL K. -ix!!-'iligflx O - -N V -' ' LLvv 2 ,fo o 6 PA, h O 0 - v . Rv LA A n:l..:E5 f A: 5 qv' :figiiigzh X' p Y f ? '. 1 I- k ,.. .. rv- A , X. , W . V m 1 Q- 'l'A u 0 J 1 o , ll ll I o X x ' 'V A 'ff o 'Q h ' ,f ' 0 - :: ' M. 59, V A b ,ffrwa ,,', 'mi9L'., X Q A I-I V gg... 'f gf . , el92Q,f V 1 1 ....1qQ : A.v-- - Ag -f - ----- I f'1-f P Q -:ae 4, . 5 3' Ui 3 Fl w X P M N I -.ig xv 'M E L ---- -- - -- ' ar: 'r'-'zxu-'aw:zz:::::::::::::::::::::x::::::::::::::::::i ...... .,.... - 1521 ...... - ..... ,.. a::::a::' '- r-'r '-':1az:::::::::::::::x::::::::'.:::::::::::::::::m::1:::::::::::::::l::l:::::::::::::::m::::::::::IIm::I:2I:I:::::::::::::: :::m: .......- IH.m...:....... .... . ... .... .. .. Q 7 2 4 f fx ' ,A 1 , I 4 2 Y - , L 5 . ' I' ee eeee e-- 2 f 2 4 if . 5? 2 5 ,ff 5 5 . fi E2 QQ? ef - ' lk' ,,,.1 :QB 'lf W 4 555 1 1 l A Q evening school freshman class officers llw ll f 2 john g- Helms - . . president E 1 54 E 3 - 1 - . . Q S J- 3- mee am l- . . vlce-presldent Q e 'Ss :-' ' my f- gfdbii - - . x. secretary and treasurer S Q e Q N 'x Ei x 5 x 5 x S x S E S N S Q 1 Q X 3 Q 5 E ' 0 Qx ' 5Cff0 LLONEL Qi , J45 e LLVY W PM f ir? 0 39 1 375 ' ,oooooog 5 ix K - w A 1 L L ' ff :mgsn W 'x E! V 1 Q Q. .. Q ..'. 5xQQQh4Sms xXimxx e Q eh fo Q F z- 2 a 5 L2 1: H4 ,Ii I wi 'K ,F I1 wi ,H W -r. ,,l 255 LL ,F 11 1. i iff .j. fi' 4. Zi ii 'L 'SQ y r. eg x 4 I x ,VS an -s 52 if 5: 2? ,A i xl Ni if 25 X if S? iz is 5? gs 5, E? bi 54 'E E X X Q, if age if S: if ' rf: ': i 1. . '1 Q .5 x Ig .nf 6 'J 1 Y x..!.9c.g-.gb , ' uma::nm::::i::::i55gggg5555::::xr1:5:asas11xme:Simanew:Mmixn11ux1s1j'? i1nLTI--l1?jgf mg,.,.,,..,.1:1,f:? 'fjgliti is . ... .... ..... . ., .4 ,,,, , , ,.,,, ,, . A M,,w., -,...,,,,- ::. I 'W 1 S I '1 ' film' .... .... .. ..... E D E P 1 1 P in mini ..........i..... . ..... ... ........... ........................:::'.::::'.mea.-..::::::::::.'::.............. ....::: .....i ........ 1 C35-9-HJ 2 , , , . P- ' . 4-1-.. Jgg ,Wx J J ' ' - - - f- -f- as J FF 'S S N S bs S J .. is 1 SI 1 L1 JP. 55 g,I'g W1 ' 11 1 fr 1. 1 CVCI'111'1g SC OO CS H1311 C HSS rs, 1 'iv 1 ll W1 wg C ass ro , . . UQ' , 4 alken, e. p. gaston, r: w. orr, J. anderson, w. w. gross, C. J. porry, C. W. QL bargeron, b. hopkins, wm. pharr, w. e. Vs A' bell, 1. a. hayes, m. l. pope, J. s. ff l ll biyea, c. a. harmon, n. J. parker, f. WT J 1 bond, r. h. hattiwangs, a. r. robbins, e. m. gf broach c. a. harris lr. C. rother Q. V borch,,h. e. liodgesfl. l. sanders, a. L5 1 bo s, b. b. hunter, n. h. simmons, t. c. 5 f gg 4 52 beyea, r. s. hammers, f. spencer, h. C. 3 Q byingfim, JB r.. Jonfa a. c. sJJaJ-ks, J. d. ig carro , c. ., J1'. am en, C. e. sia zen, e. ,J . Cochran h. w. linane 1. J. smith t. f. Eg coffer, li. e. lynn, Jr., w. J. stevens, s. s. Q Corbett, m. l. lee, n. h. smith, d. m. 5? de Vaughn, a. lovell, J. h. swann J. b. Z . . ' N ? dorsey, Jr., e. 1. line, o. t. therrel, d. h. J' JZ gyir, C. m. livegy, C.. Jowilsitr. l. e reese J. C. ma ry J. g. rewn g. E downingj J. r. moore? J. l. turner, le. f. dowd t. inc clain a. tatum h. a. ,Y durdeyn, t. e. mc cullohgh, 1. l. tumlin, w. g. Y daniel, c. a. mc elhannon, In. e. virgin, Jr., C. a. J egerton, b. t. me laughlin, e. C. waddy, w. e. 5 ellis, w. a. nelms, J. g. walkely, e. s. P5 grage, h. w. nicholson, J. m. wellons, Jr., b. h. grobli, l. g. o'clell, a. m. youngtree, l. b. ,QS if E if' 7' 52 Sc 99 5.7-'fi X N uh v . iv A L L J . . L IO N E L Q iwilifimx Q, .. . Q ' v L L v x --. 1:-A ,- ,f. 5. ,f f 2,4 :MOA 1' f 4 , - . O 351 O oak' if 'JK 4 . WW - .... . 0 r ' ..::L..::? ,Af I 1 -A W Y - . V' A- Y X , X , Tl N zsmx 4mw E gg-Q JQQQ'cxxss4,ocf,c4Nfpbr.11g:::gsr::4.:awm:m:mYawwmm -3 4 fu fl F mil' ,gf , - - - 'x - , f .7 K1 0 1' g-'STS ' Q C xylem? The Castle of My Dreams 'Tis calm tonight. The wan moon spreads her fan Of semzer light fm- ,foliage Caressed by the gentle sighing wind. l Mylriads of small stars, dotting the heavens, , Twinkle lazily, A And the- evening star flames as a torch To light with mellow radiance ' The aerial road which mounts To that great filmy height Where rests the castle of my dreams. Oh wonderful night! Oh radiant moon! That brings ' The qu-intessenee of a spell that wrings From out the ages, X - With an finvlisible force, those dreams Most dear to man T lflfhen soul within him sings And worlds are at his feet. llfouldfst journey to my castle? Come with me and we shall see The wonders of eternity. But slowly, softly, enter here And look on treasurespgods hold dear. Those virtues which, through worlds of kings Have lived, immortalized, the same As when created by the Godly head . And touched forever with a fire Divine through all the years of man Encompass us in a sphere Wiaose light is Love And Kindness a reflection of the beamg Where Mercy and Compassion Tone the atmosphere - Into a vivifying food for souls. Here a soul may drink Of all those nurturing virtues And the scheme of things Sink in its core so deep X y The radiance ofsDivinity lies bare. No mortal soul may ever cross i The threshold of this sphere and then depart To give the secret of its wonder To thosetwho have not entered here. So I drop-my pen and leave to thee . The elearness of its memory. A -W. H. V. J K, 5? u We y. I li Ei W u il 5 Q rib -4 M A 1 ,, w i 7 571 ! ! 1 g , IJ FB jx '-W ii za H as ww 1 E. ,I LI J H ii 1 ,. ff 9 1 5 if F I bl is xg E R 'T R D 1 , V V K3 :Y 'i 5 E P. E I ff 1 1. 1 1 7 i .1 ll X v 'ifki :Di y 1 K rr i - 1 err Ui i f v, ,Q i Q5 X 1 o A' i 4' - 1 A J Ae- e --.. --- 2- - ..., ,.. 'vi i .---..- -e -nl .,.-... . Q llllllullqi IIIIIHIIHHIIIII T n Ilnullll lllllaaillllmllll 5 ,fl ' R55 ' A 4: Qi Beauty H Q i t ww ,Ui - 1 K x Af 'fe Q fn -xx L X X ' H i A W N - EAUTY is a quality to J lx Q 53133 I which we all do humble Q54 XX MX X 7 ' I' homage. A masterpiece of -IA ' ' ef I - - - art, a majestic piece of architec- L -- ' - ture, the grandeur of natu1'e's beallty still TIiOlSlZi and Vefdallt -Qj lf? from the Master,S mighty stroke, jg A Q V Pl- i la y all awaken within us that instinc- I A e g' mf! Qi tive admiration which has led man 3 e - i -.. .. through all eternity to the execu- ff' -in A I j , it gg I tion 'of noble deeds and the attain- 1 , in l fy A. Jill- A N ment of the highest ideals with his x i fi, 'it ' :d- WJ, eyes toward X - Y 4' P 'f h i -ei f I ' W ' A V K assne eauy possesses o a y - F- H tp U Ti beautiful soul approaches godli- - Q'E! H -Ai ' ness surrounded by a mystic pow- yi L H W Tai- I y er which bids all worship with an l, -' k inherent yearning. Activated by H I' I 1 beauty of soul, passive beauty is it l manifest in beauty of speech, beau- I 12 I i ty of action, beauty of thought, i ' 14 lg and beauty of characterg the im- it 5' mortal marks of our Creator's I y ly i hand., The following young ladies I '- 1 A i F exemplify they highest type of it li i Q fy beauty in its full meaningg beauty 5 i of feature and beauty of soulg iand f they are loyal supporters of our gi P I beloved Alma Mater and the 1923 :E i Blue Print. l I X .ii , I , ll-!!ll ,. N, LX, Kii i ljoflffh Qvgj I Kiiiri' alta L, n 6 ' PNA 1 A QQ fig gglihfa l 1 1 11+ W!-3 K ,o ,uuuli1iQiiiiirnluuuumI ifiiiimiiigniummi I ' 'Win W I 1 F A l A X 3 MIss IRENE THOMAS 5 EL Nr Q Q nl , Atlanta, Georgia ,Q If ku xt' I fx- ' J X , -n I. x ' 2 . 1. n - - Miss LOUISE PERKINS bgj l Clarksdale, Mississippi u EF QQQ Z I V 3 I I, -,gg , 1 . fl., 9 i n F - li 4 s?gi 'kv 5 '5 , lil I ' 4 1 . A Q el l , ' .u I ' 4 Miss MARY LAMBRIGHT Tampa, Florida Miss MARY BLOODWVORTH Atlanta, Georgia I .- ,J V I I l f l I l ' , , I I 1' p I V 6 A A l , A 5 l Mlss CORDAY RICE ll I Atlanta, Georgia V J 4 - 4, I-fa p -Hg A I f T1 fi I V mm lp T I if C! i ' I fix Elf WWW will I H X f ,om W5 f N Mid. Elk 1 1 5 1 M A ky X f 'F Q., fi, fu.. ..4 fv fr? 59,5-1 f , A M Q fwfw 1 , f f 1 Cf! fff, W lf 1 -Yi SS xx NX 3 X , xv N X x is X, X f ' f . W Y ,h B X I f I .f G f . 2 X ix If 9 5 s x s Q 1 2 3 i s 3 S Q Q X E M R E P S Q 5 x Q 2 21 Q s Q 3 Q S X S E Q -.f-........,.-..,.-..-..--...,.Y.4A ...W Y... LY- fn,-.,-5g We:-if we ,:.:-:I--1-1-my 1 I 5 Q 9 i I f X, f, fffff f, ,.-Vyv ii' f, wi, V' ,V If ,-fn, ,, M ,i f Q f, ,f ,Al 1,1 ,ii J 4 7 .,,, ,.-.3i:....' - x f , , 1, . ...- ,wff K, 1 3 3 , 1 f V4 . , jx P? g he L 1f6 Q '5oaMAD1soNAvfENUE A f l i u i spNEwYoRKe'ppgit'il H it 'Jianuary ,LL X L',' r 'Tiwlaflftoh fflf Q 2 S Mr, wg'aQfvgggaAngfj3l iopi 9 L We S t, fgN op ,,?:iiiE'iLf57:ffj Dm s as i ' sieis iiris ' , l ','f LK'K, 'k LL I in .-kk f K - p , ,x ,A .Z 5, rg V,, ! 51 h ,AhA mhh l L ,VA hh , Q F 1 i it s ii The above is a reproduction of the letter received by the editor from Mr. Gibson, who was kind enough to select the most beautiful pictures from the large number sent him for judgment. It was due to his interest that we were enabled to obtain an impartial selection. We wish to thank the many young ladies who submitted pictures for we share with Mr. Gibson a desire to mark them all number one.', . Q , 'March A ' 'I . l X to i ,- 'P' qs . x .J il 4 ,fl - 5 . i s f Y ir ,li iz 'Ji 4 P i l l 1 l 1 I l l I il -V 'Qu - '..a..', f A W , A-1. 5: W1 ' J' fl ull i e f all , - 'jig x - ........ i.... Xl ,I J.. '-A V at 1 S21 . QQ! 1 11,51 A 4 Ya wb N? ,Ev -I D P4 4 W if Z , 1 I1 F w, ' ' A l 5 5? l 5' 3' . l .4 gi' 0:3 5. if ,V l E 2: 1 'a . . I 1 If E 3: V I 5 1 O E5 gif Wi l . MP V1 uni, WE l I A A ll 26 gi L , , 9 A 5 . 1 Q . 1 ggi . :J f lr 14 i i fy N ri . ., LlDNEl K' m:'-'a::::'- ff 1925 xg JL, is S-f..:.......J 13533, 1 'H' 1 1 4- ' f- I ' I 1 X ,- ' R - ,-Q-'L f 'rw 3' Em- ' ' ' ' ' - . . - x --. ' 'f - 2+--fr A 1-' J- . 1' 14 Y! .au-5.5M f A6 Q, fu -D I - qc. h - -,fi ,- v - 1-If 9 gr. j , 6, l ' nxgggggggsa: :::::zmalmlIllmmmlHill-live-nsumnuuieanulisam-gmmaJ -,i-.,,,..,,,,,..,,,......,,.,,q,,gqxugqq-::L?lu qf,,,,-..L,,....iA.......,x1...:.,..u1Z:1,a- ' :-' ' ..,, -,,,., .. , ..-.- ::::3::- .I H 1 .' . -'mam il - eg.. u- V .s--Q-,. -v--' :I .. -1: fl 1. ,l ,v ' ' ' . '. M 5 ' 1 N ll I fr I , 4- ' I.: U lb u 4 O A ....-2 .- .-.- '-'H N 631 'Y .4 'a ff Y, .-w W S if -4 53 N M .,. rc ., 3: -gl bi 5 X 2 ffom ..... . ...... . .::---- - -:-.. . V .' + -4 --'rv -, . , ' P I .V - A - :,--- D-,,,,,,,, Q w ' W V fm , I: 'E ' : If I :flu P V. Nu. ,ff S 9 k Q N f X Z . N '24 S yr N ,e EQ S 'Q ' ' ii S B 24 X. E X 5 S df I 'C I lk eff-, HJ ' 1 W lv M S820 mai 1 '--IIE' gg 1 'iff' 432. 6.5.1 W mf? W4 1 Q NW yas P ' -,SQ 39' 1 :llllh Km mf, fd 1 W V i ' 'QPF' V' 4 5 A N W H V N . bg S S -. S 2 -.3 -If rs 1:5 E, , Q1 EYE C6 :lj J '41, rc7e 17. Q . as Q 1 3 S 40 - .v 5 N , o oxF'ri,,,.,, .SSIYO 0 , N Q-4.4 1' H I H. L 'ifgif A,. 0 Q ' ' + .P K . NbY' 'NX1NSVWWY5WN5VV51f44W0 3 1, ' Y' vffs-xwzzgwczc'-z4Qx,':rQ::kzwfaxwacgzzi. I- L A Y 4 A 72 O caemgux. I H A Wm K- ' Q 'Ewsszgg -L. ---- , OS U. my L D hyki-,Q 6 Q s ,ia fl 1? Rf UN. , ! S Q ex + . . -N .W - .afk'1E?2E HhHf ?--aW aaaQw2'i ., ka-: KJ 1 . XY1ri?9g,,g'3' 13128iiqiggiiila m lmnmmmxxmRrm'35unmif3EE,:f?-,'- mnnunnmiii fn-Gil.:-.1 X -.-x ... ..x.-. :Z -----. I..Ja..ah..f::.am1---5532.-Tl:--.-... ,... ...W .... 11 5a'..nm.un1-nnuu:: :::i!i:,ii:i'1?il'iw'i'!25i-i T T H E B LV E PJ N E J mv. IM .. .. .------------ -- ----- ---------- -- 1u-n:amnn:::::::u:s::'.:::::::::s::::::z::::m:::::.'f... ....... - i!1......:5 . . ami LM mu , , ,,,,,,m,,,,.,,,-,,,,,,,,,,,,,,,,,,.,,,v, v,,, urn.. ---- ---gggggggggg,,g:',..:............ .... I-uw -an-un-unuwfwlfi-mlllllllnm ' , Dix ff. IWW' N 4 EN 5 f .Q Z 5 4 ' f 3 f 9 F 7' 1 4 A Z 2, A Q . 5 ? 5 vi 4 . Ml 5 5: 5 I 1 , QM -uv 4 P -M v-nl if' rv I . I h . wil r n Jw 5' 1 Fine, P n C ol Kiwi an-I le CHIC OUHC1 T ,' Q. A OFFICERS 57 NN J. H. BAIlNE11'f ..... . . . President HV-fi gl I.. G. RTOORE, Ju. . Vice-Presiclent 5 XY. M. MITCI-IELI. . . . . Secretary E C. P. RAT1-Inn . ..... . . Treasurer E S ' S S MEMBERS E Q 5 Q SENIOR REpRESEXT,vp1vE FnAT13nN1'rY JUNIOR REPREsEN'1ux'1'AvE I S Ni DTOORE, L. G., Ju .... . Alpha Tau Omega . . . XVHITFIELD, J. J., Ju S NBm.E'rT, R. S. . . . Beta Theta Pl . . . . . HAYS, R. L., JR S SAUSSYJ C, w, , , K Chi 51213, . . . . . . JOHNSTONE, R. G 5.5 RAT1-IEII, C. P. . . . . appa pza . . . MAT1-IESON, K. G., Jn S ' Moss, T. S .... . . Kappa Sigma . . .... LTERRITT, E G S Mlm-1E1.L,w. M. . . Phz Delta Theta . . . . .Enom S. W HLVNT, A. T. . . . . . Phi Kappa Sigma . . . . MURPHEY, T. M Q p CARR, XV. BU . . . ..Pz Kappa Alpha . . . . EXLEYJ F, M S MCDONOUGH, J. J. . . . . S1gma Alpha Epszlon . . . Fou'rsoN H. A K MORGAN, E. R. . . . Sigma Nu .. . . . .... DENTCICE, C Q 5 STARBIRD, H. V. . . Szgma Phz Epszlon . . , , HARTFORD, XV' I5 BARNETT, J. H. . . .P1 Kappa Pla. .. . . BENTON, A, 0 S 5 HOWX'EI.I,, H. A. . . Delta Tau Delta . . . . ROBERTS, H, R. gi N 5 JY ,,fff2fiSQfi - ff'-A H- 0 ' I S, F' 14' .41 305'-1 Ogiiwamcoavfws-Aavazmfnfofavmzwr.fr2s2Q4zQ9sc-fmxxfxrvffffxn E 3 .5 ' f - V C K ' T1 I SGML K im qi lx ...Q .. I J: .. . 'fTmm3X5XmXkXKXxxWwXXX mxXK' 1, - S .ggi ...I . . Hin' . O ' fx 1. V. 3 . D ?g ,6g9O lm C 1 52 ! 5 'B er .3 1 li if uf T Z K l 9 ' 'f. . 'i -:, . 55 ' I Q .0 'o o I x il P K-A ' J Q ua Nw fb 54 1 QM . M .41 1 Eb T !lU.P 4 c'iN b SE U V N 2 Q lb if E 5 X2 Q .2 2 Q lg, S S 'X Q Q li N S E Q u N fi 4 - i' Q ' X ...,. ' ' ' a,,..1.. ' I 'Q....IS.:i--. -'- :H-7' -Ia .fV... . -.-- I- -A lm :Q .. - . ... ..... -1. rv .- .-- ----- ---:m.-.-:1-- 1 I 1- K I I 2 2. A, 1 4-N x f ' I ' V K - ark 'ACN Q X v 1 : ' .fr X X I 'W f , 1 I e- . ..:' ..... In- -1 ,- ix in XL: -u 5'elIFGBXfF'H1ITflWTh n'HlV iHIhK1l lll lUiVl9 H5'l'-t- -1' r- li 5' asv- J- In 'r' - Q E: :fi ith' ?, My r ' - 5: L ji! liiiff' '- .lly . ,W H ...- .-iiizg lil :I I lr ... M- -- Q P A -'S VOX .Q I Wi i X ' o R 1 I' if 'I 'D' D 4 AP: IT ...................n ' :::.:::: ' --4---'--- -- V -- ' fff- - . V , f Y. ' - ' - ' 'L ' le I ' P H ll ' ' i an- e enic Rushing Rules tg. QTentativej ' Q-Q 9 GEORGIA TECH A SECTION 1, ARTICLE 1- is N I No man attending a high school in Atlanta or vicinity Qvicinity being construed any point that may be reached by car linej shall be rushed by any fraternity at Georgia Tech N until two weeks after the opening of the school term. 4 :Y at fab Prep school men cannot be invited to fraternity dances. V fbj That no man shall enter Tech pledged. All pledges made previous to the specified fi period will be automatically broken. - I Er Q ,f Qc, No fraternity shall rush a Ina1I at Tech between the opening date of Summer School ' and the second Monday of Fall term. -:S . E fdj No night school student, at Tech, shall be eligible for membership in fraternities. I '-X l if ARTICLE 2- . E ff ln the case where a man ineli 'ible for Iled in under Article 1, of this section, is 3. lv i 8 l S S l .ggi K A pledged to a chapter of a fraternity at another college, and later decides to come to Tech, E his led e is automaticall declared broken bf the Pan-Hellenic Council at Tech and he I, I P S Y 3 . ., 4 shall not be eligible for membership in any fraternity for his first year at Tech. In such 4 1 , cases it is understood that any fraternity may have the privilege of rushing the man during Nil his first year. ly. V in-1 - 'N nu A: rr 4 , Qaj During a period beginning the second Monday of Fall term prospects may be 'Egg rushed until the following Saturday night at mid-night. On the following day, Sunday, flmfl dates for the different chapters, both Local and National, will be arranged by the Pan- ll :ff Hellenic Council. , yi SECTION 2, ARTICLE 1- H 1 No fraternity shall approach the pledge of another fraternity with the idea of breaking his pledge or talking fraternity matters to him. K ARTICLE 2- X If a student is pledged to a fraternity and breaks his pledge of his own free will and M S accord and without the coercion of another fraternity, he may be pledged by any other fraternity after the report of said action has been made to the Council. S ' Z3 ARTICLE 3- - A No prospective student shall be allowed to live in a chapter house during the summer A vacation, unless a member of a National fraternity. Z SECTION 3, ARTICLE 1- The penalties for breach of the above rules shall be expulsion of the guilty chapter from - the Council. I ARTICLE 2- . . . - f It should be understood by the different chapters that the Pan-Hellenic Council is for 5 the advancement of all fraternities and that the best results can only be obtained by cot operation. The spirit, as well as the legal meaning of these rules should be supported by 5 ' the respective fraternities. g - 5Cf,n il X vi 0 oXV.4w -M543 4 0 V Q .Q soya ' 5- 'Eb - lilgil -W N 0 ...::f55?i' 'if ' . -' H H - w .- Ieazgast-Qsvsagasssoyazaxxxx 5 2 LIONEL K Q if-. ' , V g U LLVY X 'Q ' filffitps 4- . A ,K .-.-gv-uv.--4.--ygl.. l ,- F :'.:,,.gJ- . , , ..- M, A qf55ggNf ugnmygpg:1iilinuul55g5.55::x:x:l1auuuullnlinilulmlm'm1mmnrruuiushliu H 1- .-ff: 51 1-1 f V an a 1- - vuvrm il-gr ::.::i 5?-.E-E:-2'-2 P Irma-.1 s..z.. ..:.r.x .:... uma... I F' .1 -2-1 V -- - ----------- -- - .- - -----:H ----::--- ::-:-rms: :::::::::::::r.a::: ::::x-:::::::::: :::::: ::::::-: ::::::::::-: - .'::::::: ::::::-- x-'nr''-r:x:':: 'vxr'rll:'l 'I ' ' 'W ' ': 'R , QYY ' X x K Y n JK 2 figs'-N - . . , 1.4: x . , 5 . VC , ggi' -J .C-.J fol- Q ' F KELEWSSGE QMEMMMW--QHAWW ...., WI W., A .ff ggi? I -x- wh V1 .... . ....... .. ....s : 4...: . : .x .:.:-. ..... ... -.... . .... ... ...m.u. .... x.l.:....:.....:.:...:.... ' Div 5 V 5 ? Q Z f 4 5 I 4 V4 D N --A A NQ -N1 fr- P4 . 3:12 ,- -lllll 4519 Il? 1 . Mn vi! WH lT'.l Y 1 S Q S 222 X 'Nc 5 -6 Q, S Lrq. .N . ' ' sb 5---QVVJ. g , .1 . ' ' ,N -V ' f' ... - 5 ' -I ' 1 - V W- f-. ' 4 1' - X 4' f 1 gli- N '31-' - . . ' . 1 I A X -W A K -' , K I A k f , i h -' V f , If .Q 1 V . , , , V I , Q if ,ln I V 'al I' . fi 5- - I' ff .. k 1 I ,. ., I Q-e E34 5 5 . ,. .T Q f 5 , : if Q' .Q - 1 2 V V fu I 2 Nz f P Q1 V' ' Q f-6' l 2 f .,,,, gf- x V A f V f . S . A T XR It AR . V ,ru KA A xx . . ' 7S1me2i3.-. , . 1-G-nooaevf' V 'ioL'V2 ' A falsnewswil K If X 2 I J' :ff V ff . f.. V, . , 5 - 3 S X ' WE? QR Q A V if M J -I - N.-3' fit 1 -1, . ' V I V V.. E, . A .7 4 'SIX I K N Q Y l I ff 31 .-:CVLAW yd. .5f,,,cK,.efov.v , ,V ..n.sM-E I .V X -mv,,,WF19h VW Vw.. 1. V, ' - - . V W , -33' - W2 . -Q, - .' ff Q. K 1 7 - Gm- M aka ?5 f aw . MY' 'V 'ff4.-Q fp 1' 1 . : 1 . f 'N ., A ' 'W i, ' - fllawnsnuff '2 Vrlgunof' 1 , , f E . K . -Q' ' ..xf ,l isnvm ' 5 if FQ. ' ehvmfjnfi ' fgy' fm' ' ' .'- A f - r c ' 'JV' '- f - ' V- ' ' 1 fy' ' .:5,V 124, ff f 1 ' , ' V rf' 2 V Y.. . . . . M , ' ' 1,11 v , .4i.i, f ' ' . e. gm if . ,gnu 'f ' if , ' ' 'ADH K I-.7 A - if 1, l7's'R.'h'i?1sSJ X .h . 5, L . . ,V I 1 . -H .A.5.:i.:..VV.. 'i.V.ii.5'L. ' . - V, V ' - 9 G , xl A ' 5' , ...yy-. f ' f . . - - .-'fb 4-vt, '1 fc ggi., , .,gs'lf,gs525 5 Hfwowwf ..1, 5 . 43- 2 , V . . 12.1--l V ' . Q - rv j 1j:,,i ' il' ' ,. , . R.L.a,4u- 1 13:1 , K iw . ' 'Z'7'1x - I , lf' Vfiig? A , .M ' A 1- 'M V VVf V V in if 4 -ji g.. , fx :j,gi:N5:5.,. .I in W- 1- gf: . , -- V2 A-1 -924: . 3 .V - ' ' ,- :V 1 ' ff. fZ2'55f3?f:'1'SsEfi x ' ,1 1-1 ' 'f - VIH . X WV. ' -H f . , - 9 E Q fi sv -K V .- f--- ff , , X -se. ' R -A ew P l'i1'55f155KV9?Q-'fx' rv NUR H , 9 V I, W ...A V ' -R '- 2-T -I' 'i ' ' ' I giff. l ik f,'.Q:f?1 'Y 1 . t A5 A, . . I in ' In AV W f,, I, ru V. 16 in b F fzvmmfs A 5 A A. V,5.VQlgs4gAM5., ,... ,ls , L .. 5 . 5 A' A . X i f VVVVf,,3.v 1 ' lm ' - K1 V . ff' 'f '?f?f'2?f'f1 5 ' ' In VI . , V ' 5 ' -1,4442 A A 2 ' W Y - .. ...- Ji,-P61115 ,, .f ' r 3 ' .' wx 1 -Bcouzsfv H f . . 'V , K , ' 2.9 f-,f2f:a.'?5fQL?Mx5Y' i .f d .. - A '- . ff ne.. ' A Q-51 - , '?1,. , .E ' ax V., A ,V ' ' m - 2 if Li h ,- -fa J f-',' A ' 'If ig. ,X t ,M .S X A ' Eksofls f ' fl e A A - ' , - wr .V V -,V V V .noon 3' 1- N- . , 1 ,,. ., A V ,,,,, ,. W k 3, 1 : ,N .-If wif X .,. f , V Ulf' V' ' . X ax V f if. .. H 23 lfmfrmvuu flicnoviv- V . , . '- x .AAAA . -P , H ' , v - X 5: X . 1. ' fl S V iii H f., , V k xx A - -1' . ' ' f i - .. ...'.' w, E. - AN ' h gd - - ' 'flux Q X .cxeuNV H - x., arf ,fgqz V, Vg . 4 I fx? .,f f X Tfgiu Q Q A QQ. . V-q.SwWn. fa C -AN . ' M ' X . , , V. fx . W.,,.v,M.,.1...54k1.q, . ,5 ,ig gs. 'MPH V ., Y X . ,iv g A .JB 0 . - X , V fpxlgigx B: V .. . . - ' - -V. - .. . '1V41'i-.M 'H-HOLME5 E5 1-Aw 'c,.'ffV.,-.-nf' , I' ,f fab-wi.-V Qin' ,ggi X 501 X be ,qi A QW i In i K fJ99-zofswvsovswrnf ' ffffffb U ' 'r 1- . . MWA.-.!Mqb Lnoraan. K- Si' -am - ,Q ag, D :SRM X O V' I X-o f o -4 . ol It L Q ..-- J., ' 1,5 Lin .. , X - VV-f :---- , .a - :::::5g5::. 'N - 9 X L -n . 3 r VV U11 . L :K iv .R , . fn L X Q X' ' --V Q , . D 6 il- . , 'l I -. 1' p l A- N - . 60 0 N X .mfg mm um 1.lB1.lii1l 1 has -nu as f ? 3 5. 9 4 f 1 5 5 'mi 'N -1 ' If L, 4 1 E5 EQ' lb' V .- ggi YP. uw U mmf ef' Oi. nn 4 E S. N 3 E E 5. Q x 5 5 5 N 5 x S X S E 3 x S s S Xu S Q 5 5 S A nl Q., jxt4?omszQQ.mtsg.,xxxxxxxxxmWSxxxxxxxxXQxx' V ' lx , I qu E ' 'P x - - ' A , - . .--,II . 4 '5x'W '-iff-A ' 5' Gzvaovoj i f ' -Xi'Q a,,h ' 'A.',.,qA-. z '-1' , - ,., S ,P -- ,- lf.. I 1555555255iagggigiisnrgggggggggy:1:I:::::II:IIwxIsIl1:55:21IawsraI-nvImmuiamuIIIQEIIEIRLEES-.J -51, .... ,,,- .....,. ,.QiH.:.LqL1EZ15.5Em--,LZ-.--- ' mmm-:E ' 2-' ' ----f-- - A-------'- --m:: ' ISI A-gif' H2-212. Faisal ml 5 wx. .--. E IU 1 I E. D LV E. P I 2 L W ,141 --An, ' I :- -'S i'iQIlliIuli2R............. .s::::::::::::mr' ffff -f - f--'M-0- . Bk,-H Y. I - A -,-- . '-1? L ' - ' K' ' , A 1 3, . E555 A .., I N 1 lg EZ 2 N 4: I 3 S I' X, i S. J Alpha I au Qmega KN E ,,, GEOIRGIA BETA IOTA CHAPTER fi .Z N M 1 . Founded 1865 Lstabllshed 1888 FRATRES IN FACULTATE .Qs , PQ Q5 DEAN VS. H. EBIERSOX PIIOF. H. E. DENNISOX .N 'Q' R If NY -gg 1923 '21 . 5 JAMES DAVID :Bill-YWSTEIL LAUIIISTOX GIXEEN BIOORE, JR. I RODERICK STEWART NICIVEII, JR. RUDOLI-H STEXVART OLIVER, JR. .-1 1 ' : M .U 19241 'vp 4. L 1 ...fm FRED MONROE BALL IXUGUSTUS SIIACKLEFOIIIJ QIIIIQ FRASER CAROLYN LAW J OI-IN J ADIES XVI-IITEIELD, JR. -...Q W M- Hla is my 1925 I M ib I, 'u U19 WALTER I'IOLI.01NIAN ANDREWS BYRON HILL ICING, JR. l l Ov u T, FHS, RUSSELL LAMAR BALL BRONSON LAME 'll' ' .' GEORGE ESTES BARDWELI. ROBEIIT BEECIiEIl MARTIN -V2 -1: ...I VWI EUGENE BRYANT MARK XVILFORD MAYES JF M - N A 1 A XVILLIAMC MARVIN CLIFTON THOMAS FORTSON MURRAY, JR. Ru JULIAN BRYAN CUMMING JOHN CALVIN NrASIi, JR. XVALTER HAMPTON GODWVIN JOSEPH SHELTON RAINE, JR. FRANK GLENN HARIIIS - 3 1996 Q ' TIIODIIXS GIIIIIS CIIIAPINIAN. :DXVIGHT PALIN 35 FRANK BARTOW COLE, JR. J OHN PERSONS ROBERT ICILGORE CREIGIITON JOIIN HENRX' POTTS .1 .4 5' JAMES BOLAN GLOVER JOHN ROSS 'F JAMES BRIGHT MORGAN HOI.BIES XVALTER ANDREW STRIPLIX FREDERICK BELL LAW XVRAY BOYD SMITH NIACIDONELL MOORE 3 5' 5 I L 9' 507, 9-ox l .4 'f ui: f W V :S J N S. , ., . L ON EL K +A ':4'iiL!f'x .1 O Jgiiiiifr' ' I Lvv A X 5 ,FQ ,rx J' X o F ' O , .I O ' 'lv' N I -V s. -4 . 0 .-. G. ' ' I A IQ . L Q I - - W Ti XNSMbmm mm E 5 . 12 mwmgvmsxfzzmzxmmv, I . , ,Q L -I L 52 L 4 ' 1 I ' HL' '..i 5 ' A.. ' . .S ' J O ,PJ I 35, 6 c 1 z - ' -n. -. ig. , '7 .JF i liqtgfg, Af , l q K ' N. 'sf , w . . V.. ,V V 192 'V V ' ' - 'J :- -V .. '-S' . .- .. . . -V '4 -ff f - A . Tran, . 1:'fV, V. - ' V, ,, '., Q.: .,.. ,,,..,..,.,., ., V, H. - u 1... .. U.. 1. ..- .-V .. --,V N- - .,,,,,:,,.. . I 3H!nEI5ggiuEgnmEM?i,,,,,,-,gggggggmnmmg V lumVm.1 L... uw 1 1. ,u I 4 n an un x T In-,, my : ...-Q: ,T-:1H:L.1 a .VV V 3 , v w V ' sis. f' - I .WI 33 I I D I I i 3 .ai .af ' a- ----------:-:----'-----A---------:: -:---::mam-:r.:::na::::::::::nz:navu-:::::::::::::::::::u::::m::::::::::a::::u:::::::::::a. - -V,:------ --5' Ei 'umn:1i1.. .... .... an-au:za::::n:::.-.:.s::::s:::m::::a-.:u::::::n::::a:::::::::::n.1:.:::::m-.::::'.:::::::::::::.:.....:...:......... ........ . Ag' V V :'! ' ,V 3 x ' 7 f - 7 7 7 V, f 1 7 f 7 lg 7 Y ffffm ' ,fl XV , - 7 I VV ,,f A Vi I , ,V ff' ' rlmgy- VV fl, ,X V V ,I 'Lf pw- . . . +5 ' wfbgV,,X Lv Wi-X , V V V ' 5- f f ' X f . V V - V tw M WW V g aff: - Vein ff, V ,V ,, .... 2 , .V V ,V V , V V-. V a .1 ,V W xx l f Vik - .VNV My my fwgvciyxx I I ,I ' -.ks , ,, yx 330 2 ' 5' f Vf.' - f 1 ' 7 ' V 'w -X .',. 'X ' V V O ' ' N K SJCONAEK - 15, gm fi, 'f WQ,gf'1'c'l57 f' 'N' '.JE1T'? gf N WHVIIILLIF .V1 5 'E V V V13 VV f f ' V 9 ' V x ' I f -V , . A , .V ,iw 4 . 'LZ if' Q Q ' f V ,X V f ' ,Q ' :E z' 1 ' ' S' ,,fZ m,,V-V 5195 ' IVV. 'L V X Xa V A L -I f , ' y V ' V Y ' K xl ' ' 4 ., -,uh Wi V' , ', ' V ' , . 24' - S I M f -X -an 1 '7 'NV X' , X . V' V V. ' ' -Ufifjulfff I Wxxfig Q 4m,,,L .gamwrv f Z V V V A V V V V , V. . , V. , . VV. :XM 1: ,.. V ,V if V, ff, V N U 'V , - . F: ., V1 wig- f V, 2: V U VL V , SW: In sl V . 5 VV gf , ,' V iff , V g, A ,V - V, 3 YV, Cv il? V ' V H VV 35'24VfV2.rt: V1 ff'-' f +V ' ' V ' f- -2' f. -, K ip Y' '-A wif! ' '-QM? - 'f' N V 'V 'TIT' , .Vx-A V ,f-L Q. V . ' -V 'V f V' VV Vf 'ww V W WP :W V V VV V 2: x . l,f:f V I 7 V' 'Q L ,X , N. . V E 2 mf fx ' gf: .2 x 6 M I M A I x 7 I- V ,V ' ' . ,. .N I f . .VN VV RV' -V 5? 5: N. 'ww' ' 'MS V' 1 V, 'W-VV' H ' - V V V V ,V V , f V I I ffiflfi ff I ' M' ' , ,SMDL ,J FQ l'ff'4csxANT'1'l,- ,- 4mfxrR0Y? V- ' . ' V V,-' xl V ,ek , ' si V V - .. V 'V -V '-' Xian. ' .V V f VV 3 -' ' A V A 7 ' I VV V1 IV ff' f ,Q 2 4 ' ,. 1 ,V V Y' . .,u:5,gqV V, V ,, .V , .VXV - ZVVLQVV . V I ' noA If V, QV A V , Jk,vV,aVA V.,Mfy,v,, Q. W-VN , . ,A., Qi, Ln M Q V X , ., H f X SW lk V V Q V L1 X -V - Cfawglxuf V -' ff , f' V -' V V4 ff, 'f 'f Q7 '-llllll ' V I 'E ' -W, ' . -f V' fa. ' ,, t .ml ff Ga.vfemJr- f 7,5 7 J Vx nb v 4 . V U'L 7 ,, -' . f V7 V155 7 7 X ' W'u.sszvSv Q .-un. V ...nh V 'JJ,,V.-1-wk ,,., l,f .:, 5.1 1 :,,g,Wv, V f X V 4 Q ,V .-,,- ' h , jb Q 'mga ,, , ,V V ,V 46, VV X, 1 W! V ,,, ,f 6 , V - , V- l if V 1 V ' V A7A, v f' ,V V W' L V 114 :VV 'W V fff-QV 4 if QV V V - 2,1 .4 7 4 I 6- Q- V , ' ,- V V , ,,,A 7 cfm mg Z ' . ,M 1, m 'ZILMAA ,':VzgL!fL2 A 7 5 V f mg dug, t tk. , , lvl TQ!-,'f?,'511p5Lu'f' K - V , I I f VVV' X I ,V , xcnm ,f :V-71 7 if ' ' V ' f 'V-- X Q A , 'J M ',':r3m.w - V ,ff- QTf,Q..f QQ? I ' If 1 lr W N ' . 24' , V V. V -- M. 4 xii- i.. ' ZVVVV ,sg , V 1 V, V, ' ge V 14, V ' VV f 7 ' 1 , fi' V . V VX , Z V, .V El i :YI PVEVV.--M J. V, V XV z -1 44 ,VV -LQ , S X Vv'f.24nLmV f fvfibw' , . , Mm? , , ' -V Q X V1 5 f ' f' VJ f A V4 . Vs ,Vw wi Qsr1n11VV.'f'- 22 l'i9 W5 B A. 7 Q V' ' ,V V KV' g VV , V fvwv mra A f' ' . ' 5, 4 7 V V f ff ,V V 4 wiv Q , ' ' D , . V V Gwyn , 54 ' f',- .QV ,f s ,V . H 1:15 w..w ' ' 99335 ,V 'f,,iV 5 X 'Q in I ,,VV H ' ,I :V ' ' X - 1 ff, 7 1252 ' fffj N X X-V , 1 . V: 4'0 'f'-' VV . Wg, V 1 X . N 1 ' 1 V 1, 'f 5 3 , I H., .2 X, . 1 ,g gk 5 K - 6 5, . .V .I ' ip 2:52 Qi' Q 15? ., 'L :fig !g.g.VV , . r , HAM: J ,. Jr V X ' 2 'V 'f ' Lf ,,w2fmPiV1f:Z,xj f :gf ' N ' 'z :Vs ai. gVi'7i-'15 X il V27 Vf ' V ,V V E N . V rs' 1 7 JV- V ' ' .K fe..-5 X fir' 4. 'V V :nv V ,X N V, - . f'ff1,m-mf X V , 17-X .. 'zmmimw Q 1 V. V f' Wbxlcfamf Q --.V ., ., N 5 N S S N 'X 'X i S N . 30,0 ,I '-A 1, QOQSSX L 'ref' Q Q' - ' ' V 1 i ,, . 1- f mw 11100 iqo Q S .. AL money. K- Y xwfisagm ,hi p 'Q LX ,JW fp ,N N 0 P' -V X U . Q2 0 , N V ff' 'V 9: V, -V, .,QgVV V 0 V--1:--4 .A , -A -4sV2zeeg.... Q V meg? v 1 T I 2 Q V V WQWfAWMNhE2bbbXNX'xKmmwxxxxxxxxmxxxxN ' ' N I ' L 1...::-- ' ' ' - L' Q ,W , T' i O 1.5 ' 5 . . f .Hxgw U Y n 'xV L' A Af' DV WV5 ' ,V 4 - YQ! ' SXXN5 'XXX XWOG. XXNXWRYQRYKK XBXYXYX YBSSA NX Xbbbk X. 1 E il' llll ka 4 'Wu AQ' g 1 7 WM 'gf-'I227 NSESSSQ4' ,ffiffla67!lWfWllIf!!lHAQ'Zf9?I! if I ' lv-:-A-3 - ' . .5 - 4- '-. ' - , ' , r 'f .' viii -' 32222215375 1:1FirmIilIllImnmaxlsfu-in-nm4n4IRI'EExIRsamz -' .-QSLSJ' L:--11 I r- . ,r f 'Q-1 1- -' .... -.. nf Ng, .--.P-A : - 1 :f ' ..: ::..-'--'-'- THE V 1 ' X 'IU gl urn zz: in S ' A- ' I ra:-1,1 T 'IL ff- 1.14:-.Max 'ix I- -. S G 1 I w -- -T '15 ., W LI 1 1, M U Q ligllliiltlil-.. :..- , a::::.::::::::: ---2 +-- A -V---- ,, I V I , ,rn M - It -VAY r :QL 1 Q W A V421 X W EN LIONEL ,, ,,, CAE' 5 IX X 1:51 M' 0 - 2,25 I f 0 1.'.Q ,. N. 'f I Q 'Q S' Al h ' J Igma p a EpS1lOH A Tw N Sl GEORGIA PI-II CHAPTER Founded 1850 Established 1889 Q N N 1923 DAVID IRENUS BARRON JOI-IN FLETCIIER LOWE JOHN VVRIGIIT CARSWVELL JOIIN JOSEPH MCDONOUGII, III S SAXON ANDERSON CONNOR HEIKBEIKT SEARCH' MCGEE WILLIADI NIERIKIVVEATI-IER HILL, JR. WVILLIAINI LLXDIAII PARKER WILLIABI STAIIKE JETT, JR. :S 19241 N f U WII,I,IABI BELLADIY ,ALEXANDER BROOKS SBIITI-I LIIJE . A JOHN RANDOI,PI-I ARMSTRONG VVILLIAJT MCP11ERSOX BICIXTOSH .L 4 HENRY BOROBI CROWELL, JR. JOIIN FRANCIS MATIIEWS A gnu EIOVVARD ANTI-IONY FORTSON FRANK OGDEN VVALSII, JR. ..,,,.. LAIRE ALANSON FRYE 11 3 :Wea --lg 'ET-E15 1 , IIB 1925 W e WW lr, I R25 j, I CI-IARLES DICKINSON COLLINS LEE NIOULTRIE SESSIONS ayg, W JACK GRIFFITIJ LOCKLIN WVILLIAINI FRANCIS SEALDING, JR. u p . . , In ARTHUR BRIAN MERRY NORX'1I,T.E FILLIOTT XVILSON yi' GEORGE GARLAND REID, JR. 'I ' ww. 1926 6 CARTER TURNER BARRON JAMES MONROE MCCATIIERN WIIILIABI HINARD BRYSON GUY HARIILTON MERR1' if GEORGE WILLIABIS DAUGIAIERTY IXIITI-IUR ALONzO MOORE, JR. 32 JOEL EDWARD DEAN HENRY DURANT MORGAN 5? 3 BARNEY SAVAGE DUNEAR CIIARLES SDIITHQ WII,LIADI ANDERSON DUPRE LEROY AUGUSTUS STAPLES .2 ji FRANK HUNTER GRIGGS WVILTJADI GRIRISI.EX' TAX'T.OR JOHN CROx HALL JOSEPH WVARREN TURNER PEYTON' SADIUEL HATW'ES 'FI-IOM'AS EDWARD WVALSII fl Q MAI.COI.1SI BENJADIIN HUIE IVAN ANDY XVIl'.I,IAMS WII.LIADI FLEDIING LAW, JR. ORX'AT. :EVERETT WVILLIAMS ij 5 MATHEYN' TIi01!IAS MALONE 37 6 2:5 3 -5 5 9 - Wa 39 Rf? 2 I 2 5 , 1 ' v, . 4 r ' 617 Iv +G, 0OQ?.,f4 ku -. AAA A .IAA L A A iuiflfff I . SCA! Y I f-. Y fx - ..Nc-ASSE-rfipmvvfrfvotwQNxxN'QSxmxwxzmrvCg4zo:-:-fx ggi l:ii:2:1:LwYfoQv5-QI-M12r-2:I:Q:I1212:1:44-Z-:VA5:Za26ammw9ww9xf '- , gs- v A , VN L .. ' QI 1- A Q N., I I I O '-4. 1-, ': T '4 - v . -- X Uv.--.V -f,-- . , M, M4 V W 1 , ' 'A -'12,- 0' f ' ' M , N x ,1 A I ' . D V V V V ,V V V11 1925 'X VV V V - - . . .. ... 1-.'I -'N .. V' UP ' - 5555 Y A ....,'i'.R. .-1 '53 ' -3: ,. V1 355551igliiigiiif:zxgggliggg5::::mans:mullIninitwiliiln1usliri515asuinailxInmisxn!a4m:1mf:::.ffuw-ei---211nm--1M1-1-V,-.mlmaumm1111:1-111Iw-numunu-r.'-,mV 1--1:11,-:-n----.xaummm--Hummm-um---w-----------------m-1-4.-1mm-mmm-umumum-ummm: 1H5n4:m55,g1uud5gEi!miE! 553: ..:.::1-LT .-uzlqg .mn -'!..., -.T E. IV ' H' 'M 5 xz. 1 . 1 .1 . wh. 1' I 1 fy '1 l1- 45 !3 ::. r I1 4 W 5, 1 ' .EEF Z1 U 111 .N. 111 '11 .. 51. gwg-!zluum::rx........f.i..... .f::::a::::::::::::::: .... -aa:-.a:n::::aa:::::::::::::::: . ::::::::::a:::::::::::::::::::::::::::::::::::::::::::::::::L':::::: ..::'::::::n:::1ma:::mmm:nas:::::::::::::mu:l:::::::mu::::::::l:::::::::::::::::::::::::::::: -:::. ggg1.....i 155552 . ' X rg' 21 I M111 ? 4 9 f Z 7' - i I ' f QI, 'Q ,ah ,KUWVZ ,,,' W, X f . M X X 4 .' + V, Q, V V1 X V - may VQVVfyMQWQQ,6yZf,VjQ,wfQyVWVVKMV 1 '. - 1 51,1-XV, V V 'i ' -y WVW,Vfy,V1'Z?Vf' 1 :fy , ., V V, Y 1 WMM WVWwQmfW, ,,V, ,z , -. ,. V. V .g Wg, X , , X' ZMVVVWMMQ, ff Vffj V '. ,--'L 'VX 5 1- yif,-V :VX ,g74,VwWMzryz7V5,VfVmg,' , , -sa -, X , . ,,kk ir 131,25 I I K! ,,.. VV MV. VV,,WW6yVV,W4WVfyf4yfWWVV! Q' ' X V '--'. V ,,'.. - 'X I WTV4 VVZVMWJZVVMVW 5 ,V m.,., L XL,,VA 4 ggwigygx , In , 'X . K I E LVVV1-VV,1, ,,.f . if ,K ,V . V Qixzq Vi, 1. !!AXm.VVVV ,Vw V , . X - -- a A . ,- -, , , ,1 ' V, , ,, V,f f , g,V.','11m-V Vf Wg ww, V0 V!'fVfV 'I 1 5 XNOSSVX A Xu , -- V' 1, ,XV -, 7ffQ5f!Z74WVVf :2 X .VX' X 1 VV V V,XX'VXV X . E V '12 VX1X X' V ' 1 ,.XX W 1 iff ' . X V V4- V 4 , -V, . ' 'K.. 4 Vp- VV., ' VXV MW V ' ,-I fVf,VVf',V VV ,' Z 'K' ' w w? , V J V,: ' '--' of HY . - X VX , V VX ,--' V V V ,V , 7 V,VffV,Vf',,VV , V .A .vV,g- V QQ., V., . 5. - V , , Vgyyj, V V H V, VV ,VVV,,VV,,,VVV,! . ',-- iff: X 1 ',-- X V Q-1 ' 'VV'1V,v' 4 X' 1' gy Q Xf X k x-:VVK ,, N, 'fu , f '3 . ' X 1' 'CVZ EL' 95 5' V' W V4 ' XV O fx f , V Y -VV 'l V, X '-.- 1 5 , VJQV, 1-1 --V V ff, ,- f 0 i, Y -'-- . :41 V7 X',, 9' K -L., f ffl f X f ' of V 1, ' -X Xb.. is X X ' I OWV ' 'V f iVf,+4hfz1 m5b14 i 'ffRR9f3 VXX',, f fc La+If1cZV X -2 f. 1 -,.., . ,WW 1' - - - V' , E f TWV .0 ' f , X, .'V, -' ,. X-', V -V 1 -VV, , V 1 1 4 ' :E . L-'V'- X 2 21 f V . V ,V .VV',. fa V :- f V V Q 1,51 f V 55 .0 X' , 'X' ,V 77 1 , 1 f'-- V X! V-'V1'4iV'ff 6 0' , ' 2' ' f' A f WJ 'X' X - V- V- .' ' .r f 'fX 0 X 31 A f ',-h' X X W ease 15 f g' V' ,Vjf , ,Ulf V V 'X L x l5229 L 4V ' f ' V X L , -V ' - ': -X VV.- Z 5' XXGJSXZ., ' 551 5 7 X 1 f 'fV- 1 WSXX' V 7514 VV T -1 HH., V V V 'V,f '2Li'Xf 'V ,, H5 . L S X ,gay 'V 1 f f1VifVfzg2 1 1 I LA,VVk, 1 L,,X., V, b,.l H, ',bAL. , ,Q , j Lf V- 7 V f 'A-'V--V 1 , , . A W, ' V if ' V X 5 .,-f'y+- . -si 11-YI if , '1 -X ,ffm 'Q N' ' f .Yi V 41 5 X ' 1' , - V, V V , , ,, ,, gvwm ,m'X V, V 1V42'3riDAv15V XmV,, Q,4f'tffX1f X 5 'EI 1, fad.-.1. ,A . , 5 XV ,V..' , ,T',jV k',-,X - V KKVV Lv 'xggfiigwg V . gzvgy SJ, l ' . X'X VX,ws,V1i3iZiI2?15zf1Z V , 'IIIIP ' ,f a ,-', yf . -X2 , j..'wVzfef'1ZZ.z-,1wifes, f Y-XVJ-XVV V ' V X A 1 I in 3.,rf': ,-X' 507 - -f.' ,J Va :V-f :f?4f2X ' XQVXZJ' QU - . ' -V V ,1 X V V+ V U Y 1 ,' X L X H mu V 1 , fV V 16' X f V V- 4 ff 11 1. .X V XX,,1 X V W '61 9 V, .Vf -'lf' -XXJVQUQSOH X VX X 1 ' V K ,, ..,V , .X V, .,-' EX- ' 1' XX ff X,X'X' ,- Z- 'f 1 X 2' V54-,W 935' V V 7V'f1lCX'?f:7i7V Vff,5VX 5fV-XX V fx ,X K .233 ,Q ' , Q 3. X 'YQ' X'5,V,V-'?if,LAPfis, ,.'- n kf1V,1Q:,X , N 1 Q A ff, XKX' 1 5V .',- VVV',V V- - ,X ,X ,,.,,.V,,,4,fa3'1. V fgX1,:5LZf!O,-,a, Q1 Q X A. X13-Q H Q X VVXXV 'VV.' 'V,X XX.. 'X X' X 1 A ' ,, I, VAVV TS!Xi17.XXZXif 5giR,X'Xfw' -X 1, VVVX .V VX , Q ' X ' 'f ' , ' , 352' iX--S' , I . x ,V ,.,, 'V , if X. - ,X ,sX,X, X - E X,' '.XL L, V XXVL V, L V X?2:1x?gO? 'UN' A S .- -. V 'XL'VX'X1 fff3?1,l, X2 V- ' J I V sax . XXX? E551 EL -7 1 ' 5. VV 1 5, K. .VV,VV V.V, , Zh, ,V ,.kk , K ffqpv K .kknk S is ' ' VX fXLfLlfTC?NXQ:fX S - V' X,-' V, f'-' XX ,VV' X VX,-VXXX.V X V Q 2:12 ', ji ,, 'X,',. -VX.X.V 'XV ff-g :Qw i X V ,X , N X ',.' ., VX.X 1VV1VV V XV -' , f ,V VVM V Mm, V N V wx. V V HX 'wx-'z'V.p 1 3,30 , fu XV 1 ' ' ,: 1 -- V , Xv. :X X MX XV, 4-af: , ', X ' V - 'X,. V 74 f ,VSV ,' , ' -'-- 1 V, Vw , 5.393 I , ' .. -X :V .,X. , VVf1 . V V 1 . Q 4 'fz,,,sVVA. V ' 'V ' wi 1 X E X -1 XX, x , V , 5 fky, , N V I .ff M! V V V .. , Lax Qt. lx X Tskung . . . 'Q ,. . . . 0 -2 . In . . O . 'E . 'Z . . . . . . . in X 1 I I 1 O o 9 We V I 45 'rw S i.K'OQT:LY K' le' 1 V . 'fn 7 V f 1.2, 4 4+ V- Ax 4 X 5 ' 51 I pg? sm gf' V. I A Xf'1ua41fNvV , T x Y3w?Z4v N f6'Tk,.,,:l U N . 7 E Vw N. 15 X I',v:.qu XJOQA f LK Yes? J O OQ9??fQ ' Q o Y If 1 ' . , xx ' ' XX 0 ..::iH!i5A ' ' 4 V xligmq kk ' wk 44 L is , 4 ' V-VM -W , f Afw K V M Lmngl, K, '-:S Vp ' ' ' , W xxxx' ' qgxxgggxxy - . ' W X 0 i.....,.,,,,m W. Q V, 1 'Ig Q g V I NM - 35,1 5 ls 0. -.. I .., N. mann- O -- - W, ,-. iw rx .V R . .V K -- my V10 -gl ,ff K 'Y , 1 D wg.i..--'XO ' V31 l .53 ' L 'ae 9 1 I 1 1? W V2 if 1 fi O 25 -I I .,4 'B -W fp P 4 -11.- if X 3' 0-I Q ,o gf 'W 3 If 4. 3' .11 111 I rf I 5 H : '1 1 Q11 9 7 1 ' r- 1 ij M113 1 2 4 IIII, ll 3 EE .V 1 W X lk! EI it 35 3 N S R E S S E S Q ,SQA O i LKO1 I 1 ,hi- I A ' I F . .Q , - X . .IM - ,Q ,,-',:-. . If ff -I iiiijflilil-Q1-QQQIIIIIIIIEEEQIIISInIm:mmIIIIm?aIIlwI QE2'I?sQm::fmI--g i-I-A-A-5.14-Lua:sllZf1f ?,?ALI.f,..Z.,,.v --2-: f f4 :-- .,Y.., .f.-...-A ---- .:-r- , 2 . 2 ....- .5 if mg? ' 11' ? 1 E . -al IRQ, I ..-5 .. A W IU I 5 Iealh-:Ilia-.........:.a......a::::::::::::::m.. 'gf 1.11 -VM - z:..'-zxg,1.:I:I:qE- 4: . Y Y . ' ,,,..... : . zz' I A r I ' E E S 5 appa Igma Ns K S' A ., APHA TAU CHAPTER 5, F 01111560 1865 Established 1895 K I A I I , FRATRES IN FACULTATE E S COACH VV. A. ALEXANDER DR. D. M. SMITH 1923 lg I JOSEPH JADIES HII.I, DUNCAN SINCLAIR I I T1-IOBIIXS STRONG MOSES ALEERT HADIDIOND STATON 4' ' .Q '. 1924 I EE :Ilia XVALTER HADIES ALLEN JOHN RICIDOVVEIL NICELRATII l b PAUL ROEERTSON DAVIS ' EDWARD GRAITAMT NIERRITI' 3 '--I I , JOHN THODIAS FARGIXSON FRED BECKER MOORE I-Q11 'l i' RICHARDSON :LEONARD HENI.EX' JOHN CURTIS STATON 6 JAINIES BAxTER JARRETT JAMES HERBERT TAYLOR tum' fnnf, XAVILBUR ICING RICHAKRD FURMAN XVILLINGHADI TIE' :QQ nog JA A 1925 I 4- ROBERT HUSON BETTS XVINGATE JACKSON' 'S DANIEL CAGNEY CLARKE FREDERICK DANIEI. SAUNDERS CHARLES FRANKLIN COLLIER, JR. JOHN EDWIN SWAIN J JOSEPH BLACK ELLIOT MEIZCER MCCAXT.I. THARPE J HERBERT HUTTON bl 'bl ,. L4 . 1926 I COLLINS BIRD MOBT.E1' SI-IEPPARD 2 XVILLIADI R1CI'IARD FAIR GIVINS BROTVN STRICKLER 4-- 75 JEFFERSON ERNEST :KIDD TIYCKER XVAYNE Z THOINIASL CARROLL MAX' 'XVILIJAMI BRYANT XVOOSLEY - MII.LS SPENCER SAVAGE ' 9 'J I If 5 JCI, , x I I. 1 DWR L41 ...A.. A G .... IIE. 9 X ... .... A A A 1 SQ-. 9 E fx 3 QF NASQQANWAHQEEII-rzfx:gQ::a+:+na:1nmNmwnmw L 3 - ' Z , ' Q I ' ,gl LIONEL R. ' Q s'I'::2I55!nn -'- . L' .iisss:f: ' A I-LVN 2 :MGX J ,fq o P ',. W O 1 Q Q 4 ' P '-T I G! N ' I 1 4, .E55::,. M 1 o , .,f ,.,. ,If Ae' - - ,,, '::::::::.., S--. 9 1 V 1 T A ... A.-A A ,I X ..,5gL 'V-Q. . . .515 r O 1- Q I - ' O ,.,-.X-X,,,-,,-,.. X- .,g4-X' ' ..-1135 .I . gil x 1 Eliiiiiiiiiiiiiiiii niiiisaamlmliunnmulnmunmxlun mnmmamunsxunauuuziimgimn...1gaI1'S 'iS1',TEL1-mnQ-X--X-mid.1,111111111111-.253513111111.-1-.1XIff'.--X,11.1--11.-:1----m111-- --I--:ii-Iii...f.s.1a1:---5522.314 3' . nw. md.. -.qua 1 1mumnumumm'unnnmmmnmuummum 1 .5 I 31 um ui-' 'Q 4:---It X zlngffsi'-i'uuuf1!f:!l5 '5::::: I D V E. 1- 1 ' ' 111 N11 .1 -' 1 11 R , 111 H11 E1 :'m1.1 N - ---------- ..... . ..... ....... .......... .. HW ' .. .. ..... V . .:m.:...... .................1..::1::1:::::r::::..::.::::::::::::::::::::::::::::::::::::::::::::::::::::::um4::::r.::n:a:::::::::::::z:::n:1::l::'.r:'.u.r::l::::::::m:r.a::::::::::::::::m::::::::::.,..,........... 121. ...iieysazi , X, Y fy :ff M ' f 5 P V 1 ,,f , 1 , 4 7 4 P7 12 ,ff 52 , X V , X gg, ,f',, V f , ,' i , 'ff -' if ' 1 7 X 1 1 f' 2 V52 ' 1 1 , , pf 1. ' Xb, , I , 11' 9 ':z1,,vg - ,X X 19 f 1 ' 5 , , 1 ,, ' fl 'Q , 1' jf, f ,, I. 1, ,,y,,X,:X 'X , 1 1 X1 X ., - ff! ,. 1. 1 f X' 'XXX 3- X K f J 1 E, J , ,Z fxwfi, 2 f 1 ' mf- uf Y , ,X1 1 1 N 1 , ff , X, , ff-'ffX'C?5cj1 '. 'ga X X . , q , ' - X L-'fzzfwfz - ' 7: 1 X' 1 ' FX ' X , X , . , 'XX ff , f f ., a 1 X A . up ' ' ,X-.' ', , x , X, ,N ,gy ' If 1 ' ' 1 5 A -gR'MUR0 761 I Zi' EQ' X Q, I' , ,L Va X ., ' ' ' ,X ,X j ' . ' 2: ,XR I .VX ,Q XX H f :O 0 YM'-zf',i'wf ' X 1 X 5- XX f ' ' i '3 Zo, 1 75' f 'X f 1 ' 1 1 'X 1 .' 4. 4. f 4' 'S Wtiwf-15 , , , ,f 1, jk!-7:2,f Ig o 5 f ,f ,, 1 1 5 . '.X ' -ff X-'1i,g3v,XXfz o ' 1 ' -X ' X , ,f , w 1?-1' 1 12' 1 f f 4' 2: f 'X 'LX Xi , J ',,'?7f5 ff :I :Z X f ' ' 'fl ' S' ,Q , 72,53 ff 17,1 ..., A - I .X X if451,f5fCXg,gjX,k,fkfzXLf : 'Z 3114 1 f,,,Q5ii4fX,?if5fX , ' X - 5 . X ,141 1 1,541,113 - X UT, ,fb 3 K, K ,K 1 4 X f ggfjfhyf, f,,,31,,3j', f , ' XX f , X X' X X f 542255455 1 3? ,Z 1 1 f . +2 1 X y',g1-XQMX ,zffswgl ' .X -!1, f1 1 , 4 ' . 3 I X 1 , ' A X ' f '32 1 11 1 A f A' . 'Q W 1 - X 3- ullllf ' yff,'zf'afXmff Xf ' ' M , MH - -1 'fr 1' V -1 , 1 ' 1 ' f gy, 1 1' ' ' ,xv':f,w'X'p,vwyfXf:XM? ff-fy,XfyfAXi,f - . ' 1.33 ,f , QX-'f-11.ffQ1f:f'fXQ-XX f' f ' ' 1 4, wi 'X4ifwXmj,iv-ivdwf-'mfivyf' X X' 2' f' ' fr ' - 624fX'yZ4X6ff 'X1,, 2 fXX'M XXX' QXX ff r .1-JH ,f fe- Wi?11-57:ff'fXfffffXz:'XXa'fX,zg2X-wi z z: M ' . gX X X 1 XX2TfX1:4X',-1 !',X-fXfX 411 X' Y -, , . X p 1 XX , X FQ ,'Illl', 1 1 ,f , ,WAX 4 X - 1 ww, f. -MX Wy XXf,f.,fl.X ww 9 -Xf f 1 ,. 7 9 N X, ffXyXfXgXg1,Xp 'NX A. , 1 1,-,411 . ' .f 'Q j X gqfygw X-WX. . ffffa- ' z ,:- T iff ,' X , 1 'X,fX fig fi. ,f N- ff-Xzf f v 1 A2F'fR1g5X4 41? 2-,Q-A X X , -mf! . ,, ,X 1, W . , ' vw P' 'X 1 1 fma' . '- 1fXX,ffXX-'mir-Mwf pw . My-A X1 .1 X. X ,X , X 1. . ,g,qf1f 6, ?X,g51,p11gX ' 5 of ff . X A , X 1 . S X V' j X 1 ff. 1, ,X ' ' 'J ,gl X, ,,., 1, X1 , f'gg2y,,X,f :jg-2,7XX,?2,i91qX,,yf Xf1!fXX,j7fXX372fg gf .,5fz - 1 X XXXXX 'E ' X' , ga, , 425142 pr ,M V 'f 11115 , 'M , 1-v1:X'X,jXX,X ., f 1 22752 X 'fXXVi, x X 'XXX' X ' 3 ' u . ,'VX1Zz:vet2'iP?YXiH1 1 N f f-wfX 2Q-1i.f,-na ,j,: , fy Xf,1.f,1wX V - ff, , 'W 1 X 1 15, 1 , 1 X, 1 g X W- vi,-4.-XX: -' 12,1 X ep--fXn,-VHWI N-1 f X X 2 XXXSPXX I X EX f ' ' ' ' X X XXX 1 ' X ,,gXX 1 , X 1 A X -. ., X.,X- ' 1 X X XX X 1:1 N. 1 EX X X f, f I ,fl X51 f,i,XgiR 1:4-AH: Xx 5 X 'W N 1-1 ' f fff H X'p,f'5 ' Xfffl J-f'w'wEi X:::i:.f ,X-21? 2fX-':WfzM -X2-QQX -Pvc ' XXXXXX ' ' f., ,, ' 4 wwf 'Xiim-H, ,X ff X1,XfXX,-gf , -XX' fl XXXXXXX ' xx X X Q ,uf RX ' 5572? ,ff ,a 1 A 'iw X if Q-M51 1 E 11- f'w4fX1X:X'f 4z1X'7' X. 1. X, f 1' Xf rag 'X ,' f ,f , -:XN X , A XX X 1. XX X X X31 ,X X' 'X 'f XXX XX X X 1 is ,4,f,-,gg-Xf X R 2, v.g,f1a5:,X,,-X f. fY yfgg,'XQf --1' 5' 711- 5' X- X X ' Xi X f f '?f 'fi5Xf'i,X ff xXgi1f,f ' 1 1- ' 1 ill sf , , 'FXXQX x X 5. M ffQffX',f XX - . ffyff,21fy59fL,,'ggXf,-1,14f -XXQTN 2: asf QE X X Q 1 f Xzaliii 1. '1 X215 ' X X ' N f -X ' 1 X X. X XX X S 1-1721 , , 1, ,, Y . 12,31 gy, M A , 1 XX,-X XXX - M, , K N -1. ' X107 1 , Wy, 1 I XX 'X XX X ,, 'L ' ' X X 4 - !,,,,,,frmzpfwwffwsm-:mai .' H ' X N v'm,f fzfX'ffMfX' 1 1' ff,X'1f'Cw1f,'cX,v: xf wXf,wfwf ' 1 , 5 XX:fX ,XXv'4XX1,--1X1:f,i1XXX1,XXX' XX X X , X X -X X vita X 1 ff X 1 1 X53X'ii1X5XgXX'X!?9SHUFWX S W XXX. Q f '. XX XQx:IXX,f'fYXiRiffXX X1 X XXX X fXXXliX N ' f f'2Xi1 1 f XX'-ffX'l'iYSviX'iX X X T -X 1 XX X i x X X XXX X C : X12 X955 N A X 2 X f fffiiif' f f ffl X X ,fl ff 1 ff gf J 'X ,1 ,ff xv ,py f X1,'1iXjXi,y 'X ,153 XX litxg XX ,X , 3, ' eff X 255 ' X' XS XX X XXXX XXX I . I I 4 I 7 KJ o ,,Xg,::XXCffcX 0 X 1' Af Q-Qi .11 1 l X 4,g,!uhn N S XS :ix 51 N 45 S, 15. S S 5 S N X Xf299WQz4aoww:v f XY 'X . X , ' - ' - 1 , U vi - X 2 X - X-, X .X V, I LSA! 4111111111 75-,NOX ,,.. .WA W 'N ' LX n A .,,bki,Q wx V W X 1 X X X -X 11111 ' NQ XXX. X IQ Til JS8'f?0'29' ' K X15 ,. ' X1 1 X N X-1, Q W .I E, 5 I X I Of, U ' f X XX X -X X if , .f ff X f N Jdlhfl' , 's sm ' 54 ' fi '1 , -All -W v VI 1 4 Z 1 1 1 X 1? 1 1x ,N 1 1 -5 gy, 55 X1 11 no o I 1 W . ' 5 1 1 Mk ! 1' i 1 .3 1 114' I P' 1111 1 A J 1111 1 my I 1, P 4 -4 ul S S gk cfs X XE 1 I B 15 'X 3 5. S 5 E S X1 S1 E1 Q1 X N LlONl xx. 1 1 CDLVE: ,:., - A, . ,f -- gg!! N I lm malls:-rss: ---' mmnumusawwmnsaxesms.'4I....-2.'arm T... ,,.,,- I, ,iu,,nH pm.: . 'w5fE.-,L'.,,.. . ... -'-- TZ ' ' ..-.. . L..,-L.....,. ..,..,,.-,,. ,,,,,,,,, 251, ,mmm ' v X vu- I 2 T' I L A , . I I I ' llHllI:i,,,.. -. .a...... ::- .-LIE, .... t , ,,,,, .. gig-:nm 4 . i V 3 - V , lg., V -, A l--W-VYV, fm-1 ' u h e 5. i f x , I R x an-V ' -I E ' .1 IHIIIAM 7' 5- 'f 'F I 9 J I-453 L Hu lc a hw ' I ff 'am 1' .I , .- X W R I . 4 .12 A o. 4 .0 r 4,4 21.- 62 1 4 24 1' 4 0 I V . . 4 . 'Q 'Q Ig. Q 0 4:4 5. 0, 'o S In O'O ,v I . 9 . 0 Q 4' 1 4 Sigma Nu GABIBIA ALLPI-IA CHAPTER S Founded 1869 Established 1896 FRATRES IN FACULTATE NEIL MADISON LEWIS CLOUGH FARRAR GBE Q5 1923 TIIOIVIAS CHAINIPION DREW, JR. ' HENRY GREGORX' GRANGER, JR. l I EDMUND RICHARDS MORGAN 3 JOI-IN FRANKI,IN MCINTYRE, JR. A M : . 1924 ,253 WILLIADI OSLIN BRITT, JR. OSCAR LEON BETTS, JR. NCQ CLARENCE DENICKE 1 1925 ,, JOHN ROBERT BRANNON LENTON CALLOWAY CARTER SHERVVOOD HIGGS, JR. HILTON ECHOLS HIGHTOWl'ER JAIWIES DONAI.D LEWIS JACKVNESBIT MARX'E 1926 , GREEN FLAVIE COOPER, JR. ' ARTHUR JOEL COPELAND Z ROBERT KANE . CLIFTON PERCY ICING, JR. ' ROGERS LOCKE FRANK MOORE 'O SADIUEL X7ARBROUGH PRUITT, JR. I Z . , 5 5 . 41 0 .ICH I ZX wage- , O N JOI-IX LEE AUTREY GEORGE HOMER PORTER, JR. JOHN SCO'1'l' THOBIAS, JR. CLEMENT XVALKER XVESTON PIAYXVOOD SHEPHERD HANSELL, JR. CHARLES FRANKLIN RICH FRANK NEWTON XVILLIAMI WARREN PURKS :XRTHUR VEY XVEAVER CHESTER FREDERICK VVILSON JELISITA JAINIES XVILLIS, JR. XVILLIABI HOWARD STECKERT RTASON' DECKI,E SIIUIIATE XVALTER DAVIS SKINNER OTTO LEE XVEAVER STEPHEN DOUGLEKSS VVYCOFE THOBIAS IATNVOOD XVILDER SOLOMAN JOSEPH XJEORIAN, JR. 2. -fl f E5 Q Q N I N I-3 S: S I N N ES S N K is 2,5 N 'M if n'- 8. X35 V W L T, '51 lk DZ PN . . R.-. X. I-iv I-C1 .gf 'S Fi 5: '- Z4 7 52 45 1-2 5 .DI -:P :E P? 2 ,. 9 9 e 0 gi. .4 fi . ,P 'Pe if 6 A . . , . LIONEL K- Q H ...Emu 45 ' ' 4 ' , - L ,-W X1 QT 2 J ,X O , . L , 4 I X ' A ------ f . '-'- by ZF' ' -- O . Y . , ,L , M .- pf v -, 1 AWXJJQWMWWKKWM 'QSO 5: ' ' 27 Szwaaxwwoc-sw-xc-:-:-:ruarn2444:ff:rfg:favm'wmmmf -I , K+ O LI N XE H... ' IA . f 0 I O o Fw,- br goto Q I q H5nxIgi1- I. 'S -: TAN ..,.,.,,,, ,f,,,-.: ,:'f M Q: '- 1-.-.-, I' ... .41 ., ' ' , ' ' -, Q '- ' '. , , I-'Z I- '- Ei'E EEE ':EE2 EEEEEEf2 HH' 'HHN!!!illHi-imlliil'lIHl'!Hll!!llliU i'illmi.IESHTI ' . 1, '- 1Zf.1L . .......... , A - - ' ?7 . ...- .. ' . ... .. .. vi -A -- ------ .- . . . . . -, . , . .. . . .... .,-.. .. ....... .... . H H , U-lmuisgsm-Egg: , 1 f I I rw Q' x , . x ' .I ' f X 1 x f M g 4 Cf'-:NNN I lv, 5 -D .2 4 xfxqsx N 6s-2 I X f -'Saw' 7 . IN fx - ' UNE' gig gn -g I dw 1 I un I umm:-.m mn. ax: n A u 1 U nu 'I' 1 1 1 mmm ' ' X X W I 1 1 I In m an u In 1 nu um I I In sf 1 mn-mumlml-ul, v- 1 mm-I--mm mmm mmumunuuuamuu ng 1 bu n 1:11- In 1 .III it X It in nw .L II I' I I II:-2.551 .. I-I I I I -'I 5::- :II II 'I ..i Q... .... s::- :::::::s..-..- ' ..mr---- ---.-..-.................... ................. ................ .........---.-----......-.--............... '- f- 'V 'Qi ' ' ' - .... ....... .........:zr:...................................:................................. .....:::::a:::::a::::::zz:::::::::nIn:l:::::::::::l:::::::::::r.1:::::::::::::::::::::::::::::. 42: :- . I X A F -I I I 9 If Q, '6 I ?' I f If I f 4 1 5 I I 7 Q 1 f -Z f 5' r 5' :- . 5 S 4 .Q o Q ,- 5. -5 -,- :Z 'n 4 4 ,Q f a E . .,A , , 3' ,Ev .I up v 4 IW K 1 ' H Ill' N I IIE: IIIIQP I5 I N QI IE I I:I Y 1 I I I S I. .I 2' . 1 v Q Q Q v'. 'o I 0 Q 'Z 2' Q Q Q 0 o - s 'Z ,. 1 I .- I . ,. '. :Q ,Q 0' ,- 1 fn 0 u I Q' Z wow! E FQ'- S g,.. H f f Ijs 'Z 42 'Z ' , ,K I I 'A Own EK QWMLOM Q ,,f , , , 35 j .3 '1 k' mf 4 '- 'B' O - ff fs-.,, 4. '- fa .AGL fat-If, . Q A MIM I I .5 ' , , ,, gf, 2 :N .. :.5,f .If , I ' I I.III 9' 'I' I I I ' f ' ' ' hal' -L . , K O I Q lc.. j..,m qw ...hi K . I 1 Yi: ' '. ' ' . I ' II: . 'I CQ R41 u ' . 'wfnf S194 , i ' - o M553 qs , X ' A I F CKIPI. Q ..,I, 5 E QL , I I ' I WI IAQ 'ai - ' II 7X X ' 2 H I' .'l i. ,I -' f ' 52' Q J , 7 N. I 9 4.0, 125 , , 52. UQ.. ' 'S ..,' II? I , I, 5 I -' f ' , '4 ' I Ll vi GA I I Q 7 .L I V.::i:Q , 1 1' 3: I V . 5 ,3 .4 gggf .. Q X, -. 5 55 ,V I ., A ,. I - I ft- N , , 'E ,V I If 11 ,Q ' II' O 'I I f h A . ,J W yy ., ,apr 1, I , ,545 5. I i V v V 7w. u,53MKf3r.V V I Q,-915 t -1 .L 1 . V: Lk .I Q 1 by va- '- X 'A ,I , I ' , 1 l 3. J ' Av , - 1 54:-, J in-Ii' -14 if L,,f.,: , 25552 J Q V I I. 4. If-' fm? ,,.I i Q-,.L, ,QU 0g5r,5f.f,,,L I , ., ,1 X 1 4 ,I I., , Amr. I ,I ., I , I' . 1 -'W ff is I , . 1514 I I ' I i i'a?':I x PM Sf , xl' I I ' , 451' I .i A . lg ma Q-yy I I. K .kL,, fl 'Q P I 2 uw' , VV' f jl'Vf'. I 4 . ftffgli ' ' I fda- 4- I I SP' 4..14 fmx 'A I' I I 9,216 I L' I ' . if, ,FSI ' gkil-11, .III I . IWW .. I I ' Www f J IWW A f H, I '.f K QI ,, , I ,, ,I , ,, V' I I -- ' ,X ' J.. 'llll' I f l l . Q f- , I , , R, , , I MEMQCDOY' .e , 1 ,, I , Q., Y V I ,C fi, , -,3 , f V, My 2 ,Q I . QI. If , . I f - Q 'fi fe . Smsf I, Vx f41I-- f A.,, 5 IN I . I D . . ,2,s1n. 5. I :, fb. ,,,.. Jlwgm I' ..,'S' 9552. . V X -', , 711. I Xzlyfaf , ' ' , . '64 I. M :-. A . , I .I ,v-I , I f , . X1 . ' ,SCE . I I X , v. ,QIAUSXX :!Y,f'I' .V I 'JILH-Ffg,I r V ' -cffx j...,,. L I N I 'Ia-.,, 6? . A ff , VV' 'I If f M, ' . I -' I fx - . , I . 1 I I If Q 'Wg 'Tk , , kj ,,- , I , xg ,L I N 5 - ,gm I , , ,:.:3j ff l . -V., .,f ,gn Q 3 5-Qian' I X , N. V V h , ,. A A , .Www ,, .,.. , ,. Q 'XI ' , I . I nu , I -I I fI:, I. ' ' I ' I n ' 'I :,, I , I .355 W ,',- 5, , Q , 5 A E .,- I x - dnuvf, I , VI I .,,f ,,,,,,,Q-Viv I 25 ff V gigQZ!Kw,I.g:, A i. I I I Mr s- 1' 5 'Pma6'f , , 'V ' I , If ?71'42, I .!'QlfIamP.sIx'9f-Iq.l', I I ,. I I LIVE?-1 75 ' V, , I. IV K S I ,I I I I-If f-I. ?v , A.j- 4 , I Q, m , S . .. , f 1 - 5 f I I,I, , ... Q . 5 I px' ey' - , V Q fn I I ,I in I ,V kr 1 fr- lfxfn . I x, -- - fwfr ' 1QiwI, , I . xv - ' Y t, N, -' Quzmoty I f Vf , 1'flIG1unayy1S',gQf1':'!f xi 'Mb f f I lglixll :A . ,N 6' , . I I If I wire ,,,' ,y v,Q5RRgfKIV IaL..-,.,..,N , ,,.A .M ,, A X IS ISI IQI S S WE f 9 O 5 N I Q ' 1 v .. 5 Q I v . - O I--f o f ' 4+ I L Y 55-if fxyf ng 'z W N g' -I isi Y Y , g-x I ', f ' .' M'-'N e. Q, . ,n::lu,5' Y q .. ,--- V - 'g - L'O'm ' I 0 ' .NF ' ' . .. ' ' WWN2? xmmxxQQ4,I D' . -- ' ' I I 0 S ' ' Y , S Eu! X ,'.f ' i Uv Ig 4,..,.,, I I 3 I I I I I f I I O I ? Z 2 I I I III MI ma ,IX kr.. ll xv Gfm E .F 1 , F'-im LIIIQEL I ISI I I I 45 I I3 ru P AI II WI Sl ,I I .s.I 5 5 Q is S S if Q s N I N 5 I I G is I- ... L L. may 9 X N. V1 ff.. N? X A , .,-.Ap . .4 my K ,. L- -I J ' J 1 A J ' 3 . . R - LA I ,.-P5 I if ' . 5gggggfilgggiifgiuin1ggg5ii:::u.'sxs:1rmnmlnmn aa4naa4eanulr.aaslugHEQf-1m1nl ??li----,m- ---- 1:-,-gn4u,,.A-q22'- .fT,.-.f - M 1: f hukgg., .-. ,-r F--M - ' mg ,,,,,,.. HT. 2-' i v:- 3 OFEEM- 1 ,, . ?-'-v.:x- gi ,R .' : ER JUS- .5 I-F'-ina zi: I' l I if 'f --'- nil Ima-.IL ........... ..... .a:::.::u:l:x '-Sr H- . V ur -,..1 A 4:2 , . 1 - Y ' .........- .'f.:.-... i :nv I .iq ,II K A, :I 'T fi' I z? I ., .Q u 1 5 4 1 : I if 41 - SE rv Kappa Alpha 4: I 3 , A I if - N A APHA SIGBIA CHAPTER 5 Founded 1865 Established 1898 's FRATRES EN FACULTATE E 59 5, 5 . DR. MARION LUTHER BRIITAXIN NIAJOR ANDREW' IJEWVIS PENDLETON Ph I DR. WILLIAM GILMER PERRY gg 'Ci '-N 3: 5 1923 SI fc ' B JAMES FRANK BELL ROGER XVOODS MALONE HUGH DAVIS CARTER ROBERT WVILLIADIS NICKIXNE1' X ISAAC REID CARLISLE CIIARLES PRATT RATIIER 'Ig V 9 'FQ Kg WILMER CROUCH DAVIS JOHN TROUP SIIIEWVDIAKE V3 55 WILLIAM PAUL LYBIAN V p . , U 9 Q 'EJ' 19241 1 1 155 W izlli lea! N P ' W ww , CARL WILLIADI :BAI-IRT, JR. CHARLES .ALBERT LYONS b yy. A J 'si CIIARLES MAYHEW' 13EA'1'TY R. B. A. C. MCINTYRE W Rf-i ' 191.121, ROBERT BERTAND KENNETH GORDON BIATHESON, JR. II vc,-2 ANDRAL BRATTON GEORGE PULLIABI ROSSER 15 : 19, .qu WILLIABI ARTHUR HARTMAN XVILLIADI ALEXANDER XVILLIABIS 'fm full! fill: Km Y 1 1925 'x 'I 1 I U I . PHILLIP HENRY ,BREWVSTER JAMES MORTON HUEE JAMES ROSSER BRITP ROBERT GARDINER BICCADIEY , HENDERSON BULLOCK CARLISLE JADIES :EDIORY BICCOOK 5. g HARRY LEWIS CARLISLE GEORGE HENRX' XVI-IEATON 25 . Ev K 1926 E I' PEARCE HORNE BAKER PATRICK KIRBX' FREDERICK BELLINGER JOHN HOUSTON MARSHALL 2 TIIOMAS JACKSON DURRETT WARREN HOULETTE OLIN'Ell . Z MILLARD COURTNEY FARBIER OXK'EN' XVILLIAMZ POOL 2 BARTOW FORD ' XVILLIADI XVILLINGIIABI HUGH COURTNEY HARRIS CATO WVILSON JOHN ABRALI HUNT Ig . I 5 59 D-'E fl xyllo Q- 'NZ 3 O - --A - A - - - 7.7 ,Y 4. i. 1 , 1, t --.--.. ---- f- A - - ' ' W -'Hg P- ' 3 ' ' ' 'L . , . A f .1 . , V . , , , . ' ' . Axwmmowmmxmwcqmwmzm: -1, ' 1- A, .,W.:wv,c4z,:a1z02-5514442444-.vzfq.:-24'RMxmwww L ' A . , L I A V M Q - ' - -- . . . .S '- . . ::...::- - . , LIONEL K. 0 41.5255 ' ..L-m n.. . LLVV X 2 Rf I 0 6 IQ... -Q O u -4 fwof' V, H7 'ag V N 0 .. . 4 culg' he' T- 5 - Q, 'iiiingu N . Q r 'I P 5 'ml KN V fa 0 1 L u J Vx I' u ll O I o .gk h 1 tk. 69... . Q I-Q,??- fp Q Q 5 ,, - ' LE'- , fr' 7 'if'fiv- - w J' .. 4, X -, 5 'T-..?- . Liam x W M n A X r Y W gf .QL A jig' H.:-..,..,..,.,.-,1f' ,Qt , 1.-- .4 I I Wi: ., I 7 'Q -'- - -X...,5Qi ' , .i 55- X ,, -Q X L -. ' L - H A ...- 2'2--f , 414' - - Z.ummm1nIui:-liiuImnS69...FG-mf.-li---1-nunmmnmmmn-nmnnneuuuuumm1:::1n11m5g E 'Ee aiiiiiiliiiiiiiliiiin:QEwas5::::nsawaamuamllaalmlnumlmmumuuaimnmlsumnm.mm:,..m.u-nf---.m-fn-u--,-M,1.4-.un.uasmummaw-m1uu:anmf-L.r-Xm..-4,mu.n.. . H 1' I .::.:::. .... - - Y wi X 5 '51 . W' 1 I . .. ..... . - -- ::::::'.::::. -. . ..- .'i'L...... E mmi35i... ... ..... . a:::::a::-.a:::szazagaza-.:.-:::.'::'-1:::::::.:m:-,ma:1:::::ns:::umm::G::::n:::m::::::::::::::::::l::::::ll: ':lI:::::::::::::::::::':': n::::m:1n:a:I:::::::::: Illnlmliii-llII..:l'.!.....:1f:a'a-l'I: ' ai r X QM wi 1 f X, X 9. X 2 'v ,L LJ .If v ll ,A ,H li ri D1 :ISEE Y wx, - llll W? E' n mfg 4 r '- 55 r 1 I W5 VU WI S S N QQ S N 6 Z 5 4 5 u 'XJ If X X 1-X Ji-QQ-gil. fg1,XgXQ'Xig,1X-jQ-3, .,., H4 X f f-rf My ,ff-,f ,V fu -X f ' X A X tif yi,i',Qn! ,f - X fp-g,:,X, K XX ..'f, , ,, ,g,iX:M-, fmw f,kf QA 3 5 X ,.' Q, ,,., ' 1 xX,f1'11X: 'y1 1 1 1 11-13,5,f-1g!'Qf ,tk f ,F k, 4151, -gyfyggy ,f . -fa X f X . 1' 121111119 -' , X,fmf,f-cf,f,fi, , 33' f' fi fl - iw? M' Y l A ' ' 17 b4Wff!WffZ 'fff,Cfff'fi'5, ,515 ' f . A ' -1' . , .X -A X901 ' - 5' W! ,ffxXf5,!f?fd!ff, 1 L' ff- ' f X X, ff?77'ff4'lf'f'Zf 'VV' A5 v 1 .X',. , -lil. f 1272, fffffvf W 1' L V , j'l1f1:XzY1172.1-'gQ5:Lf1 1 - ' 'f f ' ' ifC512'7ffff!?f!,fffrff' V' 7 X X . 1 Pf?m Rfn6wffffgX 1 ,K GW 'VCO7vL?v5?' , f- '- ' T- L K' afT?ff 4 ,' .il 9215111 'f ',- 1 1 X if ' X5 - V -.1, . 4 1 ', .i , 1f1gfQ! 3 M '. . 'ivfbif ff' X N1 ' X ', ' FLEX ' fir . ' - fi af' 3325 VNV ' 'W W . ' , ig. an ,' V. x ig, , 00 ' ,LX :f X Um g rXXf1 A ,, 'AK' r,X:X ,, f wi X4 g., .4f1' V' 1 .4. . , z,.-M ' h X :4 mfg wg XX, 4 f 7 ,',', X, ' 129 6 ' 1 V1 , 411 ,' ,,'f ' ' f' X- ,'-- 'F' X ?w,1QX , k 'L . ,VX 4 1 1, ' ,V fX QXQX f X.. 116551 4 ' 'Tx ,X uv, ffpkiip A A - X ' Q X 2 ,',. ,, 2 ,',' ' 1 QD - RMX1.-.f 'f Q f XX Qf1fY,l-j'U1.Fi, MSXSQX L,',' fyffo ,f-- if ,Y fy '11 1 COLE V , , 4 4- -L'L X Q Mg,L,i,,,,4!'fC21f1TE?' ' X, . ,QQ ,L-- V , 1 -gyyf-f 2, - .- 1 - '-, , .ff NK X' . if if '5' r A ,ff .pf 111' X f . .v , 1 mf ,152 11,151-ZX f , 1 547 - X , fX!qX X af f . X 'f?,Zf2', ' , 1 .X W - . 5 ' 1 , X ,I i i' 'WT-'1 1' '-'L if 'fig ju' X A Wzyf' .Agn my Xffg, , ?VALKbFs mf 3. , X, 1 X1'g,'A,1UU1. ' I ,',, H 'f i f 5 I Q' , ' I 'QXIf'?Q1 X ' ',-- X 5525? 32 , 5 .X uf? Xin' ,vc Q V,V, :Lf 1 VA,V .wqii -, Vykk l X , VX- X MX ,XX ,AAX X -L 1 ?1fy,,fw-,f,, '-,', 41 - ' - - 1 X X, 4-1 ' - ig V.V. i,i5k,,X LVV. ,Vk, ? L? 1 ,131 Q1 V t X1 ,,,- , . js , aw X ny: . , LIL, ffv- ' X ,X- 7' 1 L , .,wX, V '.,-,' .11 N 'X 1 . . - Y X 1 X, A X M ' 1' ' X' K, . 8 2 ., Vi X . .fm wXs,,, 1 2151 f 1 U f ff- f - X,1:, X- .X JQWFQFZ .1-. X 11' V --1 , 4' - X 3 Xe- 1 . eg, 7 QXWXWXQ '1 ' X- XEMOE K , X ' 5:11 'Efiff' ,,f' 1 -A.', 3 , mf jf ' Xa , ,X, ..,.. X f AWX X V X X gf 4 f if X?'Yf1i2 - ff-1V?ZX-Qs zi'?:W5'21 ' if -1 V www ,X:114Ag1 . g 5311 5 if lf, Q Y X 1 X ,-,. an A X ii ,---J 7 wma -f, f I 1 X XV , ia, 9 if ' 1- Qs X 9 3 f Q5 P X s X ' x f 2 ZX 'R+ 0 Q A X Y 4 XQXQ ' XX1aXXfX,1f' X X - . 1 , qfwwf ,Q X1 , sv X- QXX- 'f KMVX. Sk 1, 1X1 X 1 ,ww .1 .W ,,,.X,k y 1 i f is 1 X 'X , 2 X X f f ,SAN -X 4 - ' M X 1' f i XX! ,X ,, , . ' 1 px ZX., a X - X VI .. X Xe 'Qc v 221 X , . , XXX MX, ,, . ZX W, an nf- 1--X -1- f- -X X M. 1, ., .v 4 . 'al C-X X WF, Ai S mmf X7 , f fa! Xjfhx XXAZX J mg? X f f? X ' i X ff f f x X? XX XXX I X I as , 4 Q X Xf 1 X X x , 1 nv E X ' 5 4- X Q ,V f X ' f 'TI X , 'x , X 'W 3 f f 1 f A X X 3 X- v X 7 , xx V bg S X ,X X X , .X z, .,,. 2 M '1 T.-Roaskfiff , , vi A , , X 'Hs f X,'- , - 1 111 f - '1 ' .lx 1X X -L 1 A W. ,,, A,hX,,, , , X, X.,,, X., ,X -B NN 01 ' V112 ,- ' I 1, ' f, X 5 N X XX -XX XX,, ,,, , .XXXX ,X,,, 1 X 1 ff t X- X Q :Xe 1':-qi,'1gXf- , XX, ,,.. 1 , -- :Q f If ,,, X.. , 1. fj,:4,XX, gui ,X XL Af 1- .Xf 1 iflwmxgf EX, Sqmwjf ,51qgS1BLYq , 1, rv ,',, 211, X - ,XX 1' 1 . J, 1 :Z - :Xk,X'11,g?' fl k,VX www ' XXXXYEX RX I K X XXX L 'Q iff? WS' , 1 X - ' Y '1 if. 'R XXXX X. 1 w X1 1' b ,XXX - ' P' L, , I T511 '--, 1 E11 ii'-1121916 f X X1 1 X ,1,X X A X 112513: . 7-. V' Xb. . www Kg ASK X.1 1'X,- i1x1,X11Xws1-E ' 1 ' ' 2 X 2 H H 111 ' ' f Op Q X,,VL ' .HD - f f,a:e2Lf:4541vf5Rf -9, ' X fl X Y ADANWL? 'f 1 1f' f X , ff ' M '3 X 1 W '- 1 mx- fm mf My XM .12 X XX- - X' 1. Xwswefibff X ' X 15 1 I-z W -5' J X X, X- X f m.1f1-4w.,f9f- ,L.,, ,X., V ' 34111, 1' 1' S: - fg- NX 'f .1 If. if s 5 - X gf-' f -1 X. X. - -X X1 X ' ' fX,X, f A' , V - . fl ,--', 11 . R . X .' CUNY . ,1111X,1'X,?f.f,1gfQff 55355 0,45 5 X X X 1 5' X ...XXM X.XAL1X XXzX:XXfXX1X.igX5X.igXXxIXXf.iX1 'X k X X X X X l -ASX Q. ffgfffo 0 , XX f :Jllf O will nu N5W'S2S6ff 'x5M6Cl0EC5'099' gygzuw -S 1 HEL , X f an s 1 ' 1 5 rn lv i .Q X X Of f M A 0 off' ' X, .Jig X23 O X X --XX Q -A S.x1jf . 1 ' V L 0 K' k 1 3 F - 'Qv5n 5,51-, fx' ' F' ,- Y -A, 1 ' H V' 'nl' - lf-v ---- XX., M., ,Y W4 ,gYWj4,:l1:-' ,rg LX 25 fcw , :rf X L X X 4683 f 6 f 4 5 4' ff f 5 f ,AH ? X45 2 5 LW L LA.-1 P1 3 :Sq KI 1? 'UD ' H1 W4 Y S S 5 N 5 N Q x E 5 S S 5 X 5 N S 3 E X 5 5 S 5 5 5 5 S S E N S Yu V x 094 I . ' V 44 if I ! 'Q 5 X 6 J 1 6 fx I EE - I ba HQ ,531 1 V551 num. K ' nga AY ,i SX S X X Y E S1 S S S X S S XX! Q N S. EF 5 S X X: 5 S X Q, QQ R 1 Q is. 'VN ki ' 1 :Q ,g, '. ' 'vm- -A X , . .. I. -A ,V 'L' A J br . v f f-. f-SS .. 1 925 .I - A - , - mm - umlleame-aa1ea-nsnmimIa1.s1m-.fQi'.':A5.,,g,f.I.1,...,,,- .... 1. .,,,,,,,,,E,,4,,qqg4g ,Y,.47,,Y,,, . . J Y , , L, , ' ' , W--L h-1,fg',v---W1 ,, w::J,,t::wEx:,:i ... .,..:- .. ,. I' . P '-1 ETX- E-Q F In fi I I . 'Igi itil E?5iiguum:?.5:...... ......- f::- - - -ru:-I---4x?u::...,.,,,, ,rgzzz-..-r A ..,,- . , I - T - M 9 ' V I YT? 1 1? I 1 I Fi 1 rg S 3212 ' S-I I P111 Delta I heta In ' . ,Q GEORGIA DELTA CHAPTER '. Founded 1848 Established 1902 422 A . ,, 9 5. FRATRLS IN FACUL'lAlE K. P. ZERFOSS MAJOR R. T. GIBSON A-'I . 1923 iq :E E- GEORGE LIAINIILTON BROADNA:-1 CHARLES DI-:xTER JORDAN A HOMER MONROE CARTER XVILLARD XVEBSTER KRAUSS 31 SABIUEL TA1'LOR COLEBIAN TVALTER NIARSIHIALL BTITC1-IELI. . STANLEY XVITI-IERAL CONVERSE GEORGE TXTCBRIDE Q JOSEPH HUGI-I HILL FRANK XVARD REILI.X' fu EMDIET WOMACK HINES XVILLIADI AUGUSTUS SIBLEY L1 I. Q ISQ741, JOE LESLIE JENNINGS RICI-ITKRD ERNEST XVALKER 'x f RH A U ,.i.1 ' , 1924 sm-fl' JOHN IVERSON ALLLIAN MARXVIN NIATHER BTCCALL, JR. 5 I' 0 bk BENJABIIN BROOKING BROAXDNAX JAMES XNARREN SANFORD .' SCROOP XVESLEY ENLOE ROBERT HUGITES XVORKE IQ. I 'Illia rm Q: , -lm- 1925 r 1 A , I OWEN DILIJAIID BOYD , WILLIADI THOMAS ROBERTS tw' R L f B A - B ' S ' ff OBERT AVS SON ROWN LLEN Ou EN IBLE1 QI 'N STARLING MAXWELL CARPENTER IANDREVV GAZZAWAX' XVHITE 1 ' - f VVINSLOW COPELY GOODWIN JOHN DANIEL WI-IITE JAMES LEWIS ICNIGHT ALBEIIT MELL XVRIGHT is 1926 , ' k SANFORD TXTCNIEL AYERS QUINN EDMANSON FLOWERS A JOHN CONN TITODIAS HUTCITINSON ROBERT GORDON DANIEL HX'REI.L SDIITH IQENDRICKS ARTHUR BRANNON EDGE I JAKE IQELSEY LAUNIUS I . ' JOHN LEWIS PETERS GEORGE HAZELIILYRST SESSIONS, JR. JAMES FRANIC EDWARDS S ,J 6 0' . I 9 2 I EF 's I 'E U 60 'W -ffffo o g ' .0 O c RN L W A A. IAAA A Q '--- A AAHE' if f A Q DL A L Xl N I, ,. ' , 17' U V S -I , , 'QQ E . 3 ? 45?-'QTJ.,'Qisxccmwafpwxmwzrymfaaaoyggfgzm'-mmoov . LIONEL K- ' 0 R ..., J: J u A LLVY4 Y V Y '-., A . . ' .IA .2f: ' o ,M ,y'L'f15o G Sl I ? l P - , 1 ff?-g.,. QM 1 1 x - n V - ' ,I .--5 '7' .1 Egggsgggigggggqnxggg55555:::::zqggmgmmmm4Tmmmmnmmiml,li Q,g,,,,,,,,jQ,EifHg ,ABg!4igg-ii4u.1!:- nl1-vi-'iff:L U -' ' ' 7 : '5 ' 5'3:m:g'3' u iiiigg:!iiEii'lh,-Elkay!! EFF ...muwi-.-,gu git nul f f' . .1 T H E b LV ILI 5 W ,al .. .... K. .. .... Y 5 if i'lI 151111351 .... ,,...i ..... .. a::::::::::::::: Sm: m:m::r.:iim:m:::::x::::n:::::m:::::::::::::I:1:::::l::::::::::::::l::::::lH!:::l:I::: .m'I I: :SII' F' IIIIlmlimitilIIIIIIIIIllini!!IIIiII1Ii53l-'B-.S-......l21.Jl-u.-....... ........... .. -..z......i z Y, w 2 M 3 'VFW f vu! 7 . lg Z fl , V' ZF' f H x 57 4 of f 9 f ' I s 2 I :ig - 'i I a . 3 v 1 ff Z 'I , Z, ffe M L , 'iff M l 'L A W 4 ly ul? 1 1 ' ,Q B A E17 ff . P-I i t mn' M -lm. , P Q w' fm L , 5 H1 ' H . im 'all -Illllh fi ' .1 4 41 Q, vl am 'A , vw- . . 'IIIII 11 ' Gulf' -- 1 2 2p V Elgi ef' Q 1 S Hx , K1 ,f Yr Q Q 3 Q 552 , 3 3, 5 1 EQ ' N 1. S Q S . , N 575031 Q x I A f.S'fV0'u-I, gi w N S , 'xi ' S S Q V S Vg. 'Q Oofifw ffffb f Q 5 ' f - -- Q- xwffi' f N . Q, Q Q Q- ,cz , E Q - gg xm H i IE A ' How K- D ' if 3 : mm 57' 'A Xwmaza. M- ww U 1 N . '1.. , u 125- 'a 1 Q15 - an 'CZ :O ,ga Q .M ff'fS1X-- - I 1925 fx. ,H Gif E, wk Q, - Limo, , : , ' - 1 , 4 'gr 4 . -5.5 I - A - 1 1, . -. A? X 1 4' -- - -V . AA, -4' ak 2-2-1.6 - A 1 1 ' ' . Hr' ' F' 'fb 1.4, ,- ,L .I ,. 2I1Smlswnnmlrllmnxmulsummwlawumawasarmmmkfhm, .. .,,:.,,,.,,,,,E., .... v.,,,,,,,,,,,,,,,,,,,m.31I-- -W-,L.,1,,., ..... ...lJ..:.f -4 N W ' .-...-. ,., ......,-......,-,.,,.-..,- , .,,l, ska- M- -. T I-I E V T Af lil r ts- V!! :xz::xa::: ---------f ff -Q-. - - 1 ?:n.LJ - f V Ya' iw J Z DQR R55 Aw I X1 I .Y ' I Tl' W I Nei I 1 r. . 5 NCI 5 l 5 ' Z ' - li f Ph K S S 5 1 appa Igma 'N S? S Z gg' IXLPIIA MU CHAPTER A 5? . ,Z FOUIICICCI 1850 Established 19041 4 'zlgfll g FRATRES IN FACULTATE ,if PROP. W. L. MCEVER PROF. D. B. SANFORD 5 ' 1923 gg -Q A j up - I r w ' -52 'Ig SIISIEON BATES LOOK 1XI.EXANDEll 1RO'I I'ER HUNT 'CE 7 ROBERT EDMOND CHARLES EX'EIlETT JOHNSON RQ? EDWIN WALSII HODOE J OSEPI-I LAEAI'E'I I'E 'FORBETI' ' ,Q M 4 CARLYLE HOLLEMAN , V 41 , 1 -mu v 4 , -llly Hb 192+ 4 M1 ,uv Ylglfili JAMES GERALD AIIBRIGI-IT THOMAS NIILLEDGE MUll1'1IEX' if V531 WILLIAM RADISEDI BAKXETTE FREDERICK CHARLES PRITCIIARD ll- - We Mis -una ' mf C 'A N 1.125 ,I O f 4 JOSEPH 'FERIIELL BELL HARVEY LOUIS HOXW'EI.L M 4 I I I RICHARD LEWELLYN CIYIAPDIAN JOHN EDMOND PIERSON ' 'U CARTER OGDEN DICKSON JOHN BRADLEY SNYDER HENH1' XVILLIABI FISHER Q 1926 gg 4' X CLIFFORD XVEYDIOUTH BICKEIKS HEXIIX' BURT FOSTER fl IQ4 REYNOLDS NE1N'BIAN CATE CHARLES PINCKNEY HUN'1'l2l!, JR rx -' HOWARD XVILLIABI FISCH XVILLIABI LEE SCIIELL Y at Ei . 4 E2 IE 2: ' 9' -' if 2? Z 4' . JCB I IS ,,- O V i dl 'rg Q Off N s-I N B S.,..... - 0 ' EE R I U M K .. ,omzz-zmzfrgwxesHxxixxxxxmwxxmvwzzxx-t-:- E M 3-:vg51:g:gf:5.3:g:i:-1-:-If ff-I:2:2:?:3:3whVm-:Qi-:- 5E -I L , ,, ZLJF' vtfxg QLQ L . Lx ' LIONEL rc- Q iTxufgIak g in be LLM., ' . D ykgigyhgom .- , - Or jj - 'I qfgg g V A V Wx.. ' ' -- . - fc -wa 42' ' - . ' ' '.' EF: Vp,-IQQVE 3, Y -V .-0 .2 Ji f, .QE5355amigaiggnrggg5'5ga:rr:H::Immuullnslinsiiinummmx1numsx1amiLui11n.Im..nw'...fu.L-xfilwf1m.--,--1-.--U41.nu1a1au11414-.1II-535:,ii.v..,-,-iff.,.,,,,,,...........m........-..Ef.1:i.....aaM1--42:2J..1:.... .... .,,,,,,,.,,,,,,,:,5Q.21,,,.,,,.,..,..,.,...mmnigggugmqggrggaylaaggg gg: ----- rn 1:-g:2:::. mp- gg:-GEM. v---1 V: E. I I 1 l W LW Q N3 ....... V Y .V lim:-m...,.....f.... ..... ............:::::r-..-..z::aa:::z:.'::::r.:m:::::::::::n:::x::::::::r.:.1::u:u:::::::::::::::::::::: ' mms:nm::::::::m:n:z:r::::::::::::::::l:lu:m:::::::::::::::::l:::::::::::::::::::::::: ::::::..-. .......-.--.. ,-, ..... ...gn ---- Y Y 'K 5 f 7 9 5 X - h.A4 . vi .r ,f -. . g ,f A 5 , f ' , YZ . :V .V , V , , V X V , y , . . . NX Q 5.-10 VE. , xe If XX V ' ' V, ftromzxgl' 1' 1 A Q L , 3 ' y277Lx.1LY?' . . ,. Q V V V V V V A X V 5 S: ,V 4 s V . .V V zz P .5 Q ,. 4 1 iff 5 ' f? fe-if 4-we ' , i A ' I A 'fw' A ' 1 '. :- vw ' f ' , 5 1' fr: , -g . ' Q 3 f , 47. 1 .1 ' '- Y. v ' ,J , t 1 V , -. ' Wzzox?-'L , If 'WWEN5 -X ,Q .g, ' . J , 4 , V V V fps ' VV.: A 9 r ' ,, A V Q ffsfvvi , 'A ' ' af ' J'4'f ' 5 ff , A V ff l 7 ,I N , -W V . ' v K VV 1 V :VM http, V V 5, 5 M V ' V4 KV y VV , , VV :V , N.. Q. A .f ,111-.. A. f Q - A f .. - , ' ' . . , 'FL iX',f - 'V 1 bszgfif' k ' A 'W ,+f:X' ffHff+' : ' f Y Y , 5 V, , 4 , ,J V . V, .VV ,, ,. b ' ,. A A 'L-CARRO ,+sf:i,:QV:L, 'Q-Qf'f 4z1QeS5'f ,, 3: 5' f '-bk - ,ff VA QSifzvzif1'. ' ,, C11iPr1W 5 ff HO . wx ef . , i .. A Vw, N.. A f fry, , 1 f, A.N,, ,. ,V ay -f 2- ' - - .s 14.4 ' V QW! :X 'I ' UK f 5 38 I . , . Q , , 1 I f , , , A , m L qu 5, - ' N MP' f ' Q , 50-,. :V , 5 1 1 ,mm V V -Q... VXQL V 1595 . . V 'H ,V I 1 V f !ff'3?Uf' . 5 A . x t n Si, V 'mam vw 'f LT' 5 f 'fog W V 4 3 hr - HW 1 - - lfiwfw if N of ' ' ' f 'X ' -, ,,,,. i M ,V f 'h 2 ' f .Y I al l L V. ,XV ,VV .,,,, A V, J lly xr ' f, f M g , X f ', 'f ' n Q i fr-N1 I , 'f-mf 'a ' - -f,ffx,,f, 5,9 2 , ., -IIIIIl- . . fp N 1 fm- V. , f f,.. -- s 41 K 4 ,, -ip h f , lim' V 'I iz- Gig? , , V You A V !,fg,e,g x.V,1 , , Am, A A - 'Paws , - ' , r + wi N V qbefcsscx-1 - .,L' 1 HN ' , 4 f'? 3ffZ'2 ' I' fx f ' : X ' V X X , K , V V ' f, f Q X , - . f' , , , ,. 3 fffgg, X- X Af? in V XV V, .- V 4 , xx x , Q ' 1 9 4 Q. -7 ' , gc M W X bi 'S ' ' ' X fi - f 1 H 3 'W b, W rlffffy , . VV V ' . ' ' , 31-' V , V , Vg jy, Q '?iQi, . S f' . Qfp-, w A' ' ' fl xx 1' IQ , f- 1 - ' V: , ff 5, '- , K, , - - :ply If - nyx. . .Q x ' fl ' 'r '74 : -' Z 5 , , A: l 1-W f vw Q ' . . .. 2 , , J , Li ,f , f ' 'fl ,' N, ff A - ' -J ' w ' 1 V ff ,z N 6 fy V Vsw X V MVV Q 5 bl f V f x . if . . V V V 1 -,, I, ,.k, V I. V MX, . Vik .5 Zyban? , A9 Dbpgm I V SV ' ' i ff f ff 'ww I - . 1 'A ,V S xjiff ., ' Z I V ' 4. V , A, f ' V 3, N F- A ,w 1 f Q .-45: 1- . 2 A N '25 ' ' K ' A 7 ' ' - ' -'1::.' E- fi.: FT Y' 3 . A K f x ' Al ' ' .9 Q J . -2.-.1 ' WT f fri f - - ' ' y f f J Q 2 xx -2 ,,, Vg. 1' ' QV Vj V! VV , A VV V!! N HOLLNQSW fx air- -gl 4 -,jfqf Km, I , fl V A V -W--M V V 4 CUP? MOR: -Imggrav V CLVWRERA vgzmngouaff , 1 cash!-RGV5f i sf WE? J 9' i :Q-,Y 4 'ii 5 5 S S. S 5 S MA x519R'fS6'9YflX'Q4f!0'lD'.0560661' 1' ' f9QSf!!fY,-'A-3 Q - A g Q xxvmmmxnxxxxxxxwxxxxxggq lone - ' ua- e.. U . . , W -H , L L rc Q ixnafzii V Q V i ll I 9 0 P- ' - 'o I Q I OQ-ox ig' 4 o ..4' -. . : . '-., hm. Q ---- ,225 g f '1 5 ,N - , r D ---.... .::.. -f - N 'il i A V Ki ' V x M V 4 F- , V : . , -V - xxx? V V V V A 1 '- 1 '23 1' x ' '. ' I Q L' X K 1 I A l s O . 1 O 0 21:3 .QPAO . llvv . .ful .- ,-. ..- 'J 'js -1 ' sm'--.. N ' mf' 'C-G-3-f-M-ff '- iw - ....- '1 f a A ' ' 1- ....,-urigf 1 -- . . . .. ' - .A - A - E - G G . mg . 3 HER 5511351225:-HT-3331wu8v5l!lGl-Halll1lI!H5-P12-5i0!!4.1!ilhillnB!9!l8EiSI5z1-1rfzumreafz--v--1:----nz ---4 ------Q---....14u1m.vL-xw:.1wr-1.-n.-.1..,,...........a.Im...... ..,.x. ...,-.-.-f---- Q.-. ...Amy .... ...... .....:41-E... . I 1- .: 1 1512:- n. .- '-' 51. G-,, fi I T 111 1 I - -.L V L - giuk. 1 511' 1 z' ::- ' 1 V' . . 1 Q-gjva ulil l.iEZ...... .I.... .::a:::::.::::: 1 V-4?---v--S Nz, f ' -1 ::..................... jf 1 - Q ,' .. Q ,,.g-- Y -5-'-2- - O I' '1 N J -in 1 1 .1 N 1, 1 1' .L 1 Q IV F 1 S fe 4. 1 P1 Kappa Alpha Y ' A ALPHA DELTA CHAPTEII Q Founded 1868 Established 1904 FRATRES IN FACULTATE 4' E23 . PROF. P. L. ARMSTRONG PROP. F. C. SNOW ,Q PROF. T. S. DUNN PROF. R. I. XVHITE 2 ' N PROE. STERLING FISI'IER, JR. 1 S :YE fy '51 1923 A WILLIADI BONEY CARR HENRY LLOYD SKANNAL -'E :-.3 , T1-IOINIAS LAUREN CORWIN DANIEL BICQUIGG STONE , Ji , LESI.IE EMERSON GRIKDICK EARNEST FRANKLIN TIPPETTS X' A . SPOTTSWOOD RANDOI.PI1 PARKER W Y 1924 tlllf 1 1 IMA ,M ,S-QQ, ALP LINDSEY CARROLL XVEYMTAIY TI-IEODORE XVILLINGIIAMI liz, 1218114 FRANK MORTIMER EKLEY TERREI.L HIGDON YON Hifi: ' il CHARLES ALBERT PHIPPS 1 mln 'fa' F11-3 G15 V 1 -m A EUGENE CLEGDORNE CLARK EIDWVARD DENINIAXRK O,BRIEN gg ' 1 1 11 - x ' J OI-IN ALDON CROWTHER DWIGIIT ELVIN PERRINE NN: HAROLD OSRORNE ELDER JOHN HENSON XVILDER SXEAD ' TI-IOINIAS MORTIMER HAZELHURST RHANSTON BALDWIN STILLXVELL ,y FRANCIS EDWVARD JOHNSON, JR. GEORGE LAFAYETTE XVORD .J S VVILLIAM LAWVSON JOHNSON HERBERT BENJADIIN XVREN E5 Q JAMES FRANK MCEI.WEE, JR. 5, EEE 1926 :EE E DAWSON BATES DUMAH HAROLD MORGAN 'v 9 -2 XVILLIAM1 RAINEX' CARROLL EDGAR COPELAND STURGI-:S r' Z JOHN LOVELL COPE JOSEPH ROGERS THOMPSON 1' C Qi 1 LOUIS CARTER HOLLINGSWORTH CHARLES XVADSYVORTH VIRGIN .qu .AUGUSTUS JOHN MERICLE iv P 3? J . o 6xh.L.,,.,L'9'O Q 1 1 -11 crafty -:M -1, X r Y Q ' . f NN V H: xt w S, -1 09 .'-CURE- N3NXXXNQNQ:lx, ,, Cigar. 'c. ' 5 if-2-.' . . , ,J . 2-ic'.P9i2I:P'x-5: ' LIONEL K. E ffililggxn ' .LM n I Lv 1- Y X1 ,k v - gfcgx .- ,f 0 J?-K :Cf 0 x. 4 ,521 ...fo , gliwqi' V Q . 5 . ---1-A. . .K x -' : - I f . - Q 1929 - 6 - -5-fa., tk . . :J -own.:-:No ph PJ, tj . - ..... . -....,-..- -xx.: ,. , - a s - .. A wb - , . 'A A -In - mn:lmT1nlmluummm:uaiiaxllsxiuaiaifa-Qfmn-,HI-fluZ5fs5l'Zmen--E-A,-meQuasar:w111555-EEN:ane1-.nz.-GL.'.--1.54-........m.. .........nIi..lQi..-161531: ...... .,.,.-.yn-..n...11E32-ii-11ummumunlmnggaauggnqwgggg .41-N f y -5'--'F-:ma A ' . ..... .. ..... . M J' A 1 gggiggszsa- D LV E: P IN hi Fi ' -zns55.. ,..,.. .. ------ ------..-.-...-.........,. f ' ,- HUA A' I , N .... ..........................................:.-a...-.1zz.-aa::::::.-:::-.::r:m:awaaz::::::::::::::::::::::::u:::::::::::::::::::::::::::::::::'- :::::::::r.:.nm:::::::::::ms:zz:r::u:l:::::::::::l::::::::l::::'..:::::::::::x::::::::::::::::::..:......1-h... .A5in.....5.'FEE!2 A 5 fA 5 H A A A A f A: f ' ,- 4 1 A 5 rv . A V vf Z Q .2 f - .- 5 , 54 . r A I ' J X 1 , A A Aw..- A55 f 5 ' , 5 ,fy ' . fa? 'I A .. Y . .A . C W' .A ' Q A. , - f . A A W if ,,., A 5 . ., A 4 f f A 4: was , . A .rf .A A . .' fl to f, ,4 a If N - Fm. ,VK t ,Q 3' A- h'7CARTY'5z' . 2' .A.. . io f A . 6 A 6166539 1 w , ' A Az, E A 1 l, QIz'A5'Gff, ffijgffiz 5' ,E mam W A A . f A-f - , 4 15' -NA' .ff I A 3 LL'L, AAf,1:usoS5f 5'. Af.'A'f - A 'IQ A . f , - . f 4 , -Q Aw.. . .A . . .. f fstgfjf A, AN A. , - X AAAA ..A.: I f 3 .. ,Q f ,A -fx,mOR0m A Af.5:AA. ,L-- A w 1: A as , f . Q ' A . , JVAQ.-A ' A' A ' ' 5. Q '-',. L Z N: I .. .AFM 1,15 , Zig' V ? ,A .K kf h, A ' Al '57 A AWK' 5 ' . ' .. . fig 1 .A Al: ' S. ' .. , W ' 57? ,L k--,' A A4 - 'gif UW '., Q ' 9 'I ' ' - , 'A 'i . Y A , ZA '1IAflffSAAAV, Q 4 N 5254-1 A , '. ' -'mifvokaivl' . ' 1 L J V,-, , 1 . A Nb V K .- . K Af 1 Cc fs ' fn A CHHEATYX V . 1 A 2 ' ,f N.. ,, , ,I W A 4Afv'0gTuE?f F r , .fd .A I li. pn! 'A Q7 ug Illl '5 I V .. 7, .4 b 1 , 1 'TI 25:2 AA N21 ,Zn , f ,gh 2 . . W z fr-0 4' V N81 r 31'f.n..Jq.y, 39,1 Af A A A f AA . X L- L., Ae, Hf.,41f . 4 Al' ML, A, , ,A ', ., f3.fyAv:f-.,f:,. A A ., f QQ.. -1 .g,,y.-.: M ' A -7.5 -+ A , f Am a! , 'Q .A ..,. ., .W 4,5 . , E A 'K-sig? A ,'.. 1 g ,A 1 4 ,am 1 Hz z 7 05 ,Q if 3 4 54,5 . ,, , W 'XI fx F 'Aa ', ' . b 112 ,J f 579' M x X . , ff! A AA . A1 f , K W ff 3 Y I ' f , VJ, .2 A Q-ff .kV', . X .,.,,m 1 . Q 3 , , , ,.f K 5. 2 55.71 L, rf. -1 Q '17, .f ir. -A 7 , L Q. ff ,- ,,, 1 ws. f ,A . ' . . . . . AA ' q . T ' . .A Aw Q , ' Y -4A' Xa A',-', 555.4 AAL. Y ft, Z1 is ef QQ' A- 3, ,AK ',',,, gAfgjg1:-.Ag ,.A' . S A AA AAG' Q - A 'FA . A fp. Q. ,gg 4511 ,YA . ix - 4-- a , -,'..., ag, -,.A, A. A A .A Q Q M 1 gmt . -- QOH, 551555 ,, ,l i 'QQ . ., Y A . A . A AAA . AfA AAA f . 5 A, A , r A - M .f , A ,',- f A .- .A S 4 i V , -I JAKFNNEDY I .,., I , Gb' J , AV, X ,. . . .K ,. ffT .'f2 'A i Aa f T ,:A ',A !,L2a'Q? Af Aa '. -V,, iiAffY '? A. A A . E Www A A A6 . AA A AA A X 4- A t , V, A X X1 A., , 3' , A3 ,',-' x ,AAQA1 .A iii 2 AAA A A A A A .. A A A , V 50,4 5' . . A 1C5I2RX-:fl , .A it M V I ,,.-ji 157' .1 ,J I KIA I, Lr'k'. ,g ' I I ' 5, j f,Vi,f6l4ggg,'IQi r,', Z ,., PK . K if ' X - 1 A 4. Perm , V 1 3 I N AV A-f7R1QgLANP . , ,. VV,V ,ff.WARSLAy1 f ...X f ,, xx w Y ff? 6 4 Y. L A .1 , L I A1 1 , 'I I . .A 'F' , 1:3 'F P3 3 uf ' L .I 671 A 4 uf 1 .' JU 5 IA P U lf X iq' .Q , 5. 5' ' wi A A 2354, 9 VIII 'I ,, Y N A1 w N Y fx Q' 3 I 40 I I - ., 1. ' ' As' P 4 .sg K- -4 W ,- it . , ' 5 ' 1 A i A . ,H , A 9 LU I x Q n 3' 'Qi A ' x 'S Y S A 5 5 3 3 SA S . ii n 'S Q. i ' x W Q 0 QXF ' ' 5090 O 5 A wo? '-X A N A- Y. A - Q -A--I A1 - A' in 'VKSQSJN L L A-awww . A. . 5 5 3 iff' AA - . -.Mm 1 gm 7 mum K' W' Y Y E 3 l ' 1 , jr -A ' WQNY2-2k8bXxXxxxxx3.xmX5x, I I I H r 'iff ,. I 'IZ-'It 'xfa I , ,,9.'x - -' .Mgr i Q! f.. QL ,X ' X -'7 '. ,ii-. , .-. 5 A . ,n A. . . I ' 1411-Q1-,f , A we A 'C-02:09, 1 . ' 'TQ f--' ,' ,.,r E A J Q f A ' A I A '53555g5g5g3ig5gg:w 1rmsz1vs minimalwwmexf-IWmm4rsLIsneRa21Ii-':irfii::::1:Mf-sLAi-A-m,,:-:,p-,m,:Q,,,:,4R,v- JE - Lame V -0 -: A '-- A ' f -------A-----ff-W--' ------'- -Q -ily-'j 1'::rrQ1F-'-4 ....., , .1 A 1 I - sez I, 5 I . , L THE DLVE PILI ki ilu ::S...... .. ..... ..:::::z:r.::::::. -v' 'FII ' i ' ' r- - 3+ L-,f Y I I lf fi: 45 1354 :-:5 W .g I N f R 1' Y g Ch' Ph' 5 -7 1 1 N I 4 - A I f A Q I 6 S I I ODIEGA CHAPTER S I f IN Founded 1854 Established 1904- , IS: f 52 ff 1923 'N I I D, JOHN EDWIN BIGGS, JR. FRANKLIN PERRY LEAPHART, JR ' x I TIIOINIAS FREDERICK CARTER ARTHUR EROSTROM LECRAXV F3 I HUGH INMAN DUBOSE CHARLES XVALKI-IR SAUSSY ,Q MATHEW HENDERSON ELDEIK PENROSE TERRETI' TEAGUE I ,Q I I Q I 1 . 1924 IE: I sf 'N I qv L WILLIAM WILLIAMS AMOROUS CHARI.ES SVVIFT NOIITIIERN I In CORNELIUS ELLIOTT HEATH JAMES LEAK REEX'ES A1 I 2: 2 zsai: -Ima, WALKER PATTERSON INMAN EIDXVAIID ICING VAN XVINKLE v ,4 I ,gklv RUDOLPI-I GORDON J OHNSTONE XVALTER SPENCER XVITHERS I ny if Mud: 'RQI HENRY MARTIN NORTH IPX , m'.II1 1 'II I + ' 1925 Im' I 4, I 4 gunz I. 'l lv' E. -I ALBERT DAVIS JOHN PAYSON KENNEDX' :I cr: I V 1 RICI-IARD CHADIPION DESAUSSURE HUGIfI SAUSSY ri' I ,Q AI qs ' I I I CLARENCE LAINIAR JOLLY IIIIBII I if R 3 was JOE BOSTON LAMAR MORRIS gj I MARCUS BROWN FRAZIER PATTERSON EE I Q JAMES GITLREATII LAWRENCE PETRI I: . ' 'v' 5 GERARD HARTY THODIAS SESSIONS A 5, THOBIAS PIIILLIP HINMAN XVILLIS STRICKLAND NIEDFORD KELLUDI ANDREWV XVARDLAW fd I F' Z , sf 5 ?53 I S4 I I 5 5 I ? V K f J' I I I P I I I f I 4 I 7 O 0 . 50,0 O P , 'N I 4 O I E.. I. -I A Y YY-,-,AV my 0 . L 4 ...Iliff JSA ' - 5 ?55 .E:::.. Y 67 Y Y Q S- , ..-...-, A X .....,.,. w VO I I ' - ' I W I ' iS6b22P02w4'Xi1IB1Qf'NRWS'NYNNWYQfSWP4fY2fI04f-R S - 0 R2-Nez-crmrvxzfzflezfgzwrflzrzgszrz44-I-:wg::1r:n1wRbw'f4ww4nvmK I L , J , M I Q1 . L , . 21 ' I LION EL K- N Y I V iwiiiilgfgx ' 'I x L- Fggg5:::-- U I I v v I - . ,- . A .- 1 xx Pb l , .ZQJEDO O Ii ' 1 l . a , 2 X 2 S , y , S E I 1 . 1 . I S . I K c E E ff , I I J 1 if ,v ,N Q.' :f , M' f Q' I JIM III I If -- y A - . I- . 1- 1 'Sf 'Q U .YEELMH J. .E ..... , ' ' .,. 1 F ... I ' .. :i:. JJJ JI J 41 1 --:'-':-' Illini xl lllltuil nn.. ...uni ...-. ,. -GIIIIHHSIIIISIFO 5'. ' ' -12 ' ' Q J , r.. '-' log 'J N411 -I P S 'urn'n's'I:sInnIlIussns:-aa..IIuI'Em.Q,gqLq-AI,,,L,I:,,,.,-J .:.,. ,..,, L ..... ,,,. H ,,,.,, 1 -' ,,., .,,,,. 1 V . .., , ... .- -,,,-,, .-... ...L ...--, 7 ,7 - --all ,WJ i - ... I V' .s 29 Q5 2:12 f Q: QI 2 N. 4 fs If f' 0 0 O 'N Slgma P111 EPSIIOH ii - Tw GEOIRGIYX IXLPIIA CHAPTER 5 Founded 1901 Established 1907 N bl . 1923 , JABIES WELI.S ASBURX' JOHN BELL GILL N is MAURICE BEX'EllL1' ASBURX' ' FRANCIS MARION :KIMBLE 7:2 g VERNON LYoNS'BORUM EDWARD POPE IWURIIAI-I f - HARRX' LACOSTE ELLERDEE HAIRIRX' XIANE STARDIRD '14 I J Rv L 1 j . 192.-L '-un' . T' P HARRY RIC!-IIKRD IXLLISON XVILLIAINI DONALD HAIRTFOIID I E ' .I I, WI JOHN HANNA1'I BOOTH COURTLAXD COOPER JORDAN Nuff 1111.9 JOHN JACKSON BROUOHTON SADIUEL GOUIIIIIER SELSER ku 'J ,..q' RQ! mf, I 1925 GE ,lllll-L JAMES COLEDIAN GRIFFlTI'I HOWEI. BATEZSIAN HUI.SEX' , GARLAND REEX'ES HARD1l'ICK CHARLES ANDREW LEBEY QP' I 1 JJ AT,BIN ODIBERG HOLDER J J A N O - 19-0 7 v D Y Ii 335 VS EBSTER COLRURN BROXVN DOWVNILG Oh ALD EI.I.ER HENRY HARRISON EAGER THODIAS LESLIE MOSS, JR. ElJ1K'ARD JIZUNIES HARDIN ROBER1' ED1W'IN REEX'ES V v THOINIAS HIRIKDI JOHNSON JABIES DREWRY XRJILKINS . L5 V HENRX' XVADIPOLE LIGON I IRALPH MASON XVOODSIDES J 5:1 .f IJ' 2 'Z 2' 3 r f P Q if 6 9 3 5 5 if af ff' r J . 5 N' Q O cgi? C633 4 L Q YW -blbi i 0 . 4 Dwi: J Q, 'E?EJ::::.A- A ,O Y ,- X ...... l .A V' -' w wi xwzwznmwawmxxxxxuwxfxmwwzzoxm E , S JN g,1Q:g4Nw5,:-f,,pf,:4-:ganQ:-xfzzzzrr:cf,5:vQ:1zz2v5mmmwwf L v J ,S V I., F1 L , ig, I L-Om A Xf fiwga, O LW ' -Q - 9 .' JA . XX 2151417 ,fjiffbb C S3 nf' D LV E P P, N T 1 K , I. ,Nh .U , , H if .1 -1 1 ' Q, -,. . , 7' 445 -,g , X I -. W 4 ep. 1' . K . xqwgm - 3 - 1 A-If-4 1-. if If AQ! YE,Q.:..,,,-,.J . i-,.141,,,lfn' f xg f I . 1 ' I X 14: - . f. E' 1 gui gi ul 1 - 1 A 1, X L, ,,,,,,,,,,,,,,,,. 91: ,,,,, , rug ml ,,,,,,,,,.1h1:hR1111111 -1.1.'. ,1,.,.... . H....,........1...1..1,1,.1.1..... -.7 1- .1--111.1-1111.11mmm.fmmmmmmnm m um 1 1 1 I 7' E 'I' ,, :aa F 11 1 W 111 11 ' ' 1'1 . 11 -L 1 ' W M 'll I M ' f 1 y ,,,, .,,, W V' ' '1 f 1 f - -- .--. . ....... ...... ..... .......:....... . ..- ' ...........:..... -1 .:......................... .. . :m............r.....:::.::::....l.....:. . . ' 1, ' 'XX' XI! 7 1 55 ,I . .,. ,. 1 o :Q 0 'Q 'Q o ,o ,. ,o 'I ' o 'Xi LA In Ir' . I l'f',I M--1 W' ,. -I I1 1, L 1 :Pi P wi 1 -my mm 9' 5 42 if f, KV! 'v 1111 Er. '? y W' 5 5 4 4 1 Q I lr bfi 1111 .Q Wm 514 LA 1 ' 1 1 Hu 1 ' EE Y 1 w 1 P A W 1 Q 1, S S 2 x 2, 3 54 N gl 5 'Q XJ 5 Q1 M i, -.Ah fgvdi 'E 1 5 fn A . ' A S- ' . ,q , 'T'1TSSSe2E ZAf9' .EgEENsila?Zg??' gf. .QiliisgmiilKnlgimggg:HI1:I1sm:mmInlns?mIn1IIes.esmu11mu1s1'I1LR.lfaiiqkfum, -' Tee: '-...,.l,.,,..,..,.i, Wh, 13' 7'-, A .W . - 7. ' .. ..-J 4 I , 1- I ,Q If , L . , ,. Q 'R' ' X tv sf 1 4 A M f 1 , K ' I I I 1 mn. -,Em-I rl fu m I .-S -,. ,.-.,.,,,,- ... ,, , I. Q ' E. V ! ! mmm.........p..I .4:::' ' :::::::::... 'A n... m::r'::::::: ::..... v ' A .-,-. . II s A Q -n .1 .1 -J . -:md TELNET :gferg II f ' ag .um I --- O ,.-,. - . - ' . 57? ' I 32 Q' I I L-5 24:2 V .xg I 3 PTIK P ' 3 e 1 appa h1 S 3 -. ' A .5 IA g., N 2' IOTA CIIARTER 5 . Rx is 55 :- Founded 1991 Established 1913 S N O FRATRES IN FACULTATE 11 K:- 5 COACH C- C- GRIFFIN PROP. J. L. EI.I.IS ,EEE Q Q 1923 I I Wi ' GERALD EU1'SI.Ell IXIIDIENTROUT JXRTIIUR XVILLIABL HARRIS EDWARD ROGER ,ATCI-IINSON, JR. A CHRISTIAN IQOIILRUSS I CHARLES STEVENSON CARTER JOSIAI-I PUTNAM BIUIIDAUGII f' JO1-IN HARDMAN BAKIINETT JOHN XVESTCOTT ROURK . HIXIIRX' .ANDERSON BUTLER XVILLIABI TIIOBIAS REED ,' XVILLIABI FIDVVARD DIMMOCK IEDVVARD SCARRYA SULLIVAN I L' HENIIX' BEVERLY CADIPBELI. GARDEN FRANCIS EDWARD XVI-IITELAVV A-f' A ' umm . 1924. b up WV' -a All'l'IfIUR OSSIAN BENTON ROEERT LEAK BJCDOUGALI., JR. 4 1 V ,Qf'.ik BIZETT ROBEIITS HAMMOND IQICHARD BUSI-I MORRIS If 1 I I ' .I 1:53 JAMES CIXPERS HOIJDIES HERMAN EPPS TURNER .v . H1116 JAMES HERMAN LYNN, JR. - ROEERT CADIERON XVATKINS 'E - 41111 1. ' 'N ,mb- X 1925 W V I - Vo VA A 7 1 4 'I I ARTHUR BRYANT BOAZDIIXN, JR. GAY PAUL IXEITH IIN. - JAMES W1KI.I.ACE GRANT HAROLD ,ARTHUR MCKEW 'N XNVALTER BRUCE GREEVES LIARRY HU1'CIilESON IXEDWVIXE CI-IARLES TI-IOBIAS HILL LH A 1929 BIARCUS ,ALONZO COOK JOI-IN HAI.I. NUNEE 45.1 Q XVALTER SINCLAIR HEIDT LOUIS TAVANIERE RAINEX' GEORGE ITEITH ALEERT MERION SINIITH ' PJ E THOMAS IJITCHFIELD ICENNEDY CLARENCE XVALLACE SDIITH 4 XVILLIADI LOXVNDES, JR. EDIORX' I'IARVVEI.I. SDIITH q fx 5 STEXVART IXNDREVV NIARSI-IALI. LLOYD FRANKLIN SOLODION . XVILLIAM GORDON MERIWETHER JACK STEWART QQ: -as HARVEY DUNARD NICLEAN JOSEPH JOHNSTON XVIBIBERLY if sf li 1 I - A ff 3 S H 4 5 5: 2 f I A ii I-' 5 : . I .,+iYf .. 1 -I .- . A 0 - f Ei!! W 9-1 N- Q 7 f -f- ' . fx x W 'I ' H ,,Ex,W,, E ' zsggQqQz4Sgg:offRffmzcpwcfzsys::mr-:-mr-:::2r:N:LQAwfNxwxysS , V 3 Y' 'f' 2 ' li A '-'ONEL K- ' 1 ., LN' O 7,3m?iu ,ifgfbb C S463 ' . 'X , I , '-N., s , . , ,, . 6 -, ,.,-,.wV-hqxxljtb . . Mlm f-o.,C,.,,.c,,,,,J 'dd' s ,1-, lv J 2. 1:I::::gg5ggi5:5:iii:::55555E555::::::::a::::::annnxaaiunianmaammmsnai:muahQTEK-5Q:.au::uiIu1:Q5i'ElLQ-fum -fe-- 1-1-,mf-.amnzunsassy:--limgilgnuv-Q'.fA1'f:If-ws. I1-- A--Z--n ---- -1 :-:- I--fi -:FilmM511--JST3.-f1 bZif?i'nn1mmm-mmm. -1 A- V mei ,gras-asian, X B - A w 'I' H D L P ILI :I '::: - - ,,w 'u , 1' N -1 Eg?g?EEn xll:1:5?a.... m.... ::::::a::::::::r.a:::n::.::::::ra::.u--:azz ..... an --'- -::::::::::::::::::::::::::::::::::::.:.:::::::::::l:::::::: '::::: ' : ': ---'- gggggggggmgggmgggggnggngm5,Immlm,:mm:,,Hm::,,:,u,m,m::u:,..m:Q lln' W- 1,52 r A, N ' I ,ww b Z 'f 7 3 ?' 5 ,, 7 Z 3 f if 4 5 SKS, 59 5 + 5 : .f. 32 .' , 1 54 ' 6 K' 21 E H I '-Illlu ' ga' 1 lib H Tr J fm. YEIPQ :P 29 ' J I ,-nm-L Y -r ' iff' Q lu I , E . S 2 :::::3g1 1 59 rffgf ? Ai if f x ? xy ff' 6, 1 f 4 4' ,. 5 5 . 35: '? .. of! 3 ,.. ,L 6 I4 0.0 5:3 2 4' . . :4 if ,. J 2 ., r : 'v ,A ki UA 3.-1 5 VY w 7 A v 6531 110.3 4 Q53 4 'ami 45 EE! N 1 s 1 1 Q X N 5 Y Q X z S. S w. 1 I S . Q 9: .. ...,,,,.X.xx x xx5. Q N E V I - ' Q S N 5 , 5 -N 32 5 3 3 S , ,J 0 GW Q-info , , N X Q, AAU .0 0 H 'Y f ' O -V--, 335555541 vt 3, 5 . Q L-N XQS I ,Si...- gssvsofxfmgwm-, . .wwf -2 .,,, 1 V W i if Ti V I M LMEL K X ffeez ggk '.-. frui lgg w A WwxxxxQiigxxg55gmxxgXg?Qw XX ,k y gba .:' -INN' TA- .. Ag L E 1 ,1, ' Q --1 , GZ. . L HHH: liii'EEE n 355555535221211: ':'Ia:mlnmmrmrm.'.1as'ass.sseaIe':I ILITZTE -:QW U m- 1 , 1.1 5 . m .- .'-7fv,-- A-:sl-ua - - :-::1li:?J.:1- '-5142: : - Eg.-l ':: --22 Z 1 A 'Q I 'xy X in ? 'Q nf' 5 ' N I MJ Y X Q. ' 9 ' ' ' ' f I 5 un fx x w-1 A 1- 'sl I I nu Hwwu 1 I I- I .um v nf -un - ..- .mm -. -J--1-U.,-.I-? ' -1... .mm-I ' Q- 1 5 ,gf Lf.. ......... ....-.,..,--,-,,,- . ... .Ln--iisi.msu..z........ ..........., ......z......................................::.-::.-:::::::::::::: zz:::::::z::::':.::-.::u:::um::m::::m::'.......::- ....:- , , 1 , f . 1 . ....... .......... ::....... K- - - v x 1 ' . . 'A ni 571- f--H-1 F35 E W '4 We 35: 5 Nj . Beta I heta P1 S 'S .Z Y r CJAINIBIA ETA CHAPTER ', A N 5 Founded 1839 Established 1917 Eg :fi FRATRES IN FACULTATE fi ., K ' :- PROE. A. H. ,ARBISTIIOXG PROE. XV. V. SKILES S PROE. T. P. BRANCH PROF. J. L. SKINNER DR. J. B. XVI-IITE . ,N 5' f 1923 F br' L JOHN FITZHEVV Cox GEORGE JXLBERT THOMPSON RODOLPIYI FERRELL HIXUENSTEIN 'FERIIELL HARRIS TUMLIN El fl .' CLYDE MARION :KENNEDY JR. XVILLIADI HARRY XIAUGHAN 4 :HIL -v any QR MARSDEN LAWS BTARSI-IALL HOUSTON LONGINO XVELCHI 1' ' wg,-.1 nw QQ! ROBEIIT STRATTON NEBLETT IPX mul? 12,1-r Ulu? .-4 VH 1924 Q. 1 . II . JAMES OI.IW'ER HARRIS XVILFORD THOMPSON ll ' 'gl ROBERT LEE HATS, JR. I I4 ' IIN 1925 4:1 v b TERREL ALSTON BUSEY JOHN BELGRAVE COLLINS THODIAS SANDERS BJLACICDIAN EDWIN SYLVESTER THOINIPSON ENNIS EW'ING CARLETON, JR. 5? x 4' 1926 V I, JOHN LAKE BROOKER AFRANIC PLATO LINDNIQR .5 .- -3 gf FRANCIS JESTILL COOK TIIODIAS ALLEN SHARPE r' 'w Q GEORGE ORAN DIRAPER - BERNICE TIXOBIPSON J 7 RUSSEI.I, THEODORE FISHER 3 .4 E 3 f s 5 O O f 0' ' v F 1. X Q-GLA 'SEQ' 5 , O F - N o L ',., O Q O lb N QI ' . . ' E... D 4 LA -, .,.....,. 0 A -AiQ55EIf on '- J ' . Eff? . A - --1 .. . h- 'l' I ' is-: T iEEi::::: ' J A H ' Ll0NEL K- Q ilxixilii -:'a.1Suu. O u L LX v D . - 5 ,fo O '1 X 2 PJ ,Q ,- .9 ,ifwhl .-,,., . V . I m so , .,.,-1 2 , . X .- I n , Rx lf7 Q, I X ' , ' , 175174: ' ki9251, HI '?m.,vg . V ' ,ff f . A , , x . . 415 A8 Q-:..,c.-.,.c.- 4 N 1. 15 -13-,sr N A j, W' V... iyl, 1 MAN- 3.5. :f ..., .-:4b'F-'g'? l f+- ,al I ' 'E' 'f.'?! - ' .z-4' ' V' 'TZJ' ' 3-5f5.f-6251 z! Bn' .. 