Eastwood High School - Salute Yearbook (El Paso, TX)
- Class of 1971
Page 1 of 350
Cover
Pages 6 - 7
Pages 10 - 11
Pages 14 - 15
Pages 8 - 9
Pages 12 - 13
Pages 16 - 17
Text from Pages 1 - 350 of the 1971 volume:
“
salute 1971 volume x eastwood high school el paso, texas CO n te nts student life honors activities academics goniz t' sports people advertising closing i see the sun shining on a patch of ground tar away. so near to my heart, so distant from my feet. striving to summon the sun to my side for things worthwhile. ,INV As ,A 1.-ff ' M -'-'if .Q-... ,Wm,.1..if,Q ' W, Nw if f 5' ,M W 1 . Li ' 1 . ,.. 44 5 .4 - ,fx , 4 4 W 4, S A . 1 if fp W M- ...x f ?w w -mv Jr-ft' L,,L MM z-25,5 Lf. , K Q' ,N V+-W L., f 55' uf, f, -9 Mg, ' 4 k . A -- ,Ai 4-.1-W f Q 1 1 lm 'C' in fortitude hos wings, feather things. your nature is to accomplish, to ignore, odmonish, to be olive for things worthwhile. 5 W ...wi Q ' A w THINGS WORTHWHILE 'a a child searches for reality in anticipation of understanding the world around him. his hands tremble and clutch, grasping intangible somethings and reaching for things worthwhile. THINGS WORTHWHILE as QL you are a crowd gathering all the characteristics unexemplitied by another. but, as in a crowd, one stands out endeavor to exploit this and achieve things worthwhile. THINGS WORTHWHILE 9 7, L., V, Ve V ELWV, , Vns1V.'-:gm V-.ff-VgVg--zV5V-:VV-Vf':- V-gre-VW ,.,,. V- va-SM V... .ggi-3-x,,f ,'lV5.fV3.c5-23f.172gYV? yiimwg 1-asa., Q.,-mf -V ,my VV-:V-,,r V, -VVW, ?.,Q1V:i 5.41.1 ffQpf,fgV.g5u. 11- 3-1:1 -it JF: f 2 Q, 5 23.2 .531 ,V-E-215Xf,gi?1l!-iw , -Q2-V5:IV- fiff.:3323--,iV igzVMLVJi2'fiww-fi?'3f:gg'gg,.-, g T-V'-.V'-:F1 mmf .1-2:55-gk .gb f3Vbf'9:oV..,. vwakxg-:.v-V-f,:'g -.jp-215.- 2',-J,f'f, 'V-V r.-13' Y' ..V,:f'C'.V,V- -' '4V?'VpV'AvV.- , mpeg-'.g, ,V-V, 'V..g,'?fL.W.1 49-Ee.-.l fly?55-2!7Zi2,f3,1.6fViQg-,Q5N3-Q3f',f1'.'!1'wff'Zff'5fj?Q5Q?,yuqV., V.-gg . 4...-an ,'Vg-V,:V.L-.kgs iwlzjkf ff'fV'?fV, V-1534,'w5f,4l?'Qim,5., vu--f.V '.'- ft--,Jr V-V ' 2' , . f -I. 54.91 .5311-7217 -', V5'+,:1,-',,-,,:...fV,-VV,VV: a.,L:V,V:.ng:,, ., lqf? F3 1- ,VVigV.,1 :V 15: ws- fx-If-3 -5? if ,- .f .V-.fgV?rSL1,sz,z1 Q,-,V-VQVQLQS1.M-,ffsvVVgl.,sV9V.a :Q--J ' :VV ..- .1 gf. .Vg :-541-21.1-afw,-1-Vff 1 V-.f',V.gr, ,1,. -,. -pw, ...QV . :gg QV-,'f.:V3f-,g-ag.:-f,. gs-gm V345 :liz-Q5 gg ' '35 - 1 1V -. f'VVq-nh Vf hifi V 4 , if I - ,:,.i-Sffff-f,!',-Vx,4: gV, 5:, ,V -V' QlfV,VV,'r- V, fV . Qiyw,-, V7',' ixL Q VX V, -Jf.vj'!V 115,-g',, ' - VWYV-:ffL 'f V?7f'-'1y- . V- V ff- Eg if -S 2'-if-3551 F255 --42,ffV2'L5f-f.fe'-VVim-.-T fffivlf 9?-f1VVgV,V1i52V35V,W V'V.'.'7fIgA 4-'f 7- 9 jlriy- VV: Vgfg 5:3g,',i,Va2 .gg-A,--,fVxa.fgs1 Q: 4 ff'gz5.Vgi j-gf.,V.:',,a:7xx'pv.'n -1..-14-1 g:HgVVq,, VVW...,,,wg7,,, -Vjcggrf-1,kg,iV,,.51V,,1-55,3,-,g,x,j:..1-4 6,-'. Q-QW 3.55.-..5:Ag:fi:V.VV'jf-Q V, 'Vi-zzx..-,-, 559 V..:5-?'L5e-A 'gggfuig ffl 1f.,f-ig.y11,Vm,5V-5 Wmls., 'ff V-'V :Vl'QV?'4kfViV5 -'V'i'f 'V H- f .VY-1'-fiafifi 'PHFFVV' ima? -ff ff? rf'WZ-72325K-V?f'f.Vj9'55f?V?'5W'LLWIQ-1? Vzkfiig-ffl '2ifIZ'fV-1:52-' 'VV'Z V:t.'?.V5 ,E,'!VQ1? VV V5.2 2,5---..g1:S1g.'5'f'-, ':-Ziw 432.1 .fi 'V'?15'.ef1'5'?V-il:-VlJH-Z'5iZV,VFf'?3-fV5I5E,C-2211-54,MNH-VV. , ,.Vgf',.V.V,.-gg'VV3gb,V75.q 'Vg-J.VVigTgV. 7?.ifi.fV'g:.Zi,'ji:f'. If-fgifi-51x?,fg,?fif9Qlffgf:-'vii' rg-395,-5:-V-View 355335551 agVggVg.gaV1a1,Vpg,mV-WV... M '--QV''V,-fsVVV.-43623 ,g3fgigVi,g,f2,:g.W.V -Sit! 1 ,V 4-Zfiiiliiis 3:eV5i.-QV-.-ig-2-155+-az1V 1 gf5-ffm?-V,gs,VV.V-2V21 -1QVs5:fM-53Efzufm-Vf,,,W ,V ,,.V ..,.,V ,..,,, , .VV ,V .V.,,., .5,, ,.V , V ,,., ,, ., ,,,.,,.. .A 5.4, , .. -..V .,,,. ,V.V, ,V,V., V:,wt:,VV:V,V 51- ,gZrx.,.VVVg,,-f.,V'VVv- QMV-, Vf!-p2.VmvV,fVgfV-133.-..,,5V:!gVV3-EV.0iM-g-, ui'-:.,1V,V.. ?vp,,f.V- , V-,,.-..,,.. MV-rf -mn 15V-f-5.62.-g,f?gV,g1 ,VW,-.-VW-,VVVVVW-'VgVVw,P,V1g,5'gAV-QW, ravi.: ',-1z- V as -..:V:,fVV-:'V.Lx1'3V, ,VVV-V ,V-V-. -V,--Vg. v-VV.-Vg--'Vw-VVa,,VQ,.5 V gp, ..V',,p,.V1,-,Q - V V'VVVVf-,-V,-5-255 2,1-.--.1-., 13-V' -If 1,133.3 QV, Vg- N.,-, V,V-,3,g.VV,,Vif,-kg-1 VK.-Agn ..5 Qin, ,, -' 5 -LTV-r ,Vf:,'.fVg:iyVV' 1 --V Vgg,-V QLQ-4a'pgF,lfz K .WV 'J'-I-V QV-V-4ZVi-:'V,'Vi,VrV12. if-, 33x42--,VH' gV3'Q.ig-21.Mg,3,f'wP'::Tj-l3,5gg':f.G -2.55-1. S516 aff,-KV ,iq-wr ,'VxVi-V.jgjZ35SV- lf--vir' 'V V1 .pw -':V:,gvfz-53 , V--fur-VV - -V-.VV-LV,-r . VV-'V,.-ff -.-Vg 24- S., 4-5.3 , .-,V :J-,f 1 4.-.,,.V -':,,,fVVf-VV-wx-Q, . Vw V,-:V,f:,g. fu-4-1 -1lV+ki.iV.r K31 -V., -'. Vw., 5231-. 3 3:--,V-V5 V.1:, -1,5 ,VV 5. -,V 3 -V..eff-Q EQ.Vg-,faVfy.r?f.V.-wi:yai,V,V as -,QEVMVVV-VVVV-Vg,-ggff 5-,VV--fV'gf:V.:V:?fVg L-b'.,gV,Vf,J,:I.'V,IfV?,g,Q V, ., 5VVV.LVV',,.:'-S.. -,,fgi,,.,1V:?,:VV,lgg5..g1fr.1,-mms r-gg2,3s3V?fi?:32-fE:g?fg V Y..'Q'fj V'QTIf 1, lf, '5V'- 1721.51-gg 2gV':ff95i53V?-'fig53fJ'aVJZ- M175-QgV'V1V'gk'f' eg! Q, fgVVsV,Z V2,ggfVQfLf.g.?5Q,w:3. 25-22' -VV: 5-.-Vgg 1- 1.29.1-VV5,fai-j: V:'.V--'Vi5,33,211-f-T 5-V: g3.3,V--2Vi.g.Vg'iVVgV: -'- -11.-'ff-1 1 1- .4 IV-V' V. ,V:1,,: 3- .V'1L5'f'f-V9.5 .V,VV:g'.'1a-Vs -1'f.V-if' -V-'iw'-' -VYVZVWQV1 F-V,V.:'V1-V:2V:X' 4. ---V:w1VVf'i,V,-',L-1-V,'VV.,:.V V 3 'fgvfgfi-:'fj.',:1V 4--'V-V mm -1-N-milffig'-'I-Q-Iffsf' QLQLV . VV--' .iw-142' . if1QVmVQ :V ., V ,, VV, V. VV,3,fV,f.-V VJ, nw- ,V 4 VV fg,V.l,,,fq-1, ,W-V., -.V V,.,g .,,- . -, - Le,-,-,M , i., Vg.-,, V. ,,.,, ., .qr.V.-,.V,c.,- ,,.,VV,,,VV-VfV, VN -V, ,V-.V ,,,,,,-.qw ,V- -V Vg-rV.,V1V13'-fV5.V2.f,. r2f.2..Qs?VV.s,-TVw--mf-V-V?'z-Vig4p5r.fVV1-:gg-V. Y-.MC-.3.VVVA,V...VL.,g5V,-VV'-a:2V-Q.15-g,g5g5?3gV'-wh:2Q.1..f5,g-m,V,,,, EY? - f 2 I 3545 '- Eff-'1 -V5 2 If fi? 1-' fE'H3?5kfV'fV4f5 Iffift. gfaff-:VY-ZV-f'7'-3.1-f 31 T gk gf: X 1 3 , ,-,,-'., -,.,-'V 11- V-,.,,,.'. - ,Q-V--55.5-,V-,jV3.V4 I-k.V.V,V,-'fVV.-V-.gf'IV-VVQVHV-',.fa -,- ,gVQV.a,gM5.452f5V.Q,.gx,,V,, ,Vw--. px , V V5 -g,',,' 'V-gg:,ig-f,ag1-.g,7.pHV?-4:-V ,gp ,wg 5:2 .ii-,','-45. iffm-'Q-l,g? 2'5.':.j -.QV-551'--VV IV QV- .'-JV?-3Q:,V', ay-Sfyirfiwty lm'-'VV.,., -V -3,-:.,g: 1.' L'-.----1,-5 51.32-,,..,1 AV-1.2 ig-V-V13-',-,.-V1 ,....g.w,p-, VR-.VVx,.-3-1V-p,1gw.A,g5V,.fVyV.,.,f:',,.V,.,.V 24,5 V:g,V.y. .:'-'V.Vg--QAVLV-V-.,ffV -QM-,,,1-J'fV-'-.V.: , -V:-Vwg, fig- S-,VAg:.raV-:as-,-fgp,pV :V eV:-.,V4g,V,5,4,p4VE,QVw,,gffv-f,',,41gV-17:14,bf..-V5p3VV5QVVV,xy.,-V-VV..,,, .,V,.. - ., . V V , , , ,, N. M, ,,.,.,.-.,..V, . , . .-.,-.V ., ,V .,,,V.-,VV,,,.,,VVg.. e.,1.V V. V,VVA,-A.V.,,V,,-V.,-V,,.V,,gV,-Vww ,,V-.4-1.1 ,.,1V -V,,.,.,,4, V. f,,.Vg,. ,,, . 5- a-f.,,r,f..5V,A ,R .V..v.-nik.-,.3mVV,.,,,qV V.1,f,.V,.,, WQV4. V-.V,. ,,.-V, ,. V, ,-ff ,l-.,,V..,V.!- XV. V... XVA., VV.. VV MVVVK, ,NV ig., , 1- f ,M ,g,,,:g1.,,, .,,g,,,--,gVyV-2,V-,Agfa WV VV. ,MNVV ,,,wg,,-,V,,,,,,,A.,.,y5.VJ,AFVQVV ,-V3 ,..,,--.7 V, 5 .5-, . ,,5Vfe,,1,.,Lg n,gy.Q-VL, g, Vp-7,qV.y.,. ,f-as-pV,n,5QVgV,,,..4ki.gg-gg, -:.VA,,fw1 9454,-V VV .--VVJVV.:VVyVVfZgpq-VV., V.::-V uhm. V', 4. Vs- ,-VV:-2: .,: fm- f. V Vw., , VJ, 1 an .:f,y1y..a3 f..fV,V?,-V -v7L..YV-rf V,V'!.--,VV13-ww-:A-'zav,V,,eV -V r V-V,V1 v,V-: V'--:.fV-.vlan-mVV.ff'w-..-1 y-Vx, --'Vg' -fam, 1:-.--aw.: f. -Vw'-'M 'fd'-QQ., ar-:P .V'-,LP-afxagfv-1' If-'A--VVZQQVVIS--., ,-, ,, V, ,,VV,,,,-.-,V.,.,., -V - 4.V,.f, J: -15.42-, a,:V-.1 J 4.gf,V- V.1,- ...VL ng.-VV.. gy.. ia1,-NV,-V,-sf-..,-V,V.V.4g.:,pp -V... --S VVVV-vV,,,g,.,.V VVQ--, ,,.,V,V- ,,.V,-.,VV,,- .5,,,9g,.cz,',.-jp,-,V:w,,5Mg-?R..g,J,,.-,QV ,J:3i,:,,f5,4,p,f,,,.VVf.,f:,VV,...VW ,4,.,,V V,.,,W.g ,-V.w,w f- V - Vt- V, f.- V V V, -'V, w V'-+.V'..-, -gf.-V.-I 2 2 V .1 --.ng 1' V,: ,V-mg-.fV'i.v-V.ZV:dn-ff, 1-M -5 -V-.WV-J-.-5 'V VW-V' VVVPQVVV-ff-+gVf',V2M VQVVV-:qi 'V A- 'VV V.'VVfg 'f,g-L., gV'.g4,.V.f V, V,z1.. w'V.v'V,i.Vg -. ,M -Q-A-,-...V.f,g,VV '55-mf:-:, ,X-wv'Vy,V1..Vf.JP --V,-.-Vy :VV-'-AVE! M151 exam, , .. .V 1 -.'5.-.-V..,V:.,.-- V-,Lev :gg-pg V,.:..::,VVV-,V VVV -Q 1123- .,,V.y---:. i gl:'V1V'f+g'gQ-2' V,V,Vg5V V-1.5391 bmm -,5VVVym1VVV1 ..- 2,wV'x-44'-5-Q,-rg, ., VVr-VV.-'V-' 'V1. HV,-V, 0Vw,V5V.',.-Q-Vi:.:,gV g5,qs'1,50.x,: ,ap--gp ,gy -4: ..V-.,Q-g.-.:V3y,qV,V:a5,,b .1,,f...g5Vg, 3-'sq ,3,1gg'.VV?,V.-,mg ,mfg- - . V V, V.,V,u VV , .V.V V-.QV .. .tri-.wp-5 -AV.-,W ,-.V, gf .-,.,V-51.4.-5.fV,V,VQV,+--,,+- ,VV..M Vw.:-1 -MQW-Vw-'VVt.Vg1VV1i'EJ-WHKVPV:A2-Z'z!f,ti':2-'Q'fk'.'g ?1'1.3.5 V, -,V.,',wV,w1:.V, ,g,LVa.V-Vv,M,gfV,p :.,.,VV Vflmgf ,V-..:,:,r ,.c.V-gy ,g.5.31V..f-g5f,ji4:f,f,,V.::..9 .Vw V w.k.VV-,.V:V. -V , IVV V5 ,- V' f,,: . ,:fV,- fx, .- -1-,.g1 ,.r:.:-35-r,-,. .-..V nw- V ..-J.,,r 1 qv V, V,..,.-V4 if,:aV:--MV,kg,V,VV-,m,1lV'V-'Vail-,J-4 V44-gi.-Vgypa-Vw9-QWVQ'-.V,.m,1g. V,43,V-1-:VV ,,.,1:'V v- VVV ,g.2:2V.V-5. iam-gg.. n'u,1.-?Vg-V- i',1.-'.,-,Q-,ma V-':w.gf-..,V-VV.-- Q .fwf-V-f-2gi:'ggV1V, 5-.V,-Vfwai Q-..fQ.h ,tV.i,VV,QVajaV,,,-if-tw. VV -M ,- . ' '..xV,-'.V-.V'VVf1' V. it-I VV::L- V'-V .VV-I V' 'pw 5. - ft- YW' ,gg-., if:-4.,'.,Vm-V:-,'V'1--M VW- V:fm-V-.---Vw-faS-'QVV4-V'fc5a-M559 VV-'VV-fV,'Vg'r'-iwVJ'-'V 'V,.V.'i'-:eiVQz'-:M-Q 1:a51g.5Jf-:VV-ff .f,-fm-V.'VVggV-w,,.',. -. 4ga:5:V1:Vsp5mK.6a'.Vr-:Vff,V-V -f sg-f.a,,-Vgga-L49-s.w'Vcf. V-,,-giivn-fVVVvafqQgVVV.,,, V-'.-:V 3,-V+-?'V1. ,V -',.'V..-.-5 -. V-.-,V V .. V .f--,,.p,V.g-V-. ,-',- ,V .-.- 11V----A--,,-g.V,g,f-,,q.-,gp-gf .:VJVy.w-f,I'c V:V.'y:V--VNV .xv QLMVVV'-.fr:.!Vg--'V .VV '.V'. Va.--, f.f',V- fV,VVV +1-'VV'-,fgf-fa fb lxgV,V.1- .1 ,. ,'-.Lf .V,,.: -VV' :VrVV,V 'yy-V-f rg- -'-- JY-V 'ff :wi ,:f.vV?g5VV4VV-,Q.f- V V ,-Wm -VIL -.V-rj 4 VV ..,VV,V,V-,V gVV,. V-,V,V -.V..,.5V-iggfu ,., -V-:V.V..V,'..-1V.1. 5. 1. -.54-,V-,f-:,..f.?.:g9...,AV.-.LVVVVVfgg,,,:Vifw,5ggZvVg..gV,p 'LVVvl,f'-'?V,-Q-Mqwc-25-':4Vi,qVg.5.wg,lV1.V-.f-3ffgV-V.,52- -5,44,?gV, 5-f-4-gg-:jg Q:-.3531-.ibm-'f,1Vffr -:ViM5.'V,gVaft-4,13-5.2-V2-Ma,Z??P 1'V1i?xg:q.fwyvw'Vg-mem f 'V'-1 V Q' f5'V1i5X5L9i'Q1 73 - Vff-V2 .- V-pf 1-1:-f - -g -IV f 1-f if-Vi'-fzv-:..?-. -9- if .Q 5-f WV-V 1xff2f'2ffV V--VVVV -f?V--VW i?i '4S-if 'f? f5V'U'3fi'fV? V! VF,1ff2VAV-Aiiwiei VV? VV!---I -pw 1 Vnfjm -eg-5,12-:if .2,1V?gm'fiiE- we M Vf'f'2j.-gf--'-',z'2V,VVV.LVV-3Ve1- -'VV V -fi-':.f2L5Ef 159.131 V-'ff VVV:e'3E.'-iii -- F'-. '55-Vf19j.'F.'751V,'-,-ifVa-g.gVi4'..i.if-waM1-1.-'gmVV' .5gQv.VV,fVV-QQVfg-M295 -ffIG2fV53'55 'gm-,lg-g3.'g.1 ':V..g?1a-V,g1V-5,1155 61-2,5Q'VaQ2ia':1,waVx., -V-2,11 -1. . 'r ,- Wfifqa'-24 1?.iqV.V.'fgV1Qg. Q V2 sq 3 1514453 -1313-y.V5'-1 .Vx-Vfff g. f, 2- ViiuIVi31VVxQ.fp.E:2f?1' -1-eg ,-?:V-,5V'iVf.-Q, Vx,-r5f:'. .-s::f.- .V fp?-25:22 :Q-V351-if,5f.gV-f,,,V3auf..-ifQP.:SVV,.k,g'hg31,'-Mg-Mig,-3gQg1z-Qgg5153-5.QM V5-3, fail? 5Qgga-f,:f!.a2?,s3-- fgr?gf.iif e gg ' -' -V ' VNV VfVVL' -VVQJV. V'.V1f- Vie-V-Vi--'VV-V-,:Pfflg,-1,5111 ,.. VV1 if ..::V '1'x'f, Vl1.' V Vw-any-V.ViV Jimi.. -4 -f 5'---Vw-es. 2 24 fs -E illfife? -V.V1lV1-V815-' :,','.'-.'--12,31:'fV2,Vw ..,Y'1f,.V:1. '.U'V'- uf- W.,-1' 4-T ,U-'Q-VH5V-1-1-'-?3::V',f5,VQV'gff' 5V?LI'V1'-V-''lVV'.Vi.Vwf-55V'- f2'5Pf?i.iV ''- 'f'5:V11,'1 'IV-Vf'-7-.fm.V-V1--'KV-V51 V'ffV-f '??i'r' 'W' ff'-alaaf Elma'1-?'?5fn-?3V2'3fg1545WWf? wVfteqifiif' 'Nf'f,-'- .-QM .-jVV,,r35 '2J.ff-,iff-,,f,Vf,Thiriw-? 'X ':ff-fl'V-'J'-'5'J?i6f?fE5 i5Q-ffug -If XV . L- 1'-'V- V -.ff -' '- ' .vV-V'1,.21x-T'2.Int ,T, Vp!-'f ,- VLC-VV' ,'-Fur,-:'V'aiiV': - ::5z'.V-1' 1'--A '-ff--V+ .31-'Q fi'7i',5 1 V-'17 :Vf' p-V-'T 2.z,V,.HV,','V 'f,:,-V if 3,1-'V' VV,,Vv,Vr--V-2-.'V? I-,,Vz:,q::.V . 73 :1':.f:Vf, V-S,-2-'Jim V:-V fikw'-'.-fi--V:-1-V.g V.j3'.- -'-V,'.-Vgy3.rf.gf.P -V125 QV.. 11. V , . V ,VWVV,,nV,-,-fV-,Vg'V-.-f:VgVfVs.V-5-242V-.43Va VVV.V--gV',: mg-Vis.y,,2-g.p:- 5,1-w-gsV,-QVVV .15 VV V.V,V-:V 1.41.11-5--if y-.-.V.-3g,j-j:V- .VV-nVEq,fff5S'r5V.3VjagVJQg,?fiVyga-Qfiwg-fge QV-gif-'VLVVVwg-ggi-'fpV5Vf,-'3,l5,'.'-V'Q,-3.1,3:5V.i-ax.VV,fi:V?S'2n',mal 11,-.at31-g,V5',fis-?M.rg:23 1 ,:V Q-' V 'F 1 V' V - V' ' VJ-1-VD 4:2 'V,VV,44 Q14-VVlV',V,--, .V VV.V'-,VV V-,V-, ,V',',xJg 55 if-V .:Vzf,i-V'V- -V---lf-V 1 ',--.3'g1- '.,x.j-V.V'--:V' f. EJVVV.- 'E'-J'-,IV .1 :V. -gn-CL HV fj 1, 'V frff x ,'V--V-V.fLaVm.V'1:gV.,,V:V.f?.,f,V Q,-g.V'V ,Ly- W--'-V.-'VV Ve . Y:-':'g,,'.:?:s :Ax fig-Q,.7.1f' .yd- 1 :Vw---', -VV'Qf.-9--ng--he-J . f.. g. 1 --. ,V , VV V - .V . f.,. .VVVx,K.g Q. HVVVJV. ,- , VV 1 .-4,,,.,--, AV, V .,VV -,V..,. ..,',1VVV v. ,iq ,i.,V.- ,J 1, ,, ,V ,- V Vp,f.1p!,,S,-S.,ql,Vff-V.:-ylrW N:-V4..VM---gg-,-.,,fcl1-1,wVV.,V, -,V--xV1VV4V.L,z.-V,..,.,-,Q,:V....V ...H Vs-V..-f,,V--.f,y,I'..:,---5 V-V .5-p,.,-V. .n,q4..r.-V-....---,,,, ,K- 7 ,V ...- ,- V . V, ,W-,,VV,:1 VrgV,v,2gV,V,V V' V1 V,g VV -V - ,,,'V.,V..Vy, V.--Wy .- V 31.-V. ..V- V,V,,--V-:.V'- ,V .-,-Vg , .- -- 5,--V .'4VV.V,VVV:VV-V71-V. . .-LVM.gffmf:aY,-.V:rVQ-VfgVV.,.'-- VMS,-.VV,V. 23ggiyVg,V,fVvV,,.-44. .,.,1.., ,.'1,.VL,.VVf ,5Vf,VVVif5f-4, ,?..,.5,1,-V-V-V ,hw-5.-. V,V,,. Q, ,Lp-.Vgm-g,g4,..V I.-'-V . .,, -,, l ., , ,- V. V1 --,VQVV-.--VVVVV':.iVV,-xg.,-.V'Vw.:,gg-VV:-Q..,f1'1:k,,5,,-.VSV 1.3. V , -.V L, f1'Vs' ..,1s ,V.. '24,.1'y--V . -:af-::f:V,,p - .. '-.-1,fV,iv-.-, -Ji iv--V: -VV'e.eV'V-'g-g1fV,'f-J-:KVNg-f',. mm-1, gwtvyglgiz ,V--Vu V:,,V-iw.-2'2'g iwVfhV-V-ww V - Vw -GJ-V-,4,'V-155-Q23-,,-1fb: U3 .-j:.z g,eV'2Q-'V5-::':1,:r1VS--'-'QL if-iv'-,-'x:VJi -V,-,-W I V., f - , V.' V 53 'V.VV1V'V'V- - H.-,f,'za ,,.lV'V, ,1Vi,1.V V-1 Y'-:+V .'-'x2'.--V! ,V- V' 'fm .:VV -5 -:V-V- el-,,f-jc-, .1-,VVQVQM -V,-j.1VV-,g.V.-1.,,,Q,,.V, -VV,..,v,3Xx T-5,59-.,QVa.,V, VV,V,5, V ,V VX4,-,VVVV ..VVVV.,.:VV-My-gg--gVV-,,, ,-.f..Vgj ,M . ,-V..,1,g MV: ,f2,.3e'- .VV,qVV- '3-'STVQV' '.-QJV'-0?1.11-V'V-2-.LVF, -' VJ V5 I'V 'V'-'11 il?-.7MV'Hggf-V::E'-Q.-f3:,'2lW''VW'-,Q-.r:3'!'-.' f5'VVVV','-IVA. if PVVIVQV- 15-1-.f'--4 f'fQ?'?Y ':-'E:V1':V'.--'TE P -'pi'-3?Q.V gifEWjjfww,i5'V5fi??fMr.-V?-xiff':5:Jtfil-' ''A.'iV,'-?VWk'Z''R'-fNg 5E'fZ.:l?1-..ifV5g'--Vseizi-EI -. . , .. .V --,.,V.- V -::, ., , -V VV- fm .V ,., 1 VV' xV .,V-Vg, : -VN, V.-VVV,,-:-VNV -, V, .,V-:,.V V, .. , -V-1-' wg, ,Vg '-V,.-V -Sw.-. . -V,'.gg,...,, VV,V,VVV-.- -yu:-Q . pw-m,:vV::1v 4-sq., , .5 .1 f.V V-'-:cV P-',e-Lg-,Q - .fLV,f.:fr,V-Q ...WV--.VVjVV V Q..12-.-'C--2,VVV-,V-mfs,QW-g?5gg3.-.,g4V2.gVV9-,QV-,V-, 5-jf,VeVVV:,-JVVVQVVV :Z--V :.Vi.g'?-gf,.-3-.'.-,3,55-1V214-Va.V'V?.'-QQ..ffm,gy41935,-'qi9v,.,V-UQ WV3-gifzf'-V,f'V1-'3.:'f'f,Z.1q Qw'-'V..,Z,,f ,5:.-si-.4 1 ' ' - V-.1-232' WSI- i.'11':-1.5-fzifi-'2,'.PV' ,? fV- ' -' V, - ' -'V,'fE',1- VZr.V, '5 i- If-'--fig..-V-VE-M-P' . lgv-. V532 V1-'J-'if-V V W f'V'V .fi 262'-2?V2V..?1b'Q'f'V'V1--.'i'H f'f3:T',S'f-'l,.1Fsz.:-.- '1f'.Yv'ff'f,'.- :fi.fE-V-V, :.!'l -iiffifq'-11-V-'5..f1 -ff-'TfiwiiiQivfbi-Aim -Wifi rVl5MV'5f1 '15 f- -ff'V ?,'3V''9?f:3V!VVFiWJ4fV'I- .i?V.bf?':'iV.V' ?.V'2i- ff5'5i-Qfffliif-vii-Xfiilfflifff VV -..- -.1 , V -. .:.f.,-1, V... ,- .--g . -, , -- , 5 - V V- V. V, .W ,,VV,f,V.,2. A-. MV,-V VVVVVV -,M ,Ag V-A V .- -f,-J ,- V.,. .,- e i--V'V-,,.-f--A.--,-V., V,-5 ,--,-pf. 1.4.-V-V:-V,V.-A-f-1:14?VVw.VmVV---L.-Vx,V,,.gVV9Q,,,V.,,qV.V.-5yrVmmxVf,'V,45JVVVz,gV-'Va13Q.V'V,,' .VV,V,.r.:-V..V..--,.V.vV 5 VV-V ','fw,,.VS:Vfj:, V. ' 'V 51-H .' ff,i-EV.--V V: ', .I 'V V ' ' ' J -F :-':V'.'.i SV'-gl V, ?.V .wiVi V-VVV,.'w.fVv.VVVkf1-f'.- I-C 'V -V-5L1?fg,QQ,V 'V'.1,',- fVV'gj,f!gg.T,.-1g-:Q-154, 1.19335 Vjg,:V-g.x-25 5Qq,V.,,-nflpLgVV.V.3figi-5,Vrw:.,243-.QQ-,V----VfVV V114-VV-V.L,Vgkg,'.,. VwV-Q.Vgma-:,,,Mn,5wgVVi..g,V5- Jyypg Vg--'V,g:5-,gV,qV--VVQP5-31.1 ,Vi .LJIV-12 V'V'l1..f:-152QVWP-VVVV, -g-s, s - ' .-j 2V,V 1 'f -,Y VV:--HV?-fVVf'p 3-fy?4?-VE-?.:'?fVVf..FV'hl 5VQ'f'v'V4sV4,-a'f,s51'1f1V-fig:-TV1 Vz'gf'V..VEV'V.-ViVTqf-,-'V-2,-31.--9252-V11-53:2 -'fVJ-',f33 -I-:ighyikfizi'V5'zi5-QQQQQW1p,1fQ -XgQT'qj,jg-Vf-Q'21,SV.E21-'fVVfi'.'V2'1f32rQ3?3i-? il?-,V .ptif--1+'V '--'L-,'-V':f .'V..': V5,5-T . --V LUVV' ' A' Vi--V+ ,TI PV- V' - 1-VV-fVV'f'.e:VVV2',x's.1yiiV-.22-Y -Jw,-:'V1'.f11:VfVV5.,'V.'..--'--IV-V.:'.V,f7pV'V,ff'VIi-ixfffii'112V-I-1--V.-' V' ':',f.VJQ.-1VVVf-.,VS-wV9.2-V-Q-,V25.Sf'-fV1VV'2-ifffwfi ..-V.VVfVm't'V::L::Wgbf',fl1Z37Q.VVg.?-:Vz-WN,19'H7221:V'? Vm'kV14iwfQifE ,G ,,,,.,-.V, 1,,.,3-V-V--,, V-,K--Vqw. . 1 V, k,V,V-,,k.,,,.,,, -. . V-I. Q. 4- ,K I . 5, , VV, X5 V1.1-7 ,,,.,q.,V...VVV.V-1, yq,, JV. .,g,V: . , .MV--. V, ,. gV,,,V-11.19. ,,.q f,,1.-ax. ff., ,-M 1. -1 .!.1,-V4 .4-V, 1.3.4 V. XV,-:,.-.1-V.-QQ.,-V.1,f. --V.,-wsu.,-V.2,f.f-1 Q-5 g,..'V,4.15-g5,f5VV.gi5kyqp.5-.Q,,.,-V-.Vw mp,V.,g.fQV,5 mga:-V,:.V z.:,-,3V,,'.-:.'-,q,- ,QV :VV .459 .,1,.,.'-'g.-'.e ' -x w, VV-V, 1,n,V-Vg ,mug 3-gV,,wS2V1V1-VV-VVV, V , 'V,g -, .,wp:h,--,-,--, VV.-Vw, IV. -,yr-V V,,V,MV.1VVm:-,.,.Vv gg1-,-VwggfVg,sV- ,,,V-M,-,VV,V.y5--,-VV--fVg5:V:V-yV-.zyyf-5,1 L-53-,,f,p-13 wwf --:rf-V:L:'5V1'i fgvf V-I'-'---.f'QV.- :fa'fg'.V'- .-- V'-'--QV' '--T-1--V VV-t V'VVV-'UV'-239.gV1fV12lV.':V:'.VV3:':1- - V-V.-4VV'V.rg--,V-:af-'+V,V.V'.f-Vxg':,:V:V-u-.-V -V52V-'52f.-:Qggsr-22-'V-.:'3,f,V..25-.VW'V.yV.m2ju!?XGfE?f?ffVf15.d2fgf3V-gf-jwjigi-'V.--,ggg2,VgVg5.gQzzV--5 ..1:4.,1.,VVf ,--,V '-:,--g.a , ,-VV,x gp ..- ..-'.5-jy,.-V',5,'. : Vfgf Q. , ,, we .A -- . V.,V, ,V -, 'VV VVgV..V,.p -,VV-.,:, NPV'-V ,VVVJV -,Q gcgp- 'V,VI.J,V.V-- -. -, .mf-aw,- .Vg--., ,V,,'.- V ,.'f-,:,,V': 'V -5.4-. .V '.V.V 2--gym' .VV V-5.x,'V-3, af ,MI-V ,4f,'fV'flVV'r-5' 413' -.VV-'.g'.-X-Vf ?V----1:V'aE:-'V- -v-N T V- 5:1 ' VV ilifiiffe-1 S:-JV-'SV-1'-sf'p1 'Wi .VH,V,1ff--v'?Vf-g'fiV-f-.13-keya'.V..'V--Vgi'.'V,11 :f.1gV'VhV-vI-V--'fwzf-fS1'i'QQ?f'?f-' --fi.3'TVV -'--.L-W,li-f ?fi:reff5g14gI-5I5'V?i?.f1fVW,'KsVV'NMiki!!-fV5'?i5,w:m 'WV?ifIV'C-iV'IVFHVVf'ff'ff''ff'-,VV -wi--fVVVVf, 1 '.i?'fV.ff,.f-F ,.VI:'-'I':i'i.',-f.'.1V'I5:l' .V ..-'-.V.,-fvf :Y-,Y-1 2 V ' P' ' 1-.Y 'Vg Y1V5fV35.V': f-N5'H'vf'V',,-M-V-VY'- M'- if :2V7.u'1'VV2?L'..--2'1 '-'Laid'V--F2-V--,VLV-fm-f2 :xiii.,-f,f2:'.1ff2..If'--,-V:,13f,L'u,'-gr-.V-V'Q-3V,JZ'V2i72Vwa.Vea'5-wg-.mf-za.. i..-1.wg311.31-Vvig-,VswrVVV5:V3:14 ,.,LV,.5,.5. ,Vp 5155. .,9VVV., .ywfg 5V,,V,vV,T..,, ,,g.,-.W ,-L. , l. .M : ,XV U. 5 N.. A.... , .A .,- :,. 5tV,,V'V.,VlVw n,:,v.:Vf ,Y A-1,V,,.,,-K., ,VV 4 ,,..,,,,V-V, LH, ,,i,,,,,,v ,awk ,..V,w,V-V, .by--'..v,,...f -,myH.,-V.33724,351.65i!?J,,.,.3,..Q-.,.:1.VAg,,wwi.WQ,iV,a.mVgi V. yu., -HV-., ,' Q ,V VW.:-.VQVz,--V',' V fL',j,-.5211-11-IV ,ww V,, V:.'!i'. Q,-: .-'VI,v V-G V V-V .,:V f 'V-VQ ,, -,- VQiHV,?-yi. .-1sJ-I,'VVQ--,Z- 'ffmLV-1,,,VV-5-V-if'-V: VJVV -' -1: 5,tV2:V:-,-',,i-rw QV, V',, 'sw--,.V-f pug, -f-f2a,.-f ,1,-w:Vy,g.1'V'-4'-', Vx .L,:-1-'i,,?,.-',m,gV4, 1 vi--V'1fV 2..','VVV, 9.2! -V 'q,.e '- -'V' V -.' V' -if-'1-V112-f,w ' r,V - - - V Vj 4 -' '.- . . ,J 'VV .-J, '- V ..1' -., 'V' -. .J Jn- -. -, ' - U . ' . 'V' V'VV,'1.' V '..f-f,' VVVY V' ff ,N .V-QVVVV, V,,- .-. ,. -,Q a',V',V' U-9. df, ., 5.'VfVguf ' , v X--,-g ,-5v.--,- 3,-.VI --ij - g V-.-:,j,-,Vfffgl-VIQ yh.,ff741 JV' VJ, ,-,.,4uV'Q jx,-yvV5aV-V- MN: V491 --g,.,WV-. JV ,VV,VV,.VVV,VVV.VV3 51.4- ,, ..vVSV..,f'5- ,f,, ,.V,,.V1- 5.1 V .,?:V,.l AV, -.Vjgv-, ,..V-,QV -.-,,:f. -X -3- ,, V ,, VJ VV, , V. VRIVVV, ,V AVQ. X.-m.VVVV,, ,V ,-mp...-,,:,VL,.,-,.,, 3,,V,,.,,.,,:, N., V,-,V,V,-y,G,. g,V,., gf, -,f.3.,l N., V.: 3,Vyuf5,V,5.,Vv,V WV,f,,,-V,54V,.,,,V,g 'f'f-.g.V1i---gf-Vy ' .V-L fiv:',VV3-iw-34I-'L-f1fJV.w,f-'1 -.Q -'i1f'f-:- -Fi- ff- si -s-:i5V-:f.fV.V.--VF--1 Eff-V:'l.1,' .V 'I S. We siVVQSVWVVV?-f'ffi:?ViV?Vi3V: Q5 'f'f'1?,'VffZ.-'WF' -fi?5if'i'.F V-77?5fif,VX5iAU2'3 -41'53-ffggi!?ff, 59fq5-'?3'5?lSV:iWV ':'l5v.k1':f:g5-1 -3 ','.p'2'VV riff3fffvgQgifZYV,ig,1-V:-E VVVf.,?--',q:3VV'Vj5f12fg.2':Vw .V-2'I,:Fffs 55. .jgf 3:-. .:-LV-,','--11911:Vf2Vg3dV: , '-VfV1'1-1,'-JV1:V?V35-EV-ZW-Z5-5251?j-12:3,g1 ,r,eV,:V'V:'V'f.--,V:??.fEe- -,VV.-.-..--fi'f,VVfQ.v2--:gi-'g2i.VV 'Vfz-'LVw:'-.f-.:Q....'xfV-'wg .. VKjVii9VVV1.V,XrV'1gS3q.,fi gf.LI'-,V4'a-'.7f:f'i.--VViVf54f-'.-'Se-gy 232522-Q-1V :VV -1.5.-'Z-.5f,V.V'5-V2'11q1:,ggV3g3.fV-ggr..-VfV.-'V--'?':'V2f4-Ji-'g.V?415515 VPV:fVf,9,3 .ug 1 gui- -, -V V: 1,11i,,2i..,V'-,WZV- -1V5,','51 :V - f. gf,-' V 1,-G3-,FV-:I-A VtV'1VV -Vi,-f'. VV--' 2V-1,- V','JVi iV 't-f - 'V -V -V ig -.,!' If :Q V -G-f,V---V-VV : -,,-F. 3- :'ve , V,,:V'-VV ,:V'5'1VfVfy'VV:. '-,'1,V V-be-j:.Vg-g1.' gVii.q,:?1V:.:g- ,1-..1:f,1f:. .'12-.Hr 11153-5 -qw-wx. ', '-wi ,wwf 'V ig.,-'-'V fy-'V J 1- ....':,,-Q--:-V V 7-, , V5 .Vgf,,VA:,g-.f.--V,V-,- V :VV WV ,fgyg-M-I--.1,i.,5., fg,-, V V4 5. , Vfy: ,. 3 1--1-Vp,gg..Vggw , I-gs -V VV' V.-1 - P.-.3--,V ?V.VV?.., VVU,-T.V?,3:.w?Y1VV-5 fy,-.cg J-.ff 'VK,yV'VVgy,1vj..f.?V'V, :gnu Vg !x..,i-1 - UV 1wif.,V.V. Vf.,:V?'sVV -,--S. :V- V.., -g, -:,....',.V,aw- V 'Tdffjgw -,..-.-,-,:Vq.g- g,VVn - ., ,V,,VVV., .VVV Vg,-.VV-..V,-,M . V -V, V.. .- ,VV- - V- V- V nf, ..1V V V.,f-3 I .V ,.-'V -vp.-,,VqV AV- -Vw--fa'-, .fr VVJV-,eV-V-.V-VV -V-ess-V V1:Vf.VV,-.-.J V'V.V . ,. . -.ur- Vf..-'V, 2 V... ,- M .V,V,,,.f -.,.fL,-M.,-K,-1 V-V V -9145,-VV. ,V-4 ,, ,g,,:VV,VV5V, ,,V. ,, .--,V,-, I.. ,.,,: .MV A f,.V....V-. 1.11: ., V' - .,..- -, ,f,'. V-V -..Vg. V- Q., Vg ,-.V,,.V V... V-3.,9V,,VVVVV,V.V--..Vf.VM,,.p.-V-Vg: ,V.:V.V,..-:..-.V,- .V V--1.41:-V.fc,,.,V.,-,. V.,-,.VVf' V,., ,.,.- .,.-. V4.1 V.. if3Vfi?,'Sf 3,a'T:.fV5f-5'?-9'-VSV? 'VVfV,FfVV'jlA23-QQLLI 'ff-f Cf ..'Vff.1 1,93 V' 2fQ3'Q .':'2.Q?-1 7fV'EVf- ff V5'Ef--l-'5f-.-.'-- VV gVVQf'V'-1'f'.-9'if.V -QVCT11,'.'-.VV 3: V'-if5'iii'.r'LwT5Q1'IQ93?'Q:?7f1?':V3i'32fVfV?'l'zfVV-L,-FT? Q7,E.fP2,32'5'V 'r Wifi-5'Tilirf.-'TVVS-VfQ'i1W - .V,-, - ,,.-,. f 5-, -, V, -V .- -V,VV c. :V-1-Vw -V V . V.: VV-.VV1 ,Vg - . 3--.QV V- ..'. :VV-3... , ,. .-1 . ' .- ,A -Q. , fVV V ,.,--,VV ,fV43.a-A-g-,. V , -1,--3.-VVVVV. , , 'VVQV-,,,,-.ff , - V,-, : .1- ifVijS'g.',. x'qp .1:Q--VfV25rt3,--.V-wz...mf 2 V-Q,r,Q-415 ,Q 1, V - .V1iV V V ,V-VV.,-.fV-V-,Wg ,V-'V:,VV,.. yQ.c1,V,V,.V.,- .V4,--, Vg.fg-yV,.-.,V- .-., f. --fq , . --'. --, -,-2V3.VV-3, .N,,V,V, V, NAV,-.,V.v, Wg - , .xr1gEV',?,rf.,fVpgV-,,-mfg,--.VVVV.V.lV,VV-,, :Fl Ng:-, -'Vim-,3Vg..g.gg,-5-,-,if -ff-..Vi.,,V. :V .y.ffV-M1333--..V: V.-- - '-VV--:,z..-,--V, -453'-4--VV-,..,V, -- VV1,.V. V:V.V VV4:---..V .- -,,:,,.V.- ,- V' .2-.:VV.,--,---.-VV.. :ff -V,,1Vr. -:- V.,--V---.. 3.-1 -gn V, - ,VV- ,VVQV-V-,.VVV,,V.-V-, V- .V:VV-'VSV ,- .VgQV,Vg.. V.',...r.:.. ' VV1.V.,.-. .f , ', SV Y3'--g-fx . 5,,Vjj.:jg,-Q, -V',iffg,'.fg1 Ve,vV.1-V-fffx Vw VE.V.!'V' J, V' Q5 V, ,VQ4'f.Vf,g1gS55fiVgg V,V:V'. V',-VVVQ-1' 'Q z- Q' QV .QVZ-,.VTf,'g'V V 115 T-'-' sg, ' ,, ..-34:31.21'gin---.V .'V..V .ff -'4-'yV-- V',,-.VQV-2715,--n,.V-Vw'igQ-lg,5V, VgggV,..5.V1pwpn-gg-IVVV43-VVV,V.jVQ,--.1,y ,qi-,VL My JV.-5.f,LV-:Q :Vi-j:V fV-V-, J-'-1-,V j:,-V.'V1rE,g.,g. 'V-ff1'., js- li vi- Q ,--ff if '-', ,3,Vi,jQlgV:51V-,5'V-H,- g.T VVi. '. jV,fV -'Zf'4,'V,l-.V-1 +1 53-,z.,2.Vf- 2 5g.,'.,g'V A .V j--V3,,V',QVf.V, MVVQV' Vgiv-V QV QiV,,VVVV,V,V, ,-3-4g... gV.g1'g2:5221-,il-yye.,-5,-,.',1g,,i3'. 31-21 1-,W f,-',,V- -Vg V 3-:.3V Vainr,-'--: f:3:,.-1 f.Va..f.V,V,:,, ..:,,-,ggV.'.,?,V, iq-,VV V::5,V-,V-VVVK-,VV-,VV My ,gVV,.f1,V,f Vi.-Ve, 1':f,f,V- f.,,,,.y ,.VV-V., V- V: ,VV'-.1g4..V-,-f-. V 4-q2.1,VV,gf.VV'.-V-V-1,-V,V2V,g-E5V.V'V::,:',oVV:2,'-?:iaV,V5-V--gVs-f,aVfsfV'g.6',V5V'gVz-.w-V,-V'.f,Vff-V:-fp,--risk ff.-V .gf-iggfj-1 V-V5:gV V.-QQV-1.15,+,g--..V,jf,:Vim...VfagVqVi5:-,pV.V-V-,i5gV-VV,-,.V .113 'pw VV,V-VQVVV3.-.-.-,V:VV,-,,-'1VV,'V--,,VVj:V--.'V-gl V:-r V ,- 5. ff 1 1,fi1Z.V',fV-V31-5 V-V-V.-'2V' f-, 2V-,ff Q,-1'-YW-,-1352:r1VV.Qi'ff-X27'5f-5iff-4-',', f'V-g'V-.Rav:VG9f1Vf-'ve.V'.-'gVV-V-a,s1.'V'V-.5 HV, -5.'V,.fQ-FV.'Vf'--Sgp.-vi-Vi?--E5vi-Vf-.f'i,Vf5:'Bn. gi.-Vg' lj Vbfil?V,5V1?ff5fNQ,.i Q' V V'.'Y,V?V3VV--jgf,f' '1'--3-3. f:QV,V'Vi- .HIVg'!'Ag'LffV7-:ffItji'fk,'V ?-'fin , ' -:'.z-fi- L?1fI?V:u:.3-V'-p'V3,l.5-5 -.5-i,,:3.5V VW- g',I,f'H.''V-V1.5- ':'ffft25fE53-ifliflEg'-4:Vf5h Pjji.-f'g.V'fL,-'MTV 'g .V-. ,:.,.1VV--- 1-Vw -V 3 .'V- vt,-yf'.fVV-,g, -7, ': , ,VV ggi:-K-,-ff-,wg-Vi :V .V A -V,VV ,V-VVVVJ .VA vm ,Vi-,,. -3.15 yi-V, f,-p,,r,'- ,V,gV .V --Vg..--3-.V -, - -J-VX-3. ,--,VV' :,Q:VV- -1',',fV.-. V,-.V QV --fw- 55f'V:V-V2'f,V'Z-3V. l-3 '1V'1'-','Vq'V'-5'1Vi- 1--V3 fi-.'-H V-1?'i'r.fl'H?f3-Z5 -' V V. '--'HVVVPWFV' 'V:f, V ' 'TVI3,Q-VVVPEQ-.-'WV?-VXfg'ZVL-1'V- . 3,1511 'H'- 3 VV ,2-1'af-'f.:21f1V.?lf525-?P'VV55-VPRVIVQQW5'QZMVVV'5 -'-QQWY' F.-?',.e'::vfVS ,Ti gLlV ',if'V'-Q Vjf1'k'5?'1:Vf-X..