'N1:N mlm:lunammlxumrlunnmuxauummiummml-.di-ffimf.n..n1u--X-.-xmvxuaguaunnnuiifsmwnun mm-Inf-aim-.:r.--.unuw--1-I-1 1 1G:1..n.i.z-'G ---- '-.-i.-1---1m.,,,-,mv mm-m 'mmm V - mnnwsm . , Eff ' - M -wc LQ' +- , A ' V 2 91 ' '1 ' VH ,n Q Y 1 , ' :X !!l':w M W ix E P f IH I X , A.. ,. H, ,W L E rl 4,44 W - n ' : ' h'5iilIF3115EIHHHERBllHIFIIEIIIIIUHZIIIIIIIIIIIISIEIIHHHIIIIIIIHIIIIIIIIIHIHIHITIIIIIIIHllillfninliIFISIFIIILTIHHIHIUI Hlll'lIIlilII:lf l5ulIB: u ' IQ Wg 'GZSW lb: 1 6 s 2 V g r u. 1 f 4 , fx f . 1 1 ? ' ? l z , A ., . 7 k x f :- mf. V 1 if x . , - fm V .,w:VWr. fdfvw' , 4 ER ,, .- 1 V QW V4 '-SPN QDNEWO ' ,.f: : A 5 X V ,V Q. ZZ Nywkl iw lb . . . ' x- V V .i sh V V f f I f 2 V '- . K! ,V M39 ' XX x . . 71 1 V 'VBRAHQN , -9+ f 'iflpfzff 4 tt 'K . V W Q-4 V MGASSEN f ,f ,Q g . M 1. Q. .,..' 'Q X . I g f W , , 544- ,,,, L 11,5 ,W V , X 1 - ' 2 ' , , ,,. 4, E: , i r' I z fx I I - - 1 , , 2 V AH V , ,- V V gf, V ,- SCLCARNES , Y3- , I ' ' ' .ff ' QQ - ' . ' , -Vg , f f lN,r-uywi ' f ' ' ' 3 , 5 ' , 55431, 1- . I jf . V 1 fdowmowf - A . V1.1 f 2.. x H .5 I V' . V Win. 2 Q55 CSWEF. I 'K' 5 ' V, ' , V I ' fgfklfff. I ' 'Y i' ' , , V '79, ' W, LV - 'n , I ' V ,' , ' A AMNOQ7 V f VM ,,,'WNRQQ,1xxfJ L Q , J ' ' WW . fw-wf yyvx ' - E' . ' 'f' V' fir Q ' QV E Ei , , ,- Vi ,,,N A K :Z .ug V J- Q, ' FERGUESO V ' ' 'Fav - ' V, .Ag V 'S Iggy I 5 -'73 V I ' L, - ' lf If ' , f f 53 ' L4 4? MV. ,. , '- 11 ff' 'F 1 '- A V-SVK ' P V 1. wWw,f VV: V 3 ,NMfMQwwWmVf .VSfwa1w 2JV 4nG , V -V ' . ' it ' ,-'f ,Wf ' -' -f f ' G-'A H ' 'ff '1s 1214, 'Inq U1 I iff ,.,, 54 ,- . V 1 M . gif, ffm 1.1, 'yy 1 ,, V , lp ..' ff ' :up f V V 4 by '4fV-:fwu Q7 1 f '55 ' B I P ' VV., - 'ff' 'f ' 11314 'WX . V '--,, V. 1,5 3-ip, ' V-.iff-jf' '--' V ,Q,3,C,-,'fVLV7 .' L V' 4 Q , x - -- ' Gd , f in , H dngm g .I X, rv X! 1, ,NMHCBREYEW V A it ui: A M VV.-f Q, J V -f ' 7 f?'-V, Vf . iw f ' 1-W , 1 ' M ig , . 35 'rgff 1, ' I f ff l X, :IHS W ' Wruam f ' 'A A' V f m 4 V 'D ' V , 'gg Q g va. .35 'N 4 gg , , P , - , fs ,X ,V V g- . ' f T 1 V A -' W ' A b KV f' , f V4 . h,,ylf:V5,-J , V X' ' 14 - g . . kr S ' 4- M ' 'i V - 1 -iff.-P -Z -, 'f ,- H V Q , ,.--sq if .Fifi ' - ' ,YW , . X Z3 :,.-7 . -.,- W . x K V R f' 'PN . f A500555 QQR RSY5 ' 'Ja i' ' V ' Y Q , - V A ,. Q. . , -f a V . . ' ,, .-1 - . V A , V, X ,- - V Vz, 1 7- ' . i Rmpqgrvfj V, 3 Vi N r 1 . ., K . . nf gigru - . Q X X ' , 4 A 21 AEK ' X is V V' Q ' 4 -fgf, ' . . N V - ' A 3., 1 V K , - 1 -V: . ' ' 'OM V 0-EAWOODS, Q K .1 - .V 2' V , ' f f A K' ' -N I N if f'S,srwm14 , ' ' V ' 5 'H I 53 V R , '23 a-FJ , , , M ?1N5wg6N,f 4 1 x . .V ' ' 'A , . - x 3 f f ' LGRIFFYN V V , u, 3 I S Lf 1' + ' - 1 ' -N.cggwnEP- ' VS ' 4: N221 V N 4 45+ MEMCQLNY' -iw Y , V V ' ' Q J W .. G-V .- ,.., A LEM- X ,. A N 1 ' f IQSINGLETOS ,A . 5 5 ' . .- V 65,451-ix , JSR ,K X gy , uf . ff-KW: . ' 1 L MTM GL nr:AD 'AKHSSYW ' K . 1 Q . V - 1 Q 1 V w X X L Vi 2 S E4 S 6 f 5 Vx Q E 5 N -vifo of 'F 'E . JU Nj, O Q99 V f o Vg ' -'A-H ---- -V 0 ' nuiflfggf Ha ma p V v ' ' I iiiihfz 5. '-- . A- 5 , I ffnf:f29',1bowm29-5052295205 ' Jsasvfnwfffffn 3 Ts., , 171 1 -Y Y Ai Y , , to 5 , O H 'L 'I' - J If . K X ,mzxxfwxi:-xzxmxxwvxfwqwxxyxx - ' V :wig X -J A gg- limiazw O I In I M , Z.: ,X'RvXXXXY XXXg 0HfTf?6j V ., fkJ ' L reel. K lhxluh O Q M A L- o xr Lx 'LJEELR fo L0 'D M -0 Q -.'1.::..:.- - .f - A ,Q I . .Z 5 ,,'51nI,g,3g1g:: '53SmHBllIl1liWTm1'i'l!i1-H uumm nl-E1-ms .uf ' 5 A mm ' . f- fl .fx , S w f- X 1 ' , 1 , '- x . f- I ' I -' 55555555553-gza, I -.::. ....---.----- 1 - 1: 55111 1 1 4' ummmffm- J11-fm'mm-.,---mga-E-:asusxr--15: we-nf-rf: . - - - -- - f-'A D --- -A-- -'H IT 1 1 E.-:Quia hx. . .. W' V as ,-D + 1- no f S 4 X 'mu ,fffob 'u .1 -N ,'.' -.N If N NZ .4 YI ,. 'J :Z 2 N . ar- .1 V1 ,,- ,Q I Tr vi 2.13. T K I 1 '1 1: ... , , 1 4 ' ' . 'tu ' IFE ......... 4.1 ....., :::: -' ........ I N---H-f , , If-Q 1 . - I L fp . f , -N 4 I KYDWE A N1 il' ' br 11:5 Q3 1 .gli 1 Nb- . U U ' D lt S Ph S E I e a Igma 1 gi N -' EI. ALPHA GAMBIA CHAPTER EQ I 'S ,g Founded 1899 Established 1920 sf. ' PR 4 FRATRES IN FALULTAFE Pg I 4 hp. -f LT. R. R. COURSEY PROP. J. W. JEFI-'RIES 355 1 I E :5 1923 EQ 'g VS: ' SAINIUEL .PAUL BRATTON MARION KELLY HINDE f' ZACH ST. ELMO CARNES EARNEST DUDLEY NI-:WTON 4 LIONEL JOSEPH GASSEN R.AX'BIOND ALONZO SPITLER f EIIWVARD EVEIIETT GOODLOE, JR. BERT HARDEN WELLS IQ W V L UA Q . . I 19241 L 1 iii 2215. 4 , CHAUNCEY EVERETT DORN CHARLES AUBREY SHONESY 4 .m-I ' -'Ill' t b JOHN NATHANIEI, HUDGENS STEPHEN VAN RENNAELAPZIQ SPITLER V JOHN AUBREY MINOR , 1 H 1191 I ' 41 1925 1 ' EDWARD EARL BECK WILLIAM AVIS NEWTON, JR. y Q N' C' ORDIOND MITCI-IELL CARNES BEN ROBERT PADOETT, JR. M 4 - S s 1. J' IRVING SAMSON DODBS HECTOR GRAYSTONE REID H NATITAN NORWOOD FERGUSON HIXINIILTON BROVVN STEPHENS 'Q N BISHOP FOREMAN XVILLIABI TURNER I. Q, TIIODIAS BENSON MCBREX'ER DONAIJD EDWVIN XVOODS 5 1926 Ig 4: I Y , , . if 'g JAMES HENR1' BICICERSTAFF, JR. JABIES XX ESLEX LEBIA1 cf JOSEPH BRATTAIN HOWARD FRANKLIN McCI.AvE ,I DONALD DUANE BURT JOHN XVILLIADI PRICE l-. Ps 1, TI-IOBIAS ALTON CITESTNUT GEOIIGE LESLIE READ 1 , , v , N 3. WILLIABI NAPOLEON CROWVDER XVALTER LEROX SIBGLETOB v4 . , 3 LAWTON GRIFFIN 32 ff 'lf Y 2 1: , , .9 I' J If O M270 4 O v -. iv -1 02 'I' X 'Eu E A ' 0 ,. I..-eilgf' ' ' Q11 :ztgi-iiizs. R' ' 49 , - f N - L., .O,. ,..,. A I - .-..., . 4 I K , . 7- ' A . H f 5 '5 ' w N ' I V pg-:-Nga'Ewvxfrxwmxfzicfcufszvfxzzsrz1' Lf I L MW P5.w2Qi4r2QsoeN9QQ9Qa44cf.wmq- j 24 U ? sq jg Q Ay Q W i A A W ff 1 - --ug: I. . 9- , . I .ul . . LION EL K. 0 i'i'agExx E 'gk' ,,i5 ,Z 3 L LW o ,527 .I - 5 .S C ' 23 ' .AL- Asus ,f 3 1:--.-u - V V,-.--:-. , :gxgg5g5iggiggi55 n gggiiigggglz::::: : n 'lnililllainlun'n'I'rirui'rmmiGmlll 1 me umfmn :V-2 E ww- -V-V V . - az 1 my u--sz. -.u. --Vs .1 1 .. . -, V..-. .,-- ---- ns 1 n nu ,iigup Jhvlmu V 1: ,:. T b LV P ILI 1- I'iIi ' IRZMIEIIII' I'''K'XiHllilIiXIXIlIXliIll'IlI7'III 'Il lIII :lIIIIIIHI l !iIII I l-'l: II . lI!I lIii 5 I K l II1Il1Il IIIl'lI '5?n'353il5 :53 'T:HL -.-.....,. ,:2g,un. ink-EE' .......-.z...... , , ilIIliiiiiiiiiiiiI ii 'i'r ,. , 1 'Q' V 'nr s fw- . , fx ' - f ..... ui' -V - 1 if X 4,1-A-6 .K X X 4 V'- , 3, 'C' -:--of! A .K 'sg'-4 .xff - KX 1 x V --.15 .K KKK! qi?..a-.F A 7 I M KM, A, -'Q'-. -K-.K , K in KK U V ,, ,,,, , ,.,, , ,, .,,,,. .,.,. , ,,,, , ,,,,,,,,,,,,.,,,,,.....VV ...V.l,. ,V ,',,, H... ...................:...1.'V......:a '?V'. .-...-V...-......42...,.....4,. .mf .-. ......,. . ,, M I fl K ., :su l ,L all 4 WV . M V 1 1 -V A ffl n U IWXV 1:3 .V .V . .. .......... ..... .. .s . . x.: .. :.. :H .-..:'-. . ...........::................ .. .... . ....... ' - ll--V -f . Yx ' 1 r ' V V 1 V 4 ,Vu O V K A, 3. ,. 1 , , .,,. ...A - -., .,..,., , - V V X VVVV ' . 5 . K X..V. . ,.,. XVVXQX XT? X KKKKKKKKKLZK , zz K. f KK V f , f 2 X ' ,Xa .'i?LQg, V'-, ' ,ff .,-' ,X V -rf: f ,,-- XX - X: X . 2. ' V-ff X. X ' '55 'ISFXS-if lv ' 'fi r GV V 25' ,-,'L X-', ' f ' f--,V .'-,k ' f- g XKVX-6g V if-XX4-QA X Q55 - If K,gfQf.,V ' sri Vi V- fl 5 K. MQW, VW , Qg,:5KUQ9C4K 0 , QX , . W , V . it A V X f-0' , .V X' X, X V , X ,Q n h K X 53.5 KKVXKXK , 4 KKfXj, ,gg 0 V YC' , 2 V ,gV,K',, - f . K f'KK qv Maj, I KQ V? K V X ,,-k 3 V , ' - h . , X ,, ,.- V X,,VVXzff,wV s:X.V,V,,,- V VV ,.,, , MM , VV4 f ,, -MV . 1, A .,'. X K, X . , V.Jf?qf 4V-,ZKXKK V ,g g .555 i, AQMQQ .V - , X . V , ., , ,X , V . Q ,LL,-', Q , KK '74 xy , ,. XV? --Xlllksw 'N-,9: f.V41..-jVXXf,x 4V X ,, 'ffWffQfVX w f9?WfY5 QQLSSHVWX5 X QCuVVVgNf9 -, f-'- V L,., V -X VX , V ' , X ,V f Vf '. .- , V-KVJI' -uf .X xf.5,,f ' 3. f., X,w-,,f.y '3 Xl if Kia, m'AA lg :V ' LV ig Ky'-xl, X' 1fV1,.0gK ., V ,- 3- 5 KK kk,kf , .jK - - ,, 'K 2 K K , . ,X -h V V .-: V V V- V' 1? ,TTR V 'V X fm-g. X ' , 1 'X ,L.. ffgm'- i , ' ,' y v f' f- ff X 6 ' V 2 ,ff 'K..' 1, A fV '-3 ' X , ' V X' 2 X . ,k,V. Q: , ' X' ., ' g.'L V ' ,V - - 54 K V ,--k , 5 X5 ,V ,MJ - . V . A iiis, LK', ' g X X Ii A ,V,7k Q .,V.L KK KKK ,,,, X, X K 4, .xg,X,0Q6QKQ15UKK,,-,V, VV Q-K5,,gf1z,5X:Vg,g,, Q ,3P,JM- ,V I , V K, . V V 'L.' V f , - X ' rum' ,VV,V K . K VKVVKX .X! KV ,Xv i V -W.K,XKE ,K K KK K K ,, ,X ,4 ,VMKXUM V r f'L.' , V-mg 'XJ-'L V ' f . X' XXVVXQ-K, 'g2.,j . ' V, V 5 4 -,-' V gyifwfifv,-, X X.,--V QXV--w,f X f- X' K XV mp. V Xvfigw XefX ,g 531, QX1,-fi x! - ,,,VV+-V., gg 1 h. , X XV V 1 X Q, J 5 113' ' X5 gifgii 1V-i 'l,viX'fii? ,-,, X ' f,hk X , X 2 45 V. .V , V X ',K .PX X -KK ' . V V v' XL XL ,V KK H KXVK X. L,VVkk ,XK,K,K, ,K K .61 X Q ' . X LX'.' X -' ll X1 -1. N X f X X' Sew 7 ., X, ' x - , X, 0 , f V ' - g- X , Q K K! , ,-,A K :f fir, ',-. X , - 2 , . K, 'H K Ky' , l gllllz, K K, ,Vp M QKKK KK 2 ,5 fX, gV,- KV KK K K fllll' - V 'L' WSW T., Vff'?Qf?XLfL X-Ni X V LW7-X 7,-X,X'?fX! ,Xiifii - 'Q ,XZ 1 ' X X' .- ' , - V f X'f?+r??Xfffv':f+ f-X 'k, i Z '57 V ' V, K .ff :as 555 ' fV X zX 4,5 f'.' ,g , . 1 '. ' XVXVXX3 V V , ic ,-', g VV - ',-L V 535.-j X V , XX L X' V5 ,.-- H-X' ff V X-3 L' ,, 1 '-L' ,VifV,-ifi' XX V TAU ' X X 'WT .-if' . V H . , , ..,VL ,X X V p K: P V' fl ,ffl ,.qfi'k:fff4fVk .X 'N , .VS X : QQXVKK 32,53 K , Xkr..k,V. I K K LKKKKK K K K K ,K 1X 3-gf XVXV X 1gX+XX4fwVVWVVVv i ll V f- X V Q 1-'M' -' , ,--,,, :gui X47-'NZ-Z XX ,- ' X'-'- X X - ' - X X X M Xf ff V WV ,, X V X , X Y 29 - ,, ,, , ,, . v , ,,. V . .X VK f,L,V, K,KfVK KKKKKKK Vykyk K V, XK K K Ve Rouaih L',', V jqif -V:-VXTT-PL-f5fZifVffffVXX7'z. . XX? 1 ' 2 5-772 'K ' 332- ,Qi??? X V f ',,. X-,,-'A X Xx X . f.-5 V V. . -Lf' , .V , -':XfXVV X X XV V zxlaf, V ,VXf3'V?'?VQQ5?i WV ', X, z:', f - X ' -W X. . X ::i.?V:X V , , Xf,+VX.wz4Wf:Vv.U mm-- V X ,,-, ez, X ' f f XV 2 ,V V CDR V' . gil X X V. X,-k,'L , V- , - V ' :'f1.f -' 'ff l' fl ' V X1 I ' ,f if X ' ' '7Xf'f YXi'f3'U'X I ' X 'fy-V..,V', ,fa 3 V 'X X X' .. ,- X af 2.14 .V ,, ,X'L' XXV V- SEX-5314? X X 'g .1 'X V Vqgg X , VVV V.Q..s,.,v xg k,k.f., X ,NV-f.: - X X -V XX XXX X X , X HQVX 7 I VXX XXVX5. X X ' WXQW, ,,'k VI VXXVQJ' Ak X .:, if H .X K . H X 'J gf- VX VXX ' fi 41, if V 5 V X ' ', V w X Sf:-'-' f ,V VLA'-TERYN LL f ',VV '55 1 V V' X X--X- X -X X XX .jx QW K -4-- 4.94 , 2, Q X 'V ,-,Ax 'y' ,177 1 VX-X V XX J V ,-V,xVX,,,,.-V X, A V,,, A- , X X. V -, ,V VKg,X,,,lKVMVK.X Kxfgf QKQCM-VqxK XKXX K K X KX . 1 Z of I 6yF'gfiW S 5' 32Ssff99954axxff in U X' O 4 nmllil l mmawA Sf If K Z f 3 f f Z 4 4 Z f 4 2 5 4 f 9 I Q o a 0' o 'Q 94 'o Q . 'Q 'v 5 4 . . . 0 . 6 . if . Q 51 g. - C.l 0 . . J A :EE ri X : -I 4511: P1 lb V T' V g :P V W V: ' hm 0 an I A, ,VVV S S E, S N s N s X V S N S N QV S kV N S x 1 Il 5 x ,V XSEQCOAO K 3 Llnxl -'F W YJ U A .YC N X K ,Y K Mya-f Qt XK , X 1 - , Q , v V1 . VQ KK XX X- -V -2 -- VVOVVVV ,X X gg EiO X V ,1-f ffVX IX -fkh X V X V T' if X U ,, -,flglltgi K KK ff' L x x Qgafy ::::::::::- 22 as V V V. V z V N V r V1 7 V 6 I f V 5 3 f 5 . 22 Eg. 'o' P' V fv G I Z 'G ii I4 V 4 gg. 55 .9 'J 5 V :Z in I U 4' ' o r ES il' VI Y :J I Vu: f as X uulg n b 'W 1 W5 475 IIE ,V Q S4 1 V V E X S S Q Q Q E Q S L0 CX 41 -A .. ' -.I '- x A N. -I' S .Q 'va-q. .T W - ' 54 ,iff - Xi N. A J' fl 13 T44 f I ,Qi N., A. .l ,Z -4-5-.1 ,, , Q - A V ,- gE53515isE!gig:Innlgg,gi3555.ii::::::::w11x11r:1nu7'm ss1:-11seeaeuumsaa111ageZxTlQQ451:1a11f:,Zf'J5f,--nm- ---- .:.g,.,,,,,,5:,mm.zz1r'.f:I,'E,'3 .,:..--.Hu.:l.....2.u.2J,fm :,a - ' I 2 ....-. ...A A - A -.-- -. -V 1 IL... 'T um-'-H 1 6- E I i 'ga .wh WW' Ig I EQ L E9 P R, T 11 I' .. 1. . 1' 'P' ' ' ,N - Imam F.2i...... . ......, a:::::::z:x::z:::' V, , , . ,IH . 5 , , . VYV- - I V ,V QVYWV, , I .mm-5 nf- 4 9 41. ', 11 xf ' 2:55 E Z: V5 ? ii P5 D 1 T D I 'E Z A e ta au e ta gg f S fi GAMMA PSI CHAPTER Founded 1856 Established 1921 Ei FQ S 1923 3' DAVID CHURCH HISCOX MARION CRAWFORD VERDERY X1 HOBIER AUGUSTUS HOWW'ELL , f' 1924 Y 45 1 Uk JOIIN PINSON BAUM CI-IARLES PEARSON, JR. wx W1 GEORGE FRANCIS IDOVVINIAN HUGII ITIVIERE ROBERTS - .11 , WIIILIABI GOI.DSBIITH, J R. DEI.INIAlI DARIRIA' ROBERTSON 'mg gl, IRA HAIVIILTON HARDIN JAY JEDVVIN ROI-IIIEII 1 1,1 . WII.I,IADI TROY MCWIiORTER RICIIARD JACKSON SXELLING 4 1 ' P bk PHILIP SHERWOOD PAUL EDGAR CARRUTII XVALTIIALL 1' YQ, W EP 1925 gum. 'N ,mf ,A .. r I LOUIS EDWIN GATES JOEI. HENRY PAGE T IA' DONALD BURTON HOWE LLOYD HARRISON TULL ,411 T TIIOINIAS WALTER HUGHES GEORGE MCELWEEN XVYXN WII.LIABI HAILEY MARTIN 1926 WILLIADI ALEXANDER BOSTICK THOMAS CLINTON HUGULEY WILLIAM MILLSAPS BUTTEREIELD WVILLIAINI CARL RUSTIN 'Q MARION EUGENE HALEORD GEOIIGE ROGERS TEIIIRY 7 ROBERT PRICE HORTON JAMES WARREN WVHEARY 5 5 S? - 3 Mx 0 1- ',, .fffYO O i -J I, ., 1 Q, -, 1:-h V I 1 11 2 - if 1 , W- Q I 1 . A . A 1, 3 ' .- . A ' - V I V W I , Hnwmowfnfwwf 1 YXAVJX 5 - 5 1 3 : Crm!-f99fWS:2S,Noc!aWVfff0'fff725f4'f'-' N L -3 F. ,IA A ' Q 1 L ' 'YA 'r g ' I! A A' 'lf-In W A..- ... ,O ' U K E 2 . 4 :O ' O -4. rj- c 7. ..- Lnopagl, K. iginiigx ogg g. .... .' - LLVY' X Rb .Q zffqb qi i w -.1 ,W 'mai I X , -. X w EW. x 'tj I f' . , ,P-ij' . Y I - 15- X - xg . , . V -- -rg-..h ,V , , ' 7, I ' YI T x f. izffipl q'b'a Qo'6-5-ff' W, if J L 'iiliiifliiiliiiEiiiinxmmmsg:::::::::::::mmmanmllimlfiniiimmlussxasmnliisii,AmmanH:If!hQQf,R::,-mm--w1-m-safemguuun11umm-nu-nuuvunurrw-M. f--1:mah--r,------ww--Hwwmvm-vu-ww -- 1--'---'-- ' ' '--: I w-E iggggs' :mah ,ugihiiyq W I mv' 1' '-:Sb - j ,: LE: larfim :Lai-an . . . ........... .......... ... . . J V Y x IU 1 i w w 9 , , , . li!-K--Ania:-IN.,-irgwzas ...... ...,........ ...,, ...., ,,,, ,,,, ,. ,,,,,,,,,,,,,, ,, ,,,,,,,,,,,, I l-,',,,::,:m: - I -gnu. --::::::::: ugglum-gl -'- ----'- H---3ggggggmggggqggggggggggggggg mm, :iiiixillllllliliilliliilfillillmff' :53775 L ----- ----f- .dx,..,,f r 'Z 1 2 ' f 4 4 Z f fr 1 4 i f , I : , V 4 w 3? Ir. I w T N . JI 135 S - V 1 :HIL 1 ' Min lm If ' iw, null' A lg,..'4 X U 11' N , 4 , E N W 'mi ' ' ' ' l'?1n fnuf, 5 'IF , v 1 Y Y 7 A 5 -I- ' N N W K 1 v 1 an 5 ' S , S X4 Q Q 5 S 1 E E S i E' S ? S S 5 S if S a A' . X 'S if N S Q N if E if N Q Q S A S N Q S N u M 0 xr-' ,SCWO A 9'e:!'4W,Y 'x 4 O ' f-N W ff g, ' ,,,,,, , 5, X A gi fWW5fMfWAQWA9V 3Q . X K 5 - .X gflw-5:qA ,5 ,-, ,.,.,,,---7 - 'w ,gi ' N ah-'Yan if , ' 'EA quit' ri- -H53 - I '4'Ml I ?1L?5?.t::ifrL 'PggQ Q '4 K LION 51, A in f-, IL ! H7 Q- -H14 -ii Illli 0 4527751 is 'iw ,--I M N 'J Qaesl E W x 11 ,, 1 - ' WL 1 W uv gl . 7 L 5 pg!! 5 I 9 5 f N. , 1 W, x:! 5. 4,2 f. P f-as ire 4'- .-If HQ IEP Wu I 1 1 lilac ' wi' ' mi lllv EE! lm ,- 1 1 3 3 af 2 x S S S , 5 'E S w Q 0 , F QE Xl LIONEL Q 3 :Q A ,as-:::.Q 15. I 332 ' ' E 5 5 5 5 44 4 4 4 4' 4 A 5 f 4 5 5 fs, I .4 . V P I--an R!! I P4 7 sex: H EE -lllll auf ' If P IEIEIQWE RLS? I WMA dll' l ' U A9 Sv if S S E:- 9 5 E ' I Ii 'I ,A f f - THE: DLVE: PPCI HHN!! . ....... 4' : : :zz ------ --- , ...Y -, .., ,.,,. . F512-'H , , I I GN I f I ' I Y X f L X, ,M in f ,f , -3.3.0.2 M- X 5' MLA ' H.:-1, - ' 1.4 ,Q -1 ' - -.. -. .r : ' Fm 1 HKU' ggi1: ':26m1w6nItniwiW1uir:4mwmaaaisuiiissiziihiitlxm-an-fm-gf!-.1-f-fem-1-.--S-Sigma-swam1-Rini? , -,- .A1A..- - -' - H5514 34? ' ' --- --41 --..4 -.--- S-53:54 '?!r!m:::a::-- . ....-Eg W , 1 ...- Q li Q yi ' up I I P 1 L' y I 5, U I 1 5, 1 f I It , 4. T... I I .1 s -f ,,. 1 V -. ' V , XI I I 'QW , . J Sigma Chi BETA PSI CHAPTER Founded 1855 Established 1922 FRATER IN FAC ULTATE PROE. J. B. BRADDOCK 1923 WINTON EVEIIETT BATES, JR. HADIPTON LAINIIXR DAUGIAITR1', JR. ERROLL ECKFORD WII,LIA1SI AUGUSTUS ED1W'ARD XVILLIAINI HUNTER III LEWVIS GORDON PITTS LEONARD ELLIOT BATES LANDON GARLAND CLARKE FRANK JEFFERSON DODD, JR. ICENTON BRUCE HIGGINS JADIES MORELAND CLAFLIN FRANK DICKERSON FRED STEVVART GOULD BENJABIIN HIXON MCMATH THOMAS GII,BERT NAEORS FRANK DOUGLAS NEVYISIAN S S, JR. 1924 1925 1926 I Y-iw 4' EDWARD GORDON GOODLOE EAXRNEST CABIP RICHARD EARLE GORDON THOMAS, JR. XVALTER CHANDLER STEVENS NIARTHANE ELLIOT SANDERS ANDY SPRADLIN JADIES O11'EN STAKLEY CLARENCE JULIAN XVIEIITE, JR. XVALPOLE R,AYDIOND OTIS BIATHEVV BTAUIIY PIIEWVIIT DONALD RANDOLE KARL ROBEIKTS SALZER LOGAN EIDXVARD THOMAS ESMOND XVALTIIALL I : :X-1 lfgiil Q:I'C:, get 12.1 'llc all 'Nil P -2-I I I IN: gm R N Q51 I IE?-2 9 I MQ! I L ,f 2231? figffi I 15553 1 E91 .Eg VS . I I ul' l,:E15 'WEE I+.-. I 555' I I MIS? ' HQ-I' 1Qf 1 il? .,a-Q4 N . Q YO EEE l b t r W' war 4 V? '3 fw- r III 5 'I H1 1 ri Q-: ra J J 4 u'J C- 45 Q-1 P 3 :a .U Q1 .y F -9 75 :E: ,, 7 if .51 5, :Q 2. 5-'S Z 0 L ' ' . L .. , LIONEL K- ' ' ' in- gig' W4 ' 'Y eggggnn 0 LLVE XR 2 uixf JA .L ,X 9 1 ' r a P' ',.. O Q V I O9-.4 - 1 N v -4 KA - - ,----.. H- T if ' J - 57 ,- A K A A . -x.xI2mf295oxNxNxxNxxxm.N's:yNw.s29sa2z1Avo6oI :5i ?r'e5:g4aQ55..11S::-:,:-454:-:gr-DCQ.:-::::-1:5 325:Iztzglwyozd-:ma::l:z4f 'x -1 ' XX 'Eliza 0 'RA-A, . gif-' V' Y Y D, J 5 A, ,fo Q , Q gin 4 'Vx I -2 'n .I 0:1 -5 4,4 5: ,. .9 5 'Q , Q a '4 I 4' ' I 'Q I I 4. V . I o 'vw- :EE . x 9 NN I 5 Y x J - V JI I F 1 N I 1 9 X I 4- 1 1 Y! ' I I.. ' ' ' ,Q 1-'f M V I I V, ,. , nf., 4, r A 1 , J x -.,., M I 5. I , M, ' ,VK - . f 1, 1 1: I 3 ,hi I u.......m .mms--I-n-uns.:-xmfsml-.I ax..-5 .mm wuams. ILV In. V-.4 mlm: nu--w- we -u a 'Tn 'VV-HH - fI'Hw--H--1-'I--'ww 1 -v-7 v vvfffv-v1'f'1 1 H ' H' 1 ml , I . ,,, H 'L 11. , H4 5'-. , ' II! ',I QA pl 1 ,Q A L C '--Y 4, , '---cw-: QL f ! FL' V 'II ' 925 . L . 'S ' r' '. V ' I -9' ' V 1 -mu: gmirimi- -..... i ........ . .... :... H .... hw.. - - -I-1--5346 LL' ' L ..--I- A In .L 'er-.V '-F :L :jmim mum Us E?5.,...E5E-::- ---:il-.-555: ---- - 1 ' ' ' um- ' --::-- -H em . asus - . I V,:.- .I -Q.: ,- -- -- - - ---.V-H ------------m - V : L53 I :i5,'.u,'ng:!uL-.2- aww-umm M, . HL III I V , IV 4 Il' If I IIN 'Q ,,55-.:-- ,nkigsgi . I... ........ ...........-..... ...... .. ...... .... .... ... .............. ....... ...... ................................. ..... ......... ........ ... ............ ' -V .mg V X F . .... .................-::-.......................... x . .................V.................m...n.....::r::l........:...::............:.....':............. . .... ......-,,::L ...... 'I Nx 4 I 7 ,VV . f 9 f X ? ? I -: ' gs' V' ,VV . . 1 f A., I I vu I I 5. NI h , ' V V, ,, I 4- . , ' ' V V f'-- V K V'V ', V I , .V th V V J Q . -if ...AMX 1 A X Y ,I I W ff V L ' fa 'U ' L z If mf: ,--, YV- If? V - :f l ,7 K -1 ,.k,r U., 1 V 4 . fy . p. kLV.k V kk,, V . X I . , 2, 1 f V V, ,, I - u ' , ' V V ' ff' zz .- ,' yuh is I ,.','hf'. gay V vb Nj. fh.' A ,fg.QVQ,fw .' f,77QV'g V v:I?.'V If I 0 - , 'FY .' Ig.. ,- V+ g.f I V .V z.'w2115AxorliV,.. , f , , ' Q' .L L UT I f5Ll'EL'.V V'f' L 'L V Q L - - V. 'V'LI ' ' I , ' ' 9 my 3.51 115.2 . - g Vi'gL-Q-.QSRANKLYY L1 ' -V. ky ' Wy! .f O: , VVIIUCLELUWS W X kkkV..k -K K . . QVV V A If f I I 0' L I L-' V ' .1.gL.f. F . ' JWW YYW5, 'V ' V' ' 'L -'- LL L- ,, V' 1 I' T L ' ,V L' L7 9 '?5 -L VMWL ' ' 'LW' K ff.. 7 ,,', V-HJC,-VL .'--' , V V ,VV 4' , I 2 VV ' V , ' . L 5 V VV fV 9 'V V 5 , V1 ,V -V .A.- s 4 If 7 f LH V2-4022 1 ' , 'WN LV. , ', L 'A LL X 1 W f.: kk-'f 2 L ifff 1-Y' - ..,v L . L iff! XV V' ' ff , I ,V 'g'g L ,-L. I. fi I V'V' V V I sp., 122 gj Wy- V V ',-' , , ' ,. Q au' z , Jggmiay L Q f A . ,L ,X X.'kL 'L , QQ-Vi 1 , V X ' V m V LL .' VV Vhh' ' . Ve V VW V ' -, 'Q . . .V,: sm 2' ' , 'V ' W I LL . 1. 'L I V fV V W-ww ' VV V ::V2:,1..l3 , -V V -V I ,k V-,h V' f LWL V, s-2Ti'V-' ,. I 21'-1, -' fix- : f' .r 2 f 3 -,249 ' , .W ,k'-'khV-k k.,, ' 5-' V--h I :ff .,., .mf NZ.,,!,V' I , V VV V 1.-' V V ' I ' V Q QV, V iv , ,lEWYATT.- 11,-W. lv sri: If V 13...-awiii tk' V, ,,KV 1 Q ,, A. -1: , -V ' gf-V7 .V-, V' 51 f.-VkV' V . ' -f 2 VV ' V II '92 , . V1 V V , ,VVV , 'V ,V . V V1VrVV,V.V':Vf2VVV. VV 'fffffw , V VVVV VV' L .V V V VV V I V' V' V V VVV z 2211 ' f f 5 JoNESL 'VIN' , Q,-I I. L L' VV., V k',LX 1 -V .. 3 V I.. ,il x if vm . LI, VI , mu ,V , A A-:ell I VL, ' L 'V VVV., l .Q .V --V..' I, L , E Jog nl: -mv, ' '96 ,LVL IV V,V-' L ,ffl m,V'V QV 4 :SI V .f , L' 1 TTI 'mil I 'ff' L ' ' G33vuesAF9i'L'V V ' L L' ' 1.65 V Ez 1 L ',-g f L L QI' pf .V , , 1: 1. ., , C. M, V ,, ,, ,, I I All , . if g-'V .' ', 5 f -'VV. '976fmsfI?1'fV 37 - 'UB , hvifq QVjQVjVUZ3 V ,',L L-..V L ' ' J ' -- tml: IE. , Vm.VV 1 I YW' '1-fapfowlf' I I fi V V.'9LVV1f !.V . ' U -'gkV , kk,, , II -4 HWQ ,V-., . V, . - . V V, .V,AV. , y , A , f. ,,-Vvwx V VV'V EZ . ,. -- -V,..f 'fir .V ' fa I llllll ,, .vm , V . , ,. fV E X V V' -- ' ., ' . V -V L. -'G:mavN V ,pn I 41 -V . , .',V V w ..V,VV,,- Vg? .V V I? I ' VV,V Y , WI ' Q ,,.'ffVJ, xi2?'f1',I1,' 1 ,VVV, V. ,. , 4 ' ,. L'f''-QL3lTTRii50Yf.'LV2VL L V VX QV - if V-k,-- J V f 'IL L +I V VVV, V, VV,V .V,VV ,HW ,V V n ,I , F ,L,, , , V. , k,,V . .WI .V.k,,V Q ,shigpglglx KW ..:R,x,,w I A V ' V, -,.' , .. ,V.V V',- -.fl 1. -Tw X j ' I V I' ' .. ,,,'V V, .. ,. , V Saas,-'..V IIN ' ' L' , 'VVg f K rf 'gg- 4 LV --'V fx ff V- s L .J L wi L! 'ffl .525 XQ. 1. LJLfff ,I L545' Vs LL Q L V U-CoV- LL V'V' -L ,--'V J? I Yi-Z Q'9iLLL'L9 . .' S551 S f2'V :, .:?7i' L V L L' LL . Lv--Q LL Q V. .L ,L , I V i Jil, iz, , ,V VV: , ,f V,7V:. ,r.L, E LVVL.. S K .L -H,x1,ggxgN E ' ..., .,- ' -V ,.,' f L , N, LL LL 2 ,Q , 1 ', L V. fLLV' ' . . I L X ' :R . fx . Q , V- V 1. eV ,.,. , W, p , ,','V er w., 'X' . ??a:zpE 5 L 'Z VLLV V V, 1 'L 'I 'g2iz ' f.Q 1,i., f ' LL. .V ' V' V .V ,Q '-,',L-' L' V XVV' 5' ,LVV ' Yifl-V. -FL' N rx KU' VVVLLV iwfrg rf VV ,V.:VtVi, . I .. j. V' ' 'I1g,.,!zIgNfq5h'i'i jj1. f, . V H7IVingViff4ig,'Vgj'gV'VfV 2V1V i2 ' XKLL ' LL V,V' 1 .,V'1 ' .V,. I .ii .1 ,lil ,VLK H WV' ,VK, i ikiiixf Q I V' fl .V V , , L I ,L , Li . i 'ifff L ll .,,,,, .- V . I AV' V. pgffggm f'L' 1VV'f'5L0l'P05fW,'V7 V, 'Q' ,ifw V -, .- V ' . !.L,,L, .L, ,lk?VV., .f.V:VVV ? H N I V J 5 , V Swim ' K. L' 0 V , 4 N .K I 3 WJ 1 :A VK . Vx . 'V. 'I Vf 'V'.' . 'VV,- L ' A f gg AZ .K ,Q ' K'iom.zw:xi L' . . .V oxdw ' Nia o J' Y zu, gr 5? I K V k x9S29'f956VlfS9SX2742S29' -J LIONEL K,' L ' fn Nh X 'SN -N IL mMmmmm1 xxmxxxxmxbm4gQ I S faux lg af I 4 Pqtfuu -VP' O o rw Cf! A + O V X , O ' Q-' .V::z..Jf 9 , L 5 V. Xin I , P .6 I I mm- I.. ,. . F' 1. I' 1 'fs ' F L - T W N? WW' ' 'F' V V Q W' 1 V .V X --. iggil'-'ff-VV VVV:VVVm.. nf. .... ,.v,-,,,..-,F S IJIIR 2 D VT. ...Fi KO .nm f' -V ----. . i L it , L- D J? - .nj 6 f L L x x . 4 V1 JQ55j 5 S S S S N S S E E S E if Q E 5 Q Q. Q N S S L7 ' I his ' I I null: 1:51 lung l I' r w ? VII I ' , II :L VII, I I sr. 52. u... Ii I li I ,I V, if If ' I I I I I, , IJ Il K 0 mf ' .J ,A gg J R I I S, 5 af I Q E I J LKONQL , 942: ...A k fm . 5 , ,SE Q ff!-'H 1 'X A292359 ' A ' M ' , ' .' 1 ' ,,-I- Ev-,Q ,wi I Ev -' -I 1: A f . ,,..,..1A . -'W' I Aw' , A L 111 In W S Q. - l Eiugpiggl: nz:ru 'nmn's,'mmnIllImv-mIlIIIuluI'rIIRvE:EEili::5f'.n: ..... ,.,g'1,?,,,,,,,7, . .. 'L' .. ,...::L'g'.'! , ,-,,, ,,,, '51 ,.-...-Js2u11rgL-L--'-4:1:!T!'1:1L:'- : M525 7 .... ........... ..::::::z:::.a: '. T? ,gm - V V wh., :Ft F-W ,- I U- 3' - ow' 41' fx F '14 3: Sf. gf 1 x I! E25 1 1: 'Z f I gl :T -T:-I 1 4 2? 5 Ph' S' K 1 lgma appa r . 'I ' I KAPPA DEUTERON CHAPTER N Fvunfl-'ffl 1813 Established 1923 I Fa 0, i FRATER IN FACULTATE f:E PIIOF. HUGO BRUCE DULING .g :N :Z ' :Q F 1 1923 4? 91 I GEORGE PRESCOTT BAIITLETT PALMER BICDOUGALD BQIAXVVELI. I 4 ki. if .I RODERICK STONE BRANTLEY HORACE IXLEXANDER MOORE FQ WL U DENNIS WILLIADI BROSNAN FRANCIS IQIGGS MCCLELLAX L1 4 A GEORGE HENRY ECIIOLS HOOKER EARI.E PEPPER k - g nu- ' NOYCE LOVIO GRIFFIN A FRANCIS AMORY SAXON i'fnf5' ' 2 'Sigh JAMES JACKSON HIGDON J OSEPII TIIADDEUS XVATTERS :' ln. .4 ELLIOTT FRANCIS HIGGINBOTHADI IRA EUGENE XVYATT ,QE nu ,' - , , pf l l mf 1, fa .NJ 1924 -, 1 mf, :j: '. JAMES MCCREA ALFORD EDWIN GREY' JONES Elle OLIVERY CLIFFORD ATTRIDGE GEORGE GIBBONS JONES 1 1' J OI-IN JAMES JONES Cox WILLIADI HENRX' MARTIN H ' ' ROBERT LUCULUSS COOPER CECIL HENR1' RAMSEY if GEORGE ANDERSON HUBBARD - FRANK REARDON XVOOLFORD A JAMES THODIAS JOIINSON 'YQ I 5 1925 J Q11 ALLEN LYINIAN BARTLETI' JOEL JAMES KNIGHT I JOHN JOSIAII CARR FRANCIS POWVELL NEXVBIAN XVALTER PATRICK FISCHER 2 p. 5 1926 A S 5 RUPERT GUY GETZEN ERNEST THODIAS MITI-I I, ' ERNEST LINWOOD GUNN, JR. XVILLIABI MCLEOD XVARE :Z E. I ROSWELL DAVIS POST 5 5 5' 5 5 www , -Y U, XO V Y YJ Y ' - - H In - , . LIONEL , N ' J V V -QQIEEE 5- AL- ' L Lvx X N- SM ' J 197 C A 'P 0 .vv J o V Q-ff - 4 I .J 0 fu Nez.. 53? i P D Av S1 -K,-A - ,A,Y - Y Ani.. l A 4' may-A.. 'N f , YH , X -gl If-N - Nh. 7 ,y -, .1 , . Reoovcvzqzssxxwxwzzcc-S55-Ego :fl Egg' Ev-. R':Ni:21QIzxizxrp-ffmsrkr-Irs?-rrfflz2:32lcv:-:4IVfA1I5:22Ww9WnmWy, C ' '3 ' P '+ fu ff? L Q1 ' 0 , G E: fb 3 V v A K IK 1. l C 'Q . '. , 1 jf' f - In 1 f l ' 124 if Q ' n,5gg5'351i,,, ,..., .... fin...IQ.....:....:..3::...,...'.:n:...:,m:.Q.:.f.......,...,... .,.,. ,..2l..,,....i1...,.... .....,......,...,Siw. - 1 ' -- zx- -- as GT aim: as u i ml uiuxhlimg -:-: muumum- iv- .X-mm--1 '-1- 1 '-v'! 4'1 fb' ' - ' .L Exiggiiriigigfixlii-'EEE-E-312-'Mmmxxul 1 In eu mm 1 in I n P R' I 1 4 wx! I I VMI E B . ..... . ........ --'::::-:::an::::::.::nu::::::::::::::n:::lu:l::::-.::u::l:::u:m:ax::'.::ln::::.':- - -5- 3'-333 --------' -'Ei-----.: Elifzqil- .91 W W .. N- . ........... --------.x::::::::::::::::::::::::::::-::::::nz:::::::::::::::::a:::::::::::::::::::::::::'::: :::::::.:.....l.: ...... .. mn:-nu. .... -.... ............. .. ..... ........... M In ' N ' I 3 5 5 f Z 4 01 1 r 'Z S , L U E E lzmpf ,Egg 1 ,g5E:' t.wAb 'sig ' 'P-4 Nw E ' , A 3 EE'-if Q ' ' 'sfbsrem ' ' n-YQ 'W Wa, fy- 4 ' W g Y 1 ' V x 2 4 s s 49 . xf X , I, ' - VHA ix M U Q S 3' ,i Q L Q' Q , ,919 E . - N 5 NUSSBAUVXW -Q 2 , Q Q V 1 'Z , E: ,X ICHBEWB T Q i W, aa ,, . W Q l N ei ! S f S 1 f R E ' I ' N 2 A S l Y 'z 0 ext' -ian? o 1 .. , ' ' I F .N Y 7 n. I fi - t . ...... L i.. - nm W A Y A AA , 1 . , , 7 -v .- X E L ' 'HR Q 5. 3' V4 ,KXXXXX KXKXXXXXXX new . iffwliii' W' -Q 1' . - ' A , . , 1 I V 5 Q 3 l 1 l Q1 .1 '1 bl' N .-4 ,- N. ,1 .'.4 41 -2 q A A A A 1925 11 - A .iEggg5i5?f5giQgE gE '::111:mum1ms?'mn1s:msammsvsuassss11xggm1Qmm:riff-Q-mm-01-g..:...Ase-1.1.1.-1-551,53 - -,fi-, F-- In -,---v A222212 T A 9 ' 1 -- .... 5' 1-M-M new In A UW lr' . 592221 1: 1 , , EA ' ' mn 1 I EI D H I V P A i ?:iillllIuS?f .::::::::a::::.':: ' - 'v-- 53. V ' l V rl 1 ,1,, t.. V 7 - v V Y Y 2 A V il :v Y ' J 'V 4 1 : -.-.1 V' K 'Z' gif 7 Q 57 'N 4 E: fi Q Phi E '1 P' PS1 on 1 N wr. 5 ig. ,X XI CHAPTER gf N Founded 1903 Established 1916 A f SEQ? 9' . Q 1923 1 1 IL QF 11. lg -4 1 I' WILLIAM COHEN HENRY Wumox 1 BENJAMIN JOSEPH EISEMAN 4 5 ' 4 IQ.: H91 - iw gm. 1920 , n Y wg MAX I. GOLDIN NATHAN A. JOSEL 'fig' 4 tllllg U, :IDE ' . 1 1926 A 1 1 1 11153 JOSEPH EICHBERG ABRABI LEFFLER EDYVIN S. EPSTEIN, Jn. LOUIS LYON, Jn. IRVINE GOLDINIAN HERBERT NUSSBAUIWI MELVIN HYDIAN JULIAN SAKS , 4? L5 -1 35' 5 S 55 3. 5 55 if x 30 n V14 - .1 af 3 , Z V A Q. , . . nomar. K4 ' iQu1,::- 0 - u , - LLVW X 2, rfb o P ' O 1 -4 j 6 Q L '4 , ny. o,. x i: S aim E xl N- 0 - - 2.21.53 A - -n ,555 1, Y f f . , ' r 1' - . I' x 'J T1 x?moQ,.vQmzNNxxmNmmwQQ4c4xxwsQ30 S Q . ER'Amfccbxx-oQf555'E:m2ww1zzrQ::x0:4-:-xfzf1z:ff22fgf.scoo555fQQQff.oc L ' yn L L ' i A ' 6 u .u.. ,. :'q ,xl If 1 D , ' ' ' '51 Q U , r ko ,H o J h ' JL 6 C1 ' '13 S ' 2 u 4 4 F-vi? A W YL V Y hi: J f '4 4 --W ..,-,, N, , -I , -s'm h2f4,gn V, lmf H' 1 N I ' - . ' 1 . - I - , - ' ,Q2.W 1192255 1 555555 au. www 5 1 'Q '4 IG'- '-'NKx.,3zgQ - ' -- ' ' I' FI 'Orc-c-do WQAKQ 'i-:INS wa rv J u' I Qggsisleg-Eigggi55m1g!gEg.5g5:::l:Himumm:miIRaisinninasmnsa19:ui:Ql: Q:':5s:,::u,IffS1lTH 1Qa1seuu4-isa-.1S'lxfhm6 -...- ,..1ffff,,,,J ...i. S..2. x.vii,.ma-1JGiX. g,,if,,,,..,,,,.,,,,,,,,,,,,,,,,..,,,,,H,.. ummm' ' . mr. GI,-7.ss::::!-.mg . mu :SW :iw Big I E, TFJW ,z WM E 1 Q M 5 MH rw ..,,... - MU 'N 1 .FJ 9. n .i .........u. ..,. ......... : .x ...... ::::::::m:::-.::::::sau-.::::a::::::::::: : z a as an ::::::::::::::::::: z .::'::::: ::::::::::xa::n:::::a::::::::::::::n::::::::::::ma::::::::x: 1. ::x. ........... , ii ...... E I Lf N :wi s Z ' E 5' 2 f I I X 1 I , , . , , , x I ,, Q 5 I 3 Q ' H I 5 Q, 1 52 1 . J ,. f z' H f . ia V ' L ,as f hfi If f K 0 J Ip 'Q JN Q s.l , , fig Q-'lla br ' Lbim Hung I d!v, I 1 A+ : A 'QA i 1 -4IIIl-A IW I + ' I +fm, nv! Q 592 , 4 g. 1 I ,. '5 N :I K X ,I .3 3 Si P Q J . S I , Il X S T ., S W 5 s Q ' E S N N I , . 'S Q I Q 1 , Q1 , O Gxpalvv 55570 O AN ll , Q' A -I ' ' - ' J MA 6 r- sxiifr 6 i g' ' X Q 4 f 4 f - 4 - I ::::::!':u..'N- V ', f f' M ,A K-I f , - ' ' - - V .. -- ,, , w 1 LION BL K. H 0 -i..,, all . Q yd .: - . . 1 - XNKXXXXxXX',2QNf'QX'Q. ,XXXXXXXX E XQL ,,. 2' . AQ ,wg--' --Qu rx 1 4 D' 'fix'-4-4 f0 ' Q 'W' F4 .- I , F 1 I WY In MV, Y V 'x 4 5 ? .4 . SL J pfv 1 'xv .1 y. 5 4 5. L U ILA 4 null! ' , Wx 90.2 4 .31 Wm Winn U W Q x S K 5 Q ummm ,. -A., 'Q 1 lj. f,fT2uiCZ?iw- A ff 7:-.,: .4 . f u'xm::mnm1naf1n--nzIramrss-'mx1x'u1'l--H-L--1-515' .-... -.....--.5,.- -,-- ' -.2 . 1- x 9 Y! 1 2 S g , X' If' Q f 1 -f-N'-v-N, f 4 , -:-c,-.- r Q , 1. mm, Q, I um 1 A I 1 , , , 1 aff. Z 2, ,Y I , puma, L S ' A S ax fr- I- ' 5 in IMI 0 - 11 rg QM1 wp 1 I , . S: simfiglllilxdfffk... .......... .a::::au::::::::z f- V ' Q A - ,cg ,l . v V A Fu- r H U K 'If V:- 1 K 1 . . 1 , '1 ' - - -'-------H - - V- -- vV--- - -:-' -7- - - 1--f -- - ---b -- I ,---------4-----Q gl- -1111 ,--.M . . I 5 we +- gg E 2 S I W . K ,1 N .1 1 2' - - gs . gi' Iau Epsdon P111 A 125 5 , , 1 1 III LIIAI I'EI1 '.'v 'TPL I Founded 1910 I55111111is11e11 1919 f - IE Q Q fb 1923 G . 11, 11' 4 n I , . Q01 LEOAAIIII MASCOT BI.UMI2x'1'HAI. IsI1,1I3I. HERBI.AX Inxxxsu : LII! ei: 'qml' T -1 1 1 --ug 1921 MQ' Jin 1921 aff' 1HfJ IE: , , QQ1 I 51,2 MEX'ER Gonnox VVOLFI: LI:FKoIfI' 1 r , , 1 '41 DAVID JULIUS IxIncIIIIc BIILTOX LEON lx1:I.I.1:II 1 , A '. -um-' - 1 ff ' ISE! U V 1 1925 7' Y M BENJABIIN EI.I,IS ICOBLENTZ EAIINEST IKUBIN' JOSEPH .ADOLPII MILLEII ISAIIOIIII SII,vI:ns'I'I:IN vs IsAnom3 I,EVVIS PRISANT E . E Q 1920 ' if IIOBERT NIARION COHEN IIEONARD PRINCE XVARREX 5 ESE Z E f 1.5 M 'F ? 5 3 ,I f' f 5 gf l F I IH gb 507, ox, w I a z L , 'f I L L10 N e L Q -sf'f121i',,!f' ' ' 1 . 255529: ' 0 1 I. v v X N. .,.. .- yr 5:7- X ,:,,,f'o'x 1' f 4 ' r o If .-, O 0 Q Oo-6,4 'Nix nn if 4 L A' , 1' ' 0 . Q L A 1 L. t ,, ,,,A Wi 0 .1I..:.? ,, If K ,A-n ,E h Z, xl- X wwmwmmmxxxxmxmmimvwwmxwgxgl ?:' nz ' gm, OQEQQQQAQQ-me-yyrwnmz-rgztfz:zr:2cfxcvfxQar l 'A K' rf lu IQ ' YA K I-dino 2 A I I Ai o 'Q J, 5: c '4 a - 5 Xar- N-X fi' L ,, gunning 11 15 DL F 'fl xenieiii.. .... , rg-gm,-----, --.,,,..z,,:............... .,. ..,..............,.. .,........... ........ .. ............... ....-.. . : ' N -...A - M, . mg g,qm..,g v., -., . .. .. I - m.. ..... ........... . . . U . uni' ll 1145 i2Egf,il.iEB.ll6tii..i Ililii ' , fu 'EL T .. , ui? . . .. , , ...,. ,,,,,, I . . In ' 1 Ji. . , , l x N X q I- ,IIII P X I , , 5 f , I VV III ' ff- 'h 'Q Y., 1 I f .1 4. 6 '-O od if . s T , ' I f, 'I V .... ...... .... .... .... . 4 1' - ..-,-:F:2'ig f .'f', f ff I 'fx 1 I' 'V' LIggy,5i!i:g,,,::::Egig555E,.......Win...ammsmullmmlinimmmsuaimmn:uuu11ulmuuu,..-:mLfu'ff11wma.--FVI-5--,-Qmmnaeaawuma-A-M I-ma . 11:1 nm--. . mnmm--m-m-mmm1 -. - .,....,,,..,,,,,,,.,,, ,1,,,,,,,,,,.,, ,, , , , S 1 1. 1 .,, If H! -41 gn? -:X I I .. 'E' II I I if f It --1 ns! n V If 1 . ..... i... ..... -.......-.......:.-. ............ .L : ...mm ... ........... . E. .... I . - .--:ir ':l....:.. :.. ... ........ ,, , , ,,,,,,, 1-q,,,,,,,,,,,,gg., .:,.:,,...::::::::..,.. ,.. -I ' , A I I' 1 ' I I, --ff. I X X X ,, 4 kfr, X Vs f , , QIXQFV-Z, ,LM M - ' 3 1 'I Xia, ' V V IQ , 6.4177 XKL. X XX I X XX 5 W -4 ?QffiVT-I X--gLL X Xf :v Qf '-in X I V ,LL' , - I 1 VIVV -: V1 X. , VIV X ' . Y f X - I V V . +.XV,1Xs X I X-. I 4 I :E , , , X ., .A , T' -5 ,X I. -4 wig- XX. i 'S' ' V ,:- , , ' '7' fi The 'f,- X if Q f'.'k .- ' ffl . A I7 1 SZ X- f,-,, V.k- I . ,v , ' V- -V . , V VV ,V G: , V 19 V -,., : V , X V11-ae.. 1 , 7 5 5 V, if' 'FLW V X 1 egX:fg ,. h QXQNNSXV ,, VV 2 I . III IZ! I , I f 'V ' X I I' .-., .',- V f 3 M ' ' V ' ,n XVIX V V I yo, TV Y Lyy... W Vw ,, ,QfofVVQ . 'btifs I , X' 'fig -LL, , ' V, ' w ,V '- -- L, rw f ,L 1 . ,--L X 1 IV , 2 151 V ' , ' n 'V - 'f '49, - X, K' ,--k' ,,h' I. . If i, Z3 2 'FI ,V X X if W VII--3 if L- ' I ',-L' X2-iff f if ,z I Ii , V vkky I IIIZZIII, X f,-- I I I I , ' , V I A I I -L . 271221 A.LA,, X, x 1' f Q V ,-,,' V la. ffif VN X ,, ,L'.' V' '6-N9,'V!f ,,' Vu X0 ' - '- i Vis? If h' fhk. V ' I , VV 'RSGQXV , ' h L II V m6Z?f'Lif ., VVggnigzV,,Vqf,,j4,1,,X:VgVVg,Vf , 'V , I- ,I XXV,V gig: L ,L-L 1 g 'KLL X. ,L, , -V ,- XVACU . ' ' X ' X I ,-hh f fi X X f 9,1 ',- V VV E V, X ,I fm I IV I I ,I Q 'rq ,V..' wif ,I ,X g , - I ' X 9 'V WWI - X K f V , , ' Q'N7V1M5W VJ. X-L,- I ' f -, X XIVVX , V, ,Qvk , . - ,- if : ff A Q 90595 IVVVVX .V V f IVVV f df , l K V f X ' II IQZQI I :I Izijg 5 ', , ILM. , I6 V I I, O , ' V IFE? 15? f?VVV'fV ,--'A. 477-1IaVf X' , ,- 2.551-El f'3viQfffVa?SV1Il1 I',--'? 3 , 2, 7V!,I97,?,,X,-V f,-r, I 1513! jiri Vlxgf IX I Xgklgxfff 5 I3 :XI -,X Lk,k. 5 I f IA ,VyIk:siVXX-I :fl-I , ' ' V X Vi'VL:1 Xk ' W, X 'K. if Xfr VQ ' , . lm Vu LL 2 LL'L V -::,V XVVIIET-fV:1Xf f.LL , xv 154:-,X-1 7 f W ffm f',-' I' ,V . . siffziv' Eflpiffl- ,s, ',, , . ' nf' IVVVI .I ,Iggy f I , XIIIV Q f f null? XVV 3 ' VIII ' I I 5 I V' I ,, , .y'!',,, V - Q 'V .Q 4ggV!,fk 'Vif1g'4 ' fx ' ,,.. ' -k,,, ,---' spy X 'IIlllr- f 52 , x 'L- ' I .'--- '--- X, 5 4, I I , L , V -,V- V,-,-LVV V,v.XVf, L'V,, I --VV XV fm 'f ,.V,,g:,,v, I I V'..',k ' ,,-V,, ' f ' ' I I 'V X V I ' .V - f L L I V V VV V If Xp. f f V VV V fl X Vg V, VV'T6rkC0u', , V ' gif- P V, 4' , ffm V 1 XIXI , V 1 V f V .V,- , , V f f ,X X VV X ' - V i . ' ' ' I Nw V 4f:1TDofsvi1?VI1'VgV gV,VVX VVV X VIII ' 2 VV - 'L-'V,' ',-'VLA.' I If '.V,--'VL V V Ei-I A?-'V lzzv ', VL Q 5-'rr1VQ'Qf V 'V MV.. ' I f- , p 'V-- V' XX V VV ' ' -V M '- ,,-' mm', ,V , V , K, ,.-, 7 -,V:wXX, KVV. X ,AX 4-gf,-W,-ff ,VXVJ VV 2. :SVU-SXXW Q Q , ' X Xgzi'zfgyJ Q X ' V24 ,Vg - , 0 -,A ,.-, :Il IXVV,-I '..' V g -Vw ',.f' kd ,533-V.-4 In A 1P1i,aEQw,gX,f .Vv I . , 'V VVV- 22,-If 4 .WX ,,-VV, V Xr-r, rzfvgq G V . V I S 1132!-if 4,555 ff 'V-- ,, ,iff A 5 1532221-V I Sgplxi 51 lil ' W? V V V QI V VX X I V I - 5225-ffi'?7K - V i 'i 'LV ' V'V'- I X ' X'-t,:-',,f:1pVX:-v' x R - V9 V- X' ',,- .',, V 'egzff XX g ' 1631? X V NAIXYXXREQ 'S V VV II I I V - V V VVV V 2 VV V VV I ' - ' ' iw, ,'QL9fV1:EXEkRlivXXl -'-- .wk I f f -VVV I ,. ' fi kf' X ' ' X V' VVV- ,FI 1 :X4iXx5XiX I ' '. ' X XXXX-Xa-V kvvf X, , ,yfy X -,V . - X-Q-XXX. X 'N - X X Q Xf, V I M- f VX V -VXXV V VVVV x XV X X ,Vx X 'X If NI 'L IQMRQ6' , , CSX' Rgdg-!I,,X I o ,Q o Q 4 fo ,Q :, I .X , , Q Q o O Q Q o Q 'QI O vcxp- fiffo i o 1 wo 1 X V - V- ----- nuff! V V ' X' 22523 . f X ' E? - V 'Y' i:::::.g5 I I AAI M M 2 9 Z 9 ,o La chi: il -vi -p-24 I . 6 I R r i 43. I . is ,. 4 32 I 2: . . . 24 . I. .. II' JI O I - I I Vu: I r I ly. I 'H HI!-r fi. I Illm v I mf uzg III I1 I Q S 3 Q 3 5 Q 5 x 5 5 5 Q 3 Q E I Q if X. em V - . new . Q W .Ii W Q . , ygmmgxxxwwxwxmwxmxmxxxxxwmy w 1 0 Y' 'N - -x I ,A-J L L V v- Y :' 'A 1 ' ':. XI LL O X - 4 in ::.-::-- II I ' I IE I I 5 1' .5 '33 33' 0' :-E I si V ff II 'I IQ.: I Ip ll- ,Q F I null? QI Wim 45 I 0 l 0,1 E :Ihr Q12 if Ir! Q la 'ln -Nl 5 4 .' '. V1 A II I' 1 3 5 5: IS 5 X K3 N 3 5 5 is QI 3 Q Q EI x E 3 3 Q2 N Iv QA 1 If XLR L-cx3L V R4 vi ' I1 , ,. - sql .-J 4 xi - in ' -it ' f A X A I - f . 1925 A - X- ' 4':'-Wh 1' .-A 'A -I I:- Q5555g13gg1gaI1n1i5:ggg15g51:1II11iwnmmummIn11wmamaemm:Ia1memeis:Enix.imS.m1,:-m,Q,:iL..,,,,,,-,....,...,.,,,.,,...Emaplin:-? --,MSL - A -- -- --- ' ' ' ----A------W -f-4 --- --AA- '-M-N14-'W-:LL!111i:::f 531- ----- ee: .5:::ux::!Q '-D' I ov-vr 1. 1 W1 Y- J' ' 1' I5 L V E: P I I - All' nel ,...,.. E ....... E. -..-mm....-.-- I I ' Q V.g . .....,. .-,....... .......... ..... ............ ,.,..................v: , :z z. , - Y r- 4 A rT6E,Y?f-wx' he -N ' ' 1 I .C -I-. :iz 'N .: 5 Al 11 ' I J E- Q.. J A p a Slgma au A Q2 gl 52 Cx .Q . E: Local Fmfflfnlfy Estublislwd 1919 6:1 5 N: il.-, 9 3 13- I . CARROLL BRADFORD AXNIS CIIARLES GREEN FLEETVVOOD, III IE HODIER PARK BOND EDIOIIX' LEE JENKS HARVEY RUSSEI,I. CONNELL BENJAMIN JAMES O'COXXOII 1552 I S. f 1924 . 1 X5 L THOMAS GORDON BROWN IEIJXVAIID GORDON NABELLE, JR. . ' I CLARENCE GRADY 'COLLINS IXLAX VAN HOOK NEILSON Emi FREDERICK :EVEIIETT CONKLIN, JR. JOSEPH IDALDIISAXO un, 'wh AIILAN GREER EDWW'AIIDS JAMES REGAX Qi'-3. 'N HQ! JOHN FARBIER ROIIEIIT XVILIIIABI ROANE V IRI' I - M'.'rc1 Fig' AIITHUR SPEIR HILITBRAXTIYI JOSEPH IXLEXANDER IJSRY ' , .SQ AVILLIAISI FRANCIS ICEENAN W cllllz, 1, 3 qw llnh 1925 r 1 I ,' 4. 1 A JAINIES STIRRAT BINFOIKD ROBERT BRUCE BICIDANIEL 1111: . VVILLIAM 'TI-IOINIAS PJOWVLER HIXlIOI.IJ XVALDIDIAR OERTING xv JOHN IENGLISI-I GLENN XVILBUR DANVSON OXVENS ALBERT SIDNEY HANSON THOINIAS GWYN POINDEXTER FRANK HOLDIES ROBERT COBB XVARD 111 ELIJAXII BUTTS LEE A 1926 I' HUGH BROWER XVALTER XVELLS PI-:ROY 'J ,f MCCADIIE FRANK DAVIS CHARLES SADIUEL ROCKWELL GEORGE BOLIN FOWLER CI-IARLES BENJIXDIIN XVALKER WILLIAM JOSEPH FIIAIN 555 Z3 F' fi J' I B 91 56 oxx.-1 if 1' s- I 5 ,5- 1. 'V I L , . LIONEL A J 7 Y C Y Q 'sm ffig ----- f ::?55::w'- ' L UH' X if .reg O P' O P ' O 0 ' V I ul Off' . I ':. J N L A , 1 0 - - 1--IHS' Q 0' ' 'QR IN ,Q -- - ,, H X - HY- - us-Us . , f F -, 1 I ' ' -. -f l:7:S1I1'.5Z-I2-,'-. -1-I-.''SPL-if. ' B9R6D50b3XY66 xbXQhYh vk 5 . 0g2f'NNkY---555'--5- - -39-29?-A A-9 I -A- P ' N 1 'v- NN PY'-SSO V L -3 V 9 '41 iQ L. , J K , .....- V . V 5151, O O 7127 x Rf C 1 . V -V : Q ...-v-.V-,.,-,..,., . 471-g'.vLwezy,?. .Wrf , - - . .. A . ' 2549-VX 5 A F 1 'Q E ' H .. V .ima - X :lEI.3-Elf 553931-.mx ,- v ' 41 E Big-'gi . . 5 Engii - fgg llirii V iii EEE i. - mu: sf.. ,F E 5a' ' Es ll To .. . ii E E: 5 E, g idx 'V 'b I' ' 5 3 V. gf '3f'fV1 E' n E 5 V. ' V 1 qw-:V -X :: : i' -. , , 2 5 .V :-.x1. V- 'V j . -- : Af -. x I 15. ,5'5'f'V fa ,f V ' V- ,Aff V ' V - N W . ' ' ' ig E I 'E Q 1 .V ' 01 9 V V. f V ' . -- V - P: X ,VfX.i'f - nr -: 2 I 4 . V 1 , VV . , ,- V. V. :V-. X w. . , X X-.1 - 4, ix :- gi , . XV 1, , I V ' Q in ', Zigi: 153: .i-,-- ' ,5 C-5? fi, ' .f A I - V ' V , ' . , , . f- R., 'v2XV?r'fs' ,,,',g XT, V f ii :gy O ' X f - X' ' .f :zz-.XfV..L 'V ' ,V V f I - -. ,. . m V- - P - - Q: s: .. 2.- +, - 3, , ' Y.fV.1X5,6 V - V ,V . 1 '- V V. , Q -V 1: V V' .f Z' V -- ,- ig. :: :N V Q V -V . : Q Y F X'-V ' 55 iff' 6. X X: Vf.:-YV. ' . - V V .3 'V c' VV,V'fSV'f H XXV ' - Iv .7sHgX,' -VXV-'Xxx N . ' . - . N X V :: n , ,V V - Q 23 5. V. V 93 . - - f ' .. f V QV ,X - 'Q V -12 - ' -.ff -V'P ' V, V . . 1-V X. as 1, .- -V f ., V. - - ' V -V-Vx: 1 X- V - -V X. - 52 sg 4-.3-2. - V, V V ,Vf - .,,1-VX:-l 4, X - -. ,Vg 'Xi V f . ,XVV-'-Y-vw fm - ,V 1-X . E, . rn V J X , , . ,rx ..... ,fo . . . , , X ,X ,. . X , . ,. ix 3172 Y P , 1V 3 V - 2 N? ri, -- . VVX' ,V VX 3 V ' 55 I5 H V, W .5, - A Q . h V , VV ,. 5 -5 fy f.. : VVX-5773.7 N wg X ul - Q5 5 . . A . ,N-5 , , .. , ' ' -- - -X ' ' if V, ' 3 ' In :: 5 . ,mf f N- ' , ', - . V- ,VV ,I V 45 ...ff r-. A -V XXV' -- 5 :: :E -.Qi 'Q V 'V -' wx -W -XXV V. - 'V VSV ,X - JV ,V iv ii .5 X1--.' ' . -- .-KQV -.,L',,2Q. e.x,,VX-g ,Z X . . - - g ' K fs' , fu E5 5 X ax ,. 5- X NU KM? W .vigil in .LV Q. i EV K I X I 54 A , in E V V '- V. V- ,5 -V EV 9 . 3 gx , V ' , . ' , 5 -C ' s F X,--Tl-:V V ' V 1. f . 9' IV' . V ff: - 3 W--.fV V ' Q V- I: E -V aa XXV, . V , NX -X V., . ,. X ,X :1 ,. XV,.,V XVVX, ,. A ,X 4' .-X ,. . ,, , E QW- -:xv - - V -V -V -N-if V V , , -, :V my XV-VYV-fb VX ,VXVV ,VViV .. 2 14 XVXQV , , - --'.f Q 'V . .. VV 1 V. a ,XV,VVV- fi' . fy '- . , -Q ,gf A V gg 6 3 , -.354 .V 'V ' mfr' X . 1 ff 1-51? ' ' X' '15 'b ii? FV ' 5 - V 2. 3' ' Q .. Q V V2 .V , 0. . . O.. f 1, ,V .V --1V.X V. .V .V -X X! Q N' 4 ' pry- ' .. V ,,,-V, - f X N ,wg ,g V' -- 5- -r , iw. L QI!-Xiu. is firm' Ln, -,VZ X, 14 is .. -.ku A w V' V VX V Q 4 , - I-,-5 . V - N - ' . K f - .' - V- V . ' . V- ,,V, V . 11: , 4.f9'.5f5 .' -V X3 V ' . V' Vg. . .. , 1lS'ff5,'? Z 'ff 'Q ' ' T- -W ' V.V-, Q EE X I f f V - ,VV ' is X ' ,F ,. TV V V- VX ,.XXp:,V.:, .. 4!::jg.fv1XVVf' -V V V' ' V 2 1 VV , V-VV ' f . z V X 3 ' 1, S: r V V V X V . V --V V . 1 ,5 f' V ' V' ff: V .wi V . .E 1 'O -V X ,f Vf,-jV.Xi,-mfg, , , . - ,,, I ffm , ' 'f V, ..., ' ,, -V me E V V, 'ZVVV-4? f-ffm ' 'V .1 -V M. A ,. .MV-X--1-f:V: ,. 1 ' . vw V 4 . f,1V:,V '-V:,V.,,. , --1, si : H'-. . V, V5 ' gi .vx ,VX - . 9 -, .V-' -X Q .X -, .few-'T x .. ,. .V .- ' 1 .3' , ' JYVVV,-. w,Q.V: V-VVVV:-Vfr'-D E: E L ' - V 1 1 V V V V V ' . e w..5zfV .. z' 1 , V--- V TSSNX V ' Vi F'V:iF1V9if4 'fx '- f- ' , V A TXT: ' g, ,. . ,V V' ' 'V 5' ' , .. 55 . QV 1' ,4VfQVVCf.?4fV XZ, PPV -, Q9 ' mg VyZ':yVV-'M swfw -- E -' , f V 'i-iff-I GX 2 f J -I E V V- . V .. , . .5 - 'V - . N o V V ,, X - MM VV .V ,. , f' dy , I V fra X - , 12 f 9 Q - ' V V X '5 VMQVHV wVjVfyVm,w ,VU , . Z-VV.,5pV,x.V V 7.49 XQV-V 9X 1 ,XN.X,,VW..X': X I: : 2. ff up ,gf Vg' Vx- 5, V ,4.V-,VV'.'g,,Vz,Vii Mfw V.MVfeV-7Q.,'VpvV., W VNV?-Vg N N ' ' ra V,Tf?-j'ZQff,,V V W, ,,?MV2',VV!,MV ff I fff X X X X V X EE 5 sk x , Vi V45 V5Q,VNVV4 jf ff ff V -,VV ff' yymp 'ff,,,,f2g,,VQ,V 'iimjp,Vgj',p',V,?fV,,Q .g2ZV.:Qi, 13.,XeVVV05-n514Vf,'mVV5qPL..V--Wai Xffffdsh, : : - ff X V- X X X X X V W. V V ,J ,MW M4 fMffyffWffW4VfQVf,Vff ,,f,wVV,VV4VfVV,,4, f ,VV fwf W XV- X X X X V : : NX - x fffff f ff X X X X O 5 Er Y V ' ' V4,VVf-,9Vf,V'f :w,zVQc5:V f., ff,VVV'V My VV',VVfi fin VV - X :: 2 X ii E X-AX 5 : E! E Ei E ii 2 if V E . -T a 2 E g- E E ii- A 1 .:4:.::: ml fe-rf Q: ..: :.: E . . A4 A 4- A - - I ,pf V -. A 'I ,'V-A-I, f V 'EE .fi . .Ww:ffWfM45wW ,.,.,...,.,.,., ,hu MQ. :mlgvave flgg gm, ,f-N' ' V. V If EE - 5 X . - .. ,Q .. .. .. .. . V , i'1!El-'A'Q':L?5'Z3i:, Ji2: ' 1 g ' . 5 .V J as::.,.s!!!sm..ezzaaa ' fx-N . Q Q 0,50 .9 4 0 o o,o,o,v,o,v,v Q 9,0 qv, . . N a 4 Q . 3 'Z . .- 507, X O N -V f I F. Aswmomow K' Ox .X . fm 3 I E - al! .X Y-6CK'N?4?QmXRVX'WiXX.XXXXXXgxxxX x o mum ,,, V. K ' Pt Lnvx Jx 10 5 M O O99 h V . D N Y- g A' ' O W -'M :iE'E5,ll?h6f ' 1,5 L.. EE3iE35::: N. p A V WI v U , A Q ...... 2 . -V ., nb i XV V ffm-'ff-gif-,fs Q QV - - -MW UD 1 K V n giigilifx .I A -r ' A I -'A Q ,sa s--:I x VZ Y ' nw i ' -.4 V Y Y LQ ' Q x Q . S Q x -O .5 YI 5, Tigu, a :Fw ,iff V .6 .Q V x -: -E: V 4 3 V . -:TE 'Q .E Q2 Vw r 41:51 6491 ms f Wi! ' nl ' VU 1 .Q rf ,- il pr 1 1 u I 'W -Y fl'- 5 4 jll lr- 'W NV Q if S Q. E N x 5 if x S S N S E X S Q N N KSC fx ' 'X LxON5L W S A Nu E is- s' ' 922 ' C-Z' P+ :2:5: 0 i4 Fi P 4 Y E! 1 IIIII- , r W, M 4 Rpm F9 1 IIIIIA, IQ IEE! I A I N 1 Z6 Z f Z x 9 f ---::1f 'F' ' ' ii ' I T I , i :, g A 2 , 1 Q XX UB' x ' ' ' A 1' I I I ' 19251 'xg , x 'S - A . - 'I .. In m fn-.Sqxq X -5,3 ,Ot kno o ' tff , , A ' . - - - 4. - -- 1 f 1 ' I x ' ff Q ' y I 1.1 A S A 4 -I i ii ul 2 :xi m I nmum-.nu L v -I I R I I wmv urn mm ..,,,.,,,,, , X mm Ll H -1 A 'V , 'Il 13 ll:!il..:: E vu- 1 :I .sa L I I In :I . x- . .-.I ............... ... ... 11 . a .n . . . . . 'fu ....:'..,, m ,L -.--......... ,- r K Pi Lambda Delta Local Fraternity NATHAN ATKINSON BROWN, JR DONALD DALE CUNLIFF -EBIORY DAY HALL JACKSON BRANTLEY HIERS CHARLES FRANCIS' HOLLBERG, JR STERLING PERRY JENKINS JAINIES LEDIUEL ICEEN, JR. THOINIAS EDGAR BUSDIN CLEO MAURICE COLON, III HAROLD NELSON HILL WII.LIABI ROY JONES WESLEY MILLS KAYLOR ROY CLAUDE BERRY BENJADIIN EARLE CHANDLER JOHN WALSTON HENDERSON' ROBERT EDGAR MARTIN GUY PRYOR ALLISON AUGUST GEORGE BADENHOOP CHARLES PRESTON EAST 1923 19241 1925 1926 .SCH X Qpldvv o O 0 Established 1922 FRANK RODGERS LONGLEY DONALD CADIERON MOORE LEO KENNITH PERRY WILLIADI XVIGHTBIAN RICIIAIKDSON AI.FRED AUSTIN TENNISON XVILLIAMI LEWIS XVILSON REUBEN KYLE, JR. CHARLES PI-ILHADI LOCKXVOOD CECIL XVEAVER POWELII V XVILLIADI EDWARD SICKLE XVILLIADI ADAMS PRYOR DUFF SUTTON TI-IODIAS QUENTIN XVINKLER ROBERT JASPER HOOD XVILLIAM ROY IWAYFIELD FL01'D FRANKLIN XVILCOX, JR. . Al. A --A -4--- - -::.-::::::u:,-Q mai , SL ..,.-. -I-...n. -ELI'-.::: 1 41 NT! it F59 R is A R N N. 3 R 'N N. 'R RA R Is LPI 1 I-Z' I :N ' I I :S -4 Ill W If IJ K uf' 493 ' Fi um- ' . A llw. N. 5-J S6 F5 51 R 5 , A if B D 5 A fi 4 2 3 'f W -1 Q 3 I7 xfpswosmwffzvxfwmfvmf 0n aswwwmwfmffmw' yQ999S!66fYz5'.13 0 2 '- 'Y E4 f I. Q' l Y AJ ,O 0 If .-,WO o kg, ,4 -I Nl A , , D 5 M O I A A R EQ A A 1 I I H ' - 4 '- ., ' . - . r . 5 Q : I . .A A- -- -' I. '- '- - ' :D F. ' VI, fi - , . I new K. E I S Q ' -' 0 L V XX '1!. - v . A 3 .2 - I. ' 0 U on ib1'. 1 E f?ZQ i9gEWwbNe E2 QZEDZ '. V 1.3 -, 5.34 . .. ' ' ' -. 1 - '- ...u , - ,,1- ,.. I - : :': ' '::: ' ::' n : ' ::::::::-: '- '- - 4 . . . ,. ... , 7 i 2 - '-2-2-f:C ' ' ...L 4-2 -' 'rr -.- ,. .. -- '- -1' : L V,,..:!:,.,Q:5..ei! '... .... - S-I .sflummsnmm me I mnsnm mmm: -- V - . u --f4-- -f ---- V gunna .5 -- : wmv -. r - -- A- -H .1 ..........V .... .....,. ..,...,.... . . , ,ii iEmEJhEEwm5E': I ' ' I 'C I. ',.........V... -..L.....i....:'!-EEE? gg' xl -Ei ij l'e:'f ........n.......,.::::: ---- aaa:-:--:::::---sa:--u----:----0 -:::-:-::--::::::-::::: ::::::::'::x:an-rn:-::-:::':: ::::-:::-::::::zz:: :-::::::.'::::':::':'::::::::::::: -' - -'n:: ':--: 'rIx:'r 'l':ln:l 0 W JA .HRH q l K . , . M, Q Y I x x X f I X 0 x x M , ' ' 1, 'Q , 0.1-N, , X '- ff 'O-:cR,.o..,f! 1 N 1-. X' . ' x N-.M JI, X I' ,f A xx A Ur 0 ' gtg! G-.ma mfigiiu . -I 'U mx u,gnq.,,,,Q.x,,,,,,, ,ul .L ,U , , nf, , , , 5- m':-num wily. ,mln 4 mlm. mm 1... y - .- W vm-ymmzn mn-:fummnmuumnm:1 51 -I .1 , be if M' mu -ff.--'F--- iii -7' W' Y E, D L EZ P I W ' Mmm-HMM F 1 .Nail MV ws .... .. ............::.. .. .. . .. .. . . . - ..: :::::::::: .:...:.. f-' 1- ' lx a : x za: . J 4 V W ' 1+ WN 1 H 7 f V 5 4 Z f f Z 4 I 2 f 3 d 'Q . '2- O I r I 3 5 23 , 1 ' 2 . . .0 4 O .0 Q O .g. 25 . ,. 'Z I ,Q If ' I L U 1 VV? ,. 1 mu YL A E3 Illll 65.11 QQ? 11- 3 t b nun- 1 'III Y 4 X mV V V, Vffvf w., , ,W .V ' ' ' 'f'Vff-4, Y L 'VVf .,.. V ' Vf , XLFWE '5?m-.94Q 3Q.V 2 , ,-25'- f' ,Va ' L V f' VV ' ' Q -'A- -Vi . ,L 6 , V , V., A ,lj 55' ' . 1 V' ' ' W W' -'lf '--'l f ' ' ' f ..'g ' V ' ,Si V- ,VK Lk 90 . 5, g 'T kk I V if g,.' 1 0 8' BROWN V M' SW' . V Q H.cw'd-5 j L24if 1Q656V'b L - V , ,.QS9X2 ? R73-. .' , , ., 'K '. :, ,V :...:g' 4 - .-'-' ' 'A X.kk ' A, . ' I ,O ol ' , '- ' Q . , ,jzv ' ' 53 ,V 'Vu A - A V-QF ', ' A V' 1 : vf JQJVWWWQQV QmQVQV2Qwa+V V VV V f b' 3 ' f : Q . Q' . me Y , ., K Q I WV VVS.-f , k .2 V -,, A Q, , fs, . V90 , fx A Vpocrr V K f V, I 3 ' A BRAEJX 'W' FE? V V V RDUM Q Lftmaqf ,- V . VI' ' ,mv - f V' ,ff r .',- q , 2 ,J -W! ' , 1115.51 , ,V gf- , A . V . P V f I V gi: ,hui fw V V f ' -, f -' if - V .V -fe E ,Q ff f E' Q 4 V . Qfm- V fig 1 'N' 1 V A V, , 7 - 1 , VV 4,HfV MMMMVV AQTF fam. , Jm f- uw V . fb' 4 ' 4- .-few .'-' 5 ' c- V M V QW ' y' 1' V 9 M V ' X41 wp, f 6 f wg-. ..Y 1, 44 V ' 9 1, iffy' . 0 4 ' M BROW 3. I - VV' K wavy V ysigfsye PRANKQA I f'fffjf'Tt'2?3, X V' 119 ,L'L ' :Q H A VV V ' 2' 13655 V va V . V 1 + rE 2 ' V ' fx 551 ??iVi5l - dun- dll V- X f 2,:,, SJ- ,-VXU ,r VK V V.k,V Q ' ry Q11 L Qt E A f Vf Nr V V , m m Z 'L,, If Q QAQJ V famM?f' fvfxf wwwqw miie VV ' WMU VME. V V' V ff l? . snr jf - MQ' 4 ' , 0 ,V , VM .. . 1, ,g'- ,ffl , QW? cf V, 'W' -ulllr , 'Vx 41:4-PV S V , V' ', '. - P 4 Q I4, - arrow ' 'V L fe- '1 .', Z -um-' V .. .. - P . . , V 5 Y 'I V , ggffv 5 11.2 A '-'- .ff ,V ' '- - f-Kf'.', .,-,L f,.,,L, 1 ,gg isa 'W I -' -,.L -' -,,.,- f ,Vg fl ,L', . V , gf -Q Q, -ff' H Z7 V f , V ,.1'Q,yZ V7 - - ' ' 5:4 u V W -'ENV :ff , V ,',V .gZ5,,Q,5 j,1 A U51 A f, 1 1 VA V ' 50'2P'v'V HARSSPC5 5- i ' . . V , ' ' '. 2 A V S7 3 V f ' ami, V f H J Vi' -V 'VV' V ' '11i:Z'Q-1--'W V'.V f' V Q, f , ., ' fV,, V f M , VV '65 W L V V 5 V - X f:::.s VVVV 1 3 S gm ,-Vg.,-'QV - f , -'fVfyv1 ff . ' .J ' ' .V 5 V ,V V',, L 5 g' 1 K A 4, , 'A if M' X V 'V 2 E 2 ' ' 9 ' ' 'mL ' V ', e V l L1 S 5 X 4 -7,1 5 X M . 'p X 1 Q , 7' 5 :Fifi ' 2' . 4 V ' ff . ' ' ' ' 'V .' - ' . ' V V N V. ik: A ,j ,V.j ?if.Wf:lf, 1 X V I ' , 5 ,U - aififif - 1 ' -V ' Ks , QQW ,Ewa C ! - . u. ,,,,. zgS15l?5?,-.4j4,,ni 1 S V S 'Q S S N Vs V ? X N S Q V . , , N, V V V .- - -fflxiiif 8' -1 Q37 + -V 'isa-. I ' NV F 'f H? ,- V 4- - u 'N 3 fri' E 1 V 'W 'j 1, - Y LA E K ' . ,v J' f. a '- ' ,, . ' Y' ' L LIONEL K- Y Q -,.K HEY, Q X . 1 V , wwmwbwxxxxxxxxxmXxxx , X gk --: 'mm' ' mm' 4' ggggy- U Y ' LX L XR 7-4' 'Q L L v v Y ' k J , .1 0 Q Llorxf w X 5 'W N K1-9:-:A-A-J if - A 1A-fL A ..-A' .,Q,, ,..- - S 'i2QZ,55f 5 T ' E . .. . ..... , ---::: --azaazz P PCI 4 X W t A .UA P' Hr 1 Q 9-', 2 L A D 4212? E 1 -4 RIP 4 3 bllllg -Illllf VIII 1 1 2 6 Local Fraternit 5 -....... ..-... ,,., .,,,,, -- ,I lx A A . 1 4 N. 1 x 0 . .-'- 5' ' N 'F N N Har - J - , xg' X R3 ' 2:5 - , A . ' X i- X- ' - .arf 'O ' .. ' 'f . ....4:-':1- 1 '-74' ' ' N423 ' 1 f fl-fa.. - - fl' 1 Hiihiilllllllllllmlllllhllll xn1nQIuminxlxuiuvllriu-L1 . 1-.'f-111151. 1.2 Us 5 A A W5 ff A 'im ff' ' J ,1-if 1: '1 I I lu 1 1 'ns um x 1 1 1 um ss 1-en -an , .Su 1 ul' 1 1 r- W I -1 .I 'SU !1?'i l-' :2 H - 1 'E 4 1 r 1 f W -, Y A Nl' ,Q 4, ' I1 '31 X i ... ...ui-.. -. I .. . V , 1 I ,V lquua -R . -ww - 4 I M 4 ,,,,,,,., Gamma Tau Delta y . Established 1921 FRATRES IN FACULTATE PROF. ROY M. MUNDORFF fPhi Gamma Deltaj , WALTER MARCELLUS BRANCH HERMAN BAINBRIDGE BROWN CLARENCE FLETCHER BEASLEY CHARLES THEODORE BRASF1ELD,'J JOHN HENRY BROWN, JR. EDWARD NELMS CAINIPBELL HOWARD Ross DUNWOODY RICHARD VERNON BOZARTH CHARLES MANLEY BROWN WILLIADI THOMAS HARDAGE JACKSON LEAWARD KELLY 2 ISAAC CALVIN GARBER, J R. W 1923 1924 R. 1925 1926 DR. JOHN BASCOM CRENSHAW JAMES EUSTIS CLARK WILLIABI ALEXANDER ROSS, JR. EMORY MAYO FERDEN STANLEY LYONS FIEGE GRAHABI FRANKLIN WALTER FULBIER WVELLS JOHN RIDGEW'AY MURPHEX', JR LEROY MONROE NAPIER, JR. JOSEPH IILTGRAINI PALINIER DUNCAN LEGRAND SPOONER PAUL EDWARD XVILLIADIS S: R R -:'3. RE R Rf E 53, R R N 'N 5 .V R R ai -N is E13 ' 2 V I . .- gs IIT' 7? 1 'NH fb, lr H :W 'L U Y 1 44 1 ,A :ii 4- N, QI 5:2 :ki -:M 1:24 2:5 S: fs v 19 3 ci: 'fi is 1:1 igg rf 4, ai V E 4 Q5 14 S fy f 3 w 2 5 1 5 x CH 1 4, S 1 s 1 A 3 17 A l9Sff5fIYfZl. 'A?7f99'f.fSf9f DOW9 5. - - V H -A , I. Q' L L V V' 2 All O P' ., , O o ' 09' '- ' -. ':. E Z -' . f 1 A ' - 'E55E::... L - M Y A H of -, A naiggffj' OA 5 ' .' 1 qv ::::::: :.x 9 f - , xi 1' ii ,' - . . ' K Q , g I : . ,V V R ' 2 2 V 2 If fl QR ' '. O m ...: - , O X Ll0NEL K. ' ' 0 -+':f'i5!i22Q! vf 43 D . N ,A O O -14 ? ' , ,-M. , Q in . L i , 1. f' ' ' R .-.,, Ax ,f,- . ' , . T 5 1 1'1 1. Km5-:m,.,.f Y.- f -ff f 34' ' .. ' f' if fi ' 2ern-Ag,,- - i-1 A' , 4, fi. ,-:-- -, I Q gi , ZigHH!!5,5!ll5EiunziggyEagan:Inuaamumnuaslilnannmmmmnsnulraxaaznnuiuaaiiiiil.nn..-....Z..f'il1'ff31Q-g.ml--F-, -,.. .mm-4-uuuu-rw-141-fmnmn1.1-.LTU -- . mH---uv'-----ummfi-fimmi-1-fra-------w-mvnnwmmnmnu-m--mmfwu.. , . u gif' .rr-Ria ,algal 1:52119 I .L f 52: W, , T H p LI W Q , l mlw if i . nu.:i5E:...- .... hi .....a:zzzmaw::snzzmmnmanaamwamxaazaaaaanxunnxunrxxx xumaxs as u :mm as.: au llfllillIlIISIIIIIIIIIIIIIIIHHISHISQFSSIIIIQII' , ' H --TFTffivffffFf'ffTf'ffffff1fff1'f?f1Yf1'1f?'TfF?-rr,,, V hm Iub. 3 ' 1 ' A ' N .s X 9 ju I f Q.: i p -. Z y f Z 5 I Q W f r I , 5 f 4 V Q. f 7 Q 'Q V 4- X 9 ' Af x 5 1 1 W g f' , J 1 , Q Q HQOATTERSOQ 2 N 1 O if 5 4 Kit 1 5 , 44 wu QGREENE Jn N L A 41 332 4 3 5 X 'fa 1 -fun 1, iff? Er-QL 51 'V-fi 15+ gli - + ' 1 ' 1 V , llf A A lkGfBSON F f ' M N I ,IA 5 S + E 5 ' 5. 1 ix 1 Q l X + Q S 5 5 S S ' 3 ' 5 + S i E ' S 5 1 5 gi S 2 S 9 ei S 35 3 5 'X u+ 5 S P rf S i V , ,f j5-, S qi X ,P liffx' t -3 ' ' ' -'- A A - fi? HTQ. Umm- A 'NN L ' .X ogEgwMwAv5ym WyfMW'V0'f'W999WQlQ29Y099W292zQzVw:ff4' QQO E Q l S1--VS A Ka ,. fQ9xx?1c7--f-W----,.,, ,V - - ,, - Y Lmonag, , V ,- ,, ' V ' ' t ' Y' grfiir 'iff' 7777-TN XEPN 1 K bimml kb M WX 4, 5- 5K5,L5,fQ .Ir Qixg M .. 1 X xx X M: 1, ' ' f'111f1f-1: A ..-,,,,,, ,,,, f 1,,,,,,:,L-F -A-1 4 ' ' ? Xu -?fsgf3m.ef- eOi'5 X f ' -' ' - was 73' U s , . I aj, . ,E. ,.. ' gg:i1.gggigggx:1vw.3gxxua:: u- .... '..,. 1L . . . 6 31 ' 1,1 ,-.....7 ,, ,I - , ,..,.,.,.. - -- '- - ' 5 ' ' .aft .gzifki LF' . f--23334: T H E. en. - humul ......,..........,.a::w:::x::::: -4--vie,--A - ,.....:a ...,.-. .......- 7-3-...,,.... IN -N X I Si' X ,'- 41 1 . I X -1 X . A S M F 1925 A A - ,- ' I J' - fy ' - 4 'G-Z--fc -, ,xv ,.-'. . 3 sue: gh, 4 I ' A ,. 0 f ' , -.-.1-1. -r 4+ --1 1 ...H...., 1 1 111 V JL f X 2 I I FZ! in I'1N L - ' na E E: fo ,f if .cg ff I. . S 1 is A 2. Q I , , . 5 4' 'E I 0 'F 4 1 :F . l 'Z '4 . ig! 'tf 4 f. fo Ig! :Qt . 'a g. 2 U1 M . 1133551 in J F!! I v .fix 4 1 1 1 1 196, P' I MIB 1 11551 1 'mv In J V W 'RA XYRQ' 'It-22555, I I Delta Kappa Chi Local Fraternity Established 1923 CI-IARLES HANCOCK GRAITADI IVER HENRY GRANATII ASBURY BROADUS GREENE 1924 XVILLIARI XVEBSTER GIBSON CLAUDE XIIRGII. JOHNSON THOMAS MOORE MCCARREII, JR. :EDGAR HAROLD NIEADOVVS 'FHOISIAS HOWARD MITCl'IEI.I, 1925 TI'IOBIAS DREXV BODY CARRY ALOYSIUS BOYLE 1926 GEOIKGE CHRISTIAN HAIJN X-icffo 4 11' Of IEDVVAIKD XVILLIADI HAIIX JOSEPH GAULT LATHADI, JR. JACK XVATKINS PATTERSON GEORGE FRANCIS SEYLE NENIAXN CARTWRIGIIT 'IYIIODI PSON CECIL BRUCE X7ICK RICI'IAIID XVAYNE XVETHIXGTON XVILLIADE 1iLvBEItT CRATVEORD ROBERT BIILTOX h'1C11'IILLAN .m- ,A 5:- IUl'5 'T:l' -1- ig I A 4 1922 Vw 1' '.:' W .. I M1 I 'H' 1 .55. 11:5 1 , Fri 52:11 gil , -In .,. I 1 F131 ft? . 1-. l -9 Pi 'F I - 3: k . 335 N NN. 3:9 ci ,x . Q 'S-: 591 E55 93 :SIE 251: MN R T:-5 01 rr- Q.: in 1 fb: ' 11555 IES: . 1 Pi I uk: -1 N 1 P1 lm. 1 0 m - F' 1 1 M V ij:-r 1 ' 1 ' I1 7 Q: '4 gd S3 25 31 :E Qi 63 -,. 41 fs 5 3 J 1 J' A 5 5 7' , - 1 W J ' jf L 1 1 ' LKONEL K. S H-ffm. 'Q . -, , - Lu., 5 K! Q 1 X 1-552' 1 D tx .vw -w,xO 1 O, , l, owfwi 217 T-1 4 L , , LA I A I, I 0 .Am ' if f - A--. up BJ 1 1 . . , ,. ,, , 'Sl' 'fa 1,1 1, I I Q -1 L 60S'664VW0KW'f99950'2QmNWQ4QN'5M'N1Q5?99H4lOv'f4'?wi530 QE - G 0g?:NxQQ4zf4.:QN-vfffocwsywsfarzf2z4f:c+'.fQr1::1Q2St2QoocQ:ff::QQ04avxfb04'-i4IQ C Q1 1 1 SEER .... A I, Er, O 'A ' ,AH H' - ff Q,-'16 I I 0 J , ,A ,eff Q, C 1 'AQ A I A I A I It 1925 - A A , . . :W nw!! mn: nh' I 'l' , 4 1 iiEf,Q,,,,,,u, ,,,, ,C l4,mmlulv'1117g:' n':'! 1A:' A' A' 'x ? ', F' ? '. ' H -'-. 'l. -.'.-' N ', ,y ' mm 3 .1 il I 1 1 R' N xigxliixl as iw ' 'r ' 'I' '. ' un s P ii ' s . -55? - . ,gggu 5-gpm ::- a ammsmmu imrr'nn.Imlu-- 4: '- , A-2 - A-A -- A-1 --f-ew ' ' u No N 4 . A 55 ag.: Q24 I N I O r W-' I UA IQ fl. P4 O W L O 1 'IIIIII llllllr I EQI Wu Q' P 'nu4 VIII 'Fl 7 ' 1. 2' 's N S 'Q rrGsG G gg-gg:-1:-'-: . :': .. :':':::' '::::...... ... Fraternity Addresses A ALPHA TAU OBIEGA BETA THETA PI . . CHI PHI ..... DELTA SIGDIA PI-II . DELTA TAU DELTA ICAPPA ALPHA . . KAPPA SIGMIA . . . PHI DELTA THETA PHI EPSILON PI . . PHI KAPPA SIGIVIA PHI SIGMIA IQAPPA PI KAPPA ALPHA . PI KAPPA PHI . . 87 West North Avenue 91 West North Avenue 55 West North Avenue 50 West North Avenue 46 West North Avenue 42 West North Avenue 51 West North Avenue 70 West North Aveune 69 East North Avenue . . . 486 Spring Street 90 West North Avenue 18 West North Avenue . 17 East Fifth Street SIGDIA ALPHA EPSILON . . . .252 West Peachtree Street SIGDIA CHI . Q .. . SIGDIA NU .... SIGDIA PHI EPSILON TAU EPsILoN PHI . ALPHA SIGINIA TAU DELTA KAPPA CHI GAMMA TAU DELTA PI LABIBDA DELTA . 23 West North Avenue . 79 West Fifth Street 14 West North Avenue 56 West North Avenue 24 West North Avenue . '. . 546 Spring Street 71 West North Avenue . 755 Peachtree Street X 5011 'W X 7 X S A ' ' zq.. . 1. .- ' 'Q' , , H ' LION el, :- 0 ,qmgh x , A ,L u, O gh.. uw X Pft fom , Q rv . o . ..u't,0Q' I A WY O -A' Azziifif? : , ' Q, A Y M ...WW .... ,,,,gmm,... -1 f Q , 1 V C ' ' : 5 35 4202 5 j L . , , mmmwmXmmmm Y 'ls U J A 0 A 0 . .1 4 1,1 . 'J 'Q Y P. ,x .-' ,.1 E, .x .N V.- j-x 1 , :uh- , E11 1. .-. ku 4. , .J .,. 5 ,,! 1. ,. .,, 1111 .,,, ,EW 'Q f, V 'A K, V -.11 1,11 1,., . .11 fi,--X ,L X -2, 1, I xi: hu ' .5 A ,. xl 1 511:53 ..:i11 gg -- ::2.1:T:fi .1.... ........ . .1 ,g ,-, 1 i .. -,n:5kf2:f?QC,i,-FQ if :fr-1 .--- bf 1 -, f -trr -- A?-'Tl-A 1 'A fAf-- 'THE DLVE PD.1,jNTfEbU:E X A,A. . H - ...........,..,,..,,...,,.. - ....,., M ,.,, Www, , my-,M , tg, Y-. , A LIL -M, , 15839 P Ei-E 1 'fi' F . .5295 - . , il x ji? gi A 'L ff s ' ' LIWQQZJ1 , if Q 1 f . 'ff 15 ., 5 i1'yff-- ' . . .J ,ffjf 1 f-7 '1 Z1 x ' ' WY xl '1 1147107 ,f ? , A - l 11 Ei ? 1 V 11? 'AA 1 - f ,f M 1 1323 Z xifiiefi f ' 'im Q Q 3 11 f GH, ' ,ffafl ' -, -.151 ,f ' ,f- M Q - ' . if aff S Q- m e 1 1 1 5+ 1 1 1 1 y Q W . 1 1 f 'f V xx! ,:ff,.- X X I ti- 1 X - 4 qu 4.5. G I.: , - 4 f, 1 1:52121 ' f f Q f 'Q if 'fgifffk . 1,ff1'?'1 vN . 42' 41,5 1' ' 1 Z J-3,1 A , 'i-if-fn''f1'i'VJf75'7 ?f1sq. 45 , ,r ' 1 aff ' ' 1 4 1- ff - X .ff - 1 , ,ff 1 5 . 1111 ' X '11 M 1 1 ' -iff . A A ' 11 1, j f , 1 km ,ff 35Z?Z'K?3'? 0X? ?? -113 1 N 111411 w 1. 1 Ziff' :fi f '3 ' V ' K 'lf 1,-11 1 1 1 1 1 1-.11 mlm . 1 If ' ' - , 11 giljyl i f 1 gg ,X 50 1191 X5 1 x 1 1.1155 ..1m- 1, 1 lf - A - 'I . - H NX N ' f' ' '1 1 1 2111? ' My 1 1' ' 1121 . 1 Q1 -5 HW 6 1 'f '1 1 ' H1111 51131 ' ,ff 1 0 1, 35 11 1 f , VI W X 60 1 1i,.f!S-62 ,1 F 1 I Y 5 11' 1' 9 951 V ,141 if 1 W1 V V 11' n 71 if 1 1- 1 iff 1 '11 I - 1 A 1 '1117i r I 1 1 , !11 . 'KQV f ff 255 4 fvh i ,, I K E , 1 1 - IZ ' AN 1 11 , ' 11 1 N 1 H. ,lp 211, in ,, 1 1,51 11 1 212111 Q Q, 1 I X HFyg'?flA1k '61EKi?1Q1f f ' 1 122 . 1 ' WS'- 1 if 1 ' 5 NN XQQQ QS 3. . MIN 1 eq 1 1 ,xx I n O 'L X- i -- wyff 1 1211 x fr 31. U 1.1 Ll ' I ' V ,L a ffrfk, 155 1 1 H ig 5 f 123 Q5 Xilff ,AN,' , 1 - -f 7 L:,,3Ei',,. 1 1131! Q 1 ' Q . . WF i Q V !Ogi1. EkfF-gh'-:FQ-xy'A- k W I A,,,,,1 1 0 , 1 111' ,Gg4Ef5-41 1 1 I N Z A lk If ' ' LIONEL K 1: . L X luv, ' af X 7,--0 uf ,H - .- N1 f .N Q?-1.. if-C RQ' 1- X-QSQ852' .EIU ll 5 FilHnllllllililiifillill Illl lill iillil . 'E .a . N L1 1 D4 4' D Hit iffy gl ' x Q5 u --Q2 I nu lllllv l 'E! ng . A 11 I 2 A- 4 'J I 'fi wxf A A .. i X X i I H X in x t4A 1 1' 4 Y X it X ' no-Qc-Q ' '35 I ' 'Q 'a 811-'dsx-...fs ng' Q In ' x R Q. 'ff , f f-' . J.. -' ' . . . .-...., . ,. I x J Q xl z x: x la A: I Ii i mmmuamnmminimumXfun. R in mn 1 1-mmm uvmnmn-nun nunmm 1. mf mu u 4 ra 1 ' ' ' ' mu iz: :Ea I ,ggylulijs li x 11 I , 11 33 l iw n 'X ' 3 fy 1 R M il - it 'It if .. 4 5'1-2'55- -- ' '3 - ' ... ---------------------------'H '--'--::::::::::n:: sf:-::'--ms: . . '-..::a: . ::::::'r:: :-:.:::::::..:'.. ...... - f-1 iiinaiiii. ..... ......... . ::::::::a:: Iii:::::::::::::m::::::::u:::::::x::::::::::: a s :Rman:::::::::xu::::::::::::I:::::::::::::::::...x........................------I Sill .. ... ll'll'llnl ' II -ll -I IL- - I' f -1 .. 1. ' . xi W rd 0 4 ? 1' T .:e-'- WW r I Georgiai Tech Athletic Association DR. J. B. CRENSHAW . PROF. A. H. ARINISTRONG . Q Board of Directors FACULTY MEMBERS A. H. ,ARINISTRONG M. L. BRITFAIN G. H. Bocas ALUMNI MEMBERS L. VV. ROBERT ' , STUDENT MEMBERS I BARRON F. R. MOROAK. 501, vi- WN 1 o , I . Director of Athletics . . . . Treasurer J. B. CRENSHAW FLOYD FIELDS M. V. Slcluzs FoRRRs'r ADAIR T. J NICDOYOLGH Z. i if ff E3 'Z 1: 9 5 :Q ' 4 I ,. . Q' I s WJ 2 I! I 5 A l l 4 I ' YQ NF . if -un. ' ' 0 -mf :I W , 57 ' ll . Q lfl,6f ,... . y' 1 'I 'e 'O .'.4fZ .6 ,. . 110051 . V I LV a- Uonrzx. K sgthllni O Hi, LLM X PJ ,r 0 k Jerez? D. . , .' l a A A .T ? Q - H ' o Fw 'W , '0 e ' Q r f9i: 4 9 i ik ' W 'J K V -- ...... ...... - G --ff 9 1 - , . ro 5 A rap 'f W ., - t f -' '-.H T , . . . , T U x A T , k L Q .'w'WMW'We 'mm g 3 ?4 3 ... . . D ,,?.,flLi l,g..,Q5 G .N 1 .In - -R 54 of -I' I 0 I ff I Q? . 1 4' 5 1 f 9 If .f R? I I jg . so .4 .g. rf if' xi 'si 523 :I .. 5. . if Ig! 9. 5.9 I 'Z' . I 5 : 4 . , 0 I I il if n. ,' O O L l I fn. W Il sf! M' wil. 4 vga 1:1 , 1 ,un fllllv r V? 4 1 5 Q4 of if 5 K 'Z ,. I C 3 .g. if 31 I u 0 -A 4. L. '4- .4 - . .1. :Xa 'N .5 Q ki: .+ F ,s 3.5. '01 ,. .1 t fl SE: .51 .O qu, 'V f- Q .l f 1 , L, ' I QI 'mm .LY 1- -rm. ...rz f.-f..f - . .1....L ..g:22'.,-:'s,g.L1.,..J,i: -M . - -4- . --..-f1-er'- ---4 A. I .. .?m' Y- - ---- -- - - -- - -'--- - - , - ' '--'-'V fTHE:, DLVE P 1 r .... ...., ..:z Haus: ----- ' -- -1---w A g,--- -. , t -- - ' 1 -- ' . JCL- ' Xi A' . 5 X Iii f sl, f - ' 3 i Athletlcs 5 5 iv U3 EALIZING that a real success in life must be founded upon a vigorous y 5 manhood and continued good health fostered by clean living, the col- if fm fx lege heads of today whole-heartedly support participation in athletics. I i So it is a far-sighted policy which makes athletics the chief activity of 91 our campus. In a very short time the name of Georgia Tech has ,appeared in bold 2 type among the greater institutions of learning in the United States, and in this same l space of time the prowess of her athletic teams has won the sincere high regard of ' it .li all as opponents of the finest mettle. Rising first in prominence to a sectional peer- L ' . - P 1 tg age, the reputation of our teams has spread until our schedules show an increasingly PE greater number of intersectional games each year with worthy representatives of the 44 3 North, East and lVest. Cnr teams always Jresentsaisolid front unbroken bv Jetty l l , nr 1 7 - I . - l I il y personal consideration from within. iVe are Southernersg we play the game cleanly ff wi l b and hardg the ame for the ameg and a 'ust consideration for our foes alwavs Goes q u June: gi g J ' D 4 3 alll , hand in hand with an honest desire for the best team'to win. As our engineers are gli, I: 1 known for their versatility, adaptability, and thoroughness in executive positions, so 'l A our teams are known for their clean, hard fighting, and students and friends have Hi ll 4, i learned to support them with that invincible spirit which rides triumphantly to a 5 victory in bitter defeat or victoriously to a remarkable win with the same equa- +- nimit . It is our ideal to maintain this s irit, kee Jin Geor ia Tech a Jremier W Y P I g S I in college athletics. Q Qs '15 if O r 3 U R' E xx f . . . . . . . . - -,- - - - - -.-.-.-.'.11'q1pg -ff -,-,Y - V v- . -ox-nss:5issa9sb2k'Q ',xxXxwxxwvQ-czN-1-N54 r 5, 0221...--gum.:-5.-s:-aa-,:sw.m...:-:..,1. .- , , pt, , ,,- 1 -44., , J M 1. f A L p I Q2 'X L V 3 . A , tg X i ' W ' H ' ' ' -- A... a ...ze- Lxon EL Q W ,l ' - arm-'M . Cx ,74 'lJ 5 gi O oxh5T5gQO o s V vp' o N 1 X s, N N 'wx -, ,-' xf - 1 K ii!!! O it 4-. LLVX i O . it ' Ja. 151' ... 1 , 'OW g. ,W' H92 N . f ,.., ,.,4 . . , 7 .... ----nz: :--:- ssxmi':'1-nnnxnnu.ir:ammrrra-'nms-x'lm 1-H.. ---.-B .---1-f ---B.. 1 me -- -. 1 H B B LV B P -ee: 5.5. EEE! gifiiili 'luuglgqi 1:1 '5' J! X ll 6 Jw f. ' ' 1' I I x I I if D 'CHN-x. I: I iff' 2 no dull' ' A :x I , I iff, 0 6 -. ,f A . ilu NF 1 H, x ing .uk In 1 n I P I 1 1 1 1 1 n H: n up Ja.: ' u v v n fum v 1 nu 4:11111 num vnu uf nv' 4' 'H 4 UH IHUIHIIIIHIIH' I H' O 1 wr mf mm 1 umm :frm n 1 . n, vu U u N I l A I ,. -M 4 .sn u.- 1 I 'ul W . ,. NEIL ' m Wi N 3 T 'in --...252- . 4 ' ---- ---- - '------------ ----- --------a---:--:::::::::::' aa:z::::az:::::aau::::::::::::::::::::::::::::::::::::::::::::::::::::::::zz:mm::::::::::::zzI:nnman::z:::::num:zz1:::r:::::::m:l::::::::::::::::::::::::::::::::::: '::::. ' ' 52:- -2: lf E -.nxu.......... ..... .............................. ... .. n N ' 4 1 y f 1 1 X ,Q O E O 'H lLVj :: 'A' I PPEQSEQ 1 ll I no n N . ' lvl 5:5 'Q X Q .o T T W' f ,- xv 1, - ll1-H-' 1 f '-ug.. WEARERS .P A RN Af + . of Nlllmnw- - f ills..- ...Mlm I QlfllllillllIllIdgjgIlIf'lHlVIlMQ Amlllh ll 1 2 1 ' K ,-. -74 6 221 .1 AM My r Ja VP 'hy QL' V- ' 'fl l X . gain 1 - X, O. E ! J A X-f, ......v. .. --f . A R. f 3. -M , fr V Hb 5 ' J , FOOTBALL A ' ' . r ARMENTROUT, G. E. LYMAN, W. P. M IEARRONR?-If MCINTYRE, J. F. ORUM, - - CCONNELL, F. BREWSTER, J- D- MCD-ONOUGH, J. J. 'I CONNEI-L, H- MITCI-IELL, W. M. 3.9 W 133-.Z'2?..f3...Gc -G MURPHY, T- M- - L. , R., , - - . STATON, A. H. J U ERYE, C- C STATON, J. C. 'Z '.-llln..-W ARDNER, . . USRY, J, A. gf: ' HUNT, A. T. q u 'Q' V B23 BASEBALL ja - aaa v -, I A 4 ig ALLISON: H- R- HINES, E. W. t l BARRONJ D- I- JENNINGS, J. L. W ' B-AUM, J. P. MORGAN, E. R. . . BRATTON: Al- O,LEARY, D. J. wi' 14 . COLLINS, C. G. , ROANE, R. XV, ,.- I EDWARDS, J- T- PAIJNIISANO, J. ' A f Q A BME- TIiO1NIPSON, W. D. ' TRACK ' - 3555313055 L- HLKRTFORD, VV. D. 1 1 - - MOORE, H. A. CIEEREWSTER, NABELLE, E. G. J A CALHOUIPI - - RfXTIiER, C. P. ' , CARTER, S. D. ROSSER, Gr. P. f CONNER, TA. RORERTS, L. .- DKRETOII? J' WELCI'I, H. L. GRXES' ' XVELCI-IEL, H. f GER, . G. WII.I.IABIS, VV. A. Q BASKETBALL 'H 2 B J. D. DEZYSICZRJC. - MATHESON, K. G., J . EckEORD,J E MOORE' F' JENKS Ei ' RORKNE, R. W. ' ' ' 1 STATON, A. H. N th -. - ' ' Qlllfllf l ' ' xilllu -- P will N 1' - Q . if A A O E EE PM E. HE J' 'N ' -.I-'?-9':i- .A .- N U PP Um 0 J qu-I 939 O 0 ' , L K F1 ga' wlljg l WO ...i IR Illl I Y Ll ' r 1 4 x. -.4 if 15 iig . I fm ' f ex X T K J 5' sf I ' ani ',4Wy'!, h ffm! l' -so-.4 ah-' b f ' 5. J C, 1, .,,A . ,.A 4 - . a, . lr' .,. -E -I rl. Avava 1 -In .H Mm - . ., '.1 ,. .A+ W.: M- 4-- -- '- 4 .ax ...au ' 1' , li JT I ss. M 4. W 1' 554 n u.. ' -.Q ,. F, Q 1-x fc-W 1 p .M fi-I .W . Q! -1 -.gl Q1 n'.! -:5 ,- 'N vi ,D 'J C1 7 .'a 'J f .gggwx wgiggggy SUIIBWSHIIIIRSN H 'f 7' ,...,, , ..,.. ...A -3.1, , ' : ,.. ,,.... --4.... --H ...,,.. .. .... .. ......,, , . Lo rl -QTHE. DLV E, P ILI nz mmm: zi :........ ...... . ..::u:::::::. --v--M V i 4: Y W 5 'f'g??1 fw W Sz' f H55 4 5. 1.5 f 1-- 9 - 5 f S, EQ: .4 ' 1:23 2' f ' 1.52- gf if 5E3g F gii: 5 iii' 3 EN F N !f: j- iff: 4 X 7' M31 , 4 'isa Q20 an M f' J n QM' ' r .1 5' -xv u 9? fin- f has D 4 4 .' ' um A ' ll w li 3 Q . .,- ' Q Q- E 4 ,- S . Q cy .. ,ggi 91' 331 f'x ' 1.. if ,..-4 ,f , F - - fx L' ae 'xv ' la X -' 4 if ff 2 Q 6 sf Q 9 1 E 5 Q J , ox ' Q f OV 1 KN O , .N ' -wa- L , V v -1 .ui if nouns. K' Q 'IH'-2 'iid ' ' K Ae 2 ,rub O ff V 0 ,4Q.- V o ... .- '- X w., , V Q V -'--- - - 0 J..112f.wA JA! I V-w kx --LE Y Y Y V X ' 5 .J ' ' ff KN , AN-1 F 7 T1 V o2E5x xxmxwxmx?mxmQAxxmmxxmxw.1-fm-:QXQO z F' I-E if, Qgpmgg-15.5.mg-ggi:-:-zfrqzgc-,xsgzzlzr22:2-c-:-:-:44-Q11:5zrzafsax-iQ-pri:-1-:-Q-cgzmxoa-iggo -s W' ' Q., fi L ' M ' ' ' 1 Q , ... ' , J' Ek W 17 5 ' o 'Q ' ,gif c 1 452 lx IJ 5 X ,41 I , .. ... H, ,b , , !,, , . . , . . . . J. . A A a I'H15hf L-. ...... .EZZIZIIT iii!! T:-'S'-l ' 3i l Il oT2-'E' -HIFI G I GIIIIlZI1!f 'n5'-.'1 '3I3llIEHi523l!:2:23:2222-nn n --nun 1 -un-null.. . -In-I. 1- 1 u in -in : ' , Hr x fn, I 1 92 I xi -I X . , . 1 , If - . - -1 I - F- As- - I KA L N 'Ng ' ,, I ' A H Emu., ,,,,,,,,,, . S m -v-un.-.--51-1:11111umm-nummnnlm nu 1 I -I lim AISH n IRI I5 In I I I ll lllll llhl I I L v vl-nu I u nfn 1 I Q I1 xhtxllllllilllill U' 'VU' l ln' ' ' I I I frat 7 .4 JE -fgmfgwrnnp M Y .I 52: V 'I ' 5-5' fiiii 'lh I 5 .:- Engl? I :Z N A k VL A I nn -Eli' Q IN vu- un 'l': ' ' 2'l5 l Fu'i i 'I' ''GIIEIXRSBIIZIBHIIZIIRIHIIIIS I I I lllllilnlnel- . .--. nu--. -1 ...... .iiilF..Q!. V W: my A F I 4 ? 7 I 7 in .. Am 1,21 I 15 x, 4 i A-in W W 'F L01 4 3 l b Hgh ga' V I ' F b ll S d 3 -,Im ars1ty oot a qua I -I WHS, D. I. BARRON . . . . . . . ..... Captain I I XV. A. IXLEXAXDER . . . . n. Head Coach R. A. CIJAY . . . Assisiant Coach 4 R. F. XVOOD .Line Coach H A' W C. C. GRIFFIN . . . Trainer A 'Q H. D. CARTER . . Manager if . FIRST VARSITY BARRON, D. I. FLEETwooD, C. G. INICDONOUGH, J. J. BORUBI, V. L. GARDNER, G. C. MITCHELL, VV. M. 5 BREWSTER, J. D. HUNT, A. T. IIIURPHY, T. M. I 5 CONNELI., H. R. IIYINIAN, W. P. STATON, A. H. DAX'IS, O. G. IVICINTYRE, J. F. STATON, J. C. -. I FRYE, C. A. MCCONNELL, F- Usnv, J. A. I IXRINIENTROUT, G. E. SECOND VARSITY X ALERIG1-IT, J. G. HARRIS, F. G. PovoA, G-. M. CALDWVELL, E. P. HALL, H. E. REEX'ES, H, L, BELL, J. F. JOHNSON, C- E- IIATHER, C. P. CARPENTER, S. M. MAIER, J. SAUNDERS, F, D. DAvIs, A. MALONE, R. IV. TI-IORPE, M. M. ji GODNVIN, VV. A. MCBRIDE, G- XVEAVER, O, L, :I GLEN, J. E. MCJVHORTER, JV- F- XVI-IELCIIEL, H. HARTFORD, VV. D. NABEI-I-E, E- G- VVI-IELCI-IEI., I.. I ff o oxP4l.,.., ji-IE, 0 V A f of '- 9 - 4 -- I 7 2' . . --125555: GTI Jf : L 1 ' P Y Y f I 2 I WY A ITMJ I R MA ' ' .. ' F1 -g. ' I- LIDHE 'Q I A 0 ' f L WA fl. L- L K 2+.2 'Oe L y -fi I 1:9 ' 5 V QN. 2 1 ' fi. . ...... ,. , f' S 1 'X Y 1-va. 5 Q, I 5.3 I -0:-f:-C-.,.,-ar! L 'T 'Ty . ., if 4 M' 1 f I f ' 4 5 u 'Q H HU v W v H H1 in- r-1 .nl-5-e -r qs c nn: 1- 1: 1 l I 1 ,,.. .,,. 'El ,I Y In W, 1- . . W , fii- ml ? 1 .5 '33 . .:. '11, iw, I ...- E . iimlinIi1Zi...... ... .... . , .a:::::a::'.::s:xs ' ' f ' A ,,.. , .,- -3- ' -I fo ' s Flax?-Q Q w 1 b H if s K Q Cu 1 QR 1 ,lg L.-.I 551 N. Q-I F2 -v gf :::.::5 E'55':55g,.qh Ei? QE gl 'f E -:-1 X 'N 5 2:- W' 54 Z Q f 3 lf: i 4 sis Q if i Z II:-I 'A '4 M1 - - ff rw -- 4 5 9 Q' -- Q :ki 5 f k 4 -.1 , ti y , 'iiff I , Illia mv- 4 WA.: P' -3 if!! :Eg mID W e Q r WW ' .A V553 I. ' I-NJ I 4?--v mg 1 EE Fmuf un-Q 'H LJ V WI 2.5: M 4 - 4 w J! N w ?2 . .9 ' 2 CAPTAIN u1iEDu Bmmox if ' ' 55 Q . 5 2 5 59 RQ if if ,-j' V' Q xo :wh Lil A 1 O L N Y 7 'W ' I ,X V Vw M - M-,k.gX.X3Q? XKXXXX.mX.,Xw.X,Q,lY.. . 'QQ E Q Q55 Q in v..-'.---.4.---.-.-.v.-.f.-f.'.-W -iw .-.-f.fnsg,w.n,wg-g-gf:-1-QW:-V1.5- QQ Y, 1 M , A V A W ,V A V A x ...lx ,, I .. , W... Y v Z- , jx L . .. ' LIONEL K - 0 'r ,45 ,' o LLLW, ,bang ,ff f JFK- , --f bt O Q' l Q 09644 A17 y ., me - we F N '7 E N ga Og . f v lr' E M716 N. O 'N o 4 ' fp c 'I-5,51 ' n f W X CX full . - ' . ' ' ' 5 4 f 1 I no-c-ox:-7 I 5 X f 'MA W 1 f h s-mf X iq' 'I Nw A ' - A Hg ff' x I f f4 ..-- r ll . umm'm,5g,1':,,,,,,,.,,,, , ,7,f, . an ......,.,....,.........,.w-V W W- .m...,m.f.....,..u..mm...mm.m.mm-. Hsu. in 1 4, :.L,,,.,.. 1 Fmigimmnq5555g555:::ux:za::alIIaluminiumImmun:mnmlaammnILum4uis.1H..-.u...m.4.u-an--n.-mm V ...U . . 'wi 4 ,. , A E' we Eiihmg 3 .: 1 y Y is u wa.........n..............x. . . .....: :.u....l...n ...:. z.. lm.. . .. ' 1 3 xix::eii5i...... ..4..... ...i::::::: as:::::x::::::a:.-::a:r.::::m::mama::mx:u:s::::::::: -lliililillllllflHI1ll'il3l5'im r if i l in 15 lg' ., : . : n Q ' Q Q 0 .4 - lv' Il . ?. D4 I1 E. ,1 Q . L ,, z1.,,. ...... AQ? L A n r ly.: fir gel .alma 1 l W3 I l:l noi ,o 'I ' l A A T e C dh 1. n S S o 0 ' ' A magnificent day ended gloriously, a ' football season was closed successfully, a valiant team lost, and an eleven of true, sportsmanly athletes won the S. I. A. A. sf' Championship on Grant Field before the largest football audience in the history of 4 the south. Our old friendly rivals of many years were met and conquered in the best lil of spirit on the memorable Thanksgiving which has passed into history within the archives of our Alma Mater. The day seemed electrified by the im- QI pending contest. As the sun beamed a fair ll . promise crossing the meridian at noon, many were passing through the gates at the field and the others were draining the last drops of demi tasse marking the close of the annual dinner of dinners. As the warriors came on the field the stands were roused to vibration . with thousands of voices and the bands of Tech and Auburn played the accompaniment '- while the limbs of every tree in five blocks and the roofs of every neighboring house shook E with the noise. Signal practice over, the two elevens took their respective sides, when Z1 hush fell on the audience as the Auburn eleven, led by Captain Shirley, bore a magnificent silver service across the field to Captain Barron, who met them with the Yellow Jackets and E accepted it as one of the presents of his wedding to be solemnized at six o'clock that evening. 'S The presentation finished, the two old-time rivals squared for the contest. Q The large crowd saw a real football game that day, one of the cleanest games ever S played in the Southlandg every minute of it intense. The two outstanding stars of the game were Captain VRed Barron of Tech and Captain Shirley of Auburn, both of whom were to play their last game. Red charged the opposition more energetically than ever, well demon- strating the fact that on that day Tech was to lose one of the greatest players in her history, one of the greatest backs in the United States. Captain Shirley pros ed himself the most worthy opponent Tech has found in many a day his offensive work seeming almost super- human at times Auburn Jouineyed to meet us with the greatest team she has ever had but she met one just enough better to take her measure Tech driving to a glorious win while Auburn was defeated but not beaten as they fought the hardest and cleanest game ever seen on Grant Field -5C!f0 X 6 0 llllll 'H 1' ui 0 ,N gl? ji? All' blaesfl' 's Ag xvsz'-ass 5' r' -' x 2 N E . A r D o . j 2 li x Hug' of i'rr1: 64,90 fir, '12 . ' L61 .L i l NOb u Q . 3 'lui o ' A XK is X W G 'O W l . . fl . ig N ' 6 . E . f ye I In :fur 1 ' 1. rw klggd if ' ,fi-gpg AQ i tctser i or x q GN X w . f x I 4 4 . W-N., Q. 1 J .. , .asf ,, , . .. ' T -- fo ufguilg dnl! ll l I 5 I II U Y: Ihr-ns: yu .d14..:S -fs. ,Jn . . . ..-nun!! L .,.....nzg M . 4 .- 4- . ,. ... YW- YBu-uM-H-u4v- , -ldr -4'-.-M--tiFl::JLxH.uY 1 r .yi iq li - X ' fill ? I- fin, l.a. ,' QI -IZ-' 5 I 1 un 5 ...xr s Q ,1 .'jfux'l: :'1...........f..., .a:::'-'zzz :::: ' sn-- ?75WT'T. -,,, Q V , 4 Y' ' Q' Q ju 4. ai: 'ul W ' ISSJ P ik.: 1 l gli. , viii P vm l dll!! ITE! 'lN XG.'-RSL 'QNX L NX sr Championship From Auburn Tech defended the southern goal, Mc- ' Donough returning Moultoifs kick ten yards. After two downs, Brewster punted thirty-five yards, and Shirley returned the ball for some brilliant runs before printing over Tech's goal line. Two first downs, and Brewster punted to Auburn's twenty-eight- , ' v 5,1 '-Qxg,f :1':7Qg, 1 ' yard line. On the fourth down Shirley .if-3 'ir 1' 534 flig- puntcd and McDonough fumbled, Lawrence , ig 1-CCOVC1'iI1g for Auburn on our eighteen-yard A A T - f i 5.g'.L! i ,e ' line. Auburn failed to gain on downs, and V ' - f 7 LACK-p 'T'.1.. r ' 4 '13 .'ff.'.,,, H ' ' after running two downs, Tech punted to Auburn's forty-two-yard line. By a succession of fierce line blows, Auburn worked the ball to Teeh's fourteen-yard line, when several passes failed. Several brilliant line plunges and end runs ended when Tech lost the ball on Auburn's two-yard line, one pass of twenty-eight yards, McDonough to Hunt, being the feature of the advance. Following trials at the line, Shirley punted and McDonough scored over the line after a neat end run of twelve yards by Barron, and a fourteen-yard pass, Brewster to J. Staton. Brewster kicked goal. The half ended with the ball on Auburn's thirty-yard line in Tech's possession. On the kick-off, Barron returned the ball twenty-three yards, and Brewster followed with a thirty-six-yard run to Auburn's twenty-three-yard line. After three plunges, Brewster failed to drop-kick goal. Failing to gain, Shirley kicked to Barron. A long series of line bucks, end runs and passes gave Tech first down on Auburnts sixteen-yard line. Another first down and a series of bucks ended when Red went over for the second touchdown, and Brewster kicked goal for a 14-0 score. Auburn kicked and Barron returned thirty-six yards, when Shirley, the only man in front of him, tackled and saved a touch- down. Shirling intercepted a pass and Auburn punted over Teeh's goal line. On an at- tempted triple pass, Tech fumbled and Lawrence recovered for Auburn on Tech's fourteen- yard line. A series of short line plunges gave Auburn their touchdown. Moulton missed goal. After several exchanges, a. few long runs by Shirley, and an intemeptffd PHSS, the game ended with the ball in Auburnts hands on their thirty-five-yard line. p A bluish, smoky dusk had settled down on Grant Field during the contest. and it closed in on the battling elevens as they retired on that glorious day. Barron, gladiator .of many encounters, finished his last game for Tech and left the field bound for his wedding cere- mony. A1 Staton, Brewster, Davis, McDonough, Mitchell, Lyman and Hunt ended their football careers at Tech on a field of glory, and their names will live long in our memory and in the history of Tech athletics X 'N it ,N v , :tif I X'- 1 tiki lik-:il 1 :SH , E14 . is. '. N: Sa .ki Qi ' 4:- 3:1 QS S 'S IRE ,ENT UQ: U5 l,:. l:2fE: .'.' H55 eil-:1 H3125 ' r:-: .wifi M533 ' if! i W:-1 iiil ..5'l 121' I. X i. tx. tif' .vi gg, .., 'N lg, V L ' -um- ' E 77 r V 4 l J J .4 4. I :L 1 55 5 ti: ffi .323 l his v.-.3.-r.-.-.-. .n.Xx.x.xLs .xx.xx.x l s 4 l ,g. g. I l F. P ,W -. .. Y A : Q, ,X 3 . ' - N: Y . . t ii, .tx X- ...sc a Q 1 1 '. -- ,L .. . , , x,f1-1-I - z - vw- Ogle.2-:-:-,:-1-i-1-1--1-Z eww-wwwMsmmmw A . flirt , N .c .t ' UO N E L ' 'A ' Q - ' l2iii ' .. U L x x K' r' 0 ,fs-Vifsf - a s K - 'fffiffq' -' A S P,-1 . fx - A - O. S as 17Q.4iEa.- x fs xffd J ildlbjf' ' TW 3 dal' . f ' aA' A A 1 -1 ' --252:-.22 ' A , , --f. 'x- . - ' , . f'-'. . F , f f2s5.,e.,a.j'uufuunnu.'.ge ' 'HlflIlifl'iillifllil'llEil 'rl Hifi ' 'lllmui ' ' A ' ' I 'nu 0 R ' ' .!!f ! lI 'af' I 2 '-mb ::-::- ' A N .. :'i55fiEEil.., 'N . ......... .......... ....................u.....:,........ ........ ..... .. ..............m,,-,,-, -::-::--:-----::--:---' '-'--- -'----'- 'r 'r::-'-: :l-:--:--:::s:::::: '- ':z: 'll 'H' ---- J--' -- F , 1 0 W fy, X N Q 1 ,- - X 1' H' 1 is - -f' ' rr Y! X x K 1 , 06,6 .,J , 'Q .wx s 3 f Q g y U. H I 5 1 ':!::22IH l H1EiFmiEiEiE!EEi..:.--.mmf L 1 mi! -ninth -anim-lummstun1-me-in-in-1um--anK-1--:m-1m:ssess,1xv.u- uf' .ummm nv my nun 1 um-uummummnm-vm wr - mm-n vmmmf l'I1 H 'f mI S :wg 'sig ::::::: 'U Hu' gmzmg, :mul - --.4 EEF- ---an m',,......... p I Il a. lg 1 H nhl I v , lm ml p - ..., -- - f ,I I 1 1 ' .......nn.................... .:.... ...... ... .. -----m n' a 5 x Su a nu nu- 1 -mm-- .nun mn - -I E - n . ..- -- n- 1 in 9 ., .12 :::::::x F li--aqziiiiiiiill.. ., 1 7 L X ' -. -. '-4 w t W rl YJ LoAI ' Lo!-I Illll '--up '-lIIIl- ' ' QE' wwab qmmq HWA gpg few Mly -v -wi nf' q i: ,Em vc! COACH ALEX vc-it Flllq U H . . li l 1 William A. Alexander, better known as Alex , began his career at Georgia , Tech in 1906 as a student. Up until that time his experience along football lines W ,S J 55 1 y I '1 1 Was a negative quantity. After four years of hard Work on the scrubs he had ab- sorbed enough knowledge to land a berth on the regular team and make his letter ' ' in 1912. ' 9 ' Although the faculty tried to get rid of him by giving him a degree of B.S. in Civil Engineering, he refused to leave and returned in the fall of 1912 as assis- X tant to Coach Heisman and as instructor in the Mathematics Department. He served in this capacityluntil the outbreak of the war, when he joined the army and serv- 9 ed in France as a Lieutenant in the Engineers. After another year as assistant in 1921, he was made head' coach of athletics upon the resignation of John Heisman. 'Z' His record as director of athletics has caused nation-wide comment and the eyes of the sport world are on him. He is the youngest coach at a major college and forlthat reason his brilliant work is even more praiseworthy. His biggest , asset is his personality, which is so outstanding in his work as to command the ' love and respect of everyone with Whom he comes in contact. The school is behind him to a man, and will support himin anything he may undertake. s I li' Q ' Q 4 Q ' 3 Q , oQ'. ' -. .. 1' 4 l- kwa... : Z h, A' :Q X--. Q Y Y Il .5 1 QQ? ---. , - . A gigk E'5i!5JgWrL ,. . wwmmggxmmgmwwggb D ali a s-OO L LION! . . K K 1 X -5 94 . 1 11 .il Y' . ...T-'N . 1 el9251 gif - . A ' 8 '35, - f- H':'1o ', ! '1 ' - '- ' ' 3? 'L' ' -. ' . T- EggggQE!Iiniiiiiiiff:gE5gi5gE:::::n::::mfn nilmTmnuanm-nimexmiisaansiifxggiiiiamm-2 ?f...,Q- .... .i..,,.,,,,,.-,.g,,,L.,L,-31, L7 , ' v I In Q .- k b --:x-- ' r: aguuezz. ' ' ' ' P ' ' ' f ----- ---4 ------ - - 4,::2:i,E:1.l--V izfffl-.- ....... ...., ..::m::::::::a::-'--'-------- - ..:3z .....,,-sas-.. J 1 4 '1 -4 1 i 1 lr: 1 A i vsp. .A ffw-f itil' -I C5 9 vim 155111 ' 11 'I li' ' 1511 . E341 1 2' Q H3315 3 Riu' 12 lf ' L. If V I . x X X vi, . 2 f - , I A : ' :as Q f X W' t 'f f 5 K I-' . ...'1 5 f ' 1 JN- Q' 1 A A 1351! 71 ' litdll 2 1 s i Z 1 1 ,X 1 1 Z 4 ,H u, .1 1 .4 A My . ... ,V 1 ,. fir-Y 'ig 1,5111 6 fer ,si-fd 1 ' . V 5 1 , Q . ' 1 ,N 3 '1r.!!.,'- 1 Y., ' 1- 1,13 . 5 li -' I4 '.-f .fb ff- iii: 2 s in - , . A . ivffa 5 i f 'I-El' I' I 1 . 'Q L 3.5:' Z .r , , ' W 7QggQ'4A.L A- 77328 , '.'.l Q 4 . ...L i 741754: 52-9, 7f'j,j,,1'- 1 12321, 1 ,sr 'T ' 1 1 -f at lei L -1 N 'I 1 '31 we .4 I. ' F in 1,4 .- D . 1 El 1 I Ill' 1 HQ: im M .J vnu? 5, 1 l lllllf IE .l . 1 Our Assistant Coaches Coach F. F. lVood, the mighty line coach of the Tornado for thc past five or six years, came to Tech from Notre Dame, the school that is noted for its famous football teams. Coach lvood has developed a powerful line during his stay at Tech, each year seems to find this part of the team stronger than in the preceding season. His coaching has helped develop such linesmen as Bill Fincher, A1 Staton, Oscar Davis, and other noted Tech forwards. The thoroughness of 451 fi D1 .,. 555 E Q it 1 F? illb , -um- Ill v C? L . 2 an 'D' .Y41 L35 95 53 'Z r. WI Coach lVood's drilling was apparent to all who witnessed the 1922 Auburn en- W A counter. 3 Coach R. A. Clay, more often called simply Kid , is a Tech product from many years ago. Kid received the bulk of his football training under the tute- lage of Coach Johnny Heisman. But Kid Clayis game is baseball, and he is if cj always happiest when the short cold days of winter begin to blend into the warmer 5 days of early spring. Kid Clay ,now has had full charge of the baseball work Q., for the past two years, and each season has turned out a team that has fought its way to the pinnacle of Southern college baseball. .ll George Griffin has almost become a landmark at Grant Field. George is de- g pended on to help mold the freshman football team into a team thoroughly drilled 153 3 in Tech athletics. Someone once started the expression. Let George do itf' and 1-- 5 someone else applied it to our George. The result has been an unbeatable fresh- 1 man squad for the past two or three years. It is doubtful if Tech would feel right should Daddy,' Amis decide to leave our campus. Daddy,' was the hub around which the Tornado was built for several years and it was with much regret that Tech followers saw the old warrior play his last game two seasons ago. But Daddy,' was not to leave his Alma Mater, for he returned to coach the freshman basketball and baseball teams and assist George Griffin with freslnnan football. Thus is Tech fortunate in her assistant coaches! 1 O ssififfigf 0 e A 1 ,WPQQWQFZOOHXY :So 3 ff livrsszxlsrrz-1211112141255ztfrxzatzi-I:1:1:5: fzzszizrzeizlsx-:-are:-r 1111.1-:-:-.1J . Som K. . . . W xi N 2,17 ?:!'T?g,Gi3'N C - QSMX' 7 --1 '. 5' 1 1, if 1 iii? . - - . 111 1925 'V X f YQ '-1'- '-------- '-- . :Eg 1 11 11111 I ll E, D L P IL llgiliilniiiiz .........i...... , 4:::::a::am::mnaz:::s::::a::s:n:::::m::.':::::::xm::::: ------- ---::::::::::::::::mn:::a::::::::::::::::::::::: ::: ' ' :n::::nzz::annns5:nm:::::z:::::::::1:::n:::::xm:l::::::::::::::. H : ::::::::::' ' R' 'am 5 :3355 11 Z 1 E253 A DAVID IRENUS BARRON, Hazfbaclc ' 1 t n f 1 Clarkesville, Georgia, claims the distinction of being ' the birthplace of the versatile Captain 'iRed . The 1 old home town, however, could not hold him long and if 1 if he prepped at Monroe A. 8: M. Here he established 11 a statewide reputation as a stellar athlete. On com ti 1 ing to Tech in 1918, he stepped right into a varsity A position and since that time has played halfbaCk OH the Golden Tornado. He and Al Staton share the 1' honor of being the only men to win five letters ln foot- ball, made possible by the S. A. T. C. year of. 1918. His great spirit has repeatedly kept the team. in the running, and as captain of the 1922 eleven, his gen- 1 eralship was superb. As a climax to a wonderful J career. he married Miss Alice House, on Thanksgiv- ing. His honor roll includes repeated All-Southern 4. berths and a position on Walter Camp's second All- ' American. A 1 X Y , ,L JOHN FRANKLIN MCINTYRE, Gum-cz 11 11, 1 - A 1 1 11 '41 John might be termed a knock-about sort of fellow. 'L He was born in Bigbee, Mississippi, but soon drifted 1 1 out into the wilds of Arkansas and took up his abode 1 , 1 1 1 in Pine Bluff. He returned to civilization in 1919 1 if-'el when he enrolled at Tech. He made his football IHS li 1111.11 numeral on the famous 1920 Tornado and in 1921 he . 11 1 1 : 1 was awarded a letter. He came into prominence on 'Q Wine, the eleven of 1922 when he earned the distinction of 1 1 1 being one of the South's best guards, and in recog- if nition of his fine work his teammates elected him to , one of Techis greatest honors, captain of the Golden Q7- l ' 1 ' Tornado for 1923. 111 1 11 Y 1? if . ALBERT ,HAMMOND STATON, Tackle . , Al'is a localproduct, having done his preliminary, 1 work at Boys' High School in Atlanta. He came to it Techhin fthe bfi? of 1918, and that year played tackle E' on t e oot a team. He is a member of the old E Pittsburg bunch that thrice made the trip with such f unfortunate results. Al is one of the most consistent N players that we have ever had and is always depend- U able. He-has several t1mes.earned a position on the My Composite All-Southern during the five years that he 11. played' on the gridiron. He has been. married for .1 some time now and is already training Albert, iunior, 1 in the ways and wiles of a tackle. The team will miss 1 Al long after he has gone. 12 1: E1 . 1 1 1 A E 1 as 1 Q so-' , 5CffO 0 I' Q' ' Q A '- .. 1 . 1 f A ..... - if i mc 1 Rig? 2' .1 ' .... ..... . . 'ilf ' s Q. e A a QM 1 .. ,esasooq-A-1,4f.4aQg4z432ssxw W K ,f 5 , 1 4 I rf' 11 : KET! ,xx L A K il hu u n-if . xg A f 1 ! . ,. fi ,, ' 4 .. 1 1 1 N J 1 -xv . ly. 5 4 1t 1 1- A W 1 , 1 13:4 sf! -mi 1 qgW'11 1 Wil 1 1 qi 1 1 II1 ' 'il 'o J fo 'e w 1 1 Th :n . to . . 0' 's A KKTN1' X 25 1 51 ki. G 7 n 2 1. . :- 6 ' .fx SQL ? LAON its - 'Q .te .51 KN 'FF gl ES: 'rf I - 1. .1 MN Q R. . , 1 M. 3553555Eggggggaan-arseassi:1::mrmwvm1uwwWm1w' 8EiT-fsfvfs'gLQff gg,,.q, - ..,. . . V .-.. -. rin- ,- , ,,, -,,,,, .,,,,,,.,,,,,,....... 3552 - pr---C--1 I -F if THE DLVE. PILI lli ilihuxxinsilfl .... . ..... . , 4:::::::a::::::::-- - -- --'- --z.-::z:::gn:.-gz-- ':. , , . . ,, '1,:,iL l .. OSCAR GOLDSMITH DAVIS, Guard ,gi f Oscar is one of the original hard luck boys. Since ,ff:'2? - he left Boys' High School, where he prepped, he has been almost continually in some scrape with old man 1441? 'fs J jinx. In 1918, his first year at Tech, after he had ,5 won the position of varsity center, he had his leg i 5 broken in a motorcycle accident and was laid up for the season. He barely missed making his letter in 1919, and the next year with the beginning of the Alexander regime, burst forth as one of the outstand- ,gi ing guards of the South. Since that time he has been Q25 1 77 one of the mainstays of the team. Appendieitis kept Q f him out part of 1921, but his tremendous aggressive- gf ness last year won him nationwide praise. Not only . 5 did he make the composite All-Southern, but Law- fjiil Z renee Perry placed him at guard on his All-American. Ili! T JOHN JOSEPH MCDONOUGH, Qllfl7'tCI'blICk fo Geechie hails from the city of rice and peculiar gf' pronunciation, Savannah. Here he played three years FQE3? ,Z on the football team, trying every position in the hack- Z field. He secured the directing position on the team lf? ff his first year at Tech and for four years has been the it lt! li field general of the Golden Tornado. Besides being a Q51 n 4 marvel at strategy, he is the best tackler and runs W -,l lm' the best interference of any man since the days of Joe ' M 4 b Guyon. Although somewhat small of stature he is 3 1354 as hard as a rock, and except for the time he IIC- sir quired a. broken ankle in the Pittsburg game of 1920, y i, 'ggi has rarely suffered from injury. J i' .JQJ 1 L diff JOHN CURTIS STATON, Jn., End ' John followed in the footsteps of his brother, Al, 1 7 X and graduated from Boys' High School. There he .ji jg A played four years on the team, during, which time he 2 tm tried every position except end. For this reason it is indeed strange that when he came to Tech in 1920 1 Q QQ he should make varsity end on the team of that 2 jj year. 1Vith Bill Fincher for a partner he did some gf' . fine playing that year and won a. position on the com- x posite All-Southern. Although hindered in 1921 by li? a broken arm, he had a good season, and was back in Q .form again last year. John has another year and 1' A N- should be a great help to the team when the 1923 5. --.- ,j '.', '.., Q h -I season rolls around. iff--' A E ' E JAMES DAVID BREXVSTER, Halfback .. + 3 1Vhen Jimmie reported on the field for football ,,,t,5.j,3,2ig,' Practice in 1919 he was so small that even the fact -i'r qi if tha.t he had made three letters at Newnan failed to create much impression. He had the goods, however, f ' and played in the Auburn game of that year. He , made his numeral in 1920 and has since been one of ' g ,' the regular halfs. He is a wonder at sidestepping ,A and is one of the best punters in the South. It is We A , V3 fg certainly to be regretted that he will not be able to 5 'L,, ., I play next year. l S ' S ' lg .4 7' 1' 1' o ,,,,,, ..... S Q , S- 53 . . L! 7-N . WX, QmmwgQmwM.Wg V . sfazgzgggf:g.gpg1:,p4,4-zizl 1:-:-:-I-1-:'1f:1r1z::22R2-T-:-.'-:-1-1-:o1f:w4f:f 0 if ,:l',v::70 A if QQ! 1 .. .. 5.545 N 1- of H. 4 as l sc X X 'rw 1 s 1, iv. N ' vi Q' 1 ' In ' if ? X , 4 N Q ' 5 1 Y If X I 'Q 1 -'Ns f .,' Kc. 'G If 'yy .13 SN 5 1 ' x M - X ac ' f 1 df X M 1' i f ,.- v - U' ' : x um' HX If I -1--'lui.nlIllmmimwimyIniamnisilliaxiiuii-Uriah., 1 1. mm. n 1 In sa s mmmm-n an-ur -mm nu 1 mn aw n H m 1 U 1 .......mn-fm -1 . -1- r - -1 mm..-.mnmy-mv-nnmmmnu-mmm.I sigma, 1 4,1 .qumay . 4 ii In ll :WK IH : ' ' i v 1' gg sg x :lp a I :x . .1 1 1 . 4 - ' 1 1 'X fy ,i mga i . ' nm , Qi J ?!!:EEEE. .. 1 V ' .. - 1 :- i!2E i'iQ 3iil:ii32l.........a...... .s:::::::lax::::::::::::::::::::n:::::: I-'iii-':::i:'.:1:::m:::::::::::: :::::::::::r.:L1'.:::::::::::::::i:: :::::zz:::::21:I::::III!Illl-'IIIII:IIIIIAHII:::::: -'--' II ini!!IIIImlmilni:I:::::ll!::Saliimiiltiillrlli-.ISISI2H.-. .........-... ..15g. :J K' ' f I - - 1 l 5' 'iililiuumlii Na 4 .R K' I 2' ' ' X1 A 2 -, i s 1 5 x ' :' 21 f 1 , 1 5 . Q i 4 5 . 3. 3 1 c 9 i: I .-' c ' r '. 1 I r , ' f 1 Ei l I ll ' y Ia 5 f , . A . S il 55 , , f X 55 . . 5 :C . , . :3 1 . c 4' 'Q 4. .4 i I I 45 P 3,4 HI' . 1 P . L 4 My 'IW 1 may nu ,gi 1 PID! EU 55' I. 4 1 if ,. '. Q . Y 0 go I yn W F ,v K. 9 it : 5: ,. 2' 7 4' . an V1 CLARE ALANSON FRYE Center Clare is another man from the wild and wooly west, hailing from Oklahoma City Oklahoma.. At that time he was hindered by a scarcity of avoirdu- pois but played on the local high school team. fwo years of football with Uncle Sams aggregation serw ed to season him so that after scrubbing a year at Tech he was awarded his numeral in 1920. The next year he played at various positions on the sarsity line but did not come into his own until last year when he was selected as All-Southern center. He is the alternate captain of the 1923 elew en. . VVILLIAM PAUL LYMAN, Tackle ' Paul began his football career at the McCallie High School, in Chattanooga, where he played for three years and was ,captain of the team in his senior year. Pollie came to Tech in 1919, and was a valuable asset to the scrub team of that year. He moved up to the' second varsity the next-year and was awarded a numeral. 1921 found him at varsity tackle, at which position he has done some remarkable playing. Paul is one of the most popular boys that ever came to Tech, being twice president of his class. It is hard to lose men like Paul, but they will graduate. r ALEXANDER TROTTER HUNT, Fullback To look at Pinky one would never suspect that he was born in a place with a name like Arkadelphia, Arkansas, but he soon moved over into Louisiana, which, we hope, is better. He prepped at Staunton Mi1itary!Academy, where he played ori the football team. After a year on the scrubs, he became a mem- ber of the famous pony backfield, and as such, won his letter as substitute quarterback in 1921. Last year he took over the big job of filling Judv's shoes, which he did admirably well. ' I VERNON LYONS BORUM Guard Y The birth certificate of Skinny is filed in the city of 'Norfolk Virginia and is dated somewhere about 1901. After playing football at Savannah and at Maury Virginia he came to Tech in 1919 He sened faithfully on the scrubs and the second varsity until in 1922 he won a position on the varsity . Them net er was a harder worker than Skinny and he certainly deserves praise for the way he has giwen of himself for Tech . Sc 6 .4f 11fC? H N ' ., ,-,,1.-. L I ,g u- : X S -'f2EEi5gi1 9F?CZ laid 2, . - - - gg v.: J .. 2-02 - W -91 N Eggs-rr Eg. EEL? Y -L A 'KC .I 3:3 S: . 32 . 3 - 9 3 9 Q ' . ' Y V . , c Y . C V ' c I 'l 0 of , : . ., 9 f 'r . .1 0 ----' s f. 'i 5' zu . 'wi xl V, 1 1 . ...... . , W D 4 . 1 www-ta, F 1. 52, ,,,,,,,,,,,,, A aka' ., r M G K, , X . . 2 L EL K Qs 43 ' I C I I LLVY' EA' Y n'5',y -1 fJOAo O5 Lxoynl :D-' v 1 '- y. pu 'D' iw ig I 1... 1 , K ' se, . ws. :-if W. , N - i s F 6: . ft 'S -- fi v - 1- 145 . vs.. L-'T A -ca,--.G-ff-. 1-- 2+-A-' -.., 1 ,,--'1-Q, e - ,,-jg' 7 Xiu V. ff 'Q ,-fr-' L ,XR ,T . ff? .1 ' .,. ft. -.1.... --mi... ,... - ..... -..... ..-.-......... . ,,,.g..i.-,,. .-,,,.. Y ....... --.. . L, f ' ,T --,.,f'.,, . W... ..,,:,,,,.,L5:::,:e , 3 , V, . K ', . 1 F - - 1 BLV PKI L 'lit' y . . yi --yur.. ....... -.t... .-.,,..f.. A.,-,, i -, ,Z ' T We IM 1 Q Z5 'ri-1oMAs MILLEGE 31 URPHEY, Ilulfbuek 'M ijfffefiigll -2 'T -1 ' '1'.4'!:.C.5.'ii ' E2E2i , f . . 1 - ffbllll 5:2211 Z Red is another Chattanooga produet, and did his -ff' Z preliminary work at Central High Sehool, and later gf! ' -few 4 at McCallie. At both of these sehools he made a ,dvi IL Z name for himself as an athlete and was heralded as - -R 7 such when he came to Teeh in 1920. He was a star - - Riff! f on the Freshman team and eontributed to the sue- ' Z eess of Teeh's first venture of this sort. After scrub- ' 2- 5 Z bing most of the 1921 season, he made the varsity kg 6 squad last year as substitute half and showed up to ' ' Z fine advantage, earning his letter. He should make ' rggi 4 a good man next ve'1r iff:- X ., . . . M, 5 . M531 f e 1,911 . -3 ' 'J -.. . . 1 ,QQ 3 :I 7' GEORGE C. GARIJNER limi ' --- - 115: :I 5 1 -:E Y .v i , IMI I . . . . . 1+ .2-: Z Amerieus, Georgia, is the birthplaee and home of -'-. -5 f ixlji f 1 . - 1 . h .,. 's 95 George, and he spent most or his time there before ,M gli' 555:51 6 eoming to Teeh in 1920. That year he was the main :Nia -4 ,M 3 factor in the winning of the regimental championship fi by Company BI , playing fullbaek on this team. The Q eoaehes recognized his merit and plaeed him on the flfii Q varsity squad at end the next year. Despite the fact 5 :Qi that he has had to work at night to maintain his KQSQZQ' nlaee m the Co-operative Department, he made his lf' J:-QA letter in 1922, doing some fine work on the varsity. K X He will be baek next year and should be a great help . ii l to the team. .. .. W ' . Lx -. - ,. ' Q i 1' l A 1- - - -f4w,gf- . -ui, Ja . -, Qftilflg --.rv . t, Q., .1 lwvl J . aw 3 ' iv ill - 1' f' si - 1- ni- . , XVALTER MARSHALL MITCHELL, and V f',f??g.g? -,Q3 if A a ug I ' . I i...'.if.'i.::...:.:L...--- I . Walt gets his eheeks in letters postmarked Tifton, f .1 , All Georgia, his 'p'arents having moved there from Cor- 4 gf, L 1 -X dele, where he was born. He played two years on if. 3 mv ' f Elm N7 Ai the Tifton team, and one with G. M. C. before coming J ', ,. ,N to Teeh. For some reason VValt didn't try out for 'XP u 'X 1' 1 Q W gi football until his junior year, when he rapidly worked Zin? Y ' ,g 5:3 Q his way up on the serubs until before the season was Q 'ff' 5 ' .' ' Y . '15 2' I over he was playing varsity end. He made a name for 3 f x , f ,If t himself over night and has maintained it throughout ff A s , ' tg 5 Y Z A H . .I Q, the 1922 season. D 3 ,, 1,-Q if J E 'R r:- fi.: .i -' TN E!! 'fi .1 its U I ' .5 FELTON M1-CONNELL, Gum-d ' 5' is ' . ff :if Irish did his prepping at Gainesville and Com- M - W5 meree, having been born in the town of Carnesville, A - Georgia. From there he went toftlie University of I V 141 5 Virginia, where, after scrubbing a year, he won his f' letter in 1920. Although Felton Came to Tech in . 1921, he was unable to play that year because of the 2 eligibility ruling. Unfortunately a. broken foot, sus- Q. We tamed during the early part7of3last season, hindered ' i if R . . , .K Q hun materially and he was unable to perform with QU., his usual ability. Next year should find him in fine . ,- , , shape again. lg , -S-,Q f?'3f?151, 5 Q' H li E if 59 3 E5 if IRAQ L10 ig . ' ' ' ' '. -- ' J rits: ,J Q M3551 . 2 fl. 5 , Ekrl' . u vi XOOQZEM 5 '-.xx Y - v Y , Y A . in ' QL' ' ' ' 'X :uw l --- Y. ' Y- H A-M f A f---' r -AT --iid., 5QOx'mRS5L' Xxx'-csxww 'V-'X' 'NN ' ' ' K, uh EL' 'xx i 'Y Y I ' Y w A N L 67A..x .... e bNX...b.N5'S'Skx xA V :xg-KQQ, QQ.-xy -z - - vga Q F YIM ?,fQfS.1.jl'jj.:.:.jlg1'f'i' z S .ff-f1z XX . '- . 1.2.9 ' Jrfxf , 3 ,. I i I 0 . .3- . .U . x N I f xoA l. v IF 1-9- D vs: ff. u 4 fo! .,11. J ill M 4 ., .., - ' ...- .. . .- .'-. -, -:r:...::..................... .. - 1 - 231 lllilllllii iilitn g55i5ggi:-,-- ----- r ll in ll a umm -In r mum rx mms. may .H 1 1 - - , . . - 1: 3 :::::::.rmg sg dffigfl ,W JOSEPH ALEXANDER USRY, Tackle fr if E ri if 'iii ff 12,13 f .1 viii: 151135 r 'fra . ? -, -S' -' ,, , ,G .4 G 1,4-...krvgf-,, ,,f,,7.,, MX 5 -rf 15331, , 5. 1,15 ' ' 3m1f ' 'f 2f?f,iY2f'f', vol ,U . 'siggif 5,1-rgfsfi 'gl r iff 1 :aria ig il ',- , ,A :3:f.'7 Mgr, Y few-'QL . Q 1 if 2 -lin. - ix . ti-55? ' ggillifii 1 4 I 1 'M if fi if . ', A.. , 1...-5-Q , . ,y . Valar- ,s..,, . .2 K. -1 ly' :rs-zwrziirw 341: .. , .. . . . f., 1 4 5 4 . 32. 52342 'C-ffl'-A. W, rv . 1.1, f -1 I:gsfi':.?'Zrys'-?-fi Q 5 Q., V .1 , ,penal-at-.11 .,a,-4-32 X' 'f PL 'g fs -. P -' . 4- f 12.3 2 - is its all i i . . mr., gc Qs? A siwiggi 3125523 'fi is-V. 53: if Qfgvh' Q27 J 1-f?,,gz2:i ,: , - V. P, ihyrfkvi V 55 Sm -Q--1-4---M ' V-2. . r. A 2721257 esiv f i W . fit? 1.5, .39 Q, .yrlfiz Xl lv, ' .. 'QQ u.z.wf1' ' 7 3 K , J - . 'V' .Liv :E .,-f Yi A' ' 'w f , f! .. i ea S L :jg Wai , i A4-if ,Kiel sa A f , ff .Qi xv., if -QGIW f ,ff 'fs ,,,,s, M 4,2 xi J '5 ,,'fff25f-W2 X Nrffv V Q X' ,zn f-ff 3' f Wu Mfg!! Z 1 ZX? 4 K f' f ,M is .471 z , V 5 ff as 223 fy? 24 5 ff 4 fx X 7 4115? 'ni tt , fig 6 ,fri ,, z V , 'loffvxf ff ?5 if 1: J' f 21,13 f 554, Vit 4 N Ogxmsfmwwmfnmv ff i n Baby Joe refuses to divulge the place of his birth, merely stating that it was in the neighborhood of Thomson, Georgia. It was there that he began his quest for food twenty-one years ago and has kept it up ever since. Joe plaved guard on the Thomson High School team, which taught him enough football to secure him a position on the freshman team of 1920. The next year he won a numeral by his good work on thensecond varsity. In 1922 he held down a varsity berth at tackle .and received considerable recognition for his fine work. CHARLES GREEN FLEETVVOOD Center Red is a Geechie, which is to say that he is from Savannah. Were it not for his superabundance of red hair he would probably be calledby that name rather than Red. However, after playing on the Savannah High School team he came to Tech in 1919. Although light he learned much about football ,in the regulars 'soirees with the varsity. In 1921 he was- awarded his numeral for work at center on the second varsity, and last year gave Frye a terrible struggle for the regular position. He put up such a fight that he was awarded his letter. ' HARVEY RUSSELL CONNELL Tackle Two years of football on the team of the Oakland High School of Oakland, Florida, served to fit Har- vey for college football. After leaving high school he went to the University of Florida, where, in two years, he had burlt up quite'a reputation at the game He entered as a freshman at Tech and was another member of the famous rat team of 1920. Hrs showing on the scrubs and second varsity his sophomore vear was good and last year hrs rncreas rng abrlrty won hrm the coveted T Harvey will be right on the job next year, hrs family having moved here from Florida GERALD EUTSLER ARMENTROUT End Johnny rs one of those fellows who know all about the game but are tremendously handicapped by the lack of weight What he lacks rn weight Fish makes up rn aggressrveness If he were twenty pormcls heavier the coaches would be afraid to let him on the field As rt is now, he knocks them down to his own size and then plays them on equal terms Although born rn Newport New, he prepped 'rt Richmond Academy in Augusta, where he played on the team for three years .SCH Vxrvv v, o 'I X . ' 1, f 0 Y X od xx 5 1 J X A 1 N I It I 'Q 1 '-f Frx. r X L I Ji R: li s A I I ,' X 1, -. .' y nf ' mn .mmm rm, umm., ummm mr ,.,. . 4 X i I n H, . ,mu rm mum 1 . ..,, in . ...mm-r..--mrm mm . I ,, ' J J.. ,, ., . ,, . .. . . .. .. .. . .. .. ,,.. ,ru I a as I .JI '5 1 . .:-IE? itil. A I - ' gag! I mu H,,l,::L,::::::::m:m::,........... gmgmggzazg:...::::::::.l:::::::::: '.::':'.... .....-.. ...!.......:..'..... il!! .igil ilniiiil.. ..... . ..... .. .a::::::::::::::::::::::::::::::::i:::::::::::::::::::::::::::::::: :::::::::::::::::::.:::::::...-.-.lr:7::...... .....- 5, K g l l ' s l F r I s ' A I 24? 2. r , . r' co 5' 'fd , Vi W W 5'- P I hmm wi ll Y of' L' , I Q0 ' H' Him W QQ mxwmmwz-zmmwmxx HON fl f X '--11-all , o as .mr 1 U N 44 Z J C852 +7 'Sli-14, l J l V l 1 .V 3 . J 9 1' Z 4 2 1 4 W Q f 9 Q - ? 6 4 f Z 2? - , Q 1' i ff' A . 5 rf g' 1 F ? s 1' lj 1 1. Il sa 7. 1,4 W 4 il il v 4 1' R 4 Qs - Y lim nz 'Ill ll Mb ,-my lLL.ill wa 3 lll' , W N S N FR: 3 8 T lil Fi: 91 C'I FI: 1 L IS, 1 ll g. 'Q 1 Q St 1 XJ N .. . Vw Q 55: S R: NR M . E1 'T J . I Ulm ggxnnnx ---.. ,Sling 1 -4 .B .N X- I -. ,-- X . ' . .. ' - . '4 if '71 4 +R.. -X . ' Af,-ga' pn fix Ai , ' Q ' ' i Ear -i L' -. - 4 3 - . - .5 143-1 K-x -- xg , -Y ,- --- .,- -wiln14un+afeswt-suinieaf-f-fa-C 'A-:ir-we--,--ee--viv1se:.::1. -v.1.v..f...-. -- -. f ' ' ' ' --- -4,, . .---- ' IN! -A twnwwwiifiw ......,,,,: .,......'i::., I5 LV E P ...ELI BELL, J. L. Busmx, T. CA1.DwEI.I., E. J. A. C.xnPr:N'r1-zn, S. M. CIIAMIAN, IJAVIS, A. R. L. DUBos1-2, B. P. Dux woony, E LI.ro'1'1', J. Fon n r:s'n:n , V . H. R. B. XV. R. Scrub Football Squad GLENN, J. E. Gonwrx, XY. H. Gn.xxcr:u, H. G. H.XllIKIS. F. G. l'iAIl'I'FOllD: XV. D. I-Ilxfzs, M. Jouxsox, C. limo, J. R. NIAIITIN, M. H. 3lCXVlIUll'I'Hll. XV. 17. i . F. ,'+'w-Q..-Q.. AIOORE, F. B. N.xm:I.I.i1:, E. G. Ii.xT11sn, C. P. Iii-:i-zvrzs, H. L. S.x1'xuEns, F. D. S'I'.Vl'lIAJl. Ii. G. S'ronr:x', XY. D. XYr:.xvr:n4, .-X. Y. XVlIl'Il.ClIl-II.. L. XYOODIKVFI-'jr A. G I-011' . .y 3122-3' ' .-f. TU 4 Rial N-1 1 ' Tl It ll i 1 1 1 3552 1 :5 ' l . 'I cg. le 1 Gil Z' x:l1 all 5.-5, ,441 fgnll Wi 253' Pal '52 i r-, ' 5. wx 1. .1 malt l ,'q.1 '.-I. 1 1.-l ,nil at N . 1 1 ' . lalftif is.. ,.?j:7, 1893 Football Team - Qne of the pages of Tech's athletic history brought to light. Many men since become prominent are on this team, among them General Leonard XVood, one of the highest officials of the American army. l57:5:11 ll-ill 1,1 V. v2- 515331. 1 x Hifi i L.-I 111,-,1 A 1 15. 1 1l:Y:ll 1 s.-.1 1 11., 4.1-.-, l llllu E skg. P3 1 . u 4 me -1 P 1 .1 ., 11. 7:5 1-u 112: E15 15. 1 if it 12 VV' 1 E51 E51 1515 1 l l 1 'A 5 r 1 9. Y: ' P' 50- fig . X r-.' -O , 0 -62:-5'f'e-if D .-X f A0.1f , , ,L Nil ----'- W- 0 'J '1f5' i Q2 zu Y- -' . l i l .X H 31 1' ' Qxxxxwmqgmexmwsxxsxxsz-:swam-mmmx1mb:fxmxrm4frox-rsgfgigo li gg! o??g,5.1.::g,:g.izgizg-1-11:5-:-1 -:-5:-:-:-:-rggo X , 3,4 A .:L 5, ,, I ,, gs' Y Liam. K- Q me ' 4 xox' f' o PFS? viii ' -: 5 . Lv 23.4 1 1' T. 5. Q. 'C v isa . 19229. A is ' ,aa ' . 1 ,, A .1. ,.. 41' Z O will ,WW DQ, V :- L wax 0 , ,qw --0 AJ? .... .. . . .. .. F I . .. 1 lx '::'::::::' zzz:- il ': ':':::::: ':': ' ' 'umm' 'm5'1'z'n'r'u'ss:'ammz:wgW-' :'s:nm.mm'r'm:' in ' vw m' is ' is s Q Review of the 1922 Foot all eason X OGLETHORPE, 6-TECH, 31 5 I x ' HE Golden Tornado got away to a flying start in the 1922 season by defeating X the Oglethorpe Petrels in the opening game by the score of 31 to 6. This plucky f Q7 bunch did some fine work and kept the Tech men working like Trojans for what p PM lxx they got. The feature of the game, however, must be awarded to the visitors, J! and the individual, Maurer. This whirlwind received a kick-of in the shadow Q. of his goal posts, criss-crossed through the entire team with the help of perfect interference, and placed the ball behind Tech's goal line. Credit must be given to the whole Tech line .0 in this game, for not a single first down was chalked up against them. 1' DAVIDSON, 0-TECH, 19 The game with this bunch of Wildcats has always been one looked forward to at Tech. The Davidson team always comprises a band of fine, clean sports that play hard and fight to the last. The game was played in a drizzling rain on a muddy field, and as a consequence, to the spectator, was somewhat lacking in interest. The Tech line kept up its splendid record and again held the opponents without a first down. In the backfield Red did some 4, splendid work but, of course, was badly handicapped by the condition of the field. Jack McDonough,s ability to lead a team in action was evident in the sterling manner in which L d ' he erformed. ' Q n AI P A , A ALABAMA, 7-TECH, 33 1 , ,wh The Crimson Tide -poured into Atlanta confident of wiping out any trace of football l l supremacy that they might encounter. It seems that Tech is always at a better advantage 1 , gait when the dope is against them, for the game had been in progress only a few minutes before ' , l l it was evident that the Crimson Tide was recedin before the Golden Tornado. The work of --und . 5 4, , Pup McWhortere was the outstanding feature from the Tech point of view, although he was gill' ably assisted by Red and Jack in getting the ball down the field. Again, to the dismay of Q7 4 Tech supporters, a man ran the ball the whole length of the field from the kick-off, this time U ' the performer being Oliver. The passing of the Jackets was the best ever seen on Grant Field and not a single fumble was made. ' I NAVY, 13-TECH, 0 Despite the desperate efforts of every man on the Tech team the Tornado was compelled to bow before the stronger team of Midshipmen. It seems as though the Jackets are to be 5 forever disappointed in their invasions in the East. The offensive work of Cap Red and the deadly tackling of Clare Frye, although creating a national sensation, were unable to stop it the intricate aerial attack of Annapolis, andthe Jackets trudged home bringing the short 1. end of a 13 to 0 score. A A 'M 1 V NOTRE DAME, 13-TECH, 3 1 For the first time in nine years the Tech team suffered two consecutive defeats, when they were humbled by the fast Notre Dame team by a score of 13 to 3. Fighting desperately g to retrieve the disaster of the previous week the Jackets put all they had into the fray? I gen tpis fell short. In their anxiety the backfield men seemed unable to hold the ball and y .elr ' umbles proved costly, nearly every one being recovered by one of the Westerners. Jimmie Brewster booted a beautiful drop-kick from the thirty-five-yard line for Tech's only p score of the game. It is no fault of the line that Notre Dame was allowed to score. Their S 5 N ' ll . K, , , - U. X-is 1 'ull H '- . if ,W W ,Y T w . i 2 - 2- ' 1 to -l--W 2- , . s ...qikwvf rv u Q? 0 L 0 2 Teen? . xgfgnrg Lf' , Z :f ' 5 1 ff: um-mb: X1 i N A n M ' 'o g. 4 13 he LJ W IP 'Q 6. ft I ZS: I Ii 55 I Ig. I 1 1 I I t b Q0 ' na Q L '5 i v in wily A iw ygii 'SQ Illlll 1 4 qllh i III' noi I ' A 4: . ' F6 I ,. Ia ? . KYGXYQWRWXKEXX U 3 o Q I 0 . Z4 'iz 1 I , O .1 5 17' Ll0NEl. . 1 ' I ':. X 1 1 V S . . ,. F' 9 -,f ., , . a ,- 1 ' , s ,X qf 1 A I' 3:33 f lnms7mu X 1 sn-n--4s1-efv-- 1 'I' I .4-i .uf 4 Y .L .UT I - Milf.-5. flll H E I E 1 I . 1- 51. jg' x.. H. ..,, ..:: -- Qe-ffw--4----f-------,---- 1 -- ... V . .. +, . 2. .. .. . ' 1 - ' - - V Q, as l 1 l X 13 F3 ii E- I P3 ri:-I , . EY: :Q- N .N -.i .0 4. Q. N .w 'U I . .1 15,31 I passing game was nothing short of phenomenal. The whole game was hard and clean, Jack X winning the honors for Tech and Castner for the visitors. T253 CLEMSON, 7-TECH, 21 Qgjfi This game is one of the most novel ever played at Tech. Each quarter found an I entirely new and different team on the field for the Jackets. The Tigers put up a hue scrap Z and held the Tornado to a 21 to 7 score. The encounter looked to be a. runaway for the golden jerseyed men but the visitors soon braced and stood off the attack of the Tech backs. I 5 In the second quarter Harmon, Clemson back, receiving a kick in the middle, slipped away EI: Q from the ends, crossed to the sidelines and made the prettiest run of the game for a touch- 2 down, much to the disgust of the second team. ligfillg Q GEORGETOWN, 7-TECH, I9 E l Ifor the fourth successive time the Tornado turned back the Hilltoppers in their g invasion of Grant.F1eld, this time the score being 19 to 7. The game was exceedingly rough, 3 y many penalties being made by both teams. Jimmy Brewster and John Staton were the stars g ' of the game, the former making one of the prettiest runs ever seen on Grant Field. Although Fifi. it was but thirty-five yards, he sidestepped his way through the entire Georgetown team 3 with no interference, practically every one of the opposing players having a chance at him. glffi 9 Flavin did some fine running for the visitors and in the last quarter started a rally which iff was, brought to an end when Paul.Lyman intercepted a forward pass. NORTH CAROLINA STATE, O-TECH, 17 4 The North Carolina State team was turned back with a 17 to 0 score. Red Barron fl' played one ,of his best games on the gridiron in this encounter, making one spectacular run Q1 of forty yards for a touchdown. The forward passing of the team was excellent, many 'Ling passes being completed for good substantial gains. In the last half Henry Reeves kicked il 1 drop kick of forty yards, one of the best seen on the field. In the last quarter State opened Q. . . . , . 05? :maj up a despelate passing game in an effort to overcome the lead of the Jackets but it proved um? .11 of no avail. Parks was the star of the North Carolina team. gg ' AUBURN, 6-TECH, 14 M A Q Thanksgiving Day always promises the city of Atlanta a good football game, and in 1922 was no exception. Seven men were playing their last game for Tech and they certainly put U E all they had into the fight. Despite the splendid running of the Auburn backs, especially ig Shirey, the line held splendidly and the backs came through with the necessary two touch- 5 downs to win by a 14 to 6 margin. Red and Jack were the outstanding stars, if any may ' is be picked from tl1e galaxy that performed so gallantly. 1, QI 135 51: i923 Football Schedule Oglethorpe University . . . . . September 29th . . Atlanta Virginia Military Institute . . . . October 6tl1 . . . . Atlanta if University of Florida . . . . . October 13th . . ..... Atlanta QQ Georgetown ..... . . October 20th . . ....... Atlanta S Notre Dame . ..... . . October 27th . . . . South Bend, Ind. A E University of Alabama ....... November 3rd . . ....... Atlanta 2 Pennsylvania State University . . . November 10th . . . . College Station, Pa. Eg Ng Kentucky State University ..... November 17th . . .----- Atlanta g Auburn ......... . . November 29th . . . - - Atlanta 5 fx f av 'WO 1 -QSRANN C Q22 V2 Lionel. ex O af f-O Bef I D evifgchb 7 0 I 4 .. ilk' 1 mx Q a.Wz+'f ' 1-1 .2 Q . 1 'LN f S 'TN W K wmmQmmwmxmsx1smmK 3xmsmwxmAX:-:-t-Na+.- E' Q Ci-T3 A Ogqqgzggzg.gzgzg-3-1.1:,5:rrzI:-.,... i-11251-:-:'-:'1.:'W5'H-. .:-:vi-',-'ggi-5a'c-4-I L . - li Jr 4511? Fail s ' 1 .. - K. 1 H wears 1, -L 375 D mf- -fx we if .fc N P, rr, .AQJ5 L FN ,fy V 1 jx w as H a X M251 ' -----f- lima '--'-'- - --L 7 'Wi 'f 'i'ii 'e ' 'f 12 ' 1 ' L ifEli:5llliililmnl1igZEEEEifl:::1.41:al5Ilva1:1aimilminlmmi-sin 1amiamamuauizmu -x1:-:f::1 uw-eww '----- --fx rf1:--f--f'f f ' H--'-' ' 'nn'f 'f'-SVI' ' H ...... ............ mm:,ggggggg:::::::::::::::::::::::':::::::::::::.r:n:a:::::::::::::::mmasm:::::mam::::::::::xaa'.::::::::1x:::'.:lum:::::...-......-- .:ii. ...... EE' 'iilllilhiiiii .........a....... ,..::::za::a::::::az::::::::::::::::::::::::::::I:ii::::::::::::::::::::::::::::::i:::::::::::::: .................. ........--- di Y li -.4 5 Z 4 4 :n 6 I S S Z .lf a The Annapolls Game i l Ilia? 1,51 Nm 15' liliili FTAN OR the fifth time in as many attempts Tech was turned back from the North ff ? QQ defeated, but not beaten. It was the Midshipmen from the United States 'THQ V Naval Academy who turned the trick this time, repulsing our warriors with l l ,ll , Q . . . . 4 u M such a brilliant aerial attack that they were never quite ready for the many G IPQ trick plays which oftentimes went for distances of ten and fifteen yards. Cd All that excellent coaching can do for a team was displayed in the performance QI i f of the Middies. iw i ' The seniors were given permission to attend the game, so excitement ran high as many. Q gathe1'ed for the Washington train at Peachtree Station. Friday evening the team went to Bancroft Hall, and the students and supporters from Georgia and the South sought such amusement as-.the Capltalaforded. Early the following morning the band gave a concert on Pennsylvania Avenue, and the coterie of southe1'r1ers scattered to the various points of interest about the historic city. The day was bright and clear with a briskness in the atmos- Q. phere, making itan ideal day for the greatest of all American college sports. As the sun S plasspd lthe piplpldgg crowds bggan to flock down to the little town of Annapolis, nestled in e or s o e esapea e ay. Inside Farragut Field the sward stretched smoothly, green with a sod vet spared bv the S , first light frosts of approaching winter. Nothing. more need be said of the buildingsithan Q that they harmonize with structures about Washington. The descending sun cast lehfrthen- ing shadows across the field, a hydro-aeroplane dronedabout above- white sailboats slipped across the bayaunder a gentle breeze which whipped th bl , ' . ' . '11 beyond the end of the east wan. V p e V ue expanse into iolling sue S ,: h About twehie hurgdredpsoufhe-mel'-S Occupigeffl E SCCUOH. QIl,tllC south side of the field. V Tbe Ifvslpftpams ian 3, y iw Eigna s and took position at the re.feree's whistle, the Navy having Ei ahpubackgefzcpn poun s o A ie man, on the line and Tech having Seven pounds to the man in ' The Middies kicked off to Tech, Red carrying the' ball back to Tech'S tllirty-five yard N O - -SCH ai I W N r Q-ax , f 0 1 V. l V T V-va , :l ik i Qx-PM p vp iw 0' '- -' s' ve... - 1' .F Q 1 V HA W V AY! V g f... 4 .. 'f 'f-18 .. , if F- ' .. f wmwwmsws s - ' L K l ' 1 . Lf llSi?i:,::-- D ' ...pi-. -f V I-if -,,, ,, ll I rs ' 1 I 5' . - KI i Bb 37 5:1 2. , 1 Q' .5 . . .,. ff .3 . Z n . I :Ei Z4 .fo 's . 'Z ,. 4 . P ,.,4A 'EF I mu h Q0 A Fi E 4 -llllz t Iwi: i 1 13 lr' 1 ' I-Y l fill' flllu I3 1' 1 :M Q' N S f . 'Z ., k . X 1 W S ,A w e f L M f ' -.1-1, 1 173' I ' .-L25 - U - H-mv f- 42' ' r .--4, .,4,,,,-, ,..,.,.,, -p..,...,.,,fJL1,,.....,..,.- 1 r 111 Si, hum I uri ins,-x Ill ww: Hilbii -'ve -M'-1'-. --f---J' f fu'-'T - 'iz '-r -' P ' ' 1. ' rm i E I' ' as xx .1 2 I nr ll! 1 as ,J H1 l 3 Z W' Z. 2 f 9 r 5 .4 E Hx , 'II 7 531' FSH 55595-5541 , 5-555 zuiifffiq .ARTHE DLV PILI .,. I 'Z-1 , . Q. ..- ,ga 'J .11 .if ' XI lt '........ ..... ,..:::::::: :::: ' ---' f f ' ' ' Y , , W , , i E.. line while the band rambled. Unable to gain on downs, an exchange of punts followed, when the Navy executed a clever pass to our five-yard line and pushed the ball over for her first score. .'1- V X , ,Y I , . - wx 'fl-: 5 After the next kick-off Iech began an offensive wlnch took her to the Midshzpmens pig! twenty-yard line, where the ball was lost on downs. After an exchange of punts, Tech lost iff? the ball to the Navy on downs on her own thirty-five-yard line due to poor head work. and 'S the Anna iolis eleven aut the ii fskin across with a Jrettilv executed mass. Blcliee to Tavlor, T 7 . l I 'I l if I . I l . R, Z over the goal line. 'lhe score stood 13 to 0 at the end of the first half. To Tech's credit it may be stated that she held the Middies scoreless in the last half. Z Several passes for long distances were missed by hair breadths. Tech had two chances to Z Score but took advantage of neither of them. A long pass, McDonough to Hunt. and a 115551 Z brilliant fifteen-vard run bv Red put us in striking distance of the goal, but the ball went qi:I l f - - . , , 1-: 1 over on downs. At another time Clare 1'rve fell on a hall blocked from the toe of the 'gf 5 Navy punter which might have gone for a touchdown had it been scooped up. It was quite clear that the Navy won because of a superior team and better team-work. Tavlor did stellar work for them at end. Frve and Barron divided honors for Tech, 11514 ' . . . ' 1 . . . 'i-.- I Barron reeling oft' a few of his long end runs, and Frye playing the finest defense game seen pi, on any field in some time. The features of the game were the clever trick and aerial plays If. of the Nliddies, the absence of any penalties on either side, and the end of the game, which saw lim Tceh holding a line fourteen pounds to the man heavier for six downs with their feet prac- 'gffzi ,- tically across their own goal line on a foreign field. pigs 7 fr: The line-up: ' L T144-h l o.vilion Avavy Q2 L , , ' L J. Staton . . I.eft land . . . . Stolz Connell . . . I.eft Tackle . . . Rolles JUL Mglntyi-C , . Left Guard . . . Carney f QB, F1-ye , , , . Center . . . Mathews ig. if,,Ql Davis . . . . . Right Guard . . . . I.entz PQ lEL.lL A. Staton . . . Right Tackle . . ..... Shewell T il N - . ' . . -1 g P 12,1 Mitchell . . . . . Right End . . ..... TA5 or u?.. McDonough . . . Quarter Back . . Conroy QCaptainj 0 , W Barron fCaptainj . . . . Left Half . . ..... Cullen 'ill' liillll McVVhorter . . Right Half . . . McKee 1 Hunt . . . . . Full Rack . . Barchet 1 4 11 W' ll ' T' E , Y. ' 'S S E Q 1. S: lil -:ff 5:5 4 S Z 5 B 5 git ff fi ' 39 fc ey , , Y , - I - L Lionel. x- ' Ctivlilfik -eg X 2 X as F , Q ,N A f o 44... ' ' ca I -A is 31 , A Rx Ss., . MZ E. we . - - af' vi. '-Hr-rf . GD s . .W T .1 R ,, ..,..., .,.... U. , , if .v-,m4.,:.gQ,5,wg5'QkgAxggg-X-53g,3g:,:.g.5Q.g.5 2 gl gr' egfdzgg-53:3.gi-5-,3vg,35.:.1,-553-.,53.5.1-:g:.:. 1-:.L.:-4.2.5-..-hum-,VJ-!!d4.,.l L -3 -j V -I , I3 ' jig L . .. it cv au . ' - zgffo . L- 'J .-,:fw.?f '- 7 552 J , 'A. ,hum g.-ph' . . , .---. .. - - Q f. f N I I A f r Q I I! 1 , ff . N , , ' .....,.,.,.,f W- 1 f , 1 , 1-u-5, , +0 f ll' 5 Q. ' ' , Q 1- WZ-.,,1 'lyl . - .L 'H ff, - I mu.-5 .... . ...............,..........,.- . .- -.................,,....1,.,.,.. ...m.a.... ....,,,.,. ,IM , ,W , A2 M,,,,,m,,,mq-Himgmluu v In r qapq, ILE, 2 ,, H: s-1n.mmIu..5amnluIinximmilimununnmiu mm. 1 ui 1 . 1. 1 f , In 4 ,- 4 ,., , ul u 1 I .-I ,1 mm I wa I N '49 Q , .V 5 jj A In I 1, 1 :':, , r L jj 2 . illllll l I I I I f, D I 1 C lm 'al - lilfllzlf- if-.: ll ll' :'-:-'-::::::::::::zzsnsmn:::r:x::::nzzzz::nmu:::::::l::a::::::::::: ms :::. g -gf, IEEE! nllfiiilu.---An.--.. .iIliIH353IIIEliiii:Eiiniiinllnii:ii:i:::::5::::Filii1i::'l I I:I:IIililillhmuenInununuuuunlnnnununu K' 1 S 4 . a 5 f 5 rg . . ' ' 1922 Football Banquet T P 4-, W ECEMBER4 the fourteenth will long be remembered as the date of the 1922 L, Q football banquet. Early on this memorable evening guests began to gather in u f L Q the lobby of the Capital City Club. In the assemblage might be found heroes .0 9 54 of days gone by, now valiant supporters of their Alma Mater. Here and there QA were a few camp followers whose names are instinctively coupled with Tech and a Tech football banquet. As the order was given at seven oiclock, those eminent and extremely fortunate person- ages eligible for the banquet filed into the dining room and took their places at the tables. The team retired. in order to elect the captain of next year's team. An atmosphere of b expectancy and tenseness awaited the return of the varsity. Headed by Coach Alexander they resumed their seats, refusingto divulge to the guests the result of their conclave. I Colonel Lowry Arnold, one of the most loyal supporters Tech ever had, acted as toast- master for the occasion. Receiving orders from him all other matters were forgotten as the' Y guests indulged in the material part of the banquet. This part being finished, chairs were 25? QQXL1 pushed back and the speeches of the evening began. After a few of his customarily clever xg, -lx L L ll jokes, the master of ceremonies introduced Coach Alexander, who announced that John '-.mp McIntyre had been elected to captain the 1923 Golden Tornado, to be assisted by Clare 4 l - . . t l Emi ,wa Frye as alternate. He praised the team for electing McIntyre, Saylflg he was sure John pf, would merit the honor conferred upon him. l i . The new captain was too happy to talk and when he was called upon managed to express llffalj 'mfg his thanks more by his manner than by his words. The crowd understood and got right in WR, I behind him with a rousing cheer. 313' y The other speakers followed. . First, Al Staton made some remarks about Red and his .T P recent marriage. He spoke from three years' experience when he said Red would not be li ' ll lq T captain of that team. Bob Jones made a wonderful talk, resounding with his loyalty and if 1 love for the school. There followed talks by our eminent President, Dr. Brittain, and : various members of thepress, famous at Tech banquets for their witty speeches. E' Red Barron was given a wonderful ovation as he got up to speak. Red has always been a. favorite and will be until the end of time. He is just naturally built that wav. The climax was reached when he walked over and presented Coach Alexander with the keys to a Ford Coupe, which our good friend Mr. Bussey had left outside. It was a token of appre- 'Z ciation from .the team for the wonderful work of the best coach in the world. 5 Doctor Crenshaw presented each member of the team with a pair of handsome cuff 5 buttons as a gift from the Athletic Association, which he followed with a financial report of the Association. ' After a few closing remarks, Toastmaster Lowry Arnold declared the party adjourned, and another of the famous Tech football banquets had passed into history. S 2 ., I X : S 'dl D vt: 55 0 L. .u '-1 E- Q' ...K ga d igital.. -. Q 1 W A fp 'A w 5 swQwmmxQg3xxxxxixam,mrm'Qm'm-Smxxx Lomax. n flfiiilgggx , .k'Tv, 'm?w,,.. U . , , , f gag , j Z3 I Nf i ssx . ' J -lillj .. .,-I . .,.. ...... .. -.. .. tm W THE, DLVE: P PCI xt uu1x . . .... .rn --'-- . -L--M--'s------- - 1 W --- Y T 'I I 132.4 f- X J' 1 I ,X N f 4 ff' Y! K+ fy, 3 X ' 4,-' , VJ- -Q-,.,.! ' gt i X -4 FC , ,. -, Q5 ,ff ri, Hlfnxgd r sm:uuuz1xm1Tucn 1-uw I -1 .aux -v '- - 5 ': .mx ' 5 W Q P 1, l I 1 555- ' 1 ik? n iff.. il 1' r ,figs A Y 1 it St .N '.-. id 1 511 -.Nl 1 -'-'1 - w .-.1 - .1 1. ...I 1'.' I-.1 5. J . J .51 'f 1 .ga 'Q ,-1 'r 1 1 11 s' Y ' R 1X ear s ecord of the Golden Tornado 1 If-I 5 Games Won Lost Tied Average l . :-Il Y 51 43 1 1 .543 Q W. f ll-ii , Z TOTAL Sconrzs Y Z' Georgia Tech . . ...... 1,975 Opponents . . . . 196 f 1 1 1 7 1 :': 5 Z Performance by Seasons 152552 1111 g 1917 1918 Qlfffli Q Tech Opponents Tech Opponents 'X 83 Wake Forest . . . ..... 0 28 Clemson ..... .... 0 IM X 25 Furman . . . .... 0 118 Furman ..... . 0 H-Q1 Q 41 Penn. . . . . . 0 28 Camp Gordon . . . 0 Z 32 Davidson . . . . . 10 119 Eleventh Cavalry . . 0 F 63 W. and L. . . . . 0 128 N. C. State .... . 0 ' 83 Virginia . . . . 0 O Pittsburgh . . . . 32 1 1 L 11 1 'f . 48 Tulane . . . . 0 41 Auburn . . . 0 Q1 L - L. M if 98 Carlisle . . . 0 -- - E 11111. ' 68 Auburn . . . 7 462 32 .,, ' an - - 1 1 ll 'I l 115111 ang, 491 17 ,911 'HMB 1 1 11,51 1919 1920 mg., Fine, Tech Opponents Tech. Opponents 455 '74 Furman .... ..... 0 44 1Vake Forest . . ..... 0 i 1112! 14 Vilake Forest . . .... 0 55 Oglethorpe . . . . . . 0 V 1 28 Clemson . . . . . 0 66 Davidson . . 0 ,l 17 20 Vanderbilt . . . . 0 44 Vanderbilt . . . . 0 ll' S 66 Pittsburgh . . . . 16 3 Pittsburgh . . . . 10 7 li 33 Davidson . . . . 0 24 Centre . . . . 0 Q 5 1. S 0 VV. and L. . . . . 3 7 Clemson . . . . 0 27 Georgetown . . . 0 -35 Georgetown . . 6 its 7 Auburn . . . . . 14 34 Auburn . . . 0 Q13 1- - .. i - 'N 209 33 312 16 55 .2 1921 1922 . 2 Tech. Opponents Tech 012120110111-Q J 42 1Vake Forest . . . ..... 0 33 Oglethorpe . . . . . . . . . 6 Q' 41 Oglethorpe . . . 0 19 Davidson . . - 0 13: 70 Davidson . . . 0 33 Alabama . . . . 7 ,J 69 Furman . . O 0 Navy .... . . 13 48 Rutgers . . . . 14 3 Notre Dame . . . . 13 1 7 Penn State . . . . 21 19 Geor5ICt0Wn - - 7 5, 48 Clemson . . . . 7 20 Clemson . . - 7 V 21 Georgetown . . . 7 14 Auhurn . . 6 9' S 14 Auburn . . . . 0 i - gs 4 - 141 49 5 360 49 gf ii r 1 Q X oily' -B N151 X v 4 1.92 .CCC so 1, -- g Y 1101121 K 3 L P51159-f' - ,Q -v If . , 1 4 on '9 '-' 3, w ' HJ ,Q , 'x ' - 55,:, . . 24.11,-' f'f , A, ' '- fa' 'Q . ' ' 'A ..w , ' -- ----- --I --: mnuIIInIilfimnnIIinfnnmInmiILRGmingH.-..lmI,::QfQ?f1'5l1.Q-mf:-1 -'1- 1-If-gnua1uvnn--357-tqmnur-1.1-ll..-1. -..'------ - --ll 'ww f'1 '-- 7511162-If-61:5 ,... :.Z:..f.. EuTi:nu wm..:m,.,,. 3? .Q ' nnisjiig .... ... ..... .... sa::::zzz:I::::I:sm:::s::::imma:Isas::aaasas:un::sz::nm:I:axsz:::::::::::mmmuumuszzmmia .::::::::I:s:lm::IIuni!Ill:::i:s::l::m22::11n::::n51:1mann:rzaasssamzxmanllzlmmzz r:3::::::::m:z:.1::li::l:1m:.:mI::::::z:::. .... ..... ii- .lf 'Q I f 5 f 4 5, r if , 1 , Q L: ' J, 4 3 ' t b ll ' P am, R, 'Y' E9 win: W N0 UI ' .Ili l .N 1 wb ma A 1 4 . 'W zffwi F h F b I -fu? res man oot a eam 1 I , I' N W , z E-AKRON: C- T- MORGAN, H. D. CICKERSEAIT ' O'NE.-xr., C. E OOK' ' ' OTIS, W. X DAVIS, J. P. POOLE XV O FAIR, WV. R. PRINCIZ S' 2: V ', . . HAHL, G. C. Rmzvns, R. E : IRWIN, F. L. .5 K M S'1'RIcKI.12n, G. R2 ELLUIWI, . R., JR. XVHADER, T. A S 5 KING, C. P. Q E MARSH J H ILI.IAMb, I. MCCLUfs!LfH' F ' YVILLIADIS, O. ' ' ' XVYCOFF, D, Q MERKLE, A. J., JR. S Sc X Vern... .Jo 0 I HEL .. LIU N E . ' I -- ' 'hI.l In .buf uv 'Q U bf i Q MK . , ,, I I 1-1I ... I .D - I N i V 1, 666 4 U JLEQSQ I 0 O wf f . : 1... ,' .128 33i5:5E:' .- 1 4 ix...uv '1:: ... r--- - 1 . v r 11, I K0 ,il P l'f , I A I: -2 Q I .- 9+ P 4 ..... Yo X.. Q. -'. ' -f -. . ..?-I' 1 5A-?2 gi-aili m 'ei' ' . ' Q .Dlixf QQ.. ttf El.?:9f'f'f'?'-f'2'I- - 1- I - 1-1-I-144. +w - wx'-:' mx . X' N':-I-.Q-xy' . 3 X ,Q W A , o '. L LlONl H L F .JB . l I K . X N . 19 - HE:55ii:faaaeraaxaeaggggsre : 1' . .ml lil l P IL U ji, ,,,, . ... ...... -.... .. . , Q .s vw. N 5:- .IS 'u is .Y ,v,. EI .51 3-3 . ja ri rv :Eg if :1: 35-' .,. v fi 5. --g .............. . a:::::::::::::::::::::'. ' :::.':::::::::m.. '::::::::::::::::n:2 ..:::::::......... . . . Q .- ' ' W - ., , , A ,,,,,,, N fy gy. 5 'NI 1 f I :IQ RCVICW o ft e i922 Freshman Football Season 1+ . rg T V6-D w HE year of 1922 closed upon the most successful football team that a Freshman , 6 class has yet produced. The Freshmen hadby far the hardest schedule that FQ. NX' they Pav? yet played. This yearis Freshman team developed men whom we i l . unhesitatlngly predict will be stars of the TornadoU of the future. The E: QQ Freshmen played eight games, losing only one of these, that being a hard Q, A fought game to the Freshmen of the University of Florida. FRESHMEN, 45-FEDERAL PRISON, o 'til 'This game was the first of the season for the Freshmen and was easily won by them. gheir goal was never in danger, while they bucked the line and ran end runs for seven touch- owns. l , . HN l 1C1:l T FRESHMEN, 7-UNIVERSITY HIGH, 0 The second game of the year was with the strong U. S. B. team. This was a hard fought game, the Freshmen winning, 7-0. , ' QQFQQ N52 V. FRESHMEN, 47-WOFFORD FRESHMEN, O . J 'L The Freshmen lived up to our high expectations by trouncing the XVofford Freshmen 47-0. The game was featured by the splendid playing of the entire team. 'EE 'mv 1 : , FRESHMEN, 13-UNIVERSITY HIGH, 7 sg, es! , 3 Along about the twenty-seventh of October the Freshmen again played the strong 1 'wif U. S. B. team. As in the first game, the Freshmen won, but not without a hard struggle. 1 .,Y ' Score 13-7. lu md ' -uma L l ' . gn' - . FRESHMEN, 26-CLEMSON FRESI-lMl1.N, 0 V'i - w ss rv , A t j! On November fourth the Freshmen won a cleanly fought battle from the Llemson. Kats . M il Wycoff's ferocious line plunging and Williams' end running brought on the destruction. V, FRESHMEN, 0-FLORIDA FRESHMEN, 17 Napoleon had his Waterloo and the Freshmen were served likewise when they met the strong Florida Freshman team. This, undoubtedly, was the hardest fought game of the season, and when the smoke had cleared our Rats were on the short end of a 17-O score. :F 5 FRESHMEN, 7-PIEDMONT COLLEGE, o The Freshmen, by playing good ball and by consistent line plunging, nosed out the 9 gridders from Piedmont College 7-0. The teams seemed evenly matched, the Freshman score EEE , coming in the third quarter when Reeves carried the ball over on an end run. 5 . is FRESHMEN, 27-AUBURN FRESHMEN, o 'gg . v E! The Freshmen completed a great season by defeating the Auburn. Rats on November twenty-fifth. The Tiger Rats were outclassed and the Jacket Hats had it all their own VVEQ- f Q Auburn put up a game fight, but they were completely outplayedi Tech Famed at lvlu' I XVycoif's kicks were the feature of the game. Barron, Vllilhams, Merkle, Vlfycoff. argid Riagg SE shall starred for Tech, putting up a brilliant exhibition of football. These men are t e S a S of tomorrow, and we are glad to see that they come up to the Tech football Caliber- aj 4 52 . , . if V. r . L o ox i o A -1 4: 62944 nh, 60 ---- - Q f flsiilbif A 59 as - to Q - Cx'ilQEZQxZ -tQ9ifScR'Q.'NY-x2:RQs?.Q' Nbt.XXNXXNQxWA'QxYiQ-,'QQc-ft-CXWNBQ- 5 33hXe55.5:g:75,35.:.3.3.5.g,ggQ,.-.,-g3g3g:23:3 2152:-fp. -5-Q54-g-1-Q-5-g5g.g.5-5-i ' Luo . K ' ' ' D 's'2 2ii'ilEgf ' 4.45:---V ,V N V NBL K XQ.. ,Q i4 9Q 'f . :::.::55.f ,I ig' .,i,,,3,:.,,,, ...,,,,,,,,,,,:,.., . --:: .---- . ---- ..-.-- - -..-,- --:--:: 1 .... , 1 0 rt x .1 ,V ,f 5 , . , ,,..-if , , ' . - - v .7 -H. V- - ' ' A f y X ' ' 1 C - 4 ' ..Q..:..,.,, .,,ff Wi 211. . X, 41 ., ,grew X - -7 ,,,. 4. ' , in H I in-x Eg a ,--- ---- az:mannImmlulmI1ummmlmxmseinmmaus1un.....f...........a.n.-..n--...-....1.--.--.-..-..........m.n.uu1- . .. M,,,q!,i.E:1ilhag' ,wa A . ' . mum! M .M I 1 I. ll I 'H ' 5. ll ll ll 'I ,I . ii 'il , -'ai .. 5: :hmhmm M I. ,,,,,,,,,,: ,, .,.... . 4 . . :.x.n. 1... .. : z 1 .- r........:s1r::u..x.............. .. . . s . s . .. .. .... Y KJ' 1 Y S I o 0 Q za N , . Q1 . .. ig? gn u u' PI-2 .t 'L i E s 4 YY E r w 'ulI 'Ein mul? I J Q50 ' lqlj . l l 6 I ml' N4 Press Comment on the Golden Tornado As evidence of the reputation of the Georgia Tech football team throughout the country during the past year we quote the. following comments of various coaches and scribes: , Just at present Georgia Tech, Georgia University, Centre and Auburn form a big four, whose material, methods of coaching and style of play are national in potency and scope. Georgia Tech meeting such teams from out of Dixie as the Navy, Notre Dame and Georgetown, has taken a huge stride toward increasing the interest in intersectional en- counters. -Lawrence Perry. Georgia Tech has a stronger and more united shift in which the whole line takes part than any team using a shift of this .characterff-Walter Camp. ' After the Navy game, Conroy, the crack Navy quarterback and All-American on several selections, sought out several of the Tech players. Said he, I just want to tell you fellows that you played the cleanest game that has ever been played on Farragut Field. You lost, but youlre the best bunch of sports in defeat that I ever saw. I couldn't let you get out of town without telling you. I hope we play Tech next year. C'The work of Barron, captain of the Tech team, is highly praised here and he is con- sidered one of the best backs that has ever opposed the Navy. As a whole, Tech played a hard game and its line gave the powerful 'Navy forwards a much harder time than was generally supposed. -News item from,Annapolis in Atlanta J ournal. Bob Folwell, the Navy coach, says' that 'Red Barron of Georgia Tech is one of the best backs he has seen in ten years, and the chances are that if Red would like to sail the ocean blue, he can get a dozen appointments to the Naval Academy. -Lawrence Perry in the Atlanta Journal. Coach Knute Rockne, of Notre Dame, said this: I had heard that Tech was a trifle partial on Grant Field, and came to Atlanta expecting most anything. I have never. been more agreeably surprised in my life. The crowd was most fair, applauding our good plays as much as they did the players of the Tech men. The students were absolutely con- siderate of our team at all times, giving our signal caller absolute quiet. , Notre Dame came to Atlanta ready to receive impressions. The visit was an introduc- tion to the South for almost the entire squad, most of whom are sophomores who hail from the Middle West, East and Pacific Coast. We knew that Georgia Tech was considered invincible in its home city. From various sources we concluded that some artificial condi- tions existed to produce 'this unusual power. The game is over and we know why Tech wins on its own lot, and in making the discovery we have been delighted. They hit hard but they hit legally, and they play the sort of game that makes. them one of the leading teams of the country?-Frank Wallace, Notre Dame correspondent. Mike Donahoo, the diminutive coach at Auburn, saidof Tech: They have the best team in the South by far, better. than any we have played this year regardless of location. They are a clean, hard fighting 'bunch of fellows and deserve the victory they achieved over my men? , . u . . . -if 0 lilll xl, gl syfo I I :G 2 4' I 5 L 3 E! I 32 . E w S I 4 9 il' . I .- l r . i n I fe: 5 I 'lr s r ,FJT 4 tml. LU l 7 Q N' 'l Sl' l 1 l A 1' 5 ii E I l Sl l Q 5 N 0 a.5s.4C4fs . ' l l OW-gf' H 4 ,Xp lu Y , .M 0 -. ...mmf J' ': 4 , l .N It I hi, . iff - t 'Y' Fm.. - Tp WW W Y Y V , A .... L- - V ' A -- - W w -' ' 5 3 31 XeiQxsts2m.xmsxXxmxxrgtmm2KpQxN2lmgsNX ax. rf ' .. --. mum 9-, qv. .'i.-sw . 0 . .. . ,Swv I R ,, , K-, A ,. Q ifgygffgi. Ygjybfo Q Jeep? ' u? 5l:lhn 0 'fs1:....f-1 .. . ..... ...... 1, ul y E' K if . A l ..g ft' 4 2 f 1' KA P .U J rn Q P4 A Q' YQ-SSXX ' XRNTRXA :2 t t Ei 1 My Wm r 5' x 1 QQ I l 'fund ' ITE! 55' . .. 'J :Z-is il Q E LIONL him... A. v. . 1,3 q , , . ' - 'SJ 5 r. L 7 'E' GT x . Q, m1925 1 x6 f , N 4 ,125 ' -1 , ' viii ' f- Smog-3 Q J A- - 1. - A - ' Qughlllgmgii?illU'l-gglggggiillilmilm mumnn wewasmemuer1EmQauE2i2Rvm-,fm,Z..fi,g..,,,,,-,.....Q,.:.,,:L-QLLIETQT ,,Z,n-.W ' - , - . ' K P f -Y 4 '- ' g P Lp I I A xx 5 . . 1 1 5, ..5': gE?i:iEn111..zff3z........ .......,. .4::::::::::::::::- ----'-------- - -- --gm. ....... , . Nj, 1 3 , - 7- ' , 5 132 N K'- '35 4 IH ff f Q x vi! Q . 5 2 f - r 5 fix 1 X l Z Fig: 5 W-'5 9 llfg: ,ff 'Tr 2 6 A sv 5 v 6 .NNI E W ills , I'- w N E my ' x gay an 4- L :mu fi ilk Huh 4 as i V 'M . 1 tn- , 4 A SQ P. 4325? .U lr 1 U w A A 6 U1 1, xx -:- N x 52 E il J .,. S. 5 .5 :, UHBA ' by ,Qs 'if Z . I I 5 S ' I E3 L 55 Q X 1 V' O 544:10 3 ' '- Y - ,,', WY Y hu' vs 'X 'ff' Ji if W' ,qi -Q L ,555954p5VR,Xq.,p:qg:9gQ1YvmxE.XXXKm2k'N1qgx2g.1q.51-55 12:1-:Q:1:I:5Z'Z-f-:iff-I-2:1:iS3g5LHL3:I:1:I:Q1 TLJLIIETZEELHLBZ-I-I-1'Z 151-f-I-IC- LION EL K4 Y Y 0 'fffliflifgk Qi ' ' 4? 'i-9. I Y x L v u T 5 P3xJ iff'L3Qf7- ' X-Qiilif-'A if W Q x.. 'E ' .f - E ', ' . Y -M5515 1,8 n Zigi.-' I H 3 gh, I Q . A A K . Emi ' A ,... ff..-4. .- ' ' ' 'l f 9 1 Hiiiill' 1Ei''''EBU'inii521555212m::::s:smxl1luns:Gunnuniummmumsmnmi winlTu.3-mm. ,.,. mli.-.ff--fn-mm,-1 -.,. ,--..,mm.unm-4.1-I-1--H--uuupum-W.M -....-.1-.-...U--.. ...., .. .,...,..,.,.-.. . .... -M.--.---.-.,.-.-...---mmnlammmm'-umm.,..m..m.:f-- . gg... 4.2.3322 Iniggaausaaam, D L V P N 1 W RH. 11,3 MH' z T H I 'M . l l I M mm M H T 41 Mfr 'H liguaiinziiii ......... 4... .... .ka::zu::aaa:nl::::::::s:::::::x:::::::::::::::::::n:::::::::m::::msz::::::mlmam:u:::::::s1::ml:::::::::::::::::::xs::.sm...illmhullz.nz.:....r.....u.smm.amu1::n:slz:m:uummn:3mwi mm . ..... ..- ....... ' t Z E . 9 :-:g f 7 4 61 ' 2 , ' , 2 H 1 5 'Z ' 3: :I 4 '53 s . . Q' 1 W 1 GJ XL' 'X k A w il 4 lIllk El- IW 1 1 'W V dun' i,....l l l mln: IP: 1' 'N 1' lm la I , . . A 1 - M - 1 ms. ellllf, , Nxvxx' J I 1 r . ffl . :J Y 0 1 I N 54' ut 1 .X E. L. JENKS , , , 3 . L aptam A '3 VV. A. ALEXANDER . , ' . C oavlz S . x 4 MEMBERS X B1cEWs'fER J. D - 0 DENICKE 'C' ' Arn-mms. li. G.. Jn. N I 3 E ' BIOOIKI-I, F. ' if CKFORD' J' E' lump 1: w . JENKS, E. L. A ' ' ' 2 S1-.vm-UN, .x, II, x f- Q V 79 S 1 L' Z eb' wb, .L AJW , , , . Q .. -el O eww' ' LIONEL K. 'll dl 'f lui O Qs 1 ,XO dl V -0 U A E. O X 786.1 0 I' 'SCL ,, .,,, A 7 .. , . Ohm- Qi u hui! 0 71-,K K 4, 2 - GD - f QQ, 33 - ff: - ' 'f-.1g.iiE11:6-iff-'::i:f. ---f --,Lg- j . 0 :MK Q Q 1. . x A '- -Lib! gg gf ,X U I J 0 'ILi'rr1::.:.:4--...-!-----'Af-f ' V .. . . k + I.. O 32 . ., :Z :gi if S' M' NII UI I I 'Hia 1 LIO l I It Dllh Q':. oy L , W. , - M T H E: D L V E: P ILI 5 N.:h5llXZb1lii:1n ... ...,.., .a::::::::::::z ' V gf, i. , K- I -4 A S 1 ' , - f- 4 3. L ' ' ' ' --n .. Q-. ' G , .1n...g, LlONE,L . Q , ,rl-:?,....v. If Z, - LLVV P - J IN ,,- .-.' -1 fffs :ii . , Q. .4 I .-1-1 5 me IEQEI1 g X 3 5 is i A, 1 ' , 1 25.2 f 3-3 R , ' R, f 1 1:5 1 3 lv TA ,ia Y. IEFELI Q S f ,I Y fxwlkgff i f F fig! ,FF Q WI:-3 6 i':' gl 1 ! gig! 8.56 U-:-: 2 E52 J, L E' L 1 A ' umm ' k 'wb HQ! Q7-P31 wnjp ri' U -A wi I f V w X 'fs A , 1 Y f E15 1 Q ii Ig 'V L7 O fy' 17 ,. C,xP'r,x1N Enom' Jzxxs 2 :- 55 si : O xr, - v fem, O r u J Z 0254 BA -Y Q A ' X0 eg 5 ' . hi . f X, N BT' ' A f 1 M YmbW6W' ?fKWW 51 ' 22-:f1I:x:r:'.:2s::5':-:.1:-:-11.9412-rifszl Q9r1:g2z262QM-xc-X-:w0f ff 1-I1 . .. - f G P Jrgom C ' , ' '1 . 0 ' I I I I I TI 'I II I I I I I I I I I I I I I I I I I I 'SQ lg f'III'Qir- q f ,J faiig- 35555355535gggg5asni5555,,,,za--1IIII6.I..III..iIxxlIsmI-IIIinIleiIIImiiIInInI.mnmiuuuuI.IIIIIIIIs ,,.. IuIu-III--III-,Im --1--f-.f-f IIIIIIIII-msImI.u--: :----- II.mIImI--I-.1-...II I--IIIMIIII. .......,,. I .----,---x---x I flffvl. - .-,..... .- ...,..... .. ..,...-- If .-..- I-mIm-mmm -mmmIImuuIImm:II55uI 55wIm,,mmm,,.,., ,Eiga ::::::q, u:::55:::1num WIN-Eggiisggzgng ang, 'gg liiluig lnllliliii .-....-.. i ...-. .... i 53123:KiIiiiliiiiiiiailnil533333:IIIEIIIIIIIFIEIGIFGHHI ' ' 7 51551:lllun:HIHHIII:I:I:llIHl:II2:Ililiillull:IH731233:Ulnlllllazniilililllllin I7:InlnfnffluifnlliglziI::HnI2zi3n::a:f::::u:::::f:l ...'f-.-. .. JEL, ...n. 553521: K' - , W A 53: 4' I 5 3 - .4 O L v ei ,U d N, Iii 4 O.-I S -Im- I-IIII33 e?III,I IIIAIIL viii Hind 'fllllv VIII! V41 'O I I I 5 'Q . 0 2 Review of the 1923 Basketball Season OACH ALEXANDEIVS remarks at the annual basketball banquet at Druid Hills sum up about as well as is possible Tech's 1923 basketball SeaS0r1. He stated: While the season this year has not been so impressive from the W0n- L lost standpoint, still I consider this year's team to be by far the best 0116 IlICCh . has ever had to represent her on the court. It is the first time in the basket- - ball history of Tech that I have felt that I had a team upon which I could. depend either to beat or hold to a close score any team in the South. It has taken four years to produce such a team, but from now on, our basketball teams will rank right along with our other teams? I This, in fact, tells the story. Tech has won nine games and lost nine, but of the nine games lost only one Qthe first game with the A. A. C.j was anything like a runaway. Not as an alibi, but as an agreement of experts, it may be said that Tech's opponents this year were the cream of southern' teams. A proof of the fact is that five of the games which she lost were to semi-finalists in the Southern tournament. Two were lost to city athletic clubsi the Atlanta Athletic Club, and the Birmingham Athletic Club, and two to Alabama and Auburn, both of whom Tech defeated, V ictories over the University of Georgia and Centre on successive nights, in themselves stamp the season a successful one. Alabama, Auburn, Mercer, Clemson, Florida and the Jewish Progressive Club all fell before the indoor Jackets at least once. , A The season opened shortly after the Christmas holidays with the Atlanta Athletic Club. Tech startled the audience the first half by scoring 16 points to the Clubbers, 10, but the last half proved a runaway for the more experienced and better conditioned men, and the game ended 4-0 to 28. A trip to Macon on the following night also ended in defeat at the hands of Mercer-30 to 20. The team then went on a winning streak and upset old man Dope at every turn, taking the next seven games. Auburn was the first to fall before the onslaught of the raging Tornado. Tech defeated them by a score of 35 to 17. A trip to Clemson the following night proved successful, the score being 26 to 17, although tied at 6-6 at the end of the first half. The play in the first half was marked by the very close defensive work of the Carolinians, but almost phenomenal shooting the last half from any and all corners of the court gave Tech the game. The next three games in Atlanta proved to be the easiest of the schedule. The J. P. C., Clemson, and Florida, were no match for the fast passing Jackets. Tech won the first, 33 to 27 g the second, 35 to 22g and the third, 52 to 20. Alabama came to town with a string of victories a mile long. They had won fourteen straight games from such teams as the A A C, Kentucky State, and Centre But the Tech men, fighting with their backs to the wall played the best game of their career, and retui ned victors, 39 to 34. Another surprise was given the basketball world on the next Saturday night when the famous Mercer team was defeated by the close score of 33 to 32 Mei cel was conceded by nefuls es ers one to h'1YC the best team in the South, but this apparently did not affect Tech in the least, for theV passed all around them and made the baskets count yy-iiw Z 6 'I I ,gl .ff I O IIIIIIII g. 9 V, 4' 4 x I I I .qw I I I lghq I Imax r' , I I 'llllv HEI VJ N' ' A I I Q '! F -Q - QQOSQ I WNNMHK'I2fINxQexQs'Q3xxxNrQxKxmXXEYxxXmxxwx 0 L ONEL K III I Zyl? Q Il, O WJ O HH Ie85,I In III ' :A J 1 gn ,o .Q o Q I II, P45154 1 I I I I H -I tml I I' I I EJ r , XSTxN'I I A Que A LO L II. . . . Ii II I I '+ I II II ' I . II II I I , I X I ' I V II I I . , 1 fy. , I- I - -I I1 '-I I f II' In I I I ' ' -. N E.: I , , ' ' 7' 1 ' r v r C Y I Q ,X , W I I . . I II I ,II I . . . . . 1 , III Ii I - I ' I . III ., , I - f 'I ., I I . 7 yi I I I I 5 . , M, K. I I . I i:' -I I 2 II'I I ' ' .4 - : ' I I .- . I- - I I - '- ft X N I I I' ,E 5 i .V I , .Q . I I .- M I t , I - I ' : ,II I - Y i - f I I 'Ii I I , 1 I , I I 1 .III I ' I' IIIQII I I - 51 II I I ,I si 0 x Q... -eg O O I I 5 -A I II I I 0'2 I f X I Le' 'II - I -- , ,,,,,,, O ll., rg I - , 'I- is .1 Iggy ' . Q I . I I I WA n.....y XX-44, -In 'I H - , up M Y, . I I 'I , , ,, 5 ' I If ' ' ' ' me I-Us ' ' 1:12-:Q-: ' I PI- I ' I X7 I x: J I. I I if 'I ' ' .,I , L . N ' x I . - - - . I , , -, r, . x, ,, I , I 1 I ' f .. W -I' I L ' ' - -- A. ,A - H - , . I BE , , 0 Hu H v- It . . ., A . .. . ,A - , ax . H' ..I:1!v53.I.:v ,AX - ian - Y 3 G l LYY, f, f . I 1' . X iv. ' ', -7' ' 2 II' H 'efglzff-wr ff? I -s I I II I ' XXX - A II . I, I V I I QI IIII I ., f 1 I I Al. 1 III I I A , ,I I I' : . II I I -- Q , ' ' x ' - nrt-. i, ,, . 1 .-p 5. -.1 . X U , . . ,- A' 2. as 7. t is 19275 N X Q i as s i. i, , 1 - - ff -1 , . ,, 'O , ta -or -ie 4f ,.-L., 4 nan' - A .. Y-' ' Q ' - :::xx:l::1llilN5ulln ummmnivminmlumwmu-Imiuliiimieiiigiiiiiuiu-1-ei-ig,-1,,,,,..,.,,..e.,,,,.,,,,,,,,,H,,,,,,,gg1,2,,,L,,,,,,,,,,.,,.,,,g,,M,i .-Nmnnwmmxna M ' '- -6 I f' it F 'AM' -...-. .... ,..-....: W A,., . -qui... Q Y . all ....... - A -...-- - .. .........x.......:x...a.. .:rs. i- -x.......... ...........m.x.::.1l...-.......a r I V , ' The next five games were all played away from home and all resulted disastrouslv At times during these rather discouraging road games Tech played brilliant basketball' Liut inconsistency of play in nearly every case was the cause of her downfall. Chattanooga, won the first, 411. to 29. B. A. C. won the second, 37 to 31. The Jackets staged a reinarkgible comeback in this game, Scoring 20 points to Birminghamts 10 iii the last half, but even this -spurt WaS I10t CIl0l1gh-V The Alabama game on the following night was a thriller all the wav through. Tech led most of 'the time, but some pretty shots in the last few seconds fo-r 'Bama gave her the game by a 28 to 27 score. ,Mississippi proved to be the best teanj on the schedule and on the following night they won, 4.5 to 31, in a fast game. The game with Auburn on her own court the following week turned out to be a typical Auburn-Tech scrap, and it was not until the last minute that the outcome was known and they led, 29 to 26. Tech entered the Southern tournament with these five losses staring them in the face, They were determined, however, to make up for them. Centre came first and was defeated in a fast game, 34 to 26. Tech's superiority was again evident during the second encounter between these two schools. A ' And then came Georgia! Before the greatest crowd that has ever witnessed a basket- ball game in the South, Tech got revenge on her ancient rivals when she defeated them, 27 to 22. Georgia made a brave stand but was unable to hold the ravaging Tornado in check. The next game found Tech a little stale from her previous games. Mississippi A. tk M., who won the championship the following night, defeated Tech in the semi-finals, '25 to 17. A play-off for third place was won by Mercer the last night by the score of 30 to 26. Opponents A Tech P1000 Atlanta Athletic Club . - Atlanta Mercer . .....' . . - - Macon Auburn . . . Atlanta Clemson . . . . . . Clemson Mercer . .......... . - Annntn Jewish Progressive Club . . . - Atlanta Clemson ........ - Atlanta Florida . u , , . . Florida Alabama . ....... ' Atlanta Chattanooga ...... Chattanooga Birmingham Athletic Club Bif'U1'iSl'am Alabama . ....... Tuscaloosa Mississippi A. 8: M. . ' Mississippi Auburn ...... - - ' ' Auburn Centre . ...... Tournament Georgia ..'... Tournament Mississippi A. 8: M. . Tournament Tournament Mercer . . ..... !l rr ,ii , - - i . q- L , - ,, .ii 5 . I'x . i s on E L K 0 gllglgig nb g . A jwmm iig ' 0 guilt. W5 1 o ul S.-0914, -' 5 , ' nniitx.. 5 A A - a O 1 .suiiif of '- ' 4 'Hiiari--N-' A fp - 4 l I ' - K- , ---- V .-. -'-- -. - -- ' Mmbwwwwwwsimksmwmwwwapwt E fn ' 3 XQQQQL:lssvffepg-irqzgq-,g,g.g.54.g,g.,.,. .z.:-:+5.ac-N.-,4::A:zf,f-:Q M XQ - Q L i I igegiiiif' ' - ii L L i- . . . ,319 .inn f Q 1:7 ' Y-.9 6 e - 1 : . 'MCA K X wi! p H . . . .,,. .Q i- gi f1. . .. ,,, 1.. .. .. .. .. . . ... . . fs Q Q V. WJ v4 1511. J U D 4 r was P MQJ 111.3 ldiill Inna 'El Val I 9. ' 5 X 5 2 0 n Ga. Tech. Bye Centre Clemson Tulane Bye Tennessee Georgia Miss. A. Sz M. Bye Furman Millsaps Univ. of Miss. 1 Bye Miss. College --- Southern lntercollegiate Basketball Tournament The third basketball tournament of the Southern colleges far surpassed the two earlier tournaments both in interest displayed and the brand of basket- ball offered the public. The teams began playing on Tuesday, February 27th, and did not complete the fight for the title until Saturday night, March 3rd. The interest in the games was augmented by the fact that the student bodies from Tech, Georgia, Chattanooga, and Mercer were present at one or more games, and thus added to the high pitch of excite- ment over the outcome. Of course, from a Tech standpoint, the victory over Georgia on Thursday night was the outstanding feature of the tournament. The end of the first half found Tech leading by nine points, and though Geor- .f gia put upla much better brand of ball in the second half this lead was far too much to be overcome. This victory put Tech in the semi-finals for the third time is ALL-SOUT1'IERN BABE in as many tournaments. 5: Results of the Tournament M ' Ga. Tech. il bGa. Tech. 1 , p , . 34-26 .up Centre 21-23 il 6?7aQ:L1.eCh' 1 : Tulane U G . A - A l , A P eorgiai gi CVVithdrewj N' CBD' detaultl lam Georgia 23-19 1 Miss. A. a M. . y . 1 25-17 MISS' A' SL M' ?Miss. A. a M. ' ' i 47-21 Fulman 4021 ,' Miss. A. a M. , 33-241 U. of Miss. U. of Miss- 34+-32 . N. Car. 28-21 MISS. N. Carolina. Newberry Bye Auburn Mercer S. Carolina Bye Newberry Mercer 45-2-L S. Carolina X.-X. X M. 31-21 Mercer 341-22 Mercer 28-23 Alabama Woford 4.9-24, U Alabama Ala' 44-25 I Chatt moo 1 Sewanee Sewanee 93-19 Bye qwiuidi-ewy Ch lttqnoom Georgetown fBy ClCfllllt, 3 Chattanooga Chat' 43-27 Ch-rttuioogx V. P. I. V 38-23 Q Bye . P. I. V' P. I 1 L. S. U. , 20-23 Vanderbilt j Vandy 36-10 ' All-Southern Team for 1923: Perkins, Mississippi A. tb M., Forward, Smith, Mercer: 2, F0 Wa1'd5 Redd, Chattanooga, Center, Roane, Georgia Tech, Guard, and Gatchell, Mississlppl 2, A. 8: M., Guard. I u ' 56,0 1 V v-, B 4 il K no lpn Hmm- ' Mf-'ff2 S-'F-Q0 E ' 'rf ' ' ' wsx's.s1w::smxwss x L0 EL y C C C 1 1 gc L. i 1 1 ff c Z lf V o oxbiivib-q',,, ' o I4 sl! 1 057' S Xi 1 x 'f' ,, Af V' ' ' 1 0 -fmilllll , X ,, '1' -l lluu Y, , Kg Y? iii---C- -'Min ...il Q F' ,lin , -I R' is., ...., .FL , . .. NWA., fa., -V 5 +--- vlllllx 4.l1,E,gxz57lJlX5' p w.-O,. 'La 'W' 'A ' Y us A . ' VL- ' J' I X f. ,'Q? m3i1- ' po Q S' fees J l 1 1 4 . Q -: 'Q . :F -: 'iz ,,. 9. law 5 . in Mari .t D L A M 'IIIIII ee: aw .Q ' l 4 l'I7 l ye, A Z X .5 e ? Q 2 5 o - . gi l I , l 3 l ' 1 If 5 0 4 , 7,11 QD? ' ' 1:3-:-:-a LION BL . I 'st . .... ' lllluh 45 A .- - 1 -J ' A bl .-N -I1 ,- 51 A oy Z . fx- . 5. . , ' . , fx v4 M F-' Elf- .1..L:::1:'- , A l ..-- 4. .. ..,,.'.... . . . .T I - I V - 1 - A - ff-nw 1,1 f rf' - - f--- -- --f- --- A--f 1- -- ---- - ---. A-?i1f.-.f..:i...'.:5- I 1 T H D LV P PCI 1 1 A A 1- ..,.,........,.. - ,,.,,.N....A...,.,.,. ., W ,,,,,Mm- W any . .PJ W- - Mn .,, 'V-14 A 1 'QQ 111 ' X ' 1:2 11 1 1 11: 1 Q 1 . 11 I 4 1 iff' W y 1 X ? 6 4 f Z 6 f 'J ,W E1 55 1 .J :5 f. -f 1. 1-:J . ' 1 V,- 1 . q.: 1 53. 5 4-I 1 .3- r.N .1 ... . '.-I ,-. v jf '511 'V .111 51 J. r 2, 0 J 7 1 25: 1 Z 1 Q55 1 4 1 if 1 Z f 15 1 5 1 5 1 . . f 1 fl-ff 1 f 1 1. ' 1 5' 1 1. 1 J, I '1,.Q.2 1.121 I '-'T 1 :vi 11 1 51 1 1 11511 To N 1311., 1 41 gi rv . 111113 , 1 11' ' 111 1' 15 +35 EA Q1 u 1 . Lx My 1. 1 - . gig.. T Lo NY 126534 N- . 1' 'F' 1 I 9 3 F h B k b ll T 2 res man as et a eam 11. N 1 -' 11.- 111 T. B. Anus . , Coach 11.51 X T. A. XVILDER . . Captain 1.111 1111 MEMBERS 1151 1 BARRON, C. T. PEFFLER, I. K. Bnooxs, C. G. Rmavlzs, R. E. DRAPER, G. 0. WADE, G. W. GIRARDEAU, R. B. wmm., T. A. 11531 f, HALL, J. C. XVILLIAMS, I. 1 ICING, C. P., JR. YVYCOFF, D. BIARSHALL, J. H. 1 25? :IJ , 1 1 1-1 D Q-6629 igfg i Q - -f - f ------ V... - In 'f-, L?i:fJ 1 - . . . LSA! .e:sovwy9:.9sx09.z1z:Qf:m-msoa5xxb2QQsaQzo:zfx- I ' E j3+.f3x,q.mfg-pe-:-:-pgxxzgq-:irgzg -zrrzirrizlwsxxrzf-:-ag-:-qi:-11:-bf ' mom: ' ' A f - dial' W L ' ' ' T L K L ,TAqf...:v, ,V 6 5EEg53 ::-- X, - 0 L V Y- K 'gig .af-j 50 1 D ?.X.:T6.3, Q Q6 1 . , ' ,s,.'i an '... ziggy.: , , H -, .,..s' ...-1,Z I?.'f3'.'-... ..... -2- .. . ..,-.. . ..-..: .... -.... ....... - .... , . ... - 2 365.5 1 ' -2 ---, a uzzzqw ' I ' '-' f. 1 X ' X ir 'fa g '. fa sw, X ' I, fe, 'O .9 f ' 4 . 0' 'r- ff ' 2 ,.u .1 .. ' 1 ' 'x I i ii 'll lm lllihi H S 11mumnnnmWluunmmnnafunmnnninlfiulruumnI eu -.nl all nv 1 .nm ur, my 1- nivu-num im 1. Ta, .,.,. 1, 1 ...-lm-.nl . ......... , . F. . W. .... fm... mmf nmymmlmlmnuun My 1, ll MI :I :H .L i : I , 1 'mn' 4 ii' , W V Xl 'I V ,zu l , .:::: lilflsl m::liiiL...... ......... . .::muma:an:mam:::::m:::'.:...::r.:::::::::ma::m:m::::::::::::::::::::::::::::::::::::::s::::::::::::::::::::::::::::::IIl:.':::::::::::z:::::r ': :::::::::::::::::nlull:::::::ln:l:i::::::I2:::'.:::i:::::::::: ::l:::::::::::. ...........,,,:!!i...... s 41 ,w '. 8 5 1, l 'R' W i 1 Ulf Lili '.7.' H w A 'l 3 I I 1 1 1 7' i Z 4 ' f 1923 F h B sketball Season 4 Review o 1 ICS H1811 H , h gi . ' 5 HE co d Tech Freshman basketball season marked the development of the VG-J? bestsfxewnmaterial which has ever come on the campus. The 1323 Freshman team Q showed all the earmarks of top-notchers who will furnish stiff competition for p xo. places on next vear's varsity before the final selection of berthsthtalips placei jr ll 'll B f the season ended the yearling five were passing, running e oor an ' Q4 fiiicglnfg the basket with a smoothness and ease worthy of any varsity, and many S were the games with the varsity which were in doubt until the whistle ended the contest. 0' The season began with Riverside,.ran through a gauntlet of everything .in sight whiCh offered competition, and ended with a game at West Point where the Athletic Club quintet offered the stiffest opposition of the season. Not a game was. lost which was scheduled, in most cases the Freshmen winning by a very comfortable margin. .- The first game on tap was a scheduled tilt with the Riverside five at their gymnasium. The court was small and awkward to the green jerseyl boys, but they returned the victors with a 23 to 11 score. The following week Griffin was met on their court, a low ceiling affair with pillars and obstructions adorning the boundaries. After a rough battle in restricted quarters, the LQ Frosh journeyed back through the country withga 10 to 7 win. L J 5 ' ' . I A Gordon was defeated the next Saturday on the foreign court by a 32 to 23 margin. This 3 was the first good court the Freshmen had encountered away from home. The Gordon quintet 1 had a good team, holding the yearling five pretty well in hand during an exciting game. ,lg..JL The green-jerseyed youngsters took the measure of the Georgia Military Academy cage- W feel: men with ease on a local court the following week-end. p It was pretty much of a walkaway 4 for the youngsters, G. M. C. being able to cage 16 points to the Freshmen 36. VIE gnu., l The next game on a local court proved to bela good contest for the Freshmen when N w Riverside turned loose everything they ,had learned in preparation for the game. After a 1 E: fast and rough contest, the first year five emerged with a 341 to 26 victory. T The Gordon five which invaded our district the following' week suffered a much worse beating than they received on their ownlcourt, the Freshmen coming through withhan easy 32 to 13 win. . ' i ' . ,. ' W The toughest game of the season came' the next Saturday night .when the yearling quintet 2 iplayed G. M. C. on the court where' they had not been defeated for three years. The score does not indicate the closeness of theagame, but the final count brought joy to the Frosh when N a 33 to ,18gscore was returned in their favor. q Z The last game came asa contest with the best team met during the season. The West Z Point Athletic Club hadheldr Auburn to ia' one point win and the 'Tech boys were expecting a Q tough proposition. At the end-of-' the firsthalf .the-local boys were .leading by a margin of N 5 13 points, so the scrubs finished the encounter tot a 31-19 conclusion. ' - 1 A The season was highly successfulg, all won and none lost, so it is only fair to predict 1 that such mpn as Wycoff, Draper, King, Barron, Marshall, Wilder and Reeves will appear . as stars of uture varsity cage contests. ' 3,41 . i . Q O WQFQSNQ 0 X ' A- ---.-A VY 5 ...- X ' 4 aiiilsas --- up . A W Qmynmwzgawmnffmwffzf, 'JsmgfQwvxx, Z ' Lionel. K' Q H-llhmk 'vlkojirgg Q lu., ' e ,'S'.feL: iifbyo JF' 732' i 9 i 1 i 4 . , ! I ff 4 iff 0' ! 'sf . I 5 i ig. . :fr .. 1: .9 . S2 :- :'. .g. .,: 'A S ' Q , . F 'e E W ' L lf 1 f n A ' i E 1 W4 ku lr' i X E S12 HW l MQ, igglln. wil z ' I I' V V E' 1 5 F 1 4 i l 54 r E 7 I 5 Q I Z Z 5' if 2 5 .: L- tg r i l. O EL l J Dv I .fx K V. Y.. .-f, vw' I imp n Q-2: f T H E, D L P ILI 5 I ' ,. ,,, .... ,,,-..w---.-,,.,, V . , , , 1, .T A,. H , -- , W , , , .- - D A 5 E. B A L 1 1 J 2 gl Z Z Z ? 6 4 3 9 Z Z f Q 3 Q v. X5 N , -H .ip X. M .514 L-1' 4 -:1:la I-Z-l s nfl 25552, .1 . .42 ' CQL X rg. , ' 11-21 P 11312 Q 7 '31 5 Z ,4 l '11 I ff . will V4 I L 3 a-rl! V' 1 3'g'f 4. -.-' , E 52' ,Z xy I V if 1 AC? Li-. 4. .M mn, I D wil: 'l 'J ir .. mth 4, Fi I ' uf? Us 0 .mg 254 fund, Zi2L' ,f K l lm. I f f 'lx F u? ' 1 1. 1 U? 4 Q .. Q . 3 xr. x If Iitgi 1 Qi K f--lis we T .Q ' N lil? 5355 f 4 -li:-L Q ' ' iii 1-15 Zz: .x 5 Cy lg.j 2:2 pflx Dk ' J 5 s:3 'S 5 f' N 3 K S . S W D ,u f fb, ' 'MIX , X if M Q AA -f - f , gf fx--1 uw vm, if o .xxxm-mmuezbsysr:am-r:11Smxxmm.xxs-msx:QQz212-xg:-:-1-1-1-rqib fsff 13511 If F! 52? rf-:2:2:1::frg.1151:g-,,H '3!551'5'i'fi X L , ,f , -3-A -!.2-'Fig' - ' 5 xg MON M K, ,7--E L U X , -'SmQfgf-307 Jiciiifk I - I I 1 I I I I I I fa' 'N X I -- s--r-'xx ':::: :: I I I I I III .I .II 'Q 4, .I, I. 'l l'i. l' u:f:'- F E O ,1:E,, -.,,.- -I:-1 ...: .. '.'E: W z PILI :Z- I I H E I , - .... ....... M AA,... - ., .A:.,,. . ..., ,.,... .,.. .... - 1-5. -.......-i.s- ..... 3:15622 IZIIIIIIBTFIII' Z'3llliI:1iiil' Ili'-R337-ES 'lilIlIllilllilililliiiliiliiiilll HIIIIIIIIFIZIIHICEZ-I-u - III 'I ' ' I I 1 , I X., ' is -. HI I . X - 19:45 1 f' f .4 ' -' ' ' I '1L '- .. .... '.., 1 I I X I . Ae' ,gh .1 II kc -3-gf ev?--, . ' 'e f 1 WAX Ki Km f ' W aw' '- - A2 af I , '45 ,1, , .. .....,...... Im.. ...-U. vp... ,,..,.,, mm..mm......,...m....m.. aa a H5 ,Q R, , x qu :ass .. i llnllmmlimmmllm Y I umm.-mm . ma 1 lm . mu .mmm nv nl IH' 'YUHHIN I ' am- 5 'J '10 I Jn is ,navif-'12 2 I I ia I IIIH I 4 I' I IIII ...J I II-gg in X III III r J J 3 , g . .mlm ...:... I . .....r al . .. sz: L -- ' I g , n s I z - 4 1 1 I fo I 1 s I I Q Iva Asia. Wa.. I I 922 I Baseball Tbam R A. CLAY . . . . . . Coach D. I. BARRON . ...... Captain L. C. INGRAM . . Alternate Captain J. E. CONRAD . TEAM ALLISON, H. R. BARRON, D. I. BAUM, J. P. BRA1TON,4A. I. A A I I I . . QQ: . I I . I. . E.. .ll F If Y I. I I1 f II J I I I 'I 0 QI II I I. III I 4. III I. I I if ii' Ii 'II EI I' iI 1 I, L' I I 'I I I x I IF' 'fig IuI..iII II GSI .I r : Q In AI 1 II I I I III' 3 .II .II , . I i I COLLINS, C. G. .. . . .Mana HINES, E. VV. INGRAM, L. C. JENNINGS, J. L. MORGAN, E. R. O'LEAnY, D. J. geo' I 2 X. I J .rv ' r fa, qv I uf' If I 5- I IT U fi. I I -IIE 7 Q ii II Y A E, 5 LIEI IE T 1 fill Q I IEDWARDS, J. T. PALMISANO, J. I I GRIFFIN, B- E- THOMPSON, W. D. I HILL, W. M. E I 4 - I ' I , I' I I I IV I III I Iig x 5- I . .SC ' 51 I I I , , 'J expr' 'HO O , ' I I' ' Q' Q v N II I I. N I 0 - - 150 'gi g' ao Q IISQQI I I I . ia, a, - KN 1 a N OOOO a - I I , L ' a ' f'l'lI - ' ' I -'J Q' afaaz - ' ' ' I 1 ff- -.L , I LlDH,EL K- -X .x' 10525. o 4 l 45 . .E5a,a- a v thu- I X n f, ' ' ' I ll ' . 1 I I I :gn - f:'f .. Iixx H Q--H' ' 1 II i ,nun I 1' x Ili lui hu qi I A .5 'I z 5: I 6 ? 2 . .,: I . I . I f I, 5 ,. I 2: I5 I . I I I I I I 5 LKONEL I 1 I I 0 '.'f In 'r. v.. .x ,-if ,bt 5 . .Q in ny b 1 -' El:-k L xr. X' A .i ffix ' i-Q Q , V , . ' Q . 9 A. -Zff .211 4. 'K iff: pc- : 2'9 f-?- '- ' izw Q - -' 1. .:' 5' , f Huqggi' 3534 msn 4-44 ..... ,4. ...-.,, . . .. --QL - - -.-su: .12 4 4.--W V - - V V '.v' T- H.-. - . fr-f---f-24:31 -11.::::,:1L::- 1 ,un , , ng ----ff' . ..,..........v--..........-..... T, Y Y H... A A -.. 7. ,,-qi , . MD Q ' ':r: ff 22321 I V 1:5341 P Q 'vfljiw Z iii2 Eg ,g ig l 5 3225 T2 fx ISE: 'f Z nz. f v 2315 3 j uf lb !I 9 ' win f Yxl. M Z 1 Hu X. x Q Q 4 l ,pq 4 'I' ' if? Y 4 , ' -5:5 4 w-hae' i arm f X 1 . FM f - rev 4 4 '.x' 1 9 . W ix X N 1 x f wg my 7' .hh :iff f 1 :ggi- Z , I-if Z' 4 ei 1 5 w Z l ff: 4 5 3551i f 1 'In 5 1 iii I v , if L L J ,Pm W' cllll- . H511 , T , . . Q11 ' ' P2 1-if n 'whim 1 ' STS funf, xx - , f E If-4 E film V W 'w ,A q z A X . I 1 B is 3 A 1 Fi: fi bi- wr' ff? Hi X f ,' I if X ' r 3' Q 1 5 , 'Ibis N 4-Q gg: N Q:-1 Q x. if X . E 5 f H Aw' 1' :xg ,ff-v F CAPTAIN R sn Bgxnnox 5 ,. xilkgx xo 1 f Ln0NEL K 'WIEEQR 75 F' HR S' N Q- T 5 ff 3 if X 'Q , . , L - , '-hXY'KQ.bZ.'x:QRQ-SQABSXY-D.-:QX5YiENRXx'RESERXXLPBL-1-T -,'.- I 5 Ev-'i Fw Q,g?:'1,jqig.1.f.1-1-1.11-H-L 51-f'2'f'. . G mug QN 'vi i ,f 1 1.651 . ..,, .,,i,,. 1 ,... , l- Q . . . 5, , t 5 I 5 . K' Q H 1 f-. 1 I l I -, I g ffi I f I, X .N I 7 1 N: 0 I N x TY I 41, . , , ., -ak, A 4-.s f 0-70 ' .f x ,g M 5 -1 ! A A S I , --.'-: ., .- - .-.-.g.,4 1 .--1, 22 I . . Q.. .. - u . 1 . -1 ..,..,...... ............. . ,, . H, - - , aim 3-xi, 'qlmlfg ng55:11:12:I1miami:llmiwlllIIllIIIIuInmlIlisiiiimuniisllllliuemmum.-m Q-in--m--um--1--1-1-mmmemmmum..mm-nu:-uum.a.1-1.1. 1-V,-1.1-1 1 4 mmm w I-HHH' 1 v ' I ' 'f ' N fH'1 Utnbfigfluanlz , ..,..,1 ,,,,.. . .,,. I U um I Il ,111 4 .. ,1 , 1 ul 111 1 if E ll' 11 ssrrxma 1 s.: sm .. ' 'mv l'i! I. 'helm 1 :......1rr .......::: ru. 1.1 . ... .xrn :al li as . ...:..rf:l..n..::..:.:..:: nmll:.- . .. X Y 1 -1 , Na .1 7 . 1: -9. 1 . jf :- 674 MQ? L A E 1 1 1111 qu J will ' FU 55' Q 4 '. Reviewlofl 1922 Baseball Season EJ X W ECH has won so many Southern championships of late that she hardly considers Q la the season a successful one unless the S. I. A. A. banner comes into her pos- session. The baseball team of 1922 did not run away with every opposing team j but it certainly came through with a fine record. Of the twenty-five games 'tg QQC played, fourteen were won and eleven lost. Of .these last, two were to the Detroit 'Americans,ltwo to Georgetown Qnational collegiate championsj, and two to Auburn and Washington and Lee, while Tennessee, Harvard, and Oglethorpe got one apiece. Auburn, Tennessee, Washington and Lee, and Oglethorpe, all fell before the Jackets at other times. Victories over the Naval Academy, University of Maryland, Clemson and Mercer complete the list. 1 A The season opened with Ty Cobb's Detroit Tigers on Grant Field. Tech made a great showing for a college team, but the hard-hitting big leaguers triumphed in both games- 4- to and 7 to 41. The following week the team came back and routed Clemson, 8 to 41, and 6 to 2. The first game with Auburn was rained out and in the second they managed to pile up a lead of seven runs in two innings, yet the Jackets missed tying them by one run. This last was a thriller, being a pitchers' battle between Tige Stone and Harry Allison: Palmisano's home run decided the contest. The games in Auburn were split. After losing the first, 8 to 5, Tech won the second, 5 to 4. Poor headwork on the bases lost the game t0 Harvard, 41 to 3, ,although the easterners were outhit. Tennessee was the first stop on the road trip and to this team Tech lost a five-inning game, 7 to 413 winning the next day, however, 8 to 4, without much trouble. The Georgetown champions had a hard time downing the Jackets, but in each game managed to get such big 1 l .1 -zz ,. 1 l ' I f' 1 1 i I 1 -: 1 5 I ' 5' if . l :' I . Z3 'o jo ,. I 1 2 gi k , Y leads that the Tech men were unable to overcome them, and hung up scores of 8 to 7 and '7 1 ' 5 to 3. Weinie Collins took'the mound against the Navy and held them to one tally while I: his team-mates counted thirteen times. Maryland University was the next victim, bowing to 8. score of 8 to 2. Four runs in the lucky seventh gave Washington and Lee the first game, 6 to 5, but Tech got the second, 4 to 3. Returning home, the Yellow Jackets downed the University of Tennessee twice, the scores being 4+ to 1 and 9 to 5. The next week Tech split another series with Washington and Lee, 'Q losing one, 3 to 2, and winning the other, 3 to 0. The final games with Oglethorpe proved nothing less than batting fests for both teams. Tech won the first, 10 to 2, but Oglethorpe 4, came back in the second and won a 6 to 3 victory. The third and final contest went to Techs 1 bythe one-sided score of 13 to 6. 