--'V?.f,'V2V-11-225-xr:-:ff?1-.',h1':g'ff. '--2'e59EQa1l 'V'2,3 IVV ':Q- 1 'Q:'f'l.JQ.:5!f'V-V9 fV',--QFZQQVV-, .'4 .' ffii.--V . V,LVV-f'V',Wif--f V'Qv.V V'..JgVf'.--: '--'-W 1-'ffff?-. '.5-kk'5?'1335' 'I'--?!!V'.gf'YE'-Q--VV' 'A VQV-A1- I-V 2 'J1 V'iMfV7igl157QW ,-LQif5fQ'V1V'2QWVI 'Mil ,, l-e1V V'V'34-1 - V.VV.,-.g,V,,-V-,fiq .V Vg,-. .VV Vg, V, -.5 V- V:,V'5r.V, V,-,.1-,Q --, ,V, VH ,-V7.3-. Q1 . ,...-15, V4.4 V,,VV VVV VAV. V- AV,:Vg-VV,-1,,g,, -,- ,. ,. . V,.,V :V-1 'V--g,,f,', ...Vg-f..Vg 4.-,A-V-,,-QV, GV-, .f.,.V, ,...,,,.-,-Vw.-,:-,, V .UQ-,g, s :-- . V- -, - ,V--.gpg g.V,Vg,V,p,,-4 Q-.VV ,V-, Vg, my-VgVVV,,V-.f ,-, V55-V .5 5?'Q42i.1VV.fS'.fy5 13.3-'a5.f.V.CV.-,r...',-f V-gg5-7'25,3-,-..1,g'.:fr:gif!-3.-V,:V,-j.g1V.:,Q.ig.,,,q:-E-' -27583-5-iw -y .?13.'-,'-,:V,1m.V.Q -.Vi' VV-4-ff,-1Vj-'Vw--VV 3' rfgafwf. 'VVVy,5- . Vv1'-',- ' zgw,fVf?MV.,Vi'-ig'-f-QVVVTSVV--I..171f.:VtI.f-f ,.VrV1'V, .':.VV,-'V-Wgi.-,-::,,g,.-,f!'.,- -vi..-' ,--j,V.'-'V+:V-111 -'-p,,'. V,V'V:-if-,'.V'g VV'l,V4,j.?Vq'fa:-g'g,.lV5if 1 f.:fl 1'-W1 1-Eu.:-'X-.'L ' - KJVVV-.3 V,,VfV -- .. , 'V V: , .,V.V V V ,-:V:. .,,1, -, .V -, Vw V, VV- VV.-,V-V, .., 'V . ' ,'V V '. V .nga -.5-V...-y ,Va -- ,.x-.,-. - ..-we :V 'V -, .:. -V-V'.V6:'-2-iff. - - -1 1.1.-2.2,-VV.,-' - 1 V, qw f,X'ggQ-1Q1i'Q.f-TV- .'Y- X'w'iVfgVJ,f,'Li97',f.,'Vg' -.V-:V VVQVQVQ.-VS:-Vi-eizfagg. ...VF V: ..VV,ggVVf:.f.. sig -f--,.V'1 .AV ,V V.V:fr VVV7.,-V-1.4.-f1V'.wV:.-A-iV'- -V,Vf,-..,V.V?.Vgf,ff-, , -,zgiVg.--Vf,,V.'q.f.g2-,QV-.-5.-fr-.,.1VV,Vg .,V:-,.-V,gf.::V.,Vg,-952,-V..-,, fgv.-,VV-,zf-f:V..11Vw,':gf,:fF ,425-V.11V.V,,.q V-'V':V.-V VQVVV17 V,,,VV-, --92, v-V.-.Q-V49-V-j-.scVjVV.f-,:.-,.f,- -- V, 3 V-,fs ,,.-Vt:',-U4-, , ,.-V.fg,5V.-, 4,3 V-'QV' --1-, N .Y .V ' .Vw V V..-,V 1.: Vf. -VV1V,g,,.f, ,sfj -V.V:ag,1,'-, VV,-.VV-7 ,.gV-V-,.gpgz1- -,-1V-,,gf-pw ,-,VVc,-- .3 V- , '.,.5..ff 5V...--'.'3:V:- ,-gp . .-VV., tm- ,Vu ,VV ,f .VV-My ,g . .L-H., V, -,V ,V.VV, ..3,kV,- -, 3,,V,,, V,-,,.,.:.,5, 1 . J, gfV,.,..J-V- ,nf , ,V V., ,V ,.5,Vk,,.V,,,,,V.-V, V-,u,,,,f.,,, 1, i, ,VV,-.E- ,gg .V V., ., , -,, .V -,,.,,,,V....-.M-, ,MV .,,V.V.V ,- , r1:gVVS+-Wg. 3--4:-ylgi,-,MVQCV'V14.JV',ag-.MV'sf-V-23.-,:Vi,,f,iV,--:V,A e.V-If '-5,w,.- - 5. ,:Vw.1-V'-3,-1 :L :-gy,-.'g--3-,-.V--,lf-,V1 V,,.V:qg- Vg'-51,VVVV'.-fy.. , H, -V1.4 ,- --V-,.VVV ..VV,,V3:Vf,,VVV::-my-VV-Q V,-.V-ag.V,V ,,-.,.V,,V,,VV.-VVVLVC:-VwV V, VV.Q,V,,.V-,-4::.y,5,V.V,,-Q--3551 ,I V-,,..jf V-.'1,:,.V-,V,Vg,V:gV,,: .. VVn.V- , ,VVg1, - - -V7 Vwmf-. '2z-VT42-V'21.8'4V.VIV:3VVVSVFVzE.2'iaV,f-Vim2? new ,:- V'-:HV-'.:'-.1'V1f a.lif-21.5 eV.i..:f-iVVV,'V'V-1' V.,V1VVf NV-1 -V-safsV'f?.VfV1uVV.zV1VV,.--,VVVV-,fV-VV:-'Y-V.-'fa1?aV.,,'-V giVVfgi- VVgfg-fi.-g...-gn'V-V.-,-.'..g-'jf 1.-:,::.V.-,.':.',i.,V,-3-A... ...IQ--VV-:gVf-:,,:V,.-: V V. s,..V.b ,V g,, ,V Vx..V..VA V-,.a.V..,,,9,.,.f,,..,L.4V V -f,,...VV,.:,V MV, ,,V.,,,. , , .V ,,4,V,,,,, V,,V, ,. V p ,, ,V VV.,-. .VV , .-V ,, . ,,x, .. 1' VV.VV V,.,, Q...--..,.,V. . V V,.,., . ., ,V,V,V, ,.f,V,.VJ,.,,,VV,cV. V.. ,,.,, ,V,. .. . . . ., V V.,,...V .14 . .,,,,.,,.V V, ...... L,, J., V.,.,, ,... Lflvxtfmj--IV--'V'-VVQZVVQV V,:Vg'1.-24.2-'VV -:3aVV-V:VV.V' 'WV-'L 'Vg',-E'-via:mi-V.-'j,:,-mil..Lf-V'-Z,'-.-mc.-,I..t V':-5.41-':, lllu-sV,Vn .V1VVI--V' V- VVV.-.EVVXVW.'iii- 'VVAW-'-iV',V2,Vw -Hg ig: 'H- M,V',.-: iV-VYVG, rf- yf'.2--.-:-1:Vg.--'..-, :',V. V V f,S 3-3?..'Q'i2'V'V .5253-V ,Vi.y.f 5-I51i.,fx',.-'gr?,rmj.fV1513'fgff'-,VV'-'A-5-VV-'VV-'gl'?Vgy,-yxiii.,z,Ve.Vv'j,,.gl--SlVIL-f,.-5Vgji'1,g:Q,:,iTV ff. -,.,72e,fV?.,qgf..g-..f- V,.'.-351. 5rg':':-LQLV'-,VV j'-Q.-V-z ,qv - ,Q N '--11.-Vw ' -,, T' V- U' 1- -'??g,VV'P1- UQJI Q, Q -1 'WVVVT V,3'QV 'Q,V - 'V'-'VQ-,,- '. -,:, ,'gyQ'X-'fnv'f,'-f VV' V' QV, Vg! 1' V ,'4 F-',,-'fwgzifg' 'i 'V' 'V' 'V,' Q 5- Vg, -,'-Vd .'-', v'V',3'b vf V. 'i-1 '.fVI-'1'- W4 , - VM ,'3,.5,J-.V Qin- 'LV .-, ' V 1' '-'V'V. PFW: 71. 'Fry 51-QUE, V'V 'f, 3 '- Hi'-'VI- ' V-fi' 1 ' '. f ' ' ,V-315,11 Jr..-2.-,g-f5,.-ts ,-,-K, ,q1jg.5X.,,,V.-.VV,,,vj,,-QQ.5V4,vyV?V.g-'myqQV Vi,..V.f--,-,,f,-...QQ VW,-.3..5.x.5g,.,-g?V,cgIV--3,VV,.- --,,'g,,V3-.Y-, -.,sw,..V V.-.M ---V. ,-VV .- ,V .. '.:--4.,f1fV:5.5'V--V, 5, M1-gVVj'gg,.-V. .jg mm wg,-:V.j,-.',V.-ppm' 5.,f,gY,VV.5w.-,Vlfqm-V?-5,-Q.5V',,,.5,. 5 .::-..-, ,V..V, --,'.5-,-3-l--1g,,- V -VV VV , VsffifV,..i':.f,1,.fV:,'jV.-:-C6535-1+-1VI '-V-.fV','f-V-V-,--QQV,-ek'-wig?CixiAV.-..-V:-VZ-V'if.g'5555,859Vtfrf, ,V'V-Vw ' gl rf':':V.',-.-'VP..iVifYL?f's.Vz?gY5Vf'v5ff-V,zQ-1 --V,.1'..V,--V,1VS'sVi1'gg'fi 'g!V--limi-Vz'VV'Tr V gwgii'-..-,W.THEQ5, Liiff.GV2,-ag--wks:fx-Ja'I P39I-1-1,91-.'Q3:Vf-2' V ,-Vg-V--:V.,-1 ,,V.- V ,.,V- ., '-.- 1-Vpyf-. q-,zg,5-,VVs.V-Vg,VV- .1 ,,V,.-.-,-.JV 'VV.'V.rV -.1 V-:V Q- -VV,',V,V...VV.5a.'g,.:V Vw, .V -.Q wr- V- - , .V 1'-V . '-LK:-VIV-VV'V -1---' :':-- V'.,:.--.- --V4-fgu.: -V EV: . V,g--1 VV, :- ,.-V5.1 V-.V V 9. ,Ve - ., V. rg -1: -,V .. a, , .,V-2-V,,3 '-.V 5 - Q V-J., :,..., .V-Vf,:f -5. V... --,Y-fVV:....' -V-,.V,-..VV.,V-V,fVg'1V,V1..'.V.1VVVV55,fV- V:V,1V--,v:f.-4-92.-iVVfV+14 ',-f.V ,-S' Rf V ' -VV: :-2' - ' '-- -'VV'.1V7'f' 'V -,QW +V iV'VV -W'-Vf.f 2: -9.VVV1,,9'.-i.--VV-F-V'.Y:V1'V-V f,.V,'-., vw--ICS-X5Vgr.g,.-V-5' f:- -::1,'- 4 1 wr' -1 - - :..w,Vg M' ,3..-pin rg. V-VA-V -LV -. , --Vg in-if V: ...ff .-,- VV: ,'-rf.-:,. -, , - .,,.--,VV--1w3.rVVVVrV',4Vfb 'V,-, vs .V-mf-V V- .V ,V'-V-VVV-,,V .: VV VV. ::. V .,V:.VJ' , ,- gf: - V141.15326'-fi3fi'fQfi -TlVflvlf3571'-ff!7:-'-iiiliffb'32?ViP'5?f!1i:..g'-VT1.Q2'--Wi' ' lfV 11 F.'i?'f5i'7ii1QQi1-ff-'-5 '-f,'V Y?-,'f:V! 'if- 'V-2323 -Yi.,ffVV1-i'i-zff3: l.4,?3:fVVV, ','l5.fVf- XVH',?2,Vfg.'VV-'xl'-fl-.3VV255jRi'VLf?EVZj3?:Jpf-3-VI-'25 'V-Q 'VyV1f,-!V'i' if - 11V,Vf,211,Vg,.Vs ,VW iff, VV11 --V-V:-5.1--:1qVPVV'fi' VC-UV--1:V,:fg.i,-',,, --tifIi.V.V'f,i'riF.FV1-.LVri V2V,2V,L' V3'1'f,fQfgQ4,f'gf'fii'.,Vfgf91f3iL: '-f:,u-1,'-L'.'--'gV:.-1- 'i,:L. ,'gf'-'iipf-',5 f'7,15-ff5'-V'1?51,155-'kff V7V.'.!'f-f-gf! VL .flu-V,,VV1V1g -,V,1f,f- ,xV,VVj,,:-.,.,'-',VVgi.yVV.Vg,V',,V1:.V3.gi,iQ1,,V1,2Vffi.V.,f5,gVgVV-',g,VV -,Vic--:-:V V' bt--Vfe:-1 u. . :V ' V.:-. 1 E.:--:V-:VP f-:uf-5V1.svs'f-'VV' - nfl- VV.iV.JVVV-:'VVV?V,V,fVem-VAVJ-V f-VV-q:1V,V-4:4 V-'VNV Vf- V V V -V.z'r-:V-as-' V:-ff, -,rf-VVVVV.V-.ww V-HV- V4,Vl5VVVVVf'-. aaw-1-QV--2--1 V- ,', -'Vg V-we e'1Vf-if-,Vtg-VV'. ,:r-- VX- .- ,-,V' ev, z.WV.V' 'VK' 'IV-. ',,: ,,'fV4,A.1g,-.V- V- -. , V V- ', '-3.1.1 .Vf.f1tVv41 'Vf,.' V1'.'V VV',- -'VV .,,V.1'Lf'V M- V:V'xqVV-.D 'J-' .V . Vfg.,Vr: f -T-mv Q, - T.V -VVV','-V-4.441-QVV5..-. V- fy -'35 V' VV V VV V- V'5 VY'.. VVM4-'fVV,lJV'- 'V 1XV , V V-. l- 'LN' '-V' ..w'V ' VV,-,,-9 X., HV,-,V ,Q .5 ,.'.r ,- fm.-,,f..V,fV?, V.- ,.-f.,,V V-.3,... . r,,.- nf., V. ,M-,VVVV-V.V!g.. .. -,VVV-V ,. VV,Vw-,-VV?-V.VVV,.VVgV1V9sif 1-,. , .,V.V..-,V -.,.-,VV . -,, ,.-,-.,.V A. ... --V.. .4 V. -V1-,.5,.f3VV. ,.V, -,-EV, ,,,'.V V-f' , V-.V-Vg.,:V,.V,f-V ,VV- -fm.. .V-V VV VV.V-. V., V--V. ,Q , V,r fyw' -,.'.VV.V- QV. V,V V.,V',' - VH .fr ,VJ J 'i I-:LV-'VVV . V ... -',.-,. ,c,n,:--1--V-41:51.151-.7.,V.1g'Vw-V . -.V-VV, J Uv -fV V-fr.-,lv-,?ztV.--V--9 ...Vg VV,V-.VV-V'-Vf-KV .Sy zVx,.VVw,f- ' '- 1. 'V,-1.54: ...V -4:11. VV 1,7--Q ,V -,:-- -V V- -VJ 'V,.3.VVfV,-5 V --N V--1 :V AV., Vw ,VV ,-JV V...-f., f,.-VV?-:'VV3s-,V,V,V----V. -,V-f.Vi21,3',V?.'V.Vw.-e4EE2vHQ1:-'-51V iw- V'--V.V::-V5 ijvfp--3,-qv 1 -ww. 2- +g-1-fi'-3Vz:V-5.V-i-1211, V- V, 5.-5V,V . -few -gfff-P Q,-V-2 .-. .:.gVV.V,VVa,.VVVi-V.gi-ff.4:-.i.-,--vf:--q --QV ,V.',V-VCU. g1YV.f:V-H. --f 5-'.-Vgir-2 ',--.Lf Vi-.f--V'Vz V,-VfV.aw,g. -yd-1 11- .-V. V' f 'iff.ymfV:'f5f.'QV,g.4 '.V1VU.':V,f 'v1135f'eW22.56413-f?'2x11l'91L:QY5:'1fV'VE1,.VV'-.fz VTv1V',- HL if.-'ffVfff-','f1g.Vf'zTASS-531I - 1. Eff-:V Vfi-mfr?-'.1Vf V-.V.,VVV.,.:gV- ',-f- f. 'f V-544- A-1-'HV ' pf?VQV.V:75?'VVVVV'g'-V-mf...--1g.',grV2.1-'-Q' 'SVPguy.-rVl:1--VVVV:Vvg.uV.'V.V.Vf Viixuff- 'V V. v,V-QVV' V . pf- i-V'..V V, ifee- -Fit1fzfzfkxffi-.1-'T-55V-:Vin WV..'.-zg.5V.K.:'V,s,.5Vggf, f.-V,..- -VV:.V .-.VV -'V .,-, ,, - .VV VV. .V, my-g,,V.---.-me-:f.,',., ,VV pf -,-V., ...J-fs -,f .f.,,, Vf.'.r-'V ,,gVVV5V:-V--a.V-:QV VgygV'V-V,.'V,V V-VV.a.-V,-Vg iw5-,eV-V-.g,ffi'V.-x,q:.:.eV 2 ':- V. 11'- fifVfV.,-ff? ,f,-igffi' WVJVVK' '.zx-1VV-VV-VV'Q1:'12Zz'::57' 25'-Sf--'-f. fztv V - f f.V'1.V.V -'-5:1-'fsiffV',1-'i,.'V5.. t.V- --ft- HV'-.'-F1-' 4- X3-'fV'f'VV5,-.' -V !:5 V VV.V M- :V f1VV:V:5w1'E. FV2Qf':V.'--11.-V.'e V' VV --FV--.-V:,VvV'f.V'Vf -.if 4-1-...V'2'2-.-1, -V - f.','f .? if fa'1.54g'1:f3-7-. v. V' ' V VV- , '.V1Vf'. .'VU'X. Vfi:-V1-1'5-r4315.-fV,,12' rar,.Vy'V,V5-VW-p'i2GvQ'4 ' V Vsfv ffVf.-':i.- 7,2 -.-21. -g-Vi2VV..Gg.-Vi3252:'-,z,f,.j-F,-:,2V.V.,H-wie-.4QV,'-2,-.VV-g?Ve?hV54wzf,'Eg?y-.iw-VVgV19.ff-'.,.-V'.-,'-,Vw .V,.1,f, :s:'?'2-'Liga ---Veg :V-nr.-' 1-'Qu,-2-5-Q.-'aVV:g'-,,.,'VfV -'gJ'V,'-1-',:Vs'V2-Vu. :za-f,..VV..Vs,V w.-fVVy 'V-V-VsV.VPa4- -sg Q.:--.VV V1-VV'.V.V:V'.-'--:Q-ff. -,Vg-:-S.:-.--V21, -:VV VVVV,:,:.g.V',.-gfgVV- .VJVVVVVV--5,1-5 ..Vzq2-mf,-,sVfV.:VV2g.e42--VVnew--.. Vg..v-V+,-.ai-.fy ,.,.:,V: -V.V f-if lff'ivl1V-f'-if ---ff-VW --ff . QVV -yy, 51,5 Va, 7,VV.'V:, 1--..VVa-,V-:J g,.,,i-:,.V,:V:qaV Vq,,V V .V5,-.W-r vu f .'.fV .:t. :gig-3. :V 5. '- vi-3-1,-1 , gr Q.,- V,,V .v-,K 1' vm-'V-MVV.-5'.Vj,4V x: M, Q- of 5'V.V-.,-Vg.V-,-,gj,L,V.,:V-.-,-V. ,V1.V,V.-g-Q V, V .5 V:V-, 1- .,.y-4,..'1V.5..V-g,g- ,..fv-f.V:VV,-,A V',,V VV -V M, V VNV V,- ,,.VVV. . - V WV, 4V,VV-VVAVVMV - gy: 5,-1,-'...V.,Vs,., f-Q-fu -V.-,,-V-,,:gV,V-'Vc,: ag. V '- V- V -V : VV.-V VV,V., V., V- V,,...V,.V-,.4V.,V V' .-V V 1VX'-.f,VVV3'Vw.'W,fVg-VwV'V,V-Eg-My-LVV ..V,'.rV-VVV:-,fm - V5 --1 V,.-VV.,,f,-Q -V -H -.,V .3-'Q-3 V-:V-: 1: 4 eV- 2:-V-i.,u'VVf'-f.--.. V,.V-.-.V AV- . V V. ,V .V-f: . .1-. ,--V -Ve V' 4. -,.-sy ,g,V,V-:V-V,---V.,-' 9.-V--, VV , ..,rV.VV f-,,..1- ,V..V'V..,- Y:-V-1-.. .V '--.V,VV .4 VV.. fa. V-VJ. VV- ' VV- WV- ew yr--VQWV-V-,VVV V-gf: -f.,.z1V- psf., .-,-,.VVVz,..V- QV- -QV-..V,... - :,..V, ,- z, ,.,,.V, ,- ,f,V, L, Lg--,z, V Vg .:,V.. - V- ,VM .-V ,V -VV .,j'VV.V-.,-QL.-, -'Vf-J fV'e4I:1--VGV-1. ,,4 3-HQ: ,L 2- -- g'.-V - .V-V' .-.V- rn V V'fV V s., I .gym .V-V 1' 'V -VV -, -'V ,,-',:X,,:,V,',- 2-5-V --V VVVQ- V MV V '- JJ'-'Vg'f' .VVVVVJ-,J -,-.1-,-1VsD,VV 'Juv-.. V 'I . Y,-5 --,-V.: V.,.:,:2-5 ,:4f..V- ,,.-V, .V-, V-, .V. 4 . ., V-fg:f'x--.Q J i':V--9'-,fg-V'.VV.,--.-V:'.:.Vg--wb-V,eJmf-K-LMVKV: V..-V33--:.f1,,f,.s' -.qw--V, g,V,-fV:f2Vg-fVV'V-,i-- fs,-H -:e,HV:V,::-g V-Vg.-:...f-5,9-3-V5-..,:gupV,VVVV,-,-.-g.-.g-QV'VV.,gJ-5.21,Va--?la'1-V:32,22-5322-giEV-VM--w'VZQ4g:gf-,fm V5,-.-V,,,z-.1Q- 3.-.2V' VV 1: 9:-VE Q f,jf'V,k:Vj-,V.--,JVVSQ15 ,Vpril ifv45V3,if,VwV.-It ?!V5:.S?yi5q-523,413v:.gggi-Jw-5i,qg.,:nlg ,lg-3,.m.gV?Vg.Vtfl:,fig. 923153: ,,,V X, .V ,bfyirg 3,54-3v,xv,3-19154: I 3,.k,qVv.V-- E ,A S ?, ,ig Vries-si? VV,-5:-kV .S gp. 4. vgf,gfj,'i'gZ5535.,:-big-K V.qV4:,J..,.Z.VV14I.- 3.3.2. :VIVQV 41.22-V 3. 4,3-VV1V -,5.V,,,-V .fy ,V .. V5f,V,,V., VVVV.'g.-,-a.VVgVV -,ff --15 fr.-'-f.g,, ..-V'5fV-',..,VV H, .-Vj.3V, :g:,Vf,QQ-.,VV,V ,V 5-.1V,V,V',1V-fV .,dw?Viqajf.-Sgi-fV':-'-.VI.,Q:: 9'-' 1'- '- V ' V- V-,.-45: 'i 3T ,':, -'V L'--'V'-1r',uh 1- -VV'-'-V 'V-,V V5 G V :J Vfffwgft-2-,V-V. .MV :NV. 6.:'.F-Q.-2-10,-,'V-Vx,-VQJV.-z-:.' ,V',V: , V',w-.-.'-Vt' IV.VVV..:! -'H'-'1 V1-'V'V:'.-'I V -' V'-5 'VU - a2.f-V,2'Y-'1YQ.i4fV?.?2V?f-fa'1-,V?'-f-5'-ffwi: .V-54- 2V,f?:J'V'.V::1-fP':.g.5i'55-fs, 5.1-ww -'-fl 'fr'.3xv'f2.'V'- FV, J--Vw V,:'f'ffi4f's...V- .-f.V:,.1 V' - .-if-VL V, .gr-..-V , fs,-rv, ml A V .VYV-.fV,fV-2..V'fC,-.W . -, V f-V .2gVV-vfVLv-.mix 5-V wV1fuVyx1'-g- 'V,Vv.,V--1-VV V Vps-'Vw --3 .'.y::,a ,1:1-,- Q..-f - ,-V,, V ,- 3-:,'. wp - HV' VM ,.-: , -V.: V..X-VwV1-ff-V1'gg,.,f,,.. 5c.g-3..Vg.-My-xV,s..-ffff-A ,V, V-,V,,, V-V ..,V9-VV-,V ,5,VV.,.q 9- .- .' . -U Vw- V,.,y-,Q ,- Vg-Q V5-,VV,QVVV-::VpV.V,'i-1r-.gs2,1V. -:-Vgz9.5Vg-.2V-.-VE-,VVsVV,,----4V231.1-:wg-:fr-.251fVgs,wg?-ffgiV'Va'-.V.2,.- VV:'f:-'.r'- ,v15V-.V1sif1..V1l,.V- ' ra :.1Vf,f:-gV1i-qg- smiy31311-Vg-.QVw.,g-g5Vg52Vy1f2,5V.