1 7 To Captain Red Barron are due most of the honors, for the season. Red finished his last , year of baseball at the top of the list in hitting, in stolen bases, and in runs scored. Sox z' Ingram also finished his career in a splendid way, being second to Red in each of these departments of the game. K 3 1 z.. 1 S X - N ' O Q'6f?ff 'i?-? 4 C' 1 Q: mb' ,Y -- f ..1: rillllrl i g, . ' -P HW, W My ,V A ,A V, f A U 1 52 1 ' I , 1. onex. K Q 5 Kl,, ,ryllll bgsg o s Luv' Y Al ,Q , I 1 5 1 9 ,. 15' . I . C 7 1 1 I 1 1 rig i J tp 1 V111 I 1 : 1 J 1 .1 122 1 1 , 1 1:11 E a V11 143 1,1 5 1: 4 1? 12 12 1? 12 Z. 1: 21 l 1 I S 11 E il '1 E li, E? 4 1 1. ,ei .,' 11 -x': X. S12 13 3? 2 A il I 5-,qi 1 Q.-I Ei: P ir.: :si - 7 n .I A gf- I-In .-,- .:-3 . J 7.4 '11 :gi V 'F-1 V fait qi ll ' -- iiii55555iiEiitZ5W'xiii'-Q55ggggff'w1f2rv:snmoxsfvmTm v . . . . .- QI 'ig -f.----' ...a--U-:. f -.M-.-.7. . E- . .... .. - S ,, -f '.,.,.. . , -....... , , ...... . -F:g,,,,0 ...A. IHE. DLVE: PILI Qaiiixix uxiz.. .,.. ,.:, --------- -...--..- . V ,-,mmm ,Hmmm V V VV' 'mv V --V-'MVVV VVV V - J 7 .Vw ' lwguli r., A Results of 1922 Baseball Season iggy Games Played Won Lost Average i y 24 17 7 .708 Z P' 'T Z Date Opponent Tech Place Z March 23rd . . Clemson . . . 4 8. . . Grant Field 5 March 24th . .Clemson . . . 2 is . Grant Field 355551 Z April 7th . . . Auburn . . 7 6 . . . Grant Field Z April lst .... Mercer . . 3 10. . Grant Field Z April 8th .... Mercer . . 0 1. . Grant Field g Apri 14th Auburn . 5, , . . ,xuimrn H225 Z April 15th Auburn . . 5, , , , Auburn Z April 21st Tennessee . . 4. . . Knoxville Vg April 22nd 'rcnnessee . . 8. . . . Knoxville hge? 5 April 24th Georgetown .... 7. . . Washington ' Z April 25th Georgetown ..... . . . . Washington Z April 26th U. S. Naval Academy . . 13. .... . Annapolis M. gi April 27th Maryland . ...... 8. College Station ,' L April 28th Washington Zi Lee . 5. . . . Lexington YV- April 29th 1Vashington Ck Lee . 4. . . Lexington QQQA1 an May 5th . Tennessee . .... 4. . . . Grant Field l7 i' q i Y Y. MF May 6th . . Tennessee . . . 9. . . Grant Field , May 13th . Xliashington tk Lee . 7. . . Grant Field iii' Ap May 14th .... 1Vashington tk Lee . 3. . . Grant Field . V in J 'u UIQ May 18th .... Oglethorpe . . 10. . . Grant Field 1 I 'Wing A May 19th .... O lethor e 3. . . Grant Field 4 1 4 , H P -uni I??f tVV May 20th .... Oglethorpe 13. . . Grant Field , June 6th . Mercer . . 2. . . . Macon 5 'll it ' June 10th Mercer . 3. . . Grant Field M 'N 2' Q Totals . . 143 S S Q 5-. 1923 Baseball Schedule 3. 5 ,. Q. rl? Date Opponent V Place March 28-29 - . . Pennsylvania State College . . Grant Field 'gg March 30-31 . . . University of Pennsylvania . . Grant Field April 4-5 . University of Maryland . . . Grant Field April 6-7 . Dartmouth ...... . . Grant Field lf! April 13-14 Auburn . . ..... . . Grant Field April 20-21 University of Florida. . . . Grant Field April 28 . Auburn . . .... . . . . Auburn April 24 . . . Auburn . ....... Montgomery gig Q April 25 . . . University of Alabama . . Tuscaloosa E15 3 April 26 . . . University of Alabama .... Montgomery :g. :X April 27-28 . . Mercer University ...... - - 11139011 May 4-5 . . . . University of North Carolina . Grant Field May 11-12 . . . . University of Kentucky . . . Grant Field EVE May 17-18-19 . . Oglethorpe University . . Grant Field 5 3 i XZ'-Fm, T . tw VVVf,5Qf?5F-G-if ,t . g A . ssssa as 2 - a - M Q Og?-'ifllwrabmxfkfwx-x-:Rexxswikmxmz-bixmpxg-1-1-1-za-:- l gffi 6g?g5:g51:1:3.3zg5g-5 g44.g.g.: F L-on at n V s- 'i ' 4J T a A H U., i f Qs!-if ' Q-KL -xg I Q FA .l m?iZg,,' ' mm :gan nl :H 3 NlullllHUIIIISIIIIIIIIIIIIIHII I' I I ll ll Iiillllllilillilii L1xl4':2l l:1'e::rix'-:--:-e--:emuIhililllllllnlldl I! I-il llllhlu. I 'hh ' ,: nl u '- . I - - - m ,ll 5 iz n::i::!iHi5iunlL t xiii' ., D L P ' N lu.: yr- ':::.:ah ,- Q-.T ITT TTT ' T .. ......... .' ' E' '. '2:EE'-........aa ....... an: ---- ---'-1-'1z::ru::: .: -aa - '--:an-an ----- : '-:':zz:::::::::::::::::::::::::ggg5::I:::::::::::::::::::::::n::::::::::::l::::::::::::r::::n:z:nnn:m::::::::::m:::::l1iu:m::::lnaw:::::t::z:L1::::::::..l::.::l:.........:.. ..... . ..... - - ......... 2: .f.. 2 H mi , 2- ' ' Xfgmilsei' A ' ,FY 5 I 164 at A Q :A 3 T 4 T 'ff X 1 4:1 , ,J T 4 if f T f Z ' f f : . .2 1:0 I -:' BE ' 3 E V' ' T L 5 ,. . ,, lf- AJ RY 1 5 L- Q - ,.,. OLD LETTER MEN OUT Fon THE 1923 SEASON T - 4 Q J ': 731 .,... 0 ffl! H MTL 1 T 4. . T 59 '57 , 1:Q. .,,1 'T - g-.'-T 'L , Tiff Y' ,,'Efi'f' ' 1 XZ .. KM., T, , . D-NMXN ,.,., T.:.. T- T 43. T. TT 1 - :..T:-s ., , T N. M 2 , T, N. , f ak 'Q ai, , 4-1 3 x bf x 4 X N f . T , X T .. A 5 Q S9 W ' 4 ff Q ' X ft, ' T Q 4 f V T f Q f' x fa K f f W' wal-ffm 'W'-7.1, - , x 51-'ff . '. A-, w Qx,ff ' 51 . T T - X ' ,: .Z 'h CAPTAIN EDDIE Cg.27a,3, ,gl . . . SULSHINE' THOINIPSOL X ' Q74 ,fe , N 6 ' 'LI '2 X if f WM X Q 9 ff .W . b f f f fy' W ,ay f '4 X '3 rf Q ,X .NWC-+-M Z T ff- W, Y, .,' 4 f T ,. . TT . .- .M ..:.,.-Tffw-1 . +TsT1s:.2vL ' 1 T Assfwf, . , 9 g N 4, ' - ,, 1 .f XAVM , , .XV ,253 X , , 1 :ff V 4 Q 1 E M AT f , . 5346 9 T 1 529 Q , nh, ,Vw . w ,M lv cc 'J v v x WM 'PI-IE 1923 SQUAD o:,.Qw 'fSf' ! We A ' T - - T- T- J eiiif' 9 ' ' A Tc I 'z If 'Q C -5 .-1-T 1 If P 4 I r Y 01' 81' TL Q .K !l X 4 3 IQGI ab' fl T1 fi. ' Iiql t mv E13 ii E S 3 N- S . ASQ ., A- 1 n I I 1 i T 4 P E T . 5 1 I E S I . gi gi fo 3. .6 I 22 'A it I 1 -- 1 2' I 'Q . T : 5 . I I 7 . . . to . , . . T J L E5 Q 17 In 511. P L . its nf IL T E .EP Q 4 E T: is I i lx. '? IE TE is ii TZ .? !: TE nA.vx.....-......,, vvvx .- 5 2 D' .- 3 . O lil ., O I ,, . r .' JJ. f .- 4 'F Tlw F 5 2 Fl' .- ,ll , My H! Y T ' SET TT T T , , ' TS2:!TTT' T IT, ' ' I :III tl !liii i 5 .,g:,::'A:gl!lixll!!-l v. : 1 T' 'Iva '. ? HITT' T L xi ' ...fl . . :........ ...... ..... ......... . ............ Ti5?3.Wi T T' .TT MQ JJ . . ' Vffif N i TT? Mill.: ii , Ti Wi 'I ll x T1TlT.T'ff 1 1 ' if.:T'F! ' .I T11 'i 8 Ti, . 5' ' r , 5 T .J . Z H !l!!51TQVP T' IT Q ' f .Til JTQML N ' ll uiflli 1 Q ,L VR. T.: i 5 A tg if E 1 T 3: .Tl.T!TTT5..T .T t E!z'21Tj 1 , gi '1'T1i'1 1 I T, . '3 ,-I :!:TT 1 T g VUHE T '. . ffl' T4 T :- T:Tz5TiT 1 Wgfilf, . 2: WT. 5 .' pl lilhz .T ' A 51455.11 .N T O .1951 px T .T'giT1IT!l' ., , 1 .1 1 X, T . . 2: 1i'!i:i.'3s . T 2: QQTTTW T TH' SWT T 0' T.1',?Iijl'! 0' T.TTT!g..:. ' i:lH , , Z' ,' T T TTT !,TT5iT5 . q TT L Hi if EFT. T 1 a T V TTT . 5e2PT13'T,T1J . H Wg! p mv , fs T TETTTT T T M 5 ,. 5 HRT T.. 'aw T. .T H' 1 T T T QQ MTV!! TT 'T T . Q Nil!-'32, 1 T 'JL T WT ,'I1T'zT1q fl Q N Q 9253 'T I Ti vw' LZ 'Wim fl Hung, is , ' 3: T T A TT NTT., T L , ff wp: iT T. I lIl T V' l. TT! T. 5 T 'X 3' ., gm T , .. 4 ,E TT T TT T '- iw TTT T ' .- T 1 ff' T .T ' I f 21 T if Z. T 'TTT-FTST TT T '- U ri W TR! :t cc ,Ta Iv' LT' 1 N z. lu iwlilil vw T! T 1 .T T E: Q my 3 ji i-1 M Q T IH NQLKAQM Z .gi T T2 TT .' . 9' TTQ ' , Ill T. 52h Tim 1 TTT Q TT .2 . -1 T . ,1TT!'-QT llf 'fiiw 5.3 T T ,TT T ,Ju 'I ' T V T T l xl ' ' . ? ff' wi 1 X ' Q I, T I T ,El , D , T -T T fi g 1 it W T' X .T ..T', ET gg 2 'TH ' ly li 2 1' ' l'4g 3Ei',! . 'if la' :f 9 1 f A l.u TTl1 ' T T .g. QUT W TT P- O f O T h t '.i 'f.' ' T N' 0 X N ETH S T 'T T' N T Ta .T . E23 WJ ' VE 'il T , E . 5 X w is T 1 1 TT ,. Q . 'KS' :if f 2 X al. for U i' TM A 2 ffm? ,Ti Ik. T o 0 0 H. 1 if Ti ST 5.5 fi? 1'? N ' E. TT' W H .ig-4,T if T T x ' 5 Q-Lk, X 1 b 1 , - I 1 N' 12 is 3. 'w -F S 1Qii fr F .3 J .1 xf ,. IL' L L 3 1 W V 1 m fr- , K l .X , 4, ,if . , LJ .Aff ff-X - , -V g a n: mf.. -A .,.,..., .. una! .... . -,,..-.-. ,.-auf.. YJ .-' ' ' ' -V ' 96' I We - --- A ' ' e'3g, A. I 4 .. 1.... GI ....,..i , . , , , G. D , I . . - . L -. ,UL .f ', e ' e 4 f w ' ilzf 1 1 F5 l V5 'iff f 5.3 1 Z if Z f 1 I K'-x N 6 rf J f .3 s 7 fi.. .Q Jil? gg I rf Q . P51 J 9 J Q ' :,3 . Z r 1255 J 6 .5112 Z P125 . f riff: Z l 2-'J Z 1 6 ' T5 . JMU! W L kg? , mu IRI gunz aa Ji , N' ii 1K J 52,111 .'xdu'fQ Q55 4-Sf mmf! A .. W 3 I 922 Freshman Baseball Team r 'X vi. A x S A. R. FLOWERS . . COGF-'ll fI'lg,l ff R. E. MCDADE . . . - . Caplain :QM G. E. ARMENTROUT . . Manager MM hi Xfisl' MEMBERS J .ALl1RIGI'IT, J. G. Pcrrs, JV- R- DENNICKE, C. SDIITII, M. V IRXKVIN, R, A, SNEAD, J. H. XX JM? LEE, R. E. SPANGLER, C. W. J LOCKLIN, J. G. TANXER, G- B. MCD..m-1, R. E. Trmxsn, L- H- - V33 NEWTON, F, n ERNER, S. H. jf? ' W li ' , HF Hfffw! 1 nj: HVIJ will IL 2 5 eh F 3 wif , 'xx Q JEL! ' 'Q . a . -C XQ- V- I' ff 'mwx '-XR x ' E' 5233?----1-Q-3-1-1-1-rv:-5-i-1-:-1-1+lygliizlgigigirtor.-.'Z-I1'gJgl11:51-Ss.-I'3'!'?'51f '-'- 3l3'5'5':':Q '-Q,5,X5qx5QN2793-2x'N:6.:cbXX'b.'.0.NrW AVA? Q3H5j-'-'-'- F :E it A ' '- 1 a ' gzfn, Qx 1 Ummm, K- ' L .x - 'ru -S' , . Q . an ., . .Ea,'m,::., -... . '1'4 ...-'.-'f'15S'i. ., Q. . I -- - 'W' '-' -rr '-'--' - ' 'I f ' 2-H XNTR5- , , . x ,iz , ' 1 J' ' 'Q ,' F! 'x V .ts 1 45' A so -:-,-6.0.11 1,1 1 . .1 v- 'X jf!! J Q ' M ,ff fs! M 1 S 4 ,E U! mg ,in -ul Hum x x aa.....mmllmummunumilllnlmli..i.uxumz .lumix en. -mn. is ... um 1 .4 in in 1 n if 1 g ug' , 1 3. W tg x 1 i gl .Lenz ,I :mu ' M Nm I' F - V lvl '13 as f.. is W is rf iiiiiim ml za- .-,..... .... ....1:sm................. .... .....,.,. .... .,......,......,,....,...,,m,... V -:--g---::::::::::x:1::::::::l:::::::::::::z5:::::::::::::mmrz:::::.::::::::::m:::u::l:::::1::m:::a::::::::::::::::::::::..ms........... -...i ......H-..... .asf 'aiu 1 :::'............... .4::- - - ............... -...-..... ............ .. ...... .. . ... .. ... , r A , l o f r f '- 5 5 ' f E2 1 REVIEW of the 1922 Freshman Baseball Season 5 . g W HE Freshman baseball team of 1922 came through a stiff schedule against some f of the best prep teams of the state by winning seven games, losing four, and 5 tieing one. This gives them an average of .636 for the season. i lyk The initial game of' the season was scheduled with G. M. A., but was pre- f 'Q 51 i, L A A' ' vented by King Jupiter Pluvius. The first game to be played was with the 4, 3 team from the Federal Penitentiary, the Freshman returning with an 8-3 victory. This game - gave promise of a hard hitting team and it was with high hopes that the team journeyed to H Milledgeville to play the strong G. M. C. team. 1 5: V - 5 L iz However, the G. M. C. team was altogether too strong for the Ratsii. The Tech team O had bitten off more than it could chew forpsuch an early period of the season. G. M. C. had L little difficulty in piling up a 15-3 score on the Jackets. The next day they repeated with a 'I y gg I 5-0 victory, completely baffling all attempts of the Freshmanbatters to score. , . Q . E Thisseries was marred by the tragic and fatal accident to the G. M. C. shortstop, Daven- sf V VJ 3 port. During the game he and the centerfielder ran together in an attempt to field a fly ball. He died a few days later from concussion of the brain resulting from the collision. f l A . 52 Q 1 The next series was with the Monroe Aggies, the first game resulting in a 6-6 tie. This 4 : i will game was a hard fought affair, neither team being able to hit at the end of the game well 'i . vc...-3 enough to put across a winning run. The next dayls 'game was rained out. 1 f 'Q' ,, -llllv . Then came the series with Gordon Institute, which resulted in an even split, Gordon gpg winning the first one, 3-1, and ,Tech the second one, 8-3. These two games were well played, l the first game being the better of the two, though not from a Tech standpoint. y ff' 1 ' 1 .5 G. M. XC. came to Atlanta for a return engagement, and once more defeated the Jacket '- .l ' team, this time by the score of 4--2. However, the next day the team had their batting eyes working better, and finally took the cadets into camp with an 8-6 victory. This game marked Q the beginning of a winning streakthat lasted throughout the remainder of the season. ' . 1 43 Riverside was the last team to meet the Rat team, the two playing four games, two here ' Q. and two on Riverside's diamond. Tech won the first game, 5-4, and the second, 6-4. These . gg games were much closer than the last two games, which were played in Atlanta. The Fresh- , ff man team won the last two games, 4.-1, and 7-2, and thus closed with victory a season that E 2 started out rather discouragingly. E f The season- served to train several men for the varisity of 1923, since the 1922 team lost I. ' its entire outfield. The team worked hard allthrough the season, each man realizing his opportunity during the coming season. This probably improved the general character of their playing as much as anything. i Q . ' 1 X , Q so .MT if SH ' Q X nip ML, LIONEL gl' QOQ'w, .fc1 o f ' X vi A .6271 Q21 9 1- ....... Q --1 -2 -- N. ...ra - 'N 62771 54 Q N wwmmw 1' fi' -1 assi iwmewES QmxxNz-io ii Q t . C- 6 -' ' , 1 -its . ,1 !s., . 6 1 1 . W 1 A if r -S- wffu K Sitfm A ff-4 0 im' i as O - rl XQ5 I I I .11 q A v: DZ' H.: ' L1 '21 Q.:- P-K A Y 4,1 A U ' ,I ' xl 9 2 5 I Q , W gggggilligi QiiiillfiIQEQEQQS11:rw::xs:auxm1na'?ms:sanwsfsxxessL1ezif?g31QilfZel-m,:,-: Li...' Y.....j.2,m 551 41 L ' ' , I ' ' a i. . ' ipzg h . . , , ,, ,.-. . . ,.. ,-, g ,.,,. ,..- .... .T N .- mv Mk I I I ' i Ln. liz: ., Y ' Q E: ull 4 limi! nl21ZL....,. ..... ...... .a:::' :::: '--------..... ............,.g.,,, , f . 'V x, , I ...- QQ , 1-W ---- --W A Q57 - . 1 23 , X: 1 Ef sifffl I wg ' 'XETEEII 5 l ' V35 l f tif: .Eff 5 R A R VE j ij 6 Vs? 4 u F55 wif f f' I-I g kfzi Q g V Fifi ,Z A III 2 iii X 1. X i Z t Q11 6 2 A ' 5: I W, U an IH' -lllll' wi! 3:18 I n fllllv I .I I EE! 4 I 1 i V J H in 1' 1w!.Lg I ,A ,,, A , b s fzfizf. + ' Y QL--,'1 f,,, J , Q, ' 5751 hfz. , A if W f ax' N x 'K , , l ' V 1 .--Z ' ' X' ' 1. Al X W ' U w A S Y IUSIFKW ln.: S 4: .,, .. M, I .FW l 5: 'K jf -wily HJ .R , , P f 41 f f, MW My .,, 3:2 will L W, H 4, ls I Q 4 l I ll I xmk 115 ck 1 V:- Ei I Xml X 25 - 17uNe-An -f S 1 3 6 Zim' MNA :J k .--y52C9bO2b1xX+5:Y:9QQRSoRNXXXNXism-2x'gSb5SQS:'Z'QNX '-'UNH Y in z' 15.1 f If X 2 iItx , C' xf' V- 'O 5 ,. -x , l Q f -c' 821' ' K X 0 :...:EKj' U? M.,-2 R - , ..... -:A - y W Y U ' ' N K '2 ' R C x 5 vi ji., 1 f' -3 .4 vu 'HW L 0 -H-hgl r f W4 Di,-3 Q4-f.5!:s.ee.-IPA?-lla , , K NX xgx O -v r O 7,1 1 LK W 'K V, AQ ff P lr O ft o J, fl I.. .... ........... .a:::m:::::::.--- -- --- :::r---- : :-- -1:-x ----:::::::::::n:.:::: -:::r::- : : ::::::.-::::: -::: ir :::':'-: ::::':::::: :ua-1 'r r'-:'-:----'- l'Il2ll'2 ll nuln:'::lrna::::..:' :':':m::::::---::. tbl X-Iv mf ., . Q U .. .... 1, . ... .. .... ....... .-M. .A E: BLV PILI E I'I W N, ij. X Z R ' f h I 922 T k S eview o t e rac eason g f WE, HE 1922 Track season was by far the most successful that we have had in quite . Q a number of years, the team winning the Georgia State Championship, the l l Southeastern Amateur Athletic Union Championship, the dual meet with Sef Q, 'Q wanee, and the triangle meet with Auburn and Clemson. In the Birmingham Q36 Athletic Club meet Tech placed second, losing only to Mississippi Agricultural .I and Mechanical College. Tech scored 303 points in this meet, capturing second place and g defeating twelve other colleges. - - A , , In accomplishing the above record under the coaching of George Griffin, with little out-' A side assistance, the team should feel justly proud, as it is the first time Tech has made a. showing on the- cinder path for some few years in keeping with her high standards in other branches of athletics. A. 8: M., with its usual group of stellar track men, seemed to be the only stumbling block of the season, the remainder of the meets going to us by comfortable -. ,E margins. It was a slightly brisk, sunny day which burst upon us on April 3rd, the date set for y 'ml the annual field day. About halfmof the school turned out in uniform for the various events, I and the remainder stood in the stands or aided in running the various events. 'I f Whelchel broke all standing southern records for the javelin throw, hurling the shaft for I I a clear'178 feet and 5 inches. The school record for the two-mile' run was lowered to 10 I I minutes and 28 seconds by Calhoun. Pratt Rather tied the school record for the 220-yard Will! low hurdles running them in the excellent time of 25 and 3-5 seconds. Red Barron tied the In n N L 9 I, I 100-yard dash record of 10 seconds flat. Anderson tied the 220-yard dash record of 22 and 2-5 ' I flu? seconds, the first time in twelve years that this hasbeen accomplished. Walter Mitchell 1 : lowered the school record in the 440-yard run to 52 and 1-5 seconds. QNabelle bettered this 5-1 time in the A. Sz M. meet, running his quarter in 51 and 3-5 seconds, but did not finish first.j IT A Taken all in all, the day was a very successful one, all of the records being creditable, yet ,M ' showing a slight weakness in the field events. if B The score for the triangle meet was: Tech, 64-5 Auburn, 34-g Clemson, 30. No unusual records were made during this meet, all men placing first showing good records in the Various events, however. , Tech, 63, Emory, 475, Georgia, 27g Oglethorpe, -24115, was the way scores stacked up s. at the end of the Georgia State Meet. .Thisevent was held at Emory University, April 30th. gg . The S. E. A. A. U. Meet was held on Grant Field May 22nd, ten teams winning points it with Tech in the lead by a good margin of 26 points. This was the first meet of this associa- Q PZ tion, plans having been made to make it an annual track event. X , . f 4 The meet with Sewanee was quite easily captured by a score of 80 to 32, the only events Q ' won by Sewanee being the high hurdles and a tie for first place in the pole vault. Q A Varsity letters were awarded twenty of the 'men at the end of the season, P. G. Daves being unanimously elected to captain the team lof 1923. I 5 f I xv ki .SCH 6 AAM' Q f CL-ff 'III zmmwswwnwbawwfmpfnmuasoemggoafwqsavffzgxffffm, 'QQ z: , -5 4 , Ii L - ug! on , B Q X OO JF 0 x ' -fl , O V. I 'K QOKK 'N rx. ,ii iw - .. ' O E'EE:. I V W ,,--- ,U Y 'J A-Y .- 5 U .0 .n J..i.,i - I H pl WW iw A 4 023' Begg, J L A ' 1 Q A zefsomefcz-fmxmommawwaNmiwmRQQxxxxxxmXmxxxx .. ' ', - . . . ia L o EL K- .. . -1 ....Q:3ji'..7, I A ! i5 -QQ l Lu, ' ' . iw4,Y5.e.,i . ' ' X as FC r QQBJX ! s i i l . I I a i i l I I I I ' I i if I I. 5: 112 'I i I . I, EFI I f I 44 I I ' I .QQ , ,NE . 52 Ei Q5 I Ig! Eve1 100-' Q 440-' gf, Mile 220-' Shot 52 Disc Ei Jave Hali Pole Higl I I 220-l 23 Two- 5 Broa E Mile 3 Mile 5 greg LIOSQEL A ...ti ff f 1925 X ' A 'X E f f ' ' . - ' l 11211 HH H 'i -aauiaissgfr: 1 'wzawsmfnmnam -auf-mmser --zlziisi .,-1-7 4' fu ,V ' , 3: -- 5 -L .. ........ '1 .. .. U-:gs....1 hm 2 f f , fi ak , , - 'fri X Q x ,J if X rn .iisgrx 3: nn. 'iq-P4 f .W Yau T-B f -r I '! 3 I ' -. JZ: Nm' V ii.XXISIltsl?i1,...,....a ...... . .4::w:u::- , 1 . Y I 4 X Y 2 I 2 2 ? ff 2 2 4 Q 5 3 f Z 7 1 4 if -- .0 li mr 1 1 J! tix, ll lm mn t r Ill' IE, P Wm Q I all II WE! 'rs Q fp,- f E251 rf' I 1 qs... r X.- N- airi' gezriii V F, ' v W :2:3'5 i:2:2' igzgga ? E55i M343 E533 I -'11 ,ay Frm ,.3 .ml 2 1 ' T111 nl, Y '.'1 ,W IU.: wt- 1553, '15, 1..4. UW we 1 I ,3- If:g:I , ESE? x gg L F115 'lb aw- 1' - ll' ' ml f W ,v 'Z ,ga J ,fu 55 5,4 'V' ww I , v 4 1 MQW B 5 ig , g -1-3 '12 Q: ,. ,E f 4 Q31 i 5 if - 1 1 1, I , IVJ ,'J 91 0 If r' I CAPTAIN HENRY GRANGER I 5 f 1 I 2 2- Q r' ': 0 o V . ., 0 ' kwa , . Q XZ . WN xx W T -r tQ1'29fKl999S50fQ'1Q-0NW?QlQNi'f-yfX1WYP7f1fNNYK E - - PXP k21:l:2:1s:z1:251:5-:-:.55 1:-:-1-I-:-1-1551112121:-219:-:':-:-eggzfr. -:Q-1-pzc-ggg:Qo ' '- V A jx 1 ' ' -9 sq FQ L , i5..l 5 mm K Q 'lfwsssihx ' LU' D :gm . ,figgo cf -'1 - l 'X FRN .1 fx.. 1925 e 'H W- A tr be ,, . to ,.., D -,,., .. ,. A, e ee 4 s Z Southeastern Amateur Athletic Union lVleet 5 C f 5 f 6 7 Z' 2 Z if fi r' 5 ef f f fs V 6 L4 pi 5 ll .va V Pu d xv 2 23 5?-1 Q 1:25 22 D- if r 1 1 2 3 H3 LZ Grant Field, Monday, May 22, 1922 Georgia Tech, 455 Georgia, 19, Birmingham Athletic Club, 165 Oglethorpe, 163 Alabama, Clemson, 6, Auburn, 6, Atlanta Athletic Club, 4g Carrollton High, 3, Tech Freshman Team, 2. 7 l 1. 1, 11-- l ll Ut. C i l llrfn' l a-Fl lmpll, C151 fiuf +lllh Y yi Event First Second Third Time 100-Yard Dash . Barron CTD Cleckly CGD Anderson CTD 10 sec. 4-40-Yard Dash . Mitchell CTD Redfern CCD Byrd CA.A.C.D 52 1-5 sec. .Mile Run .... Coston CAD Howard CGD Cotton CTD 4 min. 38 sec. High Hurdles . . Cook CAD Mabry CGD Moore CTD 16 4-5 sec. Shot Put .... Roberts COD Parker CC.H.S.D DVhelchel CTD 40 ft. 115 in. Discus Throw . . Roberts COD Granger CTD HokestadCFla.D 131.9 ft. Javelin Throw . . VVhelchel CTD Tucker COD Granger CTD 178 ft. 6 in. Half Mile Run . Thornton CB.A.C.D Buckley CFla.D Daves CTD 2 min. Pole Vault . . . VVelch CTD Tucker COD Cox CTD 11 ft. High Jump . . . ChisholmC,'B.A.C.fD Smith CA.A.C.D Brewster CTD 5 ft. 10175 in. 220-Yard Dash . Anderson CTD Salley CCD Kirby CAla.D 23 sec. Two Mile Run . Richter CB.A.C.D Irons CAla.D Roberts CT. Fr.D 10:4 4-5 sec. Low Hurdles . . Mabry CGD Rather CTD Cook CAu.D 25 4-5 sec. Broad Jump . . Sallee CFla.D Vllilliams CTD Brannon CFla.D 22 ft. GM, in. Mile Relay . . . Georgia Tech B. A. C. Georgia State Meet Emory University, Saturday, April 30th, 1922. Georgia Tech, 635 Emory, 471A-35 Georgia, 27, Oglethorpe, 2415. E D t 11.5,-St Second Third Fourth Timo WT V1 Dash Ivy COD Jones CED Reynolds CGD Anderson CTD 10 2-5 sec. 100-Yarii Dash Roper CGD Daves CTD Nabelle CTD Hartford CTD 53 3-5 sec. I2-In , Stokes CED Howard CGD McGrifHn CGDCureton CTD 4 min. 43 3-5 sec. 220-Yd. Hurdles Shot Put . . . Discus Throw . Rather CTD Roberts COD Roberts COD VanBu ren E DVhelchel T Granger 'l' Pierce CED Rosser CTD Jones CED D C D C Granger CTD McCree CTD 27 sec. t 3 3-5 in. V C D to f .: VanBuren CED 126.85 ft. Cai I C E-I . CV 1 l 1 T VanBuren CED Tucker COD GITIITWCI' CTD 163-S ft- gfiillriliihrgyyn. Fiitg TGC J Cureton CTD gqiarfr C137 Mxtcliiell CED 2 nun. 5 2-5 sec. , C Parks CED 4 uc 'er C ' Pole Vault . . Welch C17 DHill CGD 1Wi11if1mSCTD H ft . . B ' t ' T 5 P' ' High Jump . . Powell CED W1l1'amS4Tl isliggfi CQODK 7 'J ft' ' 'U' V V A d T Rgynoldg CG 1IltCl1Cll CTD 23 3-5 SCC- rsszsia . ia.f:'2s Hiisiozs P CTD, CGD 10 26 d J iLeSte1'fEl Nabeue CTD DVillianis CTD 19-2 ft. Bfoa 'HUP - - ' 1-Kickiighfer CGD ' , . T l xiii: Dflifiiilg . . vViT1T3lll'CI1 FVYC CTD 9 min. 92 Sec. CMO f , - ,J . u 'age -., , ' '-mug, ' - sae-r:...f5aF Q 35255: 2--Q L over K Q S ON ,f'f9' f X V i T3 C. ,. rl 5. rl I5 K-I ii: ref: A -' ,C-1 H fc- .ill 1 p,- D. fn , I. ljls T353 C., 5-I-' 2-:3 t5:2 w'.'l --:Cz T-Z4 -'J .5- . :-1 li .ji Diff! x ml! in -D if E-sz' ---,N,-- - EE' x :5:l .'Jl 45 1.1 :iii vi 1 52 fu .u 5 1' 'J 55 Iri f. 4: ,gd 54 L15 fa' if . 556. l ,fo A -X U 0, . ,.-ll 'QT ' P ' 24- T1-M 5 ' - - 5 A, 1- : X-ff ' .1 1 - , - W uf' E 1 X lg-ADHD D, W :0.g.g.p J6MY2Q,OmM :XClXsXX1.kxlx-Qx55:yQQ.f.51.3.5 5 Qi :ilgvilqllgg L ?f'1-,-,-:fb -- TA, I Lvv- D Lu Lg-itirqfgoxfl-, -.. V M QSM! Q ,, ,. ,. 1 Ei 5 zi i , i A i ,C I . 1 N, . w-+-.- H C . X X - . D ' ...,. .. Y! C N . I f .1 -wX,.?...N Qty , .I J f. 'Q A WND-z .fwfr 1 ff' N ' ' .4 guihinmisi ,gnupg C A, in .aaummmmmnmn-mon1iinmxnmsuiiiaumul un.....i iimii. i H im 1 . ,. .mumiu in 1 Myra.-sid , -- xxx I, :u zzz. 1 D L 'Q 'gill' 1- , .r . ....:.. ra ... . -1. .xr ... -- Y ' Ii! 3 mggf, 1.. .....- -...na .:. x:-'ax : v r 'if i 'N 'Q O A P Ya 1 3'- D 4 .gi A, L1 to l -llllll 1 mlllf I 'illlllg 1 W i ia? ' I mg ' l l3 5' 1 . A EE Y 5 x Triangle -Meet A ' TECH - AUBURN - CLEMSON Grant Field, May 13th, 1922. Tech, 645 Auburn, 345 Clemson, 28. Event First Second Third T 100-Yard Dash . Barron CTD Anderson CTD Salley CDCD 440-Yard Dash . Nabelle CTD ' Redfern CCD Martin Mile Run .... Cotton CTD Stockleburg CAD Cureton CTD High Hurdles . . Cook CAD Shot Put .... St2llllI1gS CAD Gmhgei- CTD D Gresham CAD Discus Throw . . Granger CTD McCree CTD Stallings CAD Javelin Throw . . Welchel CTD Harden CCD Granger CTD Half Mile Run . Daves CTD Wood CCD Rice CCD Pole Vault . . . Vllelch CTD Lock Carter Broad Jump . . . Vllilliams CCD Williams CTD 1 Pippin 220-Yard Dash . Ahdei-Shh CTD Salley CCD 5' Martin CAD Two-Mile Run . . Lassiter CAD Mitchell CTD Boyd CAD Low Hurdles . . Rather CTD Wade CCD 'Cook CAD Event 100-Yard Dash 440-Yard Dash Mile Run . . . . . . High Hurdles . . . . Shot Put . . . . . Discus Throw . . . . Javelin Throw . . . . Half Mile Run Pole Vault . . . . . High Jump ...... 220-Yard Dash Two Mile Run . . . . Low Hurdles . . . . Broad Jump . . . . Mile .Relay . . . . A Sewanee Meet Grant Field, Saturday, April 23rd, 1922. 1' ' Georgia Tech, 803 Sewanee, 32. F irst Minor CSD Nabelle CTD Daves CTD ' Coughlin CSD Granger CTD Granger CTD Welchel CTD Carter CTD Miner CSD, W Brewster CTD Anderson CTD Roberts CTD .Rather CTD , Daves CTD Tech f elch CTD Tied Second Anderson CTD Miner CSD Cureton CTD Tomlinson CSD Miuef CsD Miuei- CSD Saunders CSD Cureton CTD R Williams CTD Baird CSD Moore CTD Rosser CTD VVilliams CTD JC'-,fo N4 s ., ,ix Time 10 1-5 sec. 53 sec. 4 min. 41 sec. 16 3-5 sec. 38.05. ft. 115.03 ft. 170.03 ft. 2 min. 5 sec. - lldft. 4 in. 21 ft. 9121: in. 22 2-5 sec. 10 min. 33 4-5 sec. 25 3-5 sec. Time 10.2 sec. 53 sec. 4 min. 51.3 sec. 16.3 sec. 39.57 ft 114.6 ft. 177.18 ft. 2 min. 14.4 sec. 11 ft. 5 ft. 9 in. 22.3 sec. 2 10 min. 33.3 sec. 26.2 sec. 20.94 ft. 3 min. 36.3 sec. 5 Z 2 1, ff' 6 f? ,Q if Q? I .-' 'y I 4 I .0'fdM' 9 I 0' 0' N .4 i sis :4 51: W T 1 4 fuk , . IF' r ii' D i t i .IE 1 U 75 + wi i 3 4 Mi ' 3. I l :I i !WY.II59?.4 17 . . .cfifk 1 .-tofu. fn! .ft . .Ulf IC A -Q us Di.. I 1 I .i it K 5 2 l 2 D do O r 3 THE 0 5 lj of-2? F A . 1,3451 5 oy! -2 Luz ' sci?-.lygi if 0 ir if E 1 5 E3 5 if 2 f 7 D Z 1 Qs 5 5 I0 is E 'Ti S IIII Ig... si' W., 69 1 1 45 F? W hi 55 sf' f f :E fi 2 2 1' .4 qs if -gi 1' In I E fi. 1: 54- . ,nt ww .1-AAA T lil- A--,A . . f .,- . ., ...1 . .,-,' ' f 1.. L l l ' 5 ' h A , . ..... .a . .. - A I5 L P PJ li . L 2 l VH: ' rfgwxtaar. ,,fa,.,n..x5 .El l l A 1 31 'Q' 3:11. Q, lg 4 r v I . I5 5 5 5 ,5 5 5 5 5 5 5 7 5 f 5 5 5 5 5 5 5 5 Q. 5 4 K5 Iii WZ my Li P' 4 i ra, 'gli rg ' l HER fl i l i Q1 F E S 4 vi PI' '51 ri Q if -5 N: F H. N Q if t E WWW 4, , 'av 5- vp . r v lu 1 -Q7 l.f.1 f'.'J N4 1 i +-r x ' 2 5:2 4 , - ., f - l i .T 2. . - 1 , .x .x L 1 ' V ..,.- ' ,- . z f- f ' -1-: ' . . . L' ' ' 'tw .Q ilzi . '. L 5 il Ei ' rr l N ,.., ',,.. .x ' I il i.w lj: ' It . - 1 K. y. t .- v.x l-.4 l Tiff l ' l :ff l t , Z Efi: ! i ,'.' t l F13 l ' - . Pi l . :- . 1 2,5 i t if l li ll ...Q l,t, V-' ..-1 v-.si i., . l . II Q i iii fl-5. r,.r-l 1.., Qi .ui 4 udxii V F!! My ti il 'ca ui YRS lm :ggi ,i 'J L-h i-Zi is J The Birmingham Road Race one luor ' ' ' ru - x. hani. ,Xlah:uua, ou lleeeiulu-r ltith. 1922, was just A, I. V.. 1 The annual road raee held at lliriuiug s I weiuaex' iu Southern athletie eireles. il t I 4 opportunity tor Itch to shou lui ll I lillsworth ltiehter, the :rreat marathon runner of the lliriuiuglunu .Xthletie t'luh, won the I . 1 sl I raee auain, hreakinug the eourse reeord for the third eonseeutive tilne. Ilis new reeorrl was M . t -ss J scconds tor the tluu nult 15 minutes, -L7 1-I' 5 -- Duns the first 'l'eeh min to Although : '. had eoinpleted the eonrse, the entire '1'eeh te Georgia 'l'eeh led the entire tield. The o Sthg Mitehell, ltlthg Cooper, ltlthg and R finished 27th, hut did not eouut for points. as onli' the tirst tive were eouuted. 'l'his showing 1 r eourse. ther 'l'eeh inen who eountecl for points were Moore. l, , A 5 - . . . . . . V , tuush, tailed to eross the line until four others 5 :un ezuue in so elose together that in team points ij l , fi oherts. 20th. Barton. the other 'l'eeh entrant. r Lf I 'Li was indeed reiuarlcahle. and with four and possilily fire returning next year. 'l'eeh should lie l ahle to again win this event next' Deeemher. l For nltlll'l'4ll l'up For S. I. .l. .l. fllljf , Georgia 'l'eeh . ......... . 62 Georgia 'l'eeh .... A . . . 39 ' Birulinghain A. C. tit Clemson . . . . A . Hi 525 Atlanta. A. e. . . 71 ,hmm-n . , as ij Clemson . . . T-lr .xlilllitlllll .. . . F3 'EEE Auhnrn . . 106 Cliattuuoogn . .... , .102 Alaliarua . .... ll? llirininghzuu-Soutlu-ru . .127 Chattanooga . . . I-L9 Lljfzl llirlniughaiu-Southern . 177 Q. :V Q34-QlfI.,f:':2g,X: Maw Q - ,3J -Ayyfti531igba- f jQQ F K Lil- - - 'N i I-4,5 'H .. L f l':-.ll .xi - fxgl M5256 a,,x UONLL K, ' Q . , -..-.1 .A i Cl... klruilig Twiifs ' K f-13 1 L. XX. I O P XNA uml . f :I !i!,gTsXjXi T N Y ' X ' R' 'i'g 'fit -,..- S Q le XWIQL .,.r Xb,-:gu11..i3r:g:::.'f.iZiii,.,1.gj.'gQf3-.3',-.'gQ , , , . - bit .. 5. 'Wigs-, a Q i i O X N W H , xx .l ,.14x ff - 'Aff--....:,-f.:-X' f Ui 0 . l ff' f s z .. . , .....i s .4,ie..1 ....,,. .,., I 1 so-Q-9.1, .mx 5 ff 1 'R f x f 'Q A eh svf X Z: , ' ,vs 5 'I rf 4 M I - I N . 'E Mfr' f,,,........ 1:1 M... . .Z ..,a....... , ,. .. ,.,,.- E I lixhil Xl! , NuI11lllllllllhliilfllillill il HHHIIlllllilxlliiillmlllllxslrl unmull. In nnx vxl x Hash, A -5 x ' nl. 'WW ' I if Y r y.. If 1 Wi Lui E , if' -we . li'i im unsmiaix .... .::::na::ia::.::x:n::::::::::a::n::::::rz:::x:::s::::::::::: --------- '-::::1:::in:maaaa::a::::::::::::::::::::::::::::::::::::::::::::.'::::::::::::::::::::::::::::um:::::mums::zna:::::::::sf::nII::n:::::::::a::::::::x::zzu::::::::::::: :::::.-:::::. ..... ......-,,J... ...... 2:12:51 fo X' sq' 1 4 f .5 9 6 4 f 5 7 4 f , ,- .l 4 X 23:75 3 N 9 f g 9 f 22 :F L? s ' ' L., !. i ' 1 l i, U b 'll IL Al f i' xg! '-:nur -. ' . : ' Lad Ml 1.93 vggli 3.9 4 wait , UW 4 inf' 5 f . i 'l R f 1923 A The Cross-Country un o 5 sg e- - at Q A gully-washer blew out of the north all day and part of the night preceding the Saturday Q of March 17th, the day set for the animal cross-country. About eight oiclock the old sun looked moodily out of the mist and cloudsand gradually took on a somewhat painful smile. Q XThe three and a half mile course was very heavy, and the day was quite cool, but seven El hundred thinly cladlcake contestants romped around the starting line at two-thirty, and the 2,15 race literally started with a bang from one of the salute guns of the military department. if As usual there was a Wild race among those who aspired to be first out of the gate, 14 but the course soon marked a thin long line strung out fort a quarter of a mile, while the 0,1165 E 2 who ran the heated two-twenty to the gate dropped out. Such a varied collection of garb S 2 is never seen in one spot as appears for the starting gun on Grant Field each year. Every- d thing from golf shoes to the old man's night shirt served to guard the runners from the effects Q of high speedcompetition over the course. a S The first man to break through the gate was Lindsay Roberts, who finished far in front of his nearest competitor. R. L. Cooper and H. P. Barton finished second and third. tg Roberts received the finest cake, a cross-country T , and a gold medal. Cooper received a 'S- Q big cake and a silver medal, while Barton won a bronze medal. V r ' X ,C dia 1 fm? - if ff O at f55Wf09Wff ffovwoffffagggo Xbk,XXX5hB'QQNXXXXN?.xNB'YxXX XXSkXXXXSXX' ?lfJr u 9,130 o Q9 LQWQQXX 1 0 . f wo - 'i- V wig ' f -----.--- ....- - Q ' azzifil 0 'Y' ..:..!Ej5n 'N-- .- Q L K V V E '- ,I , H 'f W -31,-Y F X 'Q ' . 'N ' ' , fi ' -1.51-y 0 Y limi' w I I I 4 S w 'Y Sl F41 PTH f s. . .4- 'z1 lk! If 5 5 f If EE 14' ,. ds sf. 3. 5 S 5 E 9 4 15 i r 4:5 up 1 1 4 X 1 -1925f1l1 1111111111 T H E, D LV E P ILI fi TE 1 1 , llll 11 11 1 1 11 1 1 11 1 1.5, '1 f. 1 1 1 I 4 1 1 C 1 yr 19.5 1x- sy' QT? -:H lx!-Q'--wi f-v -:- - 1531-' ' lg! 411. ':5 1 .-T' 1 51- I .jg 1 5' 1 R. 11: of-1 -.- T-.-1 1. 1 1 .- , ,-Q.. 1 1'.'1 'If W n,:,1 , .'1 .A, 1 1,3 1 Q .-1 'EFS lf? rl ' ' '1.': : - -'I .' 'in'u:J' . ' 'L:: -:111 if, - 1 ' 11-:Q lu: llllSllllj, 1'lll'OSlIl'I'. .' 111- ': ' ' - : 1, , - 5:1 g. . lu- x':1 31, 5 111- ll- Yjfpl , . . . 111: I: 1 - . 5 . 1 - --- - . 1 : . . - . . l . : 1 h - - E - - 1+:gj'1 ' ',t1 1 ., - .55 , . I -, .. , 5 .. , ww. U K X r . ,, . . . .-1:1 . . . . . . . . . , 13211 Qi - .': f - .' f - Q-1 1 1 -'f -' '- ' '1 1 '11 9:1 K Q 1 ,311 Z 1 ? 1 l 5 9 3 f 5 ,S f F 5 1 Z 'S 9 1 Q l 11 g l 5 ' 2' 7 I Z' I l 1 7 I K1 9 1 5 X 'J 2 l'1 111 llu Il on 11 Xl IS 1 mul s11111 111 sux nr llgllt NIH 1111 wupx lllllxllll ilu 111 1 l 1 1 Z ll I l f l SUI 1 11111 111 II'lN5llll,I wnu l llxlll vu 1 llxlll 111 l11111 111 l 1 v v 1 . . .1 . . 1 5 Il f1-w tl'0llllljI, :uul :111 111-1':1s11111:1l lllllll spr111l111g1 up lu ilu' post :us 11 lu- w1'r1- 11'1n11111g tlu- 1211-1-. 11:-Sw l g If 1111 tlllll 1 11111, glflllll lllllkl llllllllljll llu u1l1 llu11 lllklltll 1 u1l1l spnnl l111111 llt 1111 ln ilu 3 111 lllll S ff llu lllllSll lllllll flllll 1 l11l1n,1. of 11 1111 I mr S1 11 ll,.lll 111 1111 11 111l1l llll I 1 2 llu 1111 ll stuulmg, Ill tlu fllllSlllll1, l11u l1l1 1 lm of lvrulx lllfl 11,,l1i11n or 11111111 111 11ll 1 ll f 111: :.'. 1 x'- on tlu' jJ,'l'0llllll. At th- 1-:ul of twc-nty-lwn minnnlmw ilu- gram- was 1'l11s1-cl, mul llum- in lim' llpjlll 1 Z- llIllIllN'l'L'll for ilu' 5l'll'C'tlUll of c':1k1-s. ll ,1 I 2 11 141 11, .1 . . . . . ,Will Bott- 'l'lu- 11111111111 c'1'1rss-1-111111l1'y l'llll IS mu' of ilu- 1111151 lllCllll'l'S4lllK' :1111l 1l1l1-r1-slung 1-1'1'11ls 111 EEK! tlu- yt-nr. l'lVl'l'y I'll'l'SlllIHll1 must run it, sn l'VCl'y 'llL'C'll 1111111 has il l5lllllll'll llll'lll1ll'5' lll' tlu' FM! I . . . . . fun' llllll' lu' m11ll1'1l flu' lusl lon Y lull. fllli' l1111ulr1-1l 11ml twcnlx'-slx c:1l:1's warm: f1v1-11 Olll 111 XYllllll'l'S ' l l' . ' , . : l of tllc HP23 run, wvll lllllStl'2lllll!I tlu- 111-lu'1'1111s gcuul will :mal s11pp111't 111 our llllllly ll'l!'l1IlN. l P nr' , 1113 1 1 wil 1 ' 1- - -gg l 1 -IlI1I- -M 5111117 Qi 1' Wil - 1 . . ll. r 1 l ' f N V738 11 1 1 HKS? N 'ip 'N A x l ,.. N Nerf Q 1,4 if 'll-1 '55 11 1:13 'ffl :zzz S23 wif! 1 ,ffl :': 1,', 3, 1 I '-' 775 H4 l 1:4 1 N , , Wg2sl1 .1-.- 1 A ,gg ' f -11, , fx A- X ,L: '3 ,f 1 ,gfg Bbq.,--, R ,, 'fill ll 312 1922 Irlll-ISIIMAX '1'11.xcK '1'1-:nl gl J Y X. E 5: x 'l ll l 1 QQ QQ ,E 1 'ul 1 JY A lf ogx F . F BQ Q - , , X ' -L1 11, ' A f - k ' h l 1 111 1 ., 31- v Y Y V A K mxxxxxxmwmxsxxxwxfmS NbxRS31x1-1-:-1-1-1+ fri S3317 'J :Q Q:-:-:g:ga!EQ,o L 1 . -. , ' X 1. I jl' -.-- QQ' 110111 K. M' A-a11Q'c-1fMe4ai92'Z?'sr ' F ' 1 ,f 4i5.1X, l 0 rm,-.:-:y-P5,X 2 '.' - 'FA uwwv- A LZ 1 - , Mill: -A aff, ' -1 U yi, X .- ,--5 ., X 'bg-.t.1QF-'XQN V M3555 f . - ' . l ' 1 -. 11 H i f '- 5. he-maj 5- 0 ' .. .. ..... '-,H , ,.. 7 .,.,.,. f...4,...,n1-niim..f.:1.T5ER,..,..-,tiff,..,,,...............,...........i:..3:.,.,.,.ua ..., :TII..n,,,-- ,.......-.......l.11!h.9Yi,.m..,........ . ,..55555i,5,,,u,4, H E5511:-25531H1lit..1:EnZ--:L-.2lmmmmlnnumm lllmfmmlmmimniu.11.i1a.isf-mme..mm. J- --.1,.. , .. ,. H. gig!! an .rs '1 I 1 1 'sf 1' , ' 5' D 1 5 i11!i1EalI1lIu'un X ii .x 1 ...:. .1 .aan x . - H ' 'f ' ' 'H' ' 1 ' 'I ' X Q' 1 1 1 Two-Mile Run . . . D 1 fi Tech Track Record Holders 5 'Q 4 1 :E: . :uriimfgi-E iizmg T H L P 1 51 if I M :-. Q ft 5 ' T li R C1 gi Comparative rac ecor s 1 Time, Height, or Distance. , Event S. I. A. A. A. A. U. Tech V 100-Yard Dash . 9 4-5 sec. 10 sec. 10 sec. I2 220-Yard Dash . 21 4-5 sec. 23 sec. 22 2-5 sec. 440-Yard Dash . 49 sec. 52 1-5 sec. 52 1-5 sec. ,. 8810-Yard Dash . . . 1 min. 55.3-5 sec 2 min. 2 min. , One Mile Run ....... 4 min. 29 2-5 sec. 4 min. 38 sec. 4 min. 38 sec. 120-Yard High Hurdles 15 2-5 sec. 16 -1-5 Sec. 16 Sec. ' 220-Yard Low Hurdles, 25 1-5 sec. 25 4-5 sec. 25 3-5 sec. 's High Jump . ....... 5 ft. 11 3-4 in. 5 ft. 10 1-2 in. 6 ft. 2 3-4 in. Broad Jump 22 ft. 7 in. 22 ft. 6 1-4 in 22 ft. 4 in. Q, P018 Valllt . 11 ft. 8 1-2 in. 11 ft. 12 ft. I u 15-Pound shot . 41 fft. 5 in. 40 ft. 1-2 in. 40 ft. 11 in. i 1 Discus Throw . 127 ft. 6 in. 131 ft. 9 in. 123 ft. 4 in. 1, 'v L Javelin Throw . . 176 ft. 7 in. 178 ft. 6 in. 178 ft. 6 in. ,. X A Two-Mile Run . . 10 min. 4-5 sec. 10 min. 28 sec. 'fi Mile Relay . . 3 min. 25 sec. 3 min. 36 3-5 sec. 3 min. 36 3-5 sec 'QT' ' i 1 1 -' 1,11 Gia! ii' 'lim '1 - va.-31 ' 1 i n Q p gg li ' 'El r 1,1 1 100-Yard Dash . . 220-Yard Dash . . 440-Yard Dash . . 880-Yard Dash . . One Mile Run ..... 1 120-Yard High Hurdles . 220-Yard Low Hurdles. . High Jump . . .. Broad Jump . . f Pole Vault . . 16-Pound Shot . o -. Discus Throw . ,. Q Javelin Throw .... . .Scarboro, Griffin, Strupper, Barron K . . . . . Hill, Anderson . . . Mitchell . . . Daves . McC1esky . Robinson . . Rather . . Robinson . . Scarboro . . 1Velch . . Guyon . .. . Maul: . . 1Vhelchel . . Calhoun gi x S S x 5 ,- -1 Cross-Country Q315 Milesj . . . . Moore ' .ag-,fo 9' A U O 1 X DQ0 5 'W 3 0 WQQ5WWSX1QQb5k'WZKA5aRYb2i XXKX J 'Q Q. 5: E Q? . X 1 it 4 i 1 1 - S 1 in o AXP-' , V . O ' ' ,i 9' Nos, QQ, - my , tl' 0 U, umlyifl' e 1 w . 5 ,Y C53 t 4 Y , .--- --.l , 1 'Y' ....:ug:1.. V fAYV WV Y A 4 1 . W u ' Q ' fi' K w r ga 5 ' 1 ,, - ' , ,, L o ni. n 'D Q iffjdilliila ' ' -V, , 1 ,,gg555::H 5 J 'J' ,wr-I ,,..v Nx jp - ' A LI 65 J: 5 J X 4, 0 5 - '1 -111--. , J s ,,,, - i n s - J. S ,ii-iv fill ' iff! Rt' 1 . EQ, l xiii i F 1 fn. :N ji ,G ' -' -3--,.o.fj x 3 - is u X I L Q4 I x g fu KHIH Q I IllUUXu1fsmfWfl5alW5lfH4u'-m 4i96it-11 1 it .La W L L 5 I :Q ' Q . . I . A . :'. . Lxiuxumiz.. .,,, i ------- ,, --- .... -4.- H- . 1 .--. - . , ,,, ,WM ,, 5 , ,, - , Q ' l lx w llilll 5 1 5' s Q 1 'P Z F 1 K 1' 7 Z 5 f 5 4 5 5 f 4 f f 5 2 f 53 d 5 Y l, L l L 1 Ili IIIIII v 43 1 Hull l in 'ull 1 11.1.52 ., g llll wllllf, il' 'il l S '- RQ wr 5 b. S17 i'-' tt it F23 :li :IS 5 S x Q Q ' 9 Rx f ... x Hr., . ,o 2 ,-.,-l Q. 'tif 3 l 1 ,iii 'tain '55 l iii 2525 , Y u:u l i. . :.g.l . -., tj.. i iid' -:li Eg nl I1' .-1 i j.:, .54 .5 'IQ 4 Q-if tl B no 'lla E 1:2 v . uv S . .. 12111 091:99 ilu Zozuogp .lagoon . 1, up 4 'a :,0' so 11 G 9995 1,96 u ' - ', . ' 9. 1 ,9 259 - ,n udge some oiogixogvugu una u our: G' 99 09 OO 151-12221332 .,g:,'-':.-- -- ' u' . ' ' ' ' . 'III . . 5.3. .-.fl .1251 l -'- . .Ji N I s ini oo Z4 I g l Q V r 17 ' , HE Y- l 922 Tennis Team Oirrox BLAKE . . . . . Captain E. J. XVILLIAMSON . ...... . .dlanuycr U MEMBERS O. BLAKE R. S. Melvin E. J. XVILLIABISON K. G. Mxriiizsox, Jn. THE SCHOOL TOUHNA MENT The annual school tournament was full of unexpected upsets. Blake and Williamson, who had just previously won the Southern championship in hoth singles and doubles, were both eliminated early in the singles, and lost the finals in doubles to Mclvcr and Matheson. From a field of about forty men the singles narrowed down to Mclver, Matheson, Smith, and XVilliamson. The first two had a royal battle which took two days to decide, Mclver finally winning, 5-7, 6-8, 6-3, 6-3, 6-1. The first day's play resulted in hoth men having two sets and the score standing 6-6 in the last, when it was decided to stop play on account of dark- ness. Smith won from Williamson by default, and then Mclver defeated Smith in the HHHIS in straight sets, 6-1, 6-1, 6-1. In the douhles 1Villiamson and Blake won the upper hracket hy defeating Carnes and YVilson, 3-6, -L-6, 6-4, 6-0, 6-1. Matheson and Mclver won their semi-finals match hy dcfcat- ing Slager and Regan, 6-1, 6-2, 6-O. In the finals Mclvcr and Matheson won from Blake and Vllilliamson, 4-6, 6-4, 2-6, 6-4, 7-5. It was anybody's match all the way through, as the score plainly indicates. The school tournament was just the thing ncedcd to round ofl' the rough 3 E edges in preparation for an unusually successful season. 1'- -ff V l li i it eifv lg? . ,WI il gli' WE in-it 'Qi ls, lf . 1' ' M 1, 'I liz., t. .,.,. :Ei .5 :liz 9 H53 P 'C P 5 V , Ao l K w - ,J P55 f' . N ' O oflix Q u M ,-' ,LOi:24 ' A s x, M W- - ' A 'QM' S -ff - 4' ' - is f . - . es lawf- o g5 u.xcmwsxxw-sz-gmxmnhmgmsxmzrrxl-1-:-3-1-1-55530 5 ' ggi-1 1 gf ggi. 039315311.ggg-gvz-zv. L , 'T gi , Q - 14 lr- K I - - ., , + - -L1gf'st.... ' mount K- QI lffihtigtk Q 'f.:,if:Q I, . p fy , s .tl Q36 jf ,sn Zi fi- 'Stal lv 1 34 c1925-if MX - ffdft . , m .Q f GN F q 1, N .r . 'ti-:-.. - 5 - , - if--Q .. ,, , X- . ' -- ,f - -, P ..... , . f .,, 4. Y fl , I . ', ' - ,fi --1,.:.F' 'I f-:--ac-.g-9 ,la , '-:, 5.-'N 1.9 .3 H- 1' ,.,,: ' -. . ,M ' L cs-2:-u ', - --4:1 Ext- ' I , , --1,11-i.,.,..,,.1.,,,..,.,...........,................l:...z...-...,:na....:,..-.....................,........-.wmv--m.,,mf. mm.m..m,,5..,.u5y,m,,,u, ,,,,,,,, ,,,,ni-,.q,'li,+,,,m-11,425 zz :xl1:l.i4 :mmlmihIll-Imumimua,mlnuauullulu:m,muaf.-fu-1--1---uf--my.--1-A1-1-mmm-useiivuuiu--1 - N-Agggf.-2,15 p m! -:E -r 'I ,,.u- ' '11 11 ,11 1 -I lil, 1 11111 1111 1 r- ,a- 1 fin ll -s- '1 Il 1 gg :' ax ....... ........ .... rn............x...na...x:::... .2 ..:x: .. .......n... ' ' ,gn ,lg mi-.af x ax.: :rn mama: ..z:ura.'x::.:xsu::n1. I xx xxx.. .. g fl , 1 l 14 E? 3-:E -- -:::.-11 P L:--,- ,M .-,-' A ua -3 , nz - :-- . .,,,,,m,,,, rg.-.z-.:--::::: :::.:::: ::::::::: zz: ' : :::-: -- '-:u::'- ::.. -:--: ---- : : -'sir :::::-' :: r-':':: ': : z-zz: .. ......... :iQ.L.....:,'-11:2 gf 1 7 . , . Z REVIEW of the i922 Tennis Season 4 - A f V37 ECH attempted a complete tennis schedule last year for the first time in the X history of tennis at the school. Matches were played with Camp Benning and 67 North Carolina, teams represented Tech in the Georgia State and Southern -i ff' tournaments, and there was also the annual school tournament. The team, f composed of Blake, Williamson, Mclver, and Matheson, won every one of these 'L A 'A meets except the one with North Carolina, conceded one of the best teams in the country. ,. Practice began about the middle of March on the East Lake courts at the East Lake Country Club. Due to afternoon classes and the time required to ride to the club, the men were never able to get in the very best of condition. Dspite thesehandicaps, however, a very creditable team was formed, as the results given below will indicate. TECH, 5--CAMP BENNING, 1 U Tech met Camp Benning in Atlanta on April 15th, and had little trouble in defeating D them. Blake came back after losing his first set to Switzer, and won, 2-6, 6-0, 6-2. William- z, son won handily from Vilhittamore, 6-2, 6-4, as did Mclver from Perwein, 6-3, 4-6, 6-4. , Matheson was defeated by Gordon, 7-5, 6-3. Tech took both of the doubles matches when ' Blake and Xllilliamson defeated Switzer and 'Whittamore, 6-2, 6-15 and Matheson and Mclver Q 32 won their match over Perwein and Gordon, 4-6, 6-4, 6-3. ' o' f m , TECH, 4-CAMP BENNING, 3 I L F, v 1 nu- l wma? 31 lllI.,l, 1 1 1355 I 1 un l TTI! E51 I . a K 1 The following week the team journeyed down to Columbus to play the soldiers a return match. It required an extra doubles match to decide the winner this time, but Tech managed to win out after falling behind. Blake again won his match from Switzer, 6-4, 6-4, while Mclver was downingiPerwein for the second time, 6-2, 6-4. Williamson and Matheson were ,defeated in their singles match, the former by a 6-2, 6-4 score, and the latter by a 4-6, 6-3, 6-0. VVilliamson and Blake also lost their doubles match, 6-4, 6-4, but Matheson and Mclver Won theirs in a strenuous match, 13-11, 5-7, and 6-3, which evened up the count. In the play-off Blake and Vlfilliamson got revenge over Switzer and VVhittamore when they defeated them, 3-6, 6-4, 6-1. , ' NORTH CAROLINA, 5-TECH, 1 North Carolina proved to be a little too large a dose for the Yellow Jackets. Tech, how- ever, put up a better fight than the score indicates. Blake, Tech's number one, defeated T. Coxe, 6-8, 6-2 and 9-7. VVilliamson lost to W. Coxe, 6-2, 8-6. Mclver had a very close match with R. A. Johnston fformerly of Techj. It took the North Carolinian three hard sets to win, but he finally emerged victor, 8-10, 9-7, 7-5. 'Matheson lost to Bruton, 6-4, 6-3. -North Carolina then won both doubles matches in the afternoon. ' GEORGIA STATE TOURNAMENT This meet was arranged in conjunction with the annual state track meet held every Vear at Fmory. Simpson of Emory, defeated Blal'e of Tech in the finals 9-7 4-6, 6-2 6-0, after Blake had won from Gordy of Oglethorpe in straight sets Williamson and Mclw er upheld Tech when they defeated Silver and Kauffman of Emory in the finals, 6-4, 6-4, 6-4, after they had defeated the Oglethorpe entries. 1 SOUTHERN TOURNAMENT Techs team, composed of Blake and VVilliamson, walked away wi ith the Southern cham- pionship in both singles and doubles from an excellent field of men. Blake won the finals from the Tulane entry and Williamson and Blake won the doubles from the Geoigia team. As a result of their fine work these two men were awarded cups and T s bc Q ' '0 N 'Hiili 0 ' .51 0'-. W' 1 v 0:4 'S 1 1 0, 1 . 2' 1 2 xo 4 P4 1 ,nb 1?-11 12.35 ffm 1 1 I lllll tw 4' . 1 2- 322 N 1 1 -: 1 :S 45 Yi sl Q . . Q -4 Y 9 Y X 9 9 9 s 3 R , 'Q , 5 ' , , l , ' , , . I i 1 c :S ' 5 Q ' S - y cs an 1 C c . Q 3 Ri N I 4 Q Q, . ...X 5. 0 x ' , Q ' . c, E 1 f- 2 ' . 4 1 Q .1 033' -, - . 1591 as . .... 1 0 ...mf N l it y . . - 11- 1 LA - . s .- - fix 1 1- do 'H' ' 3 g 4 fi F91 6 p 1 'XYQbAXX51RXY2hQbK XX'K A WX ' ' ' 1 L X 'Vx .. . .- .. .., -A ' QI lil' pl ' fe mm., - - - 5 , 1 L EL K fl W K ' 49 iii? D LLVY4 x , I , , . 0' J .'4L.g,-:zinc o f ,,,..................-.-1- UQ! 4? rg q il .. w. , , .1 -N 1 'I -1 l:J YN ix -1 uf -A H 47-,, k , - .X S, 5-1 ,fu , 1 . -,Q Y 1-, h 1 . f l. QL ',, Ml ' 1 ..- X gggggfngggggggaxsniggg5551111smmswssumwuuw so-mmwL+aa-uw-c5952-Q--W-7.Z.f6........ .-..........V. ..::,1?l, A,.:.... A .. Q6 1 A ., ,. . - ...-. .. ... . ,,,,, -A ...... - -I ,,,,,,,. - FEMIXILHEZ .... ' --'-- . - .,., -A-N -N---A----, A---A ---- ww- - ..-. .....- . , ... . . .-, .. - ' V 1' g .. 'MW V l if I f ytk 2 9 msg f , 31' 3 2 3 iii? Q Q ' l Vis Z 5 ss, f 523' f V -1' Q F:: . ? Sf. . 7 a E 6 5 '- Z . 1 Z 'Sf , Q 2 ,iz X f P5 ' 5 i ,- ,ff w f r fill. f -IZZAL. 5 ' mu Z 1 raw :df I f-:.:. ' 1: i , L ,5L Ll -. ' E ' rm r ' .SWL Q1 . 'uL.At JN wi FM dlllf, ru -. Hi r 1 1. 1 1 A N f 1 .3 'fg ff. mi S 1923 S ' ' T . I W1I'I'1IT111'1g earn 1 71,1 W XT. QI C. NV. SAUSSY . . . Vnlrlnin 1 E. S. l5IYI.l,0CK . . .1l!17lfl'fll'l' if l3' N' lgzi MEBIBEIQS 'Suzi ya. JXIIBISTIIOXG, J. R. Rmuznrs. I,. Bl'I.l.ocK, E. S. Rocxwmm, R. B. - w v -1 ,JZ 1' , Q CL11-'ToN, M. XX. Rosslin. Cv. P. -sig lccms, J, W. SM-M, C. W 'i E Fmzmlzn, J. Trnxnn. C. -T UQZNQ XIAYIQRI J, XY.xI.TlIAI.l. If. C. E Yi S 1 RAINH, .T. S. 4535: ' ' 'z HQ m! .f 'j'-im , W, 1 N , EAA .... A - ' . Eiihfxif? .71 K Q w 5 o2Ep.xxw:-:fzzm,2zmxxxmw-5:-mQw. w13931gggEp,g,3.5Hopulhsgo' R tx Si: Vi 7 ..g..:.g.:.5!.:.:-g.:.g- c1153-1-:':g: ' Lic N I1 L rs I ' Af - l I 1 ' ' Y X 'Xi.2p ::-1'-1 QQ X4s.e: A ,fe ff: Xxx .X plhivgk, -QQ:,X,f:': I, Ti, ,X ,N f, .K . :N Agff 1' .x 'guy ,, ,4 7 x 23311550 fx wifi A6mi ff-Pfixixif 4,4 '1,g.,.5f.-.q,:::iw'5 dir! - F-, -,gk ,H .ElVl4':Qg,j!,?,ff5a-XA? l 3, f'-1 ':'-Q 5-1 ,117 . V., W. ,.,,, 1 -' ' 1' fx. I 1 1 -A IL I ' I -s AFR fi. , v .1 .1 ' . b , -4 In M . 1-,N.-- - . v -W , 1 --.. ,Ili H XT- V7 M- Mi ij ww F 7 :Ti I I' I1 : I ' I I 1 l X W x I ' 3 1 : H .' Q TN '..f -x , ' ,A 4414 +P..---' .QQ 15.4 'v ...W .L .fx-,L gx ,- -TJRELLH -M Ju. .- .. -.. , , ,, W Avmf wa- Y slk- -My----A ---VwVV -vw Yu' Am.-A -Vwrhrw-M K V W Y V-M Mn- H cw V1 6 sg 'Z 6 6 Z 5 ? Z Z f 3 Z X Z Z f ? Z 9 9 Z f 'Z-I W 'A---gs A- xx 5 IJ . . 15 , R Q 5,31 Qfg' f .L UI J , ax 'I .g'1 ye, I i .'4:1' A J ' 1 ig, 1 'lin DT X 3,51 . 4 I K . - ' E , 1 -K ,l X mi' , U 1 : 311 ' 2 sz 1'iPf5? , f' X-1 7 Qf 7 Z I Q f' I f f ff , si - 7i, ff f N R-5 x,4 X1 ff X 1 5 ? X P4 RQ f w'fLL9f' SZ 1 fg ' XX X X + Wxyz fi-L fi ii 5 QQ fLa5awmmm+E2gff W dA hww vp - F F YA .f--f---'-'17 -- ---ii 9 - -xx ' '.- 'I I 7 C-3:':..::: .... 11.33-... T Zi '7' ' --V -V-1-if--li3f1w,1 .P-5 522 Eff Y 1 fl-gig? - A l 3 T45 A A 4 fiiga L IJONEL K gf C :,. - 4-Ll ,v f---rw y sly, ,..3,,,. , f,- N., , -f- - .Y X V. ..x - , 1 x,-its . Q tl , m 01 X f 4 X iw M Y. tr x ' 1 X ' X ' I X J I ' ' 115 ' M 4 , if . AMX ' ff. 1 'C , f - A f , X ' - X ,gf ' was .1 fl ,f sn, s iii me:5i:::1:::nawaslammu:milIiiiinIi1iaivLmv1mn:nmmssuas:xu.smm.fu...-....ufi--.,.4mm--,--1-,--f-,Rma-noeunum---umm:-umor-1:-r.-Afn..-M4.1--1-.-4..-m-mmm-...nu..H...,..1,..........,........-----W....-.,.....-mmm-mumin lmumnuigumn Hz, 15' ' M Eames: : ...::. -, , 1 m,..L....1,g mf- --41 :Y yli H: flax ,Ii ,I 5, 5, xi'i!l,, 'xiii Ish, .5 gl,,,'ei,,,,,,5, ,, ' ,,, ,,,..,..gm.m,,...,.g,,,,,,,,,, , , ,,,, H, ,, n... . I -5. ga ::::..:::.::. :..............a::u..1............ ........ . .z ' ....' z . ' .. ' P' V 1 V 4 ,x w I N . 4 'Q I 'Q 0. Vo o . - , , c so ,. , , , , 5ii z5iii5 i.., , .. -. .. .... Q v , L f A '-mln-f V A V of S cl C 'l gig tu ent Ounci f a' SENIOR MEMBERS , D. 'I. BARRON ALBERT STATON J. J. RICDONOUGH OSCAR DAVIS JOHN BICINTYRE T JUNIOR MEMBERS l l T. M. MURP1-1135: W. D. HARTFORD K. G. NIATHESON, JR. O JOHN STATON SOPHOMORE MEMBERS XVALTER GODWIN ' FRED SAUNDERS EX-OFFICIO MEMBERS XNALTER MITCHELL . .... , ........... President Senior Class JOHN BARRETT . . . . .' ....... P1'esidentPan-Hellenic Oouincfil PAUL IJYDIAN ........... X ..... P1'esicZe'nt Y. DI. C. A. Cabinet CI-IARLIE PEARSON . ............. . ...... Editor Teclmwique Z. At the instigation of the Anak Society, the Student Council was nominated, elected, and 5 accepted by the Faculty for duties embodying all of the constitution of the former Honor Z Court, and, in addition, everything in connection with any activity of the campus. It was 2 understood that they were to have full powers of trial and judgment in a case of any infrac- tion of the school regulations regarding honor or conduct. They were also to act as an Q 5 3 official body through which the student could appeall in cases of dispute with the Faculty. The Faculty retains the power, however, of finally deciding any question in dispute. This organization is a distinct step-forward on our campus, and no doubt will be produc- tive of much good in the future. Its greatest 'advantage over the old system lies iu the fact that the Faculty now has the opportunityof easily examining a question from the students' viewpoint. It is no small honor to serwe on the Council and the men who 'ue members 1iCh15 deserve . the honor having proven the worth of their judgment many times dllllIl5 the sefus they hawe been with us. . MQ 4- ------ - --- 4.... . V , - nm. ..s. ' V- W- YY WW W H K ' If EQO ' ' if f J' C ' A HWMW - - f 5 N xmXxmxvmzmmxxwxxxxwxX . - J A , N . .. ., ' is O- H Q xulilllix - ' J if - 'R B ' 1 Q ,MM O Nets! f EZ Q7 i r 9 F. 9 5 I L !,f I. I L E 225 55.11 -2-4, iff 5655 'F 5 I 2 it 'N S Jcsdzdldxzff ' if 4. ,ff S C , , C c . . . , L 1 Q 3 , Q 7 ' 0 'Y L ' 1 v 5: Y Y N f O A Af O 3 w l v 09' ' w x Q92 Q - -4fq15'5hf' ' ' + Q. su,.i.. N- O IWQVE' N Tl 1 f . V . , 'W fc T x . 0 37 1 ff 'Q -v--Y ------,f,.-.--ff.-- . v-....,...Y.-. . .. ,. . A, .4 A 22 . X I 1 v .-, '.'1 -- U , ri V .41 r'3 ' :-, ,WV uf P i 'C 0 1 ? gfifkvx a H Q JQZSB: .4 .4 Et- .ff X A K -Q-2.9-.-,:j.f -, f ,Q 5, Q---,.:4, V , .222afR'asszeieF 'i'?4ii2:Lfim ',..x . .... ' - -- -M ..... . ,..-4 lr U ' , ' Za. , x ' If-.: :i2llmlA mln... -.... nn.. .JIS . - - ' ' - --- D 3 l lx. W ' .353 'A I ' 1-C' ' ,J 1 Z, 5 5 eil w,-I 4 ,Q A . 1 Q. , iq L Qs, ' 1f23S.i 9 b N ix 6 . F., U ' E331 f ' Qs... , 2 Cl, 4 L X 4 4 4 fx ,J , 9 v QD 'f . - 9 ,, ' ' ' if. f ' t ' Q J- E tai' f 2 95' I N: Z X- i :::' X +1 ' 5,1 6 f ' IQ! Z' 1 ' '-13 , f L ' 2 wsu K4 ' l 37:51 4 , x . , QQ.: w Z xx jg. If A x N XX 1 E: 1 ,'7fL 'X 3 ' ' - NJ, 4 ! X f- wi. qw X K FEM. II- l it P 'iii v. 5 vgqllm Lg f viz! 'K - + mmf Q3 4 as r 1 ,V ng-TQ x f W Q S Tor-N Horlmm Q HJ 1 Q wil N221 1 iii ff f l ic' I I!! 'Cd ' 1.1. K w -M, Y 1 312' f X W X ' i . l C: ? HSE? 21533 Sf :IJ ' :EQ ti if ' 55111 . 5. M . I :Em :PE pg E55 R 2' N fa 5: ff, ' , ig?-Lgjffig-gf ., ,,,,A A , .. 9g'1EiS'4? 39 73 H - u: f 'N '1-iw , K, 7 V .2 N 9gEL.,m,mmm,-mqymmq.mmgwwgxxfxxxzzwtgysmir-1-1-1+ lik 3.3-3-S X! gg:lsggvgzz-szizzgrgrg-1159 1-1-1-:f:':-: L , .- - ' X' iv fe.. 65f4?' g,g:--' R . .4 . ., , f' mom L L rc- ff!! ' 5 .,px?:Q,.,.3w J, X X492 f f B ,,,. ,. .. H 3 4' I ,,,, .. ,:.,, W .zil T H E PJ N T ,,.. ,,,,,, - ,. , , I - .. . .,...,. .... .. ..,,.. ' If 'R ff 1 . K. Q 'Q4 N N A 1 tx x y 1 I X X ' I A I 5 5 X 1 fc A Y ,N 6 xx 1 fr ,qv .- A ,Q-Qc-J r . f 1 f 4 ' N'-fm f f Q! 7 I ' N f V ff 3 4 L ul R ... ,J :mp :gum , ,wnmgg a :nu Gnlllilll miulm.izIInRmu!Iunulnununmnmm......... .mm .R in 1 fa- I I . .RI mnnnmm-ul-I -Imm un mu 'Tm mn' IH- H--lwu'1 'H ' ' '2 1 'f 115:51 5 :mu It W .nl L L, np, , -mx, --my E ul YW i't.I'3 IE Il l ' ,M I- sur R - '1 ' 'll IH M 1 ' 545' 'H Ui' : II r '-- - -. -----::. ' ... ....- iq... , . in M , , ,,,,,,,,,, ,,,- ,,,,,,,,,,,,,,,,,,,,,,, ,, , I I Il ......... .. ... ......-.. . .... ........ ... . I r ff 'T 41N R -7 I I 5 2 32 . . 25 . ILL IA mr .4 . N' I I Rim 1 A Q I I Wig, ' QB T f-'U Y of ,F A W Z FZ f Z Z V' Z 5 6 3 ' E A .' H -S 'W ? 5 Z ZF: , it J 'J I ly V W I fi. ' I ,mb I Ui! ' :Qs Hx W N. A S 4 . . X H Blue Prmt Board of Management I W. H. VAUGHAN . .................... Editor-in-Chief J ' R. E. WALKER, JR ..,. .......,...... B usiness Mcmagei' L. K. LEVY .... .... A it Editor D. D. ROBERTSON . . . .... Assistant Editor G. P. BARTLETT . . ........ Senior Editor H. R. IEOBERTS . ...... I ......... Photographic Editor W. E. BATES . ................ Assistant Business Manager 9 ' ASSOCIATE EDITORS ' ! HOLRERG C. F., JR, BROWN, N. A. POWELL, C. VV. ECI-IOLS, G. H. - S I 5 CUNLIEF, D. D. ' MOSES, -VVILLIAMI PQHILLIPS, J. M. BUSDY, T. A. S 5 A GARDEN, H. B. ' Z A ADVERTISING MANAGERS 5 5 NEIGHBORS, G. J. CARROLL, A. L. A XVILLINGIIAISI, YV. T. 5 BUSINESS STAFF BOYD, O. D. RUSH, L. K. ' RIXDISEY, C. H. ' Q MARSHALL, M. L. EDWARDS, J. F. NARMORE, P. B. 2 ' WHEARY, J. W. kg . . ART STAFF ' A 3 GARDEN, H. B. YVIIITI-'IELD J. J. ' 2 FLEETWOOD, C. G. DUNBAR, B. A - CONT1 S ,Z STATON, J. C. u7IICI,E, E. J. PIUTTON., HERBERT RAMSEY, C. H. 9 GRANATH, I. H. UNDERWOOD, VV. L. MATHESON, K. G., JR. MOORE, D. C. E 2 MARTIN, R. E. BDAIlTT.E'I'T, A. L. MATSON, R. M. CARLTON, F. E. Q f 6 :CHO , -7 v N. 1 R923 Q-R Ming, 0 ,O ,gp .fu X ' o Xb 'N I 4 t . Q - . . Ann .... A, 0 f' 9 5 . ' 2I iiEia: ..- - . ' Y A K, K K - , Y , , . 1 u ' m , ' V - D W1 og35W YM56mf'W'YfMWfW'f'-9' - MffU f 5. ' 'f T 3 f-1 M mXmxwxxxxxxxvmqxxmxxxxxxxxmmm, - ' L 3 K- I ' I f . ' G L ' ' - I ' LIONEL KA Q --mm i S- 'A l m i Q' -uiwxz D ' ' L Lv' T .- , '94 i.f7Q. S9A.. C 56951 ?a:glT11g5g1W1g'L N N ' A , .1 21 1 1 P 1',, - -1-' W I W' Z 7 'Z 3 5 f ? 1 f 3 f f Z f Z 4 Z ? f 2 2 Z Q 4 5 11 JL, 'B mv! 1 v4 149 A 1 1 13 'J1 PZ' .bg E Q5 'YI Q 15? 3 1' :fi 2? 'S J J 5 fs 1 - -fi? fl 513- 0 12- 'xx +5 'Y gN 1' 1: - -' ,111 ff ' ' A fr '9f:'f:1 wx,-4f:gl fwiiflefef 1 1 1 AA,,,,, MM,,.,,, , ,Q , ' ,, , A- f- 5:-gf---ru 1:1-Y - f W, ,.. -1 --1 VV V-V .4 4'-1 1 A V.-Q TT:-E TTU -f --Y.. V 'j 3 ji. -Q 41 -xx .,,-1.5 1 . . E 1 1 ' ' ' 1 1 1-N. I 1 1 gli 1-44 1, Q 1 1' 2,1-41 1,, 1 1 1 1 1 11 111. 11.4 NIJ Q Q L .QL D1 4. 1 --- . i.,-.,.,,' ..,.,..M1..., ... .... .... H.. ,..Y-.. ..... -,, . -, N..-,.-,..-, M.- --...- ......Y.. ......W.---- - 1 1 .EE 1 ,L- ,: ,'::: 5'5- 4'-4 Q' Wi 1 60,1 L--N Q- Q I 129' M33 'EO E,.,,'1-' V152 FW' lv1k .1 'B ,W tv '11 11 1 1 lf? 1-11'1'C 'L 1 11. 1 'I'1l1: l51.1'1: l'111N'1' S'I'.Xl'l' S1-11xs1111s ,Lp-r Il H 1 112.111 Q 11:5 'ml 5, 11111- 1 11 .1 1279 1923 S'1',x1'1f 1 1 f ' Q- - -, 1 1 1 I x K1 1 ' 1 f'S11 Mxvqv 1-'15: '1 T1 1 1 li' 1 1 :: Ii 1 1.2 1 1,1 5 113 1 1 V, , .3 1 1 fig 1 J 1 1. 11, 111: 1. 11 11.-I 1 1 1 L. 1 1 1 1 1 1 11- 11 1 .1 1. 11 '1 M. 111.11 1,1 , 1 . lib vi. -I 1' 11' 111 1. 112141, 1, 1 J 1 X1 111 W1 1 11 ,Q1 1P11i'1f 'frf' X' '11 11' lf' 1! 4 .1-1 11' Q 1 1 11 1 1 i 1 ll' 1 V 1 1. 1. , 1 1 1 1 1 1 1 1' 1 1 1' ' 1, 1 1. 1 g, 1 11 1 111 11' 11'1 11 :1f 1lL. 111 1., 11' 11 111 13-H 1 1 1 , , 1 1 vjf' 1 ,f .1 ,1 1. 1, -rf 111 I 1f1 1 Ee I E15 . ,Q 1122 1 .11 112-' 11'-5 T1 K1 .111 1' . -.1 I1 11,11 1 11.1 113-1 1.11 HJ 1433 1 b -U, ' ' PJ, '11 1. Q'-wks, mr V CW...-JffQ:1fff Sf' I ff- '-Wim '1 1 A 5 7777 W , ,HIKW-V-A , ' I ' M F ' - f'-' 1 1+'ix1.1.1-:..-1--111-1 3-'T'--:-1 1 ' 11.1111 K1 UXQAT-Q1,Q1q j1:jQ,1i:-jg-if ' ' if TTT! ,fri V ' L. ,,:-.,..11 tb ff -f xx 113 5' 1, - . 1 1.-ig LL,,iiLingt:.T:1 ,SX,Kai1 , 25:1 1: if ---- A ----1--- 2 4:4--11'?14l4g9 0g1 W -f. 1 1 -- ' 11: -1 1 1 - f va ----- 1 'ae - - -im . -1--mg, --f--1---,ff 2 V- 1 sz.: Q.. 1 l 0 I'-1.-.. I 1 1 -filgpi inlwri Za'aHKQ Eiffgi ffe fl--f': t9f,a42e2?f?ja . 2 W fl! f X 1 ' ' 'lx 1 9 2 ' V s af' ' ' Y I X 1 .Gob ' xx ' 2 .4 ., ,i-...,,,Ns ff. 'Q f if f , .Q A K ff'-' f ,lf 4 nl - gn 5' iii' 'I FII l Hifi: 15 l H II3ll11nuIFNlillillilllilhllflhl iiihi!1hiuiuil1'l11il3hillh.x xi s uni num 1 1 1 ru r 1 1 v in Ill 51' 44 I-I ill' MMI! lril '1' HH 'WU 45 I Ullullllllll HHH! ' ' 'un ' 'nun nu' J duiwg' 1 '2-7' 5 4 as ll' ' if ' WNW V P I 'mi' wp ii I M F :i:, l . N :E iii::. ' l -F-2' ssigzei. l nlilll RU, '.-2:4 :E5. :E:. ss- l ....... . ....... . ..... .. ..... ........ .... ....... .. ... . . . .... ..i.... ... . . . . ..::.:m:,, mmm' Jfgzmm -5- ,.,,,,E higlkig giiiliiiil'.....---nn... ..iilllillliiiilii355535315iiiiiirniiiiiiiiiiliiilliiiiiiliiiiiiili IIHIIIHIiliiiillllllllliilllllii3335551135Il-nnuhilnnn-nnglulllunulnlnuu -munlnuufinmlulnlnu ll:unllnIE:unH3lnnnnuu:l1lm-uiugaillnvrunuc 1 .. .-V K gf, O s A V W f 1 f 1 . 1 ,. . 9 fo I . . V' Z 1. l 4 H 1 4 2 Q' 2 4 2 , 5 9 3 o 4' z . I C S3 , 'Z I , , . O . 3' . 'V P .4 S . 55 ' , W I W 1 P Pj 1 7,1 E5 EB as E? ig EQ' V 6-JQJ 1 . , it 111:13 1 J my V 1 . i 1 -y 1-1' f h T h ' lstory o t e ec mque Vg c'Fl l fji ' vii ,- Jv c Prior to 1912 there was no well organized newspaper of any kind at Georgia Tech. There Ili 4 had been a publication in the first few years of the school's existence, but .it was short-lived, 1 A5 ' and we know very little of it today. In later years students managed the publication of the lf' 3- Yellow Jacket, which appeared as a periodical for a short time. Efforts on the part of the . student body to perpetuate this paper were, sporadic and ineiective. The need for a news- X paper was realised, but the organization was lacking. ' . .5 In the spring of 1912 Gene Turner began the publication of a weekly paper known as X 5 the Technique, having gained the support of enough students and sufficient backing fromid u S ,Z the school authorities to enable him to put out a few issues that year. However, it was too Z late in the school year to accomplish very much, but he returned to school the following year y Q 5 fired with the ambition to keep this paper going on a business-like basis. During the follow- .Q ing year the paper was printed successfully, with Turner as Editor, and subscription was E made compulsory to the students, the subscription price being made a part of their fees. T Each year after this has 'seen great improvement in the style and business management . of the Technique, until it has come to us in 'its present form, f'The South's Livest College ' VVeekly in point of news, and an independent organization from a business standpoint. 1 5 The ideal of the editors is and has ever been to keep the student body fullY informed of all S l happenings on the campus and to promote and encourage all measures tending toward the S Q 3 betterment of the school as a whole and the students individually. ' 1 5 S l Fx +6 X V in of O 1' ' O xt ' - 4 . at o ' 1 H K , -1 .. 1 0 ff azz! vf Q, 'Wx 4- lhiiaegi , W 1 K kim , Ogmr ? f lr X 1 t ' l l L -3A V 1 1 4, K T X l K 0 --l.- - W gs, H -r .,,,,i: 0 l - 113 , f' fl l Tn ? 54 f1g..ivyj'f ' 1 0 K'Y58W3?w9fi5fAVffMW 1 fVf0W'H:i3Q -P H A ' 6 sswaxxawcmmsxxysgwxxxsxxsxxgvmxxxxxxxxxmxxy.. f' A 554 ' - - -- ' ' E7 ' . , L O N E L . S gllllllll, O Iii!! L YV, -f. - YY, z y O X Gas? ..f-ef f E925 l 1 ' .fn ,K , , P 1 . .N lf J. A ' . '17 'nik ' 15- ,M N-9-1-:Q ,. . - 2, v x ,fguf ,V ,bf . M,-gwgmgmummu at .:-.. ummm ... . fe-.mme-t W. , ,.. .. ..ir4,.,.-.--...-.. fs ,-E935-H ' K - -f fi'N: H , V 8 vrrrr ,hr KAL-,JV Md 'b e W. ..,f.3x QNX 'Q .f4 'i ' f . Q. . ,. im lm55:.:un . I W ' M M ,, . .,,.: ...Y A 4 '- ?fllQigEii : S I - - --N:. 1 l 5 I L , - 1 ,1 1 Q 94.40. --H --4 f- gm 1 2 , E The Techmque Staff I g THE SOUTH'S LIVEST COLLEGE WEEKLY f gl Georgia School of Technology Atlanta, Ga. Published Every Friday by the Students under the Supervision of the Student Council. 16 CHARLES PEARSON, JR. .........,..................,..........,..........,,.,,,,,.....,.....,.......l...........,.l,,....,...., ,,,.....,,,, R dit1.r-an-chief 4 4 C A Managxim: Editors PHIPPS, D. D. ROBERTSON ............,........,,,,,,,,....................... ........,,,.........,...,... ECHOLS. G. P. BARTLETT ....,,.,,,,..... Associate Editors A MATHESON, JR., A. L. CARROL, McCLELLAN ..............,... Y. M. C. A. G. H. Editor Editor Editor A W. H. MAHONE .,,......,.......... Night School Editor R. M. MATSON HERBERT HUTTON K F. G R. O. WILHELMI ..... ........ E xchange . H. STATON ......... .,.. ,...... . A lumni Editor L. G. PITTS ...,,..... ,.,... . Society Editor H. GRANATH ...... . P. JOHNSON ...... L. K. PATTON f 5 R. 6 I. ,..,,..........,..,.... .. Staff Poet C BULLOCK . ............. ........,,...,., C o-op E. S. Local Editor JOHN STATON ' A Assistant L. K- LEVY ...........................................,.... Art Editor . HORAN .,........... . ......,................. .. Gates, L. M. Turner. C. J. 'White. C. H. Ramsey. , J. W. Wheary, C. F. Hollberxz. ll. l.. l-lllerlmv. STAFF REPORTERS--C. W. Virgin, D. B. Howe. L. E. F. J. Dodd, W. C. Stevens, D. J. Kirchik, G. A. Chandler T. Q. Winkler, L. W. Halsall, A. L. Bartlett. I.. M. Blakey. H. ll. Brown X Z Z Z Q TYPISTS ........................................................,.................. ......................,......... Z ............ if 1' A BUSINESS DEPARTMI-:NT Assistant 2 gf' HUGH R. ROBERTS ..... .......... B usiness Manaxrer J. M. SUTTON ................. . .. .SQJ .... M L Assn-tant A . BROWN Padirett, Jr. W. W. RICHARDSON ........ Advertising: Manaxrer N. STAFF: I. L. Prisant, H. G. Miller, L. D. Cole, B. R. Badenhoop. E. L. BURKE .......................... Circulation Manager A. 'AA , E. Smith. C. M. Colon. A. G. lill EH 1 STEI L .,.....,..........., ,....... . ................ Asmstant W.: 1 STAFF-C. H. Ramsey, G. S. McKee, J. T. w8tlCl'24. O. Whyte, H. M. North, W. C. Brown. W. G. Meriwether. Spitler, H. A. Moore, C. E. Heath, W. Goldsmith. Jr.. J. G. Boyd. E. K. Banner. H. G. Reid. C. li. Jr.. W. F. Daniel. C. B. Sumincrs. S. V. H- H. Myers. Oliver Sale. T. I.. Kennedy. Jr. R. C. DeSAUSSURE .................... Clerical Manaxzcr E. ' hr! llll 1 i I li :Nga N. CAMPBl'Il,l. ........,......... ...,.......,...,... A seistant Glim- ,gufl ill' Y l ' 11 . un' f- ql l 1 3 X VN 3 1 1 -T51 Y E? 1 lf: -2 RZ :4 4 547 ,off -5-1 V. S .Q if xl, fx ii as '- ' .-' - 'L .. L :- x 1: '. 752 , ' C5 1'a .l LY e. 'It' :K fl Cixi, J r J X li 1 Q? ,fc'2?Qk:1'l Y ir Y Q Y ' l 1 ,H A I X XX xi-liixwxxi---i'x-:: 'E1g fa , 1-,L -: 'F ., 'iiig -- YT' ' QAA- i Y, .X er., H , ' ' LlO2HiL K if V X NPS:-..I.1-' 'l -tx ' ..i...5:: 7,5 J ' '1 iillsg. 1 I L. rl I-Q 1 A10 122-1 1 uf-'I 1 .Q , EEE! ' Iii? l 31 122: 1 2133. 2 1 1 tn- in V2.1 1 tx' V.- .'.' L , . N I ,, . 1 ii: 1 . 1 1:- l 1'-3 1 1 1-K l 1 1 : l l : I i rf' 11 l l-ji 1 1 5'- 1 1 1 , 'W 1, 1 itil! X. C' X531 ll Q11 1 -kiwi with :mtl gil 21 :gif 'Taffy l x'l ..... Q ---l 4551 3413111-R ll 'Srl 11 ! 2211 ,,1 in 1 A I 1,1 1,. ,. ,. 1t. ti 1 1 511 lill ifk 121 11:1 ,Lil J! ' Al: . ,l l il' ,. .31 ijl L41 1 I 3 .1 '1 ,. 125 '14 1 'Z 1 . 1 , ,. 1 E .3 1 1 'J Sal rj :, f 5:2 513.1 1111 l3:5EI H411 .511 C4 W .1 l 1l 'l 11211 W J iii .. , . fs. Y ' ' Wnstix- 1 X ' fi' F-' P -L, nl' :I fl A 'J' - l ' A 4, 'A 4 - - . ..1f '...,,.-1.-...-mmmmml.fmin.u1-1FG----57:5J.-3-----4-1-nn-unmliiv-nnnarln -m,.......1i. wg 3555555353111ailmuim555iiii:::zmannnlullnilniiuiiannaamnnunauisaaiuiuaiuuiuiim.:im-i.Z.fu LIMS--....mm-ref,.-.-.imma.u mum-.im...munuw ., ... . MH. , H-91 I: Eggr' -ri-IIE: ,uQEE5E:::.qmg v v'N wg .5 . lt . 1. fi .limi if D V E, P R. N 5 fa. ... ....... ....... . . .... .... 1- ----: ..:::II:1::::::.'::::::::::l:::::: :2::I:ziiimmaans:x::::::::::::::u::....::::::::l::1::::::!::3l::::::::::::::'.:::x:::::::::::. .-........- -.........i sm Lit 5:5311 its-sian.. ....... mg.. .... a:::::::x: ::':--:::::::::::::::::::::a :5:::.:....... ...... ..........:......-- - ------ . ' 4' 1 4 ' Z V 3 16 4 2 4 , 5 1 r .rr T i so as i '-un. ' Qc- .Sui ' ' Hi O ,Q I k if J? 131--P' S 5 f 1 4 1 E ,. f l o: ' ' 5 23: V at Nl' L J --El Z.. l l LFS 'PTS . rv 11' 1 ,v ig y W9 lui' i 'Ulu I 1 -'fvfg I '21 Elm I 5:3 5 . 1 ll i In . ! The Yellow Jacket ' Inythe fall of 1920 the firstiedition of,a humorous monthly publication x . s accomplished. It met with only limited success. The promised second number never materialized, but the . y student bodyawas informed that the following fall would see the edition of a new comic i Q1 1 1 publication to be known as The Yellow Jacketn. ' ' iq Late in the fall of 1921 the first number of The Yellow Jacketll made its appearance on gs Z the campus and met with great' success, considering the fact that the staff had little support 1 N 2 from the student body at the start of the school year. The first staff deserves a great deal of X 5 credit for its work during those trying times. L 1 S 1 5 Starting Work this year with renewed confidence, the staff has produced a paper that A is making a name for itself among college humorous sheets. Its circulation atthe present Q5 T time is over two thousand ,copies permonth. This phenorrnenal growth is only more remarkable 21,1 when one takes into consideration the fact that the magazine is only two years old. 1 The members of the staff have worked unceasingly, and the fact that their work has been' T crowned with success is its own reward. The versatility of Techls huniorists is the joy of the if entire student body. Attention has been drawn to the Art work, which is, with other feat- i ures, entirely original. The magazine is well balanced with bubbling wit, humor, drawings. and illustrations full of life in all its movements of joy and sorrow known to the college man. Y 2 X 0 ck ffif l Q ' ' at , ., N N boo-gf ' , ,NE K EIA .5 Eg QI EA P -nw .... . .. .0 ' O -, A 3 1 ' -0 'lzlilll uuf' ' ' ' YW, ,Y . fi A 1' Q O2E' mmfmv1mmmms2fmmammmwwmA me 3 G 'XRQQGNgXWh QtYbbtXXXXXX5gKx YKXXXS,XXXKXXX Q21 V Lion V 0 H: ll W ' K xi-n -- 1 li U O K T 2 q '44X 'I f I o 0 fx X85 C-I 'S Q .4, v . , 1 1 1 I fl . ',',. ' ' - ' , ' . . - ' anImamemmxmlsasRRi2Elf5Qii..sm.nI..giiE'Ef:i-ffm: ----'-- -.-- ,::,- 4 V .. f 'I L Q ---- . . 'fr' S 42 ' V H M l l 5,,.xng,g5pMmlnnm1mI . .1 .,.... ,.,f 4: 4 ,... ,f..4-,-vm-.,,m-a---.1-.rw-1, ....... gun.. . -H -Aw--wi ,HW-h , md.: H :.. -.-1 . ,,. '21 3... F' Ai .WW .FQ I I I E, D IJ ' A 3 ,H ' . ......, :: ---- azasr' ' - mv-'-:s:::::::x:::::' -...:m'--- JQEI'-H : - 'Q?:m.u,.--. 1 . . ' A! flrqsx Y' E9 3 1 xiii ' Nigga! V THE YELLOVV JACKET STAFF . Ivmc HENRY GRANATI'I .............. I,-d. . . , , W. A. EDVVARDS, JR. . . ..... , , ' ' ' ' ' ' ' ,' T 'w U cf Riiyj V PROF. J. E. BlCDANIEL . . ..... ' ' ' ' ' ' ' ' IJ 'ylf f','gfj' .lim . . . . . . . , ,,, -- .- sl' 'frflf EDITORIAL STAFF J 5 T. M. MCCARREI, ..... ............., - uaumi 11.1.1 h gig 5 H HARRY L. IELLEREE . ..... ' ' ' A -'I ng 1'f 0' 'Kim 4 X N A BROWW ----- -... ......... . f ISSIs'fllllf luflllur ll.li:g!. 's ' ' + C. P. J 3 'ME A B. GILL y' P- ITIQITJX C. F. HOI.I.BEIlG Ton MQCRRA Hiif' Y 0.5: A- ART STAFF V A CEIOEEIFK. Llzvy , ,... . . ........ ........., , Aj ,., Hdjml. . . . LEETWOOQIQ -if ...... ....... . . i 1 4 d.IA.Ni5.luIll XII., lgllifur ' 5 . , I Y- V- HEERY, JR- lisnmxn XV.xl.'1'n.xl.I. E222 3 IOM HORAN ' I . XY. XYm.r.s Effi' 65 T' M- HUTCHINSON J. J. XYlII'l'I IlfIl7 5 51551 Q F. VV. NIANNING ff, ADVI'Ili'1'ISING S'1'.'XFF E. N., CAMPISELI. . . ................... . fll'I'I'li.x'ill.I1 Jllllllllllfl' ' WV- B07-'UTTH --A-- . .'l.s'.s'f.vllllll ff IlI'f'l'lf.vi1lq Jlniuzqrr 1 3 W. -W. RICIIAIIDSON . .... . .'I.v.s-1'sl1111l .'IfI1'Wl'ff.S'fIl!1 JIGIIUJIPI' 1 , Z J. I-I. Bnowx ,In xy, Ivmq-Y ' Q I T.. A. IJAVVKINS XV, Ax. ROSE L? J,xxfw Km.1.r:x' J, Ii, SMITH 1351! i w. H. C. PARROTT P.u'l. XVll.l.I.XMS mm CIRCl'I,.'X'l'ION STAFF lb.-'J Qum, J. O. S'1'AKEI.Y . . . i ........................ f'il'f'HlIlfilIll .U flllllflfl' EES ' I J. F. Emmucns K. R. S.u,vx:n QL M1 O. :FLOXVEIIS XV. C. Swzvrzxs '. K. B. HIGGINS IQ 'El 'L ii QQ W- T.. M. Bnlurm' ....... .Vlrifff 7'upi.vl trim ' J P. H. Fmms . . , , , 'I'y,fi.vl kg, EEE, fig? X- ,K :aim ,554 igiijf - 1 4-N. Miix ' 4 Nfvfui Q5 Ji I 'Q S jfs' 5 R .-4 Q fha!! wg F13 1 GSM E ' ff! 1 X- Ejff ,4 I 1 ,H I EW '-:Fl .. H523 V521 R fd iv 'bij . is 135 32 J sgif . wg- 1 E figigjf E .full 3'-' . V I ff 3 4 12 . g. 2 . . J . ......,. - 77 . R42 R A WN N951 --1 Fwigfxivcox ...,..... . . ,. f f R W xw ?LY.AN lc, b XIX 5 Mi' 5- kgjw' .1-533153542-g- '- 'milfl.g,l'.'-'-l1L.gi1'Q'f'Qf'f':':'l' t'::L1,1':-Z-: L .. . N. Q-H ' nw A 'Fm' F F' ii J Q -uv. . ' vi 11 - f ,Y V ' f .,-- ' ' f.-LAL Q.-'SXT' P 1- LION ng, R R 'i fxofxjignfyfg' ' U xQB.8t5f ,xfgf A :ix if,-WW' 'liivml ww FN -wee r r bs' 'J 1 x Q 2 K '41, ,ff vw , .X ,M sfciifff il , Qfff'fia 3Q.ff .iff w 4 5 1 ,,,,, , ,i,,' fm-W-f,--,, ,, , , .,, l ,K y,Hm?5 4 W ffm if fx f --FLW . YV? I 3 V -A , , -V ,,1- 'I . .61 - ,. N 5, 1:11 W RFQ 1 gg, M L W lg ign. J 2,31 1 4 U ,, ly A , f l A gi g 1 1 j A g g , W. ., . ,L-FEE-Emumwjq-13:53m, y 3 ,633 43 ,, , Lngw, H 1 X2 ffl: I' QI! fav YS ' 73+ 1324 . .... A Mp 1 2 mgflj I yn 5? r , ,dj fi P 4:11 H1211 X Vw! 3 -I , VQIP F3 W Wi vi 5V .gg V4 Z1 1 W Hyl 4 1 ' v ful ' ZW A W VMI Ffa e WI ,' in F7 3' gg wg gl M555 ?wl,?' i5 1 .2 M915 ' lwww Qi i WEN! fl My k , pw ,I v 1 TZ- W fE Wg Q jp? I FW ' XQKOA ? 1 Y 132,41 ' EEN 1 H EE! ' 'an' N' 1 ' 2 15? I , 'W W + D-NVQ I N 2 L will dw. 2 'W'- V ' E m ff K.. Q 3 1 QQ , S ' ' M4 H ' 5 5 S! Y 53 ' E if Q ! Sf E HSI :JN 1143! 9 W g ,255 i' 6 W' W3 f ? N 2 2 - S 71 il h 1 'N 2 S Q 1 M-fx wig' W,if-----w---u-w-u.....,-.mW.-.mWM.m,.W.O,f-H1g1gguI fbiffjw 'wflgmgmx QQ 54552 fWf3TzZ7 ZfP mW'f'7W , fffv:f'f:zvffTFrf1r:2AfQ5?:l5SQXX i 1' , X I f' ?Efif3'fl?r1l-b.h. - X Q 'Tig A ' 1' 'f Q1'f :f,i11'1QUN,X0311335119:gfWf1mgs f.-ir:gyL f k--I---WW - Wx Ei,-,IL il f m X' U L K :L 1 , 4 . Q: . L W1 ilf 55 , 5, A4 si Jr' aol ETQRGQ IRKUPZ My , 1 V ., 'Sl i ff fx'-fx gf-. A 'N 19 25 V , f F I V I W P .ffm ,Q Apgzf i ,M gi 'Xzwf ,qfgfcgn N . ,A 5, gill!!! ,.-..,.....-. .-...-,,.-,-1 ,.--,.1.., , . ......: ...:.- , , .,, .. , ..... .i.::.. ,.., ,Eg 4.3352 T H E, 15 LV E P ILI Fzii ij ----. 1 -'W'----Q----b--f--------f A .. 1 ,..-., ,,,, , .- ,,,, ,.- , ,,,. -, , ,W W , Lag, 1 ffiksy 1 QR 1 V V hifi ,Q IQ. A , X :iii 1' fE1E1 f g N I w ' f ESQ f g i I-e 5:1 .Q .J .,. , k .gl .I l 4 A n -1 ...Q 'fr .W A ' , , , , i 1Eif5:??5551 'iff 'Q ' .anzaxvmwmpzwzfffzgmpfagfzzrrs::- f - 1-1-1441-:wang-:44sf:f,:4-zzyvmf,-z-f,sf A Ah:-gtgfglfgwg i C imw-mxxm-.NQmaxmasm w xQmqkm O 2 5 5 7 I ' 5 Z? ,. 3 : If D A Q. 59 Cb T1 Q1 15 x -l hi . N ,4 G rj -5 O 7: F' V ,- + fl '4 Cl V I .. ' ::f'f5: eiwiw :JS 5 2 'ff' P Z V 4 F' I O 9- F EI : 'ff eo- ,l,1 5 pg 1 F : 2 Z .- -1 . M . Z r' H 5 5 H -f 53 2 E 5' 7 -, Z' 51 : . :Q ' U tr: .-. y A f 'A 7' L' 'F' H : J E ' ' Q 4 rx 4 3 Q E lj :s F, 7: E n 'aj Cn 4 L :1 -E 51' A c' Z z 5 P O ' Q' .A -, 7-7 . y :J 121 O y ' '4 1' P1 -4 -ff 3 7 -1 5 Eff V . : P .U :j F: ' ' L 'C y rd Q Z F: E gi v-4 ' 5 L4 4 ' P 1 -. .L 3' U3 r' . Er , :J P -4 : -1 F Q : - p 2' . ff ' 5 2 : S 7 :-' 5 E . z S ,.. 3 f : 3- E L F 1 A 'CI qi : C 11' 5,3 :-' F' E3 : rv 5 M . J 9 3 A Z P O p-A Q - W . , 4 y E A S J 'em - ' .- ,.: ::A 2 ' Q '1 , ?f,,,,5?5'fx gg 3 S Q: U ,fgfvwi-,fig U - Z U3 L1 fb X27-ff ' nqfbxx'-Q YQ, C Z 1f?JZ,f--yd Afffx ' C' fn'- --5' ffm- , 4 I F-' H I' 7 ' fm. .2 .Hem Q to -2 ' P Q1 ',5',.f,w, 1 jrywf no N fy H -1 X xxrffafr 1,17 ,F on tv .4 1r. ', inf 'M' 3511 :Q ,.,. f,'Jja', 'TJ' 7519! 0 .... A A 0 px 01.14 K I -1 ff' 'U ix ' :'f:1' 1 f-1 '71 f X 'fy . -1 CD X.. f'O'r-fi . f n-4 1-4 Pi FJ mflff -'Uzil :vsrvfw ff? v -- 5- '...' O :vi ,., .4 Q 5 -,za 5 L A r-1 : I X' 3, W v-1 ro C ., rj -' Q 5 1 , ' P: '1 G 5:54 5225 zzivzf 25: Q -5 E. -X' Q' I3 2,1 5,13 J O 2' 3 m E , ua :J -4 - 5 . ff: Cf ... V ' u... - :5: P' U 4 II- F1 -4 'Tj 53' F1 U7 4 -1 . 121 5 P -T, r' w 4 1'-' 2 ' 1: C P G gf: w :I Q, as :a 3 b 5 Q .. '1 Z E :Ii mam? ZEZWQJ 3352 gi -1 Z -a 5' -1 P1 3 O '- -' 5 w if 5 :U 5 PU -i 4 : fu 14. U1 r-I 5 : .1131 7 -- -..' ' 9 O 5, : 4 5 - Q .. V - an 5 51 45-,bg sg-ana Q33 ' rj ag an :Q 3 5 5 2 : gg 5 5 x gg .- 1 -: P f. F13 5 H 5 P1 ? 5 A 5 W S- 2323 O :rs Z Z 5 . 5- 2 Z 3 . . : il UZ su :- - rm CL P-4 5' I3 J' Wig 2 Al ' Y .-.., wi . Q. ,,-.v ,,v,,, ,f1f?fff,:,,. ff --:NA -,,- A --Aww . U .-.-fTN, -' 7 ' ' 'f1Tf 'f 1:1 :r?'1 1f'i:., .. ' S ,iv ' QQ? 4 fu u- e-' -- . . . , N. .....a-- f - .L , LIONEL vi- X 'hl!ill1 -.f.: j. - illilf... D rzvx- ' ' ' f .zpwjj -' 1 iii.. C . i - ,,,' B ,, , f A ,.,, ,.,,L.,,, - a :H b wig H. ,,,,,- I ,,,, ,in ,,,,,,, ,mm,,,, ,,,,, mm ,,,,,,,, mu ,,,, ,, ,,,,,,,, Q ,,,,, ,,,.,.,g:.., .,,, ,,,..,. ,,.,..,,.,, ,. . ..u ufewuurn ra 1----- 1-ev U 1'-I' v' 1--1 - , M ' . 5 n. . 15 L P 11,1 it i es ..- S -... Q -mu,m,,,n,,m,,,h,:,ms:::m,',,1:g,uzm:m:,,3m:,,,,,m,,, ,xii ,H ,,:. an ,,,,,,,: ,guggmggggg ,gg..: . g ll -- -'---- r:::::::::::r.nn:a::::::::::m::mn::::m::::Ural2:2i4IISifIIl11l2i2I2IIISil1l-SHI I --- - 5- '-iff : - 'V if t ,AVN f W . . . I 5 Fl he Function of P1 Delta Epsilon if W W HE Georgia Tech Chapter of the Pi Delta Epsilon National Honorary Journal- ism Fraternity was installed in June, 1922, soon after a charter had been granted to the former Scribblers' Society. It immediately began to take an Ill 'll active part in promoting the efficiency of Tech's campus publications, and in .- Q. the following months did much good work in that way. 1 Although the co-ordination of the campus publications was a worthy object, a much 1 more vital and immediate' need for its services became apparent to the chapter. The il school has for years labored under heavy disadvantages due to lack of funds to provide for equipment and maintenance. Despite the 'obstacles which confronted her, Tech has accomp- lished work equal to that ,of the most generously endowed institutions of its kind. Apprecia- hug tion for this work has been shown by engineering firms and the corporations who hired V2 graduates, but not in a material way by the people who have been most benefited by the training of their sons. To acquaint these' people with the facts about Tech, and to enlist their support in obtaining finances for the school became one of the prime objects ofthe 6: Tech chapter of Pi Delta Epsilon. p e I , I e Since the fraternity took up the publicity work, news letters have been sent to the home Q town paper of every Tech man who has distinguished himself at school, explaining the honor T Sill and its connection with the training which he is receiving at school. Religious infiuences, p Q, V the academic work, physical training, military activities, in fact, all of the many vital phases ,QQQJU of Tech life have had their proportionate parts in the publicity broadcastediin this manner. ' The needs of the school have been mentioned in connection with the wonderful progress l which Tech has made with the inadequate equipment available, urging that the school be 4 : 51.31 enabled to continue and expand the work .which is a potential basis for industrial development fy .5 in Georgia. Tech is being put before the public in its true light, and it is waiting for their ELI mul, judgment as to whether it shall be assisted in its single-handed fight to develop Ge0rgia's 1 , industrial youth or be leftlwithout adequate support in the great undertaking for which it V 5 has so well demonstrated its fitness. 37 'lim Around this as a prime object are grouped other activities of the fraternity. XVays and ll li' Q means of bettering the publications are the subject of much instructive discourse at the weekly meetings. The proper co-ordination so as to produce in the most efficient manner a sc . combination of the publications which give publicity, the news, humor, and the history of the school is ever the goal toward which the fraternityaims. The power of the writers of the if past ages has been one of the most uplifting infiuences toward the development of the present civilization. It has been the power of a few strong men with the ability to think for A 5 22 the masses and record their thoughts in readable form which has led from darkness to the i light of the present day and is ever leading toward the radiance of the future. To so present f 5 the news of what the men of today- are doing thatlwe all may catch the spirit of an eternal 5 striving for that which is for the common good, and to so lead that each thought may be a S . stepping stone to higher things is the ideal toward which all of our journalistic endeavors E are directed. . 5 Pledged to the cause of Tech's development as far as itpis possible to carry it on S through the proper publicity, the chapter this year set out on its large but far-reaching Q task. May it, with the full co-operation of the students, alumni, and faculty, realize a com- l g plete fulfillment of the success which now promises to reward its efforts. Q is 3 , , . . Q O Q-5:52 0 2 M' K , M ,,,.,,,, , in ff fg '-72 3 , 5 . ' no V mg V 7, g S' i mwMww WmSQWVff'eW S, 2 E 3' I: gmesgwamwxxrmxxwxsmwwkxxxxxxxwxxwggo 0 'Wi-... .4 +5590 --H' -1--.V .L-...,-, .,,, ' -f ' - .v---..,...,A . -, --........4.,.....,.:..-a..,. ...N-.....,..L.,--..,...... .. ..., - XX w X AU fx fx -'L ' rv' . 'N : ' 5 ffffff' 1- 1925 :Q f x.Q X , p ,1-,X wa, ,f :ga '5'5asf'!'E,!H ' '-gxggggg' -' -.xA..1.L1.1h ,,A,,A,. , , ---U YL W' -W - LBA.,-f.. ,,,,,YY DLV PM X MX 4. Mm. fffw 1' 'X ,X J J fff xN'p ,f A X yv Ill Y J ,Q 15 V4 jyfff xg!!! 7 fl-NLL A If A 'Z 3 My Q x. 5' I Y kx K x.,,,,,xX W X'- XXJMWKFNNW 4Qu Musmcm ORCSANIZATKDNS Cv'x RNXX 15-'iff YXNK V-' ri 4lf A-:sail 'Y X N XNWW XX 'xv-X A BQ K x kk X fy 5-4' x . ,R W W X ' 'E Xff ,, +0 -I A1AQ l . Q Q , X XXXXXXXX X XXXX X Mm . 4 f f-- Q 1 5 . l ,Z X ! 5 :S Q ?Z , EEE? V 7 V Og Q X ,L 1 1 Li N 'g Q15 ffl' n. , - MET M kf , - 5' - I f . J X r ' xl X , :Z 1 y el L J , ., sg. 'Z 2 1 fy , ,J J , l u 5 7 ' N 5 I ' ' 5 SY - KJ --J ' N. ' mf 4 X , : A- A- Q. 293 7 ff :ff 1 N P' ' ia Z . 1 m Z if u :E f X S 5 7 , '. 5 1 Z if 9 2 f f +5 f r , X lj 4 I J f 6 ' 1 1 Z N I j :E 5 'x xg ff i fi X W 1 Q 1 2. w Q y I ff' ' I 3 1 X 4 Q, XXX Q x ' XX K 2 , 1223 A ' ,J ' f E JI if H4 I XT . x x r IF me-A A f A 4 yu. Xgl f XXIQX X KX . ,in IQ X X, X .XXDXX I X jX,.:,Q ga in iq R- x X - Y , 11 1 X I ,, I ,f:f.3,f 4 My f 'V X-X H 'X .4 . J - - r 4 ,ff f ., 1 ' MX V- ', ' f X t lib fy, 7' 7 , 1 gT'5l'j'I ' Wu fl ' X 43'-4' 'W-4 H--f W ,Y- l I WMXNX 'X t 3 1 l . X xijn if ,vi I 4 Mlm 'nfyx 5 X X 5 4 q, PM all 1X X XV . , GX QA, M115 ll' KX A, A j' ,ztffdk '. ',1 f X 4 N VTAIQ QQ X!!! X F XXXX, SX WX X 4 X-.X ' X f X Xf ?,,X.7'?2 H ' X f J' Q f' cfm' ffl ', T' 'ij f ' X, ., ' A 1 1 fp X Lzzrui 7, ,X 1 X ff' 5 X 'X,XX,V ., 1 X 5 I ff X , ig- n . XXXL-.71 T':':rmb 'H' 4 --,, 'Q 1. V- ff, wif i X fl A J 'V 'V 'wivf .4 ff 7- -W L -f. -, ' Q f VJN1 lv? HSM' XZ X, ' 1 XX , 1' 'X . - 7 X ' 4-Y 'fXX KVT1 XV? ,, 1 I 11 X X' X X X X fiffx-1, 'X if X, JNL- 4' ' X J X sX if HK X 5 ff ' Cv xx Q XX YNLV A NX 'f?ff Z Yzil ,13 ' , x xt 11 X iii W W .1 ' jd J X Q -' ' I si 1 335 1 iw Q . 22 , tqlf lx X ' . 4' lj HM 533 -f N A , 1' f lx -1 , f m as X X ' , I . X , T-. X X 47' 5 6 X X X XX , X X X w Q X ' Q PA C-Q1 W V 52 if ff V , , ., ,fy , ' Fx J j- XMX XX 5 I Il x K -ly . X , . 9 ., Xi 5 X Ap. Fl.: XX! U A XXX, KX X X - X 514, , KlfJ ffk.J-,s,',1l If 'Q' '.. 1, 'X -' 'AVI' 1- f R X A I , fl 3 1wH5q sg gwi M U . ' ?P ar l 1 5:5 ' -. ig r :ff v ' '4 EE ri? i ' W. - f 9 is QS - ' b , ' y J W.'.i '2 9-5 si? f , A 557 K j,5f1,.,- ,XXX . ,k 3 ,XXEQX 'Y ,,gif':A-Aga- ik, ,gfi lf 'Af I f -X sf , 1 Af Q1 Y..... 5 L'-f - LWE3-352i?3f5f7':i?i??22'f'-F2 Yfjiv' 5 f -v-f E 1 - -3-f25E.L .53 ff,,1g. f ff: :f ig! ' Q Umllf' 'WZ iif-wal iafgf fffQis3Q3ifimj3v ' 55i331ffiE2iii55gH99F?N xg, --xt iii V-XXf,,X,l,, Qs, - j X f 1,1 Q-A X Q',X:.::iXf-L., Xgf . ' ' ' I 1 I X W i Q 1 ,. 1 a i 1 ! 1 , . I 1 fm- x 'ff I, -,A'K X, ..A.. . ,Q ,X N ,,-,Z I' xy gf' K7 1:11 ,XF -VF Ly. 15- - x, , ., I-. ij! 1 - L , ,V 1 - , f A fx . A ,, N ,-' V, ' N- nn. -1 -f , - L' '- :- , J - V 4,4 f a 4fQ i f . J' ,Li -H H :K fr. Q- ,, fbx'-1 , ,, f - ,. , , , - -- ,..........-.......nm.-m-.mnf nu 2 ., f , ...-. BiIIllu1 !I!Bl lllllill xx IIIIIlllllIllIIIIllllllilllllIlllllllllllllililullllllimhduimdlnlei-uvuni:-1'1111-mllmilllllll n --ullmlmll A H-'I '4 ' ' ' ...nn 1 I x T 1-1 E B LV E PCI N T Nw a ' F .,. www M ff i.......maasaax-.::::::a:a.1-:sn-.'s:x:u:::::asua::nan:::x::a:::::::::muu:::1:r.m:wx:::::amxu::uu:ml:::lmx:::: l::IIll:::::t::ll:::m:::r.xx:-.:::m - -: M-V f, 7: .V-'rr-2 F'-2 L --M-- -'ff-----H ia N QU 7 s Z Q ,v ,Q ,Q I 'Z' . . ge ,Q :Q +I Z' ,Q 0 V X. 5 M55 V L l . W Miss EI,IZABEfII'l BARBER b , ,OA av P 2 Q t Illia gun. ' NNW . , .EB U? if 5 6 . W. .. M.. 2 D Glee Club Board of Management OFFICERS M. B. ASBUNY . . ........ . ....... P'rcf.vir'If'-nt G, A, THOMPSON , ...... .B'llSf'llUS8 Jlflllflfltfl' F, O, VVAL51-I , , .aelxsisfallt I3-zlsilloss J,lfllIll.Ijl7l' C. A. LYoNs . . . . Assistant Business Mancrgvr E. D. O,BlKIEN . . .Leader of Ifzrstrmrzmzyfal Club H, B, GARDEN ,,,, . .PubI'ic'ily and Stage D.l'anagvr C. F. K01-Imuss ..... ...... L flfldm' of Orchestra, Pnov. A. WV. BHOWNING ..................... Director PROP. R. I-I. BllOKl1INSIIIllE ............. Frrcfzllty ,liepwsmzfaffive 3 I' .2 2 4 ff Xxx o 6 45 'w 1 1-N S O uxlllg mom ay. V177 5221111 f'-'D u we r F ' Lggiu Q! 1 W V n 2. gl ag' ? Z1 Z f .5 4 TE, iii vii X gill UQ F U , 4 1 . A WQ352 5 V 47' .-A E F + l l LJ. '. . EE? ,wap eu H K RW E f S 5 B X S FS QQ 'X 13 'N N Q. S S S S S S 'N Q N S 5 S S s x N 2 S A M I 4V,, 1 ?Q54:,,-fl S -4 X' Q - ,A .. C.- Q- - 319' FQ? fa- K, - ,P , A WA, K, , ,V 7 A , A Y -. .1 ' A . a X . ' '- 71 w 'vm 2 ' ' W ' 'w:4iin2.SQfwwx'uQff0 A ' ...ffh XX U U , , 4685 in X 3 ,,.,,, ,..' . '.', I U8 4 5' 0 :fx fi., fx FX 1 ff, A - - X '- fir' 1 f -' ' Q Y YK f. .. ,,--J-. 5-,E-S' EI 11 gs N, .E V: of QQ 'lg fd j I-fyjx 75 4' ' , .-- ' , 3 . , Lf H-'- - . - Q N .L3-.,-,,,, , ,' , 1 -L :Q-':1,i '. ' 7 f , W-Ag HN 17,33-+ITf-Lg .wg A x g, , :lf ' ' , X. 5, X 5,-13,3 ,fav-xp-51. 1 ,- x - , Y ff .7 1-'! T 1 A525 'x':LL4'111 '--3? ffyfff' '17, ' 'A A :X -ig- .z1rgg.1zgm:, :::1:4--414-4-1g'3A,-3,3 ,,,,, M A ',-H '-- A-p-45:7 - - gn A- f- .- V , - V ,A W -- I ---' -W Y ' Y xl d,...w --,-X -1 , -- v-,, ..-- -Q ,..,, ..., f- - -- -- .-fu - lx ar- '-. ' U, v 1 ,, TA . , X , X . f ,-X Q,---Xi: , , XE . A , V 1 7-fl 'VW +. X 7 d x ' A 'N' 'I x ,, 'Z-4 , , 1 1 1 w' I x I M H ' ' mb , A.. ,Ji-... ...Q . .4. - Qi ... ... Ry .... - .- VNU VII 7 '-1 ' ,fix-vao,,,,1,w7.l.J, --... , ,. . , ,,,,,,. , Y ,, VA Y Y,-Y VY W iiir wivi W fiii- V - 'QIYY 7-1 V , lbik AW --Vi? Hu- F - in v g I I i I i ' ri 'ijt-Q 1 f, ga M L11 fri 1 -4 . Y. k'Ki'iKiN. - Z L 5 Q 4 5 Z Z 4 9 5 3 f ,,..,J nl ll AJ ,A III J nn i -r Q vi if fy,-l fx Y fW- X XE XR i Xxx Y QXXE., YWX ! XX L.. f' Sym 95 f 4 , . , 9 1: N i Z 4 R Z Y rj- an . '-5 S Y K , If A. ' . , . : 4 In , ' Q . , . 5 v fs Of 2 , iii Vg i WQQA ' - f' - F' 15.0, ' I Q ' 5 ' f ae: V AlvinVnlmzl-l'NvN11:l1 ' I gif ' .-rg 4 U ' Q' 'JP VH .V :k i ,fi I 11511511 '11 ill ,992 31 ' fl f., V' ' I if '. Y. X' 5' 1 ' .f ,Q-iii-'Z , 95 V' mb' 7. 5 'x' ff P V 13: 4 5 11. rx -N Q l Ei 1' 1 Q if - V W : c 532 , - ' W '-I - E' fi , R-. , , 1 iv, 525 lux: c,lll'IlI1S'lAN.X Q gg 1 if I if W 12 , if ' 2 hi 9 fi ,S . T 4 , fx' fx -'Q-,X ,N 'fi-pf? .v M: --- ,. f 1 f ' X-:+.TQx . , Q55 'A . v. wr L: . V , . Q 5-fs: .ff--- W' max x U A Q-Bur-AAA,-, ..-.-:'.i--V---Xv-- . '--- ---V'--.'-' ---.--.-. Q, ,gy 1 5 ' I. .A , - N jig: .,. ,S .... ..., . , ........ . ---- Y .---AA A--5--ukk-.k...--4:i.'.-i.gl,f,,A-J, K ' I ,sf KJ , '-'TM' ' -T-f--'W- A ' 'f'A '1'A-Y, N fl Q-w '. . X , 5 -' F. j- --- 4- 1 411 ' '- Ak' -1,2 big! K -Q. 1 rg' -X717-QQ :Q Q 'fy 55 .:A.'.7'L 'V fkifu.- ' '-xl , L- Q L V L L If jig, 4 ,, 5 E Fw' 4 . f x 5 2 E U 4 5 C 1 1 I 5 E 1 I F U E 1 . I S Z : 2 , . 1 , 3' I 4 , 'W K Nvfuwxm uvu-.ANyu.AA.L1.4 MMV .uf A-. o 'a Us . ,,'. . 1 if ,-., :' ka In 'aapixq :My . :.' i 5. ,,,,L::,: gf5Q555355EEgga:: 5ii::::zz::mmauma1in1snamexrmenmu5iaHaaieiiiiiiflfuwffzfvff1-'uw-'5 1ffff1fff '-1- -f - -f'ff2ff1fE:4:': :' 5 ' 'Le : ' ff ' n ggi'? :,ngf'W55E H! Q .E T ll D L P PJ.. . . if-33 ,33,g:3g,,,,, ,,,,,,,,,, ,gg:g,-:gum ,,,, , f ' .l . ' A 'Z' -ISSUED' -- fmt ' ' ?' 1 t p' . R f . ' W ' W h h G1 Cl b A f ho S O on t e ee u 5 lf Nqma Home Town Class Fraternity Position on Club ASBUIIY, M. B, Elberton, Ga. '23 E 112 E Second Tenor, Mandolin an BLASSINGADIE, C. G. M0111t1'iC, Ga- '26 Bfwifone ' 2 5' BOYLE, G. A. Savannah, Ga. '25 A K X O1'Cl1CSt1'3 3 .55 BRATTAIN, JOE Miami, Fla- '26 A E 'I' Twmret QQ BREWSTRR, P. H. CCd211't0WU, GH- '25 K A Second B355 Q BRITT, W, 0, Thomaston, Ga. '24 2 N Second Bass J BROKENSHIRE, R. H. Winchester, N. H. Faculty A 'I' Second Tenor BROWN, XV. C. Chattanooga, Tenn. '26 E CIP E SCCOUCI B355 CARLISLE, I. R. Alllilfltai Gil- '23 K A Baritone CARR, VV. B, Bainbridge, Ga. '23 H K A Second Tenor FIEGE, S. L. Atlanta, Ga. '24 1' T A MHl1Cl015l1 IN FLEETWOOD, C, G, Savannah, Ga. '23 A E T Mandolin GARDEN, H. B. Macon, Ga. '23 H K fb Second Tenor R Q HAI.FORD, M. E. Augusta, Ga. '26 A T A First Tenor HAUENS1-mx, R, F, Hattiesburg, Miss. '23 B 9 H Second Tenor HOIADERJ A, O, Atlanta, Ga, '25 2 qi E Second Tenor 2 . HURT, J. A. Atlanta, Ga. '26 K A First Tenor . N '7 JORDAN, C. D. Columbus, Ga. '23 KIJ A 9 Fi1'st Tenor, Banjo V J Kmn, J. E. Ruston, La. '24 K E Baritone In 4 Q., ICOI-ILRUSS, C. E. Augusta, Ga. '23 H K ci: Orchestra. LEVY. L. K. Augusta, Ga. '24 Artist - 1- , LYONS,' C. A. Harlan, Ky. '24 K A Baritone ' P ,wg MACINTYRE, R. B. A. C. Atlanta, Ga. '26 K A Second Tenor ggi MCCAMEY, R. B. Dalton, Ga. '25 K A Second Tenor iwpglg MCMILLIN, R. M. LaGrange, Ga. '26 A K X Second Tenor fri galil MUNGER, H. P. Atlanta, Ga. '25 Orchestra Q, O,BlUEN, E- B- Savannah, Ga. '25 H K A Second Tenor, Violin PI-Hrrs, C. A. St, Pete,-Sbnrg, Fla, '24 Il K A Baritone -:mf PIRRSON, J. E. Ripley, Tenn. '25 CIP K E Second Bass ff!! gd U Rnnmf, T. G. Macon, Ga. '26 A O E Second Bass Tw 1 ' SANDERS- M- E- Murfreesboro, Tenn. '25 E X First Tenor Wk' SAUNDERS, F. Atlanta, Ga. '25 K E Second Bass SrNcr.A1R, J. D. Moultrie, Ga. '23 K E First Tenor SINGLETON, VV. T.. Miami, Fla. '26 A 2 fp Orchestra SPALDING. VV. F. Atlanta, Ga. '25 2 A E Mandolin STATON, J. Atlanta Ga. '24 K E Fil-St Tenor SULLIVAN. Fl. I.. Atlanta, Ga. '23 ll Kip Orchestra TAYI,0R, J. H. 'Atlanta, Ga. '24 K 2 Baritgng TIPIOBIPSON, FI. S. Atlanta Ga. '25 B 9 H Orchestra A TIIODIPSON, G. A. VVhite Plains, N. Y. '23 B 9 H Baritone TURNER, J. VV. Chattanooga, Tenn. '26 A E T Baritone Q x7ANWINICI,E, E. K. Atlanta. Ga. '24 X 'IP Second Tenor 1:3 5 AVAUGIIAN, W. H. Clarksdale, Miss. '23 B 9 H Baritone lg. Z XVALKER, C. B. Lverly, Ga. '26 A E T Second Bass ' ,, AVALSI-I, F. O. Atlanta, Ga. '24 2 A E Second Bass A VVIUTR, D. Tifton, Ga. '23 'P A 9 0l'C'h0S'U'11 f Z 2 S '1 5 R O w93?' O v Q A ' Q .- a5Zf ' Qgxhka f on . - f F 4 ' 'O' - -A . fl Q-X , 2, Ve- X9xX?'Q'AYQGYQUQCNRRNIRNXXY-XXKNXYi 3SN':wE1?'bl-'-Z'I-1452- 5 j Egu msm-1:-1-5s5':441f zz::z4212-:V0f5:1:2-vHsQsW'mKY- ' 1. 10 N iz L R- W 7 I V Q ':'55'555g, 70 j ' L L V V V X' ' X :T X C,::?EffQ KX V, M75-.Alf 61331 X' ,xg 4, ' ' ffffc an M 'lf f ' ,. .,. .- gy., N x QW! If Z 'ff - ---.-. -,,-f-.-- .-.,. .X 4....J-.....-.u..,.' ,A if L- X, Af , J, f,-f E , -f-XX ! ,Ir , 'W ' fsfgifkqgiix ,agp Xgiiff LYQKQgQ4f5!,72m4 fj ' yr 425.19 QXXX. . 312751:-, f - , ' if X - -- 9,4 fggif' ff, A94 QL' ZJMX X . ff? A ' . , .V 1 77 t m:Q,X,.1...1.i.Q4.Jl.uiL 41. .W N , L. -,w..f.::.1.L .Xu fH..:,X.::x-g-. i ll Illlll llllllllllllll 1 Lx.. - A -U V A - V V rin R , PEL.:-.A.4-T 'E ' VXI . E .' - I VM! R i ' In i EM 1. x n w M ll-in TA M w. .i . W f if ' uf! 1 . Xzx W' N' ' W ' : T ! Xw 11 ' VJ ' ' X ' X ,,- ..- 11 K My .L ..,, --.f .41 1 ' W' 'W' '4 V-4 --f ' .A , 4l,,..w..Q,: ---1'-A-mf A -,ln--qg55155um113v,35wv17UfU v1H'WYRTIUEL'4r..LnEE?l?ii'i,::1:-1'iu. WT .,,.,..X. Y-. -.,,,..,,.,, , XT, ,win ,.,.,... ,Jr -ry, ,Spy qi r --W-.. ,-..,.- -...Y-Y--..-J 1 m::m777py7L'Er5:r'f,,--.,X..r7f.X-..n .-. ,-XX,.X,f v 4 ,E ,E 'EEE J... .uf --A1 V fix .PQ S W is 1 W QA 11 Xi 7,5 5 6, gl W ' v 'fail . 1 yi. Mfg U, QQ. Q Q -flllv' ww U1 Qi Q . ,T 5 4 ZQ 3 3 b? 'C ':4 Z zz ? 3 Z f gl . 1 2 6 K I X 4 6 T IIE JAZZ On C1-I lcswlm YELLUW JACJUQT FOUR JN E ra' l W. zggyz lify WU! aff .- if if 2 W W fif! IM!! Mug HW P95339 Mia 2231+ .WM 'iifilzi V4?':r VI lr' gllgfilj' Q EE? w M vw 15 Lgfli LJ W H. 16 EN PM I si gjii 1 St? 11 ul Ev u fx- v iff Ha 'f MH I I .M Eu? MM. QU if .ip ll N N If I gf Q . ., 1 1 N 6 1 7 I 4 K W. S! ' S IN U,xlmNr:n AND NIAClN'1'YIlI'I ,525 BRYSON ANU Gmzmzx I V 'V - O 7 Ky, -X ...... A, X .. G1-1- f1i,Tib1III X QPUTN2-W1.m11vXXXXM..Gv 1 'E H - ww, H T ' ., 5' 5 ,mf . D' , ' .rqiizii 4 -1- FL QX.--i 3 W' Q1 Q aLl': fi. L' ,V Tiiff ' 2' cflfq-Fuji' J 'Q723.X,,-I2.L?ZA5fZJ.5 'fTm'3g:fI.-T5ffgudwk---' - -- a3x4lNEA4U i V L! E- XOW, 5 xv U1,X'j4-H4371 , H' rf- KX. . LX x X Q - .O f, , X . , , X . X. 1. 1 W gi ?J1,?.A T,n- ,lJ , LYQQLQJC :A 11 ZR ,. Lrg ...A .my Q Q1 1-2 ? NZ e wf Z! 5 f 9 f 7 f l f 5 Z 5 3 Z f 1 4 Z 6 f ' if x 'HJ L-- ll 4 5,4 : -IIII .j E11 We bf X ff 5 v ,, -3 H' '11 1 rw D ' F mfr-i. N' ci 5 M Xxx X Q 1. ,-ff, ai li 4 cv X N 3 ff . X .,,.-4 ' W3 . . , 5 1 TJ - . -4? I Q .f. wi. P Q.:-ow-, A , mx '-' - . ff ,ff 'F AQ i..i W-15 ? 'E bf no 'M' .. Fm' I ' X ff -' auf ,V'. w Q? fliillilimiil 'ii:1'i., Ei...1Hiv:s::::'.:nnllll:nnFl luunmussmuasusnxn1Q1xmi1EfLl,.n1.a.u5,aEIi22Ii.n 5, -.an-fe mmnainwmmziiu -nn unmwm -.fu - mfM-1mu1ww----- H w--f-i'--f'-1-1-'12P-M-ww--vfrmmnvfvfvmlmvwvffmffHaw Eimlqggp N, . ' . . .. . . Y ,1,..-my . . ut 'i u l.,,u, f. i 1 .N1 mf T H E L VV W P px., T 11 H X r E i ..... n m... . amamma::::::aa::::::a:::r.nr.::::::::::a:an :::::::::: nxmm:in:1:I:::a::::::::::::::::::::::.::::::2::.:::::::il:l::....::::::x:::.21::::mn:wiIi::::iiim::1:il1Ililn::I::im:l::.I.:2I:::......:3:..::BH:: . .... ..- l Q' fx In w,+ 7 Q Ds Q I I Q 'D 24 Q -f . fa I Q 4 ' XS S 1 MISS REBECCA IXSIICRAFT 5 L W, l 919 a 14 V K l f A ' 'N M llllq, Fl- Q lr ' 1 '- 'Il lr- 1 r 4 .3 un: 55.3 0 Q' 3' . X' . V01 n .1 s W .. x 5 if Z 5 5 K of The MaI1OHCttC Board. o Control 1 E H. L., ELLEIKISE ....... E ................. P'7'9SfCl6Ilf if W, '1. IQEED . . . . . .l fice-President ' 5 VV. A. BIDWAIKDS, Jn. . . . . H'lL.S f'l1'0S5' Dlanagcr 5 HUGH SAUSSY . . . .... Pfzcbl-ic-fity Manager QZ J. J. WI'II1'P'IEI,IJ . . . Sec-'retnry and fl'reamarm' Z GEORGE ROSSIQR . ........ Historimz f 4 N Cl--ff Ili' ff O H up N 7 W 5 I7 w 1? .4 12 Ea M uf .Z 'f ? Z I 1 ? Q 5 fi ZW 1 ! 95' F2 1 , H3- E512 5 llll P 4 I I V D Q? ' ' EH 'a I I fix N 3 x 5, 5 ' Q 11? 1.15 N I N 5 S Q gs S Q S Q S Q S S. S 5 Q -x Y 5 fi rg' S931 4 1.1 ng., K muh ,Ein 2--Q U I o ,Q o I -. ll,- LQ . . . . . A ......... .... - Q D-- mil, 1? is A... .Q ' R ' Y . , , . . .. , ,.,. , -1 . KL -' V W W 'W WWW' n 'L Y i ff.wos6fmsf,wfw099wwo' 5NQW9'fA!A' gi.. l - F: mwxggxxwxxxmvpxmmsxwxxxwmxwmKxxmxxxxxXxxx3 L I 0 ' Av V Y O A AY , vb ,I I'1Q4'ffff' I 3' ' VCL- W-A. R L 'x V? if: L K' zxftiq , ' ' X A ,Gift ,,fJV, Q Q37 5: im EP ? PT i ,W I 44 5 ? Z I4 M, 5 E I ,Illl Q, SW UR 1 QM 7 fn 'l. 'A 7 QXXR YSYS 14461 '71 MNK Q w Vw HKU I 1. h .11 '::- Q - 1-1.1 DLVE. PILI, 1 45 ' ' 'E 5 cl' Lai .fag ,I u 'I 192 1 kv TZ.. :Ne ' . IL6a,e5 5 1 'Lfff' .- .... ... . ' 1. . -Sl QI 1 .. ,gg I 1 L 119 11 1? if 111, My 1 1 1 54 1 1x111 1, B1 1111N1 II 111 C,-1 11Ns, I C 1 1x111 1 II 111111 11ss11111 I1 D1 x111111111, Ii li II 11111 11111 11111s IX 4 11 1x, G11111s G xx 1111 11111111 Xl 1111 ISI 1 1111 6111111111 11111111 11111111111 11111111 1111111 1 111 11111111 111111111 151111111 1711117111111 1 111 1111111111 I111111111111111 1 1111111111 111111111111 I11111111 I1IIl11111I1I Members X I KI XIX XIII XI Xkll 1111 111r NI1 N 111 XIII X I UNIX I I l XX Casts of Plays Produced II X 1I1s11 11111 1 H 111 IR 111 N1111 11r XIII ITT I x111111 XI X1111111111w N 11111 111111111111 If 'W 'WX f rrmrr I11mr11 Llllllbljll' Cx 1 W.X. Lb..Xm1.XE':'N X 'X ..... 1:98 b Ng yx 'T LIONEL 11 N-mx X if F31 slAw,A.' Hin 1 'I . . 11. .1-. 1 2 51 FT 111-1,1 JW .447 1 'N' 11 IU 1 X! ,JX 6 1 E1 V 1 I E Q 1 . Z ' .233 ,, 1 QI . Q 1:53 7 1153 Z 1331 6 325 1 . Q , 1 15 3 9 1 1 1 If . ,A I: f , . 14 : ff ,1 f A 1: . f . I: 1 11 ' gy 1 1? 1 Z' I511. '.c' Ii. S. .IIIIIXhl1X,1'. I'. 11111111111-1-'. W. W.. .I11, l Z 1 XI 1. , :11. I11:1,1.1:11, 1111.111 II lin 1 11, W, 'I'. 11 1 B17 ..C. I..1w, XV. I . IC11111 11-11 W, II. II. I 3 5 1. hgh '1 1 1' .5 , C. F. I,'11Ns,1'1l.1l1l113 I11:Ns1 11, 11. 11151111 C .1 ', I,. G. I,1:1'1'. I.. Ii. S N-1. II. DHS, -I, . C., .Il1. NI1'I. I1l2. II11111:11'1', I'1. .X. C. S1 .11-, NI. If. H419 11' ' ' . . NI1'1111.111. I'Il1. I'. S'l'I.Yl.YN, I.. 13. 1,15-M 1115, 131.1 11. 1,. 11. 1-111, 112 II. sT A 1 1-, .1. 115215, 1121.12 I1 '1 J, '. .-X.. -111. NI, '12, X11 ' 'I'111111 u.-1. S1 ll'I'I' M1111 1:.D 12 111' '12 111., .111 111-. ,fl-11. IIlI.'.I. 11' 111111. 1. 11, gg, IIXVQ Y ' 111213 Im , 1 18, F. N1 II, II. NI. XI III1, II. NI. ffm 1 1- . . . ' ' 1 lm l11 .U . I. II. I'lIlI'I'S, if .X. XX 1.1 11, II. I'. '59 H. 1 11:,wU, 11. l1,yr111. Il. Hi Il'l'I lI1l.Il, .I. 1- I'I1:, 11, I',1.1. II.1, .'1'. 1. II. X11 ,1 ,111s, NX. X. 1 S H11 ', II, Ii1'11.11111s, Ii.1'. XY1 - ', 12, NI, 4 131 1 71 -'1'Y1 -211 1'111'1-311 E52 I :1 A 11 if 11 S11'1I1l1'l11 1101111-If . .....................,....,. .1111 IIV1 I1 111111111 11 .1 'V ' ' '.1111 ........,.................... II. I.. I ,1 1 I.IIIII, . V , 1,- - ,,,,,,,,,,,,,,,,, .,,.......... I Y. I'. I' . YR I-E 3 ' 1' .' ..............................., IV. 'I'. II111:11 , 111 1- ................................. .1. .1. 11' -11111. H1 1 '1 ' ...... ....................... I i1w111. .'1' 11.' 13: 1 - 1' WI SIINII . I 1112 'if , , . ............................ . ' JA QQ A.1l1I.l f'111'1:u 'I-1111 ...........,................. Nts 1 ' . . 111: 'L , '- 1 ' ' . .........................,.. I,r11'1s I' - '22 fi nh.. A '. 1 I - 1111 .............1......... Ii. I1. I 1 ' 111' , K ' t . ......................... V, ilu 11111 .'w AY 1 ' mf? ' - ' 1 1 ......................... II. XI. I1 1 , 1. . IH- 111251 3 . . ...........................,.... , , .. , iw S 11412 1121 1 . fri-- - - . 1 1 .... - - - I- H 5 A I -Alun., 55,32 Sigi 3 1 . U 1' T' 3 L x xm l Fm ,Ar .... r ,.. , , zsmis i' - 'EE'ii'El' ' f - -2 -- -ff--1-H 2 1 H f - -A ' - ' ' is 1 wanna.: - .e 5 F' --5 H: , g'iEi ':.-my I h -in I 1 x t l 5 N J J 1 I I YI ' X '- 1 ' -as ' f f 4 .1 .4 , .N W.-.,, f .wife f W M DX 3 - f ,, :tn Ilifllqi 11115, , 5 M Imumulml ilmlRmiinmv.1lllm1Immmnmuuuuum-mm......mu 'ia 1, .mi . ni mfmmm um'- -:mu nml Wm. .mm . mm... . . .M um V -.- . mm.. .mm-m -mn1mm-mm ummm zu I 1 - I ui 1 In ' n. ua inn- :4 ' -4' is . . . f .eg Wi : A .l I wi. . ra liiiiaa. :Hill li ' ' ru. ily, -ia gsaisra. ... I lil I I ' 4, ieiifhg im-liiia.. ..., . .Q:::wana:sanmaaazmznzmnazzsa:::::s::::::::::: .azasamisn1is:x:::::::::::::x::xxmixa:::::::l:x:::::::::::::::::ml:::::i::.'::l::n:::::: T ''-::n:::::1:::::m:x:::s:z:'.:::l:::: in:nI:Jslm:a:ln:l::::::::m:ls1:::l:::.'::x:::::l.':::::::::st -..z.....,-.ia-me 7 1 . , , I is F X 2 g . 4 4 9 9 .gg fd 4 I 4 'tgflg' . 1 H . 4 LQ WGS' YE' 41 lllllh Jw.. U3 sz. Ill . 1 N SNEEZER ET CLEOPATRICK ' Ohnlias Victrola Sneezer . . . .4 ....... .... W IVER HENRY GRANATH . Gus Gastreetas ...... V ....A HUGH SAUSSY I . Lon Lombago ...... GEORGE BRITTINGHALI V Ifvanitch, a milk-maid. , . . ROBERT kDUNWOODY f Yoovabite, feet maiden . Q .... Tow FAGAN 3 gapaiparge, feet maiden .... . . . JAMES STAKELY 'S e ena aticarra ....... . JIMMIE WHITFIELD ' glllah Asperrin, premier danseuse' . . . GEORGE RAMEX' eopatriels ......... . . RODERICK BRANTLEY Asparagus Brutus . . . . . NISBET MARYE Witch of the Seehorra . . L CITAINIP DESAUSSURE , Oebam .......... . . ANDY SPRADLIN 5 Gay Gnmdrop . ....... . DOOLEY HULSEY ' Nflcoclemns, the deadly asp Q. . .,...... , , BY HIMSELF J 25? A . V A A a -3- OFFICER 6667, E- . if Bateato ........... ........ . DELMAR ROBERTSON Michael Phelan, officer 666 . . . . FRANK Games 5 W hitney Barnes . ..... . . WILLIADI WARE I Travers Gladwin ..... , WILLIAM REED f . Helen Burton . .... , . . . , . . .y NISRET MARYE s 2 I Sadie Small ..... I .... . FRED CHANDLER A ' Ilfrs. Amelia Poindefcter-Barton . HARRYNYELLERBE -QQ!! Thomas Watkins . ....... . . EDWARD MURRAH A ' Alfred Wilson . . . I ,... . . BERT'MACINTYRE my Polzee Captain Stone . .... . . WILLIADI MARTIN mm Kearney, Plain.ClOthes Man . . . . . GEORGE RossER ' ' Ryan . . R ....... : . . . CHAMP DESAUSSURE Q. Officer Clancy . . ' I . . WALTER STEVENS - Il i- Officer Martzn, . . .A . . MACK WYNN l l Officer O'Hearn . . . . JIMMY BURNS 17 4 ' Li noi 0 K . N ' A 3 4 . 'H Review of the 1922 Dramauc Season The Marionettes during the past year have added to their well-deserved laurels of pre- vious seasons by their presentation of three plays, Under Coverv, Snr-zezer et Cleopatricli' and Officer 666 . I . . ' ' . X Under Cover was offered to the-public in the spring of 1922. This well-known play was staged at the Atlanta Theatre before a large and appreciative audience, and was unusually V 0. successful. Joe Duckworth and Harry Ellerbe obtained the majority of the applause, the 'E latter appearing in one of his unsurpassable feminine, roles: Others who contributed to the . success of thlxel play included Russell Stokes, Louis Pitts, Robert Dunwoody, Charlie Northern, E ' and Nisbet ar e. , y Q, 2 The springldf 1922 also marked-the presentation of l'Sneezer et Cleopatrick?', the first 4 play to be written and staged entirely by Tech students. The author of the play was Harry I Ellerbe, who also directed the production of the .play. 'This play was an inimitablefarce U and kept the audience' in gales of llaughter throughout the entire performance. In this play Roderick Brantley, as Cleopatrickg George Rainey, as a dancer, and I. H. Granath, as Sneezer, gave performances that were frequently encored by the audience. The' fall of 1922 marked the first attempt' of the Marionettes to produce an autumn as I well as a spring, play. The play finally adopted by themiwas the melodramatic farce, Officer K 666 . This play -was welcomed by all who were fortunate enough to hear it, and met with 95 such success that it later was taken on a. two-day road trip to Barnesville and Griffin. 3 Several new men ,were introduced to the audience, the best being Bert Maclntyre, Frank A Griggs, and lWilliam lWare. As usual, Harry Ellerbe carried OH the majority of the applause 72 as Mrs. Burton, the watchful aunt. . ' o rim. un ix 0 if ffl--:.x3 B l O N .ev -E 0 X , -A 'I wotf rv 4 iq X iw .- 1 ff- ......,.,. .A 0 -- Afnzaiql of FQ ' Giglgu. XM -- ,Q V , Y V V V M M , A A . Vi- A H H, R- ogm9 'm'956m5'W'y f'WW'W'QE ZWWWMMWWMWM E, ' Q QQXNFGZQSRYBRxx?-Rmxoxwwxxmxxxxxwxxxxxxxxxxxmxxx ' Ll0NEL K- W V V V A V V H i l W 'gnu '1-Ei' T it : To I H I L uv. ' A' A '33 e .Wir JON A f tx kfifl'--Ek f ,H - f . ,C'?x:Qf:-1 11173 JF- b,J' 1.,y4-..Qff.L-v-...Q , if -E X , , - ,...,.f A-,arf 4 .Fw 0 V X- X fx -'X Kg - Q A s - ,-f ,,1'f,',1 ' W' ,J ,S ' 1, wx '-ff ff.: , ,J ,fig-,K Ii -13' ' 1,'f1,T:,,.1.4q5?: wi u J. Q ,252 I: fyaig? 54' x -1257 ,. L Aj, ,,'f+'f4f:c.i-F, Q., - Q, -i .' '- f --1-f-,.,-.-., , ' if- A-T -- , ,mfr 4 :- w V-51,--17 -fiery, - x Yffilgd ff if. x J., ,fl 2. vi:-iL',,.-,lj, - iY-jg?-gy-5 Q xL,,,f..,,L,Y5 f' 7-X 47 ...., ,QL -A,, -4,f3 :-W ,Zi V xiii ' 4 Q V T ca. ,.,1: --':. - , D '-' ' ' ' g Fi- k Li- -Lv Tri 179.7 3 -7 77.3 YA, W, - -xl 517 ff 1- f f m. . , K 5 X ' - .-1 I K, - ', , , X , 'Ha '1 i sf 16--Lx w A g '-1' ew V ' I Ly Q L. LL H- 4 guy ,.....N4 ,--,,,,,.-f.,,1,- f..f,,Ti,.A W, Mvuqw--WiwQi'f i AV V Wall 0-hi-1-M maj, K KM Y dw -it fx E Ilyy 1 6 ' cf iyl QZI. iii Z X f K 'Z 5 4 7 Z 5 f V FRANK iz l anon 1ViRlL. HZ? U FHDNDLYR H pan Mma Rotsmmou mnvnv , NIH r 4 H CLAPQ3 C is lil Conn cm macucn Bomxv wmizmc DILLLR PETRI nmxav uLuzBL JIMMY wmrfn LD JOHN BILL 'L S QSQM. W gl E ' ' A Z 4. X M g I .4 4 ' 1. r L A , my 4 13+ ' .f , . -an Z, iii ' I r Q IR' : Id- on .K 1 ,Q 'Y A t V1 t .. H L Im, nil X L W Q ,, -HMI: VNU! '- :I Z n z g lf V- 1 :L 5 , lm' ' 3' Z Q , ' 'w Q r l 3 61? 6 , E53 1 1 5 i 1 I 5324 ' ' Q ri. 2-1 vm A i rv x' - ' U W J A x x K k ' 1 A ' 'N . ' -X 2 .fffb 'L 1 L 4 'Tx ' km? ,N L fig-gif T' ' Y 5 '-,,fI1?:1- T , ' e -W,.-,.,- 'Q:.,ar3e1fe5?- f:- ffee.s,f1f1f-,-f v-' iF2i1Eixx','1 5 fi . , 'N-- 5 iii: 'X ' i'i:gg gi gQQ51vf ug 1 X , s fg' ggg3f ggj QQfQQ 'fQQ L F Y LACVD . V K' 'f,.f':ki1- A' -H ' ,'Y.,- A -iQ fi 'ff ' 5 'T 1 I 1 1 1 i 1 , .' , 1 '1 ' - '11 If 11' .,. .. ,EEE555Iiis!!!i!iil,,,,EgEgggEEE,,,,,HHasH,mlHImaamm,,,5,i,,m,,,,,,m,,,,,,,,,5gQg,Qi ,,,,, ,,, ,,H, j,,L,g:j,'5.1,.,,, ,,,..,. .,.,.,.,, 4 ,.1..,1numm1 ------'f- V'Uli l ' f- f 'M f 'H' '- -' ' ' ' 'f ' ' ' ' mf N I 1.2 11 3 1,531 ,111 -1 Mt' 11 . illllEEi ... .s .... .. ::::a::::::::::z:::::::: 'mum:::::::::::::::::'.:::::::: :::z::::::::::...::.:::::::::. .:::::. ..::::::' H :II -SFfi1lI2 I2iI1Il1I1l1llli2I:i1':i:liinizmznlu. ...::::t1:l:5::::a3t!:::'..1:::::::.':::::::m:::::n:S:. ,... . . -.- iw'- r 'W Q1 ' 1A .c. W 1 ' I V 1 1 X J vga . 91 I 5. 6 5 1 V' I 1 il ,c H' .si Q .1 5 J ,, . Ill- ? . ga? ,Q Q H. 54 'YT , Li F31 tglll 1 P-' 1 . 1 VW. ' - IIIQ, ' .Mgtheson Literary Society I.. E. GATES Founded 1922 OFFICERS J. W. PETERS, JR. . . . H. , XV. LIGON . . . . .President . . Vice-President . . Scoretcm-y-Treas-urer 0 Q 'I . if wh E t n I I 1 - fi. 0551 1 I ,um- HI I fs . C. J? R.C1jE1Q'1ffS:h . . K. i:i'?If3, . Sergeant at Arms 1 -55119 -W4 ,CQ ' ' . ' 11ff1Q1O'NO1iN11Y 'MEMBE S e 1 'N' DR. K. Cx. M.ATI-IESON K MR, XV, D, FERGUSON , DR. M. L. BRITTAIN 115 r 1 N 1. .1 . 11 . 1111111513115 1.15 f A'I.I.AN, L. Hg fjffi, , HANKINS,' D- Dr' IQUBERTS, C. J. N Z ARENSON, A. ' HARRIS, R. M. IDARKER, A. R. 1 Z BREEN, XV. H. HUFF, J. PERKINS, H. H. IR C BIIOWVN, G. S. HUGGINS, PETERS, J. NV., JR Q, BUTTERFIELI7, VV. M. HYBIEN, M. 1 SAUXDEIIS, F. D. C1-IANDLER, S. XV. JOHNSON, M. I. SAKS, J. D. 5 ' Co1.1.1Ns, J. H. ICENNEDY, J. P., JR. SALZRR, R. CROVVDER, NV. N. LYOITT, L-1 JR- STEVENS. H. B. xg 1 IEAST, C. P. LIGON. H. XV. . XVATERS, E. .4 EI,T,IOT, J. B. MAY, T- C- XVINKLER, T. Q. Z GATES, L, E, MERIWETI-IER, VV. G., JR XVESTALI., FRANK Q g Gm,m1fAN, I, MCCAIIEY. ROBEIET S Z GUNN, E. L., JR. RUSTIN, W. C. 1 f f S YQ U +Q4 f O 7 1 .1 S11 A . of, l 1... Nw 1M T- ..... - '11:111. S--.-Q 1 T- 1 M4 1 o2ExmAca0xm9swazrfmoWA9y0R09RmQms5aQ2s6Qw2w7C??5f6mqQ0 3? , h 1 myCQSNXKQQAXXXYXXWxxxxxmmxxmmxxxmxxmo L - .S 1- - - 41 ' 1 Q S -. .. if X 1:1 1.101151 1' Q1 - EIU li 0 J... 5121155 1 1 uw ,, XS yb1.,,:4 V,i1Q,,f'7g 0 ' '1'1'iii.1f1af WWQMlMWEQ2Q? 1 v n ' ' X f I I-I it XF-A ' I X 'II na , .,.4 I W 1 A1-,A,,- -,UL A, AAA... mx ,,,, AM,g, ,D 1 ...-.... ,,,,,,,,,,,,,, Y V -,. , - , H, -- W. . W ig' ik ' 4 ,i f f - A1 - 6 .- ' I 5' Y, ffm, A. ..... - .....,., ..,,,. .... . ,.,.,.., ,-,-W,,,,,,,,-,Wm ,,,w,,,- A ,Www ,MMM M- . ,,,,,,,-,,- ,..-,L,-,Q,,,.-,r' ---.., Y y TR sm' 7 1 ,. 4.. 4. 1 V.. 1 .X-. I I., un g -44 '4,' ' gi YQ gr A: 31, , ::l.g 1 W - '.4'. '- ' .' ,, . ,WV5 I-,ESV I-, -- -.-..-Vx .xx -, -, ,..-...,-.....h 4-A. :D '..M,:.4 -,iw :-,,A:,:-FALL? ,Ti N -:vl':vN::,, N'-liz, mwV,:..AlL:,,A ,E . 2 w QEESEQEWESKQE ?iEi5Wi?5?Q . f '2i.:- fl .gf -4...:::1. -- --- - .14 - ' - , Q' ' -' E' 2221 1,5 LL,-1',1I' 1, 1.-'15 A . , :Q A ' A ' 37 M ':5,u3ap1'..'Z.:ZZ'i1.:' 'f::4.. 21.1311 . , 3- 'Q' . A . ' - 'YN ' . ,jr - , 5-lf' , 1-J:--Ugnza. :: 1-Zi-'IN 'g.1::::j 'S :'::'Zt, xx W. ' .- . t ' g ' ' y , - 3 , ,. f '.. :1::3s-Alai'-'r. - 'ff' lv' '11 E' il Z 'rf :fm f. - -- 1, ' , '.::zrfeeg?ff1Iizf:q ma, lf? 551525 1:5 w- '.,:'-Q ' -. . .f-, ' -L l , i- ' nz:--A 1:--1 --wr 42-H -2.Z-...L ' ,-- ' -' -- -1 - I .--.-.14 - -TLTL... , , 3 .. r Y ,K , 3.--e.,.-m:gg,,,.,.n TE::.: -,. V v La: : 4- vy, vt---H. ' 1-4 ..,.,. .1 ,I , ,- , lv fm 'Q--112-!':::.::.:::....--N.: -1--IL lv Pvvv-A 1---f'T'f.,. 3:1 zz-. - ' - --m..,: 7.1 . 4 -5.1 f Y-- '.:'Y'g.1f,.4:J-4.- --..-.-..... ....... . . , A ,,.,,-.,m, , , -I , V... . - - TEL- ' ' -' , ' 'iiflE3Ef': '51 L1f:i7?'f rE7fff12f1A?-271-x'E?f:--:21r:':E :if V , s ':..E? :'i-Tflmflr. liiiig Cffifm 555' ,-:fi ----- - lil: :E::.:.i::.3fE ,SQL ::.'5::f:j?'?EQ..Z..:j.:'11' ,wipv'7 . ' zi-: Elini 51. 111'--gI-Y-'j,i5:gQ'giff''15 H Aki 'f ' - ,eg , 4 al ,A A. .. ,. E ,L::i.i:iQf.,..,, hi, ,WY -, ..,..i. -L- U f. I H! x -,- I 1 ,,. .-, Q ng.. E .- . 55 , I vw 7 , N: , 1 .H . '-4 ,- .-Wi -. .A I -K- it W 1 r ' xg' M. ' I 1 , .-.3 . 1 . 1 1 X 1 - N 1... X ., N '- - Q ' r 1 ! Q X J 1 4 'Z I 4 1 f g yr 4 5 3 I I 6 Ek 1 ' 'U n 1 H X I Z LPA I i Z s Z xv 4 L 1 1 xl 1 ' f f t 2 F + .3 ' -- Q ,C 1? J 1 , z H I I X L, 1 Q 1 Q 4 Jn' In ' n ' .J 1 L I 2 : 1 k 6 -4 L J Z I' f 1 i 2 14 L 'rf JT -Ir I f I I Z 9. 1 4 ' r 51, W 335 IIQQ -SE. . .J I 4 , . w . rl 9. at A up be fi QQ, rr ,N R Y K. 1 x 5- x Y 5 L I :yn 2 j' u QQIM Fm? ,Zz W :EW xzf x LIONEL K' I zz L 'fx ': 1' .-, '-L-, .4-, Vi, , .-- '1 Tfwf? ' A - WEN ,- 1 - 4' 1 'ff 'A . Iiivifisr ' Tv . I- , 5 W H ... , . , as in .M , fri P , ,. W I ,N X . T.-.,.q - M Cl .. , . A ' , 2 1-1 1 ru A PM -' J ' A l A z 1-1 r , 1 f ' 7 I K 1 4 xr 1 f x I :SJ nr r C ,,, I 1 1 it r YK has t -in Q 1 Q I. 7 JI u I If ' I 'xx I r 1 ' l ,,, ..... .4 u 7 1 nl :TL -rn . X L r- ' ' H ,. I W1-xi Q I' lu Y N' L , ' l, , , ' , 1, ' J E. A ... ,, ,. Y t - , H f 1 -' , - . ' I K , j -l 4 A - , u Q v- 1 ,.1 1 1 , I L ' 1, ,144 nl-Jinsxxzx ,I 'fig ,f , r r r 1 I f,g'I . gig. , , :uf 1' 2- 1 f w ff. L ff x , 4 - 1' a' , v-1,1 X , ' L Il. I Bi y - 1 4' I xfh-5 Hui --d A 3 5 H V I ,gy 17yC',' xi, ,X X. P, 1 D Q 3, r., ' gf ff - 4 'l'12gFjY1::'.z. Q' f -.1-Qi' ' '-J - I Ertir- ' X 'Jw ':.r, :' - ' 2471 n il I lm X ,hx X X R 'Qin N X ,-.ffilll J ' F 1 - -' Af? J q: , , ' Q ' C' . x ' -': ':?E'-55 1'afi!ywf,:Q,!.!:g:1,,3e, ' ' '. A ,, -ff 9 , A , - ' . k ,ekiseeeuf , ' lg 1 fE::2i :Ei!E:' g ' , up R ' j 1 4, 3 N, 1331144 ,l'fT:'FIf' nl W 1252- ssf2 :Ess25,f1 'hffggfq , ' , f ff-ff ff9'??'2 , ,71T .:1:::.'.21! , , ,I '.- .1 rl, ':.: :qv E 3ff?y:1.?:fz:?-a111':x' Fifi: 7. ,711 '15 .si ' , ' M. XX -L ' M Y! 11:11-.s.1,1.ff-2.5:fa :',.,fff 5 :gf,:.1ng'e,::':1f.f-Jziy, , pfgg 'S q -50 - , 1 N - L' i 9 J1:jQfiggjgl.:1gL:3--V.-.f. I J . ' . '.2V'5fZ 7ffIL -. A' .Ei N ' x J - -1 i'1f' X filr- fr. 3 Wi Xl 9. 1 Uni' . 52asf-Y, I s :A- . ' H :qw , ' f Ir' in I gi : B 0 E 'sf ' mx if '47 ex -fin' r 5 :T Ani' '- ,- g4 - 'P' ' ' X x f 1'-'in-. V 1 j, g Q., ' -,17 . .f ' if, -u--- F fy :.-'V -r 1 K 1 w ' , f, 5 ' ' ' ' ' - .'.kff'fff'V5 'F21i..f'3'f-,I dr' HK In ' sill!! M W ' lx nw 1 5 : ,- f-- - -.: Hg.. ,L M- -1. ':,frq'f gl. ip, I. 3' 1 f tx 1 ' ' nn' rj, ,NI -ur x U, ' I ! :Higgs 14 wi- X is ,dmv :la 3 ,Al J? ,E LK I , N I x .X .Yi I V 4 mv 1+ :if J' 15 HHN - X, T, L H 1 , rl 1 , , fH5.f,,?Q, 'Hg ,A , ,- 1: QQ X Y v i Lf1 '1L XP! ff N-A f .4 P.. f ff K ...f , w- ,f fg , , X X X , i 4 , 1 1 v w I 1 'I I 4 I 4 ' P I 3- i rf, 'Ut i L 1 I X 3 L X: T H ,N I . ' 4 E X 1. 1' l l iw! ' f 'i:R-H.bf,'- Jw ' ' qpkf Y - I- Q a XE -I it ,f '74 f 7 I yr EY I Q., . Q, , , A I TfWiJVL 6i5QQiEM 111- 1 Mft' 1111 A f N S ' ,' , ,A gf 1 ' .V b. ,, 5gg.-'3i321i2:'- ' M 5:41 ' X 1. -. A:-.-121 'filfi 1-: + 'N . ',-Tr-.ff , -. ' - -i5s1E1l1-:-5'fiE15s,f- f . - 1' xi 5' .yi X '-Hee:Jiffstfilssazzf' . ,Y , ' ' ' .3 3,4 I -3' - t 411:-.ifz-t::-:':.:.:: .:. 1 . z., 1 , -- 1 A ,, 1 f .I VJ: -:---1--V: 1. 11:11:11 V'-s ' P ' I ' . ' 'ksi' ' ' ' f 4EEF555i:f2E:'.i2fx s X :L v ' P1 t 1 X, h',., j' A A 1 ff-H Q12 A hX..f'5w 213 Qvn lf-wax T2 ef , . ,, , K x 1Hf:fQ5?aTf2fc -, -'41 f 'ff',.:'E'?:,2n?f! 5' 1 -' -' ' Y 4 5 Y W ' ' 'fa -f , fiU'V 1' N 1 -A 1 . 2- M' ziiiliiigfgfiif ' , X -1, s . . , x , V .h 4 1 - J, 4, -:1'51::,s,5.,,33 .' 1 ' -A ' ' K 1 -3- . ' ', 5' ' . f , f '..- '- ' if K, ' , - - ,S5i52':,If' . - K 1 V - - Y, ' - , ,ff ' ' ' 1 V ' I L' .4z:3:m -.if A ' ' -' V, ' .5 ,,.,w J- 1 Y 'X fx lfg ,, ,L ui' 'ff IJ' f?' ffff W Q' ' A Y ' V l an-LEX i nn- WL---A x-1:4555 : , , fr V 'X QE ,-X A Q! 5 ' Qi? 6 2 1 ' xii 'Ll'-f f- :' Q.1..1-23?-'f . V1 - ' '1 T 'ye - ' 14 -- JV if jf' Ag fiifii 'V I ' ' ' I H212 3 gi: fi A rv-5:1- h,.Q.:p' 4,9 If 52, iqig-:Eg T--:Nfl fg-Tig: I ii , S xii: .I X, fd . , w-:fi 74, ji :xx Y .i 1 -1fff .f'5-ff if fi f A ,, Ti: Jil? -- - 561- ' , 1',' f,- K J F4 - I XX 2 - 1 1- . 1 A . ff -X ' f 2 NX , 'J K iilh H infi 1 4 , l, x -- 4- ' P 2 K' 7 ' XNN l , V- . j 34, W Y -X x If T - ' N! N X- .llifr -1 i 41 x' rgl ff 'ina' f f W. WNXXXXX X A Y- - 1 , if A' j i: if 'fT4'J .f4fw 1 ' llW wfi 2 1f m!1' v w w1 1ss wff1 'f'X .r 5'1i1ff i'.1f'j '5 ' f il W l 1!: giQ1LfUM. M ', ' 'if3i L f 1 , fllllml I ' if .fl mv qw Jw: N 'H N Ml.. yu' 1 A 11 PM U , L' 1 SEGEWQW, f f MMMUMMMMMMMMMMMMMMM MWv? V N V li ,, S. V E?-11' rin IK:..,,1 Csilif La:y5Q: 1 WH K' xx. Z5 .1 fi li! 'X 'A 3 3 E 2 f t.I lail ' V I '::, 159 'ff' V! 154 ,. Ni? 1rf O .-1 .,, .HL fan Yg' ,f U2 'z 5, 'f ,. . , :Af in 'jj ii 1 F55 iff . ,, -A I 511 CQ' Wig l ,, Eg? mai .gin Q , fIif1i:.,fa . N , A , 1, , J f , , , ,wwe .- , ,. ,, ,,, xx -iw.: 01 , , 'ff' -,, .QL Yw1 ':'-A-'::1:.Tt.i4:g.t.:.T:.i,.,,, ' 'xfhiqx Yrgynvwfi. fRTQo3iK. f..tg',gx1ggN.Qi-1354452 L5 'Qwy .ga WE 351-,L Wg' :,,- gl-Q34uVu,g,,,.,pgLL1,...g,,, ,,..., ..... ..4..-ggLL.g.4,... , K X 'i' , A , .. ,pi -, Q. A-W H' '4 ,,-Q, ' -hw . X Q - ' W - - A Af- -' . -A i ,K -Elk w,wfg,:tq'.-1-Q--7,'- 3:-M ,,--ily 1 LL , ' 'ft Xb. Qi1,.L+' if - u'.fff,..,.1--xy xr QW X' 'x,s,P., iffy 1 i X x 1 O r l I J i L.,- 4-- ,QJ 7 f. 1 X ,HX J. -f-ff ' 1,, ff .: Jfsx As . 49 T74 migflfjxff is - Wy W 3 iff, ---V, ,, gf x K K 2 7, N L f 2 v. , ,f .1 my I 4, 4 . ff :fig 5 f : ,,:fff-1. 1 f ,. . 1:1 1 -isa , ,M -':f.if1:U-ul!-2ff7f 'gm' - V-Y YL' Q FXm mMMMU1MMMM'111:11.Lw4LL1'Eium-.f:uqu1,g 41'.GEA'Tmrm1,Q JN, ,,,. 1,,igf7g,J,,Aq5, ,.,.f Jngf,-Mull! .-,.,,?,,,v ff4Z?Tff,-any-up-Www mm-i .Jg K 1 I ,, NRI f 'I f 'Z f ?'- 1 f ' ' ' 1 WwM l Y, A N Q W, wg N ,1 1 F., E1 ,N 5 f ' ,Q-If :QI Bye!! 1 AJ- Q, - 1,, ,V -I f fl ,. .1.v,., 1 fy! ry X N1 ' 'W ' 'VN ' ' 'z 'L :'f f u qw X. . X H' MH' 2 N Wy gf 1 ,qi Si W WWE if Y 1 .r M A 3 Z l if Maw . W1 Vg: Q .5 N g FIC 1 ir.-:V : W U35 3 S' Q Mm 1 W i 55 I l ? W y ' '74 X! Lim M551 4, S E5 1 f 1 ffwijfixbi ,ILS 2 33:5 PQ. H4 ' NEFF 55313 w .' ,gjal f 1.1 N 'X Nw: : 4 'YNSM E WS' ,M 1 H A 2:6595 V iixfj 1 A x lp f, W ' -ullllv Qfi-S 5 i f -H his Y E31 T5 1 We 453 A ,Nr FET' 'X Wffxg iix 1 41 xii? N M Q is 1 1 Q 1 JIU' ig 9 QSINV ' qw, 5 3 SH is SW W RNS ff. V is-. X 1 wg, M5 i if I 1 ' ' - V T' Sv' 5 ix 'FE Xu E L 5 if E ,QQ 6 , A ' , NH i WI 7: ' f y .,fsE3:I :ag I ' REM .41 , Qi! N 5 w Q W ir X re: ' a ,j' l 5 41 I I 'I ill J I ,ig K Q v ,',' Y-R ' A HL ff' rw lf-I Mf J SU X ffwlpm --H O vw gy. ,N.Yf,Q.AVX'., Xfkhpxx ww 7 kf'f 1w'1 Q 'M' -' f -5 .Q M llvglil Y L hi 'A A,.g-Q1g.Q,, Q Q ,V ls ,-'f.i:--if1'Af 'A fjillixl 13' X LVN :lv tl! I ri W: X ffitm- K, H K in ' '1T?'-fi-Ifk?i--gg:1'j+-T N '9 ' -'- W' Y- ff H ---f - V , M X , X ,XL K-X XA ,, j .5 ,If vy,',:I,JI7 xg: K 'S K 1 K '- 'N 11 X, x. . . . X U-, .n,.,..51K...v,x,4,- - X f , X - , f . . . .X k . .I .QI :xx H T T U' MH? N ' '7 -- WV '-'X mb ., fi ,A x.n,, X HHNX n X mn X l w x X . x . , X.. Q , V. -1-.,,.-- .. V, K- xx mx, I W x s ul 1.4 .-4 v. gg, I -. 5. 4 ,.4. -J .N 41. N it N . I '-' A'--' ' - Q .,...-,,....-5 .. ..f,,.' ' I I If H '- Y ' -A' ' R255 '11 'xiii . 4 V 1 , B I, V E P I I ' I m,df,..-.m. ...... - ,,.,..A,,. ,...,, , , ,,,A, 0 H- -,,, ,JW-Min I . , - '--' '--'---'-------------- 4-f- --W -M --.. ,.....- gli? 7 I 7 .zu I I f A IJ g -14: I in , Q' g PII K Ph' ,Q I 1 appa 1 5 liuxululu' 1-'1:,x'1'1a1:x1'1'Y ' 2 iff f - . .. 54' A Z C-lzmuam Summa. ur IIILIINIIIIIGY CIIAITEII f . - 1 '1 ' W I-:xz1.1,Im.l-.1 mu 1'I231I V' . . . . . I-if I ul-1-11 I-,nb Igggg 7 ' 'iizix Muon .Xxmuzw I.r:wls I'l:xm.r:'rnx, .In ..,. . . . l'rf,x-i,1, ,,f 1212? I'mnf. Illzxln' I'1mv.um lhzxz ..... , . l'if-4-l',',,-i.l,,,f Z I'IIUl'. Ii.u'nmxn f'lI.XIIl.IZS IIIIIIAKIII . I , , sf,-1-fluru g I'nm'. Humzn SIIIIPIIIIIIII IInwl:l.l .......... ,v.I'l'll.X'llA'l.l' EQE f 'I'3: Z Ifffi' Q. ' :lcixr - -ls. Y l. . . . - . . G. 5 I IIIISI. I,XllI.I.XII, C'u,u'll Wll.l.l,xJl .Xxmznsnx .Xl.l:x.xxm:u I'lmr. ,Xurzx Ihzxx-.ax Blmzmx 55 I'lImf'. t'.UIIHII. IJ.u'ls I5n.lM.:n:n .lnnzs XYII.I,l.XNI Mru, XX II.I.I.XJl I,.xwlu:xu: IIl..un I'nur. .lunzs linsmxnz Mrlhxnzx. ff: I Du. IiIl:1u:n'r IIII.I.IIUl'SlI Iiumzs Blum: .XNIIIIIIW I.13w1fz I'l:xm.m-wx I'nm'. Inunmr: I'm'rl's IIn.xxc'll Iln. xYII.I.I.XlI iIn.m:n I'l:nux' IDN. 3I.xumx I,l rlu:n Iinrrrnx W.n'xl: KIIIIIY IIIYIIIIS Il wj I'nm'. II.xYAmx1- l'u,xlul:s IInn,u'll I'nmV'. Iim:.xn l',xx1l'1u:l.l. SKIIIIUYIIII Ilrull II.uuus l'.XI.llN'I2III. .Imax II.xn1'l.l:1'r Smzru 45551 Du. -IUIIN S,wl.l:u Vunx I'nm'. 'I'mm,xs Gu.u'sux SIIIIIIILI. I X IDM. Juux I3.xscl'n1 i'ul:xsll,xw I'nm-'. W1l.l.x.xx1 Yxznxox SKII.IlS JA I I I'nm'. .IUIIN I,.xwm:Ncl: Ihxnzl. I'nm'. Ihvxn I,l:sx.n: S'r.n1v 95 5,4 I'nm'. IIr:um:n'r I':I'GIINII Illzxxlsux I'nm'. IJ. I,I1'l'IIIlSAX'ANT Ia.II IIII. XYlu.l.mM Ihzxnv Iinutnsnx I7n. Ihvm AIIII.VII.I.II Sxwru I Q I I I'nm-'. 'I'mm,xs Wrrr I I'I'!GIZlI,XI.Il Slxnlrlzl. f'.XlINIII.II'ti S'rm',u.l. IIIQY. IMA I'nm'. Ihzxnv I'Inw.xnn Glzxz I'nm'. IIIZUIIGII Nun. 'I'mm1'suN fmf I'nm-'. Iiumzn Smzmzun Iluwlzu. Chzunmz 'I'mm,xs 'l'n.n'w1cK IQEQ gl I,IIOI'. Rm' S'l'IZl'IlIIN Iilxu Du. IIIZXJABIIN IIl,.u'Ks1'rux XYIIUTII V Pnor. IImv,xnn Wum lhsux .-il I 1 7755-.TI I I V P,-I . . - mfg-11 fa I II,X'I'III'1S IN i'0l,l.I-.CIO dh 5 IJII Ch:n.u,n I'1l rsl.n:u .Xn1l1:N'rnm'1' .Xl,l:x.xxm:n 'I'lm1'rl:n IIl'N'r T35 NI.Xl'IIIl'lZ IIIIVIIIILY .Xsnrnv XvII.l.I.XlI I3l:N.l.nnx Jmxxs, Jn. MII? I7rIZlI'I'IIZ I.l:wls .XVIIIIA i'u.x'm: Nlxnlux Iirzxxlznr, Jn. If! QIIZIIIIIZII I'nl:scu'1'r II.xn'rl,l:1'r .Iuux 'I'11m'rllY Iilulzs, .In. 'HI 5:3 x'IIIINUN Ixuxs IInul'M I u.xxK Iimslznez I.uxm,l:v, Jn. EEE! Is.x,w Ihzm C.KIIl.ISI,IZ. Jn. IJIIANK NVv,vlT Nlxxxxxu fig, ef: Ilmllzu Nluxnmz l'.xu'rl:n lin' NIcIilxl.1:v llyrsux SQE If .Hunts IIl:l's'rls Cmnx IIIIUIIGIZ Nlcllnnut I ' S.nu'u:l. 'I',n'l.un I'm.ml.xN. Ju. I n.xxc1s Ihmzs NIm'l'll:l,mN 114. 'I'llml.xs I,.KI'IIIZN VUIIWIN IInn,xcl: .X1.1:x.xxm:n Blown: A' 'Q I7ux.xl.n I7.u.x: C'l'N1.xrr IIum:n'r S'rn,x'l'rnx Nmu.1:1'r II 251 Osv.xnUm.ns1llTn Ihvls I'fnw.xnn KNIIAXVVUIIII I'mTfmi1'. xl X'u'r:m NIANGIIT Ihvls I.1:s1,n: C'unNl:1,n's I,III'I'l'IIIfTT II.xnlus Iilxu I'IVIIIIII'I'I' Illzxnx' I,1.m'n Smxxxn, IEQZQI Wil 'IUIIN IQIHVIN CIIITZIIN .XLIIIIIIT IIAFIFIUNII Swivrux jggf I.0l'I CIIIICIZT .XITIHIII .XIASTIX 'fnxxrsox I'IIlW.XIIII XYz1.1.unr IIAIIN XV1x.x.1,ur II,xnuY X'.KI'GII.KN 13554, SIIIIIIIIY 3Ic.XN1.rtY II,nIll.'r0N IIICIIAIII' IQIINIIST NYM Kun, Jn. fffgf' .Txclcsox Iln.xx1'l.x:Y Hnzns .Insnru 'I'u,xnm's XK'.x-vrnns lgfi, .-E y v Q v II I-,Mm.:1'1- XXm1.xg-1: IIIXIIS Iknvn I.n,xNK1,1x XX IIITIT Ifgjjl Q G E . 1 1391.4 ow-'!,f?f9'f,.la Qjf ., R' , , , A 'fi u 1' A, L X ' - Q V FN I -A f I v. - W- 4afLflf - 4 Avi EQ 537i L V 1 ., ,, .A P -,,Inn,-,.-A--1-,,w-,,.,.I--+-lr, J.-.1-.+. fl N ,J Q - ' ' f - E'-1 X' --I .... ,W LIONEL ff- '2 -Puffs-.15f1'f V. QL XX.. if ' if ' --' . 'l,.'44 .r' ' 'fr'?1 ' : glib A .. 1' .. m31... Q i . - ,J , ' M 15 19255 1 f - N ' Jr: ,-'- 'w a - ., A' - , , ' . ',. X - ' - A xg l ,lx 57 Zigi' 'A K !kbf0 ,-,..J! I . he-'E . I .:a.,' Q .f , 4- ' N'1'3'N.w..:- ezffnziw 7 ' .. .V ' ' ' f 1 iiliQtil5m!EEillnrgigRE3i:: an ill! nuuImuIuInnunmesm1lusmunn1Inuiisii1171.3-m.mu.I-.mtSerif -mfw-1-41-.V-mme.muummm-in-Im-mum A-su'-,I -I -ff '-'M ' ' ' ' ::':' ' -ligirwtiq - apes ' W 1 v. . ,, N i , , 1 , ' ' 1 , A .4 R. Vul I P I T F ai. ., ' 1 hai I nmsiiiu... . :Q..... . f::1::u za 'rrmm:::::::.1m.-aa:naazza-.:::::u--mn :mu:::::::umnu::::au::::::::l::::::::ll:::::2n:::::1mllluuuuzzzaa::::::a:::::::::::::::snmun:.':::::a::u::nl::zr.:::::nr.:l:::uz:mxsaa::::::::::sll1w:'.::::. . ...--- .'m.,...,f ..., , , fx V N. s f- ' N' ' Vf' 1 Q ,AH 5 W 1 r ZW I w f'I 21 , 2 ZW ' . v Z 3 N W .. fl Q.. ,.,. - f 9 K ' , f . my V61 .1 , QQ5 ' ., f Q fi ,i ' ' ' Punk' ?'?0fnfY'x rQJ f-,- j' I ' ' K , , , ,V j,,?,2 Lf--,V y - e - ,sf V WI j: Q' jig Y ' ' 9 W , I . , ' - , 4, , ' ' y P V, y, . iff' ?g,. ' 5 'f W Q s ucbpe K ' X41 , in j xi 'ig W' es?-'L 1 ' , ' 'xml , , ' V V - 'l i if E A- '- ' f - f' f K ' W Q wg ., 1 ,X I' it A 'lf' i 13 :1 P 4? 2' 1- 0 fm' . El . 1 Q, ' W H099, I 5 5,5 1 ' X . if '! if 'A e Q! -I I ii Y . Y, A . ,r . I ,I ., V, ,x g Llvl NK r P? 1 Q, ,gf . 45+ H J . f NZ? Sa fu i ff A, - ' A 'Qwf-:sf gf f i W- ' vnu fig- r - f ' I RA QQL A Tfgds I A ,I ?i',55L,.:,,,,,,,j?7? , xi . ,, gjifg, I mm? l I L A E V, Q: , K: rl. 5 1 5 A , ji! X K, ,,,, V , 'Q 1-' 1 'fjf '- Q f , Q ,X-' M- L , L ' . A '1 Q Ly : I ' s . i s , Q, A T J ,ff l it b ,Ai N, ,il E 'dm' X x 1 ' 1 ' w my It LQ t' - aka mifiy L' - W , Lk if-...W -x 6 4 R. l b uh, , , ' ff ' '--f 'ww . N, L, , .. x- ' J ,if - f ' U ' -' N X U W 6-,I cc A J A ' , x ' N- , . , Q 1 , , Q 4 1 ', Q' DER?-4 1 ' LSR . ' ,Nia-cg I ,K 1,41 'mg , Egg Q ' 9 0' -. flmf . N-. , L 5, .. ' N l U ,.- Q I, .,..4 + V ,.L, ..,,, - H P. , N ,,,, I i Q , I 1 ,. 1 - .. - f , S , . ,Q - ii +7 N ff - 3 .oo Q ff:-. ,W ff ' 4 ' .Q l GV 5Q5?JKf Y 0 YV .5 V X fi WQLLY. V V .Nl-Q 1 H , - l 2- 'mf Q, ' '--- I S A 1 QV xvhq 1 I N 5 f 4 f Z 2, v ii? R Q' J Q x 19 f I , M18 5 I f si pf xi'-, X N X? Ni,-s X Q Ex M K x 1 N9 ' Q, ,. 4 V , 5:-my I J Q .Q . G-'NWN ' ' f 'fo fwe A- '-1 fn . , ' ' 'f'k ff .-v ' Q- g, Q , , Q vw, 'b . . 1 , 4' Mvrw' C UWHTCVX? 'f , . , V , 1 V A. , 5 X 1 was x GX -. 'QM .. -A-S PADCJ. -4 A 'QS 4 ' YY REQ ' g gi ' - '. - - ' ' is-iw p Q- iff'-' 4? fx -su 4VcH.xvW'X I Q 3 5 E+ S Im mg ig' nil S ig' N 5 S . , 1, E S 967,10 QI ' of Q ! axllyu 9 ' , ff -V - s4- f f x., 'A EIA- , - - , L EL K' ' ll X- ,O Lug I ,fC J? fees 5 Q O oxltigifw Q ' f , fowl fav XX . M Sf gg, 920 X -- FM , k X4-ZAQPP ' . G wwwmxxwmxx mxxgmmmmxxaxxxwxx LO ' H O ru lu, 0 -1-Q--f,,v M E E: Q ia A 5 1 JLG ? V . . , AiA A 1 il ' ' xr ' ' - 'X N .f l J N '4 ' I ' 4.1, -1 K gg ,U dim 1 'snr' sn A ., -- 'Tun f- -H 4, 1' 1 .Q . 'V' , ' 'M D I ' 'Ti L df.- J' .,,, ,.,. W-- ...-.L.-.-.,..L ..... E: . C. .---- -.-..-....-...J - ' N .f . R ,XkNXNWb N N 2255. XX? 4 4 IL O 'rm nz 1--- v lei, Qqllx Q53 ww allln n I Y l W A I -n :- b 4 ' ,- N s.- :TS ii u E55 rg. .g.g S: IQ.: Q Q :fd 1-2 S E Q L Alpha Kappa Psi I IONOR .-X RY CUM Bl l'1liL'I.X I, l li.X'l'I'lliNI'1'Y Founded 1905 l'1 Cxnwrrzn Established F li A '1' Ii ES I N I .XC lf I fl' A T111 JOHN lhxrmoxn Bvxxcrox W.n'x1: Klum' RIVERS 1923 Jm,1,xN XVILSON Ihzxsox D.xNn:1. Coomzn INm.s'rr Jonx Iinwlx Bums, Jn. Mucslnzx I..xws BlARSlIAl.l, PAUL Auzmxxmzn IDAYIS Clmuuzs Romxsox Pmmx' l'lmv,um Gonnox CLOODLODZ Jonx Maxam: PHILLIPS I'1nw1N XVALSII I-Ionm: Duxuxx SINCLAIR Ax.r:x.xNm:u 'l'no1'rl IIVN1' XVn.l.l,xM Rlclmnn TURMAN Wm'M,xN 'l'm:onom: XVxl,l,1xn1r,uI 1924 Gnoum: I:llANClH Dowmne linwmm CQRAHAM Mrznnvrr CAlu.1sl.r: l'Iol,m:mr.xN Fmzmzmcx CIIARLIES Pmrclunn .Lxmzs IJIZIIIHIIIT T,n'l.0n. Jn. 1925 Brix Romtm' l'.xnm:'rr, Jn. IIICIIARU I,1,l:wm.1.x'x Cn,xr'MAN 1918 Y . .54 ,.1, ..-Q.. .... Q.. H F3 .xl 525: J :Elf rf-r. 2-ilu 5:2 ' ,... . :.-.. F3 KA tj. .v.:. h - 1 5--1. .-.1 D. 1 31. 1'- -I-. -:Re 1 ...5 , 4 5. U. n :fl Qfil 1 . ' 1 .. E311 'figE5'1 by Fm XJ, I ' v fda Ear Cf I 1 S , Q ings 14 i 'iii X 'N EW Irs., r. gp, vfg 4 zf' .tug .2 , '- 1 I if 4. v. .. 1 ,, VJ 1 xv 715- F ,. J' , Egg grit' ry am-A -wx Q c ,av :g,.J.,,,4,: N Y 1 tl 'lf Y X n 0 Q . - .A ,w QUCYN5 W . GN .' - 4 . n Lf- - 1 ' 5 1 , , A-I ' x W , ,. , ,, , Vxwx xuf t ,J. !7iy...'Q'.'Jlk' ,. , . . ..-.... ..-.....- ,. .,. Q' if x,+kmbR,bmXx.NX.x,1mQN.5m.Lp.,-'-b5wgg355,5-g.--,xl-:ii-.3 E W E-Q71 l 3,351 wg 1,g-1':-1.:g3g-j-1-1-zgmbzginaglcgi-2-.-.'.-.-.-.-.',ggL-1+ATSETFE-:-.',g.y:-.-.52-1+1-YQ X L V Y W if ff. . -N b-Uk , A F ,Aj:.y'- 'a ,Q -- il L L V LION B L K, . 5 . g1g,VN'Bk rl'-. X' .rf , , . .6 J prff' j fixes! V1 -Q I -' -'if If FEV ,:: : V . . ffs, E I I ,III I ' Eur' ' f HW N --- fr-7-f CI 'I - .1 A . . ' 1 7 'fm fx . ,f, X-,1.g,'af-7.2 I L-,I.,.,.,.-,,,.ff 33' ' , fzfifv V fi IQ ui, ,g xx. - I A ww' ,4 if ' h .,, ph?-Z. ffff 'up-' fl,- H, 1 KN '.---Q35 . I , ' -ff, , ..- ..- .,..,...n ................ ...::. ...+a:.1. .::?::.:..f..........,,...,...4L...... ,......................, . . iE5Hm i2lW ' ' mm!Illllllillllllllllllnmulmllmmllillllululmmmu u-In--11-:m-n-r----,A-ml-mi 11 muxfmm munl a--I.-nu . . 1 :LA -I Y - -.E ,P I , A 4,. -. u,I,- III I' f , , A I ,Q E INS' I I IZLI -M 'I XIII ' I IEE' IIIII I ,II I P ' I ' : gf i I' I -4- 'luimmn - ff' A'L. '-r' ulmum:IlIl:::::::xr.1x1.I:ma::u:x:ax::'.:u:l:x:: IIZIIIIIllliillllllTSIHIHHIHIIIIFHIIHIWSEHIIIIMNUE' Mm:m:lmmuxmBmlnHwmwS5: rm ...------ J' .... . - il! X Kqm I x I Q31 I I , , . 23 I I I I N , I 51 I ' , I ' I I I A23l .'v3v5z95x3! V . ff? f 112 I W ff' I , I X. firm ' ,-,gk ' V r , f I 1 .. .. ' Ig . I I IIZII I Q ' ' f , Q IW! In ,Irf I 'I , Q, I IQ' , I -'WZ' .., 2 ' I 1 ' ff? I MI . ' I I I I I ' 3 SM W' f I gif? I MII, I 'Z -Silas 444 . 11 lim 'V 3 IH-3 , I, A ' A 'I SFHLEQ' I 'SGACREE3 , P554 4 1 I X- E- . A-I V I I Y I! II' 4 RMQQGN . MSWNON I I f . In-.. ' ' ezwsi- '- ' I A . fgyfffl 'Ml KM -3. 5 hr, - I..1 2 I 'M' II M 'R I ' I I ' S I I I Aw 5 95137- - V IP I ' 'a 'Wi' I wh I I 5 f - ' I I I I I I In-xv I , , 221.5 ,ff Mg,,,:,,gMf'g:.Ig 2 gp 1 ' I ' 1 I I ' I A- 'I I 1 I Q2 13 ' ffE?5fj' ' I 9 2 I U I X. I K gn, I 'V fgggfqnvi f If 3 1 , A' xufH.ALI7EN A ' 33 1 MWg?I5i'5T 1, 'Q I if I . Q V - . -k I ,ft K ' , , ' . A 5:5 Y I 'UVLYIQNJV1 E 1..:-Q, .X JOHNW . I Q I , JL VES , f..,X N, I ' , , I V .REE I h I I IX I ' I ' 9 - II I ' P 1 - IIS ' I - fi 1 f 'I I .E+ I I :Is If Q L V g . ' ,. v,,. I Q, -, Q1 ' I fgyxxg If I Q .iv::.v,,.x,fy - K, If 34, H V, Q-in I E 4 :Tj . , g .A 2 ,,, , If . - 1' VV F xv Q . I , vim I ,S g I 1, ANSESSIQQS I I 'G-HARRIS. I ' - 5- IIQ , I 9 ru vo I I ff I 61121 '-my I Ima-Ifuekff N Y V ! ,. , ,V,7 5 X I S . fJ.Q.',f'I- I fx-.p 40-CARIER I X N 4 Z 4 I f 9 I 4 5 X Z 5 KA Q 3 rx 1 wt x S E N I E I N S I ,o .I 0 1 HIIMH 0 IIL1. gg -56 up ' X-Q U X XX. DNC AJ? 188510, 'ITN fKl.il?23C'ff1 X I ,x 452:--'-f ' XO I I I I Q - ! Ag, H5 X I '- D , Y -- - 5 STV, . 'V' .nl . ' rl ir f Wifi Y iA V rn' Yi V g 4 ' . . . ,. , . QI ' 'f Q ' , w ' 02,329-1pmwmmyf , ,WMMGE-5520 , I Dx mmxXxggxxsmxxxFmmXwxXxxmmxxxwxxxxg' -- , I , , Hg ' A T- Y W I, fl ' L10 - K, f Y N Y Qy+'L,, 'B' - 3. ,I'A'....l,1 sr fp: f,-f ' O- ' ' , - f'- N -H , 7. Y, Q - ff I I I I ,g.1.,QLW5:4,.1: K f sl' Ci 's X X. -s I1 .1 ,- .1 .1 .',f Q1 J: 1 ff. ,- J ff 1 ', V .,- - wi I 5 iikk !.1rX N Ag -,! , fl 'i z 7 4 1 4 ,f . Gffi . Q15-J In H .,. Q ,-L . V I 4,6 Y- g- 45 F , Z 'L - -1 ff ' -1- - +-f f -- -- -,N gggggsasggggszzslnuezaaasvmwrssssv . ..-1.:1 .,.. ...f . A ww.- T 'if' -. . Q-5' dw-. .f,..,..., -TL ..,. ,, ' . '- 'N .. -..M , ,. . - isa.. ...f.. H ' 6 ----wi ,Q - 1 f MIHE BLVE: PILI gh' A. . B . f' M ., ..... ,,,,,,-.,-,,,.- V-, Nm, --W VV V V rm V ,Y , I V MWHQ AMMMQW-W-- VA Q-'jj iq J M 41532. . 5 .ilu L 9 11: y , f 1,4 E Z Qiri' 2 13 9 i tif . X I ' f . ZA ! an .5 f , , ' , f D lt S P 4 e a lgma 1 1, .gy 4 1, :P Z M gif? 3 I ,ue I Z . .,. .,...,.,.. gifs 4 CUM3ll'.l-lI.XI. l'l..XlI'.l-NIIH 'gigs Z 1 iii I Z K.XI'l'.X f'Il.Xl'l'lIlK Z 2 if Q Fnllllflufl 1917 l-INl:nlulisIu-4 i i 2 1 Z Er53j f E-f-. 5 l li.X'l'lil'IS IX l .Xl'l'I.'l'.X'l'l'1 'fi 5 EE ' Z , lil' :Lvl lll:,xN J. Bl. XX ,vnzus I'um'. ll. li. Dlzxxlsux E' IJ' -ff x'f.', pm 15123 Qu 'fy I':l'GlZNIZ QQIIANVIILI. .-Xrluzl: 3l.Xl'IKlL'l1 .lusrzvu 1 r:x'ruN Q al D,wm IIIIINVS lkuumx Lmxlzl. .luslgru llxssux L 'llL.'t XVll.l.l.xxl llnxm' lfum NY1l.l.1.x1l xIlIllIlIWlZ'l'lllIll IllI,l., .lu 4 wg l nlmll l cl'ronn I w I wx IY N1 'lvrvnr In . .. . x .on. lu. I.. . 1 . ... . xx ., 1 41 Jmuzrz 'l'llml,xs l':INVAlIl1fl l':llNll'Nll Rlfllkllllfl BIKIIIGAX u E-'L lixvnmxlw .Xmxmv Sr'x'rl.l:n W X . L :RQ lq-1.5. If S ' 125 E f 'Q , W,u.'rl:u lhnuts .Xl,l.l:x .lnuzs l,l:,xK Rl:r:v1::: Q! ,. XVAI.'l'lCIl l'lll'l'l'l' Dnrlmuzu, Jn. .Il'l.1.xx l'i,XHI.lI SBIITII .Mmrts Illzlmmx LYNN, Jn. XX'.xx.'ll1u Sl'lIXl!II! xYI'l'llIIIl12 Hifi - E's! 'l'l:nlu:l,1, IIIGININ Nux W1 fgf. X fi 1925 I-iz iii. l.l:N'rnN G.u.l.uw,u' C.xn'r1:n l.l:l: AlUI'I.TIlI.lI Slzssmxs 3- QQQIE FRANK GLENN ILKIIIKIS C'll.uu.l:sl71.xxx.x i'm.l1xw '71 ,lux - xl rlzgf. ' Ziggy :fix bf I lr, 1 LW . ww I 93 4 sg. N Hg I 15 l x V 1 if Af-,-YR 3 V M' C?'5i5L-q:li'i'- ' - ff 05 55' Q. AA W V - .... . , 135f:i'35 I 'YL ??l'vLf ri v XA WOwxxxxxxxmwmkwamxz-5:-zgquuxvr-RSiTfq.'::mb:1::EL-LCIEI'-'-'-'-'fx'-' if 'Q - ' . - ' .'.'-.'LdQ3.. i.-1.-L'., 127:'.Ug-Qf.i.fL.L. . .QQ'j'1'i' uorxcl fa ' .- f ,ww fl- 1.1 L QTM1? 1 - 1- Qd XO v,' Qalfi... .Lf-I-5 ,.. V 1, -..Tj - NV'-'K'. !, Ex - Qg+1:,..,..f' W.,-z 0 AXQET ' ,gg-vw.. Y -.-- :---W tw Y H, f-Haan:-aux.. f Af 1' 1 iii in, , 1 .. V ' .I 4- f IQ 1'- 'sf-J, 1, . ' 1:11 33.- Inf: f-15. -:p1,5' 5. 1, , ',,.4g 155. , -,QZAIIQ X33--AM,..L . U-J- ' K . I ' E ' 5 . 3 - 2 .I 5 'f 5 . ., 3 it .' 5 1 r I. bE:- Oll!l9' Q - 1 - v 1 1-..,, s. . ' 'fdaxnlnliiwlfr-. g I O2':l f -.SXYALQ . .Q-5n.-1'eM f'F 4w4v'li'-1lnl14l qr,.,n I ,r-- . , fi fn . . In Q . ...E ,..,f , . r5.?-IAK Socsavw' FCC I-DIC 705. OF'F+C-ERS fn Ti. 5-'VTOIQ - - Ffa' '-L-.f I T3.Uf'f'JN f - Vcc Pruzcnvr 'ixrw mp: - Sscannf E.. BC UM . Tnznunn MEMBERS Anmazvrrzoutx G. E. Mcborzcucw. J. 1. Banncu. D. I. MCINTTIE. .!. F Barium. V. L. Hzvcvrruz. 'lei M. CARTER, H, :.. riawazfz. C, P. Enwanbfs. J. T. STAT 1-Q. -'- rv L-'ww A T .,4 .. . , tg: .- 4- 1 1 if ' - X X 'gx 2 X29- ' 1 - . f Ll0rH:1. ze- Q -5 'I --21. ,Af-.1--,.f7f'.'.5 Q .L 2 .4 J .4 4 q f 'V fxpm . .. , m. '2 'H - -. - -' ' 'Ni' '- ' -- . f -. n ggflsgggkasl t tzmvmmnnnnmmn f-mnmumwm.-dm ff m N ,Huw 'A Mn il K -gear. H K - A if-Emilul5'........ .... .. aazuuxusz- rf.. ......,. - ....,,,t1:,h,,,,T,,gMw'MTW W L 'r AV I C CW C WL' - M '+ ii? 4 aw ii 'Nr-.' 3 3.5. .1 W1 'E avr- S A fm 1 I - 1 5 i gi f A ' 5 ff 1 v I 1 fa -5 I ' sl I i ' . . L . 1 1 ' F : ' I S 1 15 ' w w I? 7 g, w 1 .AQ ' x 4 ' .3-W -nn- 7711 I , , QA, uw' ?C': T up, K . 5-11354 N' 'HK am . oseme SOC1CtY Am 1 ,p , y'. 1' lv- -lzx -S54 gllllg Founded 1912 Mfg! - min- A f . fy. foi 1 o '-h..1 II IA fr' 1. VK. D. I'IARTFOIKD . A D , 11,-f,-iflffnr C. I'IOLT.EMAN . . .... I'iff'-l,7'l'.N'iIlI'llf W Q C- P- RATHER . . Nvrrvlnry nnrf 7'7'f'I1N1I7'Fl' ,I 1 . if Z5 A . 553 f fxLEXANDEll, WV. Moomz, F. D. ' 5:2 f . . 1' Q Ar.1m1GHT, J. G. Mrnmnzv, I. BI. 2 BARNETT, VV. R. R,xTnmx. C P. b I f DENICKE C. Rnnvss. H. I.. 2,1 1 f I J I . V: 2 ENLOE, S. VV., Iicmxn. R. XX. Qui 5 ILIAIITFOIKD, YV. D. S'1',vroN. J. C. :ij . 'I 6 HOLLEMAN, C. Tmmrsox, W. D. Q5 5 MATHESON, K. XV,u.su. F. O, Jn. Q w ,ig 1 9' .Zig wigglr f 'E il . viii ,S 1,..,l f , , X211 , h. . Q Apu.. N, O . V11 W J if 02:44 -F N i .xx Dgyxx - J C C . .... .C . Juif 310' ' X552 9 .-CQ ' f , . . H A Vg QLX W- .,., .,...... . FS 9?'fff291 fWxyffy7ffmfffpz0S0mS4QQQwQS29f5zs2:2QQ9QQ4m,,4.,.sg-1 5 Mggwgj g S ,lydixz A --.u ill Q, lliq' K, - 5 X , ' 'Q WLM-'LlQf .. Q FN- 5 1, ., 0 'Q L -U., , 'A , 4-AC ,M ill A w f 4 uw KR .1 V. -:uri f 1 f - n, Eiif::-iyllggugn ummm nluunnlmuumnnuliuiniini--nukli-'u ' Hifi-3 l-n-: in-I --f:--f- i-11114111-4-U'''WNf f ' '- ' ' ' ' ' 'M ' W :' ' W H ' ' ' ,gi MN F' 'I' H L V E. P ILI J . J- fs fiiiu Iinigfeu.. L.. . :ssuuinannuzammr-nnnlmrszsnuaaasr--x-I ----'- nn mx num u::::::. .::ma:::::x:ml::::ls:l:tSl::::i:l2I1Hmlur'-1::m::.'!:-Imawm:n::ln:n:smm:l :m ...rm -- ' Y mf fi . ggi 5? 25: . 'IQ' HZ: Q r X Ei? lun H5 Hg H551 ME! ., fl if .1 .il 5 J N41 if if 'J -SE E L' L EE -- '-nn: ' B ll D gm u ogs S . GQ A ' P Founded 1910 . 41 mmf Y q fi 1 OFFICERS ,M i J. J. MCDONOUGH . . W - - - P1'6Sifl6I1l' 'EJ H. D. CARTER . . ...... Vice-President I A. T. HUNT . . Serwefnry and Treas'zn'0'r fig 5 - MEMBERS ,Q I, AT.BllIG1iT, J. G. HILL, VV. M. ig.-S 2 BARNETTE, J. H. . H0m.mI.xN, C. E g Bfxnnox, D. I. HUNT, A. T. 2 BORUM, V. L. LYMAN, VV. P. S g CARTER, H. D. I NICBIIIDE, G. E COLEDIAN, S. T. MCCONNELI.. F. - S A DAVIS, O. G. BICDONOKYGIYT, J. J. - Q 1 Q FRYE, C. A. DIITCIIELT., XV. M. S 5 GIIANGER, H. G. R.v1-HER, C. P. 5 Q VVESTON, C. VV. J 5 I I? . 5 .5 1 , Z I N 56 N ' wx 5 xi 0 ,.,,u 'S' -X-1 E582 Qi. muy, X1 37-,Q lg, U, .J N. may 0 fK'i'gW-53151 -D u 2375 ,AQASJHQ 1, , ' Qi C D ......... .D f' . .milf XF. 5.....:. IE GG. .C .G , I F - , U - W4 A - fx H- A- w 'il 0Q',QEvMw.asg509ygpyf,9pWy4gQwof0fnzQggsQQmw2gQw2l14yygf fp ' G ' na... vgsgllfa .. . RSM... .C A. 0 J 4 .Q 4 1' - .V 4 o '4 Q 1,4 ?' 1 W 4 . 3 553 bl' F6 . -5-I 22.5 vi -C f 223 ss gl ff. yi 5 fi Q S ka 52 'Y S WEN ,gr1gnwi'l f - -A-- mn 11... .... ..-... - . f , .',,. V '- nqru f N ' A Y A-WV f' i X A ' - ' ' vz : l .. -H:-'i -.,. -.. AE .. e I f N' I OX Ga., 4 f-- 1 X ' 1 'Z' Q X , 1 Z 1 xx ,-f X , , v., N-, gl I 5 Bu M J -xi -I 6 i Y. 'W K T' .- . - . .ef I .-'EE M m T H E, D L V I: 1 I 1 M ,tilulil-F: ........ -1-gulf.-ffw----... ,.,. vw., A: , -1 jimi- , , V 1 -W -' W ' -0 -- f-f ' f ,SQE 'X A s Q S ,f 9' W 1 5 I A ' , . x ' I i 1 t N ' 4 2 is N 1 fx rA -I P 4 H14 p-4 Skull and Key SOC1Cty 1 I 5 v4 K ffl T IX II Cox TI UNI Wi NX IN VIII Tl Il mm IX X xp N I P I 4 Q N l X K K IXIII I'-55 s 1 :xx Xl V X TXXIH 'Q J R4-f j f 'S g I NJ x' , -mm KW Hmm IQ H Q M-930 LIONEL K Y .J 4.4 5 44 ., . - . . iff . . . . J 13 rs 5 .X ' 'H fm ' A . Q2 3 9 ' 'Z' ., .. 1 44 lfls 1 5 , I.. , 4 Q :Vg 1 Z A 1 E1 . 6 I 512 Z 5 lg T X ' ' 'I Z . 5 2 ,Z rg , ff gm- 1 X f ': ' ' 5 r 1 9 l :E 2 4 f A 1 s . I is Q in . ' ' ' 5'-I. .1 wxvwxh lybwil LQ A fl ' M mai I ' 5 Vzfvb, pil p . 1- W YI ' fi ' Wy w L 4 Q' r 4- 3 mg 1-'.,..m1.-11 lvl: V15 I ff , K'-5191 I LV 'lfjl v q S. Nl. if ul'1:N'l'l:u . .,...,,..,........,.,.A l'rf.-'ff fl Ll Qff.Pi w y , J lui Q C. l,. - UI. . ' . ..............,....,,., Viv I-l'l'l, Ivlil I X S . . 1 if E: xx . II. I IIVIN ..,..,.,.......... AN'fl'I'Yl1Y1'.fl fluff 'I rfrl,-ufr w ig xl:-zxlnrzns gg I lm... J. '11 M -xx vw. la. lv, 1 if ? l5l..u'l4, AX. 'l'. 5. NI Vx HA. li. ll. ' E 555 lx . .x. 14. NI -In-. H. x. Ii, Hn: ':l. l'. ll. NI 'XYnam'r1.n. YV. I . Q L'.xn1'1:x1-lin. S. Nl. U'llnn1N. li. D. lx AQ Q lfxn Z , I.. C. Sx :na F. ID. I l'lx.xmx.xx, li. I.. Sx . H. . H1111-TIN. l'. Nl. Furs: I.. NI. 1 ggg cz Y xi Il. sf-. nf... xv, If...1f.. l Ihp M. XY, -1 . A. Y. igi Jill. .Y. C. I.. X S7 4 EE 1 iii lz?? . :Bias 5: Nd 2. MEM nf' V51 . Wig X 3 Ziyi Q Abbb, f Q -J :, fi: .4-, 1 E322 Y - X - ff:-. 3 sv-lg E :REQ M If 'M'M 5 J fri 5 - 4' g ,wr 'f - f1I.f'f3'f-f 4' '.'- W ' ' 'Am 'Q 'Wi' if-X3 f 4 f 4 4 W Z 1 .W .. , I AT- K - A - U N 'i - ' EXC - - Unglgggggirggggggggmqlqupl I QliImnmmmIQIIIIRIIIFGZREJIIIA fllu :.1I:1v'.?:iQitvSFIlII-1: --1-- e -I-1vrr whlUiYlll'Ii 'H: mE 1 'Fn ' ' ' m ' 'am L::':':'L-'- W 'Hm '5 'm iu 1'. ' ' + 1 R R., I , 0 P I N f I I ...R I. I H E: D L V I igiiu u E51 ..... i ..... . .. 4:::nmR::::IImasrmnnmxsnusnnaaaazzal::nI:::1a::m-- -' .InIxazxzxumuulmzznamll:IlIn::::::::::m:::n:xu:::llH::lll le: ' ::n:::::::::I:nr::1amz:1zzlzznxzaninlumnmnnasilu. - ........-- fa. . . W I fjfAA44 E , I Ri I I I 1 , V ' H541 ltr? Ii! A Q, , Agn . 5 1525 ESQ A4531 - 1+ W '11' 1 b I I, I A Tech Cotl Ion C u Founded 1912 GE, R 5' . A PE LA J. H.'BARNEf'IT . . ,. .. ....... President , 5 ,I L. G, MOORE, JR. ..... . . V-ice-President I' W. M. MITCIIEI.L ...... . .Secretary and Treasure-r lim, IKE P 4 ' 4 MEMBERS .we ALBRIGHT, J. G. FARNSWORTH, VV. B. NICBRIDE, GEORGE 47 fx! ALEXANDER, VV. B. LGIIANGEH, H. G. NIACIXTYRE, R. A. 'T I M ANDREWS, H. HARRIS, A. W. lVICKINNE1', R. NV L if BARNETT, J. H. HADIDIOND, C. K. NORTHEN, C. S. lg BELL, J. F. HARIIIS, F. G. O,BRIEN, E. D. fi' BIGGS, J. E., HINES, E. W.. P111-5, L, G. S BREWSTER, J. D. HILL, W. M. RATHER, C, P. E BREWSTER, P. H. HENLEY, 'R. L. RQURK, J. XV., JR. BR1'1'1', , , E.-IIOLLEMAN, C. ROBERTS, H. R. , BUTLER, . .- UNT, A. T. RAINE, J. S. R , K' BLACKDIAN, T. S. INMAN, W. P. ' SAUNDERS, F. D. 3 SI . - f , x. 5 gifwfqifj' Il2FS1fT37Tl. R' G' 325222-1 gli. A I Z CLARK, D. LECRAW, A. E. SIRLEY, YV. A. I.. ' Z CLIFTON, W. M. LYONS, C. A. , SIBLEY, A. B. W5 Q COLEIVIAN, S. T. V MALONE, R. WV. SPALDING. XV. F. Z4 CARPENTER, S. VV. MARSIIALI., M. L. STATON, J. C. E 2 DAVIS, 0, SG, . MARYE, J. N. ' THOMPSON., G. A. R ' DAVIS, P. R. MERRETT, E. G. XY.-XNWVINKLE, E. K S , DAVIS W C MATIIESON K. G. JR XVu'I'IIAxII E C Q I . BUBOSE, MERRY, A.,B. I u XVLVPKIRS, .C.. FICKFORD, E. MITCIIET.T., VV. M. WVALSI-I, F. O. A 2 ENLOE, S. VV. MORGIKN, E. R. WVESTON, C. XV. 2 g1LDER,CM.AH. MOORE, Ig... Sr., JR. 2Q?II.I.IAM'S', HQ A' S A RYE, - - 001112. - - f RIGHT, A. M. A 2 FORTSON, H. A. NIACDONOUGIT, J. J., IH ' E S crfxo 'X Ill, if Wil -hi? RL. . USE o xv 7 di 0 - 500 I ' D X A fx Q 0 ri . N ,I OFT' I f I X wg .. . YAA----A. W- sf! ,' GI , ,,,, 1 1' --.!':x ' 1 - I . ' 1 3 , 1wnywywmwfmwMMQYMWW0224fi S ' QS? l f , ,gf L mon en. R- 'V Y I V V N ' 4 V' - glaaigjifi 2 ' Hin : ' 0 n H I ' I I I I YF' .0 Q? was Y V. f fix J 1-f -1 g:gj,g11ns 1..:xm:E:---1 .1..-,fmzm ' A.-.A,.- ..,. -. , . - ..:' f-' Lzi , -- .di-Q X X q X . J , gr. K 1 :xx f 41 S, ' L T , Cy L . K -S QL'-Q 1 L-MM-If A. fy ' 1 , Q V- -ff f 43, K . ,- L, N 1--fr. ,f f' x QQ. :xx xx .sau aus: 1 mu ,,.k,, ,Mu ,Y ,,Y.,. , , Y, ,A A , -X7 5 .3531 1 I I 4 JL .f . ' .454 . 5151 E E D LV Ii P - 1 V Q 5 Z 9 3 4 f 5 94 3 f Z Z ? f Z 5 X 5 f Z 2 4 Q 2 4 9 V! 5 f f if Q di Q I P 4 lil 611.2 v l b my 1 nb.t ' ul x qs b 4 'mg l ll - 594+ wi 4 sl N. N E N 5 13:3 Y S PQ N -w 'Q 5 E S Qc Y S Q S s J 1- ir I Zai- gw ff A 'X' ,ISN Q , .-,- I Ex TMIU- I , imigigi w XxX 4 W XX-I K xl .mm , i1 'Q 3:11, ' br- I if 1 I tdxlx, X Lf! X. I 3.2 .I V Q , I 1 I K ff 5 lx! X P' ll N i n '.l X41 N -. 6,2 KN ff' l f.5ff.,,,.mw17X V, .E Q: Q. 4 4 deff 'f lf, w' 1 ' N -JAX 'X wg, 9 ,fr V 3 ,Z fy f : Ciggz? L 124. fi, a ' QNX: 'Ui C7 .3 , ,x. 'W 53 l 'if X 11 'I -21 li X QT:- g-., E I-ng .Vw I 1 'fn ii-Z kj. E 1:15 1 Nw 4 2 1 1 Q-5 2 A 3:55 3 V: 4 iii 5 I , , ,, 1 ,: VE 4: V Q mbrxf J-,,j-, - bl . 4 FF, QXTQQ Qs Vx? .ZX S ff 1 sw Him fm-, liffii-3 ll Hi 5 lf! I 4 Lf? ' 5.2 fi is V 1 , .-, ki J 1 '. X51 ' aw 'I fa 31 -s n !1. 1 lj' I1 'J 1 , fn -, . 'fi ' 1 fry 433 Mig I 'J 1 132552 45356 E' fi . v . , . 1 V,-,v,v,v,-,-5, , . . . , . . . . , N -.5 ' M . 'I Q-QLHAQ ,,., , -vi . 331-Q 5 gf- '.gf,,,gg,4gg.13:g..,-gg-.'4.'1'LV5g:gg,,4..Ln'Q' in E37 T .:,,, , .,.,.,, 3x1 fl, - ' Q ' ay f 'R-fx23-E.:J--iii ef' LILNEL K L 'A nC .,Kfij'z7','.Q . xxx L, J ,. -XQD-C'1A..-1 xffv 'Ny J ish gp vw Y . 'Z 1- , 'mmf g , --X 4 .v 'fT' L1925f . 'J ' ' 'Af . . ,,, . . E EigggmigiigiggllIlzfggiggigiimlllnlillHHIIIllllIIIllIIII5IlilliIIIIllIIllliillllllllllllllllliulxll All: ull lllllvlfl' 'llx'1!l vi l 1 1- r vuvz lexlvhlllnigllmllfl I .. '-:gg Fjh l alive. M 1 5 lilh FEI ...... .i.s.... IHill!liiiiilllllilliiiliiliIEIIIIIHIIIIHIIIIIIIIEIIIIFIII Ili III IlllIHlilimllllllllilllllnlllilllillli IIIHIISISIllllIHIlll2::llllllHlllllIi:3lIl5Il52lHillllifmlillliillfliil fHBllZllllUnllT1u lfBHulCa:5l3'sIi3 Z'.5IlL .......-.-- .. Jai, ..--. i. . We - ,ga X YU 1 1 5 fi E25 f ' A ff 6' , 5, 1' Q . Fi 2 fa ZW 'Q 3 ,I i XX . n L A . E -f '-au:--' iv 1 3 h' I S ' r- . pg ,MB Arc ltectura OC1Cty . M vu - .V T Founded 1910 Vg. Wim- WE' 1 , . .711-1 V 1 Q :- ' A J. B. GILT, . . ...... . . . Presideizt 4 1 I N P. T. TEAGUE . . I'.i.-0-11.-esffzm B. C. HOGUE . . . . .Secretary J. S. THOINIAS . . Trcfasurvr ' MEMBERS fXI.1NIOND, A. HOGUEJ B, C, E , IBARTLETT, A. L. HLVI.SE1', H. B. A 2 BIIAIJBUIIY, A. T. TWIANNING, F. XV. 54, ' BRITT, J. O. MCCLURE, L. C. Z CHANDLER, G. A. MCINTOSI-I, YV. M. S Z CIIAPINIAN, H. K. MERRY, A. B. N Z CLARKE, L. G. SANUERS, M. E. Z CONOVER, R. T. SNELTJNG. R. F. 5 DAWSON, M. T. SPOONER, D. I.. E Q DIDSCHUNEIT, R. XV. SWAIN, J. E. S f EI.I.Ell1iE, H. L. TEAGUE, P. T. Q g TESPENDAI-II., K. LJ THOMAS, J. S. Q . GII.L, J. B. XVEEKS. H. R. Q A ff HERRIN, T. D. xVI'TTTFIET.Dv. J. J., . Z Tm Q Q 3 , V 5 ST ' f'fF- J LK.. V ,JG 0 .X V' - .. - X Cfgyffmw.Zwmawfzomaypwmmmazwmynxzrzli4lfi E I Q :S 09 ix-Siftximzgislxmxmggs3S:iXmEbm1St L X lor: EL K Y ' V ' ' .B :Xing-Li5f,.'Q..T 7 ...Q 1: WAY- i U X 5-574. Q 1 Nqf.f'jj.,...gJQ76Z '-: z 'r - 1 - nl. 1 I I .s si- . .X J - I I4 'r 'a 1 ,ga .v IC ff , 'F XTX - T. - .sf -,JV . 1 X r .N . If gixsf -W ax I' .5 ,M .... r... -.. ..,. - ff W ,ix E?f Y-M bfzif v- K o f-- aim A,-.HJC - A EEx?5'xI:Ixuzzzn.xE53:.. .....- .:x ---- -- ----- ..-.L..... ... J.-7... I xg:-J L- ' ' ' I ' 4' ' A . - S3 .4 ,fv ,BW I 'Ia-i I-if? I 'Z ' I it: I :E QQ 2 3 39 lil? . x I I I 4 I 5 . If I If Q 1 Eff I 2 ITE I sf .2 I I I E13 I T VI' . , I II. Z I Q. . 4 I E ,. gi ' I, .J wfiljh n r D1 ' Srfcoj 72.921 ILlL.QL E C . , J I I, I 5' II 5:11-A merson hemlcal SOCICIY If Q. Wish Q31 I 41 9 I 'IIN' Ei YV. H. V,xl'c:ll,xx. Jn. . , l l'r,,,g,l,,,1 1 . . Z. .. xi 41 Cr. I'.. ,xlIJIl'IN'I'IIUl I' . , l'5,-,.p,,,.g,y,,,, , W. Ii. Illnmlmwlc 4,,-,-,,,,,,',,.y',.,,,,,,,.,,. I Svllinrs .IIIIIIIITN ,s'f,,,l,,nn,,r'r,v I AIIMl'2N'l'lI0l I', U. Ii. .x'lTlIIlNlI1. U. l'. Ilnnp, U, x., ,l,,, Eg :x'l'CIIISUN, Ii. II. Ilnnwx, .I. II.. Jn. Ilu mum' II. I'. IIE' 'v . . ' if I I3AII'l'I.I'2'I I', Cf. P. Ikxsmxs. In. QYIIIQSTIJI. W. I-Q, ,lub 3:5 Iioxn. II. l'. Nunrmut. I7. I . IJ:-wmmnv, II. II. Illmxclr, XV. Slcwuz. XV. Ii. Ilwu, I.. li, II if CIIASON, A. I.. S3l.XI.l.IZY. I . W. linwsux, .I, Il. 22.1 Cmnlf. II. Svrnnxn. II. NI. Iluu. W. XV. ,I I,llI3I0CKi3XV. IC. Wmn. XY. II. I,m-pg-rr, ,L II. II'1sm,xN, . J. Blum, I-', ' 'jf 3 I'IU'I'l'llICSON, Ii. II. KI:-xmin, II. P, f. I,IIl'I'CIII-Z'l I'. I.. C. Nh-lim. 'lj IZ. it SM'ssx'. C. IV. Bldhxvv. I., J. 'jj Eg V,wui1.xN. XV. II. lImfIlux1i.,X..I, ' XV1f:l.1.s, B. II. Nr-r'rnru'r, II. J, H , YV,n'rnN. NV. T. A Q xx-IXKIITII. 'If Q. I-35 .lj , Iifql 2:1 1534! E1' I.:4.' ' 5' r- Iiifu ' . '5 ' Ig , - H3-' 7f'1'?I '-'dx'-. Iflfg I ' -lffi -I . I 5 Q.-:P-Fff g .+1 -flml - I - Jw Q- 'JOHN' K .Q'1 E':'--f:n'.'JLT - .T VZ' - '4'-'tl' 1 1-. I Y I -X 'I ' 'f Q -N' , 'xj J.. K- -, ' - QQ-xg...-.-' .R .r .-Q . L , xxyl. ' W I I f , 2 I v 5' .3 - 2 J Ch, 9 5 R5 4 4 Q 'N q f f X? 192-QW in A .S - -, ,:wFR,,q4N'-2... , A :al JH +17 -.gl , - :gs - ,,., 'y r G EEH5gm!HimnfigmimszzzugasqmnuumlfilmuIIIinanlulsuunlnnnnxsmiiilimf --ly nz v-u: I-Llilfffffi -ffu 11 ---:-Av--'-vv hl '1 '5i 'mW': 't ' ' ' ' ' ' J ' ' ' m ' m X W- ---- vu ,uIg::::u:::.1 'K' I ' I f P PSI N Ilwf ,bl E. D L - . . ,. , . , . , - ,..,. - , . .. .... - . ., R E'l ll niliiuh-.... .-.a.-..-.. il:IBill!!'I3'IIIIIFIRIFEIHHGSIIiIIlulllillllilliiillillilllil GIRIIHHIGHIQI wvfqn ilulfiislilu F 1525251 U: I I I L ll -nuun n unnnu u ununnnuunuun U uanva un nquqq aluflfnfnn nuHaflflagunuun:na-uausnunnavvnvoinuwnunoll ..--.-,-. . - .... ,,,,, ,,,, , Nia Mi x L' li I 5 Q Ii ' l fir . 7' 4 71' , lg A :A 3: ,E ,Es 1? '! f . H 1 J ' I .J . .1 Fi' . Al . V AL' I JN A wo: -lllllv 'V-up 1 ' A ' 1 ' SfEl ' 1E ' 1 ' merlcan nstltute O ectrlca ngmeers ul A L 5 I GEORGIA SCHOOL OF TECI-INOLOGY BRANCI-I 0?-4 Established 1915 1 1 I - OFFICERS QR' H J. L. 'l'ORBETT . . ...... . President ME P 5' F. R. NICCLELLAN . . Secretary H. M. CARTER . . ..... . Cl'reasurer ' O I' SENIORS AVERA, B. L. A MAXWELL, P. M. -. QI BATES, VV. E., JR. MCGEE, H. S. . CORVVIN, T. L. MOORE, H. A. i 7 ' FLOWERS, R. B. TVIOORE, L. G., JR. 4 I-IIGDON, J. J. BTOSES, WVILLIADI, J l KIRKWOOD, T. A. NEBLETT, R. S. Q A ICRAUSS, W. W. NOLEN, J. T., JR. I' ,Q LEAPIIART, F. P OLIVER, R. S., JR. ' LYNCH, W. E. PATTERSON, K. M. I LONGLEY, F. R. QUALIIINS, G. A. LYMAN, W. P. SAXON, F. A. A 'E , JUNIORS 'I BIIAKEY, L. M. JOHNSON, G. G. A 5 COX, B. C. IJANE, T. G. Gong, D, J, P1-IIPPS, C. A. JONES, G, G, SDIITI-II, P. R. I STEPHENS, VV. C. N S 7, , iv I I O A H lillun Ll nun. ' ' ' - mill I-5 -,,59,g:v.sY,-. ,.,l9 ku., fd Of rwfi, D7 Q Q I A O 6 kiwi- 0 O All A f .f 'A Y X Lv-A ,. - 41 ..... I ...L .. f:'..:S!l' of 1--. ' -- ..! .. '-- .ISD A , - V . ig.. A K' X 2 W' W V Y YE' W fw0y0wWyfH,iWQ'0ZWWJGNmWfMWWVZAi :EJ f R: YAWYKXNXXmXkXN56-KSXX-XXX-XAf X2XXNXNYK'XX 0 y I V Q P UQ ' 'Y' I v. - f .-4 , .1 . U. TEH .-...'ff-9 'b'Q nf! fees J 3 1 3 J 1 I 3 5 i 4 I 6 5 . Q 1 F I b I ..,..,....fw'...- , I ' 1 ' 5 75: I f :X - 'II 19 :5 . ,Q I fir f ,7 J .4 x y -V, .-.. xxx Qu... ..-,- K? A , A- v - ,- K gf,j, N.:, I V 3 ,, K ---3-4..., -, ,V xg i- W. W , Q .:f: . , 1 1 ' . - ,,4f, 4:1 ,x - Y . 'r -' . +7 ' 'Y ..- H -- .u .::.. :. . :annul - -- . , I as T 11 E 1.-....-.--...,.., . ..,:f+5.-.f..-. - f- -'W 'I . c c cw' --Xa F IDL PILI xlnxua .. , , , ,Y,, V n W - ' - AM ----- - -------M ---'-------------- ---W-f-..?'::Lf, ..-v.--- .... .. . .. . -....- Y, 42. IW I F. ii 223 IZ I 7 I 7 ' f Z 9 6 Z f 6 4 7 9 z 5 Z !.' 5 7 c' I I' I 1. I1 I ,f, I QI: IQ? LE .fi V I I .q. 3 I I -th. I I I . :Ji rf Iu Ii I 1,-'I I :I I-'I I E 1 I I g'-I I I If I I-.1 I I I v. -. '- o I, I. :'I .. ,.. I. Q. 'vi. mi' Ifcf QI--If Aff- QI Im F7113 I ,,...,, I W American Society of Mechanical Engineers Il Vu . I. , , . . I Ivffy 11172 If '1 u 1 ' I .' . . . . . ff? . - I,'f'M,- tr , F52 I II lumuax Inu FIIIIIXI Iluxwn Em, I Illl 1. .I III, -Ill mul HI I Il I IIN IV 1,1 In I' nl ' I I 5. Q. .-if I I :sn aw .. 'M N Y. I.. IInn1'u . .I. J. NI1'l7nxm'm II. II. l'.xn'rl:n . J. I'. NIl'IIll.Xl'GIl I'lAl.l.AlIII. I.. n 4 IIl.l.l., .I. I. IILACK. .L .L Ilmxrm, Y. I.. IIl l'l.lilI. II. .X. i'.xA1l'lu:1.l.. 'I'. I'. l',xn'rl:n. C. S. FAlI'l'IZlI. II. II. C'm.m1.xN, S. 'I'. Comic, S. II. I7x'IIn:41:. II. I. I'Zmv.xnns. W. .X. QIAIIIIISUN. R. II. 'flff ,4 . . . . . . . NJA' I . . llffrllllf ' I v . , , .N'rr'i'IfrlV11 'I' , . illnlfllll , 1 I I I I I: NIICNIIIICIIS IQ! IIl1f'IN, J, If. l'm1-IIILM XI, I IIXIIY, I . YY. I'1IWIIl,f', I , IIXIIYII. Ix. II. Iiuvunw y XX, XX, tif, Ilxnms. X. NX. II-In nu, .I, KK, 1, I IIl1l12lYIY1TIlXXI.I'I.I:. SIII.l'lIIltIl, V. fl. I I .I uimin. II. .I. SHLI1'-IX, If if f Iivill1in..I.'I'...In. S'l'KIlI!IlII'. II. Y, r 1 I.Iil'RAW. X. If. 'I'um1w, If. II., .Il:, - Xlunxri. II. IV. 'I'mwvru, II. X. ' I xI.XlITIY. II. I.. Yuremnv. NI. V. I ij NIHORII. II. l'. IVKT-HY. 'I'. II. 1 BIl'RD,Kl'GlI, J. I'. XYHIW, V. I. IQ? . , zu NIcIIoxm'4:11. .I. -I.. III XX vx1'r, I. Ia. I :ii O'Coxxnn. II. .I. I 53 if . I I L I, l ei :If :ag . . Iii 5 :. pcIQ::j--,E-Q4-ic? -A 4 P- -- .,.ffi74g'iffCAi. 1 .1 -' Y - it - I I 1- ', -. 53,115 ..A1:t1 ':. -Tg1,1ie3 xT f--5 . -- :gg-5 I gjg444351-iT,..iWW- n....-,..c.,3.tf'.'.a... - f- - I-Iv' '. . . .-:.f - if-4:-as--f ff - --f ,,, ,JI , A . , LIONEL K- I Qr N ' .I1, E 'fv,,.,4,--.1,g.'-1','q- j-- 'U 4?--V , -up 'N z--'z' M- -1 , aus ' N I V-'N - uri-ff-..,-.-' .31 ' I x'f.fLf' C 1 I I, ' It i I .. I F . I. H . Q? ii il I ,I I n A E . I I F I I I V I 1 I I I I IU II E M 5 I 1. im 1: l I I ! E I I I J I l. I I 1. 1 ! 1 ,T Elf I I I If .I I' 5 ! I 1 I, 'H-1. X I A I S I , llr' ' 'A li, . xx Y, , . X . A-X I - J L1925JbIfff , :fi K J 'I gem-IRL 4., 'I' .fr naw' 1. .... D 37' f '1 I , - - ' ? - ' ' 'f-Z 1, . I bwgkfwwug .5-fR'wr1JzQWw EggmmmggmgnlggggggilxxlI:mmHymlIlimi:ImynnnpimnmmI5mmniulil1Ig,L,,,. ,,, ,u,I,,L,i.ffQ5i ,,-!,., 4 .'-,--,..- -mnm4 uummll-75 Ilf' I!UlIH'i PW -IH 'f ' ' ' ' ' ' ' ' ' ' ' 'Wuu i'g :uiiE H B L K I . .. .....,,,.-R l .NI I IEEE 1 liihiiiii -........i. A ..-.... IiiilXIiiliiiiliiliIi5liF'lii'd'F:3 Illa'iilIliili33lIiiIliiIIII Iil!IIlI31III!!IIIGIIIIIHHXEIIIIIIIIHIIIIIIIIIIIIlllllliliililll-15:55:53: FFF: ':'J:H55355H4131HHHIl1'IIIliHIlZIEIIH3l3IKIL3w:n'5:-'33':: wg5vu5s'lncn- nvrurv- .........,, - ,-.... ..-.. iarsm . 17 NX 'I I 'ZH 5 I Z! J Id. W IZ! .ZIV f ,fa uf' iN V' V? ffi 'I Q N If li' Ll- 1 .pq Ii 5 351' 0' M :P l f . I I 135 I L 1 '-Illllf z, nm 0 0 f j I ' 1 C , ,M CIVI rew vig, ' W I , I' I nay -4 . 4 , Founded 1909 'EE OFFICERS , 0 O 1' 'l' q C. P. RATHER . ...... . . . President G. MCBRIDE . . . ...... Vive-President lg C. M. IQENNEDY . . .Secretary and Treasurer I MEMBERS N Q ALLISON, H. R. HOLMES, J. C. E ' BAHRT, C. W. JOHNSON, F. J. L BE'I rs, O. L. KENNEDX', C. M. ' Z . BROSNAN, D. VV. LIDE, B. S. S Z BURKE, J. H. MATHEYK'S, J. F. E Z CARLETON, F. E., JR. MCBRIDE, G. is Z COSLOW, G. R. PEPPER, H. E. N fig CUNLIFF, D. D. RADISEX', C. H. 2 DAVES, P. G. RATHER, C. P. , ELDER, M. L. SKANNAL, H. L. N ,f EXLEY, F. M. TIiODIPSON, G. A. . GRADICK, L. E. . TIPPETTS, E. F. S GRIFFIN, G. C. NVATTEIIS, J. T. I HILL, J. J. VVIIITELAW, F. E. ' 5 Z 2 IQ' i nf 57' N f 4, ..Q5?55Q'iCQ A ' K .... J... . , ,L I. ,..., , . EEER X 0g?MwmW,WW,W.W,yfWwAmmImmQ.zg ,Ji . I -ni. IMI 3, . 17 f EZ' A I di 2 5 Z Z Z f 4 I 1 f ? 5 Z 5 .3 ? 45 . ai? I 174. .Q Q I. f. DV 'E '.- n .3 I9 af- I -- Q- N x 4, -1.-..,,,,, ,, , ff. ,- , .f -. -- . . l- -V' 1 gig! wvvwuwuu asa...--g-. A -1. -.... -..-..-..-.. ....f- .,. ., ,..,,.. ,............-.... -..:.4- A ,,.M.M . . 1 1. ...J I . I I -, I I I I. s P-P,.1 American Society of Civil Engineers PQ C XI QJP '. . . Iinzxxmn' C. I'. IIA'l'IlIlII . II. S. I.lm: . . J. .I. IIlI.I, .. 2: 1. . xmuc' IIn.xm'll E5 1' I I I ff.: Iapig KIIIINIK 'mlmm UI Inu x Kal! mu un Lim Y I 4. I CI. II. I'Il'lIUl.S E x 2322 5. .51 -5 E7 ES I lb Ii E 5. . JXNNIS, C. II. I!.xun'r, C. W. I3.u.1,, F. NI. IIAIIIIU, .I. S. IIr:'1'l's, O. I.. IIINFUIIII, W. II., Ju. III.I'MIIN'1'IIAI.. I.. BI. IInusN.xN. II. XY. Ilrnw. J. II. Coovlzn. A. J. Cosmw, G. II. Coxlcuxu. F. Ii. Cl'NI.II'F, II. II. Ilwrts. l'. G. Iiclrois, G. II. I'II.IllIII, BI. II. IENLIZY, F. BI. Fl,r:m'woon, C. G. Fuuz, C. A. NI ICNIIIHIIS Ifrnnvzn, li. I.. IIIIIIYIN, G. C. linomt. J. C. IIRAIIICK. I.. Ii. II.u.l, Ii. I7. IIn.l, .I. .I. Ilowlzu., II. .X. Jrixxs, Ii. I.. .I1:1'r. XV. S. Jonxsox, C. Ii. Jmxxsox. F. .I. KANXIZR. I. II. Kmixxx. NV. F. Iirtxxmw, C. BI., Jn. I.1m:, B. S. I.oCKWoon. C. P. BICIIRIDF. G. BIATIIIITVS, .I. F. Mrzvmzs. T. I.. ' I A r u ff' 19'-fi? . I'l'lA'HlI nl I'lr'I -l'I'lMalr nl . N1 rr! Inf'-ll , lflII.N'Ill'f'l' . lffi rflrlfl' I NIQIl I'HX, li, II. NICIIUIS, II. G. IIQIIHNNUII. II. .I. I'l3l'l'11n, II. IC. I'l:nm. I.. Ix. IIn1s1:v.l'. II. IIATIIIIII, C. I'. Ihmr. C. I . SMITH. .X. Y. Sruxxu. II. I.. Sr'l,11v,xN.Ii.S. 'I'mmr'snN. G. ,X. 'I'lrrr1'rs. Ii. F. 'I'r'nNlin. II. IC. V'.x1'rlinS. J. T. XVITIIS. C. II. XYIIITITI uv, F. Ii NVHTOX. II. VV. .-.V QI FS 4312 Vx . if I I iii 'A I F3 , ini: ,wg ! .Xi .4 I 1:71 . .l. I VI A ITC , . I. I. I.: .Q - Sis I .wpf I wi, I lf: E Q QLSBZI rI.I9I'.'II - .gn will QI wi' I' .i, II I I 5,141 Iiii 'm71QfI ll I . ,J J .1 4 'Ii . J x -4. Luv. I v i-.Q . U 1 15 ,. .. ,. V2 rj . lj wg I ill . ., 315 ' .51 rl rf 'le .. .wg , 24 .hy 1 I., . IIJ51 : -Q K' I 59,4 , 9 . 1 - ,. . , Y I - V-1, - f-- .-.,...::,..... we -11: QI , . 1' iw .1151 A-3 . - ' wif T' favb...-.'eVN-X-M. '-X ' -vliivgl-i:1P??-E9wL1'siQs+1fQfXi..AEI Q' tn? 1 : c...--1-5-11- ....i.4..:g1:.i:g::.1..:,' HJ.. ' N . , -- . -' r. 'f 1 5 ,gr ee ' ,wx - rg ' ..t L, -'Z I3-,,.,, --,- 4-2- Q ll N' ,- ' 3-A LIONEL K I .. ... - - . 1 I' XY'-fix KTM' ' ' lg r-if-T .' V iiigw' ' 5:1232 0 1 N P N 3 'C . X , cg- 6 lt f. U.: f .43 4:5 4-z on 1 1 E .0 'o 'Q . . .4 'o 'o 'o 'I' S ,. . . 'Z 'Q . . -5 '. '? ,e . . .41 , 1 'o Q o 'o 3 'O Q 1 . 11 .lp V'4 11, A . 1 W1 1 1gla 1 Em Rpm 1 QQ 1 W3 ,EE EE! Y W 1 1,7 T v 9 fa S 3 F 2 .1 - :: , 1 ., 1 R 1 R i: . - 1 ...X J F ' Q Wi iiiliu' ' I -.....--:L-.1-... . 1 E33 i Hill I il-'ZZIBEZIF' Rlilil' lS3l:'!l P17221 3 ll 123:23 'HIi'l-l'lil1H Illllllllllllllllllnlllllllllll l1 IllIll.ii'IllllTiE,:-.tl 1.-'I-Mlfffii-f.. 4 I 4 'mm I 'Wm-.www-W v P . q 1, X 1 M C 1 1 Y X 1 ' -no-MJ ' 1- V f f 4' 1 Q , gsihgsv Z ,E r 1-54 I1 1 x .2 , I 1 if A 4 . - N 'fe ' HL- . .. ........... .. ,.........,.. . . 1 yn mumgumnu vf 1n- gu sl Hn 1 1 I alllll I ll Il I 1 I llllilululll Ln vlllk. 1 x nn' I wand all! GN ! I 4 , an ,, mn. I ma ':: ' .- 1 . 11 1 5 N1' E1 4 'Q W -- -A E ... ...... ..... .. .... .. .... ....... . .... . ..,,,...,,.., ,...,, gl mmm- L.. .-A- 5' I ...hm X tw x na us .x .n....... ... xn . : ar x um. . . x :::::::::::::::::u:::::u ll s.: . ......:..........mmm......s......:.....nlx.:l::....s1n-I: .::x::xs..u ... ... ll ... 2 .... - 1 s lgll ' K , 41' Z 1 f ' f I Q' 1 P Society of Automotive Engineers E. C. SHROYRR CARTER, T. F. Cox, J. F. DURDEN, C. L. Founded 1922 - 1 1 FACULTY MEMBERS STUDENT MEMBERS HARV'EI.L, E. W. HENRY, J. S. .5 MEX-CCH3 I O f W!! LIEUT. C. F. GBE Hiscox, D. C. LATHAM, J. G. ME1XI.Oll, T. PA'r'r12RsoN, J. XV PI-IILLIPS, VV. B. I I A ,A V. 2 7 f sf 1 1 ii 1 E 5 1 l 1 5 1 ' 2 .Q- 6 W 1 1 I l QT' l lll' Il l I N YI .U fi. ' ll IIB: ...I .1- Sl IN 1 ' 5 N A 45 4 'QV N LIONEL ,,. ' ' sk- . uuuux O .L I :mi ,LW 'Jaw Q! N 'Q N 'X 3 N N 5 I . 51 ' O 'W -V-X1 O , Q- -1 1 I ' -A , 4' 'X 4 LA -- E ......... E. 0 ,v....1l5 if X., 1!ezu . .- od. - . 34' W' u E 17 r i V ' A FQ HWY- Jqo I ' xxxwmm NmXxwxxxxxXmmxxQNmmx C 0 --.Inu I W .hm ,I x lgiuw- D ' ' l 1- 1- Y, .- X if-..,. ,,. Ao G ' ' X185 15' I' 'iffkm 'y I' Ik-1335 Il i - - .EEN-is 4. ,',,,,., A ,A,-, j ...- r , ,W .. ' 1... I In I - 'I , , 3 Z: va, W I I . A,, 1 Q1 Il-Zi., ff, f-- I Q - .J '7 1 1-I f Q 0 W-- - -..- NA' . I 45 i lI 1 ' A L I ,Ii , C lj KW av' rl Q Im' six QI gill Z 2 If Z ,xl 5 0 Q 3:1 f - 0 2 'I PII 111115 GDI' ZIIUZEITIH 115 I Z Ifi Z If I 7 IIISI 5 'nz' Z Ie , . 7 I! 5 IJ I' It ' f I I: I 5 IPI -. I' : Z , .X 'x 1 I X I rx X IQXI Ia ja 1. -.I -5 1. .IL- 1 Jw, :fi 's J r I Q41 I ,X , I . -' x I 4 Pj' I '. - A -. gg I Z 4!X..'I'iII.'I?j's!3,II- X II JA I I Q LQVQ4' , ' V7 I-I If Z Z 11 if ily: E 1 I If ff 1 ,Z .1 I n Nils' I - , t :Pj VIIIL j EK I: Q '. KAI I !:fIf. I 'Hn -I 1-f 7' , A rv V, .. q I II. I! if Il . gx. I ,4 f rg 'I ,,-fgwjjgfiiffny ff ,311 If I g , I I :-.2 I I' . I . -f '- ,H I I . I 9 ' IWI Hi'-'I. 'III '41-H ' I I. I ' fi ll: I I I A i. X I IQ I fm I II I. gp IPI? gm ' I -I, ff -' l I ' I I I , IJ V' -..Nuff -D rf , ' 4,1 If ff , ' I I ISC. I. sw I II I III LIIIWI X 'I lp' I II I f I 1 DHI I A Q II I ll - 1 IWI If A' I I 5 4,,QL21Jf , -N, X If ' GN' Q , v If 9 'Z Ig ,lv Vffyf' ' ' Qzffx Iva '-,if -'f U 7-f ., , I I -HI ,IMI ii ' I' g 1 fr, -Ax --w ' I f -I ,L .I I-I I I -I- I M Nfl. mug , Q J it 1 I X' , , -l'Q,,,f, N I , 1 5 III , I Xl It, 10.3 4 4 U ,P I K 'Hg J , , A-X l fs if I X I gg , WI. H rx. QL? 4fi'f 'ff ff ' fA'3??f!' . ILL 305' 'I If. 'QI I -W! in II v ' W I I I'I-Iff 12ff, ':r. Iii' -' ,WX np' 5 11 Io 4? 'N ' If-QL 5jLI1b2Tf1 I A K I., ,QI , i Dllfgl, r .I rl 'I uv I, A rx In' ' 6 '1- 5'if'r.jI I IQ l'iIQy3I I' I . 3 Z ' , ' I ' 1? I IIIIIII X 'L X ' 2 5, , I 5' . ' QQ'-.,. If 'I WnW5III'5 L'Zf41 N I I fi I . Ief :-: ' 7 I F - ' ' III 7' -I 1 S X -IT 'Ii ' Wx I wc' I' ll .VH V Ig! I 'IH I ItIIIZIII.LgIIlfIf'Ig'LI'. X L -I ' I I 5' .N ',. I I I- ,v- gk I f W !.1:-:'li,1'I i,l' Qjqm I 7 nf' I l 1 ,I I: l Z ' we '.--'WIA v +I 'f I , I 'I r' I , ff - Igflpli .1 Iv . IIL.1'1?'iQ2f'-Img. 41, '. .l' X I I i 1, 51 I I 'J .v..',, ,'.'y,,'QQr -' .', L:.-A: , I - , -I '. ' V.! ...f A5116 yew 'fIf'g'gf5'vI' - 4 U5 I ,III I ,I 53 f' ' - I -' ,. , ,III .Er ' :I II 4 g IIQ I . La. wr NH- -L Q -iii-ggi 1 - I: ' If X- N Ak-, .INA V , eg L 1...-, '-'ffjkff .I 'Q 2 III' ' 5 If . +7 Q- A ' I ,- I I, jlaib A MII I pil- -it II 9 4. -A :V 'Ei -??:-,Z I 1 ' !,YA-jf! ' .IE gt' Q ' ' 7 '.-1 AU ' -7w ' ' -if-?. :,1. ,TCW I. 1 ' Igii I AMIENKCATHIEDILAL- V5!5- -11, 'il ? ggjf 'T i'-:f..f,'.'11.1f 39255 iiigw MI: I: .f'7frx. I PQI . .gr Q' ,UW ' ' ...A 1 4 .f'f15LffN'X-if 1 'iv'-.bigiii-ffjfff ' Q--ffql' 1 H X Luo EL ra gl, Q n L XLffi:1f':bQ-T'-'fi' A fp flee: , ,.-.v .M- l hm-:-. 'Wy' A . - AAA 2- f 1925-A -Aw M , .f A 1 f f,AA-,E ,V , ,A-if .. ' I Y fx T- 'TX I fry.,-K - qkrmpw- J, M I, I If If .4 I ' L , -4' X 1 1 if? 4 4 .. F-7-0-f 4 A A U A Y. V am.. -- A' - Q- I .AAI ' fv' - ' -A W A . EiiiHElFl7li5i impaxxux:mmwllllllllillllllllullInIlluIulInuiimlnnluuuim.Hamm,...u.LfA:I-lmmf --v-A-1-mm-na.num1mu.1mm.num-nI..I-.1-II..-en.I-.1.A......,.ImuI..........m..m,...,----------A--mm.-.mm-.mmn1mm,mm-,ummm u a ,guinmg Wx KAW, ...A A -H .A -IIII I IA I II! I A I : ligi-IAAIIIVI' 1 IW , IIA E A .:. A -'- UI ' '-f I 'IAQ 'W EEK I I m.5L..... ..m.... . :::::::m .mszwaaarszmssazum1:smszesaasasssuaa::x:::m::::x:nn:x::1::I:I:x:1:::::::::::::::::::l:a :las:::::::zl::::::I::::l:.': IIl:n':l:::IlIm::z::::::::miI::::fal:Inr:::lza:nl::f::nluu:2::I!nlSS:::i:.'lfm'.:'-::i:'.::..z'.::::l:::m:'.::::. , ........ -1 ,.... .HL , Om Y QI' I X4 -H4 IIII' .II 5 4 'Q o 'Q o 5 . 4 :- r . .za 25. '14 'J ,- 4 ,o 0 'Q o 0 'O 0 .4 ,o o o o 'Q 4,0 Q Q o 'o 3 4 'Q .Q Q 4 Q 'Q 4 :Q 8 I -' 4' ,Q ,Q 'Q 'Q I I A4 2 AAI I I I A QI f MAA I 'A AI! A I x . . fi A. ,X QI A p ff 'A f A A A V' -1-w A ' - 'ff - V, 'A ,A,Ag,f,'-4,542 I .,.A, - A I 5 ,,, A ' I sd 40A 411-5595+ fi- ' A A V' IA aA,,s:AQAQ:QQg,,-M . f' 1 '-M2 A f 2- A I ? A ff f ,fa Hr, AA ' 'fo-,A-x,A 61 AA ,V ,A 1-,f A 'I A -lf' ' f ..,. A A ..,.., -V I f I 52 'riff f f 'CASEAW I -A'-ZERFO j A A T, IM' - I A A ' H -ff. 'A A A, HA A A-3, Z- ' ' ' -A ' If I ' A WM-AAA, AA l f A ' ,, AA fl ' S-6, Amd, A . A A ,JV 7 ' 'I A 'Z A A A X . I ' 1 A A I W V .AA ,, 44:,,l,,,V?,: z:?mf5 -ZA,,-A,:,-,A :,I! , A N441 A, , WMA, A , A N -' a s, ,fm f f?-Hiffwv 35. 1 A fi . ' 5 ' 3453248 gg A Q A 62'- ff f NA A is 3 16 3:7 A41 AI ,V , Q3 ' ff 1 f f PX x EJ I X' AQAOAA A' V' ..,'Af'! ' 1 v,,'Il Y-'AMW A ff A I' A A Aff: Ay s'-wig: 1. -A A, ,ff f A I AI f X9 , f 1 o ,Q f Af 794V , A ' 'fs I N fl Tm ,A KVA A, 74TFiE5Dbx M , 1 O IQ' 52 Z' ,, f f B, 'HRV f 2 4' X , , 4 ,4 4' f f f 242 I 42-A N Av A 'f1: ff-'X f f 0 Y W 27 A ' 4 A f , - A 44 , A wg, ,A . . 3A ' Qp , , NJPATT .A 'LYMAXA H3225 I ' ii I 651145 -15?-0 A A ' A 'AAA A - Af -vw 43 ,. ' ' F ..,. A ,. . 'ii . A , E I X . 1 I :AQ 5 Z A J A . A' .- I ' id N 'A ,A,.A A A A' A: QA . AA., J ' A A A , f ' , I ' X1 I , -A Csmovk A Q, gow Q' is-A-.I A 'VVELCI-W9 A - .A f CHN A-4 A - ' A, , A AAA .,K, A ' nf - -lui? ' A 131' f . A I Vwr A - ' -fm, j.. ' ' if If. if .Ng A A Q Q A, , Q-Q. -A A. - A 41- 3 - A -.. 'IM EN QV- AA .A ff I' A 1 A1 1 A, ff A 'V4RMQvL?- A A :za :::: A fiffai-Ar :AA I I, I Eh., .A - - A As .5 A A I ALVATSON - I , 1 'V4UGHN ' ,' A fAZ-A127513 ' A' . A,. . . A AH-fl 1 A- A A A A- Y A - ,. - - A A A Q' wi, QC1-Es' - Z A I AA. ,A.. - . gg, ' E' A 'Q A A- G A- , -,.AA , A I 'I .::s:5r.A:5A3Af'1 Tie' Xl, . Q A-5 A A A, IPA ' AW 2 ' ' ' Ay - be I I I A 'I' ' 1 -f A A A A A AA ,4 ,,A,!,f A K , . ,Q X I Af, we ,SAA AJ LA AA A A A A A X gf A IQ . A 'ALMQGNM ,A A A R ' 4. A Q A s I K ---' A ' I ,A A v A A - 'N I I ' AA ffcfyiff, A A A A A , ,, A A A- f .v -,, AA A AA A AAA, N J f'-' .Af ,A I I' - S -I A ,,,., XA A- A ,NA Z Ay- AZ!y?fQj:j, 0, ' A A gfggx I A' 57 iff f'5 1f' fi' 5 I I - ' M ,A A AA I A 5 A , AX , if ,A AA AL , ', A A A AA' 'R I 'X A 'LN ' Y 3 ' , AAAA A A I ' - X SI yybffi ' ' . A A fAFAAf1A5A X A f gj7Ay AQgAj'J.jfA' A A ,,,- ,, 3 f.f,,z,I, I V A AN Q A-Agn' IAxj:ASxgA5A11555fI' . . l J A AA,4:,7 , A94 g A A Agfsiix ' x X --Lzycgvk --CART? AA Ag A AA M . .R AK I ff 3 Z 1' a 5 4 f I I . M Xb as I AAAL. A S S i X N nf, k 'x,1 C1,,,T,,.f-f Rf A M X a Ulu: H LL 9-5 X b A'f xqff? I WW X 'O L A. 'M O J ,,f-11+-f.A A N I2 ,J Ilqg A A, in L6 N - A A AAAAAAA A U AA we 41, I. -.11 . A I A N-3 , . . . , . .. 2-Q0 A 1 LAL A, i 3 '- ' 31 ' X ' .f.-.fm-..4.: .':+:'.',w.-wiw gl -- W , R. A Lno - KA WH Y xl A '27 A E, S1-W.4.' ,, -f Y .- J lx ' W K H. . .Lg',,.1- MA I' Q X, 0 ,1 G X 4865 I I is' I - I Im, I I ix I w IIIAY ' IQ E 3 5 .ul :-SEX 'fel-Y LW . ESQEISIEIB. L' :F f V2 5 Af 5 9 A Q 2 f 6 A I HI I E55 -1 'Jill' 61' Alu qu ,A , A4 I f I -z S5 A sf 3 fl? .5:, W 6 -Z in AZ 1 4 E lo auzzzmzsnzzqg :u:. If v r I f I - , . '.- I' If '15 , 1 1.-195QfI:. I - -. -ff .Q ,4 4,. X - . ,,., - . .I fnwzeasaggsmfmffwf vw 1.1-.:-...-..-..-.- ... -.- - - ' .:.. . ...-- ...-..:,. .:::..., ,z.,.. ,,,, . , '- M-, ., -f-221221-wa 3 .I - 'x.!I I I-. ..-, 4 ,, I I6 Z I Z Z 9 4 I Z Z 4 Z X Z 9 X Z 5 I I I 53 .Jgyf L 0. I n l J .A Y. IVI. C. A. Qrganization Il. C. I3r:.x'1'Y . . Ii. I'. Zulu-'uss . . Miss IIl l'll I',un:N XV. P. I.x'Amx .. . . lI,xn'rrmm . . III I Il'I'1ICS . . . . . . . . Harnrul Sl1'l'lf4Il 'l , ,I.w'.w'u1'Ivll1 .9ar'l'1l4lI'-If . . Ufffrv Nu'r1IuI'11 KKK IIIX I'l'I' . . . .. .. . . . . . .l'I'rxuI1lll . . .Vllirf of Ilnlfl llil'I.vif1H '. '. BI.x'rlu:sux, Jn. . .Vhiff nf II'hilr Iii:-i.-'inn . . . ...... S4 fra f1ll'.ll I7IIII'II I'IIIIS II. I'. II.xn'rox W. 'I'. Blnsmu I'I. 5. I3l'l.l,0m'K I . II. xIUUIllI IAQ, I Iii inf: D II I I Ix c. yLgL.At I.. Ix. I',x'1'ruN . . gg'I IH' Ilillll I7 I Q, 'Q Q 1-3 tk IL.: s. :S X. 'G I S S 'x ?E' -14 Q. lr! li iz? S 9 Q III 'Wlb LIONEL I . II. NIMH III I .xx II. NI. l'.xn'rr:n II. .I. Mumu: I I I iux I... .INN I un. IQAIIMUIKII XV. II. .Imlxs .I. C. Srvmx I . .I. Jnuxs Rm' .Ioxlts ,N NI. II. X ,u'ml.xx, .In. II. XI IZI.l'IIlIl. IIIZVIIIZN Iivuz II. U. XYILIIIIIMI II. NI. BI.x'rsuN xo 5 r A II5 ri I I I 35 ' I I- I .,.i I FI . .na I I II I IF ' II II I I ' :LAD I1 III 1' L11 I I, I IS: I I Ii: ..- I.-. .,-1 , 5572 I I :I I I.-, I In i If-, ,- 'Z 'Q :I- II I I I If: I I :,-E 1 1-,u I III , - I ' -'I I III X I if III .IKNQII bl' . QI X, I I -if I W I 14, I Inf IEE LII! -IIIII ,III YI I FII! I iiiiz ISI: My' rg IZ If I I Ili' I I: 'ISI IP. I Eli If .55 I E51 IIIE3, 'Ein' ffgii IIZII III III I X X F R x ' I , . v ,' ' T ' . -. .mv-.-fw-w.-.g:.:- Xq,,Q,',r51-.v.N-.g?5-v.-.-.-.--.EEN PE . I -'X--2 I A f xxxxK 53-Nix. -5530 S---, ,.-- ----1 'fav Q S . tr rf- ,.I- , gf.----.---H -Ml f'1.- -- .---... A-. A Jx L Y, 747.-ip, I Ix5,?4,,. ignfi-' . ' -' T T Q,f s1:. I' .,'K.-Q.--,tif-'g-'rx ,ffgiy K 511 c . ... . .Y . , 1 1 . xv .ff - lf.-T-1...-.1- -JT' dig ry - Xin- , N 'lh' U JJ Y 'fff . .. :, . ,, . ,- . L V .,.i,. J g K , f ! : -.,xl l -14 - , . If A , ' 5 -. f..:.,...,- ,..,.f,s,f! A 'e' - , ...sv ...el . - ,.,. .-1 f-L 1 nugyg ngg5::ul:l:auummululmllllnllimlmmmuInainx1aiu1u41Tu.Lmmuum--u u-.J-in--1 .L--v-X-,-.mme.4.unenum-.IL.mmuu1:mw.f-M. .-WV41.-f---1---1:1ww-I-:mm-H,W.-W.--.4--.-.-------w--nmn--fmnuv-rfmrffmmlvwfwwI-'dw 'gg: .. .:, N ,mjikihiiilqmg H E D L P RJ N T 'u uma: ln.. .zzz .N 1 I Nw .Sl H-f 1' ' WI A 4. W .aa ,..... ilsl glir.. ...Q-.s-su....Jiliiiiilli lil!liiiillniiilliliiliiiiilliillililiiliillill ' Ii llllf'PHIIX2lI!XII1IillI!1IiiIIlIiIIIIHIII -SIIII IIIIIIIHIIIEIISHIIIIIIIIIIIHFI ' 'SIIHZGEITHl1ii5iiIilIliilI1Il1l'JIElIIl lHiIIl5'ni2ll5S-a-125-1-mfiiiifun--I--I. .........-- -..:......L,1.:- 1 f 557' Blue Ridge Delegation R. C. BEATY . . . Mus. K. P. ZERFOSS . . Miss MCALPINE and Mis BEATY, R. C. BIIYANT, EUGENE BUI.IJOCH, E. S. GILBERT, HITE J Acons, STILES JENKS, EMORY JOHNSON, FRANK JOHNSON, J. T. KHOURY, NIIKE ICYLE, IKEUBEN . General Sevretary . . . .Clmperon . Sponsors LAYBIAX, PAUL MATSON, R. M. MODANIEL, PROE. J. E NIEALOR, FRED STATON, .ALBERT STATON, JOHN SINIITH, PAUL R. '1'1-IOMASON, C. Y. XVHEI.C1'IEI., LEE ZERFOSS, K. P. x l !l1lx.i'---K3 ,. ZH wg? A Zi . 2' 6 .1 'Q 6, i :il 15551 .gg . I .,. 1 I . W 'X 1 E- J P2 .aff ug J ., , Q, L J N1 wx' .. gl 1 + hw: p , . was 1' mf wi!! lx' S E Q Q E E x S if 'WN ' v ' V W 0?' mw4m?W f 0WWf'f4 U E I Qgikxjkxkm-QmxmmxwegxNN5X,3x 'iXmxwxx Aw o Q. Z ov. I 'O 4 x .L 4 M Y - g V- 'J L' f , Hsu! J L. ' 7' ' . 'A' ' ' L ' 1 1: nf ' SN f --.. - xi.. 91 , gig, 3 . -- E -- E , ' X KE wx :'HI1:u.0 .ga .W O ru 9' 55145: 3-QTJQLQOJ 0 xi U 1 . ,Q L -A ffqgw fly-ff' 19-iQ'fwf,, f f N ' cdl-xhc-X ,q M: Ar.--cz-r k -4 1 MXATHE DLV PILI LA ik I W-N 1' USA IF 1 H! H8251-4 tn IV' P INIFNI .1 l ,yd un Gff To Blue Rldv 4 1 1 I 1 I I , nv I I I I H I ll 1 I 1 Ill H III 11 1 1 1 1 1 1 1 1 I I 1 1 1 H1 I 1 I I I II I I 1 1117 1 1 1 1 1 I I I I 1 kim xfw HIT I 1 I 71 X- W A-MM , , WTQ1. WXNFW is if ' 1 1f1IA+ H 1111-1'Q5,44eX XXKTm XX x w J , .1 WEL ,i L' , ..,....,.- -N ,. . Q . Y-,....,... , 'I' W G-9 5x9 TRU , 1 X f uv x . 1 f x . A. , .. 2 , N , , , , Y N X 1 I 1 f-3-Q-O., of x r js? i J ' Q 1 1-x. r f I 'I f 1 I , , 0 A ',.,..eh, - - I as .-fl' - I. . .-I J.. . 4 ' ,555 E1 mm E--H::Q:musmuluulllmmInIIliIIllmmmmmmmmuxanululxumhmun..-mu-.R--n.-mm--1-41-I-W..-muummmQ-.-1um-nuuufmw.14m.,-4.4..-...............,m......w................,...........................,,...,,,,,,.-,,,..,,---u-faxnn xmmxf-mel-aww 1 1 'au ,mix ---5.! 5!5I.mggQ:s!ize..u, .,,,. I1-FM. mga? ,I K' I x.:.k ff T H D L P 5 hi? l - fii I i-hu.. 'ii-Q 'ii ' Iii nl: ' in 'E lailiiilnllll 35 HHH: I In 1 I I: ' ' I ill ll 'I' ' 'll 'Ill llll I I I Il U Xi. r my km I ' X fr ' W . 5. . r ,. .32 'Z ,. 4 S .0 ,. . . r :Q llll as u...::nr ..mr:...r-:.:-sm.. I I :R ll -unrumxm. as ...mszmx ns ns .al ll 'rn r:..::x.:r...rr..1 .ur u.:rn.:m'-x:su'.::a:z:zmm:::ssm sz. nz:---'-I--:L .-.... ...- IL q, D 4 H A I .Q L L 1 -'lllll' 'QQ UWA GRI ,wM.lk VCD ullll Q ITU V ll Y 5 I? 5 4 T Z ? K . Q 9' i 4 4 4 4 1 4 4 4 4 1 X 2 The Tech Bible Class NORTIYI AVENUE PRESBYTERIAN CHURCH Photo Xby Winn OFFICERS MIIS. E. E. EAGAN . ........ . . . Teacher VV. B. JOI-INS, JR. . .... President A. F. STEPHENS . . - - ViC9-Pwsideflf L R. O. VVILHELINII . . . . . . Secretary j BI, NIATSON , , ....... T?'6ClS'1H'6'I' I A. L. CARROLL . . ...... .Recording Secretary IXLFORD, J. M. JARCHER, G. E. BAIIIIET BAUM, J P BEATTY BIDD1 I J. BCMAR CRAWFORD BOOTS, M. H. BOSTIC, VV. A. BREEN, . H. BRADIAN, J. R.. , J. T. BARTON, H. P. , T. O. ', NI. W BREITI-IAUIJT, C. C. BROACH, H. H. BROWN, C. J. CARNES, E. M. CARROLL, A. L. CAR INIICI-TAEL, XV. L. CARR, W. B. CARLETON, F. E. CARMIICI-IAEL, J. R. CASTT, WM. H. CIYIASON, A. L. CLANTON, D. W. COOK, T. E. N COLE, L. D. COSLOW, G. R. Cox, J. J. J. CREW, JAMES MEMBERS CUNLIFF, D. D. CUNNINGHABI, E. F. DARLING, E. L. DAXVES, ,P. G. A ENGEL, A. B. FINC1-IEII, VVRI. GARTHSIDE, G. H. GETZEN, J. E. GILBERT, H. T. GILIQXESON, NV. R. GLISSON, F. L. I GLOVER, A. K. GRAVES, R. M. HALL, J. O. HAI.L, H. E. PIAINIDIOND, E. C. HIKIKDIN, C. J. HRXIITFORD, DON HIT.T.IS, J. L. I'IOLLINGSWOR'1'I-I, K. E. , I C HOI,I.INGSWORTI-I HORAN, T. Y. HUIE, M. B: HUI.T., A. D. HULL, F. H. I'IARBOUGI'I, L. R. JAEGER, H. J. JONES, J. R. JONES, ROY JOHNS, VV. B. JOHNSON, G. B. JOI-INSON, XV. L. IQELLY, HENRY ICELLY, FRED G. ITIKER, J. E. KIRBY, PAT LACOOK, J. H. LIEEEY, C. A. LESLIE, J. E. MACCAY', K. H. MADDOX, J. H. TWLARSTON, E. F. NIATIAIIS,'xV. A. BTATSON, R. M. MCCOOK, J. E. MOKEE, G. S. NIEALQR, VV. T. TWJILLER, H. G. PEAEODY, VV. J. PIKE, R. XV. POINDENTER, T. G PROUT, H. XV. ROEEY, C. S. SKANNAL, 'H. L. SKINNER, E. L. SBIITIRI, J. XV. SMITH, P. R. SNEAD, J. H. STAKELY, YV. N. STEIL, ,ARTHUR STEVENS, A. F. STE1-HENSON, J. M. STEPI-IENSOX, E. L. ' S'l'ROUI , Q. D. TULL, L. H. -VJANCE, YV. H. VAUO1-IAN, XV. H. 24 If 45 fri' 1125 I :I :ZR 2 I? 2 'I .pi gf i,-'J W1 ia fi E iv il I i. F4 ' if IK ' . :-7 I -ig 1 ,Q I -N -1 'Q 4 .QI 'I 1 , t l . f I A-1. null: 1 i lllllv LE sf I1 I 2 I -i -1 -5 I S N s I -. I S DIILNER, J. VV. XVALLIS, T. J. 5 A . . I MITC'I-IET.I., J. L. XV.-XRD. ROBERT MITCI-I1ET.I., T. H. XVATKINS, B. E. MOSES, VVM. XVATTERS. J. T. DIARIVIORE, P. B. XVERTZ, THOS. Z' NASIYI, J. L. XVI'IEI.CI-IET., HOMER NOTTTNGITAKBI, WV. M. XVIIELCIIEI., LEE OERTING. H. V. XVOODSIDE, RALPII PAHIR, DXNVIGT-TT, XVILHELINII, R. 0. -P: T ' fl JUN I TON., L. K. l fx fb fy Q O IR., T . . IM J QW U IL 4 W A Y -4 I OV, KW317- AO 'vt aw 'LVV ,D N. ,YO O h.l'1.'-2 X . new I, Ep- ' Y' WT. 4 X L is .....-.,- -ff A 41 :2 of Q 4- .. :m x .. Og'f1fM5HW0,m'yfMwWQM'ww QqmmQ4Zffm 5 5 Y 3, . . 77 W Y I . L I-li 'hL ff V ' ' H f' 'l'll Y ' - .' ,Ha ff ' 0 ' 0 J , .4 . rJ66.:fY . . . .. --zz.: A 'I . 'I f QI 651. . 112.-Zim' ., 44: Zn? . . I :5 '-jg' . l L3 1 xx Q i . . N- 4 . - A I' --L-. -.. .....-..-..-........v.-,.1. ...,, ,- ,.',,. , M-, - L ' WM . -U I-V+ r-H Y W-3 ,. L wk ...I 1 . -'-'fl ..L,. ' A I .. I I-QI I T Il E. I5 L P ILI I 'I 'Ilan USL-. . ' ' . - ...W . ,,,,.,,A, H , M Yr -K r . MMA --'--W: --4.--+--Q--.-.....- .-.- ...-....-.-.. .. .I A if 5 I I .Ig 9 Z I 4 f 4 4 4. 6 4 4 4 4 Z 4 4' 4 4 4 4' 4 4 4 4 9 4 4 f - I IL, L II y 4 I' nl I I 'ln X1 II-Il' I VEB I 4 llllv , lg I 773' 'Im 'III uf r I I1 I: I5 I N . I5 if Q -2-I I -15 Q1 .. .5 ' NA K' -W fr- I'I.- m- I-x NN Tech Bible Class XII I5XIN'IN I'.l'I'1lII'NI I III IH II UI I II'lClIS , Bliss Illzssnz Hr. IZ. I.xumu'r . . lfmlfff I' 1' flu! IC. S. III'l.I.llK'K . .... , If,-. XVII 'G Ir'1'r IH.-l ff,-1.1, nl 11f'4 K' X Cxwmru . . .A firm I Ill '..... l'1.Ii.II,xxxuu ,. .lfff.-I NII .NIIII .IIS I',7I I P ' IINIIIIIN. I,. .I. IIXIIMINHI XI .IA .'xI.I.I-IN, II. Ix. III-2A'I'l'Y, l'lI.xlun. ' II,xun'r. C. IV. Iluwum, II. I. I'l In-4 , ' ' n, II. II. I'xnx1s,II. I. IIN ' ' uw III x'-,, .III, I3 . '23 . D. s I rf I I fi: I I is -1 X jx I 2 -N ,. -N I 1 -5, ri' IF: QA N ni: IJ: I bl I ni. , I'-' 5 I If I . ' I . ,A W Q. Q '25 I I . . I I I I I I I Ii I I . . I III I HA: .gm -.1 . .Pj 2:5 Na,.:Iq .,'I I. ,If Ilifil V55 I IQI Y I .,,: I.: ,I if 'I i III IIXZYIIIVIIHTA I, NI. I KI IIN, I . 5, ,jx Ihlilvzlz. I'. II. IIl'nNs. .I. C. ' CANnl.1:n. II. II. CANIILI-III. S. W. CI'lII'S, II. I.. C.vr1:u. Flux lil xx CIIIIII. II. C. Co'rnn,xN. U. IV. Dvnms. C. F. I'I.xs'r, I m:s'rox Iis'r1:s, .I. 'l'. Ffxmcv, FRANK Gnmus, F. II. GIIICICNII. IV,x1.1..xcl: NIM: 3. C. NI - I NNW. . . IIlx1n.Iv. I I,m'Kwmm, if I'. 1.11154 - l ' lmwxlvrs. XVII. Suww. III I.1'n'.xs, .I. II. SMITH. IA NIA. v. NIm'Ivrin. II. S. Inv . ' xIITIlHVI1T'IIlTIl. XY. II. 'I4lII'II'. I . X. Huis. C. II. NV11 HUT. -I NIl'l.l1ix1x. II. II. II'u.1'v1n. I W ' vrvn'-, If F. .I0llNsnN, I., II, H yxp. I I E.: Jrwmws. -I. II. IIIIPIIITH, K' I N la Il I II ' VIII I' I' I..xYn'm'K. .I. K. SXWIIWHY. lawn.: L c I 44 L In I. 4 I T4 .g,I .4 .ii ,, I I I If I .A .f.' ,i I II I ' I' S'rvr'vu Na .I. II' -.5 Hur I I' Z Gn,ur,nr. .-X. NI. Prrcmin. .Iwk II mixun, .I. .I. Goomux. 'I'. II. IIITCIIYR. F. .I. CN A.. -Q A 4 if Iv 44 .-4 Z5 Yu Q5 1:59 1:23 . III, rig. 91' Ig' .I. 'I IIEII III g . WI -Qi, LIONLL rx GJ? J X X 5 4 JN-J I I I I -l N Fx Ji? I ' -- 4 ...-Y . . xx 'M' 'I . - -4- . 'us .1 -..-. .-. - i 'V 4 . w. - U Q91-i E- 5,7 ..,,,.,,-. . .g.,4.g.r.:..f:, . fm'3,'IYb:liZ555:T5'13 4.- IV . .. 1 I I 4 X t. ,ff if . '-..,,..-- .-7 ' 'f - -S 4. I XL .- .-1 uf f 4 X1 ,K- -, ' .-'I'-I .1 X ' fm? U' W? I A A 1 - ', Fiffk .G -S . - ' H9255 . f. f . I - - I ' - F pg..-If' v, LQ-...,...-,...ff .4 f . ff .I A fig ' P ' ...--K. I ' A I f - .. - f my 5glimHIi'lln:l.,!QiiE iillllllliilllill mulnml nmmnmnRuuarnnunihliaiii.LmI...m.E.,aXiQif151I.umG-f,--I-I--HR..m.unxunuunl-.13--vi,-In A-v..v.Ii.--.M-.n.-..-mum..m.,.....:,.....a.a-. -,.- ---.-,------,,-...rmm-..M..-.,,,.......,- , - -ui! 4,555-.aizilqm .. TI W I fl! ' M' V+ W T I I E, D IJ P N I , I . VH' 1 H. V ili l -ln.. .... ..m....... aa--numnmusnumamlamz::a::m:x:lll:::a::Inamumm::RR:x:x:R:l:mnRxIl:::xl:until:xx:::::::::::::::ll:SH:.'l:li:::i::::sm:::::z::1lr.::::n:uxx1-1n61:1:a'::lilm:i7lil1II25l7r.5I:ifr.:l::i::::lIH:.'mllS:3:.n-'rJl'-l:'1: I 32 25 .3 Y :EE gi -. e .P S .g - - ----Y I fg G T B, 1 Photo by Winn ' CHC UITICI' lb C HSS RL' L L A .4 IV. P . 4 nf 1 I . 'H 54 H I 4 'I .I LU 1 I Iwi' 4 I wild: I' I 1 mg, 'Ill' VIII I I I 4 1 2 PONCE DE LEON IXVENUE BAPTIS'f CHURCH ' OFFICERS MR. J. L. MCMILLAN . ...... . . . Teacher H. A. MOORE .... . . . . . .President H. M. CARTER . . ...... ...... I 'ive-l'resicIe1zf F. J. JOHNSON . ....... . . Secretary and Treasurer MEMBERS AI.I.EN, L. H. AI.1VIOND, A. P. ATHANASON, N. A. ARCHER, VV. B. AVERA, B. L. BAGWELL, H. B. BARDWELL, G. E. BAUDIGARDNER, H. L. BECK, ED. C. BICKERS, C. W. BROWN, EDXVARD BROWN, NATHAN A. BURNS, J. C. CADIPBEI.T,, VV. XV. EIVANS, N. T. FARRIES, RAI.PH C. FITZPATRICK, J. VV. FLEBIING, J. T. FLUKER, P. SA. FORESTER, J. C. FORRESTER, VV. R. FOWLER, VV. T. FRANKLIN, S. J. FRANKLIN, SEILMON GASKINS,A EAIINIEST GETZEN, R. G. GIBBS, R. S. GIBSON, C. E. LOCKE, ROGERS TVIASSEY, C. H. TVIAULDIN, J. L. MIDDI.ETON, C. R. MILLAR, JOHN MINCEY, A. R. NIONTGOINIERY, T. B. MOORE, H. A. MOORE, FRANK MOTT, VV. H. MCBRIDE, GEORGE MCCLELLA N, F. R. MCRAE, TOM MCDOWELL, V. E. RITCH, JOHN ROl'SE, KING RUNDELL, JACK SAxON, F. A. SH.-XCKLEFORD, P SIMPSON, :KEY SBIITH, C. E. SINIITH, E. T. SMITH, LAWSON STATHAN, R. G. STEPHENS, C. F. STEPHENS, L. C. STEPHENS, YV. C STRINGER. T. F. XX I ,. CARLETON, F. F. GIBSON, W. W. MCGT.0T1IT.IN, J. A. THOMPSON. WV, 3 CARLTON, J. FQ GOODLOE, E., JR. MCKEW, H. A. THURMOND, J. D Z CARTER, C. S. GORDY, W. L. MCMANUS, TURNER, H. E. CARTER, H. M. GOUGE, D. T. MCWHORTER. C. L. LTNDERVVOOD, J. I 3 CATE, R. M. GIYEGG, J. H. NIXIZERS, G. T. WVALKER, C. B. CHAPINIAN, H. B. GRIFFIN, LAWTON VV NET.BIS, J. G. VVALKER, H. K. CI-IILDS, E. W. GUNN, E. L. NEWTON, E. T. WVEIR, NV. H. ' CONVERSE. STANLEY HAI,SAI.T., L. W. NORTII, A. J. XVELIS, B. D. 9 COOPER. VV. H. HOLLINGSWORTH, O. T. PATTEN, L. R. WVILKINS, J. D. , 4 DANIEL, F. A. HUDGENS, J. N. PARTIN., J. L. WYILDING, C. D. . DANIEI., Ri G. HULL, FRED M. PAULK, D. R. XVILLIAMS, J, B, 5 DANIELL. VV. F. JACKSON, WINGATE PEDDICORD. S. R. WVIILIAINISON, XV. Z DAVIS, H. L. JENKENS, C. M. PERCY, WAIALTER WALT-IITE, J. D. Z DODD, F. J., JR. JOHNSON, F. J. JPETEIIS. J. L. XVHYI-NEW, J, J 2 DODDS, R. B.. JR. TCENDRICKS, PIKE, H. H. WVIYIITLEY. M. G. gi DUNKLIN, PAUL E. KNAPP. W. VV. POOLE, VV. F. XVORKE, R, H, 2 IRURTIADT. C. L. KYLE, REUEEN PRINCE. H. S. W OEMAN. S. J. Ig ELDER, HAIKOYIIJ TIRE, E. B. REED, R. YOUNG, R, B. 2 ESTES, J. TIEVVIS, J. B. REYNOLDS, A. D. 0 OSfSS2fO 0 0...,,.,ffmf J: N o I , FF I . . 1. Af Q-P - L 0QiE' yf,mmfm. Em:A tg U pg NwvmxmmNxwxwxxmmmxxmxxxxxxxyg xx O be 'f8.0.1fb Q-6.4 2 K -H G :tif I 0 l ' A xr 1.5 J , I F V K' 0 'F ' Hill, 0 945: -IWW LX I I - IIIIHIK l ...... .a.......i: 5-A 1 f 'fT9 5I 1-I I 1-... I If 'I 2' dxf ' W. 2I:',I1Qi'-EQ.. 15-'rut - -- - - 1: I5 LV I3 P .. .Q f V31-if - n I , ,xv ' 1 v q ff fi- 'L W YI Y 'K N X L xv I I 1' , N ' II -,-.4.,,.,' . ff '- - ,riff 'f I 'Y . - B 1: -Q. ,-' ,,f4.. - Q., - Y xg. E. 55555fl! 'iliiigiiiinxgv-gggggi,:.::::..:zmmu1:v :AI..I.:1.. .....-.: ..1...: .-L .x,.. .-.... . .,,.-I,-any l::,-In W I H - f Y , W 44+ E53-gzr ....nn ... .. as I I 'L I I' I I ' I I II... I x .s I ,I III I I .IIII 'H IM H M1 'H I Ill 54 Austm Tech BIIJIS Class I NI I I B BIIOIIx I I 1 IIIX II 1 IIlhUX I xusux I IIIS S IIIIII II IIS IIQ IIIXII Bum Y I uxs xclnmxn xsrxc XIII IIIIII IIIIII IIIIX N IIIIIIIII IIXIIIII ISI I XIIIIII I INIIII Im I II I III IIII II III I XI XXIII KI PIII IIII S un I IIII ILIIIININ C I II Iss II I IIIIINI II II XIIII 4 IIIWIIII Tcmx II I' I xcIIIII I IXI III I N ll I X X III III I Ils II x I I I I III X I III III III N UI III N IIIIIIXI IIIIIIFIIN IIIIII 'I' :III III IIIIIXNIIX Nu Xu IIIIIIN C' II XI 'I LI fx X I I I I I IIIII II NI NTI 'II III X X Il III T TI II 'I'I'I II IIN I I I 'rfrv I III II I 0 III I I X X I I I IIII I I X III I II TI XX XI I' RIIII .65-5 -mr-I 125: 'I I4 I I I? I ' I I I. . , I 5 5: . FFR FII w q6!iO l XW'KWV SSW? IIT-3 'IN 11? Ng +-.IXI 17 ,-v LIONEL K QR Xxx! I It ' 5 IE I 5 IL Ii Z I I If I I f I I-9 I 3' I is I Z I I f I E5 4 I Q5 g I f I VE f I if Z9 - 15 5' I :S 7' I I5 5 I- .I 7 I fi , , II.. I. IMI.-I UI Z IE I 2 SA . II. II 5 NII1'I'IIlIIPIN'l' I'.I'I-IIII'II I III III II I li I, III-'I-'II'I-pus VI,-q ,i QQ Co.. .I. IV. .Il'. 'lN ...,............,I . . I..I-III. II. I'I. II' CK ills ..... .I.vsi.'lIIIIl 'l I uwlu I' I'. I II I xm II . M I I'l ,III ,Il I' HI ' 'A' ,,.,,, , , , f'1'l',v' fl III II, .Il X LINK .In-1.-I-III! ,Yr rm fIIl Il ,.-vI,5,l':-I IIII. I IV. 1 . B. IINI-:'I I'I: ..... I'if'r'-l'I'f.fi lf ffl Il. II. lil 'III X.. ff '- ' I' IQ I I 'Eff I III-'IIIII-'Im WPI? In V, . II'. I'IISIlIIII. IIILNIII' I.I-'I'I'. II'. 'lf IH- I I I I. II. II, -II. l I' X ,, ' 1, I. l'. I'II..X.'IIlIII!4. If If l.I' IIIY, 'l'. IY. l'III--II. II. I. Iufff ADI I .' 1, I. F. I'III.I.'KI.lN. .I. I.. I.I 'II II. .I. Il, I'III'II III IIII. I . If IIIQK 'IL' AYC S, f. M. I'IIIII'I'. If. .I. Il II IIIIXI I I. .I. Ii. :I XIII Y. II. I U I B. ' I A. II. I'IIIS'I' 1II, II. If II IlI'IwIl, II. I . IIXIIIII I'II. .. . .A.'fI E BA . ., II. l.. II.vI'I:s, I.. li. II YI III ws. 'l'. I . If WWI . I - IIITQIII '594I B.I ':.', D. II. IIIII:I:N, .I. II. II II YI II, II, II. III III I I. I. II, IH-M-'X' II I3l'I ., II. II. IIAAI THX. If XIIIKIII. I. II. II' IINII. IH I Q BII .. .' I-:II, I'IIilII7 Ilnl. :'I'I'. II II I'II III II II. II. III VIIIN. II.1. IQ I ', I. '. II.xxcIxs. II, II, IIIIIIII.I-. II. jun. II. II. I I-I BI'-:.'.'. .I. C. II.IIII I.. I. IIIIQIII. II. I'. 5I'7'- IN- If- II1I Bl., I .' , II. N. II.xIII MIX. .I. I'. .II1'IIIIII. II. If FIxIIIII., IV I2 I I BI...' .' I.. -2. 15. II.IvI:. , II. IIIIx-I-I.IIuIIII. II. Ii EMM II-. III. 22: B0 ' . I'. II. III.IIx. I. II. IIIIIIII. II. I. - I U' I-N - IZ. IIII 'I', II. II'. II.II.I. -I. If II1IfIII.I'. SU NJA Xl 5. I I IIII -1 ..I. I.. II II.. III. QVIIIII--,iI'-1. I-1. FII-III. III EI I IIII. 'I II. S. II II.. ... . I- N. 1. -A UI . --- .IQI IIII' I'I-:III-'II-:I.II. II'. II. II I,I, II. I.. II ' IN. II. fI1V - II- I I I CAA. ll. .IL Ig. II I.I'l. I. II. XI' Iv It I1IIx-. I. I.. I CII.x'I'II.xnI, II. II. II I.xwIm. 'I'. II. XIII! - IIIIN. I-f. N. 51' VIH NN. -I- II- I E2 CI . . .. II. II . I . II 'Y III- II- 'Xf'- 5- II' I ' CI if .l.II.x1I, C. II'. II . :II IIIII '. II. I. IIIIHY- II- II- ' 'I CO I III. II. .' is. If II. IIII rn. .I. 'If IIIIIIIII III IIJI ,VIL II. I fi I C0 ' R, In ' II. II. IIXIII 'I .I.. II. IIZIIIIINIIIIIZ In. II. I CII ' .c ', II'. .'I'I:II III'I'I', .I. II. IIXII 'I'. I. I. IQI-IIXIII, II. II. 5.3 I IS D. .' -3. .I. 'I'. III'I:III7s. 'I'. IV. I'IixII IIY. II'. -I- I VIIYIII' I II' I I? I D. -. 2 W. III 'iII.. II. I.. III - 5 1. If. 'l11II'II1If. II, H. I-I II. II. I.. .Ilil uv. III. IH-III-I-I yu yy. I'1I.,y4 I . -II. flfff DA. Q F. .I. . .I. I.. IIITI Im. II. II. II' :III x NI. .I. I Egg D .- 1. I.. .Ion G. II. IIITIISIIYS, .I II. II If. II. 1 lag D0 vg 'I O, .Inf III. II. III' A 'L If, II'. II'IIIINIIis', II. II. 2 55: 71 H I . . II . . . I'I'TII . II- In III' ' W III' II- E I' A I I..x.' t. '. G. IIIIII 'S. . I I. III' KI IV III- II' --II' FII-: .I. I. II'. In ' nt, II. 4 II WT -- II- III- II' K xl, FI. 2 . I . M. w IA ' ' A ' Mi-Ig: I -1 . ff-.1 ILL- fl 75 lf 15?5IfI -1 f- J, ff .- a 1- - 1.1 ' :fab --,1 W . --,,,- - 3:-.. I4 'I I , m-.iff -NTI -.'z-.x.'f-I-T-ffwvi -.-. L I gv-f VI -11131-ff'i'Q.'.'.Q..4Lg...'-g.'.'L.-gfff.f...,l.4ff.'l.Ll12Lkli5Q3il555 ''- .3.. ry.. .-.. '--x:-2: '---j-Ylgiv-N .g:::: ' tif? if '--I-I, 3, - gait .lt -Zi -f ' . N A- ' 4 f' ,711 x ' L . ' Q-.I if Q5I-E: 4' I' ' , i - X, . . .. A.. A Lg .L DJ L- .. ... .. A ,....,,, ,..i, .,l1,,., . ..,. .,,, .,, .fE . .,.., , ., . ,. '51 I 1 in X 5 n 1 . f f 1 Z, J I Y, I x I X , Xb I 4 46 ' . . .. . , 1 .1 , ' ' - v ,,,,,, Q.-Q -wg --1 , ' , ,Q .I llwhqsx-2 N . 4 . . t ,inf .-Q 2.-... I In :XL : A f I 'aw' 1 I -:V -V e,.,..,. 1- . , f-V . .1 ,,,, ., ..,f-' . A A iggii5HiigggiggililnlsgkgmitzlfIIlilImam!!IumlinllIlxl1nnaaInuIInnunnnn1uiushli.i..n ma.....u.Ll.,'f-limnm-ff-'I-,-. mm. .mmmum-.uw--mum.: af-r.:-lf..--.s.mm-va-...mmm..............,m.....,.-..-7-.-.------.-m...fv.m-I.--mn-nn ...umm-mnm..iiiL... ,Him ....-,u 53.: :Mg ,,,,:. ...-H, . -.., H li, In I 5 ': I I ' x Il FH ., full M ,, ,,, 5 If lla A -su. I ....n: .. . ..: . . . . . . : .. . ur.. .. .. . .............. . .-..... .. . .. -ef Y QZX A A I Y , .4 S '- 3: 3:1 5:4 3:2 fu -:C 4' I I ' ' . 'I . L7 Photo by Winn f The Berean Bible Class A TIHIIRD BAPTIST CHURCH A CLAUD PEACOCK . . . ..... ..... . .Pres-idefnt 15,94 C. E. MILES ..... . . .' . .Vice-Pirbsident ...Q ?',. P4 MRS. W. D. CI-IASTAIN . ANCHBACKEII, HAROLD BOLING, W. M. , X . n A 1 h IE Him wfpgu W' h nina ITE! V , I 1 q BAUGII, T. M. BURDETT, T. S. BIDDY, W. J. BLAIR, W. H. Secretary and Sponsor WIILLER, F A MORRIS, C. H MILES, C. E. ' MCVYATERS, F. . LICCRUTCHEX, T. E. KEITH, GEORGE I . . T 1' ' I W .Z 1:7 Z! Z gm 5 , .4 5' .fi 1 I Q5 o F Po y .4 If Y 22 V :-: H J ' 1 'K U 4 + if u iii: fi. ' I flllllw I 'T ..,,.1 1,1 x COLE, J. C. MCCALL, R. L. J' COIVIER, W. S. NUNEZ, J. H. DURHAM, C. L. I NOLEN, DAN G. DYER, R. A. NORTON, E. R. S. DAVIS, W. J. PEACOCK, V. L. Y DONALSON, L. M. PEAOOOK, J. VV. 5 DREW, EUGENE, PRICE, J. W. Q pf EDWARDS, T. E. PRUITT, N. S. 'Q Z EXUM, A. C. PROUT, H. W. 5 Z FELKER, W. O. PAIR, C. O. . N. Q , FAUCETT, H. L. ' ROSE, J. K. ' ,fi ' GARNER, J. L. RAUSCHENBERG, J. A. if GOLDSMITH, WILLIAM RAUSC1'IENBERG, A. O. Q GRESHADI, W. I. RORISON, F. M. 5 Gnms, R. S. SINIITH, H. F. Q I JACKSON, O. H. SMITH, W. R. JONES, J. S. SILVERII-IORN, L. J. Q KEMP, ARCHIE TULL, S. H. I 2 KEMP, FRED XKXUGHAN, VV. J. E Z KEMP, ERNEST XVOODS, HOBIER ' 2 KENT, W. H. Z E ff . C jo N4-.icffo Q 5? ., W 4 -raid WR f X XX I fr -,-----' f frq? i xiaflllllyl ,Q M f 0gEyfAw9WMHWfmWH QmWm9W2f1 1.3. YSSXmxK.x.Xgg'Qx3NXgxgm, xg K. ' I I I I ' T A Jaan? 1' :AH '- 5:x: '7? 1.f, A. ,' 3 . ,Lyi5,,P n .g. - - Q V., ,'. nl. x'. 1. 1. mm' 4,- ,': 5 . f' ,I ,f . X, le r 1 friwwf ,wi JF7- fn K, y I R w ri: NR ,-4 -I - 1 x 3, 5 X ly A Y 4 QQ F li ' ' KI i L KEN Cx? 9 :xii 5 qi, 5 Ki' k? iii' Z li.: 6 E Z' E Q- 11 6 'A' 5 f . 'Z if. 4 . f I, 4 -. y : y sl 7 if 4 . Z f Z 2 Z 5 I P 9 u 6 tm 6 V 3 L. ,. Q. y. 1: X 4 ,. .vlf , 4 E J ! 0 1 1. V 53 i E U 3 ui wa X Nagy, ' x A r , 1 ,QQQ FP! I ' . KPITICN 4 'I Q 'M un.jL ul ' XQY J - 'I V55 7 1 v 4 .aim I s,.:,. Qt fgx 4 4, I. ti 5.447 -uu- Rm. V . xv Mo W W 'V 531 .Y ,.l J.. ' I4 . ,, 'Nfl' ' W ' , 'QT' Ex ' 'fy .A is ..--l.-iam 14 1 'S fi, 1' 7 'Q .4 f fi E? 'N I v 1 51 S22 f Q Q I YZIMX' if ' ' ij l H' 35: Fw 1 ii --...iw 33 .f E, 1 fi. ' I, E si 25 Eff E2 SQ .4 1 -U K 4, av H275 Q2 F259 , ' S Wi . -. Q.-HL--',':1 '-.. ', A ly :Qs ,1 ,7 s0.,- Xmlf A MVN - V 7 . f 172 N-'fx 1 T5 'fyyi ii, x -u, 5 Y ' L '- -:fl -. ' . , -Avg ,- -YYY W Y YV, .gh 21 R - 1' ' M '4-Uri? LIONEL K- Qfkiiii 'K 'Q-.s .' Nmuf' -2 4 . x-'1 gf ' ,- -1 Nllmkf:--2.:'.-'f.-'X - ' I I WX I gifs? M 192-'57 . , , 'f 44 . - -X 4- - -f f .,f . , ,pf , I, . - - , ,- 1, ., ., X , X - ff ,I ' 1 W,-I ,,...- .-,,f -, p- - - - I ., ,-1 f ,,.. , I Q ' 'f k'X-Q.. . X ,C --WH 1 I gi J , 4, L - if Jw-1-. .- .--,.:.f-,A - ' XX .. i - 1' . , .,, . . - . ' -' 'milillliililfilmrlIlmiqniglllIInlmmlmllnlmumllunlmaamnnmunnmumnmu I :..m.1, uqef-lwmf1.--vAI-.-,.mm.4.u4Immm--5-1---numum.--Tf...1 - I.1I....................,..nmum.-,fi-fn---M------W-M.-..m-Hmm-..n.H.mm-mmmmum ' . gm- -1- -fa, ,Lge LEEEEMW W. 'QM T H LV P I lr - 1 Ili I .4 5 xr H I!!l i5u lniliSil..........:.4.......a5::xanax:::::::al:::ss:mx:um:::::m::::::l:::::1::x::::::::1s1 z 's ::::'::: ::::: 5' :2::::::l:ll:':::'llllllll::::::::::'... L' :::m:..'1:'.:s. ....::Hn1' -S.. -.. ' ...... .,....,. ....L..,.. IP SX' Qs: I I I III, , , ,r , I, I. L.-L,' I I 5 :.!,. FS w I 'V '55 J! , I X 1 s . I it 5 I4 I III II I AI I MIM M! IM: Q' I 5 I Illia, IIIII 1 I I I' 5 I 'W Q 5 4 I C -4 ya ' Q I Q fl f- Q'Qx'ii'x 13? ,di I I II II II I I :I N I I up ,I If Ei I I, ,I MII 'SQA I, 'I I., xgflfi 'IQIII ,-I , I ei. IIF5 I I I Ie IQ: PNIII IEEE? I IQII 5 WI I-gi' Vg::fI I I ?'5I V341 .I 'I III -..J .. 'I , EE Qu I ' lg Tr I I I I 'IN' 'I II- I II 1' IIN I its .C . IISI HSI I IIS' x ISI ,J I I 6 I. IIN I, ,. N, 4' I NI ,J IN 5 IIQII f I, 3 IIS Z , N, 7 I Q 9 x z 4 f I I 4 MAJUH A. L. P1f:Nm.l-:troN, Jn., C..X.l'., D.O.l',. II 4 1 N f C Ulllillllllllllllf k 7 N- X I 7 .4 Z S: Z f Z3 I I 'vi O :I KAI m,,,,,f' 10' A Wo X HX , ' 'I Y ' 9AfEifffffA5gitf QfQ7ff?'QmI If Y 'X ' 'H , - v - bv W A A f' A' .4i:vW -'zmzff' N- 2327- ''Qf.WA.-?7g2f5Q?:?511t1:1'fi 2 4 I' ., ' -f f' , my 7 vx ' if qw-- 1- ---4' -.-.. 5. If ,X I I I?ibi?Xl I- In MI H, M,M 4130 Llull r 1 ,I ' cl ,ilikX III' Tg:5Jq1li+ib,,:v.gb7 iff- , .:... - I - - fg- 'i'jt-. in X ff ' H' I Q 'JQ5fe5m,EV 5 ...A .1Q25W.l X -' ' - - r 'V V , D -5 2 If 3' 1- 0 . fi I .4 1 '- QL- f I I -ff 4 - ,ff -P A : - 4 I -- x - . N , 4.. -- X - . - .- C... 5 '-.imw .5-.w x-xxx - f..I'I..' . .- ..... .. -1 -... M 4... . ..........,..- .,A........,....-.. .-T.-- 4----' -- - - f- - Q-3 AWS.. -.Nb ' ,324 fl ' ' 'L-2 f I I V 61253 wx.: xxx- N. -2. . I .4 'vw . - -- 14' 7 J 4 Z Z 4 . .V .IOP . . .. If 7 XIX Z 4 f.. 4 4 5 4 4 '.. . . , , I X I llXlJl.l.lUX, Jli.. L. .L C.. ll. U. l.. I 'ffm lllunrlunl It has hw-II dm' to the K'ffiK'll'IlK'y, nlrilily. :Iml unliring I-ffurt. .if llggiur IN-mil.-lun 11.5.1 .mr Militzlrj' IJ4flHll'tllH'l1t has grown tu lhm- sph-nclirl urg:miz:Iliwn whivli il Wm' i-, Sigqrling unlll some eight liunclrml llll'll principally I-nrulh-rl in lln- l....i.- I-.mr...N uf Hmhv mm. four 5.-.uw ugh, hc has built :In rrfficivnt org::Iniz:Ilifm uf swim' fmirlvvix lmmlre-cl I-zulvlx. four lmmlra-Il uf which arc Juniors :Incl Sc-niors taking :ulvniim-cl we-rk in six un' 11. wlm-h lmu- :I rm-oral of iw-I S cCcSSiVc Ycflfs H5 il di5tinII i5llf'fI 1'HIl4'g:4'. lim-siclw his unuxnul :Iluililv :IN :un 4-xc-vnlliu-, Xlnjur 4 4 f 4 4 5 f 5 . 4 4 ' I 5. Pendleton has built for hi 'S lf an 'i5'm llfuilimi in lhv lwurlx-of :Ill llama- wilh wliivin he has come in cnntzwt :Is :I gm-iitlviimii, love-r uf our .Klum Mal:-r. .Incl .I kind frwml, :Incl it is with saclmrss that wc hvur hc is to lvuvm- our vninpus, wlu-rv lu' has mln UH. N-.pu-l :mal :nlmir:i- tion of ull. 'fi 1 E53 4 4 I V CAPTAIN CA PTA I N CAPTAIN CAPTAIN CAPTAIN N CAI-TAIx -llllll P R953 P51 ki gill: my qu i Q1 ml. Y ' 'l A vt Q51 , N Q QI S 'X 9' 335 C-I 5 5? 2:1 PE E CAPTAIN OliCANIZA'l'ION OI - MAJOR A. L. PIiNDI.Ii'1'ON, JR. . M MAJOR XV. C. XVASIIINGTON . BTAJOR R. T. Gmsox . . FRASER HAI.:-: . J. I.. IXXVTIII-EY . P. T. IFIKY . . . F. C. SIIAFI-'I:R . . XV. A. IiIOXVI.ANll . . T. D. Jizxiuxs . . li. F. S'l'Al-'l-'ORD ..... FIRST l.IliUTl5NANT R. IB. IJAVIIJSON . :FIRST I.IliU'l'l'INAN'1' R. R. Cornsicx' . FIRST I.IICUTIiNANT C. F. Um: . . . M A sTI-: ll SIIIIIGIIANT A. C. BI-:l.I..nIx' . TPICIINICIKI. SlZIKGI'ZAN'l' 'l'lluMAs BRASS SERGEANT LI-zo I.AIlI .... . . . SERGIIANT YV. H. Gonmzi-2 . . FIRST SEIIGI'IAN'I.' T. T. JONES - SERGEANT JOSEPII 1'IRl'SKA . SEIIGEANT H. I.. l4lI.I.Iss . SERGEANT R. XV. SI.Ax'noN . SERGEANT NV. M. SMITII . Q . bi I 1 X2 S 5 I 'l'lIl'I 3lll.l'l'.XliY lllil .Xll l 5ll'1N'l' , I'ruf4f,w.vnr JI, S, uml T., l'nu.vI .IFIIIII Fill I'UI'lr.1' ,f Tw- .1 :I 3.4--NP f - of .- 5 -4.1 - ' QQ' ' zh X I XSHNA 4. :L Q l'nu.f'I ,IrlIIIl r-rl Vurlix I'nu.fI .lrfillvr-rl f'III'll.V . . . .Iir N1 l'r'Iv'I . Sijnml I'frl'lm . . IIIIIIIIII'-ll , , llnlmivlrf' . Illfflllfi'-If . . . lufunlrjl , ,Qijllltll f'lll'lIR . .Iir S1 l'1'Il'If . .Infunlry ulur ,l.I'lIll.i'lHlI'I l'j'-Y . . . . .IL If. .lI. I.. , Signal Vnrps . .IL If. JI. I.. . .IL Ii. JI. I.. . .IL Ii. JI. I.. . .IL li. .lI. I.. . .IL IJ. JI. I.. . .IL Ii. JI. I.. . .IL IC. M. I.. IR ' . . l li 1 if l . .bql . i nw :iff l 5 .212 , li 7.2 4 il if l .' , . If i 1 1.:U Q zh- ' . ye 1 l fr: l 1 nv, l -: . . I fs !-- . 1 ic I --,gw 1 VE 9535 , 1. . ' X ff, 'Q QI.A4X LETS! If Ml ,F H513 x,j' ,-'.' I' ll? in 1 :I I iii lifl IIE! Sal M34 Iii I-4 ., Ia! lm :ll ii. lil gif l,jl I If .. zi . . vii ,.. . 3 fl I . I I ,.,- 5 . I-Q 5:2 I E4 C251 Ea? 1 li? lj lg! l 2 C9537 ww ' iv?-W fx it If Y,,,, 0 ,Q fuf IX,-.. H gd fig., 'jr W xc'f??f' ' 1 . . .... . . 'N IIE-I A -- I ui-'. Qf'fNw-4-fi-1-I-5' If '...,1jLf.'.'2 SO I ' I xx.,:d., ,3m3y5XXgXxx5:m'c1?'b:-I'.-we--' .pax 5 A Eg 'zz I I-sfggy, ggi-.-..--:fi-': :f1'i. ff ----W -- ---- - -- VY .J-I -X --M 1.-wffw ff 1- . f 1. .- ,,..,-, .,.- .Q if 7 .-Ix X 'fr-pe. -...Q-1-. i -ff'-TJ U N' I 'O X -- ,,.5,. ' 4 '-' LIONEL K- -X33Rx'Q7,,,::5V, jf f I ----rf R- P '11 'ff3l.11Sf v ,V 1 1 X I E f-wfx Qc 1- 31 7' J5cj1'?X xf ff 531161. IW , .f ' f ,A Wg .ff Iii- '57 M ww T1 - M Af lJg4f , o 141Qw w ' f mx WH l -1 2 -,aw ,4, 9vyy, :f. .c N !I,g,htY', ml N1 K 1 ' f 3 3 , - 4 w Q J1,uL..Lg1m'nfl1,,, 4721' Q wj'I,kggi?'o:-Q' A ff?-if-f., ,A mf' iv .- M W. T' 'A'A - QC ' -W :Mgr qw f, : f. iff 'WGN LLLmm1' I 5 I X i ' - , Q7 -fQ,ff ' 'f K' YW M' ' UJg,.J,q: 'A-Wi' 1 Q lk' v 3 1 1 ' '77'Ll'1Iij Q7 I Q' I ... .I Q 'V -,il .Z ,ng . 4?.::.:i:,MQfQ.237!f 5 ' 'pJl'LM5Ff'Y-1iH,5w.1+fE '1 Q1 31 i74'f7J9'f '-www. W-x J nf wi. 3 ' fj1'fi'g-.n-.,,,, gg 'VE-IEBEECL:-n,mffv11,.,:,j.ij H ll V f 1' 'i ' L'79 ix:-gvfflgiifgj-A'. L, ' 1 5 j Q 1 1 l ' gg as f Q 1 Qgff J 4 X ' ' 3 I f ,, 4 1 wiv! 5' f pf I f qLgLfHfQf .f,f, V' , W w yy, ., N , , 1,Aq,, X2 Iv -3 V zilwiyi ' 2 ,,.A' 5 Vi M2 .3 . ' 4 ifgx .22 ' G ,W ' . If ' Y itz. A 1 af k L Kfjiz' 'F 'sxenm ' , , ll r ' 2 f kHC'fE'X5 rl li 1561 I ,y 6 5 qxli Eg N MEEQU 1 U A I fill. f iam mn. ' s:-ff' v 493 ' ian? Ihr! , 'ML- fa, . 1 WK-jx. 2 5251! ral 5 l 2.111 'LU mar 5 a N ' Y ,i A EX. wg! L f Eg W 1 XV Q lx H4321 lag ' ' C? - lL Y Egfii f WSW Z I: 'Sli 1 V Q . Z 'APM Z MSW y 4,' im 4 115 ,i Z H Z' QM 5 A Ng! 4 5 W K g M515 Q1 1 Z Ealgiw 4 1 K sg? Q VNU E4 US!! 41 ,N YK vf .N1 1631 uw W Q21 14 - MQ? ,Wa ' 2 5 N1 .K tigi lv fl J QW wwjf, ,N , p9?'I.-. I if f' Er: -M- ,1,HG,gtgfj?4mZ2f,5,5EjfH1gg-ilk -9 Mx, 5 A5ffT?..1X..N1 A i , . mi I H --5i, 1l2n,7LHH lfksml t -,ia , f--,,, ff ., v ,f.ffB,,. .4 - -f , - f 1 f J- S- . '1 , ' 'A-1:LfV :.fJf' --f- 'TTL-.'AbfFi4f- I My X ,, . U.. WF X ' M gm gm M M X1 Q. 7' 1 'f'vn,,'H IJ xx Q VI' Q, Q! ja : ,QQ Qglgf 0-..-AM Q 1 lulh Nm q-1:f1 .ff3y Q:1X'ism,:g.,:. 51 fif--f---....-AW lw ' -1 , 1 ,ff, 'LJiff, - - 5-f--jr 'S N-O,j,,, 51-. 7- 1 - Y .., Q . ,Gmxliru V GT, 5 jg llzf X :'f'f'- A' W1 VN A ':fff:5i,?.'TSxj mfg E x X 'v-S., - ,K Aw. X 'kwrgxlbb Ilfgfxd ',.,..,, R- R. X .' - 'Xf-sf F 4 .15 ' 1 x N 1-x nl. '. 1-' s ... -- . 1 1 'Y 11 f' , ft - , I X l ,f .A 31 .,152.Z.?1,-1, - gf, W J. -- imgi.- ,. a f f-. - -..- ,.. .:. ..f.- 1 QQ-- i - 7- ' ' , 1 -. W- L1 ALM 1 '1.1 -1--Lf ,, 3, 1-.ig 11 1 1 2, 1.11 1 11 1 .f I H E, D LVE: P' PJ TF- W . .- n'rn..,... ..., - ..,,,,, N, ,,,,,,, , A4--WNW . . fi? IA 1 M- ' W M'--'--H ---M -- 1 1 1 --f --' -1 -. - 5 'f ' 1 15 E ' H .121 wr? ' ' ' . H -5. - N 'J 7 fl 1 ' 11492 -.lgwi ,i. I 1 1- 1 2 if 1 11212 ' 4 . - 1 ? ' 1 1 7 ' IT: 5- 1 if N. 1 5' , :.. 1 f ' 5 :it 1 5 5' 1 f if ' K .. I f ' 1 1 1. 1 f 1 - ., . 1 12 , X1, 1 M ' lt- 1 Em :Milf , Q: 11111- -- 1 1 1 1:1 3.51 , q 1111.9 A ul U '1 11 W' R ' l S ' Qu eglmenta taff 1 E1 1 'fi V 4 Mus. A. I.. Pl'ZNlH.lI'l'UN. Jn. . , l1'f.,1',,,,,,r,,1 1'1,,,l,,,-,,,, Vfsfj N Miss l'1nlu.v IJAVIS . . . . , A l,',.,,,',,,,,,y,,1 5-l,,,,,,,,,,. 111,111 E C. IC. .louxsox . . ...,. , 1'.1l.111,l N 1 , . :E 14 ATCIHSUN - . . l,lIIlfl 711I7ll-4711117111 1' T. C. Dnlcw . . .' , , 51.117 jl,,'j,,,- I-I. R. Dvxwom' . , , , ,flllillfflllf NV. 'l'. Mr:.u.on . , .N',1,,,.1',, r:Vf f,',-,f li. P. AIVIRIRAII . .... . .li1l 'Eif IC. C. ll.xMnmNn . . .lifl 555 is 1 14, I. 1 Q11 ' 12 II. SAVSSY . . . , Sr V-flf flllf ,llrrjn 1' '1'. S. B1.,xc1nl,xx . . 'l,'lI' .Qf7 flff771f ,M ,xx R. C. DI-ISAlYSSI'llH . . f l'l7' Nr rlflrflnf w. 11. 1l.111mN . .fw11111- mm,-.1 '-I , ' ' .jj 1 G. XX. l,AI'Gll'l'IlY . . f fflffr ffvmrfl 2.5 ggfs :Is 11951 Q5 115 F 123' . 'x 1-A ,1JQ:5J12 'IX 1 -1 , wa .P. ,lY' L fi '90 -L ,R -,H-5' 'A' K Lx .lM,L'4-aLl4-- W ' ,-.xsfff-'Tj 1 - LIONEL K- I Y Q-'irg Q-!f',X:2 F ff f- -I 1- 1 if X Xi, ?i:--.5 'f fit' '5 , x 2,02 E 'V 1 1 .11 -f 1 X. f. J. ---X-, 1 ,x 'f f , inffffffll J 11 ,1 1111 -1 1 If f . .. 11' f 1 Q' 'R 141 1- lf 1 ,, , ,V 5,,, L 5 E Nl . KAk7-I-ffilgjfi l V I Ik. I5 vii: 'X Q!!! 1' K 71 Z ' ffimf I' 1' Ni ff? JQQL1111 ffw 11 'ffl' , 1 ?f4 '::fff ' 1? f NEAWIH?-13'T l22f?mQ,fQ'lu1v1111:1mL1mmfEum1Qf1115111fnfb!Qi1,-1111111111012 , fp' Q ,Q , , AR 1 ,. . gm! ,, ff, ,, 1 ,gg'--'.Qf4:1,:fEgg4gg:.::4:r14. ig7'gj W'-ff - 131512 Hb' J in 1 v' ls bi 1 1 I, 'f f V K ' ,f-3'-' L. 'Vi.F Y V jpg 1 - , 111 1 1 R1 swf-, 1 K, , A-4. W X . 5l5?1wf1 1 - , -gg ,fw Af 1 1 M ,-,, 3 , 0 X - W ' f Mm'W T'E f1iQzmf.rv 4:335115313111::5g::ig1gi. 1.Qf.zf.1 --J -1, 11 bfgi 'f 1 'Nay1 , 1 ' 1'f H 5' li 3 11 C Z ' wif' 1 1 '32 1 A . 1 ' Hg f 'Q ' I 1 fig' A .JZ 1 1 1 1 Wi- 1 1 :vi V 1 1' 1.4 of - .11 Eg? '1 1 , 2? ' 3, 1 111111 2 4 1 9 1 25:1 1 4 -+3 1 i 5291 wg 11 .51 1 gf- 1 :ffm ' 1 1 1 f 1, 7 , 1 : 1 '35 13 1 9 Ai , 1 Y i E . 4, I 11 11 f p, QQ UHRR1 1, Q 1 QW. D -H.G00 N111 W :-:- 1 1 yfj K 1, I A X,1,1 Rf?- DQL-Ti ff: ' QHTT1 3' HN31 Kaf- f XS ' wx' 1 7 fi? '5 7 .x-iid is EE' 1, 1 14? 'ITM X, LRTXAV K 1' . AUM CJ Rl f 1-. Q' Z 1 129 '- 1' 191 k 5 1 1 fd . Z: H ' Q I 1 f , wi: I Z 1 . ml 1 4 5 1 aw' 4 A 1 l, ,' QU 1 Q 1 1 ,wil I1 5:1 1 14. ' 1 'iii wi, 1 1 1 .1151 1 f' il f E E 5-if VI il ' f 1 I . '1 1' 4 1 M QHRN 1 NQLY V16 1, ji 1 12 ,, . rl ' V1 1 Q 1 .um 1 1 F7 1' - 1 - .A., X - v gi ' gp N. . 1 1 1 1 1 1 P2 1 i 5 11 i I I 5 3 , W9-x,A 7 N- mink, .XXX k Y, Il' 'ffUA - M V W WA H H - H I 'HH 4,X,-. Y l XXRLVKNXXKM lim ,Q 1- 1, I1 -A fl Q1ff'lifff'f1f','W7'?f f'f'l '7ff'? , ff:f15'Aa 'jxi'f' f'iN1V'1 fi 51'1'i5, I l1QFlX5Il:'1-65545351.gllifiiX15251iS.iff.SXkXRiiiiiSS QN '1 9 M ' H 'V '1 ' 'f1'-11111.W-WE1i'2fffQf-W1f'a?fx11a11111-if W 'T i x X Xxx ' .X ,K wk, .gyn- , 1 1'1 1 k -K, iulxyvq l S 5 3 S x S ! 1' yo Q J' 1L1 N1 1 '1 11 QT' ...L 1 ,IQ I' 1 E9 1, 1 1 Qi' 1111 4. f Z 1 9 f 31 ? 5 5 5 4 4 2. 4 5 5 4 10' Q fb... :lf-..-m.f f?l92??,fe fy Qfw-X QP f 1 3 4' : I , I. 1. -th ' , ' N 1 , ' 1 H .A,4 4a1,.,..., -- ' 1 ' X.. .5 .g' Q A1-' ' -- -1- A - Y --ff Gfv M f? F-far? I5 L E PMPJ .6 -A 1 . 1' ,J '11 ..g .1 'I ,1 11 iw 1 11 1. 5 1' 1? Il M 2 K f Z f Z 5 Z ? W 9 5 f 4 4 4 4 5? W D. , .JW yu 'Il' an 1 1 1 1 Q 3751 11g,l.' 11:1 'FWS Il 111 ll o 1. ,,1 1 1 E1 Q-1 JS S E321 .'.' . 51 NJ 'Q N 11 251 521 . X b F 3. ,. L D CUM: Q9 SPONSORS 1 sq- 1 1 1 4 CARE-f DR hs, I X My 1 WT , 1 ,, , 1 Co H1 ,W nth C141 1 1 i, A 1 1 qy N14 A 'L's-.1 L' Lo C. 5 . 11 'Q 10,1 N o1'R1Nu11 A Co L 'N 9 1 B .rt 1 ,N 1x1 'QT' 'Yi 'ff Xi Y QQ . 13 1. be . AEST F05 CQ L 11-mg QCv 'SC.:7'1-I 'ELL H1-11 C J' ra T, CGMZ 1 .11 1 HQ 115 1 1 1 1!-3 1 1+ 11-7 1.. 1 , .. 1,1 11.1 '1 11. 1 11f: 1251 1151 1 11-1 1 1: 1. 1 A . 1 1 1151 1 i. 4. 1 Q '1 1 1 lg'-jf,', me-111 F118 1 ...., 1'fTfff1 1' 41 fxfiw 1'U'.. 1 55 '1 11 11. 112 1 2 11? 15 M Y' In 154, 11 'li If 1, V :, 1, 1 . E1 1151 133' .J 111 J . 1 'J '4 1 1, , r'1 H . if W 1:21 .112 1114, '1114 1111. ,1 ,n1 fsfwxsm Q ,4gwN1!fxfQ5:,.w . 1 Q H V. , xg . -' r- . . I ..QL .. .FT ... ,... QSV7' 53-NlxxxzxxgivX-.AN-xx-9.15. 1' .gsrgbv I - 'rv' ' 'J-'f-:3t-.,:.-....L....,,,L.fg,. .,lg,.5,,5,.:.,.g.-,:,-.5p4:4,Lf:.-.z.'.'.c'5.,3-'.f X - g,,----,, T , , -W Y -.. ..m...? +,,4,4J 1 N . . . .... A .-.--,-...-. .. ---fy-:f,,, W..-Y Y .. -1, b A - S 1 .,1, 11 I Q 'I' ' ,lvl 1 ,111 'T - N., ' . ' - 1-4,xxV - 11. 1 . ,mas -3 34' uv.. ,..-'FH LION EL K- K lkillfixg' kk X -i , Ib, , ff, -' S -1, .nl 1 ,IS if NK Q1-'ffjil :' -f ,,4x 1 0 ,O 4 ,..-, I 1 fi X , s ,ed- L -S .F M ' 192.55 M., . . It. I --I WS.. 'O' fi' , 'L , ,, L , . I L 1524: ,EEEEEQQITEE-giizzgzsnnlm IIIMTIIImumnnnmmulmmuIRZSSLRQ-ix:Rx1eu3I'1ffnQFf:ffifQ-Q-mf -f:--1----ffa mm-1Hwil1wvl'-3f:'5WW1W - f 75' ' M' ' ' nm? 'J5'7 'L' : : ' ' :5 :i':? ' . I .L I 'I' H D P LI . I I .1 :'5.Wk7 L QW A--A I W if .E 'H f'i' TJ... ' ... . .i::1:l::::I::::II::: u'lrnIa'::a::u1s:as:::::::u::n1n1:Is1:x:u:::m:::uxx:m:::::::::: mu : I al::::l::::'.::::::::::::::::::m:::.::m:::::::::::r.:mian::a:s:::m:s.'::mu:rlr-:::m::lz:1::m:2r.::.1'.::z'.:::::x::-.:l::'.:::r.::::. .. ......... 11- ...., ,,,, , r I .f 'fl' e V 9 I I P A - -.,,..,,. Z I er I 14- 'nf G A f 4 16 ' 19 Q, it 16 1. U H , I s 51 I ,.......... l X I The Georgia Tech M1l1tary Band ' I V' L A OFFICERS 1 FRANK ROMAN . ...... . Director f E. S. SULLIVAN . ..... . . . . . Major -1Illl-I V in i , B. H. WE LS . . ..... Captain H. B. GAIIDEN . ...... Captain T ,-EQ., L. E. PUDN4 f L, . . ...... Captain VV. E. SICKEL . . . . First Lieutenant Him H. N. HII.L 5. . . . First Lieutenant J. T. JOHNSON . . . . . First Lieutenant fi x: 4 A VV. R. JONES . . . . Second Lieutenant D. F. NORVELLE .... Second Lieutenant ' -5 will . . ui u J. N. HUDGENS . . . Second Lzentenant T. M. HAZELHURST ..... Fzrst Sergeant 1,6 J. D. WIJITE . . .............. Quartermasterfs Sergeant , ' 5: PRIVATES gf' 1 - 1 2 ' 1 ' ARWOOD, E. D. GRIGGS, J. H. MOORE, M. R. M E1 BEARD, D. M. HABOUII, T. VV. MUNGER, H. B. BLASINGAME, C- G- I'1AI-IN, E. VV. NEBLETT, R. S. 1 BOYI-E, G- A- HQXLL, W. W. PERRINE, D. E. I ERP-TTONI HAPPOI,D, A. S. PERSONS, J. H. HAPMAN, - - HENDERSON, T. A REDWINE, J. H. COHEN, I- HII.L, C. T. ' ROBERTS, D. T. Q COLE H. HOOD R J SIEGAL H s 2 : ' - 1 - , 5: COLLINS, J. H.. IvEY, J. W. SILVASEY, J. E. 1 ' CONKLIN, R. H. JOHNSON, B. G. SINGLETON, XV. I.. E f COPELAND, A. J. JONES, R. C. SPITLER, S. B. l Q' f CRABB J. E. KELLER, D. D. STERBING, A. L. 'N , Z DQBBSj I. S. KELLY, P. G. STRICKLAND, J. O. y DONALDSON, C. L. KEI.I,Y, T. 1 UNDEllNK'0OD, J. L. ' 3 DOWIVIAN, W. F. KOHLRUSS, C. F.- UPCI-IURCH, G. V. N 7 DREW, W. E. LANDERS, J. L. VVAI.'rIIAI.I., E. C. E ' DUNN, W. F. . LYON, L. NVALTON. XV. T. 3 A BANGLE, A. B. MAXNNING. F. VV. XVARREN, L. P. I , ENGT.ISIT. J. E. MARTIN, H. VV. XVERTZ, T. R. FARRIS, R. C. MASSEY, C. H. XVINKLER, T. Q. 4 FREEMAN. C. F. MAULDINO J. T.. YV T I 4 . OODS, . . .. xl EZ GETZEN, J. F. MAYRIELD. W. R. XRVOODSIDE' R, M, 2 gIT.BER'I', H. T. MCCREA. T. R. uTX'A'1'Ty, I, E, ' RATIADI, R. C. MOON, L. P. 1 f L A O ,L'f !Cil:L5x S .1 f r52T?'i'V9 'NOf X. A 'LA . O I . . .f nf5 53f 'Wife f '5:am ... - . . O O O - O., O , N I.A'WZxRM'f6WZ36fMSQ?YMU', zffwsf- ' 53 '25 TV-' xt If - - A A A A I J 'J , L . . LZ, gm' g S.SSN:Nm ws:SQ9 1.10 ual. K' V W ' lulll A VP ' 'L ' ' ' K UW, YY? X 2 ,ul.,.fEfQ:f'fiZ o f ' D A 7QLL5.f gg. 1 ..., II :Q . , :W I EQ uw, , Sv 'QI I . X S S S S x I S S x S S E x S I . ,I :IA II I. gg P4 Am 1 ..4l . I E! Q17 L., I gmt I! I If ,um- .9 IIII 4 ' I I 'T I If if I2 II ? 5 4 2 I I I N - f' N Z?bA QSEEBNI f- fs fa A., I Xa 5, , 12f2ff ft.f-fft1Q25 2s:a5aii -afaa . ' ' f -' L -s - , E , - A ' I T'ff 4?A 55?1ff,I'-. xg f , , X X - ---,,-Q, I.. ' . X Aw . I' pf ', ,. 1 at , -' -' ' .V .'-1'f f M N.-- - , ggziifill. ' 'r-:hw fs:-fd-, ' I -- , V - .. L I I A M x i - - , , , , 4 i ' , , .U I .-' a MauM3f II Eiga al3t1+5Vfl32 tl? Ilfl taiai , Ph I I 'I Il ' I gi , 'gf -I 5 5 3 ? I Iv 1 'T i is +I D .4 I 5ffM?F5' It 5 iw - 1 x i 1:-:Q 4'z I: I t I , Q I I .LID I I 1 Ea ix ' IRI III. IL 5 Z Z 6 6 f If X , f +- 5 7 Z Z I - 6 I I f ' 9 . I, , If-ire Il, .f. 1 II- , I I. 'CMAJ 'Q I. I I I ? Z Z Z Z I 'i,.1I .. I 4 5 ,li , , I I 1:siY:I,fv. In fu'I:y1I? II I I I I Z Ifiu-'f1Il,I1I-In I I ' I I I f gr ,:g Iraq- 7 I If I- Ziff? Hi' i ii ,Q I ILI1' ,'I,I'1 IQ I I I I 'III I, ,, I QI, IIJIIJ ,I Ir I I I I I I I ,JI IIIIIIII i i J ix, I, . I . . I 44,4 I -1-l1, I IWW!! I I-if ' I fffffff ijlhilf i 'FEI Ill ll f Infantry Unit :yzg '. .TNIX I' 'I N i First Battalion WI IYT' ,I I. ,, 'IIIII 'QQ MHS. H. H. fiUIlllIl.Kll'l . ,Vim If,-an I In xt I I II 1 , -1 S Miss Hun' Snrru . ..,.....,.. . .NI ffffl, - 1 'Im Q H I S'l'I'IlliN'l'Ul'lfl1'l'1ICh I I N. 'l'rnNl:u . . .......,.,.., , , ,llffjfff i lm. M. sw-.mr . . . ,lflvilffflllf I T. P. f'.X5ll'llIZlI . , Svflflfllff !'fIl'flI' I NY. .X. Braun: . . . . , . , gil'-Ill 'vff 1 ,llffjfif I 'Q I III l'Xl'l'F,l7 S'l'.Yl'lfS Ol'I H'lflIS IX VII XIHQV. C.u'1',uN 'l'. U. .lrixmxs ,..,. . . lifffffflfjd i l'Al l'.uN l'. 'l'. Flu '... . . ff 'f'ffff','l X 1 l',u r,uN YY. .X. Ilmvlxxn .... - . 7 f 7'7f'jf 1 l 1llS'l' l.u:rTl:x.xx1' R. R. t'o1'ns1:x' . - - 7 f 'f M.xs'rl:u Sltiu:l:.xNT ,X. C. Bm I nu' . - 1 7'- 15.11. lf- fig S1z1m1:.xx1' I.1:u lhxm . ..... I - l'- lf- 'Vi ff- x Sxzluzmxr W. Il. Ummmi . ' ' 1 If' Av ii., I f. I Q, I-. N , I Q11 I fa Q. + J il -L5 , 1-I I I :12 Q I I 'I .. M I I I Ig I ,fawzs-?X My -,,4' gigpgg ,,., K' ,Y -Z gfltxxl fix! ,, ,Ma H, H ,fl Wifi, W- - -, ,- V 7: , K I ' A 4 1 ' . f-if - , L W : L EL I l'LT:g2i:IXC '- 5: ffiei- ' ' ' ,-31 i ? t'.Q' - 1' - .om ,Yr In f, L. ff, QYQQSEPQ 4 Q . ' M.. fF5lEFX'w U LIONLL R CJ 'lull l':,qx,.:,i ,Hi '--C 5.2.29 v I y . . . , 95 f 1 :95 . . fe' wry- 1 A 'x...,., -..f ' .f , FZ . Af-an -.., X, ,E+ ,.-134 5. 'G .3 3, ' .. A, 7.4.1 ., . hui: - ' ?? nwllasal5Q:I n --vw'-L:: IiuI ' J-f-:iq-1- mIJ'fI: f 4: FhM2g!5!iwi:! ! ggnlmgIilll1E! Eigigxilllllll llIllIiiilllIllIIllIlIllvhlilllllllllllihlllllllHllll 1.... ...um-.1 .1 .. U-1 -Q ,,,,! + I HS E. D L P PCI N I I I HMM A ' . ' A .. m,,,,,,, V171 mgiiia ....... . ..... . a:::am::::mI:a::::::s:-'mr-ns::::::u::u:::::::m::u:mmm nnamn..Rmnmnun:::mann::mu::::i:::::::::s:l:R:l:lm:::::u::l ':::::::::::::::::'.m1::a::r::.:: :::::.:::u:m.n.':.':x m..x...m: ..u.-...--3.m- ---. .- ------- - - ......... S.. . . 1 I-A' ' V I . N' U 1 1 V . , 2.1- . I A 2.211 sigh ZH Agn i ' 151 I if .4 2' 2' g 1 if 3 I I I my f 12,5 fi Q! C A W5 ,, Ompany .H Y A INFANTRY Ik , F52 OFFICERS l W. L H. C. ILOBEIIT, JR. . . . .- .................. ...... L Yaptain I' S A R. F. COOK . . . . . First Lieutenant IW. T. SHEPPARD .... First Lieutenant I 1 Q H. J. LINAYLOR, JR .... Second Lieutenant J. E. IQIDD ...... Second Lieutenant WH' SERGEANTS W? 11,2 ' ' M A H. B. STEVENS ...... F'-irst Sergeant F. AF. HOLDIES ..... Platoon Sergeant , Milli FISHER, YV. H. GATES, L. E. 3 'l r DIXON, C. O. MOORS, V. :gg U VVATERINIAN, VV. M. 0 , f .mn . 9 'IDP' I , CORPORALS BRADLEY, H. P. LIODGES, N. , A CONOVER, R. J. I LOCKLIN, J. G. vw .T gl 255 GREEVES, W. B. IVIARTIN, R. B. l I HARDWICK, G. R. IYIEADOIVS, FV. R. f. N PRIVATES ' AI.1NIOND, A. P. FLOVVERS, Q. E. LONG, G. SI-IUMIATE, M. D. If BELLAH, L. T. GRAHAM, R. H LONG, O. YV. SMITH, C. E. 5, .v BOOTS, M. H. HARRIS, F. G. I MALONE, M. T. SBIITH, H. L. S x BOYD, O. D. LIAIKIIIS, R. H. NIATI-IER, R. J. SAIULLIAN. A. H. I BROWN, E. H. HAVMVES, P. H. MCCALI., K. K. SPOONER, D. L. We BROW'N, E. J. LIENGES, F. E. MEADOWS, H. D. S1-OONER, F. A. N 5, I BRYSIN, W. H. HILL, R. A. MOORE, C. D. STAKELEY.. J. O. Q IBUC1-IANAN, C. H. HORAN, T. Y. NAXSII, Rf R. STARNES, U. L., JR. .V A Z CAPDIAN, T. G. ' I'IUGI-IES, I. S. OWVENS', VV. D. TOBILINSOX, J. S. ' N , CLARK, L. G. IIOI-INSTONE, R. PAGE, J. H. TOOLE, L. I. 5 COATES, H. A. ICEHOE, S. P. PALDIER, J. I., JR. TOOLE, IV. D. 2' 5' COLWQK. O, IQEITH, G. VPENLAND, XV. H. TRAYLOR, J. H. ,Q . A DANIEI.,'C. Y. KERSEY, W. D. 1?IIILLIPS, L. XV. XVAITE, A. F. f DAX'l'IS, F. M. IQROSNOFF, L. I. POTTS, W. R. XVALLING. L. B. gg DAVIS, H. L. IIANGSTON, E. C. PRICE, J. YV. XVI-IITE, J. V. DAvIS, J. A. LEONARD, A.,H. PURKS, IV. VV. XVILI., A. J. ,Z DEWS, I-I. LIPSEY, V. P. ROUSE, R.. K. XVILLCOX, F. F. Z DUI-RE, W, A, I,1T'p1,E, R, S, SAFFLEY, XV. VV. XVILSON, C. E. 3 EDWAIIIJS, J. F. LOCKR, R. SESSIONS, L. M. XLOUNG, R. B. 4 E , - ' L.. .- Ooi37'?'1xmSi XI Q , Y .- l!'W gi smbf - Q A I I - - L f A?!,WWJAW7W Ag1Q , 'I 'O ?EmvL QmX?wxmxxxp,xSzgqm.xxxxxxmxxKQo , L . . ..... f A ,f -' iv J O - A -- A - , ? -N O -.qu 'mf .E K ? 0 ELK! ,JA . . -- QI I I I I I I I 1 : K I . I I I I I I I I I I I I X IS 41 'W -+I 'IIE yo . fx v .-FY' 3,5 ...Iv If fa. fir., :I if 1 II , n Ik x - - :if-f'C'f jFE-'H . ...... ,..... . I. 'ZITI ' 4 ' 'j' K ' . '-' : ' Finals M - .. II - If-1 . ff. -I Q. Q ao I I I L. D AK IIIxxIsIIx I I K Company B XX I XIII I I N I X N IIII III Il IIIIOX III ININI xx IXII H XII I xxxux IIIII IIII nxxx x xxl IIIIOII X I INK I X X I XIX1 K X N 'VTII I x1'III4Ix I xx I Tl III III IIT! X O-f,f.ff I'I Ix Nix- XXXTK1.-ANN 'X 'NL 'I 'RAC I 171 I III Nxx I Nxl I I IX I II I III X IIN . N: I JE I J-.' tal ' JSI.-If X 'xx -.. '- .v IZI I ,N 6 ONBI. 'JE- 4xf N If I X X Ip E I X Z' XI - I- I X If ' ' If IW '7 I 3: N If I . xx I J : IS: W '- F-Af' ,-'fir' I . Ix' f , ' 14 TIT-' , vi- 'IQI IN- f . .. 'I .I I: QI Z ' : ., I - ' ' Ii f I ' '1 3.'-3: 47. ' I I M' Er X f II I . I I. . . . I I- I X f Q 'I 4, I . . .-,, I I I N d . h Wg. U i ' - AI 5, I.: x f I - , I I I IQ I Z ' hx' . ' ' I I I If I I I , ' - ' I I u' I I If IQ I Z If . , , . I U3 I 9 f .II .1 :I - Ief I I - I - ' I , I - I I if E Z I Ifffz I. . i iii E I g VIII- . '37 ' 'A 1' , . 1 I I2 I5 I 3 i' . .2 . ' .11 'I . IP: Q I 4 .II.I - I. I . . II f f I ' ' ' : I Q: Q I 4 I I IQ 4 I Z I :F I I It 53 Z . I - 1 ' 4 'E I INIxx'IIIx ,I I I' It all, I III I IlLI'.I!H Q I I . . , . .' .' ............. .I.,. , . VIIIIII in . I I.IZI QUIT ...... I II'.-'I LII :III III III I 5 II xxxux , III.-I I,I.4 uf: III I II mu' I I'I. K. Y.xNII'Ix'IiI If I I .Nr rffml l,if IIII III III S Il SI -I II . . . NI I IIIIII l,71llflHI7If INILSJ I I 1 ll' I If-'-'ji' IQ? ' I Slfliiili .HIS :I I , IIIQII P. IIIIIITIS ....... l Il'.-I Nr I'4'l1I llf II II 5 II . I . I f'.'III-H171 ,VI J'l1I I I I I I I ' JI ?fI II' 'l'lZII'i, II. I-1. x'II-III.. If. If f 1 fu I.I2IZ. xxIxIIIwII, I.. I-,-15 , llllv, I X .1I ' I'IIIIxx'IIII II, .I. I IQIQI L. EI 11:4 I :--I IH I ' I ffpw' VIII! I'IIII IIB nu, is III: 'Ii, I.. II. IIxxIIII. XY, .I. t' I,,II. XI, lg, I If II,xIIII.xI:I:. IV. 'l'. XI I'IxI,y, If- Ij 5, WII II, .I. Il I IIII-IIINII. I.. Ix. NI III III. II. II. q II.. .I. II, xx: I .I,xL'K.'IIX. XV. IIIIIIIIVIQ. If .I. SI' IIIIN, III YI. I I ' I'IIIx' x'I'Ics I I V, .'X'l l'IIIlIGlI, .I. .I. I'III'I-ww. W. NI. IIXIIIIIN, S. X. YIIII-IIIX, II, If I If .:XII ' iv. S. I'IIIII'Y. XY, XI. III NIIIIINUY, .I. NY. IIIIIIII. VV. X. I :XYZ . S. I.. I'IIIIw. II, NI . III-xx'xIIII, II. II. I'I IIIII II. II. II. I II.xI:, II. C. I'I'xI.IIxI:Q, XV. I . .II IIw.IIw, 'If lI,. .III, I'II'I, II. IV. I IIA IW. I. III I' Ilh Iv, I. Q, .IIIIIwNIIw, XY, I,, I'4IiT. II. II. ' - X IIII . II. IV. I7I'IIIIsIi. II. I'. .III-Ii. N. .I. I'IIII'IIIII. II. III I ' Bn . . .I. II. IIITN. .I. lil. 'IIIIII'IqN, .I. S. IIIIIIIIIII. IV. 'If I- 6 III I . I'. I'IIk'II IIiIu:. .I. I' 3 1, II. II. III-I-IIIL. VV. If I 1 I .-4 . . . . I . . . I -' 'i . - :QI IIO ' , I . 5. I'. u.x.'. I. IU, I.IIIIIx', . , II. Sw-IIIXQ. I. II. Wy! I IIII .I. II. I I:IIIzI'sIIN. N. IJ 1 .I. II. SIIVIII. I' IV. I 56 ' IIII zzs, .I. W. IPISII. II. IV. NIxII-IIxII. -I. II. 51' '-Ixx. II- WI I Z III! 4 QII, .I. I.. I'iITZ'. . I . W. NI 'I1N. I . I . VIIIII II'kIIx.A .I.,I!. I I , 2 IIII U. .I. I:I.I'CIIIiII. II. .I. XII III. II. XR II4III. I.'I'. III? 5 Igu .I A.,.' J. Y KEN I ' -I. XIII gxv, fix Ill Vxi I'I'I . II. 1 i 5 III I'I'I-:IIIfII:III. II. Nl. i'IIl:I:X, I.. .I. NI 'nI'III.x'. f. Ia. K- 1'.'Ix'. NI. II. I Ii 5 Ox xx: II. IIIIII-I-IN, I.. xx'. NI -. xx. .x. xx I . II. II. I Y I FI, Z I ' Iii: Ir- - IIN 9' I I 5 ' I f?+ff3 'jf!:-I.' -9555-I II I IM, , ,If I- I - I-.III IVGOI Y 'YY if -I If, 1 J 'I A L A 'iii-YV -f I ' f- f ilI'j'T.',f'i ': T- ?Ty A ' -- S ,I I if ' -.X--' 1 -I-'3 iS'ii-?LTffi.i.ff.:.i'.iff., .... g.::.':.1..Q21-fi.1'1E5:. IQ'-'-TY'-1vI+5I3:1 I' N. ,f L..'..'T33'7l -1-1'-'l 'l '3 3'- L' 7k ElxTI X 'kF W Q, ' , 'i '-'l:i'iHVL4Ll-i H Y ' A ' ' 6,717 ' ' - 413' 'U-,X ' . . 4 - - ' af- ' -.,'?,.g,f.f.'2 . . I., 1 - ' I A ' ' Ll ' KI L S14-N cf -S. .' , 1 jr. 'N 1 . ,,,- 4 ,,,.-,1., :fy .1 l. .. 1,1 1 s VM 1 'V nw XE ,fifx . 124 , -XL . f - ' -S . 1 - 111925, 11 ' I QR K w.nmw JQJL- mfy.:mf:MM1m, T3 5 ,fWfy, H ,, 1- . . .z'7W'1 ' - 1 ...- ' 4' A -' --. sf' gmiiliigmzgggg nxgggigigggzzalnsnsll :IumllmllllllllmIllnillI1Iumumzsm1iui1llT1.Qm1m1..1'.....mbiedvll-1-e. u--e--1-1-.ma-.nalne441111111-.14-lfmymnvex-11Hr.f-.m-1-- fu-n---I---nu n--unum--f-um--vm-f----.--.-- ---- --1-Q,-....-.mm-,mum-numnmmmnnmnm: , N , mn , L, lan.. :LAL 1111 Ream, ,,.. ,. . 11 1 1111 1 11 1111. 11 1 - f 5 Eglin :. 111 1 111 - .. 1 1 : 111 111111111 -1 1 11 , 1 - 1- L 1: 11112 I I 11-1 11. Y Y ' 1 -JL ,, 5 IITTTEIQERHI-sig' ... ....... :::aaza:a:an::::-41aas:a:arll:::n:u:11za:::::a::n:::::m 1 .u 1111 mzzuszazsasz 1 . lliiiiullilIHBIIBIILEIIHBEIHHSBHHILTIXHEHEEEE '.::'.amsln W 11- --1'-4+-' ' -LWWMSS I2-'1 .---- 5' Y 1 V1 1 4 1 1- Ku' r- 1 1 ' IQQN , I 21' f, I 11 1 I 1. 1 1 F 1 1 1 . 1 1' 5 I' 1 1 1 1 '1 .6 go 2 2' :. . 1 1 E E -IIIIII1 19N 1 10' 1 I 11111111111 Q51 'v- 1 dlh d, 1:1111 fbi 1 1 1 '11 1 2 5 1 5 Z 'F 3 fl 17' Xl 1 1 J . LA Y Ll'1N LL R xr IQ? 'JO ' I' 1- 1 ., . 11 1 11 1- 51 1 1 1 . 1 1 1 R1 151 171 1? 121 5. VU 611 11211 151 11 '1 11 1 1 19 11 1 .tif . .' iii. 1 11111 . 1 ,411 1.1 1 I 1 11 .. C 1.1 I 1 Ompany 11,11 . TNFANTRY , 5? OFFICERS 1 1 I 0 - W. H. MARTIN . ..................... .... C aptai-n 'I H. A. FORTSON . . . . First Lieutenant A. RITTENBAUDI. . .First Lieutenant ' C. E. DORN . . . . . Second Lieutenant D. G. GRAVES . . . Second. Lieutenant 1 2 SERGEANTS 1 7 H. C. BULI.0CI-I ...... ........ ........ F i 'rst Sergeant X 1 KNIGI-IT, J. L. HUFF, J. M. 1 I -Y FOWLER, VV. T. BANSI.EY, J. D. Fav fllllll qu, f 4 NVILLIABISON, VV. L. COLLINS, C. D. Quay SPALDING, VV. F., JR. 4 I OORPORALS fi CAINIPBELL, F.. N. FIELD, P. G. STEPIIENSON, J. M. 111' 1 CLARKE, E. C. PETTY, J. W., JR. SDIITH, F. H. 11 1 COTI-IRAN, T. W. GILKERSON, W. R. XKYOOLVINE, IV. R. I PRIVATES 1 ANDERSON, J. M. FRANKLIN, S. LEFFLER, A. SMITH, A. M. IXNDREWS, VV. H. GANTT, E. Q. 11 MILI.S, S. F. SBIITI-I, E. H. 11 1 BAKER, M. H. GE'IZEN, R. G. NIAYES, M. VV. SDIITI-I, E. T. ' BEI.L, J. T. I GILREATII, J. W. MOCATIAIERN, J. M. SPRADLIX, A. . 1 BETTS, R. H. GOLDDIAN, I. MCGLONE, A. J. STRIPLIN, IV. A. 132 BLASINGAIVIE, C. C. GORDY, W. L. INTCMAXTII, B. H., JR. THOMAS. I.. E. Z BOZARTH, R. V. GRIER, R. W. MOORE, A'. A. '1'I-IOMIISON, B. is 2 BREEN, W. H. A HALL, H. E. MURPHY, J. R. TULLY, D. C. ' 'Z CALDWELL, H. G. HALI., J. C. 1 NESRIT, J. T. YTTURNER. J. XV. IJ CHAPIVIAN, R. L. HEARD, M. E. NJEVVINIAN, F. D. XVALS1-IV, T. I.. ag 5 C0OK1,'M. A. HEIDT, W. S. PAPAGEORGE, G. T. NVARE, YV. M. 1, CROWDER, VV. M. HERRICK, F. A. PEIICY, VV. VV. XYATERS1, H. I... JR. 5 . CUINIIWIING, J. B. T'TUTCHING'S, S. C. PETERS, J. L. XVEAVER, A. Y. 1 1 1 DEAN, M- P- HYMAN, M. POIVELL, H. VV. XXVI-IAVER, 0. I.. qc DIKAI'Ell, G. O. IRWIN, F. L.1 PRINCE, H. S. XXYESTALI., F. 1 DUNWODY, R. R. ICANE, R. PRISANT. 1- L- XVILLIABLS. I.. A. DURDEN, C. E. ICELLY, H. I.. PRUI'1 r, S. Y. XVILHAMS-1 M, R, 1 1 ESTES, J. T. IIQNIGHT, J. J. i:.,AINl'1Y, L. T. XVYQQFF1 D, 1 f FINN, S. I.. KNOX, J. H. ANDOLPII. J. D. Rvl-ZOINIAN. S. J. , ITOIKESTEII, G. C. IHKNIER, M. I-I SESSIONS, G. H., JR L.- - ......... . - ..... 1 ,Q 1 .. ..., 1, 1 1, 1, 1 1 11, 11 QQ WWWWMWMWMEEF f5QQMmFgQF1?wW11Qm Q5SSssNQSSNNSNNSSSSSQSQQSSSQR I ' 12. 13.1 1211 'fm 'A 'T . '44 X, .5 'XLT q f' Jr! IBB.: ji 5 Ie 5 ri 4 5 5 K' 11, 1 E 1 4rlIl lm' nr R ' WM 1 1 if . .4 65 '-5 Z 5. Z f Z f .4 'QQ'lQ5- WEEK? vi- '53 -1 ww.. 1'-23 tw I T M. 4541 .,. I fpw F 1 1 12,-221 43, ff,,.f,,f A I I f f r 1 -, 1 ' ,J-VIP, fix X-sr-in I vkx l l 'fm fvk J f4 ' Q4: ' ' ' Auf Qggsnqgwn 1-M:5:,:...,,.,4:A.A, ilu 7 , VA - . V ,f 1 -14 X .K N 1 .mf 1 ' ':-- . -' ' .1 A' ' A' -A'h 1 1 1 Hwfi- .gi L' , 1 J X , x. 'QQ , , , 5 1 . W 1' ' v i ' 3 N V N41 to 1 Sv ,L 1 1 PJ V .,'-.v .., fx ww., 'f i 'JE ,Qt SPT 5 .4 8' ...Q Fl J RIW 'N I! Coast Artlllery Umt Second Bauahon 4 I Iul as lm xun X 1 x IXNII Bon N fl Ll f I KIOIK NX X XHIXKT x I1 f r non R l Ill N1 Srnu xvl uxu ur xvr nu x urxvl Il lu xxT R 5lXXlN1X WATXNK fX vxxxzsfiir 'WNNB1 L-2-25 --cf OZENWKXX wx X E Xa' iXJX,Q S ff? X I X f xl 1, Q, I 7 1 : 13 Q . 13 lf . l 2 1 ' f ' . - 3115 2 ' V - 1 3 S Z 1 ' . ' Ez? X . . X 1 . X 6 f, 5 I .ii gg , Z 1 1 . - 11 L.: . Q' I 1 ' ' -5 Q W 1 , . W . , QQQI Q 6 1 1 . ' , 'B 1 113 F 'Q 1 1 1 1 1 N ? ' 1 11 115 1 5 5 I Vi' , 1 M12 . 3 Z 11 ' '11 1 1 ff? 1 N 9 1' 'bf Q f N fy, ' 12 ' N ,A 1 . 1 Q 9 WU 1 E g 1 A ' 5 l 1 1 Z 5 ' '1'11 ', H1 1. I Z ' I ' -- : i A - ' 1. 1 1 5 f , A ' 'E 1 , 2 4 1 1 1 1f?1 ' 1 1 + - 5 1 .1 ' -. . f ':21 1 2 1 1 gkif ff2J?g,fV' ., M Z ' ,-,,1 IRQ, 'ir' '32-. . ugh., A Y if li gh' T j , ' Q ' f pf.-'P Q ' v T. 1 11 xv., I 14 4 X ,V ' I A It ,111 -n Q ' 1 . I 1 I al., .z ahh 1 11 1 - A ' wffsii '1 '1' 1 - 1 Tv. 11 , .-.. 1' '1 41.31 4 S32 YNYSQZIJ- 1 f' .-15-'Cv - J ' . .ii .:Lf.y.. g 1 1 H,-,,.:f 3-skfl sg io' 'W mana l 2 , ' ww Q1...Jx1 . , g., j yr-uf, W 6531 WS' . , 1 Y ' j 1 XY HA1 8' all tal D . . 11 I , km? gm '17'Ta ,lllllf qu. 1,7 in - K if oi 4,--.1 ' 4' y m! kffxfy Mtg. 1 1 11119711 ' Bill.. I . J, ' S ,,,, , - ,,,,,,.... . ..,. , , , fhllrl rl 71171 g I Q Q i 3 , ' ' M153 ' ' Y, IIUVGII .......,.,..,.... . , ...,. . S lflllfflf E 'E 1 ' 1 . ' s'1'l'm-:N'l' mflflm-:ns E 'I 5 I 1 ! , H. R. Vrzlzlcs ............,......,....4......,,A ,Ufjwr gl 1553 R. 112 ll. I-1.-.H-my ......,.....,.. .......4,A..., , 1flj7lff77ll :ij , V. L. l'.l .,..........,A................ 51111111.11 ffifff 5 I J. I,. F1 ' uzx ..........................,., Sf Vfll mf ,Vf j'1f ! if 1 1. 6 l'Nl'l'I'1D s'lix'r1-is mflflm-:ns IX c'11,xl:ca1f, , 552: If 1 5 M.. '. F. Y. S J: ng ...........,.,..,,A, f'f1rr.1'I .lf 'l111','1 rw, I N 5 BL. . T. 3 sox ......,..............., f'fffr.fff ,17'HHf7'J'l f'f11'p1f A 1 1m.-- 51 11. A- - '11 '11 .1 4 pf ............,.,..,.,..,. 11. 15. Jr. L. i rf Sm ua. .' J. ll .....................,..... Il. li. JI. L. 5 'I Sm zz, .' ' . l.. l'1l,l,1ss ...... .........,......... I I. li. JI. L. I 1 Sm uf. ,- . W. Q , - f ....................,A.,. 11, 15. Al. L. fig 1 9 731 4 Q 11221 3 S HV Z K -7- V I :ri 114. 5' 1116411 1 I , H ,JT CNR' LQL I ,? jJ.f 'Tj Q ': nl' 5-J ' Ll' 1' 'life an if Qwflf W -ww--wa-- ' ' ' ' -.va ..'::f-vXv'vQ:G1 sTfwwfHTf- 215' ' 1 1-,fi i EI - .52AIi T:f 'f'7.. I-QI7'T 'T '-: if 1'-'-7 -' JA 3 C C' k Q W f '13E? ' '1 '1.1.1,. : 1 :, --ffL' i'1TE:1 'f f''g?f1 :fg'fif: f 361 to M ,Q ff-If 1 1 -4 , . I N ,C P ,. . r E . I gt 4' ., I F . ' . . gi ,. ,. 'I Z' g! ,O 4 'o O . E2 .,. I 4' f' . . mug' II o '. fo ,Q o 'o ,o ,S 0 'Q 4 -fif I gi925J 9 Om if ,fig I V -I- '5 ' 'Z .... L ..,........... . . . . . , mm 5-gm NI 3l'Hllllll!lllllllllll!llllIll'i!lllllllllllllllllltll uhm' - . -- 21 1. -14-.-., L 1 I i H! I' W I W A PILINT nf: .........aaa...... 'I2133511'II1 'i'lF iF'iil5'l 'i lIli'Illlli I IllliilI1:1l''llIG'llIl lZ'llII'l'll'lIlllll'l '::'::'1::::-':1:II.':'luss ':z ':: .'--: 'um-1:- .. - -1:-I ':1rlu-nascar.: I5-13315513-1 ..-23SI22'337 ...--I--w --.:....... Iiflgiiaaa, 4 . f 1 - . X I0 , ' ,, J, A .1 . i-1 ,P - . I ,-- . . ' I. , .,. V .1-. --, z I 17 A ,, mu 1 , I s., . XA I ,FF mn-In uI....mSf'g,a,,:1 I nilmullmm Inu-1.5551 Im NTT. gnu.-A.. ..nm.-mm.. mm., 'Z' -1. M.-1-,m-.in'i1mnl,-1-nmnumu: .AL A gala: Eggs Sai.. ML, mx ' .A ' I - GIF M D , 1, 15: HI M , . H. ... .m... . ' - lpaliillll .tix . .. ..... .. . ....... . .. . .... . .. . .:m. . . .- - .... lx. ...s n. .... ... .......... ..... . . . - i ox O . W 5 Company D COAST IXRTILLERY Q? K 1.55 li? 7 f g 4 Z 7 2.1 1. .4 4 I IQ' .4 'Q 'Sf' ,A if I hw .M .ll If? .,1 A .25 .I I. 1 H I i ISF? v 5 OFFICERS , J. T. VVATTERS ......... . . . .... ..... C a Jtain T I I I Q M A.. VV. HARRIS . First Lieutenant R. E. 'WALKER . ..... First Lieutenant . . g. f K. G. MAXTIIESON, JR. . . Second Ltzeutencmt D. D. ROBERTSOX .... SeconclAL1eutenant fb-ii . V in 1 ' V I I I . SERGEANTS um. v I V I C. F. COLLIRR ..... . . . .First Sergeant Q I BOWEN, J. H. CIIANDIJSR, S. XV. ggi' K HIGGINS, J. D. BARTOXV, P. L. W of N: 1' ' I OORPORALS ' BRADBURX', A. T. CLARK, D. C. H. XVARD, J. P. '- l IQTNG, J. R. XVARD, R. C. V i PRIVATES I I ANDING, J. L. GLXIIIJNEIK, E. F. LAW, XV. F. POwI:I.I., T. R. BODIAR, J. C. GLENN, J. E. LOWE, R. A. REYNOLDS. J. R. ' Z' BOZRMAN, F. HAIYIN, G. C. LIOVVNDES, XY., JR. ILOBESOX. J. L. I Z BURT, B. D. HfX1'POI.DT, A. S. JLYON, L. ROSENRERG, I.. N Z CANNON, H. J. HARDIN, W. R. MGMANUS, P. K. ROSS. J. B. Z CAPE, J. L. LIARRIS, H. C. TWERRY, G. H. SCIYIRR. S. , if CATER, F. E. I'IARTY, G. R. TMIILLER, J. A. SDIITII, XV. C. I ' CONN, J. H. HOWE, D. B. I MOOIIE, MIXCD. S'1'ISwAR'r. J. A. X xg COOPER, G. F. I'IUGUI.EY, T. C. I MORRIS, C. L. STFRGIS. E. C. f If DAVIS, J. S. HUllI,BU'fT, H. D., JR. . MOIKIIIS, J. R.. NYAGENER, F. NV If . DURRRTT, T. J., JR. IRWIN, T. J. X CYNIEI., C. E. XVILLIARIS, O. J. I EDIERSON, R. W. ,KIlNIBAT.T., L. PARTEE, I. L. XVXLSOX, J. B. Z JEPSTEIN, E. S. I.AW', F. B. PITOIIRR, F. XYOOII, J. A. 2 FORD, T. B. gi . 0 0155250 A , P, 77 . NQQ9' l i 'N Il, l X X X . R4 -..- ......... . ...mu of A ,'2I'1I!II.......-- - . . G . W, - AI. g .vwzoswmviiw , C ,, 3' - x:.gg-YEXlYN'SkSXwXYxE'X:'NQ'gQBKXYx KXXgXSXXX'XX X, L ' flown . , S C 'Nillll 'F' C ' I . FAX R x . I I 76621 xg. S 5 E E S S E Q 'X IL' E. -4 l 1.4, 1 , 0- ff' . 1 I v I M I 5 'I II III . S fi 5 S 5 5 4 e X. Z 6 If 1? ,J If I. N 2 Q? 2532 f M '1I9z5I .QQ ... - N, ..I 1!.JI fx 1 Y 47- -X f X it NX' - f fl' . . . - - L- - .' N - . . Qualif y 1 - f .- ... . .-. ' .-.. ' -- fl ' ' ,- , Q 1 ,V . ,..,5,. :Y A ig ,I 1 .P ,I 1 , 1 fl. ' I L NI 115212 Q Q11 u 1 X I .f ', 1? 14 12 '4 5 Z 5 4 ? Z f Z f 5 4 4 Z 4 f Z Z 6 f 9 f 4 3 5 4 f 5 ? f . 39 I 1 II I. Iii 'I -, J , ,Im 1 QI 13pm 1 IQ IIIH .E E. IH ,III X. N. S S YN . .J Q S: +1 QB E52 IQ 1:2 :2 if .ul S k Q :Tb N if 5 E I Q -' V1.-.V ' v 1 'xi gg 1-La .-tt . I. if 4 46 El ur I 4- x. ...I . . .1Mz.v. ., -lv ..'-lk.-..11,..f Company E lux-1 XIITIIIIIIX tII'I' It I'IIN J. IB. 1IAHIIIZ'I'l' . . ........,,.,,.... . ,..,, 1.I,1r.I1n v .. . I.. fr. I,I'l'I'S .... .l':1'.-'I llllllflllflllf .I. U, IIHIIILI . . .lux-I l,wfnIfn-1111 YV. 'I'. AIC'xYllUH'l'lIII. , .Nfrmnl l,i1uIfnfml XY. X. Wnrnuu NW-1111.1 I..fulfn1rnf QI II1.I' XYIQ NV. II. I'.UlIIIIZS'l'lIII ........ . . II.xunmlu:l:, II. II. IIIIIHVN. I'. M. . , . , . . lu.-I .NIIWIINIII IXIX1.. IIKIITIII, I.. I'. l'IlIII'1lIIXIS Ihll, II. I.. I,b.XlI'I'll1'l'l'. .X. I.. Ii: mzn. II. H. I.KWllI, II, I'.. II1111-un11,5. I.. NI1IG1x1x.I...I. I'II IN' XIICS Ammx, li. G. Vu xruuw, .l. NI, Am-zxsox. .Xmz l3.un-:Nmmx-, .L G. Blcnal-zu, IC. Ih:nN.x'ru, .I. IHNIVUIIT. -I. I'. l'l1mvmin. I'. II. L'nliw. .I. Ihuiw, XY, IC, Ih,1ms01:, XX. .I. IIVYCAX. Iv. I... -In I3no.xcu. II. II. I Xl I I' Iinowx. I-I. I7. I5uY.xN'l'. II. I'. CAlu.1sl.1:. II. I.. C.xnm1c1l.u:1., NY. I.. I-nlrrlx. I.. BI. I'Il!.N'jNlIl3Q. III. C. Iixtxxs. I.. .X. IIIUVYII. -I. II. II,xnmN. I.. S. II.xs'POX. C. G. lIl'x.1,. b. II. C11.xxnI.1su, IS. IC. CIIESIIIIII-Il, .I. II. C1n:s'rNI 1', 'I'. A. .In11xxuN.Iu, II. .Inxyg 5, I , KIIIIIY. XY. I'. I.NI'l-IIIIN. .I. N. I.:-1-r. YI. I'. . XIITXINVIIH, I'. NY. NIcI7nN.x1 11. .I. NV, A Iiumx-1.x,.I, Swxrru. II. II, Nr: nmwk, I . X. STIII XHHK. If. I,. ' XYIIJA, .I, 'IQ .Iu, U VVIIIS, XI. I'.. NILHKIII. .X. .I, Www 11. 'I'. X. xIl1IIYIIX!'I'Vl'IlIII, XX. Iv, XK11mw1., I, U, VN-'IIK1N'Q.-L IJ.. .In. NIL'G.xuvrY. I'. FI. V IIKIYS, .I. ff. xx ' ' 1 omni, C. NX. XI IIIIKWIK. U. I.. XX-II IIYLH wi. XY, C' Y1'Xrz..I. II. I'mNnrx11.n, 'I'. G. I'linwrT'r. NI. NI. XKIUIIIII II, F, I 1 '5 CN- Q Xl. . 1' E1 I'?'5I Ieig ..., 1I.:3 -I I 1.3 Im 1 ,N I 1-I5 If ISI :I .I I! I .II1 If fl: W.. EI 5l .51 l'f1 1. .,fi 1,g f -. .I mwj Ffivfx ,If 485. fx I IILQ-Y 17 ' If .I fx' .NI 1. I. 1 131 .ii Ili 121 IJ It 'L I: I I 1 lij I'1 I4 If V4 I 34 I Q 1,15 1,., Ilj 11,1 1!f-I ,1.,! IIZZ' IW' If, ,r,j. IMSI I'51I 11. II 51 I I IIIQ1 1.65251 . - O-'ff-EZ! 1?I.I'7W ' -A , ..- ---. -- -F , - .-.- xii' . ---. ------in .- X. 12 . -. vstcrtfff-. - ' .. .'..:- 1 I N Nb-1if::i':.gLi,' 'grfti , . .Tix .' I 1- 1 Y . 4412, 'I .Ik '71 W ' Af f gf ' XC-.h-w-If..- ,Q-'-- W, ' ' rx-: more a L K Q I .wg - - ' -r, ' ,A -Q4 M 5 . - --f... .,.,......., ..........,......,....,-'....,.,,,,J...,.....f.--'- , WT. . 3.4 --. V, ...V . .... W-..F2f'..,, XQGW, IXIJ 1.n..tftj: Y 4 llsw 'QQ' .- I Wfiz, '-. hi. q f fn Y! l , -5 - 4- M 4 A. -H..-ft . .4 ' J 1 1 4 -HTH! ,nlilili El F IilliiiilllIIllIlillllIIlllIilIiiIHllllIliIIIIHIIEIIHTKSGTIITE'I - '- '3f7 11 12- - -- -- A .. 1 5 1- un' ----'. vw -I--1 - 1 '1- '- -- ' - ' '1i. f TEE' Txaimw, ' ' 'A ' . 4. ,- i .hill Ili I 'Iil'ilIunl IIIISIIIIIIIIILISI l lil SIIXXFIH Illlllllllllllliill li llllll HIE li WEEE x I f , X 1 9 I, 1, 1 X ' , 1 1 I K L.-0 LO., 1 W I 4 6 1 4 5 'Q 'A eff'-A f f' f I ' V X f NN X K I ' I 1 -u x E an I I! az xul L t T ,,,,,l,,, ,,,,,,4 :H 12, ,,,, , ,!,,,,up, -mu uvfTmm , 'Ls' mmm - mummummmmm -1-Q 1 -vmfmnnnnm-rn-nn-vfnvrnmnmmunuu 1 Z L EJ! ' 11. nv .J ' Tw' MM T . 1 I ul-Ta A f 1 .. w ww ,.. fn .. T!!! FEI Xilli' HL -m---i-in-...-ii Il' ' 3 I ii ilu u ' -Hill ' li ll 3 ' Il H li E HHH!!!Ill:llllmiulluiilluinnllmllfigiHllflfnsmilliiilliiln 212355 'M -- -'ff-...... .sq v 1' M T V I o f ' 9 Z .4 2 I 4 n . 1, . 1 , A T Q 1 T T f ix. Z gil I 1 ah , l '. W 9 2: U ,s 4 I F xii 2 I Company F ,I COAST AREU LERY N U TL T OFB ICLRS E 1 , C. M. IQENXEDY . ........... ....... .... C a ptain 1 K P P. L. ALEXANDEII . . . First Lieutenant C. B. ANNIS . . . .First Lzeutenant S Tx . E. R. VVOOLFORD . .Second Lieutenant H. L. REEX'ES . . . . Second Lieutenant Na ' L cgi ,img SERGEAN'1S 'A HINES, M. JAMESON, XV. C. , LEBEY, C. A. BRITTlYGII.A1I G. L. J WOODALL, J . P. ,P 1 tg CORPORALS SIRLEY, A. R. '1RANsOL, C. B. WORD, G. L. DIURPI-IEY, C. T. BATES, L. E. m CARPENTER, S. X PRIVATES N BAKER, P. H. BILCITIIR, J. M. MADDOx,,J. H. S A ARIE, 1. -X. 2 BOSTON, J. E. FIIAZER C. R. MAXTI-IENKS 1. 14. T bl3IPSOX. K. JR BOWEN, H. VV. GIIESITAM, W. I. RJOORL C. R.. SNIITH,vC. P. V BRAWNER, G. H. GR1rE1r1-I, J. C. MOIIGAY T. I. SBIITIi L. G. BROWN, M. . GUNN, E. L. TR. POl'1'S,1 J. H. STREET- H. Z J' BROW'N, T. G. HARDIN, E. J 11ACL G. KN. SIURCIS, B. K. 1 NEWTON, . HTXYES, R. D. RfA0-SD xLE, I. M. NN A'1ERS' L. C. lg CHESTER, W. F., JR. H01 LINGSWORIH, L. C. A RTAIT G. L. XXATSON W. . 4 COLE, F. R. INIOITINGSWOIRTII, O. . EIVFR-IE1l,VSJ. X. NXAYNE, YV. . COOK, F E. I'IUN1'ER, C. P. TR. USTIN, 7. . XX FLCII' P. D. Q COOK, L. M. Join, C. I. SALLER, K. R.. Xx'INlBlf.RI.Yd A. P 2 DUNWODY A. . IQIKIIR, J. IE. TR. SCHELL, A. E. NXOOD1xLRxi B. '1 2 EJJVVARDS, P. M.. IQILCOIIE, H. VV. A 3 Z I 6 2 2 gig A ..-.-..-- A GI'-E-if C Off' .. R3 W, ' ' A A. Ek LWQQ Q MNH K J J J C A '01, A '-.-- 5 lw:iC!'f1Fifli5fES HB3f.3x-MG'J'P'Tm: 'P'T AA 1... PTC .NT L f WU A E 4' l ' 4 'f f 47 I 4 ,Q 4 . 4 . .f ,. Z I .fi 2 3 Q ' 1 I 'FQ 1 1 1 l Fei , l w if 4 QCE'l'S.'?QS58C ox-:vos We 2 5 5 2 1 4 4 v T l T 4 cg -r, xy S Q I.-, Z0 .- I-374 - N ,u .3 '4 rl' ,ly W, .,, ,, iii '0 by - ' -- -P , - 'M . in 3, uf, ' six jjj . -5, 1125.- f Q!Q25Biggugllilrilqgggillrunzxzmvuwltll uv fa I ,, - y,La-flu- I V- - F ' x ' , V ! 'Q ' 'Z + Y V W ...... , -?,,, ,., ,, . . , -, ., ...,. A- -.- . .... . -...LT..:,,: -it I I H E: LV E P ILI I L ... u1nxi'L...... .....- .azz - - H n '--- ---.....,..., -. A-, Y V ' , I I .I ' vig 'Iii I iff I.. si. I 2 QI R I. Q: I 2 I A ui.: I 4 I -V I 5 r' f I ii g 7 a Z I . 4 Q 5 Q . I ff? I 1 1 VE I if I 1 'IH I f ,E I -': I 9 555 ,Z '-I 1 I 25 Ig? Z I Eff? I If III I 5. I I E12 Z ' lf? lf ,N I Ixzgf I I IU .II J I I VI Q, IFLHH 1 SI I I .SBI I I A' S ' M T C1 0 d I EI 1r CIVICC, otor ransport an r nance ' -mlm ., :nf I tllllf, ' 'Q Umts I-gg I fic I J: I Ifr:5,3I Thlrd Battahon III! . .-III S VT: Mus. R. '1'. QQIIISON . . lm,w1-fm -- Miss JULIA Gmzxrzn . . . . . , , . Nlffvvwfr Q.: 'VIN s'rl'm-:x'r m-'I-'lwilcs IQVL IIN D. C. l'IlSL'0X . . - - --4-4-- A 'V .I J. BI. Sl-Tl-UN l , , 4 lf.i7lfIHlf I XV. I-I. XvAl'UIIAN . l'I'I. .I.fi S. B. G.nl1u.l: . . ...,...-A --V----'----'- ' ,'f. -V .I ' I-'gIx .E . D Q 'fi' l'NI'l'lii7 S'l'.X'l'liS UI-'I-'lk'I-IHS IN C'lI.Xlil.l'. .EMI C.x1 1'.ux Flms1-:R Il.u.r: ....................... . .fir Sf'I'7'if'W E' C.xv'r,ux F. C. SIl.Kl l-'IIN ..... ,,,,,,, I flrfl1HH'.f ' I FlnsT I,n:1 1'1:N.xxT R. ll. IJAYIIISOX . .I...-- IH' - 'T ff A Fmsm' I.'Il'Il l'l'fN.XN'l' C. F. Gm: . . . , .f f T 7'Tf H'l 'Y'f I H'l'f' Sr:nGlc,xx'r XY. M. SMITH . . ,.--- N- IV- M- L- IQ' S: IIZIL x I 3 f I A I, ,4,.gf4.f f1eYjX.-?x -. fv . I - -W 1-QQ -' -+11 xii 'I ,. . I .H ,,.i??2jf '::f. ,iw --.. . 1 . ,,.. ' ' f N R In 551 5: AE --,-,.:.l...:- f- 1---9: 33-fi-4: L L K qfg1'i-'Qi ,ff--,Q 1' - 105: - '- -1 -Q x- - . .-I ,, XX' X '. NJ- ,ff ff' L Lf'-If--.....--' V-i' ' . .V . -, ,KCTS ' I I I I I r I I I: I II I I 1 I, I II I I I II I I I I I I II I I I I I I i I I I 1 I, I II' VI, I 2 I . I I, .,, 'I I. I II I ,II VI, I' 11 5.I:I ,,I III I III II I I I, , , 5 III II If II Z I 5 t ,, Z III, Z 5 6 ,,I V. ..,I. I ,J L' ' I Q61 III QQHI nl IQ I ICU Fl :il 2' 1 5. ,- ,5- Q'- . . . K' 1 X ,If o ii , f I ., IIIES!!EmmgillIn1Img!!!555::meuulmmllllllumil IIRIuIIaInIIIunniinuuuiuIiuTu -.'-f m 1,u,..,. .4 6.-.J-2 ..Q--,1, 1 .---4'e-f--f-:--f I-1-UWHI'--' I K M 'L-ff EBI, ......1 I 1,,g::ma.!1nb P I ' I Z I III I I H D L , . t. I -IIE-. -- II III . .. .. ..... -e 'I-' su ::x::::n:::-2: ::-...- .:::::::::mr.::::::.:'.:::z:'.::::::sa:.. .-... ..... . .1'........ If Iiiuimnfim..- ..L......, .::::u:::x:::IxI:a::::x:snxsaxasmlamzz:sIIzums:msn:an-::::::x:::::.:::. ....... .a .... I ..... 1. . ..:..: - 'x I I I A I 1, i1 , I , 'I I , I I I f IE ' . '.g: , I Ig! COHIPQUY G AIR SERVICE 5 OFFICERS If E. L. BURKE . ...................... ...... C aptain , Eff: R. B. NITORRIS . . . First Lieutenant J. R. ARMSTRONG .... Second Lieutenant L ' C. A. PHIPPS . . . . First Lieutenant E. F. MARSTON . . . .Second Lieutenant C. W. BAI-IIKT . . Second Lieutenant R. KYLE . . . . Second Lieutenant Q51 . H. D. HANSAI,I. . . . Second Lieutenant O. L. BETTS . . . Second Lieutenant ,.,A -.3-, ' SERGEANTS 'PII I J P. S. SHACKELEORD ..... ......... ........ F i rst Sergeant gl, GIX'ENS, A. C. K1'SBR, WV. D. ffl: LKENNEDY, J. P. ITIURNER, XV. H. JIZI : '. PADGETT, B. R. CORPORALS I A BICICEIIS, C. W. HALIFORD, M. E. LINDER, J. XV. REEX'ES, R. E. H , I BLOODVVORT1-I, W. H. MORGAN, H. D. LICIQEDIIE, NV. J. XVI-DIBERLY, J. J. 1 Cox, J. W. HARRIS, F. B. PETERS, H. O. 55 EADAR, H. H. ISING, C. P. RANSAXKE, XV. E. ' PRIVATES , ALEORD, B. A. GIIADILING, J. A. NICBTILLAN, G. M. SARS, J. D. I . ATHANASON, N. A. GRAX'ES, J. F. MILES, M. L. SAVAGE, M. S. BARRETT, T. J. GRIFFIN, H. V. JNIINER, L. YV. SCARBROUGI-I, P. J. I BELLINGER, F. GWYN, C. B. MINGLEDOll,Fl , M. S. SBIITH, WV. M. E3 ,. BIGGS, H. D. - HANDINS, D. D. RIUNSON, R. D. . SOXVD, M. G. ff II BROADI-IURST, R, S, HAIILOW, M. V. NEVVBIAN, F. P. SOXVELL, A. G. ' COLLINS, E. T. HARTSEIELD, O. S. N1xoN, R. G. STEIII-TENS. L. C. COLLINS, J. B. HEERY, C. W. NOHINGI-IAINI, WV. M. STOVALL, B. W. COWART, C. R. HENDRIX, F. S. PAGE, D. P. STRIRLING, S. G. Q . COWART, W. J. HILL, F. M. PARKER, R. J. STRICKLAND, XV. H. CULBREATISI, C. C. HOWARD, W. C. PATTERSON, G. F. IFERRELI., J. T. iff DANCE, S. W. HUGGINS, G. W. PATTON, L. K. TULL, L. H. Q DAUGI-IERTY, G. VV. J OIINSON, T. W. PETERS, T. J. XVI-IEARY, J. NV. DAVIS, A. M. LAY, T. C. PHUJ-Il'S, H. C. XVI-IITE, H. 4 DONAI.DSON, J. M. LITTLE, L. L. RAWLS, J. B. XVILDE, G. XV. .,. Z GARBEII, I. C. LUTER, J. G. ILEYNOLDS, A. D. XVILLIAMS4, F, I, , f GOULD, F. S. MCCOOIC, J. E. RORERTS, E. C. NVILLIAMS, P, E, II I O QRS?-370, o ' ' . , 0'C,7 ' MS . 'I I M , L ,,,..,,. W., C- ...::!lIII'Aq'?4 I!IIE!ny. : - A , . - 1g4g N L . Hwf..fAmwAmmwSewwSQ.E'fQ2fff12f12 5 ' IE SSSSSSNSSYSSS-X:S LSm:.SSS,XS Lloraul, y V' 'A N I Y 'H l lh W n Lux F I 'N---...fi'IE 5P7, ' I 'fbspasi' I 1. Q. 4 pg . Q! 761 ' , N J' .1925 'X Q - u I f 4 1 I r. x c'-' S f 1 1 T -fr, AE 3 NP-H... 'ff w -. M-f .. 1' ' fl Ve! fi. 15 LV E P ILI I ,ju I I M ' ' II' H '-'M W--If-W H 1----wW-.--J---n---M--r--M.I..--.-A-J..--...-ff--M' ' ' FQ I ' I JSI ' 2 'dxst I 5 1:5 1 :1 I V '55 P- 5 . fig . I Ii 525 'I ' 7 I Lf? I ' I 4 vi I . 1 4 I-.11 w, f . ...- . I 9 rw . ai Z - I Q. ng. I ' I f , Z.. . Z if I 25:2 I 9 3 ME II P55 I 2 Ig . Z.. 3 yf , 3. 2:3 1 Q I 'I 1 I 4 VIII 5 :I I L I C3 I 7 I ,N I ii ' f . I 13 I Mg. ompany I-I V. 3 I I-' I . 'ik 5'j WI 'I' - ' I I1 cmm n xvumrr mu- ibm: I . . . . ' C I '-. 1 Qi ll - '-:E-'I 5 in oIfI-'ICI-:us Iwi! ' -:.. I I XV. GOLIISDIITII . .................. . . . , fwrlflnin IIWJ ,VJ-5 HI VV. B. JOIINS, Jn.. . . Firsl Liculrnnnl l'. S. I'.u'I . . . . I-'inf l,if-nrannn! JIM. L, ILA: T. H. TUMLIN . . . . Sammi Liwufmmnl .I. II. .Xn.u:v. . . .Sfmnfl Lirulumnf III' I' gg 4 , L. I1 1 ,I A fi 2 inf SI'IIlCili.'XN'l'S Iiiffi . J' R. I.. I'IAYS ........ . . ....... ..... . , lfirxl Srrynrril -' X Krzvrn, G. P. Ihzvx, Ii. C. 49. I...M.n-, J. w. I...m..-I., K. .I. Mfg... . I fxI '. . 5 N :ff ' Q E con I,on.xI.s 5 ji I'IUI.I., A. D. II.uxI:, .l. S. XYIHGIN, C. YV. Junnxx. C. C. if I.I:vI:nI:'I'r, J. M. I .uu:.xsnx. I . II. 4 'I if ., ,Q 5-5 1'IIIv,x'I'I-:S I2 I. - I N , , EI. fxIKCl'IER, YV. B. Ilnuwx. II. I.. .l.wxsux. .L C. Iirnupu, I.. II. I Lg I IXTKINSON, C. D., Ju. Cum. J. J. .lmuxsnx NI. T. Sun-sux, G. QI' :ff IBAGXVELL, H. B. LIIIASON. A. T. KI:I,I.m'. J. L. Sxxmgns. II. II. I 1: ' 13.3 BEDENBAUGH.. G- F- CoI.I.Ixs, J. Klzxxlznv, I'. G. Slll1l'l'AlHl, BI. I 2 I BLACKMON, H. N. IIAVIS. J. P. KIINNIZDY, T. I.. ST'Illlll.ING. A. II. LE' u BIIEI-:DI.ovI:, R. A. Ihwsmwx. N. T. I..u'xI1's. J. K. I'xm1nu-mm. IV. L. '. ' I,E,yg1-3, D, DI'II0sI:, C. BI. BICXVIICIRTTZH. C. I.. XK'.u.KI:n. C. F. I LESLIE, J. E. IJFIIILKM. II. G. BIII.I.Ic.xx, C. NY. Wrzrrrz. T. II. f LYLE, E. L. I'II.S.KS. NY. R. Mrxcnr. .L R. XVIIITTZIIVRFT. XY. M if MAIISIIALI., S. A. Fuznnxn. J. T. NAXCE. J. Ii. IVIrIn:xux. Ii. II. .QQ Eg 2 MCBIIAYI-111, T. B. Fos'n:n. J. C. N1'ssn.u'M. II. H. xVll.'l.lA3IS. J. II. iff I MCMUIIIIY, H. D. Grmx-r. J. XX . Pnznsux. J. E. Wfmrmrm, R. M. ' lg BIIEITI-IAUP'1', C. C. I-Ioncommz. D. Poomz. W. F. XE-HIGIIT, A. M.. IIE L1.- BIIOOKE, G. IV. HI'II:. M. B. REID. G. G. H nI'M.ANS. J. NK . I BROOICEJ J. P. H1'I.sm', H. B. Rnmxsox. XY. E. E3 ' ii. if I I - 1 55 I f ,,- 15. I 5 .f-grff41:ag.- Q61 5 15 IM. f rm 1 , !QbgN.t.:L Q: Lil-Q . 1 - ' ww I 'U ' 5. IV-.RI IN'IwI,,IQ,- Si-1'-1-f T+ +,'f gT ith, W xwlfiyfahx 'A' I 1 IIISLIEI 'iii 5:1 Qi-1-fLQi3-f13f-'ing--fi--el-A+:--.-v-vii!-Hf Z . . . . Q -Hg.. - .f H - ,H 1'-J' LIONEL K- W. .os 735:21-i ' --'.- .ff-f TJ -- NN.-?,.-C' ff - . Ji,-ft,,..-,Q ' ' -MAE! E232 S LJ few ki D D :llllr mwah, PQI l QQ! UE! 5 ' If Q' 2 2 5 3 fi f 5 If f' , 1 LE SLVR N Company I ORDNANCE OFFICERS H. F. SIWIIT1-I . . . .. ................... ..... C aptain S. L. FEIGE . . . . First Lieutenant J. R. DEJARNETTE .... First Lieutenant J. H. BOOTH . . . . Seeond Lieutenant G. G. JONES . . . . . Second Lieutenant SERGEANTS W. P. FISCHER ....... First Sergeant S. J. MI-IACHADI ..... Platoon. Sergeant O,BRIEN, E. D. DAVIS, H. K. HIERS, D. D. MAX'O, F. STOWE, N. R. CORPORALS GOODWIN, W. C. HALL, R. S. REED, H. G. DURHAINI, A. C. PETFYCASH, S. R. KOBLENZ, B. E. PRIVATES BATES, D. B. ELLIOT, J. B. I HORTON, R. P. BISHOP, A. H. FAIN, W. J., JR. HOWARD, R. BOWIVIAN, E. B. FAIR, R. HUMES, J. WV. BREWSTER, T. H. FARIVIER, M. C. HUTCIIINSON, T. BRINSON, C. J. FELKER, W. M. JONES, R. C. BROWN, W. C. FLORENCE, H. LENDER, F. P. BURKS, C. W. FOSTER, H. B. MAYS, T. C. CAMPBELL, C. R. FOWLER, G. B. INICIJAUGHLIN, J. H. CHAPMAN, J. P. FRANKLIN, S. J. MCLENDON, J. L. COOK, W. B. GIRAUDEAU, R. B. MORGAN, D. H. DANIELS, F. H. GOLDIN, M. I. MURRIXII, T. F. DAVES, M. F. HARDWITCI-I, J. C NASII, J. D. DEAN, J. E. HARRISON, J. P. PARR, C. H. DICKERSON, F. N. HENNIS, J. L. PAULK, D. R. DILLARD, R. N. HINMAN, T. P. POOLE, VV. DUNIIAR, B. S. I-IIRRS, C. L. RICI-I, J. EDGE, J. B., JR. HOLDER, H. O. ROCKWELI., G. S. ELMS, W. E. HOOCH, B. E. RUDDERDIIXN, D. I. K Aowm6xWWff Fr LIONEL K., PERKINS, H. A. TEEPLE, F. A. SAGUS, M. O. SHELL, NV. L., JR. SILVERSTEIX, I. SDIALLEY, J. F. SMITH, D. J. SOLLOMOX, L. F. STILLWELL, R. B. STRICKLER, D. G. SU'I'rON, DUEE TANNAH, G. TAYLOR, VV. D. WVATKINS, R. L. WVHIDDON, J. I. XVIDEBIAN, J. H. WVILLHOIT, J. N. WVILLIAINIS, I. H. IVOODS, S. F. ILNX efmgu.: , ' I f Q I f . 3 I f I 1 E f ' I ,V I .5 .A . . M A 5. 4' fo I 34 ,. 1 ' I .- if f if I ' 'III . 11 . - N ji 3. 'Ii I B I 4 L3 fe K -4 V A . 23 ' E it Q2 . 1 fx? j- , N ' 1 '-' fs. m x li It +9 If 'W I TE? x'l 'Es ifi FEI :ii gli, I '23 Q My 1 41 ,, ..r. IAII M: 5 aaa Igi ge if 152 5:1 131 3 2 .I Lf.-I 3253! ., ng ,fl 'GY -F1223 I x 5253i Y WFBLQ' ie? I 'Z' U '1 il . 'IK iiisiyy .,x, f'xA v -1 1 C A lil vl- vi! ,. N I I. r. v 'Z .1 I n W fg 5- , NI l V. ' TQSXEQAF- Xlg....,25fZE - - C-' ' . - Mu mx, in- mgaldiw-.:.L fyuztuvwwzilr A HA Y TM - Q Q A Y a V- lit- ,, , , .- - . ..:::-:fa jf'-iz! 1 , If I ,id 153, w H EI D L P I' ff . . .IJ A ... .. . E. , . . I .4 .- S fi 3 r 5 55 N Z I-1 I Q If S IJ Q 552 1 N I S Lil i . I RS --: I N x If Q :li . Q 'QS I S: Is f -1 X., :Y -4 , , ': , VQL QT' .3 , V, I ,1'-'J gg yxlh-SMA 1 rg, E i I f A 1 , ' s I I H Dj, .. ly k.. ,AM ,1l,. I !-I kgs , NI? ,I W. 'ifrg Q ii I I I 1 'I IW ' 5 I 1 '-I. 'f A , ,,1 E I I I pi! 11,3 .14 4 '- 4 ' I ' ' Z5 , 5 . IQ7 Nilgdyj ' 916 I R If I I ' ,I w?f ' L 4 u .I--'ll M I... I I II En.. ' W , 1 S-.I - . Q-fl H 9' Slgnal Corps Umt TI if 1 Ulm I ' I H- In I - I Ir! ' I I -'Q -'Y ' V441 5 EWS, Fourth Battalion Wy' I I -mv I... I .-wb. ,I A 'fl ff' ' 1' Mus. .I. I.. Awrnm' . , r'l,f1,,frffn ,lQf1,.T, lm I ' uf .. Miss Imtxrz 'l'mm.xs . , x,,fm.-.,r S'l'l'I7l-INT ol-'I-'uw-.ns J. I.. 'I'0RllIZ'I l' . . . Jlnjnr N 11. w. lwmm- . . . . ,4.fj,.fnnf F, ' .I. C. STATUS . 51111111.11 'WAHM 1' ' ,, C. I,. IIIZAN . . Srrlflrnnf .Vf1jff1' I l'NI'I'I'1II S'I'.X'I'If5 0I I'If'I'1IIS IN f'II.XIIGI ' C.u r.ux .I. I.. .'Xw'rnl:x' ............ . . . Signal Vnrpr C.xl'T.uN Il. F. S1'.u'runn ..... . -qij777f71 Vflflv' 'l'm'lINlc.u, Sltnmtxxr 'Tnmus Ilruss . - -Qfflflffl WPI X 5 ' Iii - 4 b 3:3 I? I 3512 Ifis1 :pi . 5 E ffif. Xl +5519 I I 'I O.. C.-'Nii E icq I Q 5,15if- 7-1' QV I Q, 'M Nfffwk . -. -. I-ig 5 :-- ju' 1. o' I LIODEL ri Qfxgxbgfgxz 'Psi-5 . X f 1 ' V L I ' lil lhll ll lilll' lllll lllllllllllllllllllllllll NIIIIIIIWIIIIIIIIIIIU ,sf Ima. , My I I I NI, A U1 I , 7 si xv ll lv' Mr-1 2 V -xv 1: P gf! ,pr I ' Y Ki J P' S if 6 4 Z 7 Z e 6 A ,. 2 ze fi ff 2 6 4 5 . f W f K S222 I I1 DLVE. ,U SOA 1 gulf AJ P Company K SIGNAL CORPS OFFICERS U H. S. MCGEI: . .................... ..... L aptazn T. L. CORWIN . . . . First Lieutenant H. M. CARTER . . . .First Lieutenant M. J. DANIEL . . .Second Lieutenant R. J. BRADFORD . . . . Second Lieutenant . Q, SERGEANTS b ROCKWELL, R. B. XVHITE, C- J- 4 DODD, F. J. COLE, L- D- OLSEN, A, W, CHEATHADI, C. W. , DODD, R. B. NIAYRE, J. N. CORPORALS DELAY, G. R. GASTON, M. H. JACOBS, V. L. JOHNSON, F. E. NASII, J. C. RADISEAUR, E. D. SPANGER, C. W. SANDERS, J. L. PRIVATES ALI.EN, L. H. DONALDSON, L. M. NIEADOVYS, E. H. ALLISON, G. P. DUNICLIN, E. P. NIITCIIELL, C. C. BLACK, J. B. DUNN, F. B. MI1'CI-IEI.I., J. D. BODY, T. D. FLANDERS, C. C. NIOORE, P. BOYD, S. W. GIDIIS, R. S. NfX13EllS, T. C. BRANDT, M. H. GOOIJRIAXN, T. H. NEESON. H. L. BROWN, W. M. GIIAVES, R. M. NEQON, E. T. CARTER, H. A. HOI.LINOSwoR'rH, K. E. PALIN, D. H. CASTELI., J. V. JUSTICE, J. T. PETRI, L. C. CI-IANDLER, C. F. KEI.I.Y, W. H. PRICE, G. F. CHILDS, E. W. LACOQQ J. H. IDRUITT, G. CHRISTIAN, J. B. ICIATTIMER, C. RACIN, R. F. CRAWFORD, W. R. LI'I 1'I.E, F. A. RRDDY, T. G. A DAVIS, H. S. MATIEIEWS, J. B. RICIIETSON, J. L. DELANEY, R. M. MCCI,EAN, H. D. ILIDGVVAY, H. B. ILITCIII, P. B 'RODOLP1'I, J XX IYOGERS, XV O IIUBIX, E. llUDlBI.E. A B SADLERU, P. XX SANDERS. J L SBIITII, J. I SDIITIYI, XV. R SURINER, J B TIIOMAS, S NI '111'I0MSON. NV XX TIM1zERI.AKE C' R XVI-IITE, C. I XVILSON, C b.'HHE QI' Xlw SI Sv WI I +I. .I III ,QI II II I 'I I S. 3, N I I I I I II I' SI 'NNI I XII QM W Sm I 4 I EI K Sgt! -XII' FII lx Q' I. 2-5,2 ISI RN vw- Sw' I II QI SQ QI Q E XXV r. III 5 I. II 21' Z 4.1 I. .fi I. EI I, XI I I I I f I .I 1: fi 1 . II fx. I .-M I, ,fr x ' . :N - IJ I I ' ' - A . . I T fi-ff-W5 - LV E P ILI I I. I .,A- I ,. , ,A A .. Q, Q, ,u is 'V I ff f I I, I, I 5 5 4 5 5 9 ? ? 9 Q 7 7 7 f f 5 5 5 4 5 3 5 ? I ? 4 F:- EI X QI Q. I-2 ,-I Q. Ili A I 4 , -1 1 U 1 I I I. I 4 Com an L I P Y ,A SMA KI in-IIIIN F I 'f I III:I IIAI'.II5 I,. CI. BIIIIIIII: . . . . ......,..,., . . I .I,.:.IIII 1 F. Ii. NIcC'I.I:I,I.,xx .... I ir.wl I,if-uf, IIIIIII I' I' I I II'II XIII I .I.-I L.. ,,:. ,,.,,,I I 2 II. c'IIlHI'lZl.I. . . . . Nr Flllllf l,il'llfl mmf XY. X, NIIIIIIII x, , ,II,,I l,,, ,1f,y,,I7,I ,NUI-I I II Ig 1, 31 'I-QI sl-:mel-2 XNI5 Iffb III.,I N . , I 'LII l il II. II. I'l.mn ........... ,......,. . . . I III N IIIIIIII IIIJQ xIOII'l'lIN, .I. II., .III. Xl. If I In, I I- fm: XI'.xI,KI:II, II. Ii. Im... Ifftq, Q! SUWAIIIIS. II. V. IK' U I I-I ,I, I , Sq- I c'1IIII'rIII XI S I ' I 'QQ IIIIIIIIY, II. If IIII.II'I-III-I I Ir II I I IIIIIIKS. XI.. X. III -IIY, I. X. I Q NIm'I7IIxIIl'I:II, 'I'. .I. .IIIIIxI..Ix I II ' I'l's1IN. N. YV. IQIIIII' I' If WT I'li.u'lIm'K. If. I,. I.1IIII'. II. I.. IQ . ,. . . I Ii I'IIIX xII.s Igg ,xI.I.I:x. II. II. I-A-wx. N. 'Ii II. I:..I.II.1-. NI. II. NIIIIIII I I Ig JXIICIIIIII, G. Ii. I'qXIIIIIIN, II. lf XI--x1'..mIIIn, II. I NXIIIIII. .I. II I II,xIuII:N. .I. V. Iflw IIIII. W. II. NIIIII.IIx, II. ll. I I I IIIYINS, .I. V. I ll'TtkIII'II, II I . XII IIIXIX, ID. II. I I I- IIIINII, ct .I. IIIIITIINIIII, II II. II- IIIIII-. IQ. I. I..I..I I.. I.. IIZI 1 IIOS'I'lL'li,xY. .L IIIIKIIXWI, .I. 'If YKVIIII, I.. NI IIII-ILIIIII, II I wp 3' IIIIOWY, G. S. IIIIIYIIIN. 5. IV. IIIIITIM., II. Y. IIIII-III I I I I ' Iluuwx, S. NI. III'IIII'r, G. II. l'KIIKIX4, .I. I. IIIIXIII. I. II. IIN 134 IIFIINS. .I. C. IIIIINII'-. .I. II. IHIIIQIN-, IV. II. I KX X. II. -I, I ' c'.KIIl.'l'UN. .I. Ii, IIIIINIIN. -I. I'. I'II'IlIX'. V. 5 V WI 'H' I II- ,If I Q.: f'lHYI,If, .X, Ii, IIl'I:IIIN, 'If XY. I'I xxIw,TIIxQ If II. VII II I II I I . C'ox.I'1. X. IIVIIT, .I. X. I'IIIIIII'-. .I. I. V' I IX'f I' 'I II' 2 - CIIUVCIT, Ii. .X. .IIIxIAs. II. II. I'II4I'. II. II. xx-II RI I' I Q11 - I7.xNII:I.. II. 'l'. IIWI4. U. .I. III WI IIY. III- I- V TI, I- I 'Egg I7.xI'IlI. Ii. NI NTIII Is. NY. X. S XII, H, II. I If R IIIAI, .I. NY. NIkfiII'III'. II. I7. SIIINIII II1. II. I . ' 'E 2 E E I: 'A' MK-N II I I I ,695 if fir ff: ,LW-'I MJ . CTf'f1' 9. 1 I- '5 'T . . Ii I IF I X. f -Q' If L ' IV: . .. If-. ' x ' I 'f A, ' . , -Xl IN fl ax A :XG CLE' O i Ulu If 1 7, J, 'al 6 6 x , . ,. .41 ,Aka 1 I ., L J 'VK X' 5 'V 1 i:,',L- - 'kS!v:...,.,9gg.ef fl --.., ' .... .,... , L, U1-:giilggazaluax mm: mumlmnaIluIIammIuuIIlIIlululmllulzlllluwim'u fv-vv -A wi- --v---:1 wh f--1-'-'1'f f N - i 'f1' ' 'U ' ' W-. ' H I My A N5 'Wild ' 4 igghiiii l -:iix........n.. ....,. .1:nm:raI:InIxur.:msmma:::uzmasaxnulllznnasunumz:axInIn::::::xu:uII:I:::I.s:::m:I::::::m::::: I1IlI:::::u:l:z::s::::::lmn : s::11::::x:.nn:::z::n:::.':.'::xum w 1'.a3::.'.mzmr:m - ....... . . ..... , 4 XY W X-II il fd I I I i I Q It! ff I 1 V I 1121 . alf ! M I I .-' 2' I II fl ' V A , it 77 ' 1:1 Company M-I 5 .I 1 I 17 ' CO-OI' SIGNAL CORPS EE LII-- 4 llllr' X 1 1 gnu, OFFICERS R., A. B. GIKEEN . .........,....... .... C 'aptain N N F4 1 T. C. MILNER . . . First Lieutenant R. S. XVEBB . . . First Lieutenant E. S. BULLOCI-I . . . . Second Lieutenant A. H. DAVIS . . . Second Lieutenant L , fn - SFRGE XNITS 5: J I L I FREEIVIAN, H. S. LOXVERY, A. B. S. M E1 XXNTON, C. S. FOUNTAIN, J. NV. 1 S' . CORPORALS , .ARVVOOD, D. E. BALI., D. T. IFIADIILTON, C. VV. NORTH, S. L. , g PR IVATES I 2. ANDEIXSON, A. S. FANT, J. M. BIAY, J. E. ITAXVLIXS, Y. E. ' Z AVERETT, J. E. GRANT, A. B. MON1-IEIIIER, XV. ROBERTS, NY. L. I Q BELL, T. E. GRANT, B. H. MAIIIIOX, XV. A. SIBLEY-, L. F. S ,Z BEARD, D. M. HA1NIBIE'E, R. IVIOOIIIC, R. M. SBIITH, J. F. ,4 BIDDY, N. J. HARRIS, R. N. 1VIATI-IEVVS, V. SKINNER., A. I.. YZ BOOKIIART, F. HAIIRISON, C, MAULIIIN, J. L. SEYLE. G. F. N 5 BUFKIN, D. VV. HARTMAN, VV. A. MACDONELI., J. R. SMITH, R. Y. Af CHATIIADI, O. JENKINS, I.. N. NIITCIIELI., T. H. STEvENs, F. A COOK, J. V. JOHNSON, J. I.. NEAI., G. H. xv.-XSIIINGTON, R. W. 9 CUIKETON, T. E. LAMIIERT. H. O. PEABOIIY, XV. J. XVERE, XV. R. 4 Dow, I-I' V. LAW, F, C, IDEACOCK, J. H. XVINE, L. R. Z EINGLAND, J. A. L'IDE, M. A. PIROGI -7- E- XVYNN- G- M- ENOLISII, J. E. LIISIIINIAN, A. NV. RUSH, VV. B. 1 7 I N f 5: flown R- ' lk ' .,lli : ,.:.-J-'4'ij-A n A A ' llkx Of 0 was f ff- 1 .. W' O f .JSR ' -.5 r, I I. 1 I5 14 - L .0 .nu W' X QL iq- o . W . H ..,.,,., ,,.,.,,,M:'.. ,, '.3 , 134 ,N , J I If-1 , 5 ' , 3 L P gmg5YmXm .S . Q,-N '-nu Q, .Q ,S II H A .. ,vyyll 'Xi-ily? , r- ,iq-wc-I 11.32 I Q V5 Es s .lg Fa If vm if .Ez 4 F. i 9 5. 1-Q .pgs 53 Q I I. I J! if 9 4,1 ,RI 'e Sz' O5 -45. .L .W f 5 9 5iiiiiiffiHiiiiiil'muaasszessHf'www nr- ----- -- -'sas'-v -,A ' , - . an ' .lx ' If -IC .I' I Qssaswnnwm 4 ,A - ' . ' 4 GR' ,f x - , ' 9:-f . '--- H -'-- - -'F A --- V --.-.-.fi .-,..v..-...-... ,.,, - f ' ,q.v E: IZLV BCILCI- I I I Ig I I f f Z V' f Z 9 2 2 f 5 I 1 . I 1 I 5 ' I 4 ? Q' .4 If IJ L P 1-I ki ua 54 1 I vi' 1IIIl' E . . S S I I 5 3 K S S 5? si EE 'W -I . za 5. E f.-C 5 NI Company IVI-2 IH-III' hum Xl tum-- UI I ICI'1IiS fl ffff T. IXIGIIT . . ........,...... , A,,,, ,f ,H J. XV. IVE!-:Ms . . .l ir.-I l,ifurfn.m1 IQ In WMA , A ,1'g,,.f 1,,', ,,f,,,,,,,g I.. N. '1'Al'l'AN . . . Svrulnl I,iruIr1mul II. II. XVII lu I Nll V ,N',...,,.l ,,IIllllIIl1lll' SIilIIiIi XNIS 'I'lI Ii I' '-'1uum,XX4X1 Ix . ., CUIIPHII IIS II.um,'ruw II I' I ul. H, I., I V . , . . Lnmzxlz. I.. I . I'Inn vu X I' !XI.I.llIll'l l'UN, II. N. AYCUQK, J. A. AYCOCK, '1'. B. I3.u.r., J. I . B.xn'rox, H. I'. l3lCA'1 l'Y, 'l'. C. BENSON. O. Bum, R. I.. l30'I l'0MS, C. II. CAm.1:. C. IV. C.u.mv1:l.1,, H. G C.xI.1mI'N, C. D. I II CV.x1m1c1I.u':I.. . . Cl..xN'l'0N, D. XV Cmuuc, IV. P. Cocmmxs, J. S CL'1ucT0N, M. C .. Jn. I'IIIV,X'I'I'1S Illini, NI. 5. IIl'WII'. XX. II. I7rnmsl:. NI. NI. II: un Y. In. U. Iilmixnns, .I. U. .I--nu'-x, C. Iixuut, I.. Ixrnw, .I. X. I'IlI'IlI II II IQINIIIIIVK, NI. I c1g'fl:Ix. I-I. C. I.lm'. XY, IB. I lII'I'Wl we C I Immn. I. IV. Gmnxniu. C. C. Gnmix, XV. .I. Nlvr-uv If NI. Grxx, II. 3IXNIVI.1I,'II. II IJ Xu. If. II.xnsC1l. lv. I7. Illtxmucxs, C. Ii. XIIIIIQII. .I. I'.. JIIIIIII, .I. II. Illzxnlmwcs. .I. NX. JIIXIIYII. II. .I. IIl:Nl.Y. II. I.. llunnls. YY. I.. 1 NI:-ss. 'I. I... -IH IIIZIIIIIXG. II. I.. IIol.l.xxn, .I. I7. Nxnwxmni. I'. I IIOI.I.l.lI.XN. Q. I.. I'1nk1r. .I. Iv. f ..-iflflfifif. of. :fi 'NI L. A 'T In XYIK-' I. I 'IIIIl II. I.. Iiunllvl. Vw. I.. I'luu I' I Iifwu I C. S, ' 4 Hu I VI XI' ,. 'IKIkIIl. II. Iv. rll'lI1 X-, Il. I.. 91'r:lv.v n, I. I . II-IIII-I'I N. II. NI. ' n 'I'muvrf.x,I1. I. II'xl:x1-IK, II. XXIII' Ii. S. XVI-'r1'l:fvvvk. Vw. I. IIIIIIN I II, II. II. rrw,I.f. H.. 'M 'I I,.4 2+ 51 :I 9 I I5 I of I If I I I Q I-N ' . :-: .5 I .. .51 I . . I-2 ':. ... I.rI I-. . If VI .1 O.. ISI Ig! QI I. T53 J' I I Iii III :EI N. ri E. A t- N172 I: '-46' '.E.,. .VA P Se. -..y 4. I. .., I 4,3 .I Im? Iii Id ' -45'-41 .G I. x.ff,x,.',, .1 I .I If 'II :J . 11 I1 15' 1. 1 . 1 A J is V. ., 4 -1 Ili J 1 L5 '-5 :fi FJ H4 , If Iii' .4 Iam. ,vu WEA I 1' X ,,,. Ldv .HV af' I 'UI r. f I I , Ii lg, 4 . V Y H I Q Lf . . ?1..II1Ofk .. . . . T--W --f- f..,... ..... ?i XQYRN-xx-,bxxgv-N'-Qw...'NT. -...XY.'l':....A.'::R -'-'-'A'-' T23b'f' '-+1 : :.-IwgZ..ng-14.-13-A- Lf'Q'L.g2.f9.-1...-....,.5.i.33.13 f v.:z.1caaQwxm1-X-14--Q - '- -'W JJ, -Y -, - , ff . . -- 1' fm- L . ' ' - 3-.I-. 4.-.1 ..-Q-1' Q Q'-1-Q - .- -. .., LONEL K ' A I I. I IQSE: 3' A ZLIN g mkl llltgi lngzzlllllll ll I nmmRIuuunImmu1uIIummnuunnulnn-Im... I MI- I! , 1 V I .II H E D L Il 1 IIIIIII -...... ......... kamumm lllliiih'1llFlllllllIllliiIi Illllllllllllilllllllllili M I II I . . . . . . . . . S , . II II . . . . , .J . I '-I lv' P S 5 1 L 1 I WI X 1 I I Wi, GTB in I' I IA 4 4 I 5 2 ff 4 4 2 3 Z I' 3 Ki 55 F. E. WIIITEI.AW' J. C. HOI.DIES . VV. H. BIASTINIAN . VV. M. HUNTER . E. M. MYERS . . VV. VV. fXM.OROUS ALIIRIGIYIT, J. G. ALFORII, J. I. ALFORD, J. M. AI.I.ISON, H. li. AI.I.DIAN, J. I., JR AI.BIAND, H. BAl.I., F. M. BANNISII, E. K. BARNETT, J. H. BAIIDl', J. P. IIIREWSTEIK, J. D. BIIOOKS, I.. A. BROWRR, M. A. BURK, J. H. BIISIIIN, T. III. BIITI.'I.l1IlI, H. A. COOK, S. IS. Cool-RR, Ii. I.. COSLOW, G. R. I TIOH' I - XJ! Company A-I JUNIORS AND SENIORS Second Lieutenant M. K. HINDR . First Platoon . Sergeant XV. A. BIOOIKE . PRIVATE IDAVIS, P. R. Cox, J. P. DANIEL, WV. F. IJAVIS, V. M. DEIEIRING, G. I.. DIOKINSON, G. I.. IJOUGLAS, IV. O. FIARINIEII, J. I.. FliNN', VV. C., JR FOIIT, E. A. FREEINIAN, VV. P. FURRIQR, E. I.. CILOVER, A. K. Goomc, J. C. IIOIIIJON, M. H. GRAVRS, D. G. KIIIUBLI, J. H. HAM MON11, IIT. C. I'I.xRTlI'O1m, IV. D S EINLOE, S. XV. HILL, R. I.. HOLT, IV. K. HOXI'EI.I., H. A. HUNT, A. T. JENKINS, S. P. JOI-INSTON, C. Y. KRRNAN, IV. F. 'KENNIam', C. M. I,.In1c, B. S. IJNK, J. A. I.OCKXVUOI7, C. P. I.Ov1-:, J. F. II'IA'1 l' ll 1-: ws, J. F. AICIXIIIDE, G. IYICCALI., M. M. Ix'IL'CAl!RliI.I.. T. M. IIICIHDONOUGII, J. J. M CIJOXVEIJ ., Y. Ii. . . . . . . Captain . . Second Lieutenant . . First Sergeant . . First Lieutenant . . Platoon Sergeant . . .Seryeant MCKEE, G. S. BICIXIINXEY, R. NV. AIINCIIENER, C. E. BIl'RDAl'GI-I, J. P. NICHOLS, D. G. NOR'1'llERX, C. S. NOR'1'llERX, K. XV. IIOSSI-IR, G. P. RVSII, I.. K. S.x1'ssx', C. XV. SKAXNAI., H. I.. SNYDER, S. S'n:w.xR1', 0. B. VIYIIVIKBIONIT, J. I. 'IIVIINI-IR, C. J. 'I'l'lINHlI, H. li. NI'.x'rK1Ns, T. H. XVRl.Ls, C. D. NY11.1.1Nmlnr, R. F. egg... . . .II ZII I. Ii .. . Ii I XII, 2 th I II I I I ' I I I I 'I 4,5 I I I I I ..I 5 I I . .- I I if I r II I7 I REI I I-4 I I on . AXXXQEBb.bA.NLX -o .I .-. .. 1 ,X lg - .1,' .Q , . fe? I 1 'I 1 K-AA? 1 , lf Rx I 1 if 1 J ,f '- f - .x-x., ,...- ..'-' K ,.- . ff ' 1'- . Mfg:- SX , I ,, fs-' 1.1 1. 1-2---f - 'X 1. 1. 1 . . E !?flfiii!i?fH'ff- :u ...........'fX .. .- - - 1 ' ' '41 4M ..- K I , 'if-' ' . - ',.-1 ---15 ., 1 ' ' ' - -'N' --'f ' -- --- A.-. . - . -Q -I-w,-4, . . ' ' -- ' V S--V l 1 I it , ' A I I ' X1 1'5 ' I L I If 4 4-N ' A I NX J f X Z ? A. I' W. I Y . ff X Z 1 4 1 f I .4 7' 1 4 6 ? Z Z 1 . 1 I f 4 . Z 6 . X. 1 15, r ff 1 1 5 7 QI l v H-,. M11 II! 133 ' I f'2',,i!1 IUQAI .. 'I 1,5 I 1 : I .mf 'III 1:11 V 1 4 I I 1 ' 1 I I- I.. I I Q if 1 Q 11 1 V . 1 '24 1 1? 1 It S 1 5 . I I 1 IQ 1 If I S1 1 A. .I . . N N, H . IS. Bnowx . O. BBx'rox . . P. CJIIAYIIUN . . Amloxn, Ii. I'. .'XII3IIiX'l'IKOIf'I', C-. I' IXSIIUIIIKY, J. XX'. JXVI-IIIA, B. I.. BAu'r1.r:'1'r, G. P. B1-:.xsl.r:x', C. I . IIl:.v1'1'Y, C. IIIVINS, Ii. I31..ucm', I.. M. Boxns, IC. II. BIKI'1'I', XV. U. Bno.mN.xx, II. II. BIIOI'GII'l'0X, J. J. Bnowx, N. A. BUr.1.ocK, IC. XX'. C.xMv1z1-zu., XX'. J. CAIIIIOLI., A. I.. CAII'l'l-Ill, C. S. C1mm1.xN, H. II. CLARK, I-I. Cows, C. XI. GIIIXIIICK . . B.XI.I..XIKD, I.. I3A'l'I'IS, XX'. Ii. BLACK, A. A. III.ACIiXX'I-Zl.I., XX'. II Boxn, I-I. I'. IIIIANCII, XX'. XI. IIn.xsI-'n:1.n, C. I'. IIIIUSNAN, XX'. I7. BROWN. Y. H., .In IINYAN, C. NI. C.xn11:Y. G. II. Cmcxxzs, Z. S. CIIAMIILISS. J. XI. Conf, J. O. Cos'1'I.m', Ii. XI. Cl'1.1.1:n. 'I'. R. Cvxxlxmunx, Ii. IJANIIZI.. J. 'I'. IJIMMUCIC, XX'. Ii. GIXIIIIISCIX. II. II. Second Platoon . . Svrymral I'Ii Cox, J. .I. Cnuwm.l., II. II. Ilrzxxxckxt, C. I'1v'rlNu, II. U. I lNcm:11, S. Ii. I xNKl.l:s'rl:lN, .I. Fox, S. II. Chxssrzx, I.. J. CIIIISON, C. Ii. XIIIISUX, XX'. XX'. Ci1.ovr:l1, II. .X. XIOUIIIICIIN. II. .X. Gumz, C. XX'. Cimuz, ID. J. I'I.xl1'l'nlr:N, XX'. .X Ifhzx Luv, I . I'IlI.I., J. J. I'II'lIlI.XIIIl, G. .1X. .IouNsox, I.. XI. I..xNr:, 'I'. G. II. II. XI.x1'r11x . IX' X'l'I S I..xu', I . C. AI.XlUNlf. II. XX. xI.XIIlllXX'lf. .I. I-', AI1Cxll,II.I.. XIc'Ix1'mll, XX. XI XIrIx1'v111t. J. I . XI1x11n,.l. .X. XIo1111lZ. I . II. AIUHIIIT. .X. XIf1u1'11x. .X. II. XAIIIZI. Ii. li. Nlimlllwlcs, II. .I. Xnznuox. .X. X'. X11111.r:. XX'. II. Xonix. J. 'I'. NUIITII. II. XI. I'.xlu41s, D. XI. I'.x'l'l'l:l1sux Ii. XI I'.x1'ruN, I.. K. I,llI'I'CllII'I'I', Ii. C Third Platoon Firxl Lifllffllllllf XX'. Ii. I.vxrl1 . I'IIIX' X'I'I'1S . Q - .V -4 . . Xv.XhlxINh, I.. I.. XIINXNB, II. .X. XIUIIXVI N, XX'. I I. II.XI.I.IIlI, Ix. II. Ilnulurxln, II. II IIAIIIIIS. J. O. II.x11w1:11.. Ii. XX'. IIl:.x'rlr. C. Ii. IIIIIIIIING, II. I'.. IIIl,I.. II. XX. IIHI, J. II. IIll.l m1.x'rH. .X. 5. IIUl.lII.5. -I. l. Iloxurn. J. XX. IIl'l.l. I . NI. III'1'clu2sUN. II. II. JENKINS, C. XI. Q .Ilzx ns. I'.. I.. .Im1xsoN, Ii. G. Joxrts. Ii. G. li.n'11111, XI. XX'. Ii11.1.1.s, J. I. IXIIAISN, XY. XX'. I.l1X'Il.XXX'. .X. Ii. Ixxux. XX'. I'. XIxn1'lx, II. I.. xI.XCI,llI'GXII. II. AIIIIIZIK. II. il. AIIIIIIII, J. XIl111i11. J.. -IH. AIITCIIYII. XX'. XI. XI11ox11Y.C. II. NIIXYTIIY, XX'. C. Xm1iN.U.I7. NHIITII. .X. .I. I'.x1u41i11. XX. I.. I'.x1'r1:v1wx'. J. XX'. I'1111111'f. II, XX.. -I II.n1s11x,l. II. IXICIIAIIII, Ii. C. Cf- .-fs . . 'X ,, ': HD :- ,. .i. 1,I ,X . , I-1.1-'I lnmlfalmu . 1 W . . .I'f11!1f11n .Mr-11-ln! -1 . . . N1I'I111 Ii11wx..I. I.. IIIIIIX. I . XX'. Iflvx-, XX.. X. II11n1111.II.I'. II1 umm. X. II. SXNIUHII, .I. XX.. 5xX11X,I . X. Su uv, I-'. Ii. SXIITII. X. Y. SXIITII, I'. II. 5-1-x11n,H.l'. S11x'1,N-l XXI. C. S1'uX1o11w, C. II. 'IIIIHXII'-HN, X . IIIXYI ll. II. X. X'u K, C. II. X'Ik'Kl.IlX'. II. I.. XX'111.u lu 1. I.. I1 1 1 Is I, nf , .1.1. .311 II: .1-.1 13' .I. . . I I I I T If 1 I 156 I 1 Www FIIII XX IIINIIN. II. N.. -IH. XX'111'1W. II. XX'. , 1111111111: 51111111 IIul1u111s11x, XX. XX IIII'lIX', .X. XX'. II1v1.l111'-. I. I. Ifmllmlxs' .I. II, lh11111111,.l. I.. II111wT11ll.II.I'. 