-MV- ,fa-VVV VE' -fix, -:Vi k-1'-gjz-Y-V-.-- .V -.,fQ'f V',.fJ.1, 91,.2V- Vj'V2V2,--IQVVVXL ''-,'iVVVrVVg55351-,3J,.V3.1-555,2VVVVSEYVR'-3-..1'1,z'VV?e'VV -ij-VJVq..V.VVQ-3 ,'fu-I-Q':f'. V C V .V'3.1-y2-V:ggV1'V'J-gif.,.VV?241Lq..Vf,ViwV.9VxVVff,,.:V .15-,V-,,. Y.,.g3.g.-Q3-.5.,' .V V, VVL 1, . -'-L -, ,I ' V -VV V' K' V 'V'- ' 521' , , E.5?3,- -Wfsv.-??ff'V', -lf'fVi???-5'1ii511'VF'-.fV.J'i4'xI 'ff-f ,V Elf- if-'V'VW-'2:V1.iV'V li-'I-VVf5f'E-T'?e59'1f1 I-355'-,-F':'i V'1,'1fV'Q- ff--fV'51.'-5'-7-5 V'-7ffw'5 .4,?.:-3fa-22k1'VFf'fE-13?w..:'V?-?a?1Jf?V?fixif'53V?.i 'VVLTMV'x- V1f'VtIf1 VVif1iW1'fi1 iE4f5,21dbf-'li-2F.- T V,,7 ff' kg. --Viv: :,.-- 1:VV,- :,VAV:-,2f,,..V.- -, g.4.g a'V2'r, ,V'V-VuV1-:Y,- .V..5-1.4, -'V 'V,,VVf1 ' Qxiganggg' IV V +f.VV.eVf'V.-,..-rw, Vic i4gQ,,,f:1,.?V,-V'-QV, ,S f :'VVV,V1'-f' , V.- V-FN-, 131 .V,'VV:, .5V:g':,Vg ',V,':'-nr'--. V-1: .VNV-rVV: -gV--5Vif1-:.ff:,5VVf-,- .Q-QM V,-WV: 1-Ewjk, VFai1,1Q-3-if-gg:xffg!..rJ3p'VVL.uL - V -5- ':3VV 7 ff: AV V:-,far .wk V-'-, ,.i--'rg,.V,'.fr:.w1.,3,,,-Q'951's,VeV :.-QVVV' -QV-my1V?I1'.'J.-',.g-1,:ry-.1'5-..'V--Vf-f-f-LWB.'.Iff?..f., -VM-IV-jf?V-LV.5Vp.,VVi'jiV3Vgt-'VV'.V-Vayff-ii-V VVZVHI ,-,zzfynx-42'-42 4-'iff-,W .453f':.--fi-512-3-r-.VV3-.-7 fin''53,-.552-g,f:V,u1.Vgvi, VV 'Vg':VfV ,+I'L-Vf'a--Vi-V?5:gVg,zi-4352:28-QZVH'J421.-iff V-4,'7.'1V'- Q-ff- '- A . , V. V ' -' V,.1 v :V -g, VV,-, VJ.:-- V V' -1, ,-, V V VV.,-1f.VVf9V i!V- 1- 'V+ 1.,V --V,.gr,.:,, ,M -V A., ,-. -. -V -, f 1u,g:,VVwVV-,-.,1- V --eV-f.11:.VVV-.M 5, ,,.-:.V- ,. ,. , 3- C ,:,514Va3VVf'f'-'V-V- L- 'Q-.,.f :V -xiii:-il:Y Q-V.-11li-.-V-.Vis-3--2..VfVVfVf.V'1.-VV.-21 -'Vi5.'V3.h55g:y..,--'sy-E, 1g.gVgif,-w:gg2f:f:VV-,,V'3V-V- -,if-ffm-1V'f41?,-Vs:V.'-gV f,.g'1 '1'.2z'i1 VJlVVig fff f- 'V'V'L 'V.--VV9-FBL?-:53Vzf?5r'?f:-MQQViff?2-32',V-'fnfwf-i VV ,.5,Vgg,a5x,,,gg,-.1,..V V, V'.f,g4 ,- .. 1QM:,',,V',3g,giV--5.27 ggi-5.5-5.V,V --01,5 gg 'Vg-YV. My g,1 Vg , 5135,-,Q -,V1V,ggr3-gli.,V,VV1.!gf.--Vg ?,'-K4.v,. ,V1.,,gL2, Q.,.i,,3pV-aff, -' ',ifigi-L-VVVM5:51-f3V-,3VVVf13E,:,Vf1'--fin-i'Vg?T'.-.V'.1g-fV'V:-'V', gVV'VfLx,-.gdwxwfblmiwie!'psig-qbigrf'-V'GL -'VC H rg 1'-. ,-'1-- --E't,:V '!-'ffVf 'V1:'1.- 'rV'3-52515- iff'w f ' va...-VV V L?l'f 'V'A .'5.1VVgfV,+Vlf 'VVV aw,-V: i .,.--'lt-V .V1Vcf2,V2f'e5i3i14-1-.- 'f.-'VV :asf-f'-,,':V:, :'-'VSL5-i,-vi?-4.-3P,,.-23, f- V 'gSf- VM--1 -V ,.VVg, -.' VVQI-.-Skin:-if 1V-',--V W, .a',vfV-'ff'1 0-,1:fb-11f,,-w:Q:V?Vp2fVM'c.'-..VVVVg'V'W15V,- WV '-V-' lr' iff, 1.-gg.. 2111- V V-z--.- :V,:4:,V--VV-gf .-,.eV4-- -V. V- V: -,V -V, VS.-2-,,-,,V:,..xV1g5 -,.1VVaV'--?V.V.-i,V.1,V-,Ji-gg,.g,igf.,V2V5V.x,5V.:V.V-VV-,'.g.V ,Vy.VVv-1: .,VY2V,V .,Y,.fV VM,-Vp-V ,V,QV??gViSV'i5V- 52:17f5V1ff'5'3,f-5.-5' :VVXVV-. 5y,LV'Q,,'-..iV.---ffg. .0 2-. '15-V 'J' .,'gf'.-'Eff-'gg ig? 1..g V- I,-v N1 f Q:-Vg: VfVVffg,HV,vFV2fV .,E, .ai r,Vf Vj3V'.5-,vgsg Va 21,15-,gy ':.4.f,gf-3, any :--'-3.3 g-,-.5V.V-g,Vf,.'VV',- r .V1.5354,4gm,4g,,z4VVV5Vq,gV,.y-1,5 :V 1-,NV .,H.,,,.-,,g,V9V W ,iw--,kxVd-3VV,.VV Vz..-,Vym-'Vi-VV-VVVVi.V,VV,.-V. Z1 0 ,5-,V- ,VVQ-Q'.,V.Vif--VV'2f7'.V..-'-.am---V' .V -ff V'f':,.'f 3,,'.g,'1.,,,VVT-1 av-V 'V.',-fa,Q53.g-r-f-'g,,-Q, .V .V.'-Xie:-:'.f,:V,-'g :. .V VV V- ,fl -:,V-3 ,,g.,.5g.,V-QQVV-9-1-, V ggV,,-5.J,V,V.VVUV.,- , -'V.V,vVV gg-V ...gr gy.-,VQVV-VV.:V V1 7-V, ,Vg-VS.--.J V.-.Vt--nf ,V.qV.1Vgf.,3-,4-gg. V-V,V,2.V'.,s ,. :V,, V? 1-Vqzf-V:-y -L-..V-- 5, ,V f,-QV4 .Sim J.'.VV.VVVV.-V.-LV-,v-'VVVA--Vs, xx-V..-JV' ,V--V'f.V,1.1,,VV r nr,--VVQ .,--,W-5, A ,, :f,V.,,, g',.gV,V. .V,.-f.Q.s,g.V--fr.-. 4-Vw-f-,V,v V-.iq , VV... VV .,V,V.VV,'-.4VV..,VVV,,.V,V .VV -'VV-VV fVfi!'1'.': VVJ1QV'1 lf..-.. VV -Vff.V5g:QHv'r,'-.VVSVQFN-,J-A :1 -Jap,-'rzf .ff,:V. .5 ' V - ,?iga,-JL.-1: V. ,V f.V ,Q-, L 'QV-.2-V:,V,y.V,V.., w-LJ 'E Q'-,TK ,1V:VVS-Qif,-15:-V-V+...-V-.,',-' ,G 1, 5.154-wg.,ig-V-iV,..f: - .. '1,-.,g.,,- 2-g-HSgVV.Vfg9YVg?.',., V--'51-.,V,,V g,sf7.- '--g,'VV- ,-.sw,VVg:gzVfQ IVV --1-'-V.-.js-Ji--ff 'V-VV,-V'-.iw-', 52 .sVVVf.- -..f.,:1s?44V:.'S:V1-1. -' g-V' gf' Vi'-'gn-., V' :S ifxa:V'fV:.'.V:,!-.z.-.'f', - :.'..V V -V M'-1-:V.V,.ff-J-V-V: 1f -uV.:V'. X .QW-V' 'V'-5'-ff'1-1'-f lfi1LfLAf?fV9 fPV -V-VF -V 1'-.V JH:l f,1-'21 .wa--'.-.9--p V'.'.V--'L ff- 'V'55,a-,Q-1,f. :V.fP.,gVV'V-FS-V . -VV-'-1 .11-ff xg '--if... ,-A,.,VVVV-V, V ,-.vim ay,-.q,.VrV.VV .5 ,,V--,V,. 4.8.4,-4 ,MV V-,..VN.V-A-,VVH Q-JV-V-V15 ,k.,f 5- -4 - :-,,,.-5 V- ., A.,f- - V, V,-yu nu, V-Vu, --,., - g,.,g -,.tV-, ,,1- -.V:V,,-, i .Vs .-.V..-V-5 L' AY. - , .gVVV,5.-V, -V ,QV ,QV,.-.V-,f-,V.151VV,-1,:-5,-,W , .V-5-,. . - . . V, :,,,,,., sq.-Vfw,V,Vr-UQ-V,-, V i,V-,V. ,, -V.-V..5,-AV,Vf Q i.,-V.iqV :VV.1f5g,VfV5V-.-VVQ.,-,Wg-,V pf V19.x-.7954-Q.: -9 -,3,,g.fV5VV. Vg,'5 VgV.p,-.V 5.VVg,V'Vg 2-Vg-.3.,V:Vg f.-.3V3qg.m 5. VJ. ,. Vg.f3.V'.,..V'.X,-V-t.- , gi- w:Q9r.f-VVVV 2g:,f5,,-3'fgjE,3Vf32'gq4-?',,.jgV-,V-':.:,Q-V:,fVVV, .V'.g..V.-i-VV,V-g-,--,fyV-.4511-..,,-g'.,V.QV-gVjV.g.-,Q--Vg Vp-9:.-.g.-Vw Mg rj.,-,y-gV-323-Y...V Vg.-i -,, 1-4, ,. ,Vg 'Q.i'ZQ--'ifV f '5if--'J-32',QM-9fFQ?'fE1i'fJi'-VG fi!-Si,'fi'--52'25S559,-32ffii2!.L!if:-.V 5'V'15'-'V 4:fZ.1'f'f!-'V-gn' 35 V 2 Yi-hs' .4 ..-W3.-Jl':'Qe+.fV'Z..g3-.i'V-V,QLV? 'f'5'QfnfEj-Z12-Ziffiii-Q , VE?7z'!'.f 2' !'T'C-?fff'ii5V-31 ll'-lji-. LffV',i'-V 'Q VJYSAVE -v.-ff--Vg SV7'if-'6:-:V'rt1,Vfe.g6Vf9?Fg1fV,Tff-isef- ggi-,gfM-, V-34V.,V-,V 'iVV ,hjrw mai29312-Sixipgi--Y..--Q-,-1. :,zVV- 1-'FI VFQ-V,-,,f'fq 'Q.f,'-V, 'Lf --My - V g.v.V-V- VV -v ,VSiizm-.'.494:25,wf1Lf,R,S?--'3V.,,,??'jVL51i3Vff3,'S..uf -:Q'-fVVVff1V5-iiafs .1 .V2f'V.Vfv,I--if,wi'11.:f V-V.'V-5.-v--'Pl V-VVi.1H5.: Q,-.-3 ,'.g,-'.j V'V V , -.-,L V: .,:'.g.L 1 ,Q---gf.'V. ,'ggy-:, V-'Q 'Vr+VV,. Lf' '- .369-,.'Va..m5Qx,'VV',V..-,Q-,Vff:V,V.,: fi.: g1,sVw-.V',.r,j:.VV:.Lrf- 1- I1 'VV-.Vf-24 ':.1- ---2 :'.'f--.Q ,115 .4 ., ,V--.-. T,'L '11 ,',VrV-.J -V, f V.VV-15'v'Q4:9.1,i'-:.V-fy,V1-if.in-VVVVVV, V-rVVg34V--i-VL-VCV.-15,11 .Vp-V12-,v,-V'A1-Ji .-Vp-'1-1.-.ZVf' zu-V4-EV-Sv.-:1V.--2, ff ,.-V'-V .'-V-21 ,Vj - WV!-Q Vi'-.V , 1',:1'f5'V,,-gTf.,2 1' --.Vg-gf?-,'f1gj.i +sVCqV:AJ'l:z.V,VVHSVV'LU-JV.-VL.+,1V'3,--QV-H-fV5fVVzfffyv-iV.f.. 423- . ,.P'-L.-,J .2 x. ',.-f V-,-.V-bf V . QF? -'V:f-V?I-.eff--jg.,V,-ar',.k:-2.hV3'V.3. VVV4:-ws,-gg 'ig-1.fV5Vg,3'?if',,V.s2.'V-1-LV'i,,X-Vf,f.1.V-J'--,-.:Vf9.:,V :kg-:3'g-11- ffl Vf E., V- 3,-Y 'LL'-5 2-1-2.51-:,.,-QV.-V:-,V-VV1,V.'.Vf.: 'Vz.-V ,rVV-'--V.V,-fVV1Vf -4-.,-V :'VVVfV.1V.1,1v'av,1:z1,1v,:V'f,-V'g.V'-'V :V ..v,p,V---T V .Ve:'V-1'..f--- 2 VVV.-, -VV-.m g-,Q Vg, -5,----'--,Q r..--Vw g,'-Vm'gV12'V V .5-f.:.lV-3-, Ve,-ff.,a.r,--,V-f-'f-,- , --Vt' ,V 'V -1 VV V.V-3-'Vw.Vfg 5-ggIg.?5-fgg.'ifji5-VVQV Ve,fx,.,,,,V,1g-.---.VgVwf..w,.iVV,.:-Faf.-'32fy,fV--VVy-',-,V:.-...'V- V-3-V:Vi-J.: ..,qfgV'-. :VV 'fm-', .g.,fzV21' -V -- .,V- f.- ?5V'j-- 'g'k':H,VP,fgV--gQ1'qV:wV J--VV--VZFQQ1--35 V'VVV'VV'V-f-Me' QV,-Vvl'-'15ViiL'1L?gE',i,V V-..-ar. -1 ff,ig:fV 2-VV.-ffV,5f1,:. -' V-Vfgaj. rg 1V-.,.f,-3...-VVV' --wif. V V' 'ai Q rw,-. UW''QU'113-Uffrkiiffxf,-'I-PL1xVf3'QV'fk ',VfVf5- MFI'Qif-ViVQigf'2J3-.gj'fg?MyQi5V-VU?'VL VfrV'.V- 'MV5 MV..-'V,-1, 21,2 V V-UV.-rf.-VV' - :MVA V g'V'f.V'.ff!--a4V::Vfr.VVVKV,-.gk .-Vfw.-4 VSV,a:VfVJ:VVg2m',wif2mx.-.VV-2-M,-V.23---.-,V-,:.V,,' ,:xV..:'f-g.ygXgg4V,V.,.gV-'Vw--'-y.Vg a V-'-1 '-,VV ,V gg ew. --Vu ':'.g. ,'.V--'V- -x-,Q .VwV:V',-.-Vf1,g-'V,f,.- .VSVQ-,V-,Vpf ',-wg,--V1MV-pV.,V-VV---,V--V, i.-WQQVW, g,,fV,VV-3-V,-:V,' , Vg.: ,.V -V 'VW V..-,f L..:g,g:y,. -. 5 . .1,,1., G . -.pq--1,4 ,V.:,,-.-QQVV-VV5VV-,.',-QV., ,'--V--.-,V.y V--V-jg--2 -:.,q,:y:.7VwV,'V-K.,,-f-gV-aeV,.- -13s.--.-'.--Vw-,'y,aVg.- .V-V Vfa,-L, gy.--:V gg fir: -f - 3 Q.: ,- V,.-?.--.V- .',-'.-'.. V--,.1V:Qs,' V .-,':.:Vfv-Q5-r,,,.-S,,:.,--Vg.VVVe,,-V.,V.1 M- V. -3,...Vw-Vf,,.,.:f--.-.-V-, ,V,. VV ,- .J-V,--V.g,v2n.,,V:.f VV- VV,,V ,- Var,--. V,-,,V.V..fV.g.VV,,,-Q5 ff ,,-.-4-,-V --Vt. V-:1..yfvV--1uw..-V..-1-,fi,'V,--'VV-4 -V'-VV.-':,Vl fc-V-2 ,,V-,,V-x.-g'y,..3.--QVV.13,.,.V-VM V . .V 1, 9 V . , V,,: VL, .5-5,-VL-,AV .,..,,,V,-.3 .VV-,-3.,, ,K-V--:V,, V,- ,g-Vx5,,fgVV- ,V..,.f,fV: 3V,VfeVg,,j ,,V ,f,V,,g,4.-,15,,,V.-jx-:hw . ,..V.,,sV..-', V.., Va, -,VVVVV l--.M-5,V:.Q,,-y.tV , , :WI-,-, ,, ,, .-,.,,,- ...WV .V., ,VVK .V--k,V....fV,VVxVV.,k :V-,,,V3.k:wgf,.e,-V6-Vg?gl,,vVV y4VV,V--EV. ,:. , Vg, 1-,VVV-V., H, ,V ,Jy,.--,,,,,,5 ,f-11,VVV:VeV 5... ---.L-, v 5---V - V-4 ,Q , 3,1 1,.a4--1..V.- 5-g-wasp-V.,i-Qatg-5.-yi.:42fggf,,,V-gf1-.12-1,4 ,Vq.VQfVaVpV,eYV,V:V-,VV,EVwgigeigVg9e'.ggV.SVyggj-,2VVV'1-,VVV-ig V,V1: ...rwF--,aQVV1,5,?g-5-fp-'33-I5- 1 ,gy-,Vg V-i,?Q,,1V,Vg'--gig-VVVE fVVg,VggVVVxJ--pf:-...3QVV.SVVQV.'IV''7.M,:SQMfgfQ2'-V',g:,' .. .g 12-I-Vf-1V5V'1?111.f.V:V-'L-,-:.'E-3n,1V--Mags' V31-pg: :VV-1Vq.--VxiVV:'IV'.fVVV'gVQVJwf-rg ff 1VJVQV-,SfV,,fV,V'i:g:'xq3a--'3-g,-'VV,-V--VM-egg' :V,'s?VJEf.5---2.1-' -. V-V'-,--VIS-fV-Z' VfV-2V'1V.V'r'fg.,g-:-VVfVV1,9 1V',Q. VV,f,1f-g'V,-V,V,:.v-V'Vgg,'V,-4.3---VV-g.,,'g-fg.V'-3? -VLVV -V-.,5.-V- 13. .Vf.,w',:.V,- 3111.2-VaV?f,gff--5-5--1,-5 53' .f,,V-.Vpsgi-V5-V.1 -V.:i.:.ss-1Visa:-xf!.f:5V:Qyfg3iVv?1gg1Z,:rgfrV5V?V ,VfV ,V . 3,-2.54 :.VV-f:-yVrV.VfVf- .V QV?-z-g?1VV:,-5g,V'VPgafV.-5-5 .' - V55 4 ,..',2V' ff --'-V,-.,IV-1'Q.. J- 'iu'V' SV V',Vf'f' Vw, VV-IVV?-Yaif'-Q-fVyV- ff.5VVV'z':g'V,4:fVV:1gV1:V!.a'.lfV V,,1'VF:,Vf'1 .V-,:'fVf-- V -.VV 'V: .-gf-MVS-2 11V.f' V.'.'--1'-: V- 'w1Vi:--5-'-VV'.-9210-2--V'921-v'5-,Vf V,f'VC.V :V ffl 'VVVV M ai V V-L L VV JV: VV' Vi We '- ,',a.','..J. :'.V'54 -.Q.V V,..-,..-4-':..Vr 'f22'..f. 79,1-I V','.'.'V,Q --V1,1ffgsi':Ji-'1.af4,:1gq1f?f1,!fVLg-'V V-1-NVQ-,f -2,--5-,. V-,simmgp .- -V'v,, V, 13,13 -5,-VV..-, -V-1-5.1.3 VSV! ' --.gw 4- V, 'pa 5-,WV -,-VJ:,1zVk5,-gg.,-1 ,g,VVg 5.7,-,VV.,K V,,V,. ,-,,g..r.,V5.,,.,m,,,a3..,5.y43,,,V,.,,g,Sp-.r,4 .V- -,. -V571 5.1, ,V , if 1 if '11 V- -gi--f fl -fi '--2225 54.-1? -A. : .f'.ifTi'?-32' ini--'-VV? iV 'fQ4,-iff? 'V - V -'-' - V. Z: fiiflig--V-'VV -21 '-Vf SS - V ' V1.1:,72.'iVf-1. KV',-',.VV-f-14'-,Vi5:Lxi9-:f,,- rf I1'ff?'--1V5..fV-V.g:.ffA1-14.15VV4-infix..-f-,flrjfgaQ,-2, my :Vi'VYV :VMIVVV-'g?V4:5igV2Vf:,YV1 ?-'1.VV'V-'Sli 11'-,ff-pr-,fff'55sf1:,-iV, 'z-4-',iJffp . 22--1 EVL'-QV.-zVv V V---5-,lg1V1-.ff-2VyV5g.3VVVVX:V'fmv-.VV.-V1--fig' 4 'IVJVQ VLV1j 2.5.-Vfr ,,V1,,., S ex .4 ,Vjf 1,a:V-, 1-1 1.2-V ,-..gV:fg.--3.V'g',-T-g,V -V-El:V'VtL..V-,Y-5, V125-1Pau-if-gf,-.1-gl'1,V ,,15ZSZV'-wif Tab. V, Q1-VV? ...L 1 -1'V::Vj', V,,,-5?- 4-. V-3 -g-',-::.gi-g,fgViV-- ZVTV-.ff-, Tw, 3- --5 gz' -VVV':,,-.V -2122:-IV7,V:'VVVVs,'g' VLA'-,m-,V 'pm' ,VV,,.1.2,,' -, .m3?,?Qf 3V.q-.-:,,:.V:-',V V-W-3 M,1-.Vg,5:'VV-V.-.V-ff.-V-Q V -5Lg.--5:59-gefV-.V3.:V..m-'ag-Vi..Vg V.-,:q.541-VV-'V'frv:f,3ig3ffV.igVf4,V3:..-.-VV-.,2-VVV:: -V.. -fi:-ug.,V-'V'q-VV,P-.Mtg vw- 'xfzV'V,--,,fV,Hg.V ,f',.'-g5:,,5f..zfV:. .-Vl,V,5..f .- V1,qVVp'VV',V'V.-f,nVV.f V-:er V+:,-V- ', '- -V12 ,f , --VVV--jf--jVV,'',..'f5'.f--2'g3,V:.'1-V .--Q qw, gf., .V --,,'V,VV--a:VX,'.':fzV-:ifVg-L'.-:gm'J-1-i--MV V -,-.V-,Q -g.xtV.,V-y,VV3..f-:7-V-.-Vf ?:-1-ren .,- .- LV. 'V -ff.-Vv..VgV-sg.-'.1g .1 VV '1,VVV ,-':V'fV:-sry-V' .af ssi-V.-' VV V-1 V-V w,VfmVVf'-.'- iJv.qV?VVfV --fm'-'aV..,-'l ' vV-V :-. .VQ5 V f1',57,.IHQ?-V5W1.I5 V2-:V 1-1' 5 -' VV- V'1.af.i-sL5Jg:iV:'- .lJ':1 '-, ff VNV V. .r 1' '-QVVJ: 4113ii,v.VV.:f?25 Q 3'V'V-'1'-V' TWV-314 Vw5'V-.,'f'V.zw5frffy-'- fi -Q-.Ti.1-.'VV?'-W5 A 'ef'Q? V'ff-If-'5r:5.Vh -4-1-. ' N Y 'M'4Q.1P'2l'-'VV fl 'ff-IVV.-3513 ',fV'..'21Vf:?9VVV- U,,Q,,-g,VA1K,VYV-V ,,3,!VV-,,k,,'f,V ,, 1-.sy :.g gV, .V V V-it,,-f,,'V '- , ,V k my , ,1V,g,g ,af .V-Vg-QQ: j,f,V.-V :Vg V-5- . - VV' 9 fV,V4'f.tV ,ij--VV1-AVK, ,gV,gVVVyr.q. .5 '-,v,V,'fff. ,,gV'4,'zV1'-,.-.- QV- '-',f3V.'j-: r'.j.' gV-'fV-- .jx Z.. V 1 -' -'.'.,,, .-XgVVi4,ifVi?sV-V-mf 32-Vw f.fV1,:f -V.gfV - -EVV -.V -1V.aVV-Q-.V.-1V-1-.LJVVVVV'VVVV'VV- ,v Vpq, V fx, -- 6- VV- -V V.: .-V.V VV-.f. .: .Vw VV--1-VV. 2.,VV.,gV-,V1:- .VVVg.vfivy,-fVVQVVw.e1LV. V- -.2 Vw., r -5-311.-: V VV .xr -.f--- VV- sw-.4'.-'VV-Vg V VV: .::VV1t-VV-:.-V- ' V -- 1 Y3,g-V:-1121.-V,-Ii 1'VV9.VVTfL3 V V'Vf1.g,'-f-'-gf Qj'S?V1gf?'-.5351-.j-1 3HVg'.'f ,VL '51, -V bij glfgz f' V:'-.5-'-V-if-fr Vigw iVig'f-LVQVV 'VI VMS,411fV'-'V',V2 VjfHi9lifaf3f?YSV5V.2iii?xiii'Vik'VB! '1,1-'fmicj,fiVf,f:'25ig.V,:45,7345QV?yI,p.Vif2-1-iff Q-73,1 1,935 V 1:2 hp V jV',.V. -4 V,Y..i2'Liff:V-V',- Vi- 1V,'gq'g'-5,K,VVVQf5V'. 4,ZVVj- ,f-VST.. 3-,x5i,3,VQ3g?,V'EVge ,VJ-V .35 gl. j I 32 ,-gfei-,.gg.1V g N LM' Vt- .jV!j-, k,:-,V-54371.4 3,3 -Q, 51,.,g5' V'gV-V-, WV Q,Q5aV5z,VVQ.g4HV.ffVfi.ig1y,iV.kggVE--',fVVV-,-.V-9:155.31--,Vff,5-fgf.,352 V-warg-LV,'E-fplggfggQgjrgggg,-. .ff - 1'-.L-g',,i g,5',Zi-Vf'5Q5iSV,. ,gi-,Vf'-.2V,g,,' f ,-V Q -- 'V ',Vf ' - V- ff. ' V-Vw, 'z--1 V.-P15',V.-VJ-VV., , , VVYVVVV-V V.'-V'V-:V-V1-.Q-eff.VffVfV-V-Vw-V-V4V-Ve--VV--MQ'-VV:V-fr. VSV-1V'-Vw-VefVVV..VV-ff-V-,Va-.--Vw'fVe ,.-ws. :V -V--,-V.vV'-V:V.V1.-1 1 V V, ,s - ,V, 5 . V. ,- VV-V.V.,V.g.V V,VV,.V VVV V ,V,V1.-..V V -,- V V. Vx.-.4 .V . , Vue, . V V, V.-...V V- -. .. 1 ,..-, -,,.,-,Vie V,VV,. ..lf.-..-V,..V,V,V17f,f-V,V V V-1... .-Vw...-,.,, V,?V,V.gV, Q --V , V1 ,- '-GVV! VP'r,'V'. 1.-!,V . Vf,V',, z'VJf- '. JV11 V-V.VgVfiV5s-QQWVVV-4V:E4V 'f'pr.VN-VV::, VV Vg Vp-V . 5. VV -1,3 gv,-,.-5.3.-qVy5,-V.: W, .'..fL,-5-5,.'.f-bf-QKia,QQ-T?yy,3Zl: - 1'f'J-I.-V'QiEVV',.Qf5Vj,V'j',1j- ,F',3fVQY5QVQE-Vfrgv?5!Y1V,,.fV1 :,.w :,V.f..',.a, 'fr .Vv 1 VJ' ,':',,--V.V , .--V Q 1' V-V'g . NQVVVA.-VV. VVVV.--V,.VV.V-f.VV,QV V VVVL--tt.-,,--V QVVVVV L--V1-fV!-sf rr,-,VV..V '..V,V V-V -V '-..- -V-.z-un.'-Vg:1VV':f,' A If .--:Vf A- VVV .VV V -V V- ,, ...,V ,V AVV, . V- ..V.,,,VV.4Vf. ..- - 1 -V, VVVV V. Vp- .J .V . V. . .V V. V - V V .,V, ,,-. M... ,VV ,V..VV.,,.VfVV...p,.V,VV..,,.,-.,V,.. VAV. .V.,,, . uf. .,. -V V V1 S- '-, ..V. VVV. -T. 'V' -1' V-LV .2 3-Vffg?-V4-ax'-VVV2, 1-.1 Vf4, 1V Mx VI,p.V.Q:V-'V -Lr,4g,Vsff-if .V J 'V ' V ' V:--'V,1 '-.Y ---gf' S-:, -V-1 13 V. Mez ...Vx 1,1 ,-g.,wYVVVV-.Vg-Lf, V .',V.fX,.g,, .-V.f.VVVV-3,111,3-gg-HV-V.'Q. ::..m5'.VpacVfVVVw.V,-91, -V V : .V::V.gV..-,,. V :.,,:-'g,:1-:V- .-,iv ,-,V-.. - V- V , V. J-i.'f..' 53-sl-V-1-. ITV -I1V..'-Vu, V25 'V':V.3?,ffVf?V.t.-vw- ., j-V.f3 jr1:g,-nl' 1-A13-Z,'-1-,,'-V-'-ff':JV: ,1'g'-51Z.Q-2: IV. 'iff-.,gV,,,'a1:V-fi,-,Vfg5--,gifggupff V' V: ,- li '25, V 4.31: V-QV-,.v ' C..-'j'5Vi'V3-MZVVFQ -V5---35,5 .V'-' V,af-V- Vffzpf-1 ' Vi-. V3-'S -'3,VVV'-,QV-'TVVQQ-:J :fi -2'2'-VV-'-iwVxfiV?--F324 'V-g.V.f,' 1 ' - - . I,-f f,,.VV1.-- .V .V 3--V.. Vg- ..- ,g-::,i1.,V-,3V,Vs,4i.' ny,-.,,V V.y.,-VV.,.g,,.-V-VV-Q,-,VV,V.f.wVV,,-.V -1 -f- 5, V- V., 1-, ,,1.V- -Q VVV--szlapgV,i,-g,V,.,f-. :W-,V ,'J!,V, 1F,,, -.-VV.e,VQV:iV--sJf5V,w5Wg,,-241,-1,QV-Vw:EVwgtf.kffggeV,5fIV:,.g5'-.Exe'V'-Vai V ilk-,':..:V 2 -, - 1 V ' , V' V1 ' nag 'Q - L-I' --1 RV VW- jNg--fV:V j-',,fiV- '.' f,,4.Q'E.9jiCf Vjqlly ,T-A-V, If':Jm-:V V.',-I, ff , - Vi ', ,f-f,VQ-'?V-Q-- V.y -f NI :V if,'ff-AXJQA- -j jk:-YQ-.'V ViL1if7fV1f-11A'VJV'-75'ig,VQ '-'1,ij1k,iu5fBV2xg?,j'5-Vg,1,''Ji:,j1,'f1-.J-'fl If ,V QV! 'jV,.j- filly,- -,,,,VY.V . , V-,V - .ii .- ,,,1Vf.,., ,V V, , VV V,-X.. ,- 1 ,-- X ,,,V,-, A - ,J K ,-5.,V,.',V4.,V,,,V 4 4, V4 ,V-,Vg,V. I K, gg ,- ,V. -,Q K V,., ,V , V,.,f,V,w.,,.,V.f- .1--VH5JV,,f,V,yV,4,,V,p5.pV,iVV-V,,Vg1.+..-VVVV-V.,,VgVyV.tV-1.,.fVVVV,q.VJ,VV'.,: V'VgfV, L V Q-Vwkillw 5, ' .--I 'V1'f,.' V . ' -Q1. ,- , V' -,.Z ,1 '.F--Eg-, VJ.-,,gV,5:',g1V V'1G'g1Sy:V5'V A ,',-V.-Vjff 5 3, V - ,V '?'.'ffyg,.,-ST' Q 'tix .-L, 73,1-E5 - ,vgfqlgwj-'.3'VVa::V,.,,.VgV.,Qf.Vgig,,y.L,',3fJ.gq, jg-.-.gyfiQ-'jp-Vypyji!-yv.5,QV5LWV.VJi 4V,,,V,.VMgj'--..' ',V' ,-IV -Q: Q-- 'V -V V- , wp. V V , . V-V , V -gVV,,,V V:-VV -- , , :V V. V,,fV.f-- --V: -- f- -,,- V ., ,r V V. .VVV-,rV- -:V'VVf-.-.V : -V, - , -. A . ,- -. r-V Vf , :-V-.eV-Vv -- ,.1i'V'C1'e..,'4.. -' , A .R ' , ' 'C . '1 -1.5 1---3 '. rg N4 ,V ' .Y ,,- , V- -1 fn' VV VVV ' -,. ' My-,V' , I-.-,yn tx!!--Q' ,W ,-- -Vi -. , If-if -'V,- :- . VQZIL-,' .-'- 1'f ,,' 2,7':'1.-g QPV1-:,'!vH '-,?5 V' ',':Vf, Q- 31.QYZ'V .UiL'-V:ff3i3'FV,VL QV , JVJ1:.-'V:fQ'V,l?,1V' '- ,-i -'QV-fVw1'V,-V'-3 , 3-51, ' ,'11,V.-f.:,.,:g.-'-. HV- -.V 1:1 - , - .f-- V- 3 '- V VifV2m'..9---1- 1 .. -..,'V, .V '- V :TV-VV--' ' .-'VTV f-1,V?::,uQV :V-Q,-V,1'?'V521-.g9?Q f'f6155-VVVNT: ,QV-,,' ,5e.VVVV.- ,.,,,..,V -, . , , ,V ,- , V.V,,, .. ..V,..,, , V. V-. ,VV - V. - -.,,-- .,VfV ,, .1 -,VV .,... V- -V MV., ., -...QV-,..V VV, ..V , . ., , - , gf -, N -'V V ' ' V - V -1,V,,W,,..+,,,, ,V.,,,,q-V,. V., .V . g.,V:.XVV,V,..V-...sy - ,. , ,, ..,.. V-, , .., , .,.V,,,V V,,VVVVVV .VV VV V V 1 V. . V,, V, VV. . , . , ,V V- f,,V-Af. ...V - M V .- ,-. V,V-1 Q- -V .Vg -5 .,V,- --V -V .:- 1--,J.-5 ,V-:rf VV fV1Wf2Vf5'V5?f'ff'V?V.WfV'11Ji-'-Ye'I-MPV-2w'I:V-iw'-51542-7-Vf.,V .V1- V. 'V 11: V-5-ff' 'fV5Vi:fVi-fVV:f 'Fw Y.f..:'- V' -Y-I -,Vw '- if-fg.VVV5-QVL1' 3- f'V,N:V,.V---i'r .3'f ., 1.1!-GV. Wi5Ggx,VgVi5-14'.fi-,V,,jNVQ'V,JQ,15-4.31'pm,-3gA,,VV,V-Eg,-5,53-,,V3Vg3f.., j-, V- Vx , X' ,A Vx..-. .AL V5 ,, ,V . . A .,yl..J,a.-A V K. 5, 2 V.gVQqylfgw-,V45,,,,-,, .,:3.53,,w33,,kk,f.V5:'4- ,V-,qu ,VV . 'K' -QV-gp ,.-5:V3V:g,i...-,wi , : -. f- -..:, ,, V. 1 !-:fa-K-,Q-,lg 351, V, ,-.ghfjyga I - .rg V !.,13:V,? wwf-.Vg--.,VV2jV-,f,v..:2-V'V.VVVV.- 'iw-'V, V,f'x+V:V1- Va-J--Vg.--'gz',V,VV.- ,Vs V-. .5 ,. ' V - V V' --'4 L5 'V--V'VV.,f- - . V'V:f.f..:',.. :, - ' VV-VV,.V,f-3-VifVTf '--V,f-' 'VVVVJ - H, V . gVgJf,',1?Vj,gE'-HV! r',f1Vf'V,x::',wiV.V 7 H-5.2.53 -Q-Vi'4,Qgif--,?5Vi:,-Sig,-NV,.N 5' . ' ' ', LV, V',,,1 - V -.,'---1, V my -.ga V. ,'1,V Ay ,,,V',- A -Y-':74,q,-35-:gg-,VxV3-j5-'V 51V 5 ,J V V.,-eV, - A 1.54:--V.gl-VV...-,1gV,g :V-Vw 3...-gV, ,V-.., ,fp silff-V-pgfir. JVVQL'-'4VV,V,-.-,-51,Vw-g-aV, ,. -VV!a1Vx,q..5.42Vag'urgV,:-V-,LgQV'VVVV.-, 'V1':,1,.'. V 'V' - -1, ,- .' .' - , ,y rf. V-5... , -:V Vf' .V---' V.--,1V.:V:V,nVL,1 ., QVVV-,E -,gif - -2- -- K...Q32'-Vfg.-573.3-,---f:,, -VM, ,- - V.,VL -, fm'-Vif-.ef-.f-c,w f-V E--tif-:zwf mr V-ig, V .. ,V V- . .- V . V - - Vx: ' VV- V Vs' ' - , V' -. VV V' -fc z.frV'S,'2VV',?fVg'Mwf+-V-A.,-V. .. - -- V. . V :far -1 f'VgIw -rw-1 Vp' -1 14-VSV V' X VV , -'V z ' -r VVV fV 9- 23- 'Vw'-gVf'-VV-.MV-LVVS-',V22V,V-Q . ,V ' 'fr'-3' . nw V- -2 ,1.z2g:.'?--V- .:f-'.V.-.-:VVV,. -V VV:'.,f. ,VV-'1-V.ie--V139-5.aVV.V:V-Q,-'VmeV19--V-f-VVM W.-VV,-'..'V3.5VfVLiw-fg-fFV1'V'5'g V- , V V lg.: fi-V4 ff.-'Vf, V'V1-.-V.'VpV -4--.1VgV:A-2V',V-gif-1VV...-f., V. V .i:- r.V,V-.-.1 .f :,- 052'-g .H -V V. VVV- QV-.g,-VVrfy',g,.,VrVLV -'ff -Vx VV, VV'-.-VV VVVVV-,'V',:V'.f', V- -A V V - V :.:--,- ' V-.gm--,V, ,. ' --V--QV ,V-ww.-,:Vf V V,.f,,,VVwV. A V w V, V. .,..V--. 5 -,f- - ,.--,x,5-.V,.,- V- 15,-.-V.-I ,V.V, V -.V .QM Q., ',V-.VSV-,V,,1.-1 J, V.-gViV,V-V.,VV-1,-VV., .sV,-V.gV-Vmwa.--V' ,V , 1, . ,- . -. .., ,VV---.V,,-VV,. p:.-V:,fV...VVggV- V V 3 V V -. , VV mgvfyx QV? -,L---,..'9:-. ,K-S' .Vg ga ' V:-'VV-1,VfVVz'',.--V.V-,Vf.L.,V-fr:V.- V,VVf-V1 ,VVVV-4-.mpg4V,?f.V,-...,-Vww,-, -, -- V. V V, V, .., , ., ,'.- .,,V.V ,VVV -gv,V'-V.ig,V.,,k.-,Vg ,--,-.,V,VgV',,t, V, . -4 . - ,g,VV -145' -Q. . :R-:, Vsf..V--3- T -w16,3--15.0'ayila-e2VV1fVw4-:WMgl-zrV-V-f,'V,-.f5.fV,V1:i7YVVv:VVmV:VV4'aV:5.:V-VVS'-rV-.,':,V-' ,..:1',V V V' ' V- --.- 5 V: .V1,.2'gQV'VV-Vg-V4-'.fV.gVVVV.g',--.VV ' V' 'i- - ' 1:1 f3j--,g3:P1'sf,.-,-341-3 y.,1jV.5g-5w.-1,1552-maxV-.::Vl.VV'if-',V.,1V1 V,:NV,,-'VVEV-,'.r'ffVsVXJ..3...-5-3.-.GV1.-q,,-1 xg-1. K' a. - 'V',,., UV- -V . 5 V, - V'v gn- ,f ,i,VV .V, , Ae.. gf . ' 1, ' 5 3' V'-'z'-f-T ,:V2'--'Q 1- S-12V1-:TV:'VwT-5dV11u5i'fV-.4-S-X'-QVVV V,'Veg'.V-'.Vf42'.fff-V.-V,QV,---VwTiiV1f.-swf-lVVfW-V,,, -J V,',V',gV.,.g. , . , wig.. Q. .' ' . LVVVEVV 3 VV' -Vu ,g -V-V-.--V...r1V.,eg,-.V- -. -:V .-gc., 2.1, ,--. ,f .,,f.f-.V-,iyffm -.ww-V.,V-.-.V'11: ,Vw V--1. V:,.V,,'-,V'VVQV..fV VH .'-V pf--,, ,- -. -V, . VV' xg, -, fig.-V,f-,VVVg-Al-,.V VV-, .VV-, ,V ,ui f.'V,' .gg,,,,,.,V .V ,WV ...qi ,HV 1 .,..gr.Q3?g,,,,?. 5.,l.V5V54.,VmL.V V 3V -5AV..M,::i,,V-,,Vk,iV,,V13,3gVj9Vx,Q.Vfn,jV,, MV,g,,,.V,,i.4:,, ,Af N3 VA .V ,,,gg-,,igi.m . Vi I V. J, I Q- .- ,Q.,5V..m,,,1,.!V,-L-,V ,...VLVs,,,v-W , V., V, 45VVAV.Vf . V. V, -V --if-33'-55 --.Vif --VV-V - 7VV-- Vw.: Vpwii--:.V-.,f2'V' V -V li- V - P 'iw-,:ff::' 1--.121 '- -' W-V':'Vf.' ' 1fVVlff-Vw Vzzs-,---V 'V . V -- 3 , fV-ffZ'Vf'55-2 -?,TiRV'3VjfVW-3?fa QFVQJQ:3,VH-5112,VV-ggfgfgagf,. V. .. -' ' ' , H 5 VVV jff.'V.V-YVQQ-Q' j VV-:V 104, V :.fit.Ve ,-r 'JL 41V.SfQsf',.f1.aI'2-V ',Z-aVi'f -21---.2--fb'VzL '.1-4-:UV-fgfVVf--V:ll.iVVV'VM-.11 MV,V4V,-'MV'524.3-1-VfVLV:u-.:fL'1-, .VV ., - .. 1' V V--V V '-V,Vgf---292-V'-,-VV, 116.--',VL'-3 V ,QV V, - -, A. .5 -,....- ,. .x,,VV,,,,,. VV.. .5.f,1,,, .-, , . . - ,S . V V , .,, V, ,. , VV,..V.Vg- V V, , H .V f V- , -V ,, VV V nl-.VrV3'3,'Vyf,,5,.ii:-A-V.,V,V'VV.Q'kj1:..g.u 3,2-V1aygff-',-'V-Vff'-Vn,QVV'-A-2.,.1-:LEM-L-yViVVgQ1if3W'V2'3'-2-'95V':'Vg fx V:Q,'1',- .-V, 113 . TIG 'f V V ' - V f V' 1. -V 5-V Vsf':L'VVz3VVV2-sglfl.--rV -VV.VCf-'21 V,.fV.VT '-19452--VV'ff!:.: 'f.1'1V'V'-f.:4L',':gfV VP-MV li-fb! -Q 5VV1kr-ig--'f'51.1.-,V.w:Vg,,V , -Q -V 5 ' Vilgj-,QV-, -Lf VV- 33, .- 5 V,V?V,Vf.yVf..:VVV.?m1'zVppV'-gs-VV,-as-.Vgrzpayf-igmi-fVVV'fsiVV,Vgz1VV..-Q' VVVVV-.VVVVV3,f.5fVVV-nz..5-gn-Vw-zz'V':VVV-gV-1,-'- Jw 'V'--VV-,,V': sf.. -Q-V., 1,V - .-Q QV:-1 .Visa .. V- --fV,3V,VV,- VV V ,J 3 -mV.w.f,d2,V-VV- Vw-'VV,-gV:V'-4 V-V.vV'..V-:fgV- .-,i:- Q.:-:-5-.VV2-V-V1,.V1.,1--.NV-V SVV.V...,-YW VVVVa,.V.1-V -V -- VV-MV-V.. ,,.f.,.. Vw-,,.V-, :. V- .. - V, .. V:-. ,...V. .V-.,fqVV ., - ,S - V T V V - V'QV9Fl'V'2'lC?VNV'Isg':V'42w.f5VgVw.IEVa.g?ffM?9s'V'iiQ1i52'..43'i'jggi-G2S42:Vij?ip?-2.-':,L+-igJ fi'2ff.L-gi 5r'r'fg'-.nn 11J--TiVV'Qfrgf'fQ1-'V'VC,VVa:fi'ff-.5-5?-5-'f5'.1PV'l4f,VVU? ,MV-'-T, VFWI171V'.3 '1-xzwilifQ-Z' VVL1,'-V,,-,f:- . - 1 .',s,,V'.j, V ' - ' ' -VV'.f,2', ' 'Z '- WV 1 Ri --VVgz,V.g1-::.5.-V.V--V.aVq.yVu-1V-Vg-V--,Vw-V-V4-V+wVgVg4fv,yi?fVV-'V--?w,.-'-,Jw-,. 'a'f..VV.:rm,A.iz,1-,cawff-V-Q-V-V'g4w,::',:-Vw'- :'.V1V-'V' IV'-,-vw ,VrV-.-,5:!,-Vz-:.VgV- -V., ,r.-,,- V.,V.yf-.V,.pv'fV .,..:.V,V,,VVg..V.-. Mg.-Vg.-VV..--:.,,,-VVV-,.'.,VV-V, , V ,-Vg , , -Ar..-.. ,V V V ,, . -, - f35Qzjl-fffjwlilV.'111g'fsmV-ff-VV-1-1,agJkj5V1v2rfV-.2VVS,-i2ggiE'?32:3VMQ5xQ'A,gwillQ1-V3-xglkquygtgfftf,V.V.-5i'gw'a,24iQ.-5245-wg' ggi- 1 .g. .-ffa-,QQ-7i,Q.V4V,1:15--VV- H, .,-3.qV:-'..,gQ' V-V.-.V,VuQV r,.eVV'.Vg.yVV--4,1 iv-V,',g'--VV-',,V...QS- . ' Ve., '-V LV: V K- J- .V'-VM ., . X i.-V ..fm,,-,,2V'-:.,'.' Vx,. V1uV'.VVgV'V V-My ,. Qgrxg .V .Vis 5 V T... -V Q V-,.-Vg.-V-, -rf..-Vgf.-Q : ,. -g -V -,Q-. QV-'.-gjgg-A-.V ,g,. -V5 ,M-13135. 45- Vg., VV . ,VJVT , , K Mg, I- ' , ,- , VVV-.4 siiag-iff.V.ggQ.,,:.fiV,VV-igVw-5-,V3-Vx?Vi.W-iV5z.V225,55-iv?-f?i3m,161?VVV?w:f1'4:Vv--A--TVM1V..'Vg25.Vfq.g-eg frf-r-V, Vp- V-Viaiifffm :aw -zV,.-V .r.VV'V--.V,,: VVi.V,-V-,Ve,:,VE.xV.5.-43.f---,'.V.V--,.VVNV y'Vp.V?. -1 . -, -- pf f -,- , V 5 gs...--HQ-iq-Vw,.LV-VV.Vg -V-.gl-VVV-5.J+'wg4,g:V-s.Mf,.y.s--'S'Magic-Q.wi3m-kg51,'.'fV..w1Var,wV fu-V..VwgV2VVg-VV Vw..-1-.V--.V-, fig.: - fV...V :assi-,1Vf.-.!,r,.. V-V-'V'V ff VV-Q mf-rail-V?-VV-,4V,-'fV,-f.'w.:'-V,,'fi'gVV -f ll'-1-'-rf,-.6ff:VV'f-.5-V, I -V '- ' . Vf ' ,-' ., , ,V ' . ' ' V -' Vf,V VV ,- - Sfff,.MV+,f,V,l1'gQ1-SVY2iigfQYVVff.fV..g,:Wi.11,--ug.Vw :V Vzg-QV-5 -V.VffffgaQVV'-5--54-Vj,Qff.,1V'V.553.V3-.-,Q .VV . Vs A 1 '32:SlfzGf1.gl?'. V? 'rw :df-V 'ff .'--L IQ.115,-vi,2.V'?V'V34afWVELiQ1J '05 V 'f W,-j'-V'L!f'3-V.. VV? 2 -VT 'Q f'- .Vg-13 'Vi 3,2 3-Ts-V:iX?V,V. Haw 'L Zijfigf Y 'S 252-91.-L V45 ,,.VV1.Tf,'- Vlfvpxj Lf V , ,V.V.'1Q,i-ff' bikifli 'S gp?---N-' Q Vrll 5.29, ,-G',!5,g!gL-'rj V,',xV,,-fV,,.'-L, V 'f -. Q 'gl-gVV 513 .,,iVy,-:Q Vgnjvf H .' , ' 3 rg,--1-Q .VVfV, ,V--.VQV-,V4-N ,i,..,,e-, V, V,-,yfV..V.W 5.-...VV -V, QMV-V. f. -.1,15VV.V..VV, ,V-.55,V.1V1Vefr-f,V.V.,.. V. V., -V :f,.'5ig-fa-aff,.,g.fV,V,V.V-V..V-.--,,- .V..,-...V- ,-V --.-,. ,T .,V, . .EV .VV-V, .VW-3-.-.V,:..,..VV,,y ,V-,B -,- , - ., V , . , , , ,L ..--mf:-,I A, lim, ,J-.-,tiny ,1.2-rag..,gxw-V1,41.2.f,.V1eV1V.xdgV-,,-VVV-fV'V.iVV,1-V.. --Hx -..,,-,gg-,Vf..rVgV,s,'V5 VV- .VJ Vw XV,-f. .L-.pw-,-V V-V .V.