51111. X. Ixvvn. I1'.I.. It-ux, .I. X. X'11z1u11x. XI. XX XINII. I'. U. XX'x1'x1N-, II. C. XX'1111. XX'. II. XXAl111l. 'I'. X. XX.Ill'II'. II. If. XXIIIYTI, C. II. XX'1lm'. C. 'I'. XX.II Kuwx. .I. XI. IFS' i.X:4X .VII .Al-. 1 fi 'v ff FA!! I ff nl 51. I? Il g.. ..1 .I1 . . I .1 I-I 1351 I I 1 .11 I,11 l 1111 1:.- 1.. 1'Z1 Ir: 1:,1 51 I I 1 I-. II'I ,. IIE! .. In' ,. 155. 'Z L. I13. 1 11. .jI lI:1 Ijj. 2,21 5.2! .-, . 1 Ii 1 IH, I XX lv11llHI'II' Iv.. -III. , -I . Iii. 1 Ifxl 1112 ,f:f.1i.-- Q.-r.Tlw 14215 ,. - H , '. - 4. '- ' m..,1f J: fl. --1 .X -, Tj - .91 . - . C., . . JA-- YA M.. -W W K . ow yo' I . . . g-. ........ ,-... ...,---- . ...,+,-.- lb.-.'-. .-'.-L-L'ha,,IS ' I-X71 I '-T 'Xfflfb-J-114'-9--::'-'izf-'-it ,-::'.-, -1-.1': -b.'--' -'-5:11-E . I Y.. ' ' I V, U , fx1s3Xq.xv.xXx1QQy.'.5'.-.XT Q owxxxxxxxvmqrz-S:-www.:qw-b.-.-S!-SN-- --'Mm - --'-f-- L ' LIONEL K- IIN ii 11 ll 1.2 2 iff-- A'? '-.X -1:2-iii ff.--f. . W :YH Nv:.r' ,F--. --f----f- -AYH 'AM' - - -.: V xg.. ,QE XX, L' fr. t Ji! - .gg-,1.,..--.-'t ss 1: R, 'fm 5 3 N. 'WlQ3M1sNfHwm,,...-, A . QW ' f U J5,ii'Q Hmmm 7,, iw A fr ,, , l ,N ' f'Il'l'1HlT-TF' Y , f' qw , A v N M N , ,fgfgk fm .Q . '!? E4y ,m 'VW W if ' 1 f 5?f:?'fji'zi1if. 'fm' D+ X f 2f2',,, EEMTTL'-..,.,,! w' p 1 NAE N xl 5' Q x lf X IQSSXN x ,.f,,,,,LTmmg., 1 i , , idx. iflriglirwzjiw ix --.4 4571i-:V-7,2 L MM X V Sw ' I-EMU P111 '4 f 1 x 1 V 1 'nQm'U'Uf'U-f 'Ci' MV ' if ' -X , lj'---M-f , 1 - 1 . ,,Qf' f I , ,Y ,251- 'N ' 3 , -, ff, . - Q H , ' , 1471 i'- 43i r 1411 ' ,ff fre- ' 3 4, , f ' + 1155 1 'f'MUEIgp,y'---I ' X , 'A 'l72,5 ' ,i7 ' 'iyfffff f L u Xa f--14,gfw3vfU1,tQTnTFTFAw I -Jfgggzixwrvn ? ,, 'W ' ' ' 'fff?f?,T4:' - ,J , , ' f i J'Lf1fQ2f'L, N , H-:f,:: ' ' f-.z,',.L'f-,mm W 'L Zigi:-13423 , 5 4'?1i fi-Ig, ' ' ' --,.'f,.gh4AF'.LA- X 7' I ' 1 . Q ,E MP- . f VN' . w W4 f 1 ,fff , E Q f 65 x rd ffi A 1 . f7'?5,fl N Wf T1 E! Q E214 W wi . ig' Trai ' 1 fig 1 1 gi X l 51: - Eff N, MY' ' ,JF ..., W' U vr. Cf: ' . X - ff 5 5 .,,-3 ,Ag if . X QPU, ' 4 1 f 1 w 'ta . 'F ' ' inf V Q2 , EWS bi N- . . . pfffflf lg , ' fm ' 9 V J 5914 J? f aaa! vb. 4 A , 5 l - h. , . H: , gg.-, . Q' ' - . 4 . S- - k W.- f Wusam JF' ' , V ' fx , Q wr. 1 N , ' Q b 26 'E - ' ' A, ' ' Hum U' NL'-,CY , , . , I f x. .Q -:','p, . b 1 An- ,If ' V in W 2 -Qf '- , -HIE Z :. . '-'f'cLew 321 Z at V , . 'tiff i ' , 3 1 IN Sify 5 w' ' WI f -. g. ?,j.v x , v f , , . m - ' xv, Z dill f N. - ,, A- wwf Z .TORBEJNX I .,.k.3.gA A 4 Z 5 1 i5: 'Q ll , A' A SEM L2 ' JR 1 Q25 Z K A A 31 4 x - ,. M , f Q , 5 lg. t E' Z xx' ,N I Q m E 'ji 1 9 .KEN 3 ' i I N: + 6 v SW 7' ,WU X 'SWA f IQHQ 2 We A54 WE!!! XM? M !fk',X,J7v.,um if . H' ! GY f! f. If' 7 , 'AL,,'v1Y,:'-:T-L.Aa-M '- I--,k2f7ki!6J'2Z7:7?.?A:f,4gr7, 7h ?-,,,,, X I ' F 1-1, 'jffff'-'55 f f-'f-:N . .1 ff - S 1 1 -Yggffhi jY1i.f,.f4,5T3j , --3.M.fh-NM fj'yD5?9xh QM fx xvyx i-YQ. f , .1-g.-:-'- , A---, -' A v, H-.---' 2' ! :AA 'lifgffF1ll1fB l?':, N :,lxXQ.??.X'S'1X gg W -7. . .Y,-v 1 krxrii-1--,gyf VI , X ,A svn NH XX WX , V uxfmma- iw 1' 51 I li, U mum?-.X V 'l1llhX..,x,Q,L l, ffl wr. l,XgY3f:fg,Lq . M lixamili- in-1'xillxtl:,'fA5!b,vYv,:if QQ:Xg5:,QQ.N Aw'-2...-H ' 1. 1 - X 64, ,XNFQ-i71 fm-.A 4 K - 4124. A A UMW F' W fF-CfTf5Yf'- 'A-NI..- w 1-fi wx wi-.-' 1 jx .Y ff-AM x t 1' 9,17 ff-S3 Q-x H rw: - QNX- X .QF ,456 X, 7 X -had k , ' '-uiijf il gijf-zz? , fa -Nil ,-g11V'g-A A ,N X Q X NQZA- X1 L 'A Y -x x .w 3.3 in - .m -3 ln an . n -A V 1 EE ,K , 1 1 I I I , - , , -, , . . , , R -1- 5 Y v - B -u., .. . , nxt, Si rqV. Q.,19 Lxomel. - ' N .Aw ,gx 2,91 .',,.'ny A xllh, 1 4 .- elsif q 3 . I A . Y 1 n1.925,- .4 H-' f . AVN , ,Aff - Y . ,,-. I , ,-- -5 1 V x .... .... 1 ?4,,,,... A' q.,, -. -- 1- gr -1- A-' - -' - I I'I E D LV E: P I -1551... .... , ,.:: ----- -g - - . V Q ,,,, ,,,, V K M Y .mph V 'Ili 'WUI :ri I 1 'I'I I I Sw 7' 1-Z? Z . gg f I 1.5 5 Scabbard CI Bl d 5 an a e QF: J I 415' uxlrw C , , , 6 - 0311191 Slzcoxn REGIAILLXT F Q . IEE51 ng., HONORARY MII,I'1'.XIiY FR.X'I'I'lRNI'l'Y , Q52 . 5 Founded 1904 listulvlisln-41 l'l H , 5. I r fi , I:':I I-IONORARY BIl'1MBl'1liS ' I 3.-.1 If . . .. . . .. I BIAJOR A. L. Phvx DLI-,'1OB, Jn. CAvTA1x I'nAsl:n IIAI1: 2 IVIAJOR IN. C'.'XX'ASIlINGTOX CAI l'.XlX T. C. .hzxxxxs , g CAPTAIN R- 1- GIBSON CAPTAIN XV. .X. IIuw1,Axn 1 65 CAPTAIN J. If AUTHEY CAl l'AIN H. I-'. STM-mum Q Z4 CAPTAIN P. 1. FRY I 1ns'r I,u:l'T. li. II. Vurnsltx' : 'jx YQ CAPTAIN F. C. SIIAFFI-IR Fmzvr I.n:r'r. li. ll. IDM-:laws M L 97:4 A, Ky,,,,f , -..q-v 1923 -:-V. I , IEINVARD Roman ,'X'1'CllISON, Jn. Ilmuuznr Smncv Nlcihplz ,wg Houma Moxnorz CAn'1'1an. l..xl'n1s1'nx linmzxnz Blmnu:. .ln 'T , irq! THOMAS CHAMPION Dmzw Wn.x.1.ux 'I'1umAs Ilmin .x I 1.92 -ROBERT IQDMOXIJ, Jn. Iimxxxnn Smlun' Sr1uv.xx I AI T525 'III-IOINIAS COIVAX Enwxx -IUSIIPII l.Ar.u'm'rn: 'I'Ulllll.'IT 'il gig, C1IA1u.1zs EX'l'IICliS'I' Jouxsox IJILXNCIS limxxuum Wm'rn:l.uv W, P4 F -.qR...yI.C. , '. l mm nAxu., mc., . L l.r.m.Ax pw, 'K 1 A 'rf . lg. r 3,53-.fi N. 4 V 1921, 'ROW 1 I JI 391 I I 1 HENRY IBOIIIYIII Cnowrsm. I,m'1:: Guulmx I,I'I'li jill PIKUI. Rom:u'rsoN DAVIS KIHAIKIIIS ,Xlmznrr l'uu-nw kip R IJIAYNVOOD S111-:mlm I'IANsl-zu. IIIZIMAH Duuux IIlilll2lK'I'5llN 5325 . XVILLIABI HI'N'1'l-:n llrzuxux lil-vs 'l'ruxn1n UQ' bg XVILLIARI I-Ilcxlu' BIAIKTIN I-'aussi li. Wmwmnn 54,9 I? Kr:NxxA:'1'1I CIOIIDUN BIA'l'Illi!-ION, Jn. U 5 A ii 5 H312 2 1925 51 'FIIODIAS SAxm:ns IXLACKBIAN Wuuuxu Gmnsxurru. Ju. ' P1-IILLI1' I-I1-:NNY Bnr:ws'n:u BI.m1snx IIINIZS , 354, Imxwux C.u.r..uv.n' CAnTx:u XYIIIJAN l'H.w11::1 -I.U1lf 'N :Ei 3 I'Il2NllY FISIIIIIK .Hanes I'f.xx'r1:n -IAIKIIIZTT MSW 3 LOVIS IEINVIN CIATES L'l.,xn1:Nu: .lx'1l.xx Wmnz. -Ill . IQ5' , Af. I ' IQM' 3 Irifig III, I KEN VU IF. I A L, 2iAFll: 4W 355 X.: I 2' I L Z' .... . - D 4. 3i'If 3Ii4?fgT'f .f C9 A-v wwf It Igamfou I . ,... . , ......... .... ,. ........ , N mqavavnxx-r3mwwmmw5xxxf5w:aQe:s51.g-:-:-1-:-:-ego K E-QE ji. 35,57 f 'JJ X! I IJNX. 452' 1 Y ' K O C' .FN 2 1 54 Z2 W 19. 1 1 .M 4 1L.'5 1 .', E. x ,bw - - .2--11- .rR,...... Aw 14. ' I, X J , --XE A .X f,4'A 1111 fy 11 .1 by 'if , .21 ff 1 f ,Jff '- 1-fix 3 .5 , qt , fi , ,Vi 1.1 '1 Q M411 1 I 'f .17 .y 11 f., 'f', , f'y2 , 1 1' X' T 7,1--',J' .1-A --E tim ' 1' .ff ffl 1 . .J Lf' f , I ' Q .4 5 f ,ffcf , Rf .E..1 ,. 1. , , '11.11-ipqigg1m1jE311.Em11T4gQWmfEEf'-15111-A.. f1W'rfER1'111m11m1111mmi1um11,E -QAV 111m.14u111b1..1 i----115 -wfxf VL-1-W, - A 1 - - --- -M-f-+--ff 1--H-A-H -f-- -j--iff--i-Hi' f,'- - 1 1 1 L1 15-31 Ylmxi 11,1 5 1 ff . . 11 . 11X . f- H 1 1 .1 1, , . 4 1 . , 1 'Lv 1 X , I--A-nv. , J I I A .2 V 11111 1 11 11 11 11 1 11 J I1 .1 11 1 1 1 . 4 1 1 E3 hjlHf1j.i11-'rf1?iLl!.,12MmnH4,5fWT4E61wgQTJjjrg5w115,1mn?5?mm1E1FL11Lm111mwimzfrfwrfuazffff-ff: ffEffLfW?f?'Tf ff f ' ii TT-,fffk-1 67+ 11E?Ff1' Z5 1 xc' ' 1 5. 'Q 1 1 'l 1 i? 1 E23 1 1 fi iff 1 1 ' ' :iv '1 1 1 7521 Q gf 1 7411 , .151 1 51 11 . 15211 1 2 4 1l 9111! Z-it i,'rf,3,. 1.-wi E 1 KQV' 1 - 1 1 if j 2:2 '. fi. 1 141,11 5 12 1.5 ' -'f 1 T, . ggi? 1 S13 1F ' -14 if-1 15:1 1 gg 1 512.11 'HIE yC Qfl' . E . 1 Q . 5 igf jl .' ' 1 I 4 . 25 1 131.9111 My 1 . 1 nil' . . 29 ' 1922 R fl I 1 E 1 e earn 1 . .1 W9 1 . r X l-A - H. B. BROWN . . . . . . Capiazn wif f , 1 vSX M CAPTAIN H. D. GIBSON . . . . . . . . Coach 4 . BROWN, H. B. Mosrzs, WM., JR. 1 E - ' 'EEN y 1 HINDE, M. Ix. ROBERTS, C. R. W 11' .4 GARDINER, S. SAXON, F. A. Y .. , PENN, H. L. XX EIL, A. S. PETERS, H. O. 1131351 WI 11511 1 Nfl 3 awg 1 1R11 11 1 1 1 .E , .M .941 1 FIRE? . Efgjf 1 1 11 1 5 1' X . I 1 X V 4 Q 15123 BOXING 'l'1-:Xml ,- n V I 'Z' . ,l Sit- N 11.1 svfw -1 'X ...KW 1 n Q' -W1 '-:AX 111.1 ,J JI' -I I full. I X rj ww ,I .rX?9'1,-- ., --..- W W- ........ ...--l!'LL. .,-...1jgL11HW'Ql'A 1fnR,kxAQw 1-fl li:1'iiii':i.Tiiii'1iL . . ' 'Ti ' - ' 11 Qi.: ,, A - ,A y ' Ti,,,,f-AAf 'x-7'7 -T:-T'Tf'1fi,fff Tiff :Q -v, W4.2l5iQfEi'5Ey:fc:QzQzf1gf.fff.1'Qf::'.',':5F:f.'P'11.'111,f.-1-'mr5.,1. ,L 5-5-31 1.1. '. .'-PR-ffiigil Lg! 1v.1KMi'g 1121 S'T'Ti5Sl1l'li59 fffixtx-f-f'R , 'TQ'Y,XKNYf:5XS.'S?T xgN'LQ .JZ -L--:'::,:izi:-7 ..1:f,1..g:-1:.iw ...... .,....1,. ..... :i:.:..,,..::l -in I4 ' 'li' 1X 1 X ' 'gff' t -'S .... L. . W Y M lf ,, ,QQ ,,,.. ,fLL:N . 1 '47 - 'u '111111l11 33'-'01 ' 'H' 1 i 1- .jig , 'aff L, .51 Igxjtw jkj X JN! N uma: . V--Q....P- I.. .LTI . ,.5 ...I q A1 I ff-ffv f- Q.. 1 FI I' dm- ,ff -H---f - 4 EK . .I ff H... gggimr' jiiln -gzrsxsxxxwu 11111:-a:::::-111.3 .:.. ,,,V. -...A. :.. .. . .. ', .- .. ,TWZA .Y JS, A ,fd QIEL -I 'E.. -I . 4 '- I -I I '. . I I ' , I I I 'I I H 5 Ig 5 I f 51 5 3 3 f f 4 f ? ? f Z 4 ? f 2 3 9 .5 f 5 .4 5 f 5 2 If H-,I ul H w II-ll' s 4 'N ...QI X EI? III I I I- I 'QI IIIIIL I ll I ...I 1.49 S A 2 ir Q. 32 Q. F I2-C .x -Zfl 5:12 G 'I 12 J .0 I ' I ' I wi E :- 3? I Ig S I 'AI -I Tech Aero Squadron f ff-tv-af .LJA F -'. ' . . . -3, :,--- -- ---, -. . ,, , ,N-. . ..!,+.q-q.,Q.. - 1o n-Mtg-.-wg-...D .Iii:7.f, I 'au , I M I . - +.+-Q:-.f-wfrn' H f 33-114. f1I'.+F.fff.f?ff+eu.m-a-ff+f-2g41g I f-1Jv4f'+44?7!i4.u -.I. 11 J -ef ' f my -.-55f.+3f ' .I. qi I. . . . lv sr .. -4. ..b. '.- .'. .-'-'.I. . vixlyfwh r, 1- -v - .....'-.,... M- A ....I. Q N 'I I '- - . .u. : 'N . s C - , 1, Mfr!! Iiignr ,IJ E.. -A, A - LJ.- I ff - .aa .LJ .I .. .J - 1 ,V M.. . V1 .1 .',. ' ' , - ' i. . . ' y 5 I x - , ' , 1 . if . .-,'1SY-,,..,,.,sv,.yNftJ . rl . fir, . , . XR' I I 1 ' ' ' 5 ' 5 H A' n nl rn 4 's W ll rig , 0 .. Q flflol I AI.P'0IIlJ, B. A. AI.k'0IIl7, M. E. Almrswnoxa, J. II. ATIIIANSON, N. A. BAnu'1', C. AV. BA1uu:'r, J. T. I5EA1'1'Y, C. 131-II.I.INGliII, F. I5IiT'l'S, O. I.. IBICKEIIS, C. AV. BIGGS, H. D. Bx.0ouw0n'1'u, AV. II. BlI0IAIlIIlVlIS1', II. S. Bnowx, N. A. BUI.I.0Cli, E. AV. BURKE, IC. I.. CAn'1'r:n, C. S. CoI.1.1xs, E. 'I'. Conuxs, J. B. Cox, J. AV. CUI.IIIIl'Z'I'II, C. C. DANCE. S. AV. DAA'IS, A. M. Ijl-INICKIC, C. Dmms, I. S. D0N.u.nsoN, J. AI. EAGAR, I-I. H. F.xnNsw0n'r1r. AV. II. Flxcnlalx. II. G. Gmumn, I. C. Gn.m:n'r, I-I. 'I'. Iilvrzxs, A. Ii. Gl.0x'r:n, II. A. G0l.'l.n, I . S. Glc.xMl.1xn, .I. A. Gn.u'r:s. .I. I . IIIIIFFIN, II. A'. Gwvx, C. II. I'I.sNK1xs. IJ. ID. I'I.ANSI'2I.I., II. S. II.uu.ow, AI. A'. II.AII'lSI'IIII.D. U. 5. Ilmznv, V. AA'. Illtxlmvx, I . S. IIILI., I . AI. IIn.l.. J. .I. II0l.I.INGSAA'UII'I'lI, II00n, II. J. Illwsmxs. G. AA'. Jonxsox, 'I'. AY. KIINNIIIIY. J. I'. KING. C II. Iivuz, II. II. Kvslin. AA'. I7. I..xw. I . I'. I.lNlHilI, J. AA. I.I'l l'I.lI. I.. AA. I.1'1'l:n. J. Il. IAIc'I'om:, .I. If. AICI NTUSII, AA', AI xIl'IX'I'A'IIlI, J. F. Nlclimunt. AV. J. C 1, Of..-' -- AICAIIIIAY. Il. AI. Suu RIIIIIIIII, I'. Blum. NI. I.. Allxuu. I.. AY. Alumni. I . A'. Ahmnlf. II. A. Alumni, AI. II. AI1Ilu:xN, II. II. NIIIIIIIIS. II. II. AIVNSUN, II. II. X AIlI.l.l, I'. If, Su x' I-Y, J. Ii. IIAIN-ITT, II. II. SAIITII, A. AI. 5AIlTll, AA, AI, SIIAYIIIII. 51.15. SUAA'I'lI, A. IS. S'ruu,N1Ix1lu..A. Suu, J. If 511 I-lu x-. I.. I . NIIIIZIIIIUIIN, Iv. .I. Suu ul, II. AA'. Nlzwuxw, I . I'. NHL:-wx. A. A', Hmmm xxn, AY. SI THIN, .I. STIIIIII Iva. S. Ii. Nuns. II. Ii. Xmpjx, .I, 'I', IIIIUWIII. A. II. XH'I'l'lX1LllAAI, AA, AI. IIII. I.. II. H1-15, AA', II, 'I'u nun, AA'. II. I'y1'n'n'-uw I I , I'NlI1lux'mm, .I. I I,l.'l'liIIS. II. II. III.'I'I.llN, 'I'. J. IIIIIIIIIN. II. I. I'uu'l'-, If A. Annum, I.. I.. AAIIIIIII, I.. AA III um. .I, AA. II qsvyxp. AA',I-1, AA IIITI. II. AAIIIIII. Il, AA'. AA-IIIIAAIS, I . I.. AA.lIIlAAI'I. I'. Ii. AA'u...x, II. S. II AAA'lN. .I. II. IIl:rvu. -I. I.. IILIYI4. II. If. IIruu.Y. In AA. Sui'-. J. II. AAIIAIIIIIIII V. .I. .I. S yA'At1I', AI. S. IIrvxmlN. A. I7. SIIAIIIIIIIIIIVMII, I'. .I. '- 1. ffl.. 'X A umllxw. AA. II. 187.1 .Awn- .bf .! , . . . I iii 3252 'III iz. .I 'I I ,. I. T II II I, .I.- ,. ,. -2. I'.' ,VI I-- 'I IA- . . ,. ,. II: Ix . I .EQ I I I I E: I 3, . , ISI I f5f'I H1 xi--I 'IF , S kxgtx I -A If -.I 614' .,..+, Irf. IQ.. , II' W .WI V J., :I I ,. dx I If ' I .1 I Y 'Z I I , II I. IX, Iw' .I.. Ifjl II: I.. iI,I .'1I -gZI If IIC' s'. .III af. .-. .. ,I fig In I. I. II. I 'f . .. ,. If: In ': fl I gl II . I5 It' I .., if I we I If I gf II I J - aff.-I '.' .II 0..,f if 5' Pg .?Aff'-A z lilijff W I4 .A .-.CCJ 1-TIE l M ihri FI I Q , ',-nw-- .Q . --v- v '-' xg, f .. I -ff.. -. ? wS1TQif-'-1-4.-'-' I '. IRT' C If 'U' CTT-,-4-:--4:--c--'-'-::-I''-'--f:f '1'1'f 'f-f-f-f'l'1-- . N?'sX'-1Ki'iY1'-ZPiX'!v?.'7SY1bXY'N'3'E5-?t:'X 'X'QlA'bkf' 'J'-A 'f 535xI 'I . , 3 .i-f' -2 V R? T - AL' I . . I ' ' K.---,wwf fr- -- L LIONEL K' v, Jyfziaxtxs '- f' f' -1 X -, . .- .PL .A ., -. . ,. ,- If L .',r-5..,--- -. ,IJ I' X ', i fr wi.. 1--1. P 7.' 7'-1 I RS -:- 'lf 5.- ... twill q i: ,ax 1 il i ' . 1' L 'I X9 ' - 1- I H2 M I i. . --: . , ...., ' A .Hi , ..... .I ...., . . . . g...,....,...,.... . .. il: fi 2 1ulIllmlIIlmIIIllIll1iillIllumulIInmuluullll---n-nw 1---- -A wr f----: n 1'-f-- -f---v1-f1 'IHIIH'-f 'f' ' '- - ' I I H E: D L P PJ ' I A VL Mill' lm. -I I 1 2 'X I xiimiiix ..............,. 4:mu:saas:nim:::mnx::.'u::::::a:l::::s:a:nn::::nissanax:a41unauma::xunxuxnm::z:nm:x:::::ms::::: li IIIIE'-iiIIl5l!lHII2I7FI!lZ FII - . -- - ---M M- .-., --f- .------f -:sm ,..... ...., - ..... ,... i ' l 1 I Q ' was X ' pup E 341 N I i I f? W li-ll' , Q ll. :xi - ' E 4 '1 ?i 3 x X 'f. - ,' ll W I . . , in , .V It if W M 9,1 ' .I I 4 I Rt f 5 Q Y 0' , V, Fi' O 5 Q i. . r 1 ll li ll 5 E 2 .v I if 1 l f .il ,N . ,X 'W Xfiiiql 1' i W I W W . li II O ll? I' ,V ff' f' - IM i 1, ' .Ml e ff ' .1 , ' . 1 'A 'Ili .3 firm! TQ I' ' COMPANY B REGIMENTAL FOOTBALL CHAMPIONS . J W PM M 3' EIO' ATTRIDGE, A- A- LEFKOFF, XV. lil ,Q n irq. ii .y i i - BARSWORTH, Lroox, H. W. gr xi pf 'wb BOND, S.YP. 1v1Ay, 5, C, 4 . . V ig s, :ggi BRANNOIS, J- R- MCKEW, H. A. fini , A BRYANT, J- STRIPLIX, XV. A. wil . M M Q53 FLUKER, R. A. TURNER, C. T. 'Q gif 55,2 I HARRIS, S- A- TURNER, N. 115 I Q , iff' in 1 LANIERJ W- J- XVREN, H. B. hp I il-N LZ' TWT if . ,M if we COMPANY BR REGIMENTAL BASKETBALL CHAMPIONS M .1 ,VM G A BRANNON, J- R- SDIITH, C. XV. i ff' A HM. gil yilgi BROWN, C. J. , STRIPLIN, IV. A. X .ig V L' ' SIHAPDIANAR. TU1gyER, , 1: . il I -LK . : ANSON, . S. I ft ?-Ty, E5 b - MiM.M'- -p, WINNERS OF MILITARY PRIZES FOR 1922 ,I ma lg p J of gflilitaryyfgjup . ....... .............. . Comply- f-DI' -il I 5'-U .QV g , g es race n. .. . , ,J 1- 3, C., QM Gold Medal, Highest Grade, M. T. C. . , , T. , i i 326331, gfgilffst grades C- - - - . . Goomzvnx, R. ji . L 3.1, g o e a , ig iest Grade, C. A. C. . . . IXENNEDY, C, . 2. ' ., W, 1 0 e a igies ra e . ..... .... P . . -v C. D I Z Prize for Aizcomplishing Most tor Military . . DICCr.i:X.xc:i2x1:, G 5 Q fgll 4 W Prize for Accomplishing Most for Athletics . . , , CHAPMAN R . l ., .Q l f Prize for Best Leadership . .......... . . . 'I'UnxRR,' N. I 1' i I Gold Medal, Highest Grade Co-Op ........ , , F i H. EQ Q 'Z Gold Medal, First Place, In,dividual Competition . . . . . F. ' .1 I il f ' Silver Medal, Second Place, Individual Competition . . . . . Bsiwrx' . I-3 Bronze Medal, Third Place, Individual Competition . . . . ICING, XV., B H I 5 JGEON' l' if Z Gold Medal, First Place, Riile Competition ..... . . . BROWN, H, B. I fl, 2 Silver Medal, Second Place, Riiie Competition . . , h i . Stxxoyl F. A I Q fl- Elf Bronze Medal, Third Place, Rifle Competition . . . , DUNN-Om-I H. R e I 'fi 5 I ' 12 5 I1 'IAZJ Xi. . Z 2 . ',Wi5-fig ia I X ti !TQl.l.fiii .il -In wp ,II I ra I Z u f 5 Fi pl 1 O A 0,fS5.a-I-355Qi 0 il O - a ........ C- m l ,p , ,, p , I I it 'gg 1, if 3VQJki6S.f-T' !f?lhil.? I p . J. 1M 1 1 i Mauntg, v--fs.ei- Z.-. ..,AA,A ,:A, .L.,4,:m mW - J N- F vgwwww v .A y 5- .. vi 1 'ii V eff' . rs... - 1925 .l 3 X - f m i ,,,, - . ........ ,,,,,,,, , , '- , L k C'2 'i f'7 '1t, 'Q 'f y - Q h r ' g I V 1 'gn ai 5 W u , 'ii 1 l 'lm u T T ld X' ' Y Ng C' N X 71:3-...,..'ff O .K . . 1 1 .ill I Z'- :LI 1 lu -J ,. J: .1 ' IU T 11 E LV E, p 1 'Ii' mhiiihi. ll V 1 -f-- --f11- . ..........,,,,,,.. Q-8-n Z, -V RJ QQ-.-j I . 1 s Th N lS' 'f' f h R E e atlona lgfll icance o t e . . T. C. EE S 4 lil l w . . I 1-I r S FQ aflicggfittttl-iiigwte-ann of all collegiate training is good citizenship. The Reserve X NX 0 s Q raining Corps is an integral part of the st-luul:ic1w or-g4mim1i,,,, on X53 ! S. a par with the hnghsh and Mathematics Departments. and in the eoinplex lllfll 1 4 ' ,I l l '. Q make-up of. the modern school there is probably no one element mort- i-uiuliu-iw EQ 5 A 1 to good citizenship. To catalogue the advantages of the li. U. T. C. would lu- 3 to catalogue the advantages of education. XX'e may. lunvevt-r, Consider ,.,,,,.. uf Hu. mon. l 'A significant features. . E55 1 s 5 ,. .. . S U lhe R. O. 1. C. will add to the educational resources of schools and colleges and will iff 2 V give to the student a training which will be as valuable to him in his industrial or prof.-sgiuual i , V T career as it would be should the nation call u Jon him to ' 't ' A ' l-' l- ' 't l-f- Q' - -- ' If 6 I 1 I dl :IN ll Lili tl' Ill l N li CIISIXQ' fllfllx li.: X 8 He IS taught that the base line which he finds, in artillery work, to be of prime importance. V l is Just as important in any other precise surveying and that the methods of procedure are l is 1dent1cal. The same mechanical principles which are employed in government trucks and . 5 tractors are applied to all internal combustion engines, The electrical training derived from 1311 the signal corps is of vast importance in commercial life of today. Personal hygiene and T ,331 . f' sanitation are of equal value to soldier and civilian. The United States army officers un 'y Ui. duty with the R. O. T. C. are not only most thorough gentlemen personally, but are highly A may skilled technicians as well, thus making themselves of incaleulable value as a supplementary 'W 439' facult 'Q 1 ' '......: Y' 'sei l l 'W'-1 'r T -ffl ' - - . llq 5-,,l The R. O. T. C. effects a marked saving 1n the personal expenses of the student as well ' l t' 'ggi as IH the case of his school. The equipment furnished by the Government provides better ji ix ia. 4 facilities for academic instruction and enables students to do more thorough research and ,mmf l experimental work at no increased cost to the school. The uniform, which is supplied the 1, Student gratis, constitutes a most attractive, serviceable and economic form of dress for O . u u Q n u n . ' 'N' l ff School wear. The fact that he is in distinctive dress forces on lnm the realization that he is W e M more than an individual-he is part of a student body, the reputation of which is degraded :Q Q p or exalted by his every act. He feels a duty toward every man in the same uniform, and . I this sense of responsibility is one of the fundamentals of our Government. The pay given 55 to advanced students is of surprising assistance, particularly to the deserving student who y .- Q iS paying his way through school. I Efort- along any legitimate line is commendable and deserving of reward. There now f i exists in thirty of the leading R. O. T. C. schools of the country an honorary military Agp fraternity ,approved of by the War Department and known as the Scabbard and Blade. This fraternity aims to develop, preserve and reward the essential qualities of good and gf? g efficient officers and to unite into a closer relationship the military departments of other pai ' 5 schools. It bears the same relation to military excellence that Phi Beta Kappa and Phi kappa 5 Phi bear to academic work, and membership in it is equally exclusive and esteemed. lisa Mid 5 The military pursued by our Government is based eventually upon the judgment of the yg people as a whole, and for that judgment to be sound, there must be a more y'-'14lC-Sphfcafl knowledge of military history, customs and policy. Much can be accomplished through stunu- 2 lation of interest at centers of learning. It is difficult to feel patriotism for a country lf Z one is not acquainted with the operation of its military system- Mimi' PCOPIC are Sun of at ' lid X' . lil f 1 . lie . U Xwgb 0 yd J L 7 . - - 'flee at ff ..., L D RAMQWOWQAQSMTMKTWQKYXWYZKQILT lj Q Tffq-:?1S:2:.:-5:21-ff:.11-:iz 'A ' :':':'Z5j5:w LION M' K' D will-ally ' -ii -.:.L A'f-'4',f,Q,s in - 5 J 4 4.,3fD, ex 4 i 4 ' f 5 Z q XX A ifiezaij' -f .1 1, i v y . 2 'u . .N X1 GE . Q g .fi . H .a z Ji I - , r , ff' X, '- 5 A ',i,ff .f: 1 -Wjmapm-,,-,,l f' ' -44 M, ,A X4 It 'I ii ..r1.'t . ff - W 5' ,, L ...... ,..,...,,... c , IIllmmnmluinnnmuumunnnumluuiu1ui.L.f.n.i-is ,,... .4 MJ-2 .,ff, fu --.--, -. -!... .-iimuu-unmw --------f .w..m1.- .f,- f i- . A - - Si -'-'- til' W! ' it ' 5, T ll T ll E D L P IL ,, . ,a lll iii! llltiggh..- ..:...--. il21333!HXIIiiESIEHSIIIISISIIIIHXIIIllllillliliilifflliiiilillli ' S 5C!ZXl!lI!Z..-- -IUHIISQII ' III!! W willSSBIUIEEIIISIHHEISSIUHHI .:'.' 'B3ZZiHH57 -. Y I - H' 1 - W A ' II i ,A si W: f Wi 1 c fi the opinion that military training consists solely of saluting, drilling and calisthenics. These are but a few of the means to a noble end. The military aim of the system is to supply the iffy regular and reserve army with officers, capable of quick, clear thinking, who shall have sg, x acquired the power of analysis and the faculty of concise, logical expression. 'Zi . I :ji The summer camps, in addition to furnishing most beneficial recreation, serve to bring 5 ll together men from different sections of the country, men different as to ideas, interests and iii? , aims. They are in the most impressionable period of their lives, and their associations at 'ig this time will tend strongly to promote sympathy and to combat any tendency toward sec- tionalisni. This six weeks of travel and the new associations are worth a year at college. FE? :Z wx 5' The estimate of a man in the military system is typically democratic and typically American. There is no consideration of family, of connections, or of estate, he stands naked Ei' before his judges to be rewarded for his individual merit and qualifications. He has learned ,mill that his own are the only feet upon which he can stand. The rivalry for appointment as T-gli cadet officers gives the student a taste of the competition that shall hold the scales of achieve- t, ment when he shall have taken his place in the ranks of the army of world citizenship! ig-gl' The benefits of military training to the physical man need no discussion. Its importance im' :f as mental discipline has been shown. Of more value than either of these is the character -ii 55 trainin Throu h the workin of the s stem nd b th oc' t' d ' l f h' 'T 5 y g. g g y a y e ass 1a ion an exampe o is 'V Li instructors he becomes honorable, up-standing and self-reliant. There are cultivated in him i Q f' A attributes of character that will be equally beneficial to him whether his forte be drawing li or digging ditches. Military tactics and athletics bring to him a regard for the rights of r 'dl' U others, magnanimity for his opponent, and the sense of the importance of team-work and Qui ...- . . . 46 Mil co-operation. He appreciates the observance of rules in everything, he has found that it is with not the winning of the game, but how the game is played! 'ir IH L .4 nit il 3 Is it not significant that the insignia of the Reserve Officers' Training Corps is the hand l of the Statue of Liberty bearing aloft the resplendent Torch of Knowledge? V 3 i p tl A l i . I S if if ra l if le 2 Q V' lp , I ' , T f V Z 5 S. Z Z t f Z ,Z fe 3 E f ,ff ., sxsgisagezftfsffigg sg iQ i Y .i,...... f - llil ln u ' Fi H or V , , 1 L 'Yamini if M Q I it l l vo ,: 'V 'vu I N Ai i u s Y 4: L 1 is ,X 3,313-i,Xf:4lglQY. i' EAA ix' I ldqu I I L. O st' I I F4 .-fa ,x I X if 1925 , I -.fA A.,. A g . H E. D LV I I A A I I 5-.I C-I b PILI :PIL Co I NCEME EEK W E 1... I W fe? In M If . gkffx KX F - iff! K- 1 I: A ' V v v ' , 'f l I, I , Ab I ' . SX 'I I I -3 ---A--.., I n :rr.......-..... ,,,44,,,, -bv---5-Y Wrwu-.N Y-at---.M-0 ' Y Vw-W-A----I V- fr QI x YR W ' A ' x N I' I S 2 I I I IIE N V I I I I Z I Q 5 I if I SI 6 I ' N J -' I S ? I I N 4 I Q f . Q ' ? If I I If - Us I ,Z I N I 5 I N f I I N V' I I S 9 I3 I N I ff' ' S I ,Z - if I I I Q I I I I I V Ng r p I I X I IIEQ f' IR I . If' I I If W IKM , I2 , I I do A I sf I ' I 'nh I I I 4 M Qx' ' I . mv- - , I 'Im' I-Q' Ibwi I I If '5-I IIIII III I I I I ' 9 I 'Uv I I I 'PQ I 1 .,,,,, Illl f 4 I 4 'fm I Im i -N E IE In ul V ' I w I III I N Ir I I X S I I E I I 3 1 J rjn -L ,gx T, 4- ' 17- 'I '1, I-A .-. Y.. WIS.- I . ..: . 3. I III I.. III I I I ,I. II: I,. rf rf A 53 I If I 9 I 5: I , 5 I .1 , E I 5' I Il, I I. ' I TZ I I Ig I I I I5 I If I1 I If 42 Ij I I I5 4 IE I si I If' K2 E :J J QI I X 4 , If 4 I' ' X if ' I5 I 55 N ' 'I I 2 E I III if Q I II ,fs 38 6 ?'f I I f E I Ii? X S I If 5 3 I I N 3:5 If I If I g IZ I f , .' L ' N , ., 1, ' III- ' ' J' I ' .',lEg -fx 1 I Ilifz I- ' - -f , N ' -J - .7 If '- Igfhflli- -Qmxxmww-xmaiN111SMNFfNlfiff-i'1'1'l'1+bQSEI1SI'EI 53, :ii 5.-1I.'f'IQQ-'l----ifa21-,- -4--- I I-,xffdef--f--L1 ff19fe92Qi'g4:f521'5'?j,?' Q I- I I I - I I -1 ' 1-I If fr ' M,-:A 'I ' I' i ' I QI KI I' J I Y K : , A., ' 'T T I Rx , K flff I E- . fy ..., A .., . . , ,,. ,,,,, , gl ijjiillllgiallonlliilwsglIllIIIllIllIllnulllmluuuunnnIllumumasmnuiuunuI-mu Jxl. ui ..-. -In ---..'f, m --1----.-- imnn n411a111aw a -.-nf-f--f n 1-:, -..,4.m--..-w 1- 1 . - ' II, ' Im R E D L P 12,1 ., ,..mam:as:san:mm-:mzu'.r.n::n:::w:::u:::saxzmam-'I IISIIHIIXIImillIIHZUIIISS.:I!Il:IHIllllli252332581Ili!!NIHIIHIGIIIUMISIMJIBZISQIBI 'u:as'..1::xnl:l ff, ,-- f, 'f - 55:1 -- ' W -'75--f--5 ,1 I ' I I I Calendar Of the 1922 Commencement THURSDAY FROINI EAIILX' M THURSDAY AF'PE R NOON . THURSDAY EVENING . . FRIDAY, VERY A.M. . FRIDAY, SLIGHTLY 11.31. . FRIDAY EVENING .... SATURDAY, EXTREMEIIX' A.RI SATURDAY AFTERNOON . SATURDAY SEVENING . SUNDAY MOIINING . . . SUNDAY AFTEIINOON AND MONDAY MORNING . MONDAY AFTERNOON . MONDAY EVENING . . MONDAY AT MIDNIGI'IT . . TUESDAY MORNING AT SEVEN . . . It just simply COllldl'1,t last forever TUESDAY NOON . . . All's well that ends Well- X , f?h,,,.,,,-f Lt? jf' AIO, X , ff. 'fi I Y 1:EV.-.mm TY 3--,Y-.g .. AT-U ff iT1,1i, i iT.gi1i'i'i'l:'TIffl1f,g ,...Y -..ni 'T ', I L 'M ' T M ff' if T , Him-' ,. Q1 'IVR ?I', VII IF? 1?-1:-'gf1,-reef.-m.-ff-l1e4--5-f----f-r- ,--el ur I K QJNN-.Nbr 'O 15---:LI...y',:j! ,f9X '-QQ I I I N s T I I ul I I I Ia I 1 I A EE , 'I ' I 'Z dll? I I sn X-. 4 fx. I Q 5 K . . 1 1 4 1 rr I7- xx :j 9 , H, 62-5 1 .1935 LP V ' f Df-'WQE U . fl 5 , , fQfi, f1f,, r F fE,f1, gV 1 T I-I EI D m ' A A 64.115- 54-,-ig ... L V E: P ILI i U Q x Mm 'x ' 'A ' ' -A---- -'--f .... -.J,- rvrw Q. fm, - ,W im U 1, P V V rv . K- S A ' Fifi Q ' :g T . H 1, . Q w Z g s 1 1 N if , 1 ' Q 5 l 2 N 5 5? K !4 K ng g Q Ig 1 tg E S f fi? 1 N .4 s N f v 1 X. J if N Z - 5 Thirt Th' N C1 A al C sg Z Y- lr nnu ommencement I1 5 7 y 5 4 :- Q Z' 1lnNn.w, .lrxlz IQ. 1922 I-5 t 5 fi 2 A ig, 10:00 AAI. 5 ' - SN 2 5-I 5 Q 2' 12 si 5 rs N. 5 I'nucl:sslnx.u. Q E: 1 1 I I T: 2 I I: L92 Ixvocwrxox . ' 5-I EQ 6 . . Ur. D. l'. Nlvku-:u'ln' 3' ' INIRODDLTORX . ............... . . Nutlmun-I Vznlvm-r Pratt . 2: f ly 'N 9 f.'xdlllifliStl'llliYl' lim-mllivvj F i 4 . . . . , ,. .. 3 F i l EZ Connxnxcnnlsyr .xlllllllubh . ............. llu- Hun. llumms W. Hardwick ' 5' Qi! !, ' Gnvvrllor uf G1-urgigl ' 1, N' A, J K by Q 4 wfjr: E ' wr- - 19:7 .. Egm . an . I '- ' PTI 1 ' EI!!! . . 22:-' 4 : 4 Ammnss T0 bn.xnl',x'1'r:s . . . I . 4-lmm.,.H.,r nurmw 'ws W-1 ' 3 -- '. J , ,sg-E CLOSING Annnl-:ss 'ro Gn,xm',x'rl:s . , , , llnnl N. lg. Hung, 'W 3131 Q 7 Emi, XIALEDICTORY Annnrzss . . ............ . wr! Hnmnmml Siuhm If! I 'l'lu- 'l'c'c'lll1i1':uI S mirif' 'V' 87' W I I 1m 1 . V ,, '.x W HN IXXVAIRDING or Pluzrzs . ................... . . xvillis ,L Snlhvn Gigi' . V Q Supa-rintc-mls-nl of .Xtlzmln Svlmolw 3 I E 2 is 5 Till' IVIIHPI' l'. .'lH,l'f'II'.N' f,f'llfUl'il'lll Jllflfll :A 1 TIM Srullixll lfilr l':.N'.'Hl'll .Wlulul X J Sr'lmlnr.wl:ip flulfl 7 .v nQf',l0lIlI'.?hiIP Ifnlrl llvf'-ll CON!-'ICIIIIIXG or lhzmuznzs, ClIllTIl'll'.XTlZS ,xxn Cmunssmxs IN Tm: RIZSIIIIYF Urrunns' 'l'nuwxma , Cours ...... ........... . . . . . Dr. Kr-nnr-th G-mlfun Blntlu-sfm 7. 5 . 1 1 2 V E9 f 9 sg 1 4 :wi 1 ,f T rl? I 2 A 51 5 - ff Q I ti r 5 1 i ff If 1' ! Af: I :ff X RQ rf! 9 ii- ? 1 Q ,Q S' Cx 1 ,j' 'bfi-fi' v -A 5 I L ,1 X,j,f',.--V-'QP A 'egg' 5. ' , ,TJ -ffX'- 3553 75 '- ' r , ,W !3X -, 'It I R. Q. . X3 V.A,j'::'EY'i i'Vf'Vi Y:i i1I.':T LT.igi'i klg.J?,::?1L i 4:1TX wxxxxxxxmvumxrb:iam-R11QE.:S3'5-555-NH--- w'f'5 1E55fi'fESlei'35:Q9,l-5fy ff-T2 if-r ., .... ,,g,L,..l..Z,i.g,.'g.. .... .1iQ:i.Q:.V .... . -L-IQ -'- , LIONEL K' , ' ' -' X h V W - . K'-' 1' 'iwl'-' 7 if?- ' ' 'kr' Y --' ufiiifxl '-'?.'fs-is-F:: lf f' f g xv . N , , . ,, X' C- -. 4 if f V 'NN f fl! 0 , a .. .. '-Lf:f..s' - ' I .-.5 I A ' ,, ..,,,a:.,:...i:..:.i........., .. , ii l illlnv ii: u .NNIIHIIIllIllllllIIlllllllllliilllllllllili'iflllllllllllllll -- --f.- -:L .,.. ,.,,.. . i .. . .,, .,, , . X ' me ' .2 ie am... THE DLVE PILI x , I P f J 1' Y 1 ' a-10. ' . 'Q ,4 ' J 'Q 'A :Aw N . n 4 I .M . f , X 7 ANR 'I I I ' In ' J' Q- v vv 1 rn 1 111 :Hull tnvvl If . . uiiim. 1 U- 1 H. 1 m, I i i an u 1 . in ,mu mn. im. y . 1 ,mme mum ---m--umm.. ,fr .1 I I 1' I 1 W, is , M ,lil ... . . ' 3 i FE. a . .. .... .. . .. .......................,w,,.,3,..-...,,..,mu,.,,..,,n:...u,.,,,...... ,m:,:,..:..::z,.,3g,:3'.m3- .-. 55 IH! Illliiiisliiii. .... ...a....... ..::zmmzaasilis:num:1::ml:::l:::::::::lll:::aa:::::l:::::::::i::: :zzliHH:::::::::::ul:::ll::S1lIlllilsl::::::1ml:.S..lHl-..ill..I.i.,2...--....-............. -,-.. m .. .N - ...JS 0 I l V I' K' 4 ii i - ' i f :Ia 'f l :Ll i 5 :Eli K it nior Prom U I xii i, : Y . . An important event in the life of the Junior, an sz- ' 3 ' , . vt :g kg l 1 occasion never to be forgotten, was the Junior Prom y e ' X Q . E of 1922, held on Thursday evening of Commence- 1 'il' - f : 1552. . . . J 5.5155 ment week. It was the Junior party, ushering in 1 ' ' ' 532, Q 5.:fiZ j?, , , . . . -iff -'2 iff-gy I, V. as it did the commencement season of festivity, it 1 '. ggkzg' lf Eff f' , ' S r . . f-c' E 3 F,-.. n must needs be the equal of anything to follow. The gs .Z I 1: ' 131 . A , . fy? 13, . :I , opening event must set the pads. The season of gi Q' iii-I , . ' 5 l , .f ' JL . 1 .7 353 i.','i i' 7 3 ,5255 class dances and Pan-Hellenic was to be one of un- : if V if-2 if fly' i i -wait . . . f I-: Q91 -5 ' ' Efggiilizi - precedented gaiety, so no pains were spared to make 1 ' ' a - h 1 iif 1'-ha f ll f ' ., fi gy , pf .i if.'....s.. thc first dance t e stanc arc is wnc iey a were '74 . 33 rn- ' Y PQ' 'ud Cd. 3' 'Ox ,v,,..,ff -- , , pe, J S ,f ., . .. , , M 1, ,V 15-. M., ., ffl'- ,,f..i 'ii. ' 4 Brookhaven Country Club, the scene of so many f V f , 4, ,is . . . gg 1, of the most delightful affairs of the preceding year, ll f 'MQ iff Skill was chosen as the most appropriate setting for the ML 1' dances composing the finale of the social season. T A 2 ii Brilliantlv lighted, and filled to capacity with happy, U .n4,f':'f'wfi:,1 , xxx,-,'f? . ' . iii -., ' dancing couples, it presented a festal scene unap- '1 I v . .I ff.: Q, hr, gv V V 1 J I. 4 is illl i .N 634' gli va-'ii -'Q 1 rllll , limb l lfl , 'fl ll la l 2 f f 5? .I 2 3 ? 5 4 6 6 ,S n ii7Q .'1f'f1Q ' 5 1 V+. an j,g., g155f,13,.y proached for many moons. :ff . ' up . r 'i 'ff As the evening progressed and the merry-making 1 4-5--2 '11 4' L MLM... .,, ' ' ' reached its height, the moments sped by all too quickly for the happy dancers. VVhether one was dancing or strolling by the lake in the light of a resplendent moon, the hands of the clock seemed to have wings. The night was one of those rare concoctions of ,nature in which the hand of Providence has seemingly inter- woven that most beautiful and soothing to make one shed his cloak of care and face the gentle breeze with a soft, exultant joy in stimulating life, the niere living of it. And when such a scene becomes but the background for one of fairer sex bespeaking all of that finesse of the Creator's hand in every gracefulymove and gracious speech delicately portraying her cast into a finer mold, the inspiring influence felt since time immemorial, is it any wonder that the tangible things escape us but the memory remains forever? The rich perfume of the balmy spring air was like wine, and the moonlight danced in every tiny ripple across the placid lake. The music was the best possible, for never -had Garber's syncopators played with such entrancing strains. The whole universe was in a happy mood, nor was merri- ment lacking on the part of anyone present. But the hour of three came all too soon. The musicians indicated quite plainly that they had completed their work and that the gay affair must come to an end. Encores and entreaties were to no availg and a quick feeling of remorse that a rare flower of life was slipping into the garden of memories heralded the end of the dance. The only consolation lay in the fact that the other three dances were yet to come - ..- .-YC! A93 ff V - ill l l 45 lit' 5 l l f F , h t l . . rox All my , IIE ' . s bb .g. o il N .. .. - ...... ..... T . .fi . .::i.ll, Xa, a-.!!im,, e- i e ., -. l '- - ' l' YYY Y W ' if -, , W XXmS.QKmXKW-wt.-Y ,A AL f-7 N'-' T 4'1 'M 'W 'N ' .1 m ir ' - -- --'V' f Y feef ---f-f V - -' H 4 f . . fr U - as . Lionel, K. ' 'lim O 'QS Wi , .liiifi 4' 0 UVJ i vlQ 'J N D - 'Z' 's N I sq A oboj2,v ' gn' I XX V is A Q.. - . 5 of is Q X ., 8 'Y' E g ' If x 'WGN V o II 0, I F ' G X K ll QNX 5 Q . ' t' Xp P .ALA IAi.:4 ,:5 ., fy E U fa ii T889 J 'X 4 3 l il l 'm 7 QS 1 '? 5 i 2 2 5 E ii 21-2. - Z1 . . unc-Zixggfx M AA'A 'A A' ' 'j' ' 1-- ' -4f-- 'f ,. ,-fu- ---an --.L-4- ,A n i llll .. L i ,1 ,, E2 , , 7.45.4 I .1 , x i 7 FRE fag X ' . , ,rf-4. xx' 3. 1 -. klssi-t 1 V , - - -4 ', 'V' ' 5ii555:::Eiifi5EEi :.-- . Hman: . , , 1 X QA' 0 Y ' -'- 1 ' l, S' '. YT ' --Y. I, l' , N l N ' I l ' 'NE f u 1 T. fl x ' 1- ' S A Nl N 'N- X l l X ll S l S l l i S N . l Q l 3 5 l 5 l 5 l l lx l Z l gg f ll ,I if xl Z l,v'l P? Pf- S f X f 1 ll ., N Z ' ff 'XX f ,- lg S 9 l -2 -A Q 4 l l N f 154 ,. , .1 r,-Q ' ., nl-'I I' ,, - -ff ll. if f 5 is J 'qi ' ' f ,t .,.' 'Q . - s E Z if W: X' d 1 Q . . 5 ' .fi 211' QQ . .2 lx 5 . 5 H ll V' ,. 4 A 1 I: - I 'lie , :q l 1 1 -V f '1 . , in ' y .i-f . , '. f 9 Q ,A ? 5: ' . '. . 9 x illll5lJlllKllllQ vlllllli-lllx ull lh.ll l-right glnll llll'lll1'Till'l1' l . 4 'N'4'IlNl'lll ll! lhl- 14llIl!lll'lIl'1'llll'lll ul-4-L uf 12122. lim l Senior Hop , l 'l --Ll 3A . m , . ll .: l l'.lllllllNlIlNlll. Alfly Illlll Lfllllllll'NN, uilh l5l'fll.l!lx gg lllg - n l lllllvll llf e-:ullu-Qs in ilu- lu-.lrtx -lf flu- Si-nillrx, Ullsl l h:ul .ind l'1llIll1il'l1'll ilu- lllllg, hzlrll ffnlr-51-.lr xtrllgglq- 1 for ilu' vllwll-fl lliplllln.l. in-rv pr-llmllly Hu- lll-'Ni llil Io,, 1,, , , ll' . .. 1,1 li, Ql:l , S1-nillr llllllf' .- l I I-I ll llrllllklmslwll fllllllllff fqlllll um tl- lu- ilu' :.ll'lll-ll ' l l l. l xplll llf llu- xx-urls! nn that nu-nl-lr.-lllIl- night ill .lun--, l l l 1 ' I ' ': N 3 l . g ull' lu' N 34-H Q A 1 l- - ilu- llrc'lll-xllwl iIIllll'.lY'1'li Jlllll llu- .lrvlll-Nlltl, nl-ll, ll ' l l. - l- , 1 Il l ill 1 '- : N ww' Ill'4l -xx l : l'l . ' A 5 NlI'llILI lllNll'llllIl'lllN lllifllix nfl llll'llll'l' 1 'llllIll'lll. A-, lkfd tl ' lXlTXlllll ul 'Ill lllllll Ilrllllllllx ll IH l I l ul I . -- x Q l ax 'R IF up 1, f. was lllllll' llllu-r lh:ln lh-l-.v inilnll.lllll- I-l'-ullll.-lw --f - 1 Ill 1-lrlur lllXl ul ul ullh nllll llul I 'l' . A- ..l. W H - ' x x5Q: .xl-.. 5 L 4 53 1 1 l ll l l l ll l ? ' ll l Fl- P 4 lllllf 5 . 7 l 4 llll I l l has lu-vn fill-gotta-ll. if is Rcvclry Jlllll llN'l'l'lllll'lIl we-rv :ll hzllulz 'lllj l'1'lglIl'4l Nlllll'4'llll' in ihix I'l4'JI'-lll'I' l.llul H1 ill-- 5 is cl bl S 'P if . cverytlmlg sc-4-nu-ll In 4-xl N Q life. Ilours pllssx-ll lilu- sl-vllllcls. :nul llu- wllrlll xl-1-llu-ll lll lu' ,itll-llllllilug 1-l fl-null :lll ilu- bw. 5 . . 52 beam. 9 ll 6 . L S is l il. 2 I 5 5 l 4 . 4 S an S Q gl 'iii f ' 'lilll' I'Xl'lllll1f lx IN lllu- llii lhllxl- gl- ri lllx 'Ilrs :hd .- '4 . ' ,K x'4 I 1 5 ix 'N ' F 'Q l'llIl lu-xl-r lu- fHl'1jl'lll'll, ilu- lllllllll Ill ll- lwpll-lulllll 'ppl L 4Pg',,!Rg2igg1?Q : , . llI'illIlf'. llll'l llx rl'll4'1'lillll ill llu- lll'lIlllN 1-1 lhl 1l'Il'h fn- Vqrgfz A -Q X- 1. X - 1-rs new ulllll-ll lllmll hy llu- gl-nllv ll'lllIflN lllllll ll 'efrcc yonlh Ctllllll lull lu- llc-nil-ll: mu- lhlli h:ul lll'l'll :llllu-ipllh-ll with qillj. Jlllil ll--xx llllll ' mtl lll'lIll1lllj' ll'JlHSlDll't'fl. :lll lllUlIiIlIlN elf XX'lll'i1llf lhingx paul-ll :nhl 4'llllXl ll, ll-,nillg --nlg ' CXlllJl'l'ill1lly l'Xl'll2llIj1lllj1' gl'1'l'lillgs wilh illll' :lnllllu-r. Xl llnl- ll'l'l'lf'lx ll.llu'ing nqlx l'l'illllIl'4l, i , P- with thc spirils nf llum' lll'l'N1'lll Nl'1'lllllljj lvl rl-:u'h ilu- lllulll-Nl ll llll vu-rx llllllIll4', lllllll , , ull' llu' nl:uI lm' nf hung. lllll lll:Ill fnn um ll-IXIIIQ ilu- llllli' --1 lll- l 'll the SHIPS winkvll llINll'lHl nf lwillkling. Jlllll ilu- lllllflll lilll1lN'll ind:-:ul nf ilu- llll'I'l' --ll-1-flnslry if like all things. must l'Y1'I1lll2lllf' yin-Ill tn tlu- 1-ull nf l'.1lllN'T' li-llIll'. 'llln' l sl'llIllgj url- llmuillg g., to il closc. 'flu' cl:llu'vrs. SK'ClI1lHLI lo rcnlizl- lllix. put :lll flu-lr lu-ll lnlll vw-rl llqlluw- unlll ilu: r-2 hour of two was rc:u'lu'll lly ilu' sh-:uly lI7llHlN nf ilu- cllu-L. .Xgllin :nul Jlgillll ilu- 1'TVllf'LlI'fl ,, - was cIu'm'cd. lllll of no ilYilll. 'l'lu- 4-lul was :ll hlnul. 'I'lu- llllllllll :lull ilu- kllllllilllfj fllf-fi :lk . , l those present :lt this IOIIQ'-l'l'llll'lIllll'Fl'fl hop I1!lN5f'fl 'ln flu-ir Nl'l'-lffllf' W-'ly-. fllrpflflll 'lf Ulf . -YQ. .', , ul. F1325 l ll E iz. llu- Nlll'lIlllH'Tf Jlllll Xilbllllx. ll u.lN :ln lwllllllg Nllrll l-.-, -9'-nl L , '91 -Q - IH . + ,, dw: l g . l l l' n ,3'15A-- - . Qi.. M l - X 'N 5,-,,'g-3.-1: 9 1:5-.h NYJlll'l'N. wlu-rv llu- fnnl! 1r:lggl':lln-l- --1 llu- lu-.ll' Ill-uh II ,l, V- Q.-W lui? lull 1lIllv l JI 1tl I 7 4 that 0Xllll1ll'Jllll joy lo llIll5l' lll'1'Sl'l1l lh:ll is llllly plluillll- 1-l l-llrvlrl-v flllllll XXlll'll lhlll l'5ll ' hi'-F, ll l lf if .J liffhl. At llll1'l'llllSSlllI1 lulplly VUIIIDIUN Nlrlllh-ll :ll-lng llu- Illlll-llllil-X Jllltl llll 'llQ,fll ilu- Qfflllllllk. 1 , l , 1 1 , . , . , , , I 1 . . V . . 4 3 . . - . 1 li lov that il' lulhls llllll :l fm-w hllllfl IIUIITN, lllillxillgj l'X1'l'flllll' Nil l--llllngl--lllkli lmlllll thu! fu-n ,lg Pl 13lltUlll'S-INXS cannot l'1'lIlJllH lINl1'lll1ll1'lf'. lhl- vlltlulllllxlu- lIH'TTlllIl'lll ,uul '11-5 nf gl-nlh. , 7 l . . . l 1 . xr, W l X75 ,VJ .. ,iii -H51 'f . Il l l but L'-CI' l'l't1lll1lllg ilu- lIN'lIIUl'y uf this. tlu- nm-1 hrillillnl uf :ill Sl-llinr ll-qw ,ffl I I , I-fl ,yi lil l gf, V . ,7- 57. Vi' l ll - - -, . ill ' 'X -. f L .rf , , ' - .5-'.,,:', W- 'll 'lx 4 L 0 5 LIONEL - gf X ja.. 5 llgj ' . .i ii .i xv- .f i. i i 'RE-'..Q5 ii , . ,,,., i i I -- ' 9' 4x gxxx'- QWb1'-NNXY-N-IBBSY3'Ni3V-'55513255-bib?-'l'l':'-'-fiiffigfuv,11Ek .EQ if .4-gg-9:14-ss..-i.-Q.f,?9ig3gg g:,l:5.5l , L4 ' , ,I .Pl XI' - - - 'IN' . f 4 n K f- , Nl. . 5,,v-::,,.1P : xx,-tl, Y 1' ' wg. vi- -7iL.-.. Z!! X,-L-,X .- yr- ,f ' x.'f:1-f--' -.5 ii -45,52 ff' l l il 'll ,, l, , , l ,,,, ,,,K i ly ,, ,H , , fi ll, , i I l , , ' I ,3 - ..,+ , , ,il ,N 1 , ,Qld ww, ,lm 3, , ul' ,iw er, , , ,l , , L, li' pu , l 1 al i 1 P it ly, i Q . ,, 41 . , k , 1 1, Q, I 4 Q, l 1, i 5 x 2 f 4 4 w 2 , 'I' N Q , shadows. The sophomores, drinking in the realization that this collection of Southern pulchritude, unsurpassable in color and vivacity, was paying homage to the class of nineteen twenty-four, because thc most prominent among the dancers. Seemingly tireless, they were the feature of an eventful evening. Too soon the company realized the coming of the Sabbath i , . n lv V - , - . - il X E- S I vw ' e be .c 9 fi :- -Ei, ERIE gmrvllml lllllllillll ' lllllllllll IliIllIllIlllulllnmllllliillIlnmltmuimsu u'1es--in'enm-'4--1-1fuuluhiauluaumm-1114 Iuvmmnn 4-v.-,mn : W It :: ' Q' liff' -I g '14, 2, A jr Q V N E:.......m..,.,...asmuamnznmumnrmmm:uilassslnasaamlalnxannsmlme::x::xxmus1lu:::n:amnn::mll:::::susamuszullmsnsmaasxslnlazmslu 3, ':.. 1, :f FH' , f 3 'f '- ff Y'f, ff 5 ' ' ' V' 'i at , Q i 'li' A 0 Zi 1. YIQI A ,g, :E 6 i if h S A ' lf ' op OIHOTC IT1CI'1C8.1'1 Hgil 32' , '1' , l It was one of those nights when the full summer I 5: 1, moon, casting its silvery glance through the fresh 1:23 '. V Y- f X .ZQQIIIQ1 . . x 5 Ap,'i M ff, i. A rlssl f foliage and forming mystic shadows beneath the ,Iii '..Qfift14 -r . f . . V V lie ,lgf swaying branches, forces into equally somber shadow, will 522 2? glxlhllf iii , . . . . T ' ig ',iif,,5fi!Q1if5 the rarity of the June day, brushing aside with lts ,i . 5 a 1.3-52 iii., 5fl?Y? ' 4 . .41 gf it ,, gentle breezes, all thought of the glaring sun. After iii gg - aft or if , . . . . , f . ,il y an d 721 S two such nights, during which the compelling strains ii , A I' 'V if if Q. n . I' ! :gi of the saxophone and the clarinet, the laughter and iq, 5212 ,. 7 W flt fi 1 ' ' ','. - ri? ' . . il ' ' .0 25 . '.3g:',aYi1g95g- song transcribed two periods of ecstacy, small won- my E 1., V: ff, I.-.w,,f,.-MV' , n . T I .,, .Q f .wa r ff 5 Wiki- K 1 der that the idea of a third should be more a eal- ' R' rr, -ff: 1- '-- ,f- ,V ll 1 I 'Q if-,. .. -, ' ff f -,N f, Lf ',, ' , . . ,' 1 .2 ,-lf' ii, 3 ing than the hurried uncertainty of the customary T 1: 1,1-'v a , ,.g nf , ,A , .' t' iiifi 1 , , , ,, . , i,f',.ffg.,Lg'f .5 tea dance. Thus it is the Sophomore American of gggil P - t,.t ,, ' s gp . ,av , . 1 , -j f M 1922- was held on one of the most beautiful June 5, gilt i ttl if,-1. nights IH the history ot this land of moonlight. yi gl 'V - fffceff , , K -A VVhen the crowd joyful in the anticipation of 5 4 ,, ,,,'f ??9 the evening, crowded up the steps at barber s Hall, - I- ...h...:: fi11lw.'f f, ,Yi . , . . . . , 'girl Jan Garber and his wonderful musicians had started H, i I .A ' vfif' 5,9 . ' L - va-11' ' , L , , ' E H the opening number ot a program so filled with Jazz 1' Q ...ze J'- ' 1 5 i . T ,tire l ,F if -1'-Wma that it left no doubt as to the orchestral supremacy u-XJ ' ' Y . . . . . 'Q fine, w ot the South. Because of the alarming proximity I 4lllb . I . , i . I T43 of Sunday morning the dancing began earlier than those ot the preceding evenings. As the av g . p excitement increased, the more seriously inclined couples found benches, secluded in the lf , ll I ' , Y. ,I ' as i! was upon them. In the midst of the revelry the striking of twelve brought a realization of . . , l the ,day of rest. In spite of a flurry of protest, the orchestra refused to continue, and the throng slowly and wearily broke up into groups and began the journey homeward. After , the third successive night of the reign of King Jazz, who, though ruling in a state of revelry, 'l l ', is exacting in his toll of energy, everyone welcomed a chance to rest up for the even more I ' strenuous affair, the climax of the social year, the Pan-Hellenic. ii I ss N 5 Thus the first Sophomore American ever held at night was a decided success and will K o u u n 'N live for a long time in the memories of those who were fortunate to attend. The IHOOH, 2 sinking lower in its zenith, but having lost none of its splendor, smiled down on the fruits ig 2,5 of her handiwork and gradually dropped behind a distant fringe ot pines with a final gleam Z of satisfaction, marking the passage of a night that had established itself in the hearts of -4 2 Tech men and those inimitable Southern girls. N2 6 S 4 Z 7 - Z ' S 3 ,c s .f -flfvvcif-X , F fxry-awk, R, ,J N ,QI Q4 O , K v i , c .. ...,. g G1--fi' , sg--. mum A as-s a s Lge X -- ,, ,- ' 'Y Y , 1, K , ,TILT ,itil .. x , --5 ' i- r, -- .f ' , '- l . N U,---11, . -Af: ' money. K. N V QIQQ-,xg xb YI-4 i!iuiyijJ?i?AOfT 'U V Xt- ., f5fqfR.f:Q-f15Qff,f -1 E1 'WJ ,GY up ,UQ ff! If-A G A : , sfgxx X'-PL' gf, 1 ,71 .f,-,1:Ji,N, 17-1:24 XL fx xxx D 3,i,,gri1g5gQrswf1a1a.'f -1 11 .fii . ,1.AA H ' .Qi ,i fiifxkft-.L-jiri i ii v ,K-Q, -4- :rags 4-, b W ' C-'5'XgQ -'. N 1 :xg hum W , ,,cyi!fz.X 2: - , , I L N L 1. 1 T Il E: 15 L E: p PJ 1 ' ull A. . A Y' - .A +....., ,,,...,.,,., A.,4 , , ,, ,YYw,,-A.,- an -4-N--Aki --Ahwn ,i'--v- vvii- -llviii - v W V'.' hh Vi A00-wi-N-Y . 1 A , 1 - 1 1. 5 1 Ju P' ,A 'i J' P4 The Pan Heiieruc 'infra 151711 ff ,gg G? i'- x tx xx A ,9 S 9' 1 fl 4 xa in i 6 I0 Ya Q 'pl Q04 ,fb ii' -A W , Wi -Nw X11 NU IX ll l x UIX 1 unnn lhnn 1 u I 0NillllIl s s mms I 1 ll in r u X I 1' s sl1 1 X N 1 111 Y LU 11 1 ' 'V' ll1 vsslhla llil V 'X' Nilllli U1 1 f nllx 1 mnl Y ' ' ' 1 1 win' N ' ? fx CL1.,i,!v' K f x wwS:ss'xW'x2N X X TX X J XJ 4-. lv' Li. ABL ix X! 1131 S 6 . 15 if ii my If I 1 1 1 S if . is N1 f ET ,4 ' 11 N 7 rv X . 5 Y: QQ! f it N f . S Z .. h 15 E f ' - 1 h 'I N 6 NJ 1 'r ' 7 A - 1 E: E Q fa l 6 11 f 'A ,4 85:11 ' Qi i1ia ' 2. X 1 K - i . '- N f 1 ,-P1 . . .x . 1 Q .1 1. iix ' f ' ' ' 'S A 1 1 '. pg Z XY Q M A1 A A my 1 ' ' x :, ' ,ft 1 , l I 1' .3 'L g I' -rl 1g'7A'i n fi 7,17 9 ,:. in ' 1l g 51 fb .ki . -Yr .- LF I., ll TJ 75 -A-lfll: 'J fy L . I N WN' ,' 51 - 0 '- rx' ' A ' ' Q 'ix f' 1 1 V 4 1 1' -I ' ky ' 7 ix, i, K. :Il-K 1 119 , .,v Af ' ' : 6 IX-X 1 L ' 'W 194' ' 1 5' , I' Nha Z A-'r-1,1 -Q 4 by- w. Q 21 1 1 1 5 1 12 . Q .1 1 1.1 1 . 1 1' uf 1 'Q 1: Q-ff' 1 -fir , .', ' .1-, ' .- 1- , A f n . X 1 1 1 f ' N, 1. ' X '- ' -:ff - r 1 1' 1 f I '1 ' '4 . - w v NQ Q X117 Y , I- , ,f IAVLX nf, .- 1 A 4 1, ' - 1 .41 1 H' . . - yr .-ww ik If . ax iff, - gy YI? - 3. ' , 5 . .1 ' lil, fi 9 1 . 1' 'fe ,1 'LM' .t-,'i1 .3 it 4 - ' 3 , ' 1' ' , A 1' 1 37 i V Q ' . ' 1 1 yi' f-4-1 i A I' f' Q ' M 'i ' I 1 wi iibw 1:4 Q ' ' . fg f if 'A ' i 1 Egg ,, Ti- ' jc ' J g H- f, 4 ff' .5 kg. N ' 1 ' Eg mm ff. 1 v. 1gg ?1w,'1 ' g if 1, ff 1 pm- ' 1 .nm , y 1,1 ,y it I -.xii : L - A. v 5-4, ', , 41,3 1 .1111 '1. 11? ' 333572 ' W,-11: , '.' .NN 1,1 . t I 11-11 ' 2. ' '. R ..,' '31 1 L ' 21 , 5 ' v A Q N11 iuluiiin Q11 IW X '- . I ' i ,ML1 i ' 1 -111115 , . . , , , ff' 2 , 1 .mb fNl Ill iill' ill.l rj' ul Hn' X1'li1v11l lux .1 4'f'llllIIllV lllIIIi 11 1 1111 1111!-11 in 11111 1 11i,1,1 111 ,fy 5 gxlo asinnin1-I1-1'n-tw1-my-t11- 111 H11- l':1n'll1Il11111 N11 -111-1.1111 l11ll I 111 111,-'11 1.l11111f --1 .1 'I-I II: ni Cl02ll', hill ' si'y. lin' 5iiYt'l' sluiw Villlll' uni, :lllti H1111 llllll I1 D11 r.1I1h1i l..-1 1g'1 N11-11-1 1111 111 1112 111 ,,',1 1. 11' 1 , , I Xt ig ll! 'ix gl 'II11-lmppythrvng.tr1111I1I1-lI11'11111111-111.-111111i,i1.4.111 g.11I1.11114 17 1111 101111-., 11.1131 1I1. 111' S dvi ' : ' inl1:nv1- UlI'lliyili 111' 1-:1r1- 1111- 1-1111151111 11! .1111l 51-1-1121111 51111-1 .11fii1g1i111'111 111 lg an long, Kil'l'1II'f', iil'l'5Ullll' sun llll1'I'. 12 5, C .' 'Ji In filili iwx 1' nf iH'JllIii4'N I'l'llI'l'v'IliilIQ 11- rx -5.151 11 --111 111111-11 H1111 11.1 YI 1 1' Yi . . ' , . ' . . , 1 I C051 'singing Irwin th1- m1-1-I1 IIHI1- I'111-111111 1111111 13111111 111 5119-1. .11111 11-1111121111211 111111 113 p:n'I1n'nmi1lt11ll111hl:1s11l111lhingl11-111115. XIIIUIILI H11- 111.1 111l:111 1l1111111t 111111 1- .1 .111I11!.111: 5 frm zu slrcvl gninin to an limi' Ml i 111 .1111l 11-11111 .111 X1111 V1 1-1 ii1li'l' -1 - W1 N1111111i I V' night spvd nn nniil 11111111-1' Yi X :nn 1111111115 111111 11:1 gr:1111i 1-11131 114111 -11 11 21311 1 .11 151- hi H' X of sn: 'n: n1'1'. 'l'h1' lllllxit' vu 1-1-1111111111 111 1-111-11111-11 .1111l l11l1i 11111 111 .15 111103 111. 77 1 f-114 ' 51 I ii? slr 'uk of dawn JIl3l1l'JIl'l'4i 1n'1-1' lhv hillx. 111111 111.1i1i11g 17 1 11 .13 .1 111 . 11.1 1:11 1, ..'11 111 fi 1! 1 5 if dan rs in lhvir mml vhirl 111'pl1':1Nnr1x X Xhwrf 111111-1111111 11 . . 112111 1111 -.1111i1-.-11.1 .11111 , 1 1 R'-1. 'l'h -n HN- fun hpggqn glx HN' Tilt 01, Vninf' N' .lilliill TTWIHI i-if ,ji'v7i ii- 'lil '-viiiifli 51' vxc' ' ihc lliI'l'Jllij' jnlvilnnt 1-r1m'1l 111 il 1'1'1'1wy. S' 'H'Ul1'1 111.1111-.1l .11 4111 1 'i 'i-471' -. -'1i'!1. N i if IN '. iilll'ii1k'l' ind ' 'mi I11'h inhw ihv 1' 1 Wi. VW' VF ' N' ' 'i VH' 'E E' Us fi 'I' 'ii' ii' 1 1 nnl: ' ' 'l'f'Olll'1'i1N1' on tilt' 1l:1n1 1 nr. f 1 fi N . . - . . . 1 . .. . 'E i 1i Fil: nfl '1' nm' hui iillI'I'f'. ih1'ln'1-11 lbI'4'i1l NiT':l 11111111 4i -11.11 .11 1.v.1n1- ii 'll'. N-'1'f' i ll 'N. :incl lin' W1':ll'f' il 1' VHP' sul li4NYIl 111 hr -1 kind -rx fi' -H113 i i!N VW ' i'if if' 'i 'i . 'Qi th' 1 uf. g1ii'ili1'1n11.-i XV0lNil'I'iilll night tl il 11111111-111' 111-11111 111 5211 g.11'1: '1 ' Tl 1:11111 1 L. i i xi ' 4 Pb ' 1 11 is 1 E1 Q4 V 1 I 1 Q-: f ,- 15 1. , , , 1-W1 5? Q' .4-:Z-I qi Q9 .ffwfvm-E- f m-Hf1 111111, .9 li ',Ag nff:i15.3qf, : Q1 i ' , - . A jiggf 1151,-gif' i,-v.-...f i1-L..--. , .',QQlQ.,-,QgLLl.f7,7, ' f i Y w 1 . L.:-:1 5,3 1, rc' : 1- --413-:-., .. ..,.. ,... .. ...... M, ..... -1.--1-1112 ig, ' L 25' ml 21' A if 'T ' ' ' f ffl .1 fs 'T T' ., K 1 Q1+- W '- 'A s'w'F'f-AQ? N L 1.Q 11 wi? if ij Q i Eff ' ' 'A 1 R 1 L -Q i A 1 ' 1 W1 X, uf' ,411 . , 4, 5 , . J f1 , 11 WM 1 1 -1, 1 - 11. ' 1' 1,-111-1 11111111 1 1 f 1 1 1 ,1 f 1,1 14.11 ,, , 11 f. ,111 4111 111 1 1 ff F1 1 1 V yu F., 1:x'1u,Xk? .. A ink YV-44 ,141 ,, 1:17 VX!! U W V, WLVV 1,1 K 41.-5 fl p .1H..,-.. ,, , , Y U 4 1, , X 1 I ., j,ff1c1-rj 1,15 7.1 ,QA fn ,, ,' , ,ff , , - gg I 1 1f1L11111l1k11311Ql1!j111111111111111Qg1.1LL1111I1m11'1111'11j1151'1,1,1311,11111111111lu11111,111113,fmj1mmL,,,ULbfi?MTM E . , pf , nf' -272' f j' 1 1 1111' 4'1 fxL l?11 f 1 2 ', ' 1' ' I ! 0 1 U ' ' 1- 1 ' i,'1'ff'Qg., V: IK' ' , '1' 1 1 A, N 4 I I ,, 11111 11 111 111 111 1 1 V - 1 1 111w 11 1111 1 1 1- 1 1 1 1 1- 1 JL11l.'1i7,11311 11115,151 11-5 Af '- ITT' --3- ' - A ' . 1 FQDX11 I' ll ' 1' W JJLWLLW' D111-L fED7:JM'3-T'539311WV5E1fLWK1IK1'1i'EETW1F'fVPf1 1'Fvf1111i1g1j 1'f1'f1 if-fr11 f'11'rfr,1 1 1, 5 ',,, Hifi 1. ,, .,.ig,, ,mg -1- -11 1 1 -1 'A -N W ' ' ' ' -1 1' --'- '-J' 1,g,, 1 1 'f '? r 2'f7 f ' -1:41-M Q' ff . 117143113 ' '-'mf f ---of .-.- , Q- ' 1 ff. 1 ff V X1 , 1. 1, .. ,. 1, .1 1 ff' 14 Elm 511 1 IPX 1 Q Sf Y 1!! 1 Ps- 1 4 1,1 1 lg I A ' ' ' ' 11 ' Q7 1 gg l 1 1, , -41 I 1 1 LZ 1 1 'ba 1 1 ' 54 '45 1- 11-1 5 W 2,1 1l 1 1, ,f1 1 V 1 1 1 ,4- 1 ,ln 1.4 1 1 f ' 1? 1 . f ff' 1 1 , 0. . 1 22: 1 ' 51' V1 151 1 gg L 1 1,3 ' 1 1 1? 1 I ,, ,1 1 .1 4, 1 15 1 ' Af. ' 1 1 31? ' 1 1 Q' 92 1 1 gif I I 1521i ' f 1 1 1.1 1 1 11 1 1 1 ,112 J1 33111 11 1 ' 1 . .1 3 Q Q 1111 ., 1 1 4:-N AQ 1321 1 11 1 11 11 1 1 H 1 'A 1 151 1 1 ? Q 7 2-1 'f Q7 Z W Q Z 7 Z 1 Z f 3 Z f 7 f 1 1111111'l , Q-9 X ,,,, fx .N 1 ,J QBY 1 H 1 E 'Q ,li A ' :Q 1 N 'N 1 1 :APM -1 gig 'f A1 NNE 5 Hulk 1. 11:-1,1 4111 J LX I N. ' 5.-. 1 'ff 1 'q 1 11 I 1 1 x 1 1 1 if 11 '11 , , xv x- , 1 3. 1 R 1 1 11 11 1 1 11 11: 1 ' 1 1 4,1 . E1 V111 1 R. 1 1 1- 1 f:3.11 1' ,1 N 1 if 1 3 K-1' 11 1:11 X 1 S5111 1 ml R311-' 1 111 115311 L-.E 5 xv 11 Sv - 11 51 R x., 1 111 11 1. . W I! 11 , , 1 Z 14 1 1 1 1f ag 21 ,1 1 1 f .1 1, ,. , 11 W' 1 1 g A fl '71 .21 1 1 g ,y -, 11 . , 1, FQ I1 11 11 2 Iwhgl ff V151 11 1 Aw ,I 1 11' i 111915111 313 1:1 1 1 .IM V I, 05.1.11 .W ,NX .X NM S 1 1 1 1 11 11 1111 1 ,, 11'11r'.1' '1 -X11?..'1 41 1 11 1 1 1M1W 1Oii5 W , f 1.... 1 1111111 11 1 1D l1.3.11U1,m,M5 X QQ 6 I p1Q11ff, ' Y f 11 A IQESUI11 X-V,11y, V11 1.11Xx1 Q.5-N -- -1:-:X I '11 1 1, 1, 1 ,1 11:11, 1, 1-, X ., X K, X -x NC, N . 1 1..1.,W 1 1 1111, 51 '11 A1 41.11 Q.-xxxxw 1f.:skxg11f1x: L '11111 Wa ' 1 11'g,'1i.1111111111 f 11 ,I ig, A xxy1k.N KXMN 1 .. . ,I XX 1111 1. Cl' Xx QI 5 HE- gn as S ,Z ..1 f if J' Q, 1 A925 QW?-figs ,, I X Y q 1 W , Q 1 .11 'kkkigr r--3 jj- . - -f' f ff' '11, 'X ,4 'rg Q . 'Z 'fN'-- 1 ' 2 M .1 ,. M- ' , f ' g Xxx gk 4,43 -.-1531! 1,-ff!-N 1 .V , ,,. Q I5 XJ 11 4 I K 1 GC ' , 2 , Hd , II n A P u v 9 Greater Ceorgla Tech Camping ...Y 1 no llll 4 Il cmol Xplllillllll U s 1 1 1101110 1 I must umm N Jlll N ' K sc mol hmlclm H- Q N hc un H H 1 W 1 ul N 1 1 I TI 1 nn uma It 1 CX ,ftjfj TX A X , 4. ,1 ,H by qhrsg -J- w x -A, X ,-.J HJ. . n u. ,. 1 5, wll - :E T' Nv- C f x fc' K' .XN N-YW-'5'5l35-K T-Q -f x f N 4-.. '1'..,- LIONEL if X A. f N f f V N 4 ! ay v' ' 2 N1 6 1 if 15 1' 3 V f - ii 'Q gl .I , 3 Q. 3 , I J 'Z XS Z , 1 'I N f f n fx X 1 f I , N 9' . . 1 2: N1 f 4 1 f 1 1 ga X . f . 2X1 id J l -. 2X f I X ag JN If ' , V 1 '1 U Z - A A if 5 , XX V :-. w 'X ' f. dx Q . Z , 4 Q A 'N' ff' 5- ' 1 i, N . 9 'A si ax. . 1 g g MX 2 T. MS z Z -- N 5 . ' A 5 , 1 M 1 A , rg Q 1 V L A l gi J 1 ' ' . . n ' - - Q 1 . 1 , as mx V . , , J i g A - - ig!! 1 i A NLS. In 4, .,. l 1 W - H. 1 W 53,111 3-2 2, 4 Nun' VIINHIQQ Hn umm. 3,',f13A f A wi an '1 -ww ' - M, an , 1 Jllllu- .lf-x ,-mg E X nu- ' , - ' nn' 4' . f 1 iv A 1 A. r, , . 3 f, 'f x 'VLA ,', f' Du' grill:-s1'lmI:nslu' H-:ur rl 19241-IUQI, IM: Ii tl Xl,n1l,:-'1y.1mi - V ' V. .-4 fy, .:.',.w., ,fi if - -I . . . . . ' 'J' 'X 1 , of H ' s'l llllll plum Im'll14'lmll43l11gfvI J. 1-rvnh r 1.v.,fJ1. l..M, 11,1 .H ,if n V.,-mfmvq: Z, E ' N ill! OJ ' 'l' of s1'Ym'r:ll million flfvllnrx 'I'I1-4 I-l,.n 1-JH. .i 1'v:' . .1 4, , 14 , V' .J ,V 5- . -11 5. .' N . . . . . . 1 ' IIIXQ :xml SOIICIIIIIQ' suxlnvrml I1 uw mm ilu- N'Y'l'llLjHl nf H.. nw,,1.l x ,iw ,' .1 In 1. , -mmf 5 'ff bri 5' 5 Hx' slnlv in m'clm':ulml mn-n. 'l'ln- -fll-+1-1 rw .mul 1---xx I-,fain ' vm. .3-3.1, .,,.' H. l . V , , - H10 lll1l1'tl'I' of 4-41 i mwnl :uml :ulw knvu thu! 1' IILIKWI U. wg, IH , .f K vi .L .-, gmiv '-H Wig' rg I I N 1 -.. ,. , , I if H4 Fe - - 1 :: UV: 5 I Tha' Cilllllliligjll l'l'NllH1'll in H ' vnlw-viplifvwm Ht' .mmf .mllz vw ' Y' S Y Nw, fl ' 11 531 ' ull' ma lwgzm cunning in to ilu' flwvuxunrm-ruf111---Jruupligzu,,md Mm-i 1-4 . fx ,M 1.-, 1-f gm 5 5? Plans wvrv clruwn for :u :ww plryxim xirm-im-r-, .ui 111,11 mm QV- :H -- - -4 - wfvi .-f 121- - 5 ,' -I . 'l'lu' uiclurm rm' u'mllu'm1 nlwuv -lwux ilu 1'V 'Q'A' -- .' .M 1,1 E. X '-.-fl fm :M 5 'f kg 2 ' ' ' Wf j ' ' 21 'l'hix l'iliHt'l' will lu' l'c':Hlj' fm' 4H'm'1lp:uHv'11 -xi ff gbzul' ' ' Eg si ' gi 21 'l'lI ' Plllllf fm' :I f:l'l'JIi1'I' Uwrgin 'l'0m'l1 alw l'lIII'T',l'1 U1 1- .wi 5 '1'7 -f ' 1 fl N on 1 ' 'l'cc'h C: pls. l'r1l:1lwly llw m M l1 1lAV'iY'HYf 1-x.mq-Ef 1' Um -- ,M 1 4fff1.I1 1 ' 9 clq:u'l1m-lmt cnlllclxuplalivcl fm' :1 study nf ilu' rufiliffatiwm H1 43 'QI -1 2' - 'H' -- in 'ME - 5 N , , , , . , 1, , , I 5 ' Sv '2ll IIIOFUIIQS wvrc hold In H1C.lTll1glTI 11123 lwtu'-'vu Hn -. li - -1 mm mf- rm.: jwmzww. f 1: A l'0l'1lllIiC' lllilllllf2IK'llll'1'I'S nf ilu' sinlv. :wi wlmivll Huw w- '- 1.1511 fv-r H1-A R'fgf'17l77l.' f 91+ '73-1 WVU' ilu' nvxl your or so Huis nvw work will lwgin. .md rx3-.1114-11 'vt' KG' vr 'mf 'IVAN u1U 1 N . - 5 fi lam' ' il 1 llfy. 2 5 Si ' Z Q 'Z , . lj x :1 if! 9 .,- , 5' lg ' ,C-1'l,- ',t7!ix A. A I 5 , 'Sl- 'Lf .ff WT- U W - , .. 17,73 X ' ,, .' , 7 , ,Ln ggfi i .lin 'Am' A' 1 f ' ' ij? ' 'Q Q ' , , X, '-A :Lv-Q i :,,. -1-,3gQf':-.L ..... ,.A....:1i7f.Tj.,..:qi1i..,....1:3LZ:5:TttiiQLg1' , 1 A 1 bfi' X U 4' ' Y W M'4' f, +Q?,,,,' iiwflf, L gil.,-' l,'f'4'ef 'A 'W' 'f A ' AA1 '5' MQQ gow ' K. wx - xgggxf '32 .gi jf? ff - x A x 1 I.,-,L .. , 1 K i. if i 1 . i l I 1 ' I .Z.- I ' . IA' ' fa! ' Us ' . A ,D--.. N ..-.f .14 Y 5 'Q or 9 , -Q fn ,ff-1 ,. I , , Q- 'H' . '. ' ,' ,l f i , ..-eil ' i 'g'f .1 - x 1- lnlu 'i Egmaxuumllnnlllm In 1mumunluliiiiiiimiiiiiiiumfinii-aH gfmgfi-1-.-mga'-1iuni.i--75515 1 - -.1-'AQ-' 1 -iw V m -- H .. -- - -3-Q51-1--'vw-vw-wvegfff f' : M Y iv- f: iiii n llsitilf' mghsilaleimp . - N fit I i i . lf. ttf c S . p lisiliiaiei an-ii '. uk... ..4:n ---- HiliIFHEESETIEEIIIEITGHSHZHIIIIIIEIIIXIIIIIIIHIHI .::mm:::::u: .. . suzsuzutnluumaiszzaulzi -Imwwssi---New-1'HMM-'fl+fr:f?'5'7Fi':1'+ ''At'W '1'Hz'ttt'tZ: 'f ft, fs ' I 2 ly x. ' Qi lx I , if E? J igltg 3 '14 13 J 2 ga S' Iii A mal if :Wai 'gil o ' ,ft : ii i . lrz i 1 'Yagi Mgt 1: 'ea-f Ex' . iyil 233 ' :fait 'Z Nc- tl' ' ii l g! Q gill IE srl Hi! -iii 0 4' :J 1 . , My , T tt ss? '11 l A' gait' 1 v' -1 I jd E eg. 54 1 Wu L A s s -Illl N9 sw tfflgia Q5 f Tull' l mlb' l lIl V 'i 4 1 The National Alumni Association The National Alumni Association of the Georgia School of Technology was organized in 1920 for the purpose of aidingthe school in the Greater Georgia Tech Campaign which was then in progress. A group of alumni in New York were largely instrumental in its formation, Mr. H. B. Evans, Mr. L. E. Collier, Mr. P. C. Brooks and Mr. P. Y. Stephens lk i Q + ri ' . N 4-c aiding materially with their time and money. During the course of the campaign, the Association was very active, getting the names Y, of about 2,500 of the former students 'of .the school, and carrying on a. good work in the organization of the local Tech clubs in the various large centers of the country. More than a score ot these clubs were organized, about ten of them being in the state of Georgia, and P the rest in the larger cities of the country., if 5 Z f 4 Z ? f 2 Z if Z f, 4 4 f 7 6 4 1 .1 ji iz! I Z 4 i f 4 f f After the heat of the campaign was over, the activities of the Association were carried on in a perfunctory way, due chiefly to the fact that there was no paid secretary, and the progress of the Association depended on the spare time of some busy men. Mr. Frank Freeman was elected president of the Association in the summer of 19:21. He at once set to work to 'try to make the Association of vital interest both to the Alumni and the School. Mr. Hugh Bell was employed in the spring of 1922 as Secretary, and held the position until August of that year, when he left the Association to go into other work. Albert H. Staten was appointed Secretary in August. 1922, and a meeting of the .Xtlanta Alumni was held, in which a number of Alumni agreed to stand the expenses of a thorough reorganization of the office work, and if possible the publication of a magazine. ln August, the office consisted of two chairs and a typewriter presented by Mr. Freeman. Now the Association has a well equipped office, the names and present addresses of 3691 of the former students, iwith a complete adressograph file of them. The publication of the maga- zine was begun with the March issue, and the Association is assured of the remainder of this year. The outcome of the work for the school year 1923-24+ depends solely on the sup- port given the Association by the Alumni. fi ' TNA .41 ' Y 'zklnx .w I, Xl: L .. ..,, Ii, it G - 1 xt. ' 'N-.Nix A Ln' RA 3. . . -- - -G .-v.----N ...-A M... . ,:-,.,.,--,14,,-,4-, -W Mahi- q , - '- 1- -V-'IAWMP fwbiflzlwm-.':-M-:-:-'14.22, .2 . IZ.: 'LEW .r .-sfzzz.-o-:f,w.'.g,g.'2k,oy-'-353. 'g'gJK, . A-mmm A-W-Wv'p....... .. , A ' f- . Y --ive J- A L' .-A vs AWK GN -t x N f-5.5 it .L X c . , . D-0 U- xxyisl ,.qQ 1 t Q . Jil. L i Av vu A ,ff !,fo,.,V 3 up KA on ,.,.,,,,, . ,.,. , C- if Wg B' ' of e -f A. L 4 e -.,,,f-...s---V-1.-..glwifviifr ,, ' A fr , A ,ff illlllr Triiifliifjlliiililiiilfilwliififx V ,. , ,, N ' ' ' ' QQLRX' .B '--is-af , -. W ,T ,-., - I J, js .L , dig' 1-5.. .I- O Ji A 1665 -' N 1 ff X IIT' PQL-hm A-lj I lx S f 1:15 I 1 :I bl I4 S ombu- Nwgr 'X X 'XX-X X x J L 0 N EJ. rc xx X X X S Q S S S I h wa ' E :L-it Z4 1 A w 2 J '-5 f Z ' 1 5 v gg K G Z 1 5, 5 1 '11, i S x 5 gy! 14. N I f I f I I WH - gxo , ,-L I x , ','- 3 ' - I r 1 2 f I I . ,,,, I I L19 23-TL I . . J IIIIHI'Igm!!!illnllif-El!l5flxg.lul:.u::uu munil IIIRummuluumnns1I1iIilIQiJnQi.n..mu-KI-fQIl?fQf5L'Q-,.m.'-VA.-.--.I.I.,In.RuIunuwu-GI?-fiWFv-fw1'1' f 7'f'-ff'-'I ' ' ' ' '1 M 'L ' ' W 'w'nHmmnmmumummh imv Km. ---1 1' , 'gin mi.!-any ww 1 'f-4' ' .. II I Ili I' ,II , j f' I2.I',II17 ' IIIII' Ia -I .. . :fi E53 i'ii' m 2Ez ....., ... ..... . . . :a.:mmuanmu::::asmmnmzuausaussmamu a an II'I'IREIliliIIIGIIIIIIllllilllHllililiilllllllIll:II!!IIlilIllllillEilflfllllllllIH!!!U251575231IMZRBJJi1il55iIll3lZHliHlUmHE35li T4N. . ,... ...... 1 'I In ggi . yi X. ZII I QII II I K . ff . I f I 5 51 . ' 94: . ir :5 If' ' : I 'Q sg . 11 I 4 I I: I. L I J . -il -Q5 Wu'- P 1 I I J clllll H Hum I .: IIE..Il Ili rl I dll' VIII noi 5 5 ? 5 Z Q ? 5 Q ? 4 if 2 9 f 5 if 5 f J. VV. Ii0URK . . A. E. LECRAW . J. F. BELL . BALLAIRD, I.. BELL, J. F. BORUM, V. I.. BUTLER, H. A. CARTER, C. S. CVARTER, H. D. COLEDIAN, S. '1'. Cook, S. P. DUBOSE, H. I HAHN, E. XV. Photo by 'Win n . .Presitlelzf . . Sevrvfary . Trcaszlrer PIARRIS, A. YV. IQILLEN. J. T. I.ECRAXV, A. E. BIALONE, R. XV. MCDONOUGH J. J. BIURIJAUGIT, J. P. ROURK, J. NV. STARBIRD, H. V. '1'1IoM.xs, E. G. XYERDEIIY, M. C. I V4 14, I 71 . x , Q . Q J. D I ,Jf f X. . IN I ..,-,A.AA I M 62 155 , 'IM . . GI' Lx .f - 'H Q I I' III II ' I l e, ' , . I Ili . I W II I I QT: all ffl If-5 I II 3 I Im. P I -Am. I-I I Aga' II X I '5 I I 5. I 1 I X Q 2 E I 'Q 5 . IX ' M ,, .gnqqpf ' -..' ' N , A '- - V ' -.X 'J . ..-f5HfE-'EEAEfE?- I- , . . , ' ' ' L ul ' ' A ' - I I I X -. J AAC A V V - . W . df 1- , N .. . ,... M. L Y Lumnn. K G++-QL 'o -- -:Q.9,55!..!.:y6 JIM, L U , XX r,3..Nfhg.f3 f5'f X .. xx .,... 2 .jx . fN Nj.- J' fl?-121 WT' l. w, , -QQ WSI, 13 I S N I R11 Ml 5 ...I 4,1 2 q , .. g I -f jk? .:X f'5 -ff' -ix Q II alas -:-: :f - ...Z , .tA, ...MZ Q, 4 ,... -' - 1.. . 'ii' Q- ' W , ' an i H--:sa ---- X --- -A-W - 1 w - f fa- A W .AA W ,,i, 1 -.. xxx I f Z4 QQ , f M 1- ,f J ,win 11 -ns lg, :du mu I I ' Y ' A-f ' z -1. 'I .x 1 E F I' I f ' 2 i n g I I I f ri, ,,, n fI ,-' I -22 Ii-mms:zr....-......,.., ..a---- ...M ..-.-..,,,,h-H . ,. 1' W -- ---- ------,...---m- . . . . , 1-T-W ,. , YJQQ A WH x, N .w' I TEU :I I Il I I I IIE , l V ll I I ,gif I I IN -I , ' 'J Royal Order of the Bleedmg Toe I Il Sxnx lil fb ' ,pri xXx N I 5 5.-ffl :Ev f N12 K Ill 4 S limi XI X I Run K , xx XX nu 1 only I max mu ' I x II XXIII 1 IINIIXIII ' IIIKXLII D11 su xmrxc I xnu Us p I 1T I I X NT Imhulx I X Ix IN N ma I 1 I Q..,ff.,?..'f X ' X X ff ix ...QQ xmwfmamgx NX mxxx m1S'B.q'iX'iXx..NNN'1'N T X LIONEL K . S 4 I IS i I- I HQ f I 'f I IS 6 2 IQ 4: x- N Z a IS' Z I 'A I 'N f I.: I X Z Lf 1 Q f 3 ,X f . ,fx f I. I X f 1- IIKQ. Q I: IQ ,Z :EI N 7' , I: , IX 7 IE IR Z r- I X I IIS ' 4 1 -- HN 1 IE N Q' I 1: I I I Q I I: I Ig sg IT IIS ' f 5 I I II I I , ,IX 4 l'I,.',- III wf- -. -1 I5 4 ' II I I5 Z . I 5262 I I I I K Eg P Is. II. .'.' ' . ..... , I' I -' ff: nf Ml, . A ...P , , ' ' t I I I V1 I , I I .4 lumlclmul-'uvlxvlln us W: 1 'I I 'N' I 'W , , I 1111.53 , , , , . , . II, Q4 I, I 4 ' IJII. l. I. IIPII. .' 'Il I vw: I 5 II: N 'yr-1 I :hw-i Pun '. C. li. IIII 1 vu vm: I,I 'I I II 'I H 'U I :HI I4-JI . . ' ff. Tung . 'f5 ul-'lflc'lclc.' I' I . I xl. J .f QI 'W lf. M. l'1.zm' , ....,....,, , A f'fff f'1ff In-i,q l fI. 'I P. G. I7,xvx:s .......,,.,.. , I If, II 'I'I 'III' 2' 'N Q F. I'1.L'o.'lc.1xu .......,,.. , , ffwvffl I rf' lL'v'f W I I I2 IS. S. I.1m: .....,...- - - . I I I' I W 1' I ' N . . A 'l..-vx-'4.V, A 7'I1I. 1717 I . Y 5 I 1 I ', ,I I E . 15 I g XlIiNIIIl'lIS I . 54 L x 5' AL, v X. 11. IIl'KI'Nrmx. ll, I. I M. fl. I--IU x'I -S If H I Aww- 11. la. IN -.-.' . uw!--In 'li S. I 1 IV WH II I 1 I I5 IMI II. XY.. QIII. If,xsT NN, XY. II. NI I nu IIN -I I S'-IVIII, IWW: 'II W , BX I? XI I'IXIIZY. If. NI. NI1l'mmuv VI., XI. ,Ira N HV. I'I ! I' I I . IS, 1.1. - is-Ii ll-IVKVXQ 'I' II' X, qt If Xl' Sr 'min Xf I? I 5 if AA ' ' ' .- : X' .I-X x X' Sr wx 'x, I l vj BF,.,.q 0 In Jn. lfu . I.. .X. 1 I . - . , I, I ' Ii' K. f Ium: C D. I IHTIi.1XX. II, NI. Y' -'N I9 II 'I 'I' I x '- 'I II' 1 2 Ii 1.' '13 '11, ' ' xv. 11, Iimviu. 1. II, 'IIN 'm.1-1.14 Ig I I ' C6 A XXL. I-Ii .Iml 'suN. 15.1. Iiuvwm se, .I.- I' V- '- 'f f'- I' II- I Q lk, ,I ,, A 2 Ipjjjyj, XY, If, HHH, IA, I' I I Co. . . -. - Il- I -- I 5 DA ' Q .. XV. F. Iii . .I. If. IIII' YY. N. V I Z Q M... p, cz. mmf. u, 5. lm Im, II. 1 - .lv I 4 IL2, 5 Q Ip: I 6 Ng Ni. X 1 , ff x I 4 I ,If ra .- - If Z' , jj-.L-2'- jLf'9i-.H . Txx Z N1 f -V 'Aj' if 'TT wid -WW A Y A, , 745. Y NKVK Y - -W J - 'fITffT' 3fI 2 T I ---.- I 'f .- I' 'Q ,Q,'fTTiiTffQ:.2'LQ..1,.'.':-giilggpgl.:'-5 321- ' I LQ W f Ng f. 1. 3.3:-IK - -'-gig-if-??ii3SA'ff1ffT' I'-IK 'ijfif Auf fglflfllfill!--V-wf+-A -14 4. -f-l-L. 'f',3 W L I Q, 1- ' , . . 'Q lg Q .JT V fig. . . 97. ,7 . 1 X 4.- , ,..-0 A N g - llll umnmium Vu -m-mv1--1-'m-emmlm miuslnsmnllflllo m --:umm-fi4 us-n--ul lu uvnsnunxufuun 1 ffff mr-vw 1-- -w-w-----v-wwouvnnwrvnmrr1Inmmnnungauqun.5:xu. -I if I! 3nlgiuguvlllKzmigigiglgwllllillllllllll llllllllllIllIllllUlllllllllllllllllllnl llllllll I ls I I 'vi X L.-' IIIIII I I E P Q . III .I -- I .. 5 3 SH Ili HH! :hi .......-. in ..-.... 6IIIHHHIlililllllllllliliillillllIII!IiiliiilllllllllllllilillillllllIIXIHlilllllillllllllllllllflllllilill llllllllllllilllillllllllllll' llll 'MQ' 'QL' f' 'I 4 'MA ' 'f I v- vw ------. . E Ni fd' ,rg 'I I I If' II II I in I iI I I It ' I II I H f I II .I If v' 2 I I I ' '- gi :5 I I! E 2- I I s :I 'III 2 : 1 -' -fe I 5 I III' II 4 EIf22!I ' II I II i , I QI' I I I . :I II il - J If I Z 'I I rf Photo by Winn '.,i4' ' ' 2:'l 1 3 Free Bod Club ,ee Y '1- 1 5? va J. T. IFARGASON, Ju. . , L A I I IT I lx If? n Il lla I VU Y 1 1 'I' VV. O. BRITT, Ju. . I SALTAMARIA . . . . PRoF.VC. F. COOLIDGE QJUXIOR NIECHANIC.-XLS, . . .President Vice-Presiclent . . Sczretaru and Treasurer NILWIBBRS . . . .I-ldliaor ALDHIISON V. L. I Hu,sAr.L, L. NX. ' BRIT1, W. O. JR. HUI,I,. F XI, I COX, J J. J. IQINC, XV. B DENICKE C. . BIILLAR, J. FARGASON, J. '1. Jn. NILKEI-1, G, S Govvr, D T- Sxvr nmnu, I. HANSFI L, H S IL I ww X Iw , I '-LI I Qu Lu, M-4 I ' .ls I I5 I I 5.4: I ., I I I . mf X vWWfm,'m'y'?W N f 320 II ,K III IQQN ww .www NX X wx XXQX k.-gag XXX -1- UIIIUII vi X ,QW PM A QI! 'QQSERYX I I II. I 'gm I3 Y 0 , L.-Q X X E .af i 'I V iff' , 1 1 1 1 ,f 1 1 ,1 Q , 1 1 11 . I 1 1 ll ,1 'E A .1 1 ' 1 1 1 ' 1 1 1 1 1 1 1 1 W 1 1 1 ' I 71 Q ,? I fP m2! Hc ' JV :ll ff gf 1925 wiv , , 5' Q53 ' i..i1'5sf' ii 'Sy-L -176 'AN 4.5 f 'T Enffbl ,XJ LJ L-V Y A C ll - I Ill P4 x w z 1 5? .41 ' -1 2111 K? .Q Av K1 'VIAIFIIPNK s Aw Llllll' SKIN N111 Noxuu IIIPI I r xnr x cu I-lf Imr Irxmxs Co operatlve Students N I SWIFH XNII Nikl lx 1 1 H X IIN y x X x -.v CAG LE Glmvsox CUm:ToN XVES'1'BROOK S INIITII B R ow N I'II-INDIIICKS Pm Km: 'I'A1'1nxN HOLLAND H .xnlrfrox XVAR Non' K COCIIRAN ', 1.1..xu. .' Gmmxrzn STONE NI1 xmzn Moss IQIGIIT ST,xr,msu C0-operative Students Ilmxxrt .Xl.IlllI'I l'lfX I3 'I 1 0 'K I'n:AxT'rY UXVIIT, . SMITH .Xvcocx '.x .n vu ,. Ruin Touxsox SVVTION Kmixr .I'lfR1l3l.KX.' 3l.x1S1wN -THIIXS STKPIIFNS 3 AXYVITII, Hmuni. N Rnminw rsim' 'NIHIASI t 'TT 'IEC 'PKR ' I'.1r1-rug 41 jT11Y .' UH11-1, NTI 1' TY . W ,UI 'Y f', 3, f K ,415 -1 17 - .1 ' 1 V1 '-1-, .. 1 X'L X EI Vi 'sr ' 5T'rr'ur-tg 1u'1w 'H X ' , 'H Vx X 'um 'e 1 , 1 Swv '. . 15171 Y - -.g,,,-.,,..,.,1... ..-W- mg ,,,A, -,. fl. ..1,--- fi f , 2 1 ' - ' ' i N' , . ,. . , , -ff' f' ff H' 'ff---,H ,- A ' ' ..-.N--X g, - 'V V x X Y ' ' if -t ' . Y Lwpael. K- .,.,..,.. A Ax X W Sax '. -,,,,, , . 1' ,f ' f . ffm Q 15 J kt? ,lr Sf I f 9 1' f ' 7 f fl X r' Z 9 1 Z f ? f 7 7 1 Z 5 I 4 1 1 i I W lx- ff. ff, YQ! ,,Mk v I k I 1 KIM, U1 f,,,.,1.N:..-,w.i 3 Q km ri-x kb f' ,V .zfyffx ' I ' I .A ' nl. .V j., . ,. 1. ,ff '-,. -,L . l, - ,fix-jf 1 K Ns Kip 1 T, JL, ty , iw ,, , ,4,, X A If f A,,:,.g1-, 1 mm 1 1 -1-f A ,, -.--45 , ,wfvff 'ff'-'J QQHT Y fffg'-7'f.T A 5 if -f f?-T1 i M M W fa ' 19 251. iff, 19 f if M mf a Q M 5 W Vw GW 1 El Y F1 -,f If A, if '9 H! l--J if 45:-,Lf- Ji L- ,,.. -,i:v v,,Q, A P51'Nf1ikfEN , 'fiEL,:m:.1'U - -3-GM ?i53W1-mf' if -U w:f11fl.gf -'ff,,-A --if N N f - Q ' iff! ,' N ,N 35,11 . Y 'V' x. 1 ZR I Fi P4 ' 1 ! 52 ? P 2 Q WWI 1 N gg fra 2 fit 's N 2 F Egg a . iifflff '3 li., A 1 an LL J:-515 igfi 'I' Q! mr: . wg' N ' .......,.. 1 'gil Mfg f N W 1' off: 1 5 ! -ISU' 15 2 2-QU I 1 Q df: g QA Q ..Av, W , re Q ' ' . 1 ' Y W. 2 5225. ! Photo by mn Q ,-,E W C I 0 A 5 0- p ssoclatlon N A Y Q 4 X, N K N BL' r.1,ocK NIA'1 1'I'IEVVS GIQEHNH 1'lAXVI.INS SMITI-I MAX XVEBB .-Xv1zn1u:'r'1' QFIZXZEI. FILEPIBIJXN B15,x1m D3-IE Eg Elly I-I,x1uusoN SKINNER BENSON SEYLE ILNGLAND V IXE 5111.9 Bympy E N Gusu Momus Cox Fu,xN RUM H.ARRIS .b 4' LAW B nom: HART Blu' LAIX H ,mu 1.1'0N M r:.u.on Fosnzn L ' I 'i , PE,x1aonY BII'.l'C'lIEI,I. I,IKmrAN NORTH BIADDCX LYNNE .Q N 1 ' NI fXCDON,XI,D 'rf W1 A - ,. Vi, 1 , ,, I -IIIIIF ' f 'K 3 'XX X X 1 , 3' M. hx -,N QQ ' 1 N ' 4X Qi 5 , N... wg, . in Ea , I, N4 -P :N . 45, 54.5. Hx 2, , in 1 Mg HQ' V s , fini FS 4 3 15' is f 1 E g EiSO1'1lC U X f M Cl b X , N COLLINS Gooum Du. SHAW NIIILICII Plml-'. NNu1'rn: Mc'Cr,IN'rr1CK M1 LN me ITAnvr:1. D1 N umromc IQVlCRlC'l l' TE Hsin' XXVICLLS M ,xx NTNG l'nm1'. D11 N N Q ,f 53 ,. :Fi EQ Qfgflg , ,' 5 .1 W ,f x,Nf't. , W' , M , MA --- ........ M--A-,.-,fQ.x .,,,m1n156 -gf 'W QW- 1I1mnRbW-fD N U - N - ,P Wifi.5'?2awmzm:z:r1:::::.:::f:f:qf.f'..1:-'-'. .1221-:z fi -Y -L-'YQQQQSE Mhjj Mhhgx Q551SFsg':f'i1fN::.1:sffSNS::gal'.fQ?:N:Q:jf.QfpxNS NEf3? - NM -' 'N'YA 'RQQ1' 'i'H'f11Qu1um,:x,,fH'w,Sw95.51-5,-N'?5f'.fgiVnm P'ff44iw ' Aww' fi'7' lf-- 'l5x,h N, my M N ,F x. iv., ,JL- 'ff s' I II. CRW! I qv I. 'I fx .-'T' f Q jj, N mwwmamq Y' xx Q2 1925 IX., qi! 'O Fm MI., ,,,l, W THE DLVE P I I P Q4 P' r- I IE' , ,...-- D amz IIIIl'11 I B XRIII 11 BOM xl: I um N I Il N XX BROMLR L II B1 on N C II CUN IIPI D D KI nz C DUN u oom I E S IQ XX I mm R. . 4 my 1. . . FIIISEDI KY' XX . Gxnlxrzu, I. C. G ucvs, A. C. GOULD F. . . GUN N L . . H su KIYQ' . HILI, H. I . . IiISER NX . . In BZ C. H. . . Georgla Tech Dewlolay Club I Snlr I I' I u N X X If . . . . I5 UU. . . . . 'X UI X, , . . . . . I IJ. 5. . 'VII 7, .... 5.... -X.. Nm, , , . . . 'H1l: :. XIII, ', . . . . 'u'-.mwvi P. '.. '.x1x1N'. , , . 'rnru VI' . . . . 1.xI1l0llI0 Tcxns .lIITT. I . . . . . 'll'l'1 'Tx s 'nr1,9 .....-'mt' '. 'wfmn 'N N- I I' IL, T , l '11, 1 I' YI :ATI I, Af, - M?-:fffi- ' .IQ H CI - f.-...-.2a2Z1....f?:fN, If QI. . f I-fd-2,-, ----f 95 ' :J P gf, 1 . A N J 1 i i - 52 IN, I L Y Q, :L4 LIONEL K- 5. XJ '- ' 4 --, -. N ,f .- 1 ff lf.--T--.-,-.-' I ' I ,Q L 4. -f C ,, ., .,., - ..,, - - .- ., V+.-A, I -.-.M-M. V I I I 6-:F X Hr :N Il QS f VI I I 2' ' if 5-Ei ff 'A I X!-,,,- ,,-III , 4 I 'Tk ff' .A h .,!..,, 'lr !Ef: 'Hfr1n: 1.ff1ff1, ,.....I-.-.., ,.-. . ...f', . 'A-' iw T I -M-':'C':5 ,QI 'A J 'Q .E. a JI! .' K - 1 Y , I 51 'lf Ig I . I 1.-....m., ,,...,I,, ,.,..,.,,,,,. M ,,,,. my m .m M ' N I W - - H-fH'H W---f--I- --J , -.V-Y-. . TMI, , S ' 1 IN I I 5 I I fy IS Z L H M Ig I I -IS- .L N f I - , 1 -N NI z I f f N I 7' I SI I 3 ' ' IS I I Z I KN I I K I 5 V ' 5 9 ' . N l I? f 4 f 5 4 ' I A-Q I Z . - IN I 4 I Q 'N ' , 1' IQ 1 4 f I Q 9 f VN 4 IIIQQI I 4 .Q 2 7' IIN I 4 IIS I I II ' I I II' Z II I I w II! I g II If - 3, . Z . I I ' ' I 4- .-....I.Qv' QW! ' ,Q 'I NU. Ik 11 Wk I ISIIIIEIIIN I I i 'I' . ICI' I I3-lllfn I I- 'I IGB E I 5' I kllllz I , '- ' 9 l,fff'flI'ffn Xfrswr lf, ,, , ,,, -mm-Q I -IlIll- H u ' i-,I BA 'I ', - . I ..... NI. .'ll ill. XII. I :Nun .I I' V II,.,,M,H.I,.m,I XI. I 'Ii B'm'1 '3T1'- A- If ---- ' fxllillllil. Cin. XI.c'Im1.III, I. 'II I I.'.II.QeIIn. 5 I , W A! IQOA 1 J , ci. P ...., Xllillllil. IIN, NIIII-IIM4 I Ilug, H,,,IX. X I ' 1 , 1 - C -'-- - - I,iIlII- II WIQ. X II. XI:-Ifvfl. VI X X1IgIII1:I, IM I I Bo df, ..C. .... XI'illis Hn. X. Il, Yu NNN, I I' N!5:III1:.,lQ:, BIHCJ, '. II ..... I'm'n awuln. lfln. I'Xll..I'I'I4 II If ygg,,,,g,,4 IL., ' ' , I. ---.- l'HI1nnlu1r-. Un, l'Im:I In II, If ,I ,I,,.,I,Ix. 'I1lI, 'I HI, - '- --.. .xllilllllh Kin. Hun, Il, I. , .l:.II,-fmmll, liq, IA , J . IP, . . . . . .XIl:ll1l:l. Un. III-.wry XXI I- X1fI.,1.I,,.4 'I,,,,,, Il . Du, 1: , I. O.. . , . Ile-nri4'II:1. llLI.u. Sn.-, .I ID , I,,.,g1g,.,,- NIH. I, ' X J ' ', .. 1. . . ,XII:1nI:u, Un, S wuz, l', VV II:,gIg,'I,,,,,L.. II, II' 1.1.1, Y. Ii. .... .X.ll:mI:l, Un: Sunny IC, II , ,IV,.I, .,,,I gg., I-Ir, III H5 FA .. C NXIIVI X I7 911 rv' vi I I1.'r ..11 Y I' II F0 , I3 Xllm I I-I Nr rr 5 X Ig ,,,I, f,, 1 II, I P Xlllllll In IIIHMI I-N I II f,ff, II, Im, I lg I .Luk 011 WIINN Im' rr' XR II VI Im, r,, I' I 5 VI l.1mp1.Il1 NI I VI f SIIIUVIIIQ I , I 2 J I S 1,411 IN 'IN I I' X III IIII 4- 'XII I Q ' HJ, . I, J. IIN ll II1 V N I II 'III lui I, II, 2 A ' A I, L IX XIIJIIIJ. C11 Ifylp I1 I Ig 25 . Y 5.11 . -. NK II 1 mf Ia,-f. I I5 gf , I D Nl. 11.1 H vo , N II, In I., ' Y' XII. .1.c..I In-nf. li N1 fII.f1f.::f N c I I .3 I g S3 Y 2 S II I' I I , , N rg K X IK.: . Vs? I L fi , L 2. I cz!-.gf-'X o i , . --.1 r 1 X- , ' 1 3X 5- X 4-- ,, .. . .fx . Q- -rr' , ,A - 1.5.-fgwffx. f H K. , . . T '4 .U-ff . ,f f- , ' . W j ff IHE!IUiiimEl'''' 'Film!!Elgluuunuslllu mln n IllIIslll1luluuul:QaTllhlQQn ',-. U4 f uvffwu--1i5ffT P-1-' I'-' ff--'- ff 9 'Tm' :::': L' '9i5: ' ' 'Q'vWfwa.z E' 'E 11.55 ' 'Q 1- I fi -2-J 4 'T M11 H1 H E: D L P ILI . v ' nmaiiiz ......... 4 ...... T am....H.r.1...1B..fmmm..m.................. mmm: zx:s:::1xu::::::xmwmm::::::su: 'TIISIIIIIIHIIIIIIIIHIISIZSII' :ma ' Hw+Wm5+,'-wAf-4M'g5wZw+ . .... .,.-. .-, .41 ..,.... . T ff T' 'Z ,fn 3 if as 'qi ' il UEUKUIA TECH UUU: CLUB T T 5 if I il G3 Q' . r ff ' T. 'if' T7 f'J lffxi' ff n 5' 1 D F70 lb 3 fill' Q I gb L 1 EI if Q B T' T, . af.. ,. z N D 1 3 Q ' v Vi , 'xy 4' X 1 T ' T. f T wif a 1 'W T M415 4'-H l 4. TWV af: J? F ' EW' 1' ar. ,Q ,T 4' 'flegw 'D' f- HL I . ' .. T -3 sill f V . I, Xflff 2 . Ti 1 VEST! Q fififl , L 523131 f 4 2 .1-,, 21 :fi 18 MQ 1 54 L A -IIIII ,mga vi ,Y IIE! Y 'I I l 4 OITICLRS VV. B. FgXllNLISWOl!lI'I C'1pt'1in Of 1111111 . H. D. Cxlmnlz . . . QT. H. FAULOR T . . CAPQAINA IT. I-I xu- . Mus. R. 'P.'.Tox1cs . D . M. T. BllI1FAIN D . T. B. C,n1Ns1.rAu Mu R P JoNrs AK1Ns, K BHOWN T II 4 TSRANNONI T 1 nun I CoNv1 HSI, S W OIIINS, T Dxvw W C I Aus, A M . N t'l'1TflIl'.1l a I I II-IONORARN MT N1 BFRS Du. VV. G. IH 1-,1mY Pnol' T F MCD xxwl MT MBTRS lmnm llllX N7 ITOIIOUCII TV P Tu TJRAIIII C' T 1'kllNlqVi0lKlIl NV B NM xv l INDIAN XV P NIGIII I lxn ws'-1 NV XV f- xx 1NIuIxum R RIOOIH- M lllklll N NLHIVIR C 1 RUN I INII c xx J L. NT 74 mm I X oto .sy Winn Prvxidnu' ' -I residfnf 'c llNll7'l r Tnsfrm for , L 7011-'Ol' f hor a It ll H. D. Drzxslsov -. . X. BIERRHK R 4' H C C u DXVFI 1 Sw un SNIIIII Sllll-ll '11 XUIDIXK num xuu usu nuns NX H R in 'iJ 0?SM.wWJ1mff71.wzfHzf',5azPRMf 2.-1 ww 'fe Ng. Kkk WL Qgiixxmx ww xxxm g WXXXYBSXEX - l .. '13 LQQ 4.35: jr IS i s NL1 A 3 W s b E5 in Q 5 22 PJ 3 P5 Y 12, gi 94 V U5 3 7' 5 Y 44 5 4 4 9 if ,L 2 Q A fi- , -, If' -x x vf L I - .W I ' , , 'N-. wif, ,MC ff-y .,-f X V.. ----. ,... f .xx,... ..: ,,f'X--f , , ff' N -9 ,4ci5.?.kv,,f-QQ43-1: LJHXX --:-.,,,t,-,f 1., ,lf -L iflisglyggg afwfiffv W 3 ,ff 1 Q x X 1 , A ig' I Z. 15 54 4 4 3 5 Z f r 6 1 F g , 4 7 f Z 5 Z' I 5 rg W- f f :Z 92 'I lu,- X Boxxx gggug Plaluclxs Snuwll Q J 1 195.13 VH 7 ...3 r. . 5 E . 'L l 3 E :S N5 :fl 'f 5 5? 5. 15 Q39 4 LYSRY FZIJNVAIIDS C,xu'l'xsn M l'1'CIIl-ELI. MCCUX X151-L I uw I QI I I-T .,A. , ,, ,, N M gm L L A 1 , l l' - ' ' ' '- '-1- - A N x '-r-1xx 1 ., Americus Club KIAIIHXIZIK Hum' Xl v ISlKHAIHIl'HS'l' l5,xlr'n-w Vu: u II'-1.1 u I- v- XYIKIGIIT lllupw Ilffmw N: vnu m1 ' lull Wuxxv Nuns X N lic rc 1-'mm CULLI NS 'l'mm vsu N S'r,vroN M .vrl 1 1-:so X T'Yw'U L- V. hl ' T Cl b At etlc u 'MNKS Ilyqxy 1.-xx x lxuvwu I H ,ull Vllx Ylcllxl ll 1' ll Y r V I ' 1 xll'INTYIllZ UIINHF' HU' Vx X T Xn nv! 1 i I X1lX1'fllll T Y 'Htl .lvzxxlxus HVY RUXYI. jlumggx Vylmll Hu11llID f J A X , -I ,f' ' ' T Q xv vi. .. , 'H'-1f',.f'f'j X xvvgr ii 1 -KA .-3.wi.i422-,+Afagm Q - ff . ,Y . -. - mzbrxx 355-'-by 4-T-'-'-'r ' A 'E-C' '. 1 k X 5 5 xg' x A . L ' LLONEL K K x 1. 57. , 1 .9- -f ,4 , . 1 -:1 1 1 Q 1 ,. TQ' INK:-TA'1' 171,11 fwfil' 111 1117 ,211 ,1,f,f1 f'i7Af ' 1 1' ff 1 .f 1-1 1 .. 1 1f Hu - 1,1 1 1- 1114,--A . , ' ,1-11,1 , 'gi '1ff' 1L11l11 1' ' 1 11 1 111 ff K nf' ,294 'f 1, 1 1,0171 ,111-g1g1,:7' 111,111 1 'ff' rffyflff , 4.1 f Q! kj JjJJ,A.,,,A, Own ,, , ,I ,, W W, V ,,,,, , ,L .. , Y, , l ,gf ,I A. f 114' 1 Wfiirig-ll 5 f?111f::?f2il7 f ,1 ,lf - A ff f - f7i'f :Q ,,,,, . .x1111Q,:1z:u.1.1f .111 :M -1' ' 7' '-'- A-' ' 'JL '- fjZ ,L f' V I: A 'v' I 1 , 1 I, X1 1 1 ' A 11 1111 11 1 1111 111 1 '1 1 1M 1' W 1 V' . . j , E 1111 111121 111111 1 1 1 11 1 'N 1 1 1 1 ' 1 1 11 '11 111 1111 111111 1111 -:E A-if A-L--I 7, , , A, ,fifg ,mf ,V . ,.,'fT1T'gi', ,,,f ,- , 4,32 --ff-133'2-1-ef-151, ., -. 1 11111 g11 f111.L1mz1mQ,L1.-1--LLLCHHMJJAD:11f1M?umHEQ1ElfL1?m1EfH11n1,111Gm.um1'v'1111:1:m11JS...''LLL''--f'l-H:----4-11144W-1411----W----'M-W--v-V f- fff- ---'--ff' H H' ' 1- xiii Jfffl 1, xx 1 11' ' 1 1 1 W1 , 1 , V 1 1 5 1 61 1 W 1 1 ISE. 1' 1 1 A N .ff 1 1 7 151 .1 1 ' Qi 1 15 1 1- 1 1 1 11 Qi 1 1 1 115x111 ' 1 1 1 ,lfl 11 1 1 2111 1 I ,- 1 1 1 55111 1 1 ' 51? 1 1 QE - .' 1 1 E431 1 1 , 14,1 11 1 ,wg 1 1 EZ? 1 1 .f 1 1 kj I 1.11. 1 1 1 1 112 1 ' 1 59 1 A ax: 11 1 . Photo by VYIHII 1 B k Cl 1:1 11 153' IUHSWIC U ,I ,I-. I ,111 ,IF y .5 114534 . MCGARVEY B,xL1,,x1:1J PA ULK bnrru NX ,x1,K12R L45 SMITH VV1M1s11: lx LY BQORGAX Kr:L1.r:u H1Gc1xBoTH,u1 1 X ,1 ,z41'15ff1 1 ' : WEQ1 5171 1' X11 1 'P 1 1 F1 .11 11 1 6 'SQQN11 N 'wwf if '11f11'j 112241 11 ,15 1 1 1 1 X 15211 I 1,1111 1 11? 1 1:2 1 1 1 12 N1 1 1 1 E31 ff - N 11 1 1 Q11 1 1 1 31: 41 Z 1 4 1 '5111 7 1151. 6 j I 1 : 1 1 6 111511 1 4 1 11511 Z 1 1 1 1 1111 A 1 1511 1 Z1 1 1xh0tKY by W11111 115111 1 f M' 1 f C 1 b Cl b 1111 A O UID US ll 11511 1 1, A , 1 Z 1 11 1 1 f 1 V v 1 1 1 MKIIIIIAII lxm-:Nm Moss BROWN lNlulxm-: linmvlqlq 1, v 1 1 'r0lllH'I'l'lJ Jon NSUN .lmlxsox S'l'lIlNGl'Ill P!1I'l'lll D.xxu':1 111 1 Z X! KYLI1: .ln1:N1clNs Wu,mNu NV.uu1: l,uumv11m1 71, 1 ' 1 , 41 1 11N 1 S17 1'111'XX'1 15.7441 Y.1'N.1'l. 1 xxifx kg! '11w'1 1--1 111111111- X1 '11 1 11 111. wil 1 W 11f11'5 11 11 ..1-' 1 1 11 111111111111 H111 'ff - - 11- 11 1-1 1 1.11 11'1111' Q 'YQSQXWY ,111 19011 '1 ,w LN1-W. X .X V ., 1 g1,'1,!11xg 1 'zxxxj 1 A 111 ll 1 1 111111111,111Nx1Q,i1fVl11X.gv1,jxf111.1 11Q 1gt.mw,f.- ,NW 1 lx.'.1l,' 1:1 1 X111 X111 ' 1311111 ,. 4-..f. , -V-. .. - - - ,...,: ..., ,- .. ..... - ...M -f ...,-.- 2..- ..,,.,..... -.. ...,... , .- .f r .- NSU 'NM ,wah MMI, WLXNXNQ' fs M Q1 NH Nm f Nil Ni U ii 'Xx 5153 f SM fs if W 13125 H W Sy Tio vip: gm ww Vx Nw Sw QU 2-:I Qi T235 L,l1l' -fs' Q ,143 1' Nl lifji X: M YW iflxi REFM ,,.1 ZW P21 413 ' 'fa 1 I 1 U, :.' 1 ,Q 1 fflq ,gg Willi ,LOW MH 'mlm 11.-wg f . ,Wg ,I ' :Q W w fil, Wai A. 21? ZW! ZH yhfl f I! pap all Wi 'flu Qu!! XV my 'Ili 60131 'f A Z5 , to f . A 'JC' A 0 Nw! 3-,. , T Cf ' fQ'fQ i5l4fo?kf Q 4f-11oA'1i95 fx'711: '7f?:f'-xiii f' L V ,. ,H H V Y Y , ,v -- - f A --- - AV:,vf:.v:..-r ., -4, Y-- : Q Si if ., -T' , W 1 , ... ,, A www' ,f , , Q...,.,QL:. ,M 4A,,,,, KAYKAY m ! -412, X1 ,L ,g Q X fi? Lg 1 ? f Z ? Z 7 f Q 2 2 4 4 3 5 Z 7 2 4 ff 5 4 X ,le 6 f 4 Z Q ff V 'Ilia Nm-:L Eg l ,x'l'1'ox Qs nnlm 335 f W ' ETH ,QW b p V WT an 5 w Ve. 2, Z? .Q sc S5 X .4 .'f if , if sz 55. H Lf' X 'C -2 EEE' av ' ' '-v'v....M-.Q.....,,, ,NMA 91' ' -f-' ,-N,-lP,.t..J.x: 'D Q ZS '99 Cosmopolitan Club Mx'l'w1vN -'unix Nw.: 1 l.'.: IIIXVN IXNlxx Xxl- I' We Fitzgerald Club MAY1-'Q Roumtn Rlk'KIf'INl'N 'IUHXNTUXI V f'f 55 , w Q NVILLCOX Wu11'r.m' l'HWliII H' V' W I xT' X ic Q. 22 Af' if M fr-K- Gif' . Xxx ff, 5, ' - xxf frgf .',.N V1 A X-X'2.N . , px.. l funn , w lq-dl mn 'VI ILM'-I gh -...ffyf A ' 4 ' X iii: -- ...- , :gf W m ,,:4f1fl P ff?E?fV . ' ' '.1-,--As-Am-A-.Y-Y ' C gEszE5555gSiF:?:sfgifiitiiegg:1 R 1 ' - ' is fj A ,. X k I K L 1. LlONl1L ' vo - X U- , .' f ,..--N V - '--'--' o ' A ' I II I x , Vf' I Ulf!! - 'HH k II'IIII. ., ., .,I.,,, II.. ,III FIJIIU'-IEIIII If 'I'f'-III II1fl ' I ff I jf' I ,I Ig 1 ,,,, fff,nI ,U iff Irg fy , , , I I I N I IIIIH I ' I' ' If ' wi' - I I 'ff , , f-if II 'I ,III 'J 1V , TQ, 1, -X gjfgf -- iff If I 'I Yi- ,I ,fy IIIII'G'I'IVIIIIDL,I1IIIII 'IjI!I.IIII1 If I IIIIIILIIQI-,-I I.I 4, ,I-,., , -- f7 ' I' ,I I , I I , , ,ff , ff I I- ,rf ff ,. I fff, , , ,, Vr U f' J 4X f ff ff , . 4 7 I 1, WJ, ,ufff nf ,,f.,f , I, , f ,,, ,- , . X ,V - , ,ff ff f- .J 14- Y 'J .1 1 I :fi I f 1,1 2-.5 I 5.- I I I ,W ,,n. l.lY.4:mI! W . , A , , I - f,,,., Q1 Nm A X My X +I I I X A I - J I K' , IIIIII I IIII II I I I II I, I I I I I I II'7'!Nx II II I I I , I I I I I ' I I Q Ruff MIIIIII, ,-,I IW, ,I II WI -M ,.. --....M,A,I ,-f .,-A. f-----I ,T 7 ,J - - A --I ,M I-Q TJ II1,IHI3m!.I1Iww--uIQI,I.wmQIIAI'IIIQIQUIIEQQIII.I,,1f:I1mIrIIfIf- IIIIHMIILIM2Ismfu,I21m5I.2m:a1m,IigzamLT1i5Tff234' 1'fLLg1i'fWf 'fff' ' Tfffifaiif fu SSRI I, jf' I'?IgI'I I bf I II Ii: I I I QI I M 'I If' I If ,I Qrl I II ' f 4 ' . 6' I IES I 'I I I E Qi if I I Q9 I QQ f Iggiij I I I IIZEII '? ri? I WWI - I Q I 1 5.-1 I X fi A F., I I I T5 I I 1 1 SA- 1 I :112l 3 : I ,, ,f Photo by VVinn IVI ' Cl b I I anetta u I Pl: I N I 'WI I MA'rT11Ews L'NDEllVYO0D CONNOII lf IELDS BI.-XXNIXG ,EIIIII K 1 PETTY DUPREE SESSIONS GIIIGGS TODILIXSON E GLOVEII NASH B1S'l'IO1' E! 'mi I N J If IIW. I IDJII II Q, I Al '1 XV-I I 'af Q9 I IT, Z IIEII PQI! I 3 IINI 2 'NSI f I IQ I Z IEIII If WSJ' 9 I IINIII 4 - Z 7 I Ni' f : II' Z 'IQII Z IISII 2 I QM' f II II f IX-I f I ,W I 4 .INII g IIQIII 7 'I SI 4 .I QII Z In NI! X . Z . . 0 . 1 Photo by NYiun f I M1SS1SS1pp1 C ub MII f II I 2 I ,A Yum' If I,l'2l'l GANIIIN I IIIIJII-rs I l.xIII-:Ns'I'I:I N I QIIIA NnI,II:n ,IX N N IH XVI-:IICII UIIIIII WAIIIII-:N I ' Z S'I'llll!l.lNII IIIIIGSIIAIN' IVIOIIIIIS IN'IIxIIsII.xI.I I3I I'I'II:III-'III:I.II I Z R MI:-IIIIII,I-1 WII.I.I,x Ms lSIIII'rs XVI N li 1.1-:II .X I.I.I4:N .V 4 I I2 I5 I If IIMU- Qft --T A u IW Q, Il . I , W I .f ,QI I III I -IfIXv, IM LXAII I -I1-'I-'I -fII'IIHIII ? I' IMI ' X' PIII IIIIIIIIIIQIQ, ,Ig Rig ffm. I I I II, A 9 i 'I '+ 'KI'M'fTf'M'If'f'Iff'5 f'II2,,f f'f' S9-1 I. I .5:..xxmw:,aQy1s14sNt51SI, ' V I A I I' I II I 'I f 'I IQ! ' III'rf ' --' I I, I' I I . I nu, -W 5--I-A wft I Q... ,W ...III Y, 3 IIII ......KX.I . xlI'.4I X, N ,I II,I , ,V , f f, IL. I II IIKIM. I XX I NIIXIIIIIXNIII II I III I I IIIIIIIII, I X IQ AW I X I IRI I II . I I I I I EM Nan SSH sw' N ww ' R :Zi N.-u :ya 57 E15 AQ 'ffl yy W A A J, ff' 2-D-n - F. -fx X Iliff Q2 5 7 XV. Fira.-7 'B !,i1X Y X he 2-4j?,X'-Rx Lu'-S04 Q- fix? ' 44 Af' ' ' A5- vl11'f hf:L7,, fix , ffl' ,' 15, ' 11, , , , , , , A141 'L -. - , M, bgiiv QQmI:faXf3i7f,,fA if ' Tk' Q gf-2112 -T gig:i'?5'I,,5j'i Y VHF' '11111:::-:1m:m:,,.AfA mf -A T 'A'f2-if:L:16-:Ffa-f..2-,,.,.3..-.-. 5?.,.g.K'3f:l1 - J NA' ' '3T'Z4,,,x-f:i'f' A A ' -U' V21 Tl T7 ,E ,X H ' 1 Y- -J N11 NJ -N' i., ,Q --f ' . A A Thx- gg, ,f---W ------ -.----- ----. .-- ,wx-mmAhiww-Wm-www -A i A-' - xy -- - .f n'i ' ,' . fl H ' VA fy 3 Q 3 it if-5 Yi 1 ':msI' ' 1 I I li .mm Savannah Club LxNYG BI urs C T COIIINQ XDXNINUX IOIINSOX Iiflflhk M2 HKLL H0015 Hun ,ff Buowv S111 FI -Y Touxsov , S msn 1 in Xb Xl ll - s.. Q ge In P4 1 'N K ff--Q Tennessee Club BILIU Rb D xx mwx D U TN Jouxbox T1 smu Xxmn N BIFDSOI X ISI U' X W Iqrxm Hmm x Ixmnx O-1 x Nnlx, mmm in Q X'mwwWmNMmh Q, 33 if 0252 XX! VIIUX QR Wxxmn Nxmv I ' N n t I I ,S n EX A 1 QQ wi A n a A Ni! A0 A ,e JM . fx I , gr' ' W - f,.,..L ASL A e x Al .W R0 A: 'S, ... Ilrczluzs I 1 'nz I-,xnxx Hn uf. gg ' 'LY A . ,. .' .' 'l'I'llY lvlCHU'lllll Ilwm-X V' E .A Y . XS I Ii,llQYII1HPl' lrliltll x lfrlnyu llvfrf 1 x. II IIIX lump-1 lflkgl Q ' IV . V . . . . . , x w , P- 1 A x.. I,l'.I'I'I.l.ll H1n,n1-All, I.. Inn-Ax e e wa Q, n A-I4, A a A- ,G a rw ,-: 3-A -- A , 'T A A :Ilfp , ix , f u H2 e 5 'ff ' 4-- A a A 1 I A A AA , Q! A I ' A , W Is A A Q A a --.-A ' n -1- -- ,. a ' 1 2 ' 574: Af - 7 A- Z A-I 5343 ? - ' 151 N ? if if ? ' if if 4 if if 9 if if I K a x a pai ,fp ., Qin F U N M W MJ Y A 91' ' - '5' 'C . .' A: my Hmm -A ' H f A A V , Y 5 II xu'r1 wmv . A ,fi Sw? ,u C C A- A A A V ' . Q Q 5 v , - l',,VvI,ll la ff A A W 5 gm 2 A ee e dl, . 1. ix 'ZW ,ff if A. sy. xx 3 ,if Y A A 14fzf1f..-'P ',:f,x1-igL-V5-.iss-,X ee e we wjbl ' ' , -ix M ! +A - i5-2531-A-ii--f ' '4A l ' A H .. e Www:-. Aw- A EE 1. :rw Af --- e'f '-ea ' ' W AA Q5 'f h H gli M al l '7 ' ,H QTL 'A g, T Aff. 'avg ,,4Q?fA ' A A 'f1l1A' efQf1fgQlQffilfjAjijfT Qg5'QE e ' G4 A I Wm , 1 1 Wm 1 1111- 1 mniuwi uf lfifgfd WW wg 3 if' 1 I' W9 1 1 H rx E.-f, 11 I fi E3 L' KAL.. 1 11 ., 1 IEE e 1 :QE 1 U wif' ' if-1-Z 5 1' v 11 E21 9 1 1 11 1515 I X! NI-:P 1 1 me I 1 M 5 1513 l A W1 , P'-f I' 1wEi?11 1113:-115 ', 151 11 1,12-'Sl wil 1 113:13 Q :lil I1 if :ll 4 'SCM'- wr' Q 391 , 1 xA 41:54 X V923 17 ii? 'fi .Q 19: 1 1:-5-1 I 2-1. 1 K 1 'f 1 fiffl ,511 mg! + 1 W wg 174 1 4 ,, 1 41 Y Qi: L Q13 ' fl 3a1 1 N 1. ' ' ' U R ' 1-11W 11f1m11fQ. 1 P M' ' . ', ' 1, 1.1 . ,1 41 1 U ff- H5707 I 'W' WL K1 QQ M7341 ,Q 1 1 11111 wx ,S 'K 1W111y!1ll 1M,.,k. ,hj,k1fx 15. T535., - 1xCE - --'-v--,,. ...,, , ig- . , 1 ,fx ' '-we nmgjg' 1f11'f1fH 1'r1 ' ' ' 1 11 ,, - - -1---V W..-.--mv 1r4z11+11 1,11111fw'1-11segrggrg 1 ' ' H 1 ' , .,., 1 .. 1731 1 , V ,,, ,NN 3, -5 tl.. , 1,, , 1 f , ,fY,,f A, --4 .Q 2 1 f-f. i ' 'ffl -T44 ,ez Wifi? 'DC' ' ,,,, , 11f 13 'fQ1 fx , , Qi ici fl, 'zff W ff. ,,1 1, . 11,411 1 '51 ' fx, gi 1 fflfli. JJ. ' C. XE! X-- f 1794 1 x,j X .XXI ' Q ,gm A-Q fx Fix' 'fr 31 : Fw ,Nv1.y,. tx livf -1 in - X X. .1 I-11 ,5 , M1 X N 1 , 3111 'Q NU: .QW fj 11 vyyg 11,-1,5 fisw 1' ww 1 1 , 1 1-22 11 fbiig 1 r ' :-,. A 1 ',Q ' 1 W! V555 Mm MW I n X Ni: We hy, , 11 , 1 1 1. ,1111 , 1 1 , V, Y- ,. We , J T' 4 , . . ., . Q-1-,,.-.-,..,, ....-.zf -:,.v-...-.-..,--..., .. ,.......-, ,.. . ,,,,- A ' 1 A AF -.... ...,... ,. .,.. --.W ......,...----......,.....,. . . , - 4. -:.:.',,. A -,T 4 QNX RW S131 'S X1 1 1 S111 :EX S X4 1 N11 111 111 S N11 1 S Q 1 S11 x E X X S111 S1 ,yy XXX N sw 1 ' Q51 W N' 12 1' 1'.E'31 1: :X Q 1 1 Q R25 -Q VZ' A ,NO 1 129 I-121 11 2212 11 ff :QQ11 'Ni 'v If X IX: ,Q ,X, 1 1 1 22 :PS 1 1 .'l 1 M1 1 lv , 1 P 1 1' X 54 11 :va 1 12 1 if ,, X ,, Z4 iff f 55 '1 EZ 1 Z 1 55 5, J 57 1 45 Qx fi 1 ff ff fi f, ,A ,, 112, U4 1 fx-1-1 1 -f QTT1 ,aw A x 5 1 f'N1 VFX1 7 F X TI 1 1 1 i J xx . 1 1 X 1 . in-f 1 - 1 .,,,.f X ' 1 ,S--X M 1 I f Q C31 1 V I 5 ' ! 7 . 4., ?xiJ f-ix .155 ' ,V Xi- gi , - f -,- ff' X'T ,- N 1 '+rzi-.- 1 1 fa- 'MN-1 f 1 VTX 5-' Z --cf, 1-:kia-,j CYKYSXX z f ff- - W. 1 A 1-.Xff f . g UP? 3.1536 YLQFX X X iff' X : X -.Q ,Hifi 'I fly X X X yfx, .3 'XX XXX, 1 , Afwx- 1 wwf fl 1 11 '1 :igffPf 1 1 f' 1 ,11111.f1f.1f11 1 1 5. 2, ' ff X1 I X fcdtfp .V .. Rr X I 1 J X 1 '-' 'T - 1 .,.,:ff f 1X X1 x X1 1 11 1 2 , - X 11 1 1 1 -1 , 1X X ' XX X. X. 1 1 1 X11 11X 1 x f1f1M1 1 X XKXXX ,Lf I4-K -Y X 1XXu. 1 Y X' 'f'1' k ' 1 1 1 . 1111 X V' 1' 1 I ' ,' . N Q44 MX 1 1 1 1 J 1 '-- ,1-1 W ' xff,- V , 1 X ' -J! ,A ff ' , 1 ' 1' 2 f , A Af! - .ix -XX4-,,,,.-L':.Q 5--,.. L.--,--k-T' -1 iQ 'V 1 W ' ,., 1 XXX 'Xjlva f 'f 'gif JR bf! XX 1 V X ,X 1 LU XI1' X K 'XX Y 5 XX fx ' I Y 'x 1 X .,-- 'X- X ' X3 K x T A Q 2 I if ,f ' -' ' .N 1 I, ' xjxs A Z4 X X f 1 'fill' ' ' ' . X1 X 71 1 X CKJQE 'Y ff!4i'A 1-4 ' 1 'S + 1' , ' 1 1 if X l 1 f . f L- 1' 1 I -, ,,. - 1 X 0 1 X A 1 f 1 1X L11 - Z , X1 XFN, Q1 ,f-xx 'X-ff ,-,.,- Y1-- --- ---'- -A-N ' 1X,,,.,W....4.. ,,, ,, Q, . - -1 1 .. -.--..... - . -. ....-,.-.,...k,.- ..-W ............, . - -,., I xi Y I 3 , l , I :I I 1 . ' i 4 l V Z- 'f K 'tis 1 , ' vw. . i W -I is .ff'f ff... .. lk' , ,al 'rf Q' 1 H Ig,- , r I L QA I I A ly . E? V- K K x :?..Y,,,a1,,-,,l , lilgryi ,, llliimllillllfumgvllllllllillialvrvull n mmmm umummum nmuiniiiknhn. .Z-. iffffiia-1 .fm--. -.'... Am in mm.-..I1fffi-..... .' ,i1f,.,, M. .. ..........:,..: .,., .Wax .... :Eid-' ..,..,..- 1'...,m 1 .M uf' ' 1 .1 - '-H A v' l ll'liu lmlifi'.. ...i ... JIl1lWWllmli3 EllllHml llltllllilliiillltliilililiiillilllllitiillllllli ' ul f iZlII2 .5m E7ITl'V?5?EW'n't::v 's'l 1:7'i f57i Y '4'1f''fum e'ef'47:L1f:5f' ,- .5 A 0: f. X' I' xy i l'4,1llI S 41 Y ig , V' W ' LJATIEZR Forecast A Collection of All Matters 5:24 1 M Te -.S-were The Terror and Tatler Censored From Tech ean empeiature - Mean Publications Ev gy . , qs 1 , W, .- VOIUNIF' FOUR' L1 ' 1 QU ' APRIL Kiwi! . I ,. QU n Aurs lst, 1923 2 BALES or MARKS PER COPY ipfjq . li' if ' '1 yt , ,. 1 ,I 3, 'I .y ll. I . H ., li , A like 3 '-t4 is ' in W 941. f r i w R. -ggi .. . . . ,um , , .. H32 ' 'af ' -' 4- We 0-MW' yy!!! .sb Q t C w m..'f.,5', ' 1, sf .f GSP- If -sl , , 4- fy, . . j L xy . '74 g I. pw!! fi I. fi A 'I- l f if J f I e al If I... , X, 1 3 I I 3 X iii f ii 'li 1 sg . li lll U X fc .7rfff '!i5Nf'f l15i1'4l' it I I rf: G- eg! ' A r ':i'Z'f: , W . ,,. -I Ag. 2 -'T si- -tif 'X N.. K 11-1 l 1 - E -- , , if ,175 x gsm- ., ,NXFELT jfs -fX Am -- fe-1--ff R..?,Zfg4,f xg.- - ,s , - lfinf , nik! K' ' XIX? I I . A I I I Hafqamlf- ' i' LL , s l , lg wi Eel' ' l ' or '?' . 192 . I 1tor1a .Staff CD1 V55 Lett for the Seashore when we received the above pieture of our sponsors. ,X man is , r y Y Tong, SQ don t blame the Statt tor what you find in the following iawesg we didn't F 'I Wm do lt. ' L I C ' 'A' ' 4 1 W Q - . , , , nh l. FELL, OF BACQIJS-I,QXl'RAl'E SERMOB. IB THIS ISSUE! 'l I OPB' lltten 19244 By lhe lVllllC Handoff lVurst Scandal Svndieate.j lr V ' ' 1 4 V , ' , ' , , r 1 - ' G . 5 S: de1iVfgfe5ISll1al,dtbti9Ll'e1ioi and fattlei is tnst! lhe following Baceus-Lowrate sermon will be '1' of T cl gy ie iveiend. l astor N. Spoke before the graduating class of the Georgia School 4 biddgn SHO ogy In tie Sprlng of 1980, A.D. Qlieprinting in part or as a whole strietlv for- i x 2 ' I -T7 Q - 1 :gi -4 The sermon is as follows- W WWII I I 5 6 1 c . e , Y A ff Gentlemen- I 5' if . ' . , A 9 g I am particularly interested in you, young inen, because my son was onee a lneinber of 'I ,QV YOUI' uscliool. A smart lad, my son! He won his degree in one year-can von iniauine? One K Z year in Iech and winning the R. O. T- C. dc,gN.c.. U,uuQ:1,tm.., I mm Swwoul. Snmcs :md it 5: 1. Z really docs seem incredible, but I assure you that I havekthc proofs. K I Z Young men, you can be thankful, thankful because your degree is evidence of cu1tm.,.. Z You can be thankful that you are familiar with Plato, Shakespeare, and llnnvan. Some day I Z you may have occasion to read some of their works! ,You can be thankful that your elothinlr s ,Z distinctive, and that if you wear an old, worn-out suit people will ascribe it fo intellectual g independence rather. than necessity. Indeed, you have inug-11 to hc thankful for' 4 There is one point that I should like to impress more than any other I can think of and X 2' that is the value of teamwork. You simply cannot overestimate the value of teznn work! i Z When I was .in college 'two of my 'friends and myself would always pull together. In a qnizz I Z we would finish in half of the tune the rest of the elass took! How did we do it? I ask von, y I gentlemen, how did we do it? 'l'ezun work! Ah, there's nothing like tvmn work! ' N y 5 I fto be eonelndedj Z y AT 'l'IrIIS POINT 'l'I'Il!l SI'l'GAlil+lli. NVAS EGGED .XND 'l'OM.fX'l'Ol4ZD, 1 J Q I CCONCLUSIONQ Q f f 1- . -. au I - s 3' si, ,O'qffzf ..ix9 'xiii N - - .. ,gi e 'A' mls l xQ' .. A-, Y W , - ,ll - A -1i'7 qA '4 TIIQ-,L?',-gl T-5-f-I-Q' -f'ff.QQ -Jgrz. ' 11 . -hui '- f --'img ffflifl. fT'ifI1gil'T.Q1'1.1'.1' iigiiiiijimi, - W x J 1 im f ' ' Y f ,, N -- --... A ,, , .-- . , .1 Q . e--H----,Nf-!-.e:,.t--wY-v-.- vA,-V -W uf-,-.TT--13, 7 v U! ' L C' 'e QLX XJX ,I 'Q117-l1'i fFf.e !'S.1lll ' -'-'19 .lt I I X xux.-M s -sf ,,.-'O' ff Q, we . . 0612 : 17? ,qui -a qv .if I uw. gg F H ,Yi ' 1 Na-J w fiv 5 4 L KW? WRX XX S '05 9 L Qfful ff 52 X 4 was -N I .f- THE 21,4 ,- W f J rf-4 alnff I , , TrfQQ,2fa1gefQm11nu 1 11u11lH1111u111n1.1 .zzz ,gimj b Q ' wx U17 A'-f' .J A 'X iv A JN tv fs 711' N 'I joy X -r u rs X Q 11'1V1i1 -11 PLQMF1 .7 Ni 151 Lcyqq XXF X X 1111 x.,2'X N-rf' 1'w1 Il X li ,LX S' iDf.f v0 S2503 fy W-Elin Qi G5Ax J ap? lfixn by A t kk SQ,,, z.'.an .zirwivirzaiua 1.-zur: .xnszr7g N. XQANN -afawxxxxw. vac-wrcmmxxx wwmx X ENNO QR f 'OK X A-gl, X 1.10111-.1. K Rgukf- 1 1 1 1 1' ' V N f 11 1: 'F' - .f,-. '- 1 1' - 2 mg, WMI '11 1 W., - . .. A . b . ' LH l'31 WT ' 717+ W g,: X ... W -----.. ..... ...N 43 ...uaznm Y -. ,5 N W r. 1' ' ' , -f - 1 Q -A 1 W-,-H . ,-1 ,s 1 E :Si S X X '! f,. r,- , U. 1 X 1 , .- ' 1T 'f.f1f ' lm 1 ' - - -' - 1 1- - Y - 1 .1 1 N W ' ' .9 -r ' 111H1Iw11111- 1 1-1--11 -1' ,V 'Y - -x 2 'f 1 N :za C 1- Sf, Q .Y11,,1.111111 1 -1'1- Til: --1-A--14,79 LYYY 5?I.'1l.j,5' My 'N -NX' ' 3+-5 1 H 1 N 1-. . .r NN 111--L --.. ..... , A,.,A , ,,rw-'W f 1. , - -. 1 1 1 X 22 61 -- rx +1 '-M-Ov., '1 1 af: 1 E. I 2' W wi X XX XLNN-14 1.1 A N WH , 1 l- l x 1 ff. 1 1 ,..-,W 1 -1 1 Q ,I r X iw KN 11 -1. A S '. 1 S - - 1 -1 N .1 2 i UP ' 1 if E 1 5 R -Q3 1 1 1 - X X 1 1 -11 1 1 ., 5 1 1 1 1, 5 5 Y 1,11 f iff 1 13 3 ,. 15 1J? mv 1 X' '. , 1 im? 1 C 1 1 .-' : X kv 1 1 1 1 1 1 :iz Q 1 X 'M 1:5 ' 1 1 M .E q A 'V EVV JN1 1 1 is ' 111 1H1 11 - 1 X 5: 1 115 1 S 1 fi. 1 35 1 11 1 2 EE F? fx.11 1W? 13 1' 'Sf 2 1 1' ' if I fbi 1 11 1 J 1 1 1121 1 1 Q 1 QE- ' F5 . E .41 ' , N ' fl c 16311 ' 11 11 ' . , 11512 115, E l 41 1 - -Q X 3 15 51:1 - 1 1 1 ' 1 1111 .1 R? 1 192 1 112 my 41 -lllll. 1 1 1 R 1 .', - .1 11--f 1 5 N' 1 :gig I XY 111 ' '31-U 477A I Qi 1 4, 1 1lI 1. V 'X - pgyf Kg! ' 1 ' 1 n - E? wW ig 11 W3 F5 1 1 1- Q Q ' - 1.1: 1- 1 -ang . -11111 5 j 5 1 F215 LI 1 . BE it QE L HW. 1? 'ju U1 A 'V QE 1 We vu 11 I 11- 4 Q ,A1 X nlqf. I-41,1 1 '1 15 1 1 1w1 14. 5 '1 -- 1 '54 11111.-1 1 Q f 1 'QU fi.,1,,! 1 1 ' X-1 1 gs wi w 1 1 Lrgfi 1 Q: ' 9 Q ' 14 1 'f 1 1 1 fi 114 1 11 3 1411 1 :J 1 ,E f . .1111 1 11 1 r 1115 Q 1 1 ,E , 1.11 1 Eg 1 1 E QE IH1 1 Qs 5112 1 51 1 1' .5 .512 1 .5 , 1 .YE -n I Srzig 1 1 2 1 11 , f 1 1 1 1 ' ' 1 1 E 1 -2 ' . ' ' W ' ii 1 1 1 - -g .f 11 , 1 1, 1 1 1211 51 - X 3 4 E 2 - gggmwql mi an 12 f F AYTZQQTQA ' 1 11351 12 ' . i,, ' V11 :Z 1 Z ' 51: I I 5 ' - g.A-'3. 11 1 5: qv- Xi, ef. , A ' ', N25 ' 5 1 fl -9 S X f 'IVV 4-L U 1 VA 1 il: 1? 1 .. -1 , 1 LJ3g4ggd,f' 11-ff-1 '1' 1 Z ' 1f ' - ' '1 M 'ww' -f+1-:i?vLf121f?Q:v.lL.4,L.3gZL1. TETi57i '11 - ii fi 1 6, V 1 1.1, ,,.1 ,T,3L:u.,:LLlMiL,uLJm,- Ly- Uk- I , Z Z1 1 ,i 'W' X 125 1 X 117 J: 4, 1 If 1,1 1 1 1 5 , ggi' , gift- 1 ii 15 1 O 1 Af..- 'tf?--QQ-h' 1 1 139 1 1 1 151,-, -1 1 .1 2 1 Q jg.-11 1 -. -:- -. , - ...,,. , 'KSA' :gf K 1i -'YY 1 VJ A 1 A i f 15 S. EYE, 1 1 Q 111,13 ,gwg1.f:3.gi.1g1':: ,Tflk if - -W 5 I TwsZ5gf,f::fif1 M 1 1' 1 f J 'A 1 1' 4 r ,,c it 1 5- ' ' or X f if '-1-ff m. , . ,,,avfw' t L., ., wg!mmmgg1uxiuggiggigmzl:::a:':mununiil I uu1.1mul1uaIuinnI1nnn1wihiiiin...,.i,...u,I-I L-'-ffl.---mu ------. W-f,-,.....n4-1-of.-.1Q1..mWf.ff-., ,.1.,,,,,,,........ ...... ,.......... . ,--i--J1fv-.-2.- ....... ................ - ... ,.... .,.-- , ,.-.mm 1 ...Qu ,.:1 ' in fr H E P M i S . in. 'ir iv! V? 1 il' ar I w W: f , -Q RNX X ,--f f I 1 I tl I ZA f ll l D L ihllgii. ll' nl .. . ....... -. .. . . E-.- A -.., 1 ' .. .-sa 1 lg llhlhn ............... . .4ss:znzmsnmuuzrzamll llIlliIIBHIIIIIIIIIIIIIISIIKIIHIE IM253illilllllillllillllllilllil!IlHIlllIlI ' III-fl-I H-NIIUISSIFI---u--w -----f ----FL f--- ----IIS!---531411-IBIS-FII-53:-I M --w - 1 ra fff' , 4 :E -I ef Q ' si? I r I 1 ' , ,f if f ames Pharmacy , Yell fi 'THE DEPENDABLE DR UG STORE lf, 1 1 ii A We built our reputation on quality merchandise and our prices are commensurate with quality of 5 lfxis goods sold. My ,iw . 4 If your prescription bears a James label you may be assured of PURITY. ,gl :tl . ii fl' , Q Just drop zn and make yourself at home agp n fl -'HT if 1 I p . Hi! 1 ames Pharmacy , W rl lv' LJ Il xl CORNER NORTH AVENUE AND WEST PEACHTREE l ' i xf we I l , I .llllln ? ah? .W , 3 ll 4 Standard Pharmac , You'll like them 1 E ?'. rua H wlx i n :IIE Y 1 E 1 l . 1 7 1 1 l 1 l 9 lr I E 4 4 Z 4 I I 4 y f 2 4 3 1 2 i li 4 1 Z ' 2 2 Z 4 n I N C . Cox and White, Proprietors Prescription Dmggists Telephones: Hem. 0866, Hem. 0279 Hem. 9159 Pay Station Q Toilet Articles, Drug Sundries Stationery, Soda Water, Cigars, Cigarettes, Tobacco, Etc. - ,:, - CORNER NORTH AVE. AND LUCKY ST. o - 0,0 You will like our sandwiches because they are so tasty. , Made on Sandwich Shop toast. Also good waffles, fresh eggs, fruits, etc. Drop in for a regular meal. Something that is- so different. 0 0.0 Sandwich Shop No. I OWNED AND OPERATED BY TECH MEN 113 N. Pryor Street Opposite Candler Bldg. f I 51 VTE l l 93, '53 l W 1, W 'fs IJ .w ll r l 5 N ' 1 X 6 'Q S ,. I I s V k X X N. Z x f 9 l 1 n S 3: x x 5 x it 5 rl A K1 , XX' QQ 'T' l KJ 1 E 1 ,,,,,,, ci-1--f 5' aid 4 AQ. I C X P O Z 166.1 ,E i, 1 I fx - -. ..,, EE., ll. - . mms. P E- 1:4 F '- 'fr2f'111'1S.TTr-,:2.'::gz::,,7l1 -. 2 ' - ' . f '-11121 g,Q:EE:::,,,m:r-4-if ' 1 - -,-Me,,fd-fQiEff'?PE?rrf?f:f1f:E:1f:f:1?tQi0 6 W I I, 1 1 ,,l.. ...Q ' ' ' ' N -u. ' .- D l s QT -+x:..k, -- - -- --- 4- Q' fJi:':n..'?- SQ V I' aff Aef' I LJ. 3 IH1'S mmluimnxmmasuwqa Lx' ,---4,-ugififv, --.Z - ' - , 44-5 H I5 LV EL P 12,1 fe? s 1 t . 'il f Q H Q H is .f x 1 My xif M ' 'W' ' '--' +-Y------ --Q---1 7 W ...--' Lb I u 51 XX NOW Eff-V Axqercr-aou' Anqus mcllufll 'Bound' Hoool INIQH1' cmd Normmq,- 'LKJA' . t it G 0 .F J i X4 06069 PM KB..1.. OL-.. m'rL.., 1. in m 1 V Vdksu in dad qv 7-. -, I -,'.-.- -., ANC! 5'fru'H'ed Hs - 5Tuf-F, -TEN M Q M ' A T54 ' Fsnvall ' hd d 'my R W-O M lt' To gre A ' +1.26 E TMC r 's M? 'VU' -Ny 'kl ' Had Hey bhsf il-nrt.: 'Ihmr hides Xkux C Munn Wei' ll' mm 7 1 ' ' ' QQv1purnd wxih X..-, NMMA 4 V' X . Q, X 1 it ' a Q 1 D A H- MN- M1 f XX ,ULU ' D . j,i4.. Tf,- 'X' . 1. I S Q ..5-' . ' , , . Full Moray years passed XNh.l, M.. L. ...L rx ,.,L,- ww.. , 9..,1f'- 5 ANA poor IXNQUW NQDQFG, AN'-X p W 'V' NW FWHM'- Wnflw hrs mn Bchx Kqppq Dlvmlvd MU-1 N-K HW- UWM cm 'uw W-,tx Qc- mf, Swv, lf ut. N VM- 2 Is MG':a5CxqQxNq 'Hua xwnqhwuyw UNK' w H'l'4 ' '-'x' ANd 5Qv'qJduNc' Nw Xwqd, Vw M-t-1-P-4 ' 5 To QurNx'9X'x, his Qxqhf XNQIJKNYY dmhxv nm-ul uf-fu - -X14-M LUV' H VM' g had 'wha Q V'--N Y I Nfxfdlw lwQud - ' This is the story of Johnny McGuire, ' 4 .Mu 4 K N. -M f X Suu CAl'T.XIN C10 unc wwf ilu- prv-scngr-rQ T'Vho ran through. the town. with his Ir0n.wr.e 14-:ming m-pr 11,9 ,hilfg milj: S',,m11Qr, 07 fire- lad? Xvffllk si4u11:1Cl1? He zotgclzt fo the doctors and famtcd 791111 P-xssnxmin Uwrwmlwz MUCH. aim I rzgzt . . l , , mihnz: xt ru fnr ns the rvsl fvf H1f'I11f' IfVhen the doctor told lum his and was in I ' sight. G40-Q.f.fag :. '5 ' .0 ,, '1 i Q--fr--1117! xiuv-:JYg . . -, -. .. -. w X 1 1-,:Q-9,51-1-1-i-1-z-.I' V EIB fi. ix .WE Ez' 5 'hifi--Q-Q-3-lil---3-'-5--1f Q2Ff,:1l45l?g6f,J1l'QQl9l9:9li- ,J XXXXXXTBPYX Nag! fri Gxxgi ,isgsgg ,Z ?.,.,fg, ,W W, Q -- J ---.uswfox-, if-2532.-i'fw.:' Q- ,-ff ',' - Lnonex. rc- ' 'Q RQ., fi!-,,',gv' 7,1 : QF':,--'-? '-ffw ' 1 2-S 1 1 ,. 11 1 N1 K.,-, BN Z' - 1 new,,,mi!!,,,,:gHm u::,...,., mm. . ...... .. .........,...,.... 1.1- 1...t .,...... ...,-.,. ..,... . 1 -.1, f1' --- 11 f---' 11 --'-' ---'---'---'--f,- '1' 1 1114M'-1-- I 'mf--1 1 mg- 1. MW BLVE P 11,1 1 1Q 1 1111 ..... 11 .... . ........,.... .i......i. ...... 1mm1.1.-.11..11-.-1.--1- 1i W'Q runner-1--M-W -'Q' - ' fm- - iv S 141 11 1 111 1 1 -1 1111 B, 11,11 1 1' I ' ' 1 1 1 1 1 1 11 111 1: , 1 if 11111 - 1 1111, 4 11 11, 'V 11'1 O H1 1 ' 1' ' -I 1 11 1l1 1: 1 1 111 11 E 11.111, ' ' 11111111 1: 11 11,1 1, ' It, 1111111 I 111 11 1 1 1' 1' 1 1 I 11 11 Tech e 1 11 1111 1 Makes Make 11 1 1 3 1 111 Better Men Better Bread 1 . W, 1. 11 11 '11, 1 1 1111 1' UUE 1 1. 11.1 11 1 1 1111 'A ,, x 111 'ni 23 UNCLE SAM BRE D ' l , 511 1 11 1 12 1 li 11 1 55 V151 52. 1 1? 1 1 11 1411 1 '11 1 I 111 ' W f1 51' 11 11 5gf 11 :S 1 1b j I 14 J Al ' 4 ' I' ', -7 1 1 1 1S!'l, plz A l,1 1431 11.9 ?'1l 1711 1 131,11 The Qualzty Loaf 11' X V H OW 11 31' 1 '1 - 1 'V' '1 ' 1 1 1 11 fa I fr? 1 .4 11 t ,1 1 ' 1 1 57 b 1 1 1 1 A 1 P' . 1 J ' Q ' E22 1 1 Z . 1 1 7 1 1 9 1 Z , TE 1 Z , ' 1 1 Z . Z . ' 1? 1 pf 4 x '11 1 I 1 Z ei 4 'Q Z 23 5 Ig. 9 1, 96 IX 19 1 xv !! N Full Welght 1 11 1'1111 Properly Made 1, T1 1. :H111 M 1 Very Best of Materlals 1 I 4 Y 1 1 1 ' 1 5111 '1 1 We ,l 1 5 Your grocer has zt, or he can get zt 1 111 1' '- 1 1111f :fi 1 1 -1' Schlesinger Meyer Baking Co 11'11. 1 . 111411 ATLANTA 1 1' 1,3 111'1i 11' 1 H1111 . V. M31 11111111 1 11111 1 11 1,11 1 1 1, 1 111 . 1, 1 111 ,111 31111 1 U-N 1:2151 HQUQXBX 1 1 ' J 'fx 5 It 1' X . :1 X,.Q,,,' ,, V, 1, f T C 4 V4 ' yy6:5J,w' IF 173 wif XO LU ,'11 f Y...... ,,,. - Y,-' 111 'Q' .' X 1 -1 1' 1 '1 ' f -' '-- M- rwnvf '-f+-- ' S ' '1 - 1- -fr . W - ' ,Y.Y 7.1, ,gr ,,,-1: 5 ..,.... ,,,, -., , ,, ,W ,,,,,,,,. 4-.-...-2 'T 111 11' ' '-Hwwwddf-T7 4-iZ'.:f Y'.5.3.5F5i7A-M'.7Z7'F13j',5f'9i'T-ix' I' ,g 1, ww XX A' T-1411 -JR' HQ Q . '.'I .LQ ' Q 'Q ' 1 '1 1-11 N1 11 1 I 1.1011 11.1, ,Q Q1 - 11,5 'TJX 'I' Q,'11v,'l,Q!,-2,n91fp1f-ff --L-YT, X ' ' 'WL' ' ' W ' -'-' 12 5 -'N 1-',1N 1 111 1 J XQQEQXJ 111 ,I n in A , 4' ' I l, V Y, - .4.,f , ,LVL P PCI The Thanks and Patronage of the The1es a Reason Student Body ' FOR THAT - O are due Clean Cut lsig I fl ' X I XX .. Kem ws + , i X :aug I 'Q F4 M A elx W 1 -as v I I L x X ya ' ef: I 1: :mn S xmmr umm: ' ' X ' J? h 1- S N rp r Kr ,I .L I -1. ' ,l 5 I , I .h II A - Q X E. ml' I - , QT, I Ei! ham..-E. lllll ll ' -: x Te I Q K' Tm' J' I Q I I If 'I X ' Q '- 2 N I F' QI I X -Q W f v S a. , Wil' X :Tr I I S: G 2 I I S I I X .Q s I or S A ' I-I X I 5 I Q I X f II I ' is 1 ' S 'I' I X ,. ' ' I Q , I X - I 5: . . S S I I x W min V4 P4 I I3 5- I we . -Im-Q ffs l II I 9, f F f I? I I QI ,AFA N Q... Metropolitan Look I,:, I ' lu . I . ' u It I , 1 1 4 r , 1 , , II I. Iva ,,f fm fy , 4,5 MII . 'MII I ' I 1: : OU1' Advertlsers ,Is I - E Wh , -It's Your Haircut Iif I o have alded us so sub- ,ISI I Tl I f I2 I stantlally ln financing the - -' - 'QQ 5 I 923 J ' B b Sh Ill Kg, erry s ar er op I I th G ' T 41137 Il C CCI' lan CTFBCC Il I f BLUE PRINT g km -IM -me Iwpi e Ig,-I, ugwlzjg QIQQI Imp C - . . , 3,95 I hild Health Qrganization ofAmer1ca I , I-arg I, A Health ln Education W3-Qi I r The Child Health Organization has undertaken a nation-wide canipxiiirn to 1-:II I I the health standard of the school child. I I If The following books are now ready: Rosy Cheeks and Strong Heart Rhymes of Cho-Cho's Grandma A I Cho-Cho and The Health Fairy 5L Child Health Alphabet ,I 'Price list furnished upon application. Order from any of the following: :addresses of HE MACMILLAN COMPANY ATLANTA NEW YORK CHICAGO SAN FRANCISCO BOSTON DALLAS A Other b00ks published by Child Health Organization of America should be ordered dirr-rt from Childs Health Organization of America. Penn Mutual Building. 370 Seventh Avenue. New Yr-rl: City, br from the United States Bureau of Education, Washington. D. C. L7 E I O 1 IIIQII .I sl , , ge?-'fgih QL EJ A A 'L 5 Ig-TJTQ7 so A .-fvif ,LIONEL K- c xr ox -1,9 11.-. f tspaf-. 4 xQ5,5jf' 4 4 I . ', - .g. . V n.: 1 I 2-: - -2- 9 :2' .3 - lzivi J. W films . X . is ' Af f ,ff l E A f' ' ,. lllml IIlIlllliilllllllllllllllilll illllfilli u--f-1n1 1 -1--- I1-fu Lf 1----f' -4-U 'z ' ' : 1' ' ' ' :' ' ' ::' -LW ruff 4 1 rx n i5 4as-:muu:nxu:4a::l1::a:x::::::umn::u :::z::::::: ... .:.:u::::x::. .::t::. ssszzisulnlzsexslsasaeunzmzi'-V , ,, , ,-- -'ww ---- --f---'M ' Y ---H 1. ..... ,E il lg l il is P il ll l ag Li ft i ll' f fl f I o 0 o , 2,4 Scmdfwzch Speczczlzsts ' l f' I P m l 3' lr sl ' i if LUNCHES, CIGARS l ag 11 . 9 nf l A ND S ODA S ji ll QW 4 9 N ' 'i ff ' TECH S BEST FRIE D l f' ff vi i ' 1 it Lp OPEN 'TIL 1 A. M SLX E. NOR TH AVE. IL J , , 331 4 aeQ 'i' 4 1k C 1 C b ' L b 1 ' rysta ar onlc a oratory . I LQ i ATLANTA, GEORGIA lf g I X MANUFACTURERS OF '1 if CR YST N ff w l AL BRA D P is Qt q ' Carb ' A 'd G 'll ' 0 n z C cz as P f W l 2 QLIQUEFIEDJ i 2 The only Gas in the South made by the Old Reliable wet method t 1 5 Satisfied customers for twenty years is the proof of its superiority hz, Z OUR MOTTO- Purity of Product, Prompt Service, Polite Treatment Z f 4 Z ' Z Z P 0 x A E --Ar.:.'g' f:iifT 'i???:9f311: QSC.. it-,O RD 'ii yfv' - T' f---V ---f A-5 gg- - 1' -2- --333:73-Q, 5 K :I this J P 5 gg p A 1fwIfTG'G it P P P P Qi- 1 1 'iii ' i QP ?'t:if'f-.. f- 'jig --'A' I 3 1 5 5 5 T3 s S S S 5 N ME We r W 1 I E U? 4 + 'lb I W 1, 'N fs! Il I 5 'Ili 1 F r +7 f n HN 4. 1+ 1, I 1 fl ll I i I .E ti 1 U nf is I til E1 il 1 T? 1 6 EI il I! 'I W , , I. si 5 u r n v lil, ai 'I xr 'n T' V, w l, ,. I. ie 2 . ,. ,, ,, .. :Q , . ,I H 7 I f 4 v fy 1 V, X fs , - 1925, . ef zsasa En nu sll l- . VK , , ,,- W Y TILE D LV P ILI iiall 'h t px , ' r is g g 1 Atlanta Consewatory ? fi Q . T 5 'I 3 of MUSIC T 68 50 if WIC-u.s.vA1j0'G' i i . 3 i ' l E SPALDING The Foremost School of Fine Arts In The South dl r To be well equipped is as satisfy- mg as to be well dressed. Q - I 1 -, Rerg isldao suclistiicgte 0 pa mg ual . ,T IF IT'S SPALDING'S, IT'S RZGHT S U M M E' R S S I O N Q Catalogue mailed on request. mf: X - . Gen. F. Lindncr, Director W w 1 . . QW Mm X if X Z6 Peachtree and Broad Streets I 1 74 NO. BROAD ST., ATLANTA, GA. ATLANTA, GEORGIA FF :Tea N Y- M, W w i' ac ww-f ' A '-'.. J . The Cheapest M Zgx Way to Da te -QQ-X 8 -1 fn- JMW' + 2 R E N T A N E W ,o 2 F 0 R D The u Drive It Yourself , T -,P Florshelm 2 ' ff U . DRIV - IT OC System of Atlanta For the Mazz who Cares 5 ! 5 I9James st. Ivy 3266 I7 PEACHTREE sr. ffl r fi X T54 ,bmgqugm pm ---. .. exezszvrmasxvmxxssgwwww-1-3'f'f'1':'HSOwiiigi 54 LONEL K T I 7 Q 3312 1 rr 's 5 . 5' , fi 5s ,. 'Z fo ,. I 5. . ,Q f 34 I' ,. '. 3 ,. 3. 1' ff 7 9 . V A -ulln' 'mv . I SA u. lu ' 1 ll' AP in Lim 1 tai ' Fm, Y XXX XXX NBA N ef r H E 15 L s s P, t Iwi- i nrpifrlnrv r'y':y V American Book Company KINCORPORATED IN NEW YORKJ Publishers of School and College Textbooks Southern Department A. I. 2-4 No Branham, Manager rth Forsyth Street ATLANTA, GEORGIA NEW YORK CINCINNA TI CHICAGO BOSTON , xr Q N ,Lf CUSITHIIINISII ll ITHOUTTHI IXNOV INC! 0l1TlxVON Ixl ID! 10lUl'0N IHI' C0 N Sflt VA fllflf ljl l'.lllfA Y' lb l'fll'l'OAl'llOS'l'llL'.lf IAA Cl.C7THlf.S' DL'Vl'l OPLD l'0lr C0l.l.l'C'l' VFX. ll H11 ll Pl'Al'l'C I CO YSIDIPA- IJYOA H43 b'l'lf.N C lI'l'Y IU I'Hl:' IIIODFIIA C' 1241 lfl' IS Ol' Fllxbl' l1llPORT.-4A Cf BOY!! .-IS Yxl.'l'.1lxI7W IIIA 1c1111 usa IND SIAIICI FORTY DOLLARS A X D fll0lx I IFHNCC 5West 4-6 th Street NEW YORK A'HEZ7'.WZZ'27'?' f'7 iZ?'.fd' : Fx wxxx XX Km.QN's ' s Q I I I V r ffl 4542, I , 1 5 1 .yur ,Lf rg' I .K A' H N - .- P1 . -,:' -up Q Q-rf. u. fir -4 jhd! wi I l .EH 'A ln V qw 'V 11N 1 , 41' 1 1 .31 1 1 1 S 11 15 15 'Q 11 1 11 r X , 115 TEE Lf 11 Q 1?-E. E 1 , P4 ...A 1 , 1 P-I 1? ofa' 1, I A 1? 112 112 16 1 11 11 111 11 11 11 1 1, 111. 1 1 5 J P75 2 17 I I' 1 ,5 ,. 5: I 52 O X IE r :t 1 1:2 . .O 1 1 f 1 1 .1 NU 1 4 1 EE 1 LIIII4 ffm, 1 M C 1291: 1551 Y 51151 Q Y Y 1. 11 1 1 1 1 I Q5 521- -F N - 1 XVZ 1? 1, 'TE 115. fx I ,ff 1. gk, -4 .Tm '-'F-A-wL.1.,'f-. gglglllqm i V wx gsauaaaammmxx 1 H1111 313,15 Q'-Ng EW ' L lnz. '-'wflf15'.ff: -:'f 7-'y' . 'g'N.- ,.-Y Y 111 11, .1111 F1 Tig' 1 xi -T' -rv fwg X ' 1-.Z-. ,111 1 JH4- fx ff 5' :Z , , j11I111 1 111111 M Ei I Nfl x , -, ...., ...:-- ,,......W,,,:-iii Q' 1 f.--,.,f 41703 ' 'A----4- '--- ---..--. ,.., ff, ,W 1 1 ... 1 .I W. 3 , 5 Z ' '5S3elQQ- 1 Exclilzms F11011 Tm: 17l.x11v or x I I XPP C5 -5 . 1 X 1 '-1 1 , - f, ' 2:5 13 f Q- -1 ' .3 -- A ' ' r ff v v.xv.'xy'-'qq- 35 LL., L 'Y 5 51 ' 16cgxQe24o2QbxfrxQ33'v.--xi :':1-'i-54-4 ------1,-3:-J-r-'if -- ,I ij? : F il X if ' Q'--liiggx c 'gl' 5 , f ' 515' LlONEL K' X - XA V X, ,- f ,Lk-, V.',- ,Q g, f- -ff 1 1 - 'SX .1 'ML X E V. . A '7 4 Pl . . - s el T ' I 4.1 J., . ll Ke'f'M'Z'f l I V4:' . Mg!!,iimglilzggiulligxg l,,,,,,,,,, ,,,,,, - ,,,4,,,,,,,,,, m,,, g,Q ,,,!, ,, ,,u, ,.,,.,,,,..5 Q:.ZTf ,... , T v.,. A--Q- f4'- -vfi A A A ----1- u WTHE: DLVE.: P KI l-is lI,,i,.,,: iz ..-.. -,-,-. 4 13, ,,,,,,,,,,,,,,,,,, ,,,,,,m,,,,,,,,,,,,,., ,,,,,,,, mm, ,,,,,,,,,,:,,,,,,,,,,,,,, ,,,,,,,,,,,,,, ,,,, ,,,,,,,,,,,,,,,,,g,,g,gwgnm1::muag - -::::::::u:au.':::: - '- -'-- '-'asum' --- I - -f--A-eff. -----W -'12-.-.--. Ml 3 A f l? MHDT DGGSH THAT EXPLAIN THEMSELVES Q 55 W DINTY lVIO0RE'S PLACE A We Never Sleep 151 ' r l 22 all When You Eat ICE CREAM L g Eat The Best A :W E MADE BY W ,Q V 0 j' essup 8: Antrlm lce Cream Co. A 1 , ' A , E , FRATERNITY P I N S E M B L E M S H O P MEDALS 200 METROPOLITAN BUILDING 3 CLASS FORSYTH AND LUCKIE s'rs. DANCE PROGRAMS Q CLUB ATLANTA AND STATIONERY V 4 3 V 5 Z 5 ? 7 5 Z, 5 I A I I Z I 4 4 Z 6 I E 1 M1 Us fz, SPECIAL ORDERS SOLICITED--DESIGNS FURNISHED WITHOUT OBLIGATION CLANTON 8: WEBB-COMPANY RHODES BUILDING, ATLANTA, GA. Footballs Baseballs Masks Basket-Balls Gloves Bats Volley-Balls Mitts Uniforms .2-' ' - A. p .1gCre'Q..:5.fffflX1x Q i I W.. J' I MM M Y Q- ...ff 'lcd . Qu XX of . Q f W W- 7 VVKVV V Q A-ess. 'laxqi -A' 'QQ-aff ,AQ -f- Weil' R LV' f V ' ' L :vs LUQ A-0 T 'N IE.: Q ll T . r 137' sf: T T o . 1:5 i W 2 A 1 135' fi , ,l , TNQPQ 'spy W -ku lk .dst . ll vb: X it . ' M. l .l, Qi S is l S I s ,N N S l 'S 'S is N E S N is S TN l S ' i t -I n '1 -Hn IK? 1 l li g XXl U it 5 ,I clll ,T P 5. ef' My x 4, 9 6 2' 2 2 2 l ' C 7 E P 1 l Q ,Q -, Q:-,AM-L' X 197,11 Q E 'Tx C X- X ! ,g XX X. N X X 1 '. ' Y if . fl 555555. 1 cd-11 ' ' lgiigclliiuiilfi ......... i ..... , .i:::::::::::::::::::::::.-U ---- D P RJ I i 'wi X 5. ---. .............. ,Qs A,,A: E . M ,.XXX l .SDJ 432 Jil? lx 3:12 v FA. A i -P Y 'lyk IXX,-xl' X i 1' Y t LM l 2 ' n 1 . Q l lx .1 ' l l 1 'Ez Q ' 1-E : 'Z l ' il - vu ' i l : N l li l l 'X l Ei l il l i l if l l . . 5 l ' I lfffilll: 'll 4-rv you :nt tha- lmlii-s' fm,-L4 l l X X ' nwvt r I li : L X , X X Xl ill1'r:lX,xw: XYvs. :xml thi' lap you ran ' f 05- e IX In thosv tight skirts was :I r.-w1:,1i..,,X '5 1 X R ' I J I .. - . l . Y. i - Q I mssuzz Mm lmrrul fl,g,,gX . X .Q ' H nf- 1 I 5 f ' .. - , . - . 2 r' l gm PIN TIE: uTh,lt S0 HX' X Ill.X'll, I- ,xTIH,llZ 'X tlllllll mnu. hum, un 5 5 XX L L 1.ePeI.tOi1.eX,, C l 'mo llflfl fl MFEC out in this plum- :il tc-n-thirty. F 1 x04 . aa - . inn i l.lIlI'l'N'1N nz 1 ll , H 1 lk , ll '. A '-,'.7Xf: Siilglgxocgn. AliIn't lt the truth, now, und XIXXXH INV.. ',.,,, l',,,min,,iXXXX :XL XXXX'XXXXXX:X'Xl'lli -lllllr , y u S1393 Uf lf, l1C1' dress onlv lllZlliC ' ' ' ll l l lt look worse. ' j X AX vis 1533! lliznn Dov: NK hnl ls in ilu- -4-,. In-xj,l,.g Sl 75,1 , smlium vhlflricla- :incl mlm-iuni plump i 13311: Shavmg Songs of Famous Profs 'l'f:,u..-iz: l-'islu-sf' gi fm llggl DR. PERRY: g Sl-Al II- , Lily, lily of the mpzey- X, X, A .1 nl Kscrapel Agcrapefj 0 41 Jw ' , ' ' 1 TX!! To bask amacl thy fragrant svmzfs, 'f' .W ' fS'C'7 f P'09 ' lf?i3t.'Q Ei I wcmder abse1zt-minded, dilly, daily, I X 'lfl-ig' 2: fSU7'Cl1J6f Scrapefj : lf, X , . i Xj And an a.bsent-minded f1l0Ilfl,If gvlx :nw ' , X :Q offense! I X ' ,f l. X IQ . C SC?1'-7'-7'-l'-'I'-'I'-7'-H110.I Q Q- i X A 1 X Ah! A b0lIf'1Lt'if'llll fhouglitf Lvl us rlzuwll upon I!-N l nf-so! i 5, X 5 1 fi . its s : Bo-CAT: w g. X su- gr? , lj 1 -.1 gn, :, 1 ,X fNeC6sSity has IIUVCI' hccn thc lllllllll'l' Of -Mm -S ' . 's4,.,- Q , invention in his cuscnj ff 71 7 fj l V l -'yr f l il J Fnooouzz X' X'X1nlX:, rf xx 3, H0-7111-1r1.' fpuff-puffl 110-hum .' Xl 3' 1 , 3 fCI'Clf'1m'! Ur-r-r-11r'1f.'j -Lg' I ' I must tell 'mn my fflZ'Ul'ifl' punf filjhi ' l fCrmrl.'.' Cl'-I'-I'!Il'A'.'j .Tia - X If they laugh in my vluss . X in X H . At flzis pzziz-111031 slmll pass: . - u f A ' And iliegfll know if by Iwurl vrv l'm flfnuz' fCrar'k! Cr-r-r-r-r-ackfj ,X X i ...,- ' XV! '14 ' . ll 4 Oh! I Cun't ever hc a pretty girl. wuilccl ' little Susie Smith. Ono of my km-cs is l'no1ur:n Sozvipn: Pulling on wr-l' from crooked. ,.iU,,.r 4-nd. F2 . ,, l , ,1 f5X l .i 1 CX iiff'-lsfftll.-'.' X: gan f u an s 4 KX : XX Sg Qf!Sg-LALXX-XC, v v - N.xwmw-xxx-xv-.sw-:-X-.r.-.-.'.-Ifqi if gf-2 fi f-'- 'f-'-fuzsfx.. x'5.X'Y'X' 7X , J-.. .,,, X4 'Xmis Q, .X x --s -if-:fi .4-.:, mg. it fill- .. , JpX X L no N e 1. K- KA'-U i ' . r' - w X 6 'WE L f,, , NSA ' -F 93 . s s 5. P ' - ., X x fu if f Y ' rs-ff 'K' K ,, f fi' . f 'rkgfifw or f .fff Xi f 7 2 ff gsm: U - nu u mm: lllllllllll mlulllmlumilmul lllllh- v--1f--f ui-mu --vf--w if --uu m -------v'-v--1+- I-mlwi 'f ' ' 1 ' ' ' ,mir ' ' Sr i x N l' ll l H E. I5 L V E. P PJ 5 ' new . all ,ll W- s , o 1 qrff' H.. . mluulxasunlluzmllnll In B1 'V' A A illllllllll mm lllillllill-1fvI!IillIHIlll ' :lil lmlllllillllillllilllll itllllzllml 'g-- rn A-+v'-'- A-FETEM 'f'fX 'f 2 W f 'F:fJl1i TLLT rw gf' 3 l? Q 0 Q mi r I I Y. 1 -Q fl 01-o--m-Q-c1-o--x-0-1-O-Jn-Oo:-n.2'o-J--O'JD-O 'O gil RQ o ' 1 0 l Q 6 O 0' 1 ' Hote S tat QI' V ' BUFFALO I si 6 ' o 41 M . 450 Rooms 450 Baths , i, I l V LE a' I. 0 O CLEIGZAND 0 4 0 A 1000 Rooms 1000 Baths ' ' ' T 6 Q Dzmoz . ggi ' 1000 Rooms 1000 Baths ' - . i l Q , 0 O - . Iv ., Lb i S71 LUUIS E 6 sso Rooms sso Baths 6 4 , Every guest-room in each of these hotels has private 0 I bath, circulating ice water and other unusual conven I iences Morning paper deli-vered free to every bedroom ,-it u , Club breakfasts club luncheons and club dinners 'X i W, 5 4, F 4 Q 0 e ennsy vama fi A q ' Y W X ' ' , New York - Statler- operated 6 I . . N 9 The Largest Hotel m the World . l 5 ' :zoo Rooms zzoo Baths l 2 Seventh Ave.. 32nd to 33rd Sn., opp. Pennsylvania Termlxul ' 1 i O X Q - ' 1 l 51 ll 4 .Nl X .dof A Z 00 V ..,r4 '. 'l f o ' 6 X uf, I D'-l. . . 4 l 1 Z 'O -9: lf 'lli A O l' i 6 ' 'I 5 -'X 'X . 2'- ' 4 X -1 .iv has . - Z -l P7313 3 Ll : 4.9-Ulm -' - x g 4 so ,.i:,n': um: I I . D ,.ln1l1-.x O f ' v .- 1-0 '--' :'-l r-.llllll 2 Q ..il'l...'.al nu 14. .I Nw.. - g ::!:.::2:g:1Snn3 Pg- Z:-Q .::i :ff Y ' 'I . Eff' 71' ': . C Z 5EE:E22?2Ei:::3g l-If 12. 2.1 1. z . nn-ll ' :'lU' ' i ll. Q -. H? 2 7 au' - i -1 l I A.. L ,. ..... ..... 5 i Q., N ie.rlllll11ll fEll1lf4?lJ1f W Z :fri -,534 .Lf I U - ' t 'fi ::.- i X: Z i i j06.'L-3,-95:-fi iv fi Vigil! X ,af ,,L0T. ' ,il ILNQE U th .4 - A 'uf nge' ll.llll1m,.'--IU H ,W , - - , 7, 1- i N' ' v -.,-.:.- -,1Tg,,...-,.,,::,,--T:, ,,,, -'g3,1ti,igg:7'i:1T: . ,I ' H X, , f ' 'iii 1 ,, , ,L , 'ifii i ,.., ' :'ii:.1t I'flTLi'l'l.'fI'jf , 'if' li l gifs ' N ' SZUYTMT' ii 'A Q11-K--H 'IJ li -Ql?.5Q.Q-.-lz fl57 -'7l: iiH- -ui so A' Q., D T L. IQ? 1- T T Ni, ITN NI x 1 4 T T P T M N T T T '13 ' V3 ..l , y A .A f ' T ' I ' 9 25 S 4 QA I I T :M X I Mfr ' X: -2-:-Q.,--1 5 pf xx 1 x a gn v v - I f In x K ' ul 15 I Y' I-Ituumnmmunmm numxnxn1x,s...x!w'-n,m1f , :C dw 1. ,,, J i '6 jf ' xy' fl 4 if qi' D 5-I 5 iuixlliilcii-EEZ.........a.....,. .nanaam ---- ,,, T ,fig ls 3 CIE -' 'V AN Speczalzstsf PHONE IVY 3460 WEA INSUR D U N L P CANDLER BLDG ATLANTA GA A I 7 ' MO TAG BROTHERS .1 INCORPORATED 4152. ,Am .144 MANIUFACTURI RS OF Fzne College Statz01ze1y ENVELOPES TABLETS SCHOOL SUPPLIES ETC ATLANTA GEORGIA Q2E TANK ' uw .... L T LLL EL ,QLTQTQ .-,p A IT . T T21 HT Ig t. Tri ,Z T :N ex ET Pl T4- ..- Q21 ,fo Af- 'N I 1 'Ali 4 SU . ' 1 : o 1 E ET' er r' ' E Nil -A xv, -T N15 A A 52 ggi? 'j - if T TN! ' A if T gil: A ' A ' A 13 T T 1, - ' ' sf ' i TI -, ' .. . lf: ' 1. if A - AATE A -T M Tig, 1 L 1 . . .-Ry 1 , 4 D M l ' A T 'E H I . I T ba A T I , A WEN T , T .5 BE gig Ti V J 1 1' T '- 1' ' ' T H' I Sf I 2 I l . A ' up A E' I 5:-1 ! I T i f -:ww--' I f T ' ' f A fi T . ' ' 'E ? ' f A ' ' T Q T ' T? ' - : T xi A 52 TZ!! A Z . 'E Y T I- VI T 5 . T . u . 5 fi 1 'T T f 1 It T A . 0 if i gi! A ' I 29 I 1' ' 1 fs? if ' in A 1: 4 1 If A 1 - ' ' 24 I 55 5 A T Q il - ff? i AQ T 3 ' TTA A 5 T T gn Y A T f 1 ZW 3 5 T gg ,Q A f ,I 5',.f N if-in Lx 5-f ,,f' A ,QNX l Q' MW' A cf 1 ':4'x 1 1- S 1vT4:'iii,lgi,1i ,TT T iff 5 71 'T T T-TWTETTO ,Lx 'ju -' rf.. .T TN vb' Fi .- - 1 :N T -A T -ff' -'-- -ff' -T4.'.'4 ' -'ff-'V'-7-T-v ' --'- 3,3-:T 5 STE, If .X Af L w f ,. - 1 TTA Legg, -ix,E-if,:Q,f'E.:J:'g'vQ-7 jx 14,f- Viv Y ' ' 2 ' ' Llowm K T51 M I . , .-f':EgE'k V' I! Vg? uno: H K A 'A I? I N I wg, Ilia Lfn' WI 41 W . , XR v I ' .I 1 b 1 l ,l wa . ' FN A Y ee A .e..f 1 ffm U H3 rx , H , , 'fl 4, -,aw X l iff' f fx. , Y, ' , , e M e 1 1. , , . nlm!!ll,,:gwumg::,,,,,,,,,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,,,,,,,,,,,i,,,,,,,,,.,,,,,,,,.,,,,,,u,,,.,,, ......,..,.......,..-m.---- '--m-'-'w-f--fH-'--- V 4 V V E: P ILI i la x - 1 m mm: nnnunmaxnnnuuun man :mum um - u:::::::u::::m:::ms:m:z:::.zr ' ' 3' S: e e e e e JZX e 0 L! , t fn age! ll ll'St ' 121 .3 V O 1 ffm ' You score extra pomts ,gg gi S 9213! 8 with this bottle or glass VS I SE! NEI- UQ rmk L ' ' 2 e faqs: .:, l gm' 5 17 H 5 W! , if I ala Sffgfpqlf l w fn- v 4 V v-n ri- .-1 .f 'l '1 -ISN JEL-'W ' as - .. Q J- i I I -,-nite P 44 E Le ,W M ' Tw- - 3 1 . 'xr' 5 1.3 ff Z ' 1 .. f ff Z 522 H f ' .J f 9 .. 7 1:1 Z E52 f .j. 3 Z ' 5. :I 159- jg I 4: X: f N :ji Ky , 5' T5 I' ,-nw A A, ,lj 3 , H . e , .. ., 1 .' ' , MH N x 1 NX ' l 232 fffffgiif ' Ppiimx-'k iw i f ,BX -.- HM- '- e I ' 33: , gg- 14 ,l.'1: 9 M, , l . X7 1... , 7 . ji iii! U jx U Q ', c, M xnxx 2 if Mg' 1 M 3 Q, arf . -1 ?ia.j'2si:j'4,4,4, -Q I f X3 3161?'13aism.,x e. Y , '- .Ag ,-'QM' ' .Q mfr. ,XP ,'-s-,YK-, by-H1 pa f. ,rg ax. f f ?1Q Q : Lyn KJ ,gfin v1i',g' L f --x- JM-' ' 4' ,.-,Q -.11 Ilqf-i rmf? Y in Delicious and Refre shing f 5 The Coca C011 Co , Atlanta, Ga .1 ' 'Tfx fghi- 1.1 Qqji . 1' Mmm? , , n Q 'ul , :QB L gi : UQ! 1, , e av af f ! ' M H . U 3! fs : , S1 id if . I f :I U g ,f Q rf 'N N-- GX W R O lm , X YI , U k Mu, X.: .- T ' - -Q '.-- fx f K1 f X ,e , e A R x N 2 1, 4 f i.flA31'i'4 ' N f y :X 4' E- ' wp Q 2 ' Q f ' 1 + s f f ' f Q 4 9 4 S ff' Q Q Q I ' L . 4 o X Z V, N, ' SL: 3 x H X ?c AIQQ' e ee e , Ae,, me G- ,144 A YQ M X2- Ge- ee e ee e e A 9 J L Y Ifllltl :LL K W 7 V IYVQ V YA V Vw 'P Y-ix-.QM '23 W Y---EL:L,,,l2,'Y ,'b ,. ,- X rt-Qu I Y l I N N Y f 4 ,X e B 1 L AJ X5 y er mb V. milhuuxu ....... 651555. Rl 3' r Z2 lx .E x l 1-C- --: .x K.-, 2-1 'J'- -v, x. 5 i i l E - f l -' - -Q 'F MA Q ' -4' ' ' eg.,-, ,6?Yi'1 y '- : ' L.!925 ,ll l - 1, cw - E gigsQREgEmg!!lnl2iE:g5g::a:mxs:almunl:lamnT emi-nslmsuuenflgsis , ,, , V in ' ,I A ' ff' 'nf X 'f. N V Egllaliulzxl-z5fEz... ,... ., f:::::::u:::.-ar - .....-..,..f- 1 ,- Q xii L- -ivi N A N ' - . N P '- N - , N -Q l Q , My Q i l l X V xl X 2 L S lf iz Q . l , li S E- 4 ll' ii Y, 4, l 'E S 5 . s li N ' v f '1 Q I , l RQ i I TE 5 V l in , I VA s Z Q I A ii If x N .-K! .4 I i R , , - Ei 5 a 3 Bl l E Q 5 'li ' ig i, -l .L x. A ., l 'X Z, lil: Ili lx 1 5, L-,-1 - ,i..1Q,,. ,Um , , 5 -Hlllx l liilliilx :li 1-1 l ' ll--ll will 1111.1 ' K Q 1 ll ' All Xl 5 I .lf ' I Wall! kv Ilwx 4 4 l..,1 1 ,Vi QI .li lrllil lli- - u li H l H i im l l i i l ,X l l 'His l 'l-. A IF M21 M4 fi nil Q M' . il i, 139,15 L , 1.5! gil l wil -, -4' fi . li-NJ l Q 5,25 li l It was ll sott, lllllllly Spring night. Thi' ' 'Qu 2, moon was :lt ils xcllilh. mulling ils lllvllllw . . U E l ' l Y i l'2lKll2lIll'00l1 thx' gjl'1'i'l15XYJll'tl frmii ll vlilillllwx i 'l' ' H4 v lily l 11 rl sky lVlll'll Dolph IHlN5lUIIJll1'lf' ill-vlllrl-ll hi fl 7' 'J K' luvc l 71 N ' f i l E My llJll'lllllI,u lil- l'l'El-ll, wiilliullx, in l ll1 N l X ' . l , i 5 vilwzllll' with vllioliml. I will lay my l l'llllll 1 ll Qi lwsiclv ylllll' fl'1'l. I ' 5: D Uh, lllll your flll'llllll' ix lllll wry l,il'g-'. l 2' ' Clmvtl thc olljl-cf of his :itll-vlivvli. i li S Nu, llc' l'4'plil'll. Jllll'4'll4lllJlll'll Nllllpllll yr 5 his 2ll'llI zllwlllllcl lll'l' lrilll wnixl. l-Hf il lllll X ' 9 look l1ll'g1'1' lN'Slil1'l'41lII' lilly' fvvlf' i , Ill' wull ll1'l'. 4 9 A A 5 2 f fi 4 :I 2 U0-C,x'l': My gmail lllslll. jllll lull l-Hi' Vx l l 2 1 llllcv lhl- slrvvl Pill' llUlll1'.n 'l ' 1' I 5 KNOX: 'Sli' Ill? lixllvf lxllvx Wlllllfllhl lf? lllfrl f ll- Nl 1 :Z 5 llll' llic f-'f- lwvll il ill lhv ll-wllslllf' i mu- i- 1 1 l E2 Y 7 1' A. '7 4 S l' if 3 ., . 7: ,ix .I , If my - fx l M--- ffl ' E i K -, 5 ffiii- - 'f'f77i17'1iTfff7iittttfiuigymffgg1, , g 011- f gi' ' ,,,.-6,F,,gV2k X -llkifrh L I, -A -Q f 7 , - LJ. ..' -Y ' E Llorihl. K X -'kg 'I V 4 I g 'f,fLL 'f- ki? A 4 f'. rt-- Y: I-21 H4 ' n Q? Q .1 .V . u H FZ . FY I qt A 5 i p I I ' ,mb . , :,.,, ,,. . . ,,... B .,.. , ff..j mm,m , ,,,, '- 'f,..,,,,,-...,...,.,,.,,,,,,.,.,,.,.,..1:1.fim,3 .T ,.1.,.. .,.. l.....i......-.1f- -..- 25.1:... ,.. . : .::. .:... ' fn-- '--- -an-mmfun ,mum ,H .. sig' :-'fr' ,. . In., ! .i, TTTH A DL AP1L1 EL ' ' ' - Wu an gr, , -Y A , ,,.,,,.., ,... - ,A ,..,..,. ........... - ..,.... .A,,, ,-,,,.,.a,,,.,,,....L..,...L........:.... ....., A .... ,..,.. e..f.4...r,-,,a.,,..,...,,-.,::x..-.. ,,.,.. ..-46.0 .. man... ..... . ..- 'i!:......i?f? W XTC I V3 gf: ' E 4 I. 13: 1 I , llllllllllllllllllllllllllIIllllllllllllllllllllllllllllllllllllllllllllllIlllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIlllllIllllllllllllllllllllllllllllllIlllllllllllllllllllllllllllllllllllll llllllllllllllllllllllllllllllllllllllllllllllllIllllIIIIIllllIIllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIIIIIllIlllllllIHlllIIIllllIllllllllllllllllllllllllllllllllllllllllIllllllllllllllIIllllllIllllllllllllllllllllllll Q if A l 3 A d ' N 5 A 2 ' 7' . 2 CORNER LINDEN AND l 'f ' PEACHTREE STREETS iq 1 I 5' E 11' eh ' d EA T ,il everyt mg t at zs goo to vp 1 4 qc- N iy1a:a!f - lg ll At. T 534.5 , - gl IIllIllllIHIllIIIIIIllIIlIllllllllllHHIIllIlilllIHHIHIIlIIIllIllIllIllIlIllIllIlllllHIllIIllIIllIllIlllIIIIIHHlIIIllIllIIIllllllIllIIHUllIUHIllIHHHllllIHIIllIllllllIIIIllIllIIlllllllllIllllllIllHIllIllllllllmllllllmlnl 'all -I- j llllllllllllIIlllllllIIllllllIIIIIIIIllllllllIIIHHIIllllllIlllllliIllllllIllllllllIIlllllllllllllllIIIIllllllIIIIHHIlllllllllllllllllllllIlllllllIllllllllHllllllIllllllllllllllllIllllllllIIIlllllllllllllllllIllIIllllllllllllllllllllllll 1 ' 944 ' W in ' A if 1 M 1, . ,Y Fil ' M C M C C 1 ' f CO. OOIC CC feafn O., HC. ggi .F T- ' MANUFACTURERS OF 45 1 1 l ' 4 gl! I I . 11 Q The Better Kznd of Pure Ice Cream 5 A Healthful Food and Leading Dessert, I , Prepared in as Modern, Spotless Factory. T ' N .4 5' 51-53 East Alabama Street '-1: - ' 9 ATLANTA 5 1 .g. 4 'C-Z 1 5 T , . , 1 X BECAUSE OUR ICE CREAM HAS ALWAYS ' 55 BEEN JUST A LITTLE BETTER - WE I 5:3 CAN SAY THE SAME ABOUT OUR BUSINESS A s i E3 ' 1 , Main 4164 Telephones Mam 3323 E 5 E' ' O fog: E 54.2 ,nr - U j'o23'.sSN.gqQR5-1fnx:.f:5Q.:-:gmz-:1:25:3wQ4-szr:-rx-rx ws-1-:-21 -f-'-1-rf:-PQQEQXQ 33:5 j ggj'CQ?-,Yam971114Wfmrwwwfflxvmififfakcwffvm727 ,fm g -1 L1 rj, fl-3 4 , 11- vi.. S ' :- ix Q Lllr-:L p- V Ql x ' ' ' 'CDR f f I -LV'I' XgQ?fS'S-5-filfio x? 1 5 I f I I, s Aa 41935. v M 1' gg., , L ee P PJ I Georgla School of Technology pg: I fx I v wr' , .ff Mx' we A I ' A N I ' X r A ,lgllligs I i:4 .- 1 I ki-5.-:II 2 Q' vm --Q 3 I I I I II ' if It I I Iwi! ' ' .law Q .fx N I ti: I A If I QI I Z 't I I ' 7 I I S Z 0 I: I I N f N 4 A 6 it ? N 4 L A -' 'LE 521 fri.- FFQQA! giin iii Tzxxxx I It IE: 4 ,Qt -H N Q. ' . I 5 a , . III II Q I I N, I Ii In p I I 'I .51 ,, . I. Ili I 7 I I 2 .. I 1 A TECHNICAL sCHooL WITH It-EI AZ I 'X - Ol Ii' I Z A NATIONAL REPUTATION I 3' Z I I2 I till 4 fl THE GEORGIA SCHOOL OF TECHNOLOGY offers I to young men of ability and ambition a training which 22 I will fit them for positions of responsibility and power. The national reputation of this institution is based not I on claims, but oII results. Its greatest asset is the Q55 record which its alumni are making in the productive Yfil I work of the world. Georgia Tech graduates succeed Q-, 9'-.75 I because they have been trained both to think scien- Q I tifically and to work efficiently. IM ' Complete courses in MEC'IIANlC'AI,. ELI'If I'RICAL, CIVIL, CHEMICAL, AUToIIoIzII,I-: AND TEXTILE IQ: ENGINEERING, CIIEMISTRY. AIICIIITICCTLIRE. I I COMMERCE AND INIJL'STRIAI, EDUCATION, I I Q ,Q I INFANTRY, COAST ARTII,I,I'IRY. SIGNAL CORPS. I If I AIR SERVICE, MOTOR TRANSPORT. AND ORD- , NANCE UNITS or TIIIQ II. o. T. C. I I2 , III ' 4 li I 3 It For Further Information. Address I I THE REGIsTR.-In IEEQ :Ii Georgia School of Technology ATLANTA. GEORGIA I - I I3 I I G-'gift .4I' LVL' fi , L, YTZVI if I Q -, -1 -,., ,. :A Hi,TTT,f 'i11i fiiw I it f fi-3, 'TA' X f' L A f. f. xi SJ I-3-' I4 . , V' Ia? 4 ,, I.- I 'M 714 .5 32 ,HAZ .ei ! T I u -- A ' ..-. ' I -, f'I-I-S , I III I I H . Vg? I ,I - ........ Robert 6: Company f ff A INCORPORATED S. 3 . . A 5 Archztects and Engzneers S f N I I I A T L A N T A ,E-1 5 gl NU I . CANDLER BUILDING RED CROSS BUILDING I ' I A I ' I I 5 I I i w I IIIII? ' . 0 0 I Deflance Sales Corporatlon I, 5 I P I , I N MANUFACTURERS AND IMPORTERS OF 5 V- ff I 'I I I ? Mathematzcal Insfruments, I Drawing Materials ARCHITECTS' and ENGINEERS' SUPPLIES 227 SOUTH BROAD STREET PHILADELPHIA, PA. A E, U A 2 SE' , I - S I I I-A l xwemmeImsSfmwMm+vmx.-:wfxm-rx-xxx-Nw-wx-.4-vZ- gg I EEEX fH i'flf!Z'i,W'f0WlW!h7!W ! ' , I - ' . I I ..,, ..i..,,. . n G .. ax umnm xmusqaa '!f 5 43 ' - - - Q. mlm--5--'Q-,i,-Zfiliigm-2IJ'xii. 1 1' ,, - ul: . 3. e w a D LVE P I x 1 x . ' J: 5 .MY mf 1 --rl: u .. . I , , , ,,:',,,,f, y M 'I' H I Q in ' 4 , I . ,Im , : fi... um' Iii I IL ' 55 s Y A 5 i l A 9,-'gl I f I M N m U 4 e , :ffl l I I v , , .. Q, M x I yi x:xl'..v 'JD Il - 1 x S.5L.5 111-11 C'.-Ijllf IJ' jjj' 1-jjfff A l ' , V- e 1 - . - . 3 'E I J' I I f3fCI I167' fun! af mnr orlorkg '- - L h Life nfrrr .-'ffrnfd Su 4-:pf-11, I 'f 1 f 'Yi' S nw 'IH ,WWTF 0. l k fI 7i'fl FFHHC Iur mimi rg ff, , 'J And Imlprfl mv' mill: his ffff. , -A l'.y.1 - .E -, X- X I I.-I33f'lI'IIOT an Ilm nfIrrn,,,,,,. 'Z Bb 'gg X .'I'IIfI Ju.-'I as .vim :nm 1,07-5,,,7. E 322, X I ' ll SIN? f 7jlI.ll .WIHI 03 .vhp I,fy5',-yd LU' I Il I ' . N Are yrru magrryrfl II1lx ,rrning I I2 ' I 2 I . I' .Ll-5 I Ifimrfl Iffr in IInf mm,,,1i,,1,f. ' I ' .Vy Izrrul :mm in a :,:'I1irl,' I -ti, .lly mfnlllr nnrl 0.4113 in rw full uf img, N . I 36 I fi .lly nrmx :cf rr full ,,f ,,jr1A ' . 3 I - . . l xr . 5 . I Iil.V.N'l-II Inr in my 1Irrun1.' lImI ni.1I1I,' ' J 7Ilf' IL'II.v :L'IIIIfIfIl1l,i ,Q-gt-,Ili A I l, O gs IIIII I flTi'flII'f', l'IH'll,lIlIfIlI, ' 1' .-Inrl found I'fl ki.-'.-ffl Ihr vhul I I Af I WA - . G ' I I.'l.YSt lI Ill I' Ill IIN' FIU.-'.1 ruuyyg , , TIN? fIIIlfI'.s' ll I 1 - ' Young hopeful, aged slxteen, called up I , H H 5 ' QQ .Q . , U lurnml umuml mul .mrs III: l'r.,y', I I ,. GC01g'CttC, a college wldow of long standing . In . - I: N I IAIIHIP FIIIIIIIU I11nI,,yy,, UH' Qc .gil aged twenty-four, for a date. ' - 1- , k,A tc as - sc v Q v I -y W-tgndeidbnczi, she saxd. I cant go out I k,'W,, ,Hr ,H HH !,'m,,H' W Ullllln- ' lui af af y- U U H , , .'IlllI 7lI.ll I:l'llI,ll IAWL1' l'1lIIlff ,,I,',I,I,',m1,l- X-:FI tmp Please pardon me, he l'CpllCKl, I dldnt 11,, r,,,,, ,,, ,, ,. H , A, A V .1-. f-S 'he' knOw,,- - l 1 11 .A Il. ,Hula I 1-.1 III! -,F A .lI-ll Illia' UIHI 1',IflIi'.V 75117 rffI:IIl-'Il, 'N-3756, ml? 3, '11 I I1'i.w'.-'ul Irrr in IIff lmrlffr, Ulf' .M I frll 7nI1.wIf flrfm' Ifriulj 5421 -lllllu. I 1 . I ' ' ' ' ' I null nfl fr Inf ufrIu:1lrl1rI'Af7l7nr - '1 I' I IIIYIIII ffm lIl1Il'Il ' I '.-'I . ,nun . ,. Bl rd . . I N7 I Iva.-'.-'HI Iur In IIN lurll l'I llIl.' 'viz-Y L Ifrlfflrr I I. nah' In 1' flflmf, slr' I I IIIIIHIIIII IImI I Imfl ,-ful, 1, jf' . Vf 5 IIIII I In.-I lIljlh'frI1'I: uufl rImz'11. I , V Ig: I Iff.-'H :I In r In IIN 1'r,--ljlfulf, ' 'Q I -rlrnrnrfl flu' mffrr mul mffrf, ' 2' I E61 III In I.'i.-.Q Ilrr :Iliff 11,1-:III - If IIIII I.'l'.-MII II1r f'I .'IIl:l flf,,ff'. I EE I I.'f.-wrfl In r in Iarr Iiznff1l.w'n1 , I ' NIH Ill.-IMI :IUHII If: 711r 1- 54 Xi IIIIV IIHII.-H71 Irfl III: Ivfnfifrwyzwf I .Infl 1-lizrllufl I-NIH al Inf I I.'f.1.'r II I1f7' In I1r7' IJWI1 'VIH'-f, Iful 1111! .W f,rrrfufI'f1,' ' .IHII :.'I1r'n I I7'a'rfI if 'Inf' frfmiu A I ' I Ili.-.-mi IIN .iifrrr fral, If ' 2' , ..., 5' I 2 NIAY: 'WX oulql you XVCJII' :I l'vl1lL'4l lmlll- I I.'7.f.iI:I unfi I.'1.wf.r' nn.-I I.v.f.frvi fha! J7zrI, V ' 3 ing Suit? UI: :gm Ifr wnffu mn' ' ' Juxlcz It depends on whore the rent ,I'Il'77l.'lIl Ilffjf 'vii Imvi ,uf mf In -1 :gIu'rl, l f lsuv ,Yul 11 .-i11.,1Ir ffm' 55.1.1 lf:-rr,' f 3 I ' I , 5 If I I I is . ' R, a A Q ,e fl il? 1 f ' XSNI' ,V-' xx- t 'X ,- -'IQ' .B I O ,f'53:f,mN'fAa e e 1764 -v ' I !i I, I -ff' 5 2 filwffl' 1-MH -f fT5f -M621 fr, -ff 1 1-if FRI X' P., .L ,H -, - q,--.-f..,--- yt ' Ji ,ggn ,- XM.. f ' 1- Y- -fl--f9i:'fe?fS' 5s:2t'fff 'f' LIONEL K- 1, X Q- X11 ,lv 1,-If l w L 15 r. A .0 .Na ' J I 'Q xx X 5 r , c s W ' 9 29, . . A K L . fx, 5 - :I 'Q T if. Egnaggigggggniw -L-iuzqn IlllHlIllllllll6SHll-RIAIANIIIIIIDQIHUIIBI nn-umu -:vi ..'mn.-Eh ,--- mmm1-ll'anr:11-xl-1I'11'r1vl1lfI1-I - -'xl-v---'-- - - - 'l ' 1' ' ' ' - '- 'v ' Iv l2rvv-1-1:: -. T H E L V P ILI lillahig' ......... . .azz - L mn. ' V MLW- - F--V-F .--A-, ..' ,- ,.,..,..,, v. v-wwf-42 ' ' fQ-- xm' -v um. + H ui .x::::2m:u::'.::::: . ..-.- :fin ...... Y: X L 4.1, f 5 2 1 Q T 4 if if N N f SE 5 T is if - S 6 T2 I 'ii . ,gm X Q - ' az: 1: 4 E7 l-.Mfr it 19,3 -all T , gi-f QQ! ' I y uw + Th '1 f f' C1 lf C 1I11t1a S O 3 F1611 1 I vi' , 1 fl A. - T . . Il 'Q You will find these letters on many tools by which l EN electricity works. They are on great generators M used by electric light and power companiesg and on lamps that light millions of homes. They are on big motors that pull railway trainsg and on tiny motors that make hard housework By such tools electricity dispels the dark and lifts J ii heavy burdens from human shoulders. Hence the T Q letters G-E are more than a trademark. They are 511 X . . . . . -:' S an emblem of service-the 1n1t1als of a friend. if rig 1 QQ . .g. , sir a c 73 r or r Q KCgffvfiwyfffnfimwfnfffflfaWwYwNff0wWff L ' ffmx v - - - X:'CZ'1l' 'xg - ' T , A L co '51 -af f Q C ' ' at 1T..,1 fi, 1 f'57 X0 - o . XX rw: w' ' gbs.3i5 f, X E 53 bi 1 I li I r X , C w f , Y P I 1 yi.. -N511----1-v-svf.,4, l--gif' X . r 1 ' ' . A -'H' - -fc' -I XX X I 4' 5, ,Q ,h E 1 'nr' - I ,N , ilxq -FWQN V 3 3 il:-1 gb if f 'X wf' . g n - U4 L1 m mw ii ...-. I-A 'Q N ' 11 T H I 5 L V E4 'W- P M - w w ,.,:., FMF IWW 5 -Q--W mm N 1 'E NAT KAISER 'N ' M C G 0 , I rl C g ' I A I Us 1 'I , ESTABLISHED 1893 A 5 si . 1 51 .IE WELERS and SIL VERSMITHS 1 ' . I i f2 'Q S . 5 52+ . . , V 8 .f ' , WATCHES-DIAMGNDS-JEWELRY I Gifts That Last yt Z 's 1. n. 1. '. A . 1 X v , 1 1 ' . v I K . , v ' 'C I, .' . 4 , ,:.,.. 5 L I e I-, v 'I 1 .1 'J v .,1 I , 1 , 1 1 1 n uf ,a f 1 f w 1 ,. gs if! . ,, ,, 4 , x 1 1. No. 3 Peachtree Street Phone Wal. l9lO ll I I S 1'F f Q A-H - A'-f .5 ff l l b wp 7 e-ee iw glllnl . N ' 1 Ad ir gl Senter VV 3 Egg S til 3 ' 5? l ENGINEERS and BUILDERS , H 'Z 5 I HEALEY BUILDING S i :I 1 i 2 ATLANTA, GA. 9 3 '- 5 ff?-ta. ' I-AN 'il 'Eg-:il AV I-E-HQ!-1 -EA I moyer. K T Q --f , any Q .fvrv . .'-- ,fe . X N P.f:4..,,.1 -' '-:T A fQe,e: ,L .. :Tv ' ki '- I ,Q t fx f-:,f1fIrft5.If 4421 l. if-I Wo I I n , . . l f to W e w new If ' ' ' I Z' ' - -- - P- I x Q' 1:41--t ' : Ia' H .ai .,-II il I fI 'V I' IAQ' ' N 'I XI I I' I 'X I' I ' ' 5 1 I - -A I , .I t I if '1.,.....,-f .LI . - , .r .L I ...c . - . 1, num -'J 'm33:m:ul5:3:::: V 0 ' MQW - C II Ihillil Q ' II 'H' I 22.11 ef I an 13 -455952: fi ' I5?55J I - I II I . ' I 'gx I fif x , iii The Complete Project 'wav I I I-1- Q3: ANI I X hr lbe Standard I II Oil Building I I: New York Cify ,I gzg . A - IIg55fI I CARRERE 'I 3 . and X gy I ogg' I HASTINGS I R If . Architects I 4,39 e t I 4.3, Il Cs, I I . I It 'Vu IIE. I .- IICEIII, is Inf II 2? 'I -..' ' 0. III if QQ IIIEFIII K., I,-I I Wliisilg I PIII: ISQQZZ ' 120' ' ' .Ky pg K ' I A V4 FN t - ro? .L 4 E lllg I I Pt 1 d , II I ' I ' I I I Ruhr M l I 11 95 I we if' .. . SW I , VIII I - .I I 5 I I 9 IF2- I Y' . 4 It? I fi I I 2:1 X , I FII ' 3 ii . f Iffil. I ,N 91' ' I I Mu. rs. uu. 1 , 5 IISQE51 ,.,., ., , . 'A ff 1 A A o ff fe .III 1 oe . few rc zieomre I . -Fill if ' :-.-z . f DISTINCTLY new tendency is apparent in architectural ' HZQEEQII thought and design today. Architects are designing in Z masses-the great silhouette, the profile of the building has 9 I QII become of far greater importance than its detail. I There is a new vigor and ruggedness even in. buildings which are conven- WI II tionally classic in their detail. Masses mount upward, supporting the tower, 5 I SHI accentuating its height. The new architecture is tending toward great struc- Img? tures rather than multiplicity of detail. . H? Certainly modern invention-modern engineering skill and organization, 5 will prove more than equal to the demands ofthe architecture of the future. I f' Ia otis E1.EVA,ro,-R COMPANY 5 I Off-ICES in all Principal Cities of the World tr' I 'JI ' ' I I IE I ? Zed I 9 .f:- ' ,j'7f'15' A I , t ,ffm vig' N '-,- ,Que Iigbi W. r U 1 . e T I . 1 IJ yi A 'K' N21 li lv W 7' Q2,e,,,.:.:.,,, .:::.-,-:-:'f:f:f-1-1-:f Eif I ij 325 429VafffffffwfwWnffiffffxfffzvwmVfMmfMxf V11 Q V 3 .-'I, 1g.Q'-,fi , E- ' 'f:,g1'L-S W we ' ,ef L 'C 5 5 L 1. v vv AP 1 U .. :--..., nga.. Ei Q FN, S S S 2 , 'u -4 S J .11 QE' ' 'W 18' 1 '4 1 QU-1 U, ' 1 1 I lllll' I 0 Y an 4 4' 1 2 1 I 11 R324 5' Ze LF.. Q' i g' ff 25 1 AW f7I:f+'5.. 'X - A .rf ' . . 'K li '-fb?-1 , PQ lf? 0 1' X-:-1.,.f.w..-'I 4' .fx . h nt 51 241 2 -- ,f 4,, - W A, -- --, ,, , .- .- 4 .:, . -:pxxxmsxa nm 1 :cm ..,,, .... ....: .,.. - 1- - ' --. - 1 ,Fl ' - 1-1 - -- ---. q......- .,.,i..m...,-,,,.,,,,, A - . .- 1 1 J 55 -.Q -- '- 4 - 1' -1' XX, ... , 1, . 1, 1 1 A 5' . , 1 1. .--L., JL, ,,,, , , 1 1 .4 '11 1 2 5 ? 3 Q Q f V 5 Q 2 4 4 Z Z 2 4 4 f 4 5 i 1? ff 1,5 I. qu. 111 1 1,53 I ld- A '. mr! 44 11 ' 1 ' Wil 1' I llll YECSD A xi' N 1'.J 14- Q52 15. .35 if Q. 1.51 N 5 E MQ: ,Q-: it 1191 1 P .. W f ,,:1i,.,1H Q 14 K ,, Q' l'?- i Hairy-- K Gi, 0 XO-' 45 R A .OJ J, ji vi, : I . wxkxx L Ax . A. Q I., ,J f-X Y ' 1 , 1 U . 1 .r 1 firm f ' 1 4 1 4 1 1 4 . , I 1 , -. 1 I 1 . .- , y 1 4 ' A cr: 'l'I11-y t1-ll lm' Um! mor Hill VlS'Nf'll H I I out HVM: Y1'w: ln' su:1ll11xu'd :n 1ln'rll1ullu'!1'r and died by dc-gre-1-1-. J Ho: R1'111imix 1111- nf Ill? slug, Ile- :dv up Slllllf' W'1'llil'N :md mn up Hur' nllvy :end dim! hy ilu- yard. X , Swmrr l .uu Vsmzn Qpuuiing lip-J I vnu want 'l'w11? ' IMI VAS' D Ihwnullwl, Ill'7.7,Xlllb1 XVIII 5-111 I1-1 1111-' Every day Ill uery w n uc nrc gnttl wetter, md wcttcr, 1nd uettcr fo -00 12--0 L - en rn ou. . . nk! Q? - ...JG-P ' 11 f - 1 - I fig xx 1 1 ....-.... .. uk Homid Q as - , , , fi. . I , ' N 2 1 ' . 1 4, 4 1 1 1 1 ' I , , 1 , wr- - if 1 M V WI px ' ' 1 if ' ' ' , ' . ' 41-f 1' 1 1 1 1 f f N 1 1 - P- Q . f- 4 , '04-W -' w . ,Q ' .-f-' F 7 A 1 , x S fx - 'LTI ' 1 I Xe S QA . W, Wf 1 f - 5QA' 'g'1'1w,lfl 11J L'7- 1,11 - V nfl. V ' 5 1 I D 4 1 X I1 ' I' ' ' 1' 11 1 ,H n N if 1 'W 1 I , Q at wp va 1 A 11 . I- , ,f hx 1 Q2 x 3,1 - x 5 ' Y . 4 w ,g I ci 1' 1 .3 Tomzz Just one more kiss. hun! IIL Qhinw 1im 'lvlvb' NU TIN' A All 4. 113.5 1 J 1 Q 1 4-P . vdh 41 , F' UN Hzrr.-rw 1 1 1 'J ' :L 1,1 .yy 5, 1:- i Q Q ,..,44--LV' I.:. .,- 1,, , l U . s I4 J fy Q I .l. I 5 1 A I . Q 1 1 11 -v , 'N S-fpu. ,I .s.-. i.,lk 3 --1 -f ' ' . : 'V' .. . Q Street ff 509 bf Hu ffm H N' W 0' 'K 1 l.1l'll'.'I' s1'N11 xx' xr su xxx and its eleven alrcadyq' 3 H, xx. 1 it i, I2 ii 1 , 1 1 1 I I FW xv. 1.4 ,ff -'1 , . ,. n'f .F 's 'sm 1 ., fn 1. 11 1 1, 1, 5 '-1 ,w 5 Q , x fi .n ,, u E CN ' Lal 1 R27 1 5 I.--.r-.L 11 .1-1. ff.. Z' 1 1-f ,--.-4-f- : - , 'ii-R-D gm., . rr.-: ' I, , , fuk ,, ...1 ,W , W Q-N ' 1 .A ,- 5 7' ,' ff-if- '- ' ' ' Af f Xvvff- ft -A ,. h ' K' - '-- Qggggp-NE-IW-',-1. -.QFLLL-A '-E-2:15---:----fv::1: E, A-1 fi if ' I , ' - gi, gg W. ,vi Y - - ,A', L -'I' 1 . . 241, -x fr 1 L . ' 52:11-..-.f ' . -- ,, -,.Q,...-, .. Z.. , Qfikffxl- money. K- ik J C SEI! -252 D1 :JI .43 I.. S v. 3. ,. H 'JN .Q Hx fi N' v I ' -' f f . .N . -. . -r . L1925 I iiggH!?gggIH!x X21Il llllllli ll!-'l'lll!llWll.l'lll:lR1l!!5!iilli r 'f:-- vm--uw -f--Q ---- mf- ------ - +---1v-- mf v'v:-2 HP' '1 ' U' -' '-A - ' ' ' ' ' ' ' :.':iSiE!g5Tllligmy1llggig T H E D L P ILI Eg g' n,,,a- mn J,,,,,,,,,,,, ,.-...w- ..... If:-...-..-L..,......,,,,Ev5,:n,..f ,,-- - :wang-gags::-.:unm:.-:.-::.-::::...-::::::::..1:::i::-.zx::mas:m:nz:::::xxx::::::::::::'.:::x:::ulu:::::::::1. ...------ -.. :ik -..--. P13571 li .W est ' X -J-wx 'l ls' I rf' L COMPLIDIENTS . V, H , T H E W A L R A V l 5 g C 0 M P A N Y R V 9 A 5 MACHINE TO OLS, 5 TEXTILE, MILL and F' SHOP SUPPLIES 55 if IN s C 1-I 0 o L S 36-38 W. Alabama St. OR SHOP X X I lp -A This Stagrett Set 2'No.b901J .wills start yfeu off - - ' ' il. lla' I0 ' li' , t ,L 1 ' Finch, Flecitriblengteel 13nu12nlnw190ckStu?122e, C213 vm fm., Gage, 6-inch Outside Caliper yvith solid nut. 5- I g y ' in-ala Dcijniger iivith solid nut, 6-inch Inside Caliper 'pvl . . WI. S l .nu ' . . . ,- M- 'I 'EQS9 We can do 3 big Job- , gelxiialessdlosufgicigxf flgleifgoieiiglferfs Riihcfi- li l vggql Xve can do an Small Job-. tamed m an attractive folding leather case. 5.4. . . This .wet and 2100 precision tools are fully 0 , 4 ANY klnd of a Job We :lest-riberl in. the Starrett Catalog No. H do must be 3 gggd IVE will be glad to sefnfl you fl' copy. , THE L. S. STARRETT CO. 4' ' 'X ' ' M The World's Ercgteii Toolrrgxkers ll d My 4 N S X anufacture1XTIgOL alilggvgs nexce e 5 . 0 . ,A ,, A ' ' P .. Y . Y 2 4 Roofmg Co. - I l 9 TS' 5' Chas. N. Walker, Prop. 5 SE . 207-209 Marietta st., ATLANTA, GA. 5' N b Y 5 Ivy 5761 fi 57 x . gg .9 i! L We top em all Z E3 . Starrett Set No. 901 .2 f I Metal Work and Furnaces TTAW gfgfygfmff. PM Etemznett S I . 5 sz .B- 664115 lo xp XIJAMMJOX 0 + 525155. Q ,fsoif -I hilif' L L A L Q 1854 ,Q 39. 'N-' 'U I A fn - o2gy,s.mQm.,,,.c.m..-,-.-.-A-., 1 .-.-.-r:f:-v.'::4.-4.Z.Q l llil gg-Bmofzaa4QQmWywAvffnaWzyfa:ywwmwvfmJff f. W 'I 'IEI' S'i' ' 'I '52 - -, I A it 1.uJ:s5L K- ' is th S., 'f 5 5 uv' ' K D Pi' i-11.5 f Xian! 4' 'Xi-rf ' QIA VIAQZ5 X... , maui' - r-:TQ . ft K I xl' .X . ' 41 R' 'flux ' X Y- , :I I Q 'f' f 1 i254 'E, 'if : ',-:fw-ma . 7 - A S y Tod T?-' I. ' I I. I 2' M TT ' ' T 5 ' ' - ' I ' I .II I -E In . I , I I I 'II Im In nl-jg II I nm . , , , I II To IIIII ,, 1 I Ii I Ip 1751 SAC -LUWELL I I X. 'II 3: I 5 ,. f Z Z 7 . sf 6? ff HJ W' Mn I ,Ev 5 I I 4 .I 1 I Largest Manufacturers of TEXTILE MACHINERY In America si N Complcle lmcs o COTTON AND WASTE RECLAIMING WORSTED AND SPUN SILK MACHINERY FLYERS THREAD BOARDS RINGS METALLIC ROLLS SPINDLES CARD STRIPPERS Our' TecI1mcaI Experts always at sour ner Ice In IOIUIIOD of your production problems ROGERS W DAVIS SOUTHERN AGENT CHARLOTTE N C Branch Offlcc Green 1IIc 5 C Excculuc O cc 77 FRANKLIN ST BOSTON MASS LIL NEWTON UPPER FALLS MASS SOQIIFL1. IA-S5 PAWTUCLET R I BIDDEFOR O-125' mx fx SS . ,- 1 I I -Yi .5 -I , 5.-, . AQ 'I. I lu 'I Iv Iii Iii Iii II, 'Q Isa Ii IRI VI :QI I. . II, I, I: ,., IIE1 .ITV .J In- 1 lui www N A-.LI 55'-f Sym , . I I . I: , ' , I 3 I I ' ' I ,f , If. I , f I I Z' I I I I: I I I in ., s. I , am my I IIIIll' li! I Suv- I QF ir-I '1 A','s H , I S' mm W I I I 1 I I 'I II 1 I 'I II I' 'IQ rf. -.nun I I ixf II' -A' I , 5-.e A . , I ,I II ' T It ' I ' , N I1 I , 5 I 1, . 12 . . . , I: N f ' ,' A v I :. w . S' Q - :F I rf: ' E: -- I I1 1-:Z I ' EE? I I 7 '4 :, , ' az If ' If 1 I , - - - -'-' ' - I I, In: I A '. Q2 : v . . V- I If I I If I 1.1 ,, I' , I if ' If 1-' I IQ I , Ig I I z, 0 Q Q ' I If ' I I: I --- I 2: I5 ' I ,Z I X- 'Plan ocalzd aI I Ifj' 3, ' I IE I I If I I I 1 I Ei , .. - I I' I 1 I ii I ' l-3 'ff -N ,142-1 'I I I' A :ill 4 Q' 'ff D A M L, , 'T f I AM ,A ,A M, - QT 5111? I-1Q53-fQlf.fff..ffQf1ff:iii .... iTff,ff. ilqzvzfiji-irizgi.::QQQ5j:-QI , Y Y g-42-I , '53 . L :A ,xii-' fr 'nk '?'fTf1'f:- ' ' 'id AT AA ' ' ' ' ' T ' 'T' f , I K. H Y Y Qrg-mg v,:..gvT.jg1:11QIT7. ,L 4-1 . r X -A ,f 1 .f Q x 'r'fj1'TQ :F J I P 1. Cu 92 .L .1. 9? .SER EwEH+LSmMffEww0LfHz . .....-. . gggg u 5,,mmnguum,mug-fmf,,5,, ,,., ,:,,Q,g,.',ff'-.,, ,,,..,. ....,.,,. ,mg qnqln mnaii' -: I'IvI l-f-f- If v-'If-4 'l --U ' '4 '7 :: : ' l ll 'lim Illv ,Z T IIE Is L P PCI f 3-- ma,-ga .. ...... im.,d.-.Wk,. 1mw.n -- -A--P - .::::::. ':::: ' Q-' ':z'.x:::x:Iann::zzu.'::n:::::::xn:u:x:Iu:::.::xx:. .nu:u::x: ..k. :'.f1. ... .!!1 l,.- 5, :E I I. . if . IQ F LTON SUPPLY COMPAN gp I . 70 NELSON ST. -MAIN 3400 A ATLANTA I yi -CET OUR PRICES ON- O Q ' I Leather Belting Pumps Welding Outfits and Supplies I ' i K Transmission Equipment Motors Electric Drills I Z Pipe Lathes Etc. I gf Valves and Fittings Machine Tools I TEXTILE SUPPLIES I COMPLETE STOCKS MILL SU-PPLIES AND MACHINERY ' 0 QUALITY . S SERVICE . . RIGHT PRICES S I F, M- ' '-C3 I I fi . FLOOR and WALL TILE CONTRACTORS I WOOD I and TILE MANTELS I , ELECTRIC LIGHTING FIXTURES I If-1 +L ' I ES 1 ri' , ' 0 Ni 'W IM llQ'Tl C Iggy ueen ante .1 e O. I 50 WEST MITCHELL ST. 'MAIN 6186 E g 1 ESTABLISHED 1909 If 'E E T- Illnw II If N ,. ,. 'W BW E111 RIC? VV IN C1 M I , l l I? THE MERROW HIGH SPEED OVERJSEAJMING ' 1 as I M y OVEREDGING AND SHELLSTITCH MACHINES M y in 5 6 Q for - FINISHING M E 'f,f',?kW I Reg. a e ar A ' I All Kinds of 2 . 2 Q Knitted' and Woven' 'x MERROWISEI is E, . I THE MERROW MACHINE COMPANY I h - - ESTABLISHED 1838 A 000 Laurel SL, HARTFORD, CONN., U. S. A. , Cf! NWN gix xx 1 - W1 I . . 3 .. giiacfffifiai 7 0 ,T .- 4 o?-g+:-sszCxc31Izfafe:ysizG:-:11L-Q4-semwr,rfssfz.ffa.-m.c:.1:-:E-:vwx,-QQL4. A QPR E X ,E Qifffffinffffwfmvmrffmfiff llffzl , V' 'Ex' -fr ' IIQNLI. K. ' E I T351 I D V-LVi'L ' T' ' 1-' ,fl ' ., , faq, , I -1 'i QW- iw If 65, - 1925'I X... g.ssasasZ5m5?xu n m .,:, .,', if I -NQ , -3 - ' 'Z-A A 'jf f . , X , , .A , 4-- - - . I 0 Q ba lf. - f , f?+?1-L X 1 ,, X 0 W I 5 1 I 'fx 1 N If ,X 'Q ff'-f f-- I , x. ' E' u I rr 1 um, A 4 x F X ,Mi A 'J f Xi H 1 x u 1 m 4 Y 1 ff Y J X 4 flak, X x. 5 V '10 mn- nn- . I Q- V .I -' A I I I I'IQ--f- zz E3 III I :st-X5 --I X fxi ':5:. ,L II-II I Y' -rim umm.mn... .... .... I -. ..... .... , I - K. - --- us., 3-.,....-,,,,.,,,.--...W N--V F--Q H , I ' .. J . I S 0.0 .X , I I V X I I J 5 -X I 1 Q WN p-X X F I I f QNX I I I ' . S, it 'if X Xa I : co I ' ' 'I ao.-, P f 's N' X fd. , - . I I ' R' II ir -' W I ' I ' . I XXV I ' I ' NY I a NI S I 7 k 1 A A II WJ ,Q IT P4 .J I fc I f . I ' ' I 5 E QI I!! I A Jk- ff, ff A v- NWA W1 A, QI? If hff' II AN INFORNI XI q'll N 57, 31-A-f' 'IAM 105 NPH XI NIOXD X3 NIORXIXK Ol Z 'RX 55' Itmm 'xx -cw -mmm.-m xxxxx xmxxxxx X QQ I C xg -L5 S-f 'j Bl' x :,ov,'X 41 LIONEL K Xu,iZ X 1 Xie 1 , 5 I 1 I ' QI I I 5 I I I I f 4 I I I I ' I 4 .f e 'I 'Ext if I ' :- I 4 - 0 I' W ,. 1 5 1 A ' I L'-.-, F-!l3l',x If - J Q t I Z K f-153 gf Q' I - I A V ' -. 7 f ' I I ' I I II L I X' WZ xg' II I I .I In f I I hs 'I I I I :mu K 'Mgj J MR! I M5 I ,. DY Ulf sum-1 mf l'Nt'l.li cars' I'IIII'I4I-Ny .'g'i'j I sf I I II ' - I N ,V M, ,If I 'U Jug, , X A f ' I 5 ,.+. I Vx' . ' I V I ' A IIA I I I ' , I I 1 I I' I ' - I I I I l I I I If ' I I, I ' I I' I I4 J . it , , I Eg I K' 1- : . . ' - I - 7 : V- - '1 ' I5 -Q I I X I ff ii I 5 N' 3 I I V ' I g I I :I 2 6 I' 9 -I I' I E ' I: , Q I I I I I I 5 v - - I I If I V A 5:00 J .I.-- vw WI .. , . . . I 7 I I I '1' ' Y I . .' . ' . .' .'? -' .X SIIAK lull 5,2 ' I I I I If I .Q ,f - . C ,,fQ..:,i5gI3Q:3xk , I gk- , I yi-' m 5. ,A g:zQ'pI, I, - .f IK: :,,x 1, if u J, 'J , f Ii-, I- I 'J 1 W . !1I-IIf. '- ,. . ...,...,.,, . II --I, . ,I.-.I. T'-L- f I A Fix I I H- I-fff'-51-l-i'f'?fi' ,S I N1 Earl 'FT'-3 lf'r2rL1l-Lmsilaeff-uf-14:-f-12-I4--'e+:ffQf1,-1f,,,-1j'y?QI I I I I - ? r.IIJ. b1QELl'Q:?I-isI 1-. I I ' I 'Q - U I I .I ' I 5 'PC ..,.Zft'Q-9' 'K 1 ,, . 1.1 ,Q- M711 lr .:. an, ' , v 41 1 . e e A A A PM 192 A . i y Wig an, . ,,.,.e .... ,.,.....,..,.,,,.g.Mf,,, .,,.,,. - ..A..,,,., ,.,, H ..... ...... Q ,.... - ....... .- .....--.....-- U-fam--1:1-.:tr-:----M-.W:.m:.e.m ....... .........:...:i5iigE?3...g4!,.,,a5iL - T H I5 L V ,T P ILI fl A lllildms-...-.... .... ' .........r-nun v'- --+-'- -- :::z:::- - ' - - ,, ::::::x:xxnazttritlznm:::::!:::::x::::n::::.':.:!a::1 ..:::'.::::Immlm::::l.':2::::::m ..... : ....... .. ' in ,g l ' 11 , - , . . y BILLIARDS LUNCHES 1 T COHTICTCHCCI ' SQFT DRINKS 5' ,T 5 When you entrust your 4 - - 0:0 1 1 Q V eyes to us your confidence il Z has not been misplaced. You y l l are given careful, considerate R V i e tt t' , d 'f d n't I h y Q l ieeiln glalsseasll We telllmyouo so e e l 2 frankly. I 5 f St d t l th i e y eil erloiltiguicouslgrse Shogi' ! I 25 -29 North Pryor Street Q M have their eyes examined at A W regular intervals so as to ..... 4 ,Q .... 1 , E I 5 keep their sight in the best ' i .5 if Condition- A cz Pl f f cz F zz S We invite students o f ean ace 0 ean e Ows A S Georgia Tech to consult us. ! -p and a 1 I ' T 9 I ,y i I Hearty Welcome to all Tech Men 'gee A. K. Hawkes Co. T U - A - - T 'T' L, OPTOMETRISTS-OPTICIANS 0 14- Whitehall R Q B E R T L , Y O R K H. .1 4 l l 4 T E AZ. . tu. 35 1 WHEN A FELLUW NEEDS A I? I- 'lv' if l 1 1 IM A . :,. A Call Avy I1 73 5 E vig The Cab that Took the , Tw i E ' , 3 5 5 Tax out of Taxicab 1 X j ' A 2 te , Q Yellow Cab Company o F A T L A N T A T Q -r.. ,t f A . ee TT - I . fnwwzxffnfffwwnfifflffxgm x e , ,g . e r R. , .... . ,Q ' f F uw. l..On ,L K X ooze 4. r - 'AOA D l'f3' e - I . X .-A X fl' o I , '.,,:..,, fx - ' 1-- 5,3 ' Xzvf . ' ' ::::::-'-::Ix:::-H 3iifi5Qggggif2fvlnlmzsurxlnawisf g..5.,,,.,,,, 'ei - -v - ry I A X M1-,w::,g,q ff- fffbf' V -- ------ ----........, ,.,.....,.,...,.. Vv,,,,,,,- V U - - ai' 1 I! xmnu1..n..n ll ll' Kali I v N A . ' W , FE , . 5 4 . 'Z 'Q . . . . Q . 0.0 'o fi Ri ff 5, g. , 7 1 I' -I , , COAL and LUMBER A. B. C. TAXICABS Baggage Checked From Residence --ozo-- 1 l I . I Direct to Destination For Furnace For Crate and + Stove I BONDED AGENTS ANTHRACITE ACTON COKE CREECH X L SMOKELESS NIONTEVALLO Ernest Horwitz. Mgr. Iiwlnh. 1565 rst ont thnx! f n c C1 ton nrt mm 1 c C1 n 1 txlw nd I ILL: Randall Bros 210 Peters Bldg Phone Ivy 356l Telephonw 'Shun H80 ttltltl OPLN DAI -UND Alf HI R ATLANTAS FINLS7 I'II10H Atlanta s Fmest Launderers and Dry ClCHI1CrS TRIO M 'I'I-IE.: D V I or 'ijjs .rgzi ee Q e ,NIL ,.ttt, e e,eett , ateet ettt PJ 1 I .2 ',?' ,tag A ,J sm'-. f. I E. ,Hg i 5 If gf -: lil jf vz .,, ,. ,. ,tl Z J Nfl 9-Zi? txrq R- E! Wx xxmxx at F q I - 1 1 .. . , . li N P1 .' -- - o xx 11111 Siu I if . l Ea I midi i :xl um--tl' I All 10 A ' 'O' 1 I Ea I zxcirlitiemnl prism-m:er, 1' tu- I 6 I 3 . 25c j I IIa Z: f f: 5:0 I IiI'II'f 5 . 1 J f I , ,, 1 vi u L 0 I . ,, l H I I' 4 '-rllllf . I 5 f ' ' ' ' ' kit? l ' ' kr?-1 I . HY' 1 '31 uit H.. m':.D QL y 1 1 1 Q ' S' F O 4 1 J 1 L ,.,-'i :il 'KWQH A 9 A , , . EQ , O 1 5: . - 1 0,9 ' if ' - 5 1 ff I I if A 3 5? o 2 lf 1 , - - 'v - - i -2 : 5 I Ia f 5 I , gg ' . 3 tg , ' If E , 55 If T 155 ' ,- t lf: I 1 lf! 3 f , .ef I If CALL lvl 1600 4 I ' if f A Q I ' ,Q N Wi Ctr., b zu-, N.. 3, 3:44 Y -W x ,Jig-Miz-- , 1 v . W V - ' 1 X -p ' Y , .fp--V-2-f-V-'-Y ,-'W ,gf tif .' Y V-.- 7' X lg 4 , N T! ' .e ,Q E 2-. -1-:SPST 'fd' j,f,rg.7,T.' ....:.:1 .Q pi .L:e:-:-:g,,,g5L.4...1, J-50,2 v ' f - -Qmx.x:g2mt-Y-we 5-L :.,Xss:-555253.-.-.'3'1'1': Y-X T' l. SX' 'g 5 5lf'ff-ffiilga' I . -- 14--f ' 'I ' ' 4' ' '-1 'r li-TT'-' ' oe e e I e ,fe f fe of I- ' IIONEL K isnt fc-. I ,. fa , Z H- P:-2 5:5 l ,- A L C, C , . ., ,,,.. .A,. , ,,,,.!,,,, ,. ..i.i.i1,. . ..,.. ..., , ..... ...........,.....,...t....4,:.. .... -..--....W. ..., .....,.,,,...... I - z.. .... ,...-!.,,.-L.h. MN.. .. W-.. ..., E 1- g........... :::::.':: u :::mm:::::::::z:zr:a:z:::::::: T-H! T 4 2 B Paseo Tool Company 5 . Y: L - E MILL SUPPLIES AND TOOLS R ATLAN TA E 3 :K 5 I0 NORTH BROAD ST. WALNUT 3767- C K 57 l . X UNEDA BARBER SHOP Rf: L AND D T UNEDA LUNCH Tr FQ 16 CHERRY STREET , E E ' E , We Are F or TECH F irst, Last and Always 1 -nl ls, al 12.11 if vil - ri' ' R Quality and Serrvioe N T C C li H H fl d y IS OUR MOTTO mf 4. Suits Cleaned and Pressed MA A R S h O p ' R WE CALL FOR AN'D Q DELIVER PROMPTLY E N L.-...C The T- P O W E L L S O N ? , at R I' Crown Dry Cleaning Co. if Pfopfletofs K 534 Peach-tree St. Hemlock 4927 gg ' V .. .. fg. ... .. A MOST-UP-TO-DATE SHOE REPAIRING PLANT AND T ij K If P leases SHOE SHINING PARLOR ' Lg - H- E 1,-Q? 4 4 E U S N Your.Patronage Will Be Appreciated 3 E, T P l 0 ease The Crown Shoe Shop L Y 0 U . 534 Peachtree St. Hemlock 4927 E .. K-VE P., Q me 5929. R Q R528 J' ' ' R2 R My o , U a 1,35 -S, , P l - - f - ' A , ax L A -H f- f f - .- K 5 UG 5 VFR Q K -, , -.gn-r H:-..'.J-Q-r-:fn-g.5,ix.r:':-'iv!-:ff-1-1-':' : f ' ' 1- f 195' wf !I wmwmR1Egmw .fmm ww Y f N Q0 Mi d x E 51 igfrwfwfiafe ffwwffffffffwfy IMQQQ-' 3 f LLOHEL K' M T D TTU. 'Ag' Q H-VYQ X IEE.: -,QQ c N , , V? In V., X P 1925 l 'K-Q Q, Y L ! :mm , lmao anllmmm-ms! .su ,-5 gf ' .' ' ' .pf - -,A ' ' . 'Y -- if - 3-:F , vw n. ,,. . ga.:'IiffggEil1x-ililllillgg, uumnmmnnmsmm q ' i' - x,XE,'i:Y, M- ry li U W h L Al 1 - W: A ' I 'fT - H f..i ' ' ' . N f o lf ' lm A ' ,uv 1. I , s 1 X -3. ,I F :Kg :ml L , ff X 1 , 7 Q ' 'f 1 vm ' -- -.. . J A '- Elliz. . wf 1I-iglliiikiEEK-.....-Qin.. ..:::::a:n::::::::' .-. . . , , U , gli i - .. - W.---.. ..---.------... - , l N Q 'Q 'Q :-5 32 Ni Pb SF :Q s-2 Q. r I OA l',I 1 'WI I 4 1 2 2 f ff 2 +6 L E 'mn- 4 it 51,91 will wil 1 nm' A r l 4 I l 1 1 Q 4' 0 lu wi .J R. f o 'Q X , QQ: l I ' I 1 'K 1 .fx 3' 15.1-1. KW, ,A ,. .f' f f l 'I 4, NN 4 .qw , lf 4'N., 'Nj I , jfl-1 I i I . f wg . as . i Y 'l w all l Lil-ll'!l'lfllllllMlllll f1u2a.::alw .m f All I 4 5 4 1 X T1 . ,., . s'l'xlfl-' Nll'INlILlxll on I lam il Q I f INSVIH XTIHK - . SHE: Can you read lips? LYMAN: 'sY0s, by the touch system. . .5 n .gf- 9 ' K-4. A' n' :'-. ,,, A Taxi drivers are slowly hucommg cclu- 5 1 ,-, cated to the Joint where thcv 11-ulizv that , l . if the Woman in the buck says Stop! slum? in isn't talking to them. F3 O Q5 v i Z4' 4 ,-fr ' 1 .-.-...F . l'..-.A1 , . L- rf I- VHNIIYQL IX ,I,,,ff,.f nn l,..,rf4l fl ffrfilr ff-11 ,uf lcailllll 11 fr: ,Hill fllfll f i' ' :'71!?lf. lin! :slimy In iv.-l.f,l, Huff Shr jfrorrzjflljl 111511, lon, For 111111 P11117 f 'f:':g'1'flz mf in 7711 +V'-,HC ,Q X ' ' ' - tis 'X -fxfX VXZQ slmvs on Hw wrong fwl. ' ' Y i Y 'Y 'Lt.1rlA - ' 31515. llquhpsj XX tlffll' I x ' i cjfyah 4'-f 1. 0 i i I I l v 1 4 li lf o n A n gi ll 5. li ,. I i. O I S . kim, 1.1.1 . l if? C' ,, f- 155.4 '. ff: x-lf a R1'1 .K I -N! fm- .,. l. V'- . l j 1 4 v, 1 .. Pump llfnwa-: Hlllli. llfzm-11.1. fllff 35 l W W ...f KFFPING FP ms Svmrrs Nw -mb' ff'- 1 Vi CMV' 1. f IZ f, ,. v 2 H ff,- 4 C' X I a iw 11 fl' '-5' T- lf- - -M -7 WN -. .. .ef--gf' 4. 7 A f new ' , -1 P - - .. , Wrlg- -f- '-,,g1g Y ---W-- ' --+-' xx M--1' C, .i - 2 V , .'-F-1f - ' ,,- ,,-... .JJ . . .- -vrf-141-N1-w AT' 2 '-r -'-'Q-1 --lf,---1---A-M-' -f-- - liff ' M A U- : , is-.--A 33:1 -- -f 4 ' 1 LIONEL .- V .f .,,,,,., .. .... K., Q, g -L:-. Cv, Kg TNA., U ,l ,H-, , - ., Xi? x ', - .r K Q,:?.!'..h,.-7.5. ki: s .gb . ,,.. .....,.-,.--I-3 ., , ', x ,Y .1 q 2 W is 4. 1 1 1 1 1 , f 1 A z i.,. ,,,, M., - .LA.. ,,. 1 , ,, 1 .., 1 .. ..... ..., . .. 1 4' .. ffaamnuif- .,.n-pu -----1-.......1........,m. ..:a3..1. 1, -1.0 - :::::u---m.s::a:::. '-'-:m::::r.::m--z:11: '-'- 1xr'rr':::'-ur.z::::::.':mxa:::x:x:'::z::u'.uxu'-----r ...........- J..:......iE?'??.ZI , I 1 1 f 0 f ,, N I 1 1 1 1 f 21 1 I x ' 1 y X 1 1 1- '4 f.Lf1 x X Q1 1 R3 'dj :JN X A x N 5 E I N 1' J 'N x ,gels A 5 - , 1' x ,xx I , x 1: S 1 1 411111-1 1.1 -1 -1 -11111 11 111 114 1 ru num 1 10 M 11- 1 1 11 1 1111111111111111111 1 1 11 1111111 111 11111 1-11111 me un-uummuuu nu 1 5555: .... 1: I -az. Y ' l - W... 3 -1:53, 1-1 11, x ' K l rl' i 1 J.:. -f ' 1 - A w I 211. '1 M' ' 4 11. ' 'i 1 .1-1 L11 --4 ..1.... 1....,:.1-- 1-.-11.1a.1u 1.11 11... 11. -11-1.111111 11 1 11 11- 1 1' 11.1111 1. 1 V 1 ' 1 ' 1 . X N , N 1 25 5' S 5 1 6 1 I xl I T Q 1 r 4 ,X , Q I 1 's-1 5 T 1 5 3 h e - , 1 gg 1 :hx I ! . n ' x 9 J T E C X U 11 4 YE r ww, 4 ' H3110 mm. :sly 'hw , Y ' kg Mi? 'ln' 1 Q 1' .4 QQ! I uw 1 mgmi , ww V tffs l 'I Y U1 - I9 S1 ' , .S S f , 1 Q : R W ' 11 E' C + E4 Slgmun lsner 0. f S? ,Q RED BANK, N. J. , M 2 fi 1 Q 5, 1 .-1 1 1 1 ' Q? Q 11 an Q' A ff'- 9R,,,f,,,,1,:.z:,-111:.sf-,1-:-:Qs:1mr::1zg-g.Q.:-1-mcssfsfrux1.p.v1.:4.:.g,x-QQ EX EEQEE 1 QL ig 0?-fnvfjnfffffyxwarnfyiwffagm ,Af f N .. 1 4--1+ X - 4 11 A 1 A . T 111,51 K '-:z:,,:'1,9.:,'1, E Y A v LLVY i f - 1 D I. NL. T . -'. 1 . f-1 .g A -::: -- 5' 'T ' l g A . -A as f 1 E Ilslkl 1 I , x x Y 1 1 ' . Q 1 'fx X ' 1 1: if am Iuxiifuf fmumm KIIIBIRI 1 :T fhfwl I XT 2 ' I X X 1 :H W Eu ,I nm lm lwunmxlnx-mu:,xnm In A 14 W bg' .f- ' ' U- -1 .- .-.. Y - A - F 1- . ..,..,. , ,- Y Y -iq Y I Y VV M a Q i?E55ffEEL,...., x!:. ' ' ' , ' me--, 55.m..1 ni... .... .a::uz::::::::::::::::r..-:-----..:...,.,,,,.,,'-...W - ,-4 V -.-..-..-. .. -.... .......::'::::::zn: 5 --up , , if - 5 1 1, N 1 4 Bs X - S N -I Q. A15 X x :SI ll he World s A Stage Paramount 'A Plctures -1 54 li If NJ 5 PI P4 .I V Af the beginning of things wh1,n 1h1 wo1 d was made, the stage xx as 1 1 1 1 e, fol xou eu uma 11 111 eve1y OVQ1 floxxmg emotmn un x c ng exent on earth on Ll and m 111 IS snatched f1OTl1 the uux in n tha suuounds 1181111 ls h11,h I11 lx 1111 theatle fO1 xou The healt beats of men md 11111111111 111 19g1St619d Ill sh aclmxs md 11111115111 111 m ends of the enth fm mu 1 1 N11 The 1101111 s on SIIOXX BY THE outhern Enterprnses, Inc ATLANTA THEATRES HOWARD RI U T0 FORSYTH Hlgh Class Permanent Stock C o LYRIC B I' Ixelth Vaudeulle To amuse and entertaln ls good 10 do both and lnstruct IS better fI SQCNXK, Ann: X I-'U' , 'X ,wuz iff If 1 111 KJX Mr' S ll 13:1 X YSXXXXXXXXQQXX XX Q5 L PHE Lmonel. K NX Q 1 1 I l. 4 1 1 1 S ' 1 I 1 A n 1 5. 'I ' P . V '1 .' S0 41 1' I . fl ' 1'f ' j . Ev DY 11 I nr. A 5:5 . , , Q. 1121 ' ' . s 1: : : ' I i I ' ' ' I 1 ' I ' '-1 1 ', in 1 ' ' 4 I5 o W ' .- ,xv '. . . ' - 31 1 , an ' wif? W' ' - ' 1 1 ' - : '- ggix if 1 . . . 1 mmg ' ' . Z 2 ' 1 ' 1 1 I W W . . . . , L-' 1 . ' 9 , f - . , 1 Em 4, C , '-V72 Tl 1' '1 fx' 1 4 .- - - - N I Vai' ' , 0 if ' J V O 1 1 1' 1 lj 1 if 1 1 if . 1 514 , Kg: 4' 1 Z . 1 . - 1 ff it K n 3 Z - . 9 ' 5: 6 - - '- - 1 1a l 27 2 1m 4 . . 1 1: 1 5 H 1 Ms - W A . . as F . , I . 1 111 ' 3 in H Z 1 f 1 1 is 1 f S ,agjgiggye-,,1 1 5 251 1 if' If 1 'iii'- 1 A , Gf'1,9giJ A . Ee 'Ds V sAf:7-1 4 A se e A A w 1-E! ,1,..-Q 15 .5-f.,ff ee l ea Y,,jj,1i.ff:. ffQf?5.1-gritrii. .... 1.323199 -N , i J- VA i 5.1 7.3.3.3-1-1-3-'-E' frgvi gh 5.1: -sf-Ibis-g:li'-4-:V -V V f 1-V - - -YW ' -'fly i 'T as A is - ' Un-f4q25?tPZg? f 'Q f X! X ' l . Cxflizlx, gr'-Q5 H gf 2.5,-hid'.,,2 'X ' 'Ln- 2.1 1 .., -rl ll nil i fun! ,,i ,. 5:2 Ii li F - - ,.,41:i'e P- or 'iilixl Ao , ix qljgr ,ixlg ll B1 Q3 i 2 3, X.,-17, Q, L'f.f-rf-:EQX 2522:-'ffafffr -KFC--RW-2--if-ufl-o'3Qfi:w'11ii'129' N' 2-2 - NESS f- f-152?nif?iiQ2:sQfXx22 .Y,- f-'1'fQ3f5QfAgn33'riggff'r51 'i 'ibigf-zs?f'i iff-9?Qff?55E?f3iii?-iLx?1QjQif'iiirTf'aT U 2 A 4 a'M -2 M ai' aim' ' 'W ' ' 2 ' ' l ' 2 l l -xfi Vi 2, ff ' I' QQ ' f 7' Elf.. 21' V73 Q fly ' l l A ii l E i if f 2 --2' lf! l Q ll lll-Us li 2 i ii wilili - 2- -+V -1' fff'f'i, 2. We ,,,, ,4,,, ,,,, gall - . 2 2, ,lull H K 7323 lffflll l l lil 2 if l will l nf i 1 if llggili. ig 41' , 5-1-i l I ll' l wrfl r l ,, 53 li Fifi - 5 li eff i ' I if , R fifll lr llrfl lllil l iff l ifj-. i i ' ' li llf l - . . . . , lr 'gill quippecl with many years experience X lg For making fhoko rafhs ol all sorts, l desirable for il uslralingj College ' Annualslnesl' olnlainalnle artis'ls,work- X J, manship and tlie cafvaclly lor Prompt X lr E52 l andoneqoalled service. A f 2 a X lwifil l lliiiq ll iliil il il 33,311 ' ii lllili :L ljliiilil Qi lr llllijl 2 l lofi? gl L94 ,girl fsefyi 2,1 2 llf5 ?ll faq, Ji lilflf Nl? Zi HQ? l 'Era li 4.3. X '.i' :'l -.-.ir ,AT-Z ,uf 1261 U, Fi' -.-,, i 1 lli I ri llll' I i 5 llllivi .ff lfas lllil fliffl ' lift' C? 1 li V 2 Smiiioio F9 rf HOTOGIQAPHEIQS 4 l l fizill - - Executive Ollices Laboratory 4 l 1546 Broadway fl EW VCR, K 220 M1423 Street 2 2 22 22 2 2 2 2 2 -:-2i 1-1 11' 7'f ' V 1' 11441,fzpzlxfffzgffffzigvafznuwf-Vfffsfrzffpffx 11 15 Vo I W925? 6 ' f 1 A I DULIY I ILL L' BELIEVE IT OR NOT I V TRACK-MAN :mov Recugvrg I V3 I5 PROPOSAL 1 E S ' . MARRIAGE A WEEK4 . I I I , 1 ,, A P I W X, F 11- X3 I - ' x - 1 X Fi' , M ,4 1':xi'1'55'l uv 1. ini! mm- LIN 43 , r 'A ' x -A ! 1 JE' I 1, -' rf- um ff- , 4 -I 2 - -X ,fri I' ' If -i'I--I1-nm. nm 4 I I K' I I A -. s .s l I I 1 I I 2 I ' u-rrl I I . ...--I 5 5 I I: K ' I :I .V I I I OF I 1 I I , I f x. ' ima :liz I B W J L7 5 IIIL .I F, 1 , , V: I , I I I I , T wif i ii 91.111 Of!-HLAN1, ,mu DO S A LA'Jt 55114 me vacmuvv Nl.: HA IF THE CIGARETTE Q BUTT5 PICKLD UD ON THE CAMPUS wane. PLACED END TO END TIILY WOULD ENCIRCLE. THE- C,-LOBL AT THE. Eoumom fl-IE UORROWED NECKTIIS HIIXT ARE RETURNED WOULD NOT WAKE A SUIT OF UNDERWLINR ICH A DECENT CFXNNIBQL. ' Qi, rc THQ H01 AIR THAT 'J SPILLEU IN THE. COrIr1IJtsM1Y KOULD BE USED FOR HEKTINQ KUIXL DEALER5 MIOULU C-0 OUT OF IEUJINI JB I llllx Hollbuffb Ins lllllxk hrs hmd look IIIII 1 mm e lnut tlnm, on thg CIINPIIQ I Hu nh Il n 1 wmns I III'-v caught 5 Img fewer IN DL'lIl XX lttLI'S pct 100110 uhuh hc' Pl 111 I Inu- Inhvrltr-fi from lmnr- rr- hah wwf!!! X . K ' , x -1-fxgq-:'w'x ..Xmx O vi- N I .J 4... LIONEL IX ' I 5 Q C, as I Q f E3 'N or I - 3: TNQ ' ' 'y . lv L :E ff , b . if Z I N I I ' W.: I Y I I I tr-'F -In-. If I ', I f -' I ,se I l Vx f Tiny, Illiil' ff ll, W II I I . Ir- Nj: I 'NN ,7 g llllv d .ff I 'yi - , h X Q I D' Iso, A f ' Q1 2 I I I 'IJ I I N 3 I , Y 5 X K I bf V ff' I , sl x, , . 5 Y K! i if X L J I , H I if 3 . 52 . , 4 , 2 f i I is f' 1 -. -..i.,a j I eg l Yllli ' ' f I Fl.: - , .Cn .1 .C I A r -C Q . - , , ' I ,- pup, I ' T11 ' Hg ' J ' I .. nm - 0 1' Ii ,Q H121 . 1 11.01 rv : ' f' Ihr ,- , -- ,K 'I , 5' , - ,'- g - N I-I .' - . 'g ' P I I I? I EE . I I5 I ' . ., x I If ' ,i7f5.-'QP-E?1 Xi 1417:- IB 4 W V i L- - ' .S 1 '-'51 V if Egg, Y A' ' - -Mi'-S' . I Pi I 7 a -i12E'i33f'TEll?47'fQf'77IQ'f'Ti' F' ' X--wg '1:?isg.:5ffg:g4L4: LN :gi '5 E-wx 1 if -1-.QQLN A.--- ---- I--ff ---A 11-fy---4-ulgig--J--fAflv1116 -- 6' 'Mx' ' X 47'4ff:ig?Q ,IIr,A'Q5.-,HM-:if.,,3' 3,-39.1 XlY'?5f'-'-'b'- '4 - , ' K. 21+ , f ,, . , . V Q 1 'r,'ffT QU :Q I-f . L , I i 1z I ,L . , O .,., ,C 1 5 O ,.nfL A 1 I , 1 xxx I n A fi A if K: If . :,.:.,Ni Q- f I low , I qi 1 I , get -ui,qKu,,g 1 :mai m:a...x...1m:.1r.aR1nsnsm asnlslsslulslanxxsxaauilu- 1 1-L- -1 :T-1:1 mx nf -u--- ww' P W'U ' 'HI' ' ' ' ' - 'i'': ' sign.:-, i -EL 'I 31: 5:1 f- , , W ' ' ' Ei NI! . W if iff, W ,I .. ' . U5 nn.x,.A. ..z..:.. . -:.-:r .. -'::..-7-.......:a...:x..x .... ...........::.1:::.:::z-::'.:.............-.::.:1:.......::.. .... ......:......:::..::..... .... ......--::.......... ..... I: .... n:...n:: .... 1..:l::::::::mm::z::::::::n:::m::::::::::x. ..... .....- :t:1.. 'Y '11 N? . , V A n 1 I .1 J ol L1 LSOI l . E - E ' R E- 5 'Q Company .f ADVERTISING - I PRINTING ' I A 1 G ' Q t anta, eorgm 541 I , L V Q.,zs:..r2s-.9 , '74 I I Q4 AZ. ae! - il img A COLLEGE ANNUALS we F'-iw riff hm COLLEGE CATALOGS mu: . 1 CATALOGS :I DESIGNING 1 , - V 1 J E BOOKLETS , A R Q ALL PQRMS OF Aj DIRECT-BY-MAIL A A D V E R T I S I N C1 N . I , COMMERCIAL PRINTING I 4 REL DOg gg X W M EQ mWHfffffyfwmrwWWWffzfza I 1 I -: qup ue 41.155 u :F fx l 1 i A 1- nv .W .g . 1 , '- ,Y . x '--x A G13 ':ixsif,QJ:---f' l JQEQL A4 -f' F .cf A A. ANA -' , f' 44. T-1 1 2, Q 'lf' ' if ,P ff' M A- --' .,.-.1.., - ,- ,A ,,.,,,,,,,,,A,A,,.,:,, - T, K if H A1 . lil-l' lil S ' d5S iiiiixa:u:E... ..... A '---- - --f-- - - K . f K' W' A k N- H--l-N- A-if A-m..--..... -A-,.,A,,A, Q,A4 , i A A A if l ' i A555 ' ,Kal ?l V 5, 1 2 3 ' Zire l l? 7 1 is i f li Af ci i ii tCI'WO1' l if l y . 'i 5 1 is with cuiifnsing i-iiwtiuiix thzit ui- ii-lm nl, ill, 1, I , , 1 gin ' 1 Ex vnliiliic- winch l'1'lll'l'Nt'IliN that uhirh lux l-wh iiiili-lil-ix 'liNi t-int tfi 9 6 llwllflll thc- rm-orrlx of mir .Klum xilti1'!'tillFlllP, tht Iii l zu. li. iii iitlix 'i if ff l. lilt' .xllllllili 'ilJlS INT!! tlllr khf'1'Hn'glr1 tiny' 11,4115 liiqglygyit liiiiifx iiiziny, lllitlly ilIlH'Slit'lIl!llltiillj1 :ith-iitiwii in thi- uw- li-iiirx .ii 1l,.i mum 1 1 -.5 wha-ii ws- 4-mild lmu- lu-1-ii wulliing mir tin-il iuimlt .mil l....i,.'., ..,, IQ , clmi'iiy'cuiicln-s. It is with sncliiux 'mil glmlm-w that ui 5 ir! with lu r, ilu i-li.il if which is to hlossmii into :i thing whivli wi- lmlw uill I.. I-4 .iiititnl. X .-ii mix lm--it i IE that wc have had mir hvnrts in thi' mark xi-ln-ii xiii: rmlm- ilu- iiiiili-tt .lfl.iil IUVUIVWL fill' Silt'l'tiit'1' of mwiul hwurw, :intl thi- iii 'li-rl :vt -vli-ml xx-irl, uhhh NH l li liuvc Cilt't'l'flIiij' givvii tu thi' mimpiliiig uf thiw lliii l'mx1 ..1 ..l,1 'l',.,.i,-R mN,,,,.5 , l: Our fort-iimst ch-sirv :it :ill tiimw hm lu-rn tw pli-:iw yin, :intl ui- li--iw 111,11 up h.n1 N 33 succccdccl. l ' i gf I,. K. I4-vy has hvnt his lu-st ifforts tim ml iii.iltiii,. thi l -.alt th- mit irlistw g QQ ' of-tlic vnliiiiivs yi-t piililislivtl. ti. P. l'i:irtlvtt hnx lm-ii iiixxpiriii: --1' hw limi- .tml 1: 6 IHIIIIS to iiiulu' thx' Sm-iiior Si-vtinii thi- lu-sl vu-r. lt-ilu-rt-vii iii hi --'ii-it-in :ix l 'j A gm ASSiSt2lnt iittitnr. hus r1'INh'r4'1l IllY'lilI'lili1' hm-lp. To 'ill the-w iiivii 'intl thiiw- nhl' 4 wk COIltl'iiNltl'ti ii wi-:llth nf grunt mute-ri:il, wlii-tlivr it new prfvw, lilwlry, Jiri unfit. 'IDF' glam or lmsim-ss iuliniiiistraitiim. wi- i-xtviiil mir lu-:irth-ll illlIll'1'1'lIlilllll, l.- lliiiii :it .i 55,5 whole is chu' :my priiisw whivh this Ili:-pg l,nix1- ul' thi- 1-.iiiiinix :it-tuitiiw might l l merit. W 3,44 .,.'. 4. N if , , . -Inq get 10 thnsi' who lmvi' :iixlvxt us in .i prnfn SNIUII-li u.nx iii in rle 4 lin, thi im - h.iiiu':il lulupiii part of thc linuk wi' lizivv thi- wuriiim-st prniscw. Nlr. Ilnllik. Nlr. Nlvt'iit1-li:-1-ii hyd its Mr. Thcn Smith. :incl Mr. Slum-k. 'if thi- .lnliiiwii-llnllax t .iiiipiiiix lim- l-w.-iii-- -'ur MAI pc-rsolml fria-mls tlirnugli :i wviiiiiiim iiitvrm-xt in thi- lim-lt. 'I'lu- Whitt- Studi... .-1 .7L1-5 i Nvw York. has givvn lIll1'tllIZlit'ti M-rvicw tiiwnrml m'il'iiig thi- ivlifil-vf'r'iiilu U1 th' WYE hook lll1ifm'lll. 1ll'tiSti4'. :intl :ix':lil:ihl1' :it the' sliphtiwt wixh. Nlr. Ufiltvr xvlllll. 1 ,ji V l the Atlzuitn .iourn:il, has grin-li m.iny liiiislu-il pit-turi-N f-ir thi- lil-'ill in :ulilnif-ii li A to imich thin' :intl vlTni't. Nliws l':uh'n :intl Hr. ltnuxt-'ii lwiw lv-ith 1'1H1l f 't ,ligfl im':ilu:ihlt' :iid in cullvvtiiigr. With tha- ee-rvii-iw uf tin-'ii' inti-ri-its-rl 1YiIY'ill'X f-lily hi Q Q it hvvn pussihli' tn prmliivm' thi' visii:ilim'cl 1-tlvvtx mlwirwl iii thi- l--with :L j 4 I S Finullv, thc Stuff elm-sirvs tn vxpru-W itx :ippri-4-i.ili1-ii fur thi- Niili-mliil up iii Z I S which tilt'-5illtit'l1t hotly :is :i wliwlv hm Nt:uiiu'lily xiippurlml thi- lumix in .xi iumuiirr 52 S which has iiizulv it piissihlm- to vnlnrpi- thc- wiliiiiin- to :i iiiiiiil ulwri- il li fi HHH' in l true rcprvsvi1t:itinii uf mir gm-:it wliiwl :mil :ill th-iw liliri' lhiiic- fur Hlil-'h '-ll' Q stands. 52 2 RH If, in tht' Pt'l'tlS1li :if thix .Xniiu:iI, you hnvr' lixml :i Nh.-rt hi-ur with j-'Hr flflxi' nuitcs. wishiilil' that V111 we-rv hack :iiiiiinir thfl in iliwiilx 'unfit llfllh- f l- l lmvc lenriwtl frmii tlwsi- pugaw thc pri-:il ish-:its .if lit-T fn::.iiir-i-lr-N llllffllt TRUTH, .'Xt't'l'ti,Xt'Y. Ill-I'l'lilt NllN,X'l'lUN. fllllt lr itll' tbl l.'I lil Nfl-l 1 5 wc can writv thc limit word in this vnliimv with :iii iii'-liufflillltf i'f'i'i'1wiii mlm-I' i 5 Q qumec onli' to tlmsv who fvvl thvv linvv viiiiiplvtrwl ri IHYUP 'Mk Wir.-.f.,g.iillf :ff A hz . t . I H A 3' 5 4 l if Q les l . ' g- 'Q i 52 I 5: ' ' I 'lj liz l l . l E ls 2 I it , 3 S' 5 3 Q -A - A A TE , if .F -. g-2, '.7 fQ'l L N' A FKIIQEX, 1 4 V-H A f 1- WY, ,,,, wma, - A fffT-QqX--A : -l A : ,A .1:Af i..A- ,Mgt X in 4 fix fi 5ggQ5.QgLLK-QQQZ L - 14 E Mr' 3115 5' -- '7 ' LIONEL ic L i f L X.. i Q QQ .K -M fr- , L.: vg- I 1 I I ! I I 1 E I s I 1 , Z a ,, K ...V x- ' -,lf-1