-A eff.. ,,-VVV, .-.,.V- .,.' V,-:,. QV- Vf. 5-:Vw - - ,' Vw. ,-,. VV-.Vw-, f. QVV-V -V Vp V' VVQ- .V p-,fV - ,VV.. 1.1. V ,, - .- - ,, ,-.- V- fgw- V -, -.Vg-,Vw . V -ww -.V ,. . .,,V,V.V , , gig- ,yVV,,.k..-yRg..,,SV3..V..fV-.5i,..,.Vm, V. VV..eVV,, Vg V .,aVQ.5,q.8,,, -g-VVy,q Vv,i.V.1-.V.. - .,..,..,,,4,VV.--4 VJ. V, lf..-JV. ,VV..,, VV., :H , .5-Vw.. VM- .V VV, ,C ,,..V, .. ,.. VV -. , V . , - , q:4:-VfV,e-?.,.-,1,.V-- V'-XV-1fBI'E.V-VI?-f -- if-A545-V 13551-Hi f.-?sfE.VfVQ,.VW1-V.-Vx:VV1, we-,,VVA ,Vw .-V.Q.:VVf-sV1V:L.qV1-V ,-V-ng-fVp!,..:V..VyVV'f -ii Mfg., ,g-fQ,,..- V., 1, -,ww , -.g--,,V. VV.-: - ,,,V,.- ,V ,- VV VV V'--,-. V.3,.V' - VVVV-,V VV... ,, ...D-.V .V,fV V- .V -VV' - V.: u V V-V'V,'--' V- - . - .V.- My-qVVg,,-x, .3 .V -X f Vg, gssxg VM-VVf,,,:.V-Giig.VVV-p.w-,V-V, .,- .VV .V.V.p.VVV,.1,V,aMf:3,.,,:w ,,:,Vy5--Vg -Vp am.-nm4V,,,,VV,,,gpVg kv .Q--VV--fy-:VVS VQQLYMVV agp. . -: - .VV- - - -'sg .V,. 5-L-,,f:,-.:.,1V,.--,V, V .v 5 -Vv,:V ..VV-V. VV V-QV.-. ,,.5,.y in VgVg:1VuVVV1VV V,VVVVV.mV9-4 Q.-1-nz - V1.-,- - . V1 -. 1 V ' -fV5af :V-L ,- - .'Vz-f,1g'rV-,V- .-Y-' 'fi .. , f W: V-,VV-L-r V-f:V.V--4911- V ,--V: ,VfVs. r,1QVVm17Va' :1VAT ff:r1,Q7ffeV:- E V--1,-,Veg-5V.,EAg-M: -ag.,-5, V-,VV,.V,.-,wa ,.,, qpffn jf5V...m-veVqf3-QV. V..,V,g- .V ,VVVVV 'g,V--V.,-1 . MMQVV, Vg- V V..f,-f.- , VV . EQ-Qgi5S-2.f'w-?y.e!-V'- VL-V61-VViefV.V:.e.S.V.f,g3g egg?iiVEQgVg-SV-V.x1mV-g--gum?V-:xg-fHif,QK'2:4QV!.z.g3KVM:-,V -4.V-JS-,Vfwfwggg-f,-V.-1V-f5egQ,m5dE- Q-.VV .-VV,.,-,-,V'.-.- -- -V ,,-gym 3-.,.,VV,'-.V,f.j.cmf,- .--'f-V,V-,,.V,.:- f5VVVV,2f. V,N,,..V.V-,,V VVVV-V.VV.f,VVV,,V-Vw, .- -Vgn.p.,V,,g , V.L.mVm- 'V , Vx'-jfgV-::a1V.g,:-ge1,-4.-V,g:V ---VegV,.3-J .VGJW-,,,g ggg.-kr.--V-Va,x.ggfVg -,1-mf ,g,V,5:-'f.3,V,. ..5g,.gVW .-.1 VVg,V,VyVV.V ' -Veqff-e,rV wwf-V...:v, ,V-.3-,Q--.5.4,a.:,g5g,V3s,-- .gr--Vg..--3 11' ,. fur- Q-5,2 .N-1:5 9-a.'gs',V.f.,--:V-.p.VVw ,cV.1 -.VV-,--it :-,V,-aw, .V VV- 'VV Vrr V- 1'-i,. QVA, - - ' EE?-V-f':x-:..'VVQ-1 1.1.23-gf--V4??i-gl-VV.Q-Vw-Q-5, Vg..-, V-V4:f,VwVzV3g.V,.'2wV,VrV'-:MViw-'VV'--S.Q,-Vggerk-Vl?f+gflVx.f3frZ?w-'rw cgg'gM':VUgff'i55ig.gQ5.5:-.VV5.4- g.Vi,VfV..V , ..V1,:,-N.,-,,g..V -AV.-,Li :V-1,2--V-V.g,V,gVV-. .T .,+..m1:VV,-Vw- wp:.p:,,... ..:-.fs V, ' .ig61.A'V,-V'-VsV2'Lf2si5.2-.iii?-i . fffwi-E565-V4qgV,rf,,.1,1a1.1--im.fi?-558'-5'.5Tr2.,.V-sngAV1Vmz,f13-,V4.'5fVw,.1V1--V'.,V-.4,V2fuff5L-,, 'wffkgzaf'4.1,-.Q-VYQNYHi'frf'a1f!'V.,i,AHE5'XI'i'f,'fP -gk yifsaw-V,-.Q CS!-,,: ,V. :1-:-...an x. 'gps-'neg-ffgfgf,fVi-1.-Val. riff- 1' VgV:..V-7'rar9--'g'ifVsV.53 V.,X+VV VV-CVE, ,-,',:,VVfV,xV '-,.'V,L. F. 'f'V:H2':g?W?125,i-SWRrfgg V fi5fsVA:lfC:,f .WV-i'f'6,gV2:if..',g:554-. .ufslfgra-4f.z,,-,bVVVV:Vm'w,V1,.V.,Vgwy2YVVgjV-H..'r1V:9'V..:f.ggV2QV WVVN-gVVi1,W,ifV,Vafi1V.5S-,g-4,v3V.1x-s--x 4r 'V-4.1, 1-.f'f'gg14:'-ivg-,vi--VJS-:VQQJ-I: . 1' V, .:Vf.'V 5 VV-'VV,:.VV.V'I--,V-'.VV':,'..gV V 1 -fi-2-gg.-2,w.V+f2JQ.fg4AVf:V2aV P-221-.12.pwVVSVIVVVBQVxvfmz--nw'-V93-V..fyx2-Qwtiv-2 :fm.-VVVM-..,fg:4,V,-,AVQVVJVSQi-'Va-Vqwi,-,L'-:iw'f1r1:'rVgVV3V,1fJ-','.-3.---.'V--Q-mfs'-fn-1--3-'V -iw -.'.r'f-4.1 '- V-,VVVI-qu am-V 'V.g5V,,V'V.r-- Vw 'ww - VH . -, f MQVVJV--ew' A A ff-su: Agri ,HLA - Vzzigzs..-3515.5 .'i:'Va--fiqV'53'fV,g at '--Vw ,M-Vg.e,1Va.V. M-V-w'f'TVVV.y---,-vwV--qc-Q'14VQ.,'f,t',,VV.V rf. XVAg2:V-W.:-5 ,QPLFIQ-5-,E-F 5 ,-VJ -.VV ,...-.-4.-Vpg.5V,.-L4-.-., yi.,-IV.-V.,V.V.-..Lz 'V V . ,V, ,,V--:., V,.V..g, .,V..,,V., VV-V,,., V, W, .rVV., ,, ,VV,VVVN,,- ,, V- ,4g,.V.1,1?V.,5.V-'E,V...,4 --kr.,-V,V-nVe.fi-,g,.,-y-,Q 4V.:Vg,,5V,1-V iV3..,V V,R,,+,g.V.V,.-VVVVWQV V- mfg-.4g35Q.V.sgV.Vf:g2,WV-.gy MMV, WQHVV: .iaffgn-V,5.,,g-.VJ-1 -,-- VCV V..,,,- .Va.V,Vz.f-,.-9.2.5-,5 -,Vps-..V.V.V-.-V,:,V ,-,V ...,, ww . V--V-.-,A-,.,1VV VVV, -VV-,.,- ,VV 'vV2PQ'VVf-INvlfifezsf'-.a' 3.1.2 -MJ- -'9s'-H QI,f':VV::.4VVcJVf'f:yi 113-4 V QV-gw 11V-F :'---,:fVf,-39.5 -1Qfqfyal-V-.-fV-w.V:f:1.--mmf-'VV.VV '-'V--'V5gVwV'Ia2iVV:V. V' VV 1bff3,,V,.y.-ana'-V5i..f,.f.-,VggVfV'i?51VE,22SVVV,VgVVf3,VVy?-Vg5?,..M.-VHS?-f5Q ,3'1Zf-?J.5gV'. --ig-V.-f - 431,--V:,V :fl-,.,V1 .V -,AV 1, ,QV M- 132'-V'-V . V. V' ic, - f. V. -V?-ff-,nw .ref --Q:'m.V Q-'-uf.:-V1:r V:V P4..f?3Lgi,f,.g-iii-,fQ.2V1,5-.3535i-VVgf -1.gf,3,VZ-?31ggr,vX.,iV3g1ljffEJ,e'3H1 5V?3 VSTVg5gqffl5,?5'fV.V?f'5'5Vggm la. Sai. 5-f- V--1-iVV5,yV f--:ig-fi--V :-,.'Qg'fV:,:,2:V.aV: .l,VeVVVg. W -i 'QA-gigqz.. 4 is Q' arf? 5, -gg 'g -IJ,.51f-gxfgifi ry? -VLJQQQVQ3 z5,vV,u., Vw 'xb:,.g,VV,kg. V V 1' ,4 QQ. ' ' EV.-mf. -,.,'- :',7-. -,'ii,Qf5,f11VV S'V-,i..ffVgrV,ff','-1-.-'-Vdy-:sf.VW Vg- ij' f ', -V -f-mgq.f,:V:- .v-V.-ke- VE.p5s--:-gy,,- V- 'wfgw +15 V.,,VV.V'V'VV,,,..1Vg -5 1, V, - 4, V Vg .4-1V 4-V, ,Q -'.gj-uy1...-j--,EV-3-a,-3.-VV-.V-V V-.-Vvff.-,ff fm-wg.+V,ff55gVg:'fV5aV,zs2-wb Eg fVVV,f,f,V-QR- 4!Vq51X?.sV?VV 5.-:3z5,.egw:wV-Vrf.gmqy,V'V.2Vw1-.-Q4-5Ag5VV,VQ.f VAS.. Q. 5-5, M. -.V-.V 1,-. --.Vf,,,-'-1V-VVV- .-S-.V -V VV,iiV,gj,55.Fg.3...fw1--?:gpVek:h.VsV-Vgfizpi- 1 yi--1-W.-.:mai,SVR-5f4V'.15,a5f5gf.,wxeiV.-fl',VV1.,sHgv?'VV., QVq.gg.,4- -VVV'm .,V1VVmV pm. V4gfV.,p5V.ff mf- ug- 1- --V Vg- -.-.gVV-...V-.-.-:V-V- -2.,55Vg'afgf,+Sa Lai--:Wi,,,QsQ'V5-V:Vfq,,21VVV5yf.g?r-gif3 5'-.J fe-Vgss'-x2V.VfS--,-+V:,!:'V:5,,g1QU-,V'-Wg'Wed ,Maw .VV- 125, Vz-wVg,.V4V,g,,fay,nVV- 'i15VnV,41. -V.. V , .--1.54-' S -4. -V ,::'-VV9,:n-vVf,:,,41- 'V.V1 -f ff ji . 1,1 ' -V22-QIfmafgslip-2-:,'x'--1:4 'V,:-V451-xV5:.,Vv.Z'V VVi:4v?..V-nk ey-mas.-V 5-Sing--14 -3V,'-VvZ9i.5V-'fe-:,2.VV1.4 Qs. V53iVJg.qr..M.5-ff:'Qy,.VQ.'Vg,':Vx V , ww,-Vi 'Vx .. V1VV.V-:5'r:1-:w,- -- V Aff.Q.Ig'gy2gf-f.'SVf1V36-,Vwi4.Vea:fr:-wi.-V,'fffV4.-is-ai-VVS 1.- .g'V2?':g 3.1-.4V2fV:.4sVa-L 3mvV'fVVsV4.rMip,f,fVnVy VV'g5,V.igV .VG . H:V'VVy,4-g,V---ina g. - ' g.gvi3,3.g.i35-fs53:5,.:v31::5f2-z5gffVQ.,:g:V32jg 2151.-,,.-.,V,,2Vg,4fV:!-Vfw,Vwymgf -S. -W: '-vxfV'VV5Vg.-2f .V- .2 V-VV...,5-,5,,l,g5r,v-,Q:,-1,gsfgggm-.-V,Lfg53g:55,g'3,:.,,,-meZvV5..V,x1j,Vf5d:,rgg52.m?.LgQ.46,S-V,q.,i455-Vgizqiwy.-gf5w,,V,gm,ggg-+gL,qf,g-Sgwgak, :,, .Vg . 5.532-5 V,,,.,,5,,35 434131.-V11-'!'.1,wEg. -': Qq1?3.':SL5f f g 5 -g.rQ':fgFVVf,-I-1. af? 'V.f?'rWL4g.gil9fS'5u5wV513'3!'f'ig'-QXLW. .34 13-WVZW Mp-'-E-?5x1 M R95 V22-V -V Q? Hi -f-FTS .5 'w.ux'5,FWifSVEVSQSS-Ent?-523V52,'f'l:5'f'V-zfV,,Viivf-VFQWLSVVQf'lVV2Q'n5N:ffVfaj:f,g5Vi5f.Q3. ' f',gfg-Vw QQCVQTDK'-fw,,:.q. ai-s.:V','g,-Vw Spf, 52651,-VVl5g'..,-xv .-'-fr'V-5'-pf.V1-W., ggi- ,'-3,4 Vg- ,VV-VV., VV H ,.-,gg -- nf - -.gym I.-V Q 1- LI- -Q-vw kg, -Q5-.-s.Vwy+-i,.ss2',qV4V!V .VM-V V- --nm Vw... gV,,9-axrvwgjv .M -.5.-'fV.Vfs5V,-.WV 9...-,W.,'hK, 4--,J ,V.V,VV ,g-,g:.,yV,'k.1e... ,-5:45 2-gif.-gm. Q5 WV. .3551.--.n,,.-..:VVVQ-.:VV,.-EV.-e:V.V. 4.-V.,.VpV V. VV?,k!f:V,4VVVV-V-,-fag5V.e.V V.-VVV-V-...W .-.- Vg,-mg,-, . , - 5 1 VV --.V .. 4,4 V-Vy V M. -5.-sg-.,h.V. , '3?5Q. LV.-Vw mx cw -ww V.-V...,.V.gf-...tg VV,V,,.,,VrVyPVVV: ad, MV- ,.:s-,V.i.,,,,,-,.- dnggcggggfffe--lf' UH- -gf -35--fo.-Y'N51f,., ,w4V,Q---,rg-w,.VVV.t.:1,-V321-qsv-1-5'.s,.wYif,V,,VW.,--,,J.1Vg-.5--,,,2V'VyV:-Vw,-Vg Vfd.'V1-gm 14.,V.VV.mJV ng,VV-,4g:V.:-qi egmvfggf-V41--u ,:r.,1g.-.mfy -:wk .pu -- V.:-VV-V. .V,-Vw. M- -WV ,5Zgeg:,,yVw5-y-wVV- V.V'V-V V .QVVVVVV V-V-V , '-.W--f-V las,-.-,Egg aV:z,5,-5.:2'gffV,Q .1-.V-133: ' ia. vg,Vzi1ix,,gmijaygfmggfyf. -1 51w3V:isf.Vf,?.-V VW--.Lis-Q54-. 'f3P,4Vf.'VpV'if.vtiV? V'Vj-'W,VVV.Vk'VVd:'V. V V V WV-1. .V VV -,VV VV-.e-,fy , -.-QM.. VV -.sfX.,-:V-V,ffgi..f,gV-g-.sw-J ng. VV- V V-.V-V. yr..-WV-,gfff -,Vgege12itFV,-3- ysg,5k:.,3.eE: .3-v.V1i.5y -y5,,,5,,,V. .-5-MV ,VVV. r,.:.gV,.gyV-V-.VV.qif,g.VV1- J.,-.,.-,V 1-IVVVVQVV VWIV-Vw. VVVV-.VV-Www -,. ..,. - Vw -- V wg. ,V '- . - --4 41- V-NV. .Vg ,y-.my ,,.V.,g. .gVM,.V.--,p..,g3V,,,.4,-.V --V, ,-,.VV V, VVVVVMVVV-,VV-., V' 1.Vg535Q-V.-3-WPVQQIQ wi- ff---Qkiygsy.-iL'1fV.Vvv-ru V.Vi-fq:V,- 4: 1,3-ms.. f,35sVveaVfq:QifPVV2 211: V 1-V Vw -iz? -V1.1 Vw -2 V15 'S:mz ' !fS,JxQ1X-,Wt-Q-JQJHT, ,-.-12ifV-Vwyixq-V,VVsgViiQ.eVS,V1m-Vgmffg .Dyed SV-.r,V'Vg:gV-Vwgwf. A-3. E gjfffigm- ,.V,VxgV5:-4:-Exif,aZ:.,g-Vg-v-PX: VXffmsv-cis...-.RSSB-'Vwlggb-.P-cpm'ug:V 'VLQF-,'-aw' .4 ,VV .Qw -- V:-wk. -.,, V.. - . fgL,i3.,M,:3gg:LVV ,?.u.,,w-'V S , qv,-.V1V':VVV.V-f.'. :i :5'-.-PM -WV,-,... 54.1,-f?Q1..V-,, ,,,...,- V,.V.VV.fV.1..-.WV :MMV-V..--VN.. mfs, -V - f2i'T4'V53w 5--V rs-QV'-'VJ, ?q5LV5.V45f,1-L.,1riL1i-3'MVH4'-YS-N'.:3iZ'iHW' .VVV'.-VVV-5-we-ff.--V Vzg3Vi5g5i.V3g.4V-?Vfw1x'i,f-fqcb ,gig ,gm -ww VV:-sam f-'V2'V,'z.Vf.VV Vv 'V V -.QV .Va-1:5-V' f:rg,:.fV-ke-.,--V, ,fi fi V41-fy,iViV5x'f-VV-Vgw,1V VV--Vg-1,3-1: gs 'MVM64 dwg-Rami,-.ff-' Me- '-:VH 'VQVXSVJVVMQ2' :2.'VV:'s-V-' -..,f.V:MrfkV,, F 4- 1---gV.rm5:Vgf , ff-53.9.54 -VVaf'.V- N32 ... N-' fb-5.-, 5--V: : 34-.1-Q.: -.- V: fr- VV wVa-Vq.s-p,1,V-sV.n-- mu.g-,.g,RV,,V,f.Vf.f,u-,Vf V-Q.,E5,2,53 V,,.g,-3,4 g,..,, .V .V-,,,v5,V,.,, V. Ak'-e5i3ga3'G'V2---5? aafwfgf-K PAV J.Ic:-321-f :.:e4-V233 - ' HVKAYQQ-.y:V,' , .sifnsla-:gi HF-X - -sa5Z5V,2gw -' -if '-' -Vflzxf V. 3 V-V ' V-'flag -. mg AN -a:w,.:,q.,--V f-21:1 fwgi-gp .,,ggi,y,yVi::V,.fi,gV,A3, .AVE .. .um V., W- f .41-1,-5-1 J, V413-V,. .-H wir-'QVV-f sh se... ' J ?5xD21i,'5'i' 'L '- 1saiVy2,3:, 9 flowering into your own little garden, don't expect to find happiness within your own picket fence boundaries. Iet's go together. iust us, the 20 of us. no Iet's take those new kids. you are a street corner, the crossing of the child and the adult . . . the old, the new. fresh faces, fast friends. and conglomeration, of inconcrete stability with the ability of adiusting and expanding to your preferred environment and forethought so as to include things worthwhile. 'PII 2.21. Individuals mergep people unite People. Jacki Magness watches another girl model as she prepares for her turn in the FHA fashion show Togetherness. Separate parts of an undivided whole. Each team member is an individual, yet all strive to merge. Each person is as important as all persons together. Happy in what they do. Glad that they belong to themselves and to each other. People. Q0 'f.O ,QCD QIUO OO UO pl! lQCi D00 P90 D05 Il. i.' I Q Q 2 or ' Amid strenuous activities, junior Jenny Picken stops for a moment with retrospection surfacing among bright promises of future experiences Junior Dennis Koehler listens attentively to instruc- tions from the coaches during halftime. L7 y STUDENT LIFE Happiness Good times, too. The smell of chlorine and the childhood feeling of summer. Screams and laughter as the roller coaster almost doesn't make it to the top. Sitting in the sun, enjoying it. Clear notes sounding in the cold, clear morning air. Memory-making. Good times. Senior Gail Harris takes a moment from a full day to relax from its hectic activities. . . wg Krlsll Golchef and Valerie Phillips, summer swimming coaches, teach children the basics of floating fun under the sun ' ts YK ww -.W Awaiting the signal to begin from instructor Mr. John Faraone, senior varsity band member Richard Voicing the exuberant ioys of a roller-coaster Hernandez silently contemplates his future endeavers while his tuba reflects the past. fide, Ahh Sdvino screams excited reactions, STUDENT LIFE is Homecoming greets Trooper exes, brings out contagious excitement Mr. Bob Bradley crowns the radiant Davette Juen Homecoming queen as her escort Pat Henderson and the rest of the court look on. Homecoming! Infectious excitement, color, traditions, and innovations. Halls in gaudy welcome. Yellow mums making splashes of color, blue and gold balloons in the night sky. Happiness. Spirit. Cheers once forgotten are remembered and shouted with ioy. Homecoming! Crashing through the spirit banner, the Trooper team officially opens the 1970 Homecoming match. A , l Wy -sf ngwr' W . . . ltr ' g 5 3' my 1 k .i,f?f'.4-f if ,ff W. 'f' .v . ' f'-sit . . 'ev ' -Z Y f 1 4. 'Qggt' ff g ffffggj ,'g'.'rlif . L , W ,'8 in .. . .W s ',,v.,ss.. , ,. , -,-i 1-J ,V su , ,., V' av. was '. 4 ' 1 Hr sw- mi., mag is J eqgvkuef .gk NX, 164 07, S. fi? 7,32 .RQ Z' Y ja 9 H If 4 A G aff! F 'fi Q .-, Aish y fi-'QA V: aw ff- U1 1' f 'w f ' ' Q pw JG, ., Qgyfywjlaw' 1 . 43,j,b: Lu. 2 N '- Y 'f:,J, '21 4 31 7W1':G1f-.' ' ' X' x f hw. N' V' 4 1 ' ,ff Rx W? m NN ,Y P v '.f A'-m f .+- V n A , ,- 4-' 4, mi' ' S NX xr Weather spurs ecstatic spirit Sophomore Janet Correll and iunior Chris Gorman ride the ferris wheel at Western Playland, a favorite amusement park. Spirit. Rain doesn't matter at a pep rally. Cheerleaders working at being cheerleaders. Capturing the moment on film. Sunlight on snowp exhilarating downhill run. Ferris wheels making a lofty perch showing the whole world, dizzy and ecstatic. Spirit. Cathy Gouch, Salute photographer, is caught doing her thing by a fellow photographer. JK: Mrs. Paula Turner and Mrs. Martha Harrison hide beneath football warm-ups during a rainy pep rally. .z , ff' ,fn 'ff' ff' , fav--f x ,X ,Q ' 'Z MW my an 'Hu f 1 A ,,, 'N 'Q Rita Chavez anxiously awaits the resumption of the football game following halftime. Student life brings Troopers to the slopes to expe rience the exhilaration of snow skiing. STUDENT LIFE 19 Y.. wa ,J ff mn m Qs. BX 2 if' , f 2 Qiifl ,g 1f1gfggf.g fl ,f vifff an fm 2 we? nzlgif' 5 H L Despair marks the Sue Phillips decorates halls for Homecoming with the traditional blue and gold streamers. countenance of Debby Yurborough as she watches the Burges Mustangs tally another touchdown against the Troopers. ,,. esffg W Troopers look back at heritage IN THE BEGINNING, Salute 1962 pic- tured 650 students existing as seventh, eighth, and ninth graders. This small body of students provided the embryo for the fully-accredited four-year high school that lives a mere ten years later. Salute 1963 portrayed the creation of increased traditions, and a growing school with a fresh, spirited outlook was showing its muscles in competition. Maturing to the realization of the total Eastwood educational experience, students seen in Salute 1964 expanded their own horizons. A triumph in the eyes of Eastwood students was the year it became a full four-year high school. Salute 1965 was dedicated to the first graduating class. The theme of Salute 1966 was one that was first in the thoughts of Eastwood stu- dents, Trooper heritage. The Troopers were proving their tradition valid: deter- mination, courage, and individualism. Finding their place in our world, Troopers in Salute 1967 secured their spot in the sun by being active and concerned. If something needed to be done, Troopers were doing it. Involvement with the world around them was the essence of Salute 1968's picture. The personal initiative to ac- complish became traditional. Salute 1969 found the Troopers praising their liberties and freedoms. ln the midst of activity in athletics, academics, and service, time was still available for ap- preciating America and the dream. Students viewed through Salute 1970 found winning a tradition. Trophy cases had to be added to contain the many awards, honoring the noble heritage came naturally. Then came Salute 1971 with a por- trait of Eastwood High School and the Troopers ten years after the beginning. HAPPY ANNIVERSARY, TROOPERS, WE'VE COME A LONG, LONG WAY. STUDENT LIFE 23 Faith. Believing in the school and the church. Finding beauty in God's sunset as well as the symbol of our pride. Respecting the flag. Respecting the laws of nature and of man. Q Trusting. l lx Secure in our beliefs of what is right. Faith. Reverent beliefs, trust Cheerleaders and student council president John Edmonson stand reverently for the national anthem Introducing twilight, the sensitive Southwestern sun sets in bewilderment of the turmoil it views. F ,fir l T x 2 is' K 71 symbolize faith in man Illuminating the drive of youfh, the Christian Confidently looking forward, Ecsfwoocl's Trooper roudl commands alfenfion and res ecf, ideal faithfully awails its next challenge. P Y P STUDENT LlFE 25 W, wi H EE'WTE'iff3X--1 -1? f Ewxsiw 'F' 'm7'i3'?? .f ? 'YW'Y5'?5iW7:i5Q ?Vfzfff'5i ' 'K 'WV WWW WW: L ' zaef,ffH'ewwrJ:1z,w6fXf'Y,1','5a?wwff315,affvxgefev:1fm?:Qfa,vx,igQ21Qszi2,gm4 ,elgzaagfjjaxs 1Qf.m:.zw,::,:-mg:wI1gwgga:,,Q1mm. 43-wgw ,-Ygw2Y,q53 gm- - tw , 54 'wmv :t:.f,:-Qmfid?,f, .- :ima i:1vw: 311.-1 zz ix , was ?zfJ:wf'w:,'n wi' 1 uw 1- iflrv H5212-'fg.-'7 war wiki:-:ff-?.?-2 'ff 1' fi.'g2.au,L:4,fx1r.w.Jf4QA.1eff44?h5+ Jw ew?-Jaifgcfiiyisawri,mm3iq15gg'f,3FrQ 1 vw vm- mq1w:'5vm?g3,v,:, igigeL1'vi-'4pe:'f,8e.r5X Y , , t 4 3455 ,Q 'fw,1-:wad-1x151-ffrf,'J-fgvr-fmww-W-1L,w'-,aww.1:wqSv1Am,,wQ Ew-wgTv1cf wf-W--muff-wir.mv: fwiiiW''iQ?Kf,31?N9Lf13'K'1 'xFKK-?55U:f'7M4 'fI V5'r1ffv-w'jlfff :',-,fuf'-1'yf3+.Y7'L?' swfw1NjY1a 'Zff.43:7-!f1,:4WMf'f'Rg'QU'7-z+i '7'2Afpf'7zgvQH3fA'r2,ifMw-F.Q5's1aQg'vJ?'f?kE1gf1Fe'.LiLf64 ,A ,ggQf,wJf.1gg,9jfmyqgmvwgm efywdfv 'xvgigsqsgaf 52- ',, J 4 , - W 'J 4:42ffffffii'Iii'-2-1'-Wx?-Gfwz'wiguw1y,z.:Rlwxrwayzffxf?r:'?3rL!2r',':1':,:fs'-xfimy vfH,:frLghYf:1.fw:-,.,ffiff1f2zn:f',V1:3GS-f:frwe:,f,f,1?'-lfnxlzaaf,-tfa1?1,wi ff'f.-risk! fvwf1emma37rWf1HuFif6w.?+ ,f- wt'mrrw-1x6s2e,e6'Pa24ff1,W,,mi'wg5f2?1-,Q f,5ffggj,fQ4ak,?',s?gxEQffs:fff-if - A - Z . '-I gg y uw:fgpwlxgwsfe. mag:,'ff,f,!:5:sfa-'Lam w',f4-1,f.,fqg.42:2is,v1ws,wiw+a,,Egwfrm.fxmmAQ,,'f..bffag4-ifv-iywga-,ffgmmwf--,5,m:1ff-4..f.fz-ffmt1'.iwfa-i4f'fv,1a1:,,:,gr,,.:fewr,,snsf1ff541fvmw1'gs,w: 1sf11g4fpms.ww1mm 35Qw.Q-m'2f'sffff.fg?+ft'fIWf , am -A K K 2 'E wr wa:frwx,mf-'Qiw-f?,w::r.amL1,':.1qg,i,-sz-PM-5-mx,ww,wgaw,M2Hwf9w1.,.1.Q:'1fwas-5'fr-1-svn-wa,zefmmi:',w.1,:X..fsvm-1f1Qf..w,mf'A1awmg,-f+1uwwffffilfmf'Q .wmv frigiwxmgwgyfxg aim- is .g m f iw 3'f5'm3'7Y'R3-j,5:IkK:QD-'LZ325 a145Zb?wk:-s11aa4-,'w-,ag4a1r1'ggaPm gfiw? 5p'L'-im-mwgirbg'fQ-3if5.2Q-':wf,24Nr-34',L g,fg.Kga4m:.u,q1,A4s.m,gy5 1awke,mg, r!Qf51RXg,,rimsKai?-nxp11,'15z:.Q,vfa-gfvefqiwif'vfffwllwgm-'-qfvgi-552566.Fyafvggmf MQW. AyQ,faf Sva553,z5geRWmw3d.reL ' ', .. Q . mmm: A.M-mvww-W4vwff6wfa'a-1'www Aww! lv 2 'J-.-if-vw'w4fk1.+f'mf?x?ffw wz2f:w1 ffw,v-4,2 xf.f:,i,YALff-,ft-lixxvgff hwfi1'm1f'-.mLf1e-vw ,v'Wwt'fff.:m,-:vv:vy:Qvr4,,szw:.fM-tggwpw :-Wg,a:pwQ!1,,gw fbiwf mf. agfqgigwk wiflw- .e-swv,,Q.-Mwvf?e'AfS Aga' Q. www 17111241..,U'-sv-'Hff.Q-Mmyp4f,,v.f,,f.vR3gm-,f-v.K,zza . V 4,jr,v7wsmy-fgilie,-Tffxzfmf-L,:1f.5,g',5f.'Myg1.:,f xy'0ima-'1w:ff121x':,411:2,,y,9-Wy, W-Mfr X, fa-5-1vri',Qx.,f .n .QQ frvyw if 4411 :Z-Av '',-,f4f',n,iff,3Qyfi,wff , 44,5-vGq,y,Lff4W5'Ay,Qg,, fy,-QQ,-,e,,,w,Yw5L 15-my 5:9g,?5'vgfgg ,-Mg. ,gil .h,gg49igPT.E. , 5Q5g.r9K3gp71f,Agf,i ,Q , -1 V' , N f Q. pq y- , , .,, .rm ,'-mf MW sv- e f4,f1ffffwvm,-.1:.r: , N1 W V rf- 1v4fx.'Lv.',-Ni 'fm' muh , -4 5 -G w:'- -. f.:,:wvf1 v P:-f.1-Y f . fn- -, 1 , ,M x 1 - if 31 pp-ff' -Q. wk - 1 -Q-v Iiqg3gX5:Cf,15 W. sf f- :SmgJ?c!1'.:-KJ: ,.X2,w-ixx'-xryfig-fhfyfsffygni-!gvf3,keNQi4:1141Jqf'--::3mG5-1Qff:QAy.+. WT M51 vfffff-w,wf,M:,3-2 AQL5af4.:v.,yAW ,Q 7Q'5w'S,!g'f,vf,Mf'-1'ififxff-'fivf iffxih:W-M'ffl1,zfQ-wWifi F517fy3wf',f!m54f:':-Fwgi 2?-47Q?'3i' :f,::ff.g1b,'!af-fiffgh wafx?fv Hv'z3v 4fA5'H5'g5'5H'e,'f'5,f-'Amir wiv 'aim M: A ,F wk!-nk Q WY W? Ar! 'ftuivv lu-er A -' 'W X51 f, 7'-wi. ta 4f, f' iwfrfxn: - fn -4.3 '17 ,A V- Ar. .wx 13 -'mfs -wwf,'-V15 1. 'A HQ .14- W 1:9-5. vb.. X., fikfiv -'- .' 1 v'- v 1213111 'e '---'21 .1 vyf wi . 'L' 'wp 1' '.1 Av 4' nw! ' .-H' 13' , 4 Aw M- 4 W'-' -!'lifwE-4 'f'f lW1' fini! -5 Af V VY .- 1' 42 y 31411 Nm, ' Ui 1--wfe:fNfHffwb.w'wbffhvw-rff2'wvwlfilwpxivslwefqM9g!?'iwf,gfH55'fffm813125-lf.-fmff,wvS.faf2-fvwv'vffwn-'kzwiw..S4'--Mf5M..,4Q-ummm'bff'2:nizI--mi!-QM-hexM-ffMm-QwzPQefQ A.v?',wSgeffwwiff:fflffiwgffdfrmixfsrih-x3,wg,fwfg.1f2fW22i1xg1Lf agen mai farm: gr, wg- v ,L .fx - Jv,1-Wg, ,g 1395?,STH5-l FQ'f3!Qg51WGS?41?3U'3ZxW'F'f9?if'l-filfffvlffkiiw'Q14'fE5'?wf-L5WfW 1H'rP45sffysf2:.-my-'swS,u1r.+mima f' .1t2w1kiffwSgzs:,4twu31e5ws:.fT12-if15-wN-+31ffm?-?1mi2iia'2's-:qiswkfff--ag:'uffx-W3gQgf14w+M a ziiez-XSSQVQW-ff'vw-f1a 1,z54b?wff4J.2Pqm1fsiv?2? ' f fm ,, ' rims: N- fm-vf!afffff:+'8f f114wf:Mww2vL1l2S52' 'Mk'A:eiwwf'fwzfhfwsfffggefswfvmsiiyfz-L,'-'emQV!-:gf.4msk.f,1g,,Q,m.gw+gw:fzfgwpima- Mmmx:pewmga-mevvgvqhcvx mrf:,:wg+5ae11fmuQv?fw,1fawh3vf--ak xfrwiw'mfg:gQ.1!PfWQ'ZQ-'fwwaiviifwfivfiwwff'h,g:M'w Hg? 1 fwgyxa- 'P Y -. t,. Wim lf if aw 51.577V-EIQQFQ,1,?gf'i15 i55QQQ,'2Q!'1f,YEW'HlQ?2Q?!531525flf17.bQ'-'gitfiglEQfvgL,23QfQQL25Yi9?L22f?7E:fS1i5'S5K'f:5 XTT.QEf'L'iS4QLZ21fx 'g4133:fflFhfliifnuf!f7'i5515ffW5Cff?'V,?FQzlSg2S15fQ,-1'f5'?ff,ini wasyygym-f,:fw,g+fwe gf1mywgmygi'5:-:g.ffd5sfwdg'gafI24ygfw,M1ffS,f1,,5gfgw1aefawi,5f,f3v HQiT?gsz2,,,'igggf3 QW' - Q , 5- ' 'Y 'xrsfszmgbz,gm--A:'fspQ?e xmgwfv'42'vw:ffL+,-iffvfisQ-'ifbwwffb-wbmrwf-mach,miffcv-ibxak-fi-fafwgw'w v,'.f-,awwwiVff 4afwefit.xf5mme-'.me2:v,,wz'f.-Avff'g:w:n,',m--f.,!:w:w.',,m 51791-.awizwIchi-Mi-fzmff5:04-cfiwf'mfwgsfzsff Nefqayivcvzvwfff-f1E.we5??Y2q My H' 'fix ' WW J' f?i,?ffwMv . m is M 1.,.,ng,.X gl N ,Q-,M ,1.5v,gUq.Lfwfw54f f,,,,My A,p'g,fvm.w,:w ww cpm, Q,-1Wf,..- ,fqfgxfg-L. -v1.wwf.4., 'Styx J.r,,w.anf-:,',,fg.ys'?' ,N,x,.,4y2,:,Y-'cfff,1f,:',vHxy. -!g:.y ,Q-'JN-,ww-U-',f 3.5 a,f,fjv?E'w.,:'97y,.ff2M s4V,1.3,:?1Ji .,1e4x,w3v 2, -zffyw qggfwvw f ,qw , gi V W Q I ,, X ,Q X Q - . .1 -Aiiflffr-,Qfgw 4515!-Nwaf.'2iv'z5?f?1pfr1-:fm 1'QfA1-'f.w,f2-faqyfgpfu-gum'gymclSQ,v:..1iQx-IVw:'2fw.f,.'f-.waxia,-fx+A,wzzvebwlyfwfa'-amcfypf'-skefwy -zwfww-:a-1 We 12+--ifwr!-wwf'9w'21fwk 'QQ-e'Hf.-G .dw .f,, W. Qggmwff Huff? ff'--SM 'Mf'wwr5w'9 fm WW ' -V ' -1 K ' Q A 2 ' ' r ,. 'gk-,4,w.N gm.. f., .Aw -., fn- MLW- wp- ,uw wh.. vfxwri ww, W. A-,.w.-1,-,11 '11 f-u3Y,f-,Mf'f,,1,s- ,f,,+zK,, .,.x,..n, ,Q-gkvgg.,,f'y,,g1,,,f,,5 ww, fa W, Kam,-f,Q:y..w4ff.4pK , wwmp ,elm-53 -gay, A, 1, N , 4 fa ,,M,,MA,,,.,.gf,.,,g,:E ,nfs 45,515.5,,,f,,ggyQ,,1.i,..1vElE.ffmi+MgLnewmfr,.Q-.W-1.,Cl-,Xm,w1,2x,W, V:-.-,wrfu11.1f,.,,,:.MJ,ff..,,.fw,.1 nw. My -m,:M,,1-1:,Af, A-my ff ,,--,fy-5,,-,Num X.-,yy :N-My-, www Q.-wg, . Nf..JS?e- Sw- M' . . 5,41 .1 .1 L .-,H - 'tlxbiw-4.'r 4244.-fw'f:fW.2iwv, 1354- U Sfbyffgig 'Fl-A1 Jo -nu w,t':4:w5. 'fisvzvfe v.Vu wT-ww':yx,:h,ffPf11'g91'P''k'fu:nf,w-xwww-fl-'x' 1.f.'w-w -Mr. v -pf.1:f'sH'1fc4A,.'zefm:,,e,w- -'MP vp:Qma!-w.'a:ww'.x:Ww1?'M-Q435',f'f5fw--0,Ai-H113 -muff M P-Mgsggmf , 3 3??f-xmfiv V. -Si? ' Las 5.-wi 'eff 3? f-Y ff s,r,.,W,,T,,gf,f, fi.--vqwkvyg-g,m.,p, ig'-JM, gL'w lxyfig:-V.wf211fg,21fk,3zqSi3?f2m:mfr-Y gm. .wwf f,:,M,fgQg,-,f :,.!,.f..fwwg-M.P,q4ezQ.,5,.1,fg-vw,-z'f , ..fxf.,f ,w,meg-:f,f,-,.,1- wg-1,32 yw-f.y,fm.v-Q7qvf,f5cfwl-g,w.!wh,px-yw,14,Q,Lfg+w?,n ay, fzi2Vp.,.,7:ffif1 f 1, if rw , kygggwgenilqya' iv .A .gy LS, ,N gZw fe2?'sf a JAw,wv-ew wrvf.w2:zffxwmsmuf'f.fxwg:,,,wf:lfmff.riS?'TyrpB.m,awwfiffmfM?3'wv-2:-vi.2'fzwffw?2wif-f:ff2fGfM'ff'v'-iffm-'2g5:Z5::ngf1f'fXK+J+Y.. 'vs 'Mai 9?-JEL .-my f w b - -Pl:'5f2IgW:g.ff1fMDM'fgtsgigrflzagxwgigfvffmfemyai'gcfiguafgami' -me'mlffzxfffweim-fzgwq'war''.uwarfJ,f.4fwf2y1zfwmw,+f:2,m.mymzffm:fwif'www'..vfwxWw1,:'f'caweQsC'ai1w 5 wrwb?KG'W Kg3f' -wwf 'Ars-1'2're5-wwim FEKHQWFSA 2+ WSL X-,s 1 wi '- 1- 'rv A.:,. ft 1 'ff :fr-v 'Zff.211w-wfwf' myfmfg:fzfxzsvff'-z,m,:ww ,':Q+:f,1 fm wwf -:wwfrwh'4131.1-swtaMyst-LM-54'1 n,q1.fwi1sJ.2.vf-fn-Y'ofm-uwgffr'rwkwwww-wsf11Ew,Q!4awwsm -ww gmwffzfw wmv www fn, 'I 53549 Ag, 1'f,':-Q51 dy ,m M 4 wie f f - ffl: ME-ffs.X.,I.1,,,,v,:.NfJ,nL945s,5,Cfffifqfgklsf-aEswM,i5,5,4??'xS+q:f,.fE1w--1sQj.Q-fqhgf,ewfa-W,,1a,1.-W, -,wwgv,,,4f.S,,gW,.m-W, ff-ffzf..,w,,q,Qvf,fzqLqy .,q,-e1,,.gf1 Awfazgnfv--,xp:11.-m,,,y1:y4.2g:pf ,,vsQ,1y.,qk.,kgf,s ,. fff,3Qa.,.5.,g5Q, Q, - ,rf.v,,.W4. .W , ,Q ,gb ,, gk 453 yfvifw , A my Q :bk V, 51- Y f'f,Vsvsfwf.Q1QQ12:-ww+f1:f?M-M..as.'am2wL.a FzwmrfA-umggmiffwmwfwflem-QM:5SfsQ51fmw'WpzffQigG2f'gd2fH1fgws?g:7T+imga-.farm shiqw -awz5ff?zf'f q w.f6:Ei..1rfia1P new 2f'.f1n'ff-' f f - -1 ,Q wwf: f:ffaa:.'m,w. 'wfrgff1iZ9Q9151i1'an5ffwBXbfmxffll'wG'SwQf.wff.v+:emg'- xh52'iwiiqxzfv-4ff x- 'y':' 5262-1f,+,'fiWL 4,-,wwwffiwrwvqQv-'whnnmmzszmwfx.M. iQ2H:Q.wf'wf.A:xf:fh AGS.-H-14 ,1'f.'wYwfAfwfw -:fy va wr W- J + f wlaf-wv r A 2 f ,Sv 4 ,gig , -iff '1.gffsf,iii-'1'QL'1'Qf3'fi'ffQiQ1fr:+'Lfy,-b--ami-wxlww, fmxmzxffezryf,-W .H5313M5512-.N,i-55.zQ,'!2f,:-,-,V.frwf .VJ-fffum.:-'f1,az4+fg. ..4S,'f,w-.:-fx-fi3mv.f. M+:':a5f,fgwg?A-- 'wwf,R'f:'2W.vf1,1sw'wI!'2f.www ?54ywfes'-'Zwfiwgr-1-1Z35Jg'2,1fXf'fHf'JW-Ae AW1 lkf' '.f,13y!gS'- QUE-.Hi'v 'L i 5Bf1-M V - ' 51 tw f 'f 'W Q' Q' xx-mf:mfwfw:sI2P.- 'amz fqwffwMina,-fmIiq1w+g.fmf.,1ga-wwwx 'wwfwxefw-wwqrmw1ff,fw2.wsfX'.fA-gssumswim-M15315:wwfwmifa-mx.f wawfiffIffwzbiiQQwivmvfzi-wfflwif' Ibifkwfwinwwwmv .Wf'Mfm?r2aj52:sw ,133 Vg , Sw ,, M Y ' -f f' DW'-W.1:myfs wf1::?4q?'im'J--i'w1u-gwysfv-wxfwfgfg 9'2wfua1'11a.KageggwGiw!'Qi'f::1fQ'.-M41a.w.'.'wf'-1-wal'wr'-T-mph.-yf ?f:1wf'pfnAvf1,,'a:1'fff1'Mvf914f1i11,JEf.,a-xi'1'f,ffg,,sg-Zksfyziwiiazf 5'-ffmwArk?-6'-M2'frqQ21zf-'-w.53fwg A:w'ff'1,2f4WQf?f-f WY-1-EQ-aku A ffptviif V '5 ' - A Leia M V ,., FHM gf 19: by My I 'I ' aw - mm' . :Mikey ,-w ,wr Vx' yu H rt 1,-:fs 1, fur if 1+ ww -we ,s 'ffwtv r-- S1mV.2c,- 11.521 ,fs f ffl-af 'MW'-l-I-w fbwfwafii' -41: zkciw -rv'f'44,,G ,ff -ff fgiwkw -,ignilh ' w faq -4- . .,,a-,- N' xx im a, .f ,, -, 1S:,A5,w,,.4,,,-k,zf.5555hm4:1f!w5,1s,-gy-,xmfk-y-g,f.: mfy,1f,,fmqw,F'.-En-,Qi-fy.myaf ?z.e,27,,z.mQqf.91A'Q,J.:3!,w2:YA.w-vfimm-ffvb,M-Mwffwfffxwf-wwLu:-2? 1.wfi.wia K.-if-1Pw13+AR4-'L-anmy-Qfw.f1wfv3-1,12 ,wh frW?ff5fW fvfMbfafy- wfyzwg ww 19 if W, ' f S -wfk f , 2- f,:wwt..m.-1Maki . q5m.-fm,-Lff11,awe.-2',w.fW -a.'5,5gM,qgmxzNNw',gf:,xgrp:.w,:mm3xfaf,Qy,Q?ze:lgfsy45f:,-1Q1'v.,:.fmw1541,-:,,f',,m4w2,Ezpm,f5,-QQ,'yi3.2.5M,-.mfQGw.:Me,-Q.Ywg,,gw,m,g,m3v?..pi,Qm2,?Qff-4942-4,.,. Qsqyjaxfilaw :WA?w51f234,xyh5a,1ffg5awJg?34, X 3 . M, fi : ,- L 14- Pffbfr'fzaffxffkivs'.i53yff'ffm-fszifswffrizafwaff'Mfw,5IQ1gQ5:Q z,frf,:ff,x.'Mame?'gfwf',,w,1,ggSfm?.w:Pf,mceirisgelff ,V k T f' wi 31 11 W' W- '.1f,:,m 5'gfm2sg1,5 1 wwyzf kb.-vf-,aw . 5153 ,IM Vg' i ff' 'Q:s,1f,Tw1gvfxgz SAW'-.',g,Ay-:rage ffm-vm, ,Jf,,gLrfv1 ,g,:,vf, -.4fw,.i'fw,: x ft11,5k,wwff bg142.4Q,k,2v-ww.,Zvfyffmy, xmas?--'N,q3,gfu1,,1,f ww paw, fu vu., uf-,gw',-1,4x:,ffv wh rgrmrvsw , w 1 N - . -. 15, ,xi l.,x,,,.A .,1,.A,,w,,,y,f,5i+Q,.Lim,w:yxmyfx,,L,,km.W Q.,XmfH:I WMI ,f,f,,.W.M-iqvffem-m', Rfwwv h.,1,f1w..f,-mf:-vi.4,-ffwxA-,411M-J--1-gf.-my fm.-Qfif up.-fQ.ffw,f-QwfwgwMM ww ww gZQ.v v:- Pfliwff-Ns -Jfwww dkwivfgfynigfg-'Mwff MP' 'hw-. X- QW' A W - ' M myig-W ':'4sw,fE1fwwifi?-ulzwaw1wsmtigevwpwvwxqagwwp- wwM,.M.i-,-mrffywf,,:f,f-,vfq-1:::,qw,:v'wv-'yfgfvge'S:w5w'rg-as-1,'+MPp-wwwa fEw,fk+g,qFm wfwfzw ma-gxsfw.fx'2'mgQw--1 f.,,54hMw? B--zbwnff 4-igv-wp.-W1 MH, V .wavkw warm f K V, Va' fn w , 1 .Y ,r. M,.LqWw,f,Wf.vf.f, me 1319.Wmfxif-.QV.y,a.f,i.,4M,1-ws'.En-w,f.x.,,s.1mA,K M-f .,,. w:'v:'-affwxlfew ,-xwhf,-.1-Mgf f' a.y.Am-,,.,f,1-,afw,,3,ffwu,.mJ1x,:,,-::,,.ry.'.m-myxy-mf-Wwzmuwia.,n.Wh fjmv- ,wwf V1-.f fqlwmdmf M ,.,,vQ,1x-li,-w, 5 , -W' V .f fy A-Lg,Q,5,-1,14-V,zm,m,1am,QW4-qfi.a.gfgww-H:,1.qyg'U:'-ffm:-a,-,vt K..-ni'ww'Way--:fear-pyvm-ff.4 -Q.w,f41'.f'w,fw.,fw',w1q.w?W1fw,v10,w,fw',M wwffwwawf-:we-Mya-fr-fivwwcf.W:-'-fwxwfvw-rm-1'Mfg 5 M '.v:13s.' Hin mihffe A. e f . A wr. w ig?-4 44- ,251 .,,f.gwHH.,,11l-Aai-Mffy :Lff9w5'99z'fi-iw rffw-gpwr-, xr,QM-h1g,f55'gg5Ff -gm 54.30 ff,-f,3,'.',-3m?:,.m4.fdqsryq,uw-qfffpf:-A391 f,f?3,:A:5-'g4'4.ff: y,,gf gw5vA,w,,,yP6:f.'rA,r,W-p.,553n5Qt3wx,y,,- fy -V im, 1.ff'u25!T,,L A R fwyg pl' -5 1 1 We M. , W 4'-f A 'qggwfgfswi , M, 2.24, Heli 4 -. ,J Kew- f X ',.ga3v5'wfg'5l?-,-359:,3-.mistff1Eil1,::f5wLJTT,,fJ25f-,iziiqiwf5y!'f?ff:3si'2fAg: -:,f.fff4lm'.Qf14' f 4, -14j,i,1f+f- ,HN 11,2-yi-Tx L-1 A 5,-vuqyfvmw ,gwfffwm f-vqws-2' 2:'1M5,?gaM-XY'm4Hh,?,Q9z,, f,'wQgg4egi?g.4zW3f,gwq5Qmg mi Kim-Q .1 vfywt2fWegif'?'X-'fx ,J , , V L, , N ,mf-:Q-. fx vu-L., - M 9-, ,- vmmfirg-s1gk,w-,,w.4,,,.g- wx liar -if Y ' we-9--X: JM V: .. WW? g.f114:,, .Nw uw 3: gn Egagfwg if ,,-zg.X'i314gQLg,L1T4t,wf ,gg-,,1f,, .ar is gd, Www, ,fn.2Q,1x'F', Jw w y.,-. :gf f,.w-g51wfH2vypp fxlwsg Q Qi, Ww- w Q, 3 qx ,, Mx,1 ggiQ,Zi-cziglgsagggiaiffjgcyivfevgqgz -5 545132 xv' 555 QQ' i'm7'4Aii.1Hif ?lf' k: 1? fr Q: 115 ' .-',:fv,f-sv.3,1z.'151' yi, Q f ' . wg fsvfaija 5 Q32 -Y-5 4-2-Q: ge' gf-82,5-' . 'E fvmiir' 5'f'wKw ,f:mf 1: Q,,,', M, 0. lv 'xG'- E2 Ax X W y , ,Q ff lx ' 5' ', f.f'k'f'YJ If Jqnef 'YJ Fc? 5,1 Pf1'L 1. ,Vw Y-fl, , . 14:2 my I 1 K af NfAfi9,,gp5p'g4-arf ' 'L it HW lp-,'w,. wifi. frgwfl :ff f.PmgiLfG -sig, M571 f,,f5'i,i'.J 111. ,QA .ff 'gif mg 21 wg ,.Qfif.fsf: is , ,F C My ggv. gi 5. -cy. ,xp mWf,f:L,45,g 'sm 4 wi Win 2 Q , -1. Q 5 .re 1 -i ., ..Lf f ,N W 'B mm VKX f K ,J A 4.,,w:v x 1 ' X z 1 W'-iii' ., af , VM. 4.2 .Q-Q.: arf-1 Q ,?e,1+v:m,: if - 'I '5'if'1.T7v9fEff Q X A ' ig H' EVN ,N-Q-143 T gl fs M le 'wr Y x WJ u. 4 u 4 , -,M-Q-rg ' h-MNA, .f ,MW 1 f 31.10, Qi. iff'-1 , , .5 f mm Y, . K. N 1 Pflxx N ,ig J Kr if A f Efgxffcli L .,,-,D :fam f 4 'mfs 4 U. , Q' g 4 vw ' V 5 MMP u 1 M X, we Y , cm e af' 4 n 1 ,ff r' Q ev bm X v vw, if A-if 2 54 A , Y 1 v 2. rg M,- V ,W Y1m,?n':Qzf:fsfwww .xTX45h...-M.. . ,..,. ,L,,,q, vwv.iKff,, X. ,H m mm mf' L, Alf wa' yf f x ffm,-vp, , H fg:.w,.1 ,,s.9- 'yf.,,':,',j., ,rw Qi'+, f 'I' KU' N55-L-r:w'lf f ' 'hw 1',m7,: 4.:rr',4,?H-...'M'Exif w.g,.w ' M GMM X I J r'?':eMzf11.:'2 'I .Ma ar .w Jn as ' 1 A M52 wg' af, yzfiff.-rf 'ff 4 1 ,I , r 7 C mf V f J I 4,435 Q rex: . QL., Y., br-2 w , Ka X f 4, K 4 fwx x x rkbr x w f fa v 3,1 5 yyi-f1:ff'.:k','j:f,gg 5' ,,Q?,jZ1,D 95 f,w.- Q M- WW, L, 4 ,H mf. Nw f W3 x'f,l!r ,f ru f fig 1 'A 4,,.1.. ,..r ,f ,,, f I wn,,,w iw, ig 1 nigh Q 4599 R W 1 vw '1 Mm, f 1 in ,Y , 4 K r X ,r rg hw '4 vi vnK 4, K Meri., + Ydfme f 2 W Q 1. 2 gf www' Wx a Q 1 1 fm ' fw fa 1 Dymffy 11 Nh X Q , X A,evu,i S 'v , JR X H Q A ff X s ,XA ' W ' of X vw 1 ef ya sw , Q K Jr' X rw Q Mr 1 ' Nw w S JP 'f ' s ,ai f ,M X 55,11 1, N v 1 K k 1 5 fu X 1 n ex Q Q v 1 kr ff, ,I fu Mx' Y V f xl 5 V11 94 ,W YL fs af Ls f.,f , Q X N X Q , W uf , m ff Nw A 3 x W R V x f , 1 w H, ,, ,ww f w W ,v QQ Qfwfv? QL .Q 1 65 44 W A . ff , 4 Q v 5 wi f K v 1 H., HI Exvfwk ,1, U gf f:f f,fw1f,:4:- aw -J ,A-,-5,M..1:MY,?k -I' . T'PQ,..1..1-f, Y f.,,p5. ,X b ww 4 r. 4 x v -f J mx xg R ,gf W T X if 1 me sr, LU -New I w,. eff. W- P y , 9 J .-41551 5 li -Tffmp. , - X, - . .,, ,,.. . ,, . HV 'ny W Q 2 f 5 M fgxl ,M X W yr, 'W U xg 1 1 ns Q f .ff N4 Y f J 4 iff. , .9fif,,zQ.,f57i,4, 96.3 fgggys ,1 W3 ai f 1 ff f W wi mai ' , F ' , f ? Ji sv . 'Q fmI,g4'wQ,1:2r9f'5:,:':Ysq!Yfm9'4wf ,aggvdxsfhgcffgi sl?f'L1W' Ml ' mg--Mwrf Y H 'D , X w7vum f2:Fi+ws,w- .vb 12 JH W M?'v'?ffhw:a.-4.HYEQS:w-, H JL, -3mV'1 u M FA! ' W .32-1 L, ,i' ,Q f4n,w,fiQ .WS ' 191, 'V fm ,-uf, F 'Z ww. ff W' 'QL' g Q 'gwkki : 523, mi f W 4 Q 1 f 3:12:35-ww + Bwg':2:1SWl,5hfjf?e'5v 11'mba.ff1- 122 if M W vf94U'gbg in sggfmgwfmgfv w,3a3ww:+,fwa4 --ffm iv' 9 . QL ww nm ,4 Q ,fi5T35fs9:gLf ZhzmgfmhftfskymwmlwJ,1,Qe 5q44w4q'JQAaEw2H 55:61.-'W-Rf: 'iq-swf f 1 W K I wx 1-2 zilfgwwfimgXa::i2?3WyA4srr-iffwwggeg,. 22123 .1 'F' vm: mu: vim 'I f 1 W ' r fi: wQL1'2wf --'swz- 'M' YV rw iw 2. S ' 'E A51-V59 fm' '- Q VKX ' 411,21 ,Q '-swl.fM-,ww YW'-f-QM x'f,g3fwy,f:frx5+ f JW f -Ab5,w3Eww3 w 1 af f A A I vm? Mg Xkifgfmf !1,,x3j i be 1 Neff f -fc, H , uf, v 'V . .auf mf limi? 0 3455361 Q , -, df:-nf -ww J: ' ' ,nv 1' ,pk a'f,iw Af ,Ms ,, 5i,,p3,f , v 4 Mir QFHL' ,Q JH'ffE.'1s1H85'v.3iffQxWyi5u,g-.1wb.,1C,,. .mg SF ' Q T xg M, 'ff ,Q w dv 4-LTL, My -fwg ,elf-mffgf eafm-vjv vw, 1 M, ,ky e .w 1 f 2 uf Maile'lQiQ:f.2i'fgyesw.i'Zf7Hg,iifg:Kikkiirigm 'iiiw QQ? xggfffifa :M ,, , f w, N wal 5? 735' 4 , Wm? 5 94315,-15 gg,g,gw2QEw..3 V -M fy' 1 -.X - sy, , -U,5:nf.,1 ,cw fl wwf R ww A JJ- 5152? 133,51 ??Qm,:2f'l Q , Q X . H, . X W 5 W Q35 2 f f h 335, 'fe A J ,2,7:-w:- sxfvwfwrlfbffgif aww U7 f 1 C ,yfgzfli-L'Fofm,f'fmfgemafwfsfMQ,Mint- gf .9gz1.-X-yksgvgggni' 1-f sq K5 'f 6ziagfiff?-ixsaevfwif'-2z1f4 1ff25 f22 GWii'i?v3?t mf X' sq 4 J wi qw f mmf- 4-if ZIL-Wf4,.f2gf'? 1,?ba1ffnm.v,.g 4: hibfv mv 11 'C . f ' 7 wnf'+f551:i:kfMe MiifrS5QN'ff4v'f? W' Q'- if' , .f Z: . 1 Y 4 M 'J ,Y , mi? x -' 4 fa-u!:Q.x.w.ff Q-'QQQH-,w.,fm-1,131 wa K' ,-mem Q 'frminy 4:--V K xg A232 fm x 1, 5 ff ,N 3,1 H flzggfgggi 6553.3WdXIn,135g,3fg3fifghi3,qg?gg,g,g,?lgxk3L Y 1 2 Y wi-.XZ 'S533,c?5L4i?ffif'7EFkW25iiQEi5f?ficR1?fT,'?ifA59RW2Jw gs xqlwxga-wwaia, wg, A W, .W , , 'ffWEPJQSC,m5i3I2pr?F,mwas W W 2 Q W . S, ff isa wwf fff5,wge 'f4f:r45af Qfwg -QMEM ' N , Y , N L :P 2 wk, Lima? ., wifEQ?i,1'sfkA'?,,':,vLmf,54.-'zSE1f5 v,3:,.'anrEL'5,L-'firm-525 fvigfiiiifef-Wsvkf Will fiifvfq 'N A' ew 1 f vffgifg mf: fa-1' - .wwqnsfw 1-wwf um-.wfifuf-1?fW WfJ:' -ws? 'S -4'Yw V5 fun. MM, 1 'fifgffx wmgizv -2 gp 'Rf -i gang- un G 3,15 ig,:g.wx1imxw.3Kris?-.Xa mmewffefg2gifi5gz,2Q2,Meg24wm'?f 55+ U y le, ff ea if AJAX 1 mmlk Q,,g,1,a, L U-3651, V? may f qwfz 'f-,'m ,waggqWQQW yin gray, g N, ,Q ww sg Qwwgvi, ,.fWg?,5tgggf..f,,f 4 V 1 , 5 . ..1, 4. ., . , , 5 . ' 1 ,A M' :KP .aff mjwaizf-1'-:uw ffi5-fNff.:ffJ :,- fa-if '5Qr,.. . 6-f L X fs, fax. -aimfiiig wq1?52:2e,5f ' 1 ., ,,,,, . .,-,,,,, ,.H,., ,,, ,, ,wx 1 f-'As Avy. v M fxa TY f ,mv mm, Aw ' if ,ff MM., v L 1 wwf-w'2'1'-Y-fx:-1 .. U,-,, 9 ww, ww A: -1, -,uf ,rw Q: ., . 4.21 X fm :mfs Q L A ' f'f55+f 5fi1S:W53'9 'H of-Qs 'Z V? EM aff Uisf VNU 'wi J' Ni., ,iff ,gi wgiwf ,ag k'md',,g55,gf, 5 Z 4134 r 5.4 gm XV ,g AUJX pw my Q p E31-, ,fQ,L,A,fwfWWgyV'f fm. v. me '32-v m ffl -L f. -:E 5 rg? h 5? Mfg-I? fgmithggigi L 5 , M 3, QQ af ff ? S 291.59 - qfmzvf gyc'-1553 ,, .,.11,,f 13 mi ww . 1,-qfam, 5,-gfwj. 1 M., . wi. ,, , H jmwvw A U., L WZ: g,,w1wg,,',.J,:y,-,. fwqgvm ,-wgfcczft A F fy, fi :W x- -,5rffi,x4E'S, i Q k f x 512' 225 IZ . .m,1av..fXL:k, ,, U ,, , .4 H, mf, .w,5-f1r1,.wv 1',,w1,v. We,-Mwgfi..f7M:e.1-mi f,,,'v+3v,xf'.'W0 lift , ,mf . qw 51355315 xy ., 22' .w s 1, g i, z , fm.:-.uf na '2f ,::, wie- 1 fi W Z . A ' 74 'W 5- V 5 1- 1 'Mx aw- z 6 5 12,51 f A43 3, 5 ' ..v .' Mm., ,M .iw . , E., -uFff,.f',,4?f?2' 'sw Yi .wi ,M 4 W Q ' my -3-aww.wp.fW82w :miw2. GQ,ffw:mfiQ:uiXI4iM?a1v- f,f5gig'i3Q?'?'1f-1H'Mt?? w 1355- Q9 r? f f-4 Q35 ' 'Ls V 33 1 - asf J y 'U SK R 9 'v54'3'v. 'v'4Kr.fs+f': :fgW?f5,wi'x334,3gx M K' R41 '7 43? i K 5 A 3' w 'V A fr E Q ' .x . . 1 11 Aww 75 ia w 1' f I 'Sf we 32 1 A 1 ilxagiggf .gg H-A Y 1 Q , M, - 1 1 , , . .A . 'QW' ' id ,bfi 9' x 'H f K, 6f?fL3Z:'fflvZw1i1f!fw?f Nf'3iq.z?,wigfififf 11bfwfP5f'1f.wy3f likilWEEIQW:M1914r57,345-,425115.55cfx?3.',5iiEJiiiS'.?,ep..s' fy''ifa,q1L,?'kiF,f5i.Jil'7'f.5,f,5rg2'i,3h'?'E5gzLgM'g,3g'i 155551 Y VL ,wi he 1 '- ff ' - 4 - A -L -5- M f Y w '-wmff f'f mx-wfzmwf 1f-f -1'w?fw2.fM:4a:,fffwiv'ff.f4Effw +fYf.5vif1:f'f .- aWi1ffAC1fw pp, 3 ,L M . lv, . X , ,, .T x Vw, ,W -,LL,43.,1,,5:,f.f -f ,,m.',,, 46? Wg: -pq-s 0 wf,w,,m,r.Q.x,g4 f,,i,,,1 74, V, k,f,,4ff-,,y:?, ,,,A -W':M!w,,if,5W,4,.y54Q,,5g.11y?Lug.Q-.4Lv,q- 7545,-L,kM qv, ,f- 6-1 p 5 x A 1 apr 'rn - 1 Ufy -1 ,X ,Lf-gyfig-1 pg, ' f,.'.f.Wz.A'1. ,f-T, ,f V :W Lw.,W1z,-.',,-xgvgw.-an ,L Ng, ,E-,,5 5-1,Ny-f-,gvm A ,g.'1,w+i-Af: .,:v-Wi: L ,my,1-- W ',,:1,,gx.:q. -, Q, yr .wg- L' Si ' y CAT' ' ' ' ' 31 K ' 6 2 'wrimf 44 1ram?1 11'efWS:-v,v,fffs?-ie-.xgf-'fmi P:'wfv.f'+?w 4 'Wl.WE. ?J+:'i:'W'-1 1-?k?22..2r1m?. ,zl.ge.Ef.rf.91f-Jiffy? fekfffkmfi-:r'f2Q LUf'JfY4H wa nf IH SWF:--f4.aQe2:hg-,'.As1 r, , , , 3. vm b. ,, 'W ,f , .f ,v ,Q W- lf, y .w,.5,,ugx. ,A - at-Q X,g,f ,,,, -.,: fr,,,,1,uif, :gWy1V.Ak,,f,,W,:Lhy,gL.fm5g,,,g!4,I, ,ig-VM.-m,.g 4..,,.,-,,, 7,w.Q1,S, ,,.,,g,5g,wY,.f5,f:w::,3fy,g:.Lffm.-Q-f:..f51M1-qwr,L:gLE+:,p',, ff..153gQ7fw5g33 vrffv wi 'f 1 ig J 3 A mi . , - 3 .9,,iff,. QFTMYL' V,w:a.,w1v5.f WiK1 5Wvr'-1Azz-,r21.w,,.f'-g,uyQ.'er?:- izwwremmf',.P'xw-'g::'fJ'ff3-Lfwiggtl-fagLi1:1:g',s f,,,f1g,'rJ,1g,,,,.giQg if,-Ev:,'QH,,2s::-3fJ,5g,-wqfq.-N:aff-:m':,1fvg:,A ',gp1wWN:f,- .gewmg ,Mew M , f, K., Vx 4 1 H . , 5, A ' :i4,':sf ,-wwf3fwf:fxa:1m,wyngzwff-,finxfmmf,Aw-1.1 wx faayaiff''im.'5g1-a-KifvazynmxvQi: ffffz'4'f-iljkqi flffizs15xgfxgfigfleiamflwgfzig.f2a3.v-age'Qgf'fg1g1yawAif' 1? 1 W 1 M - . f f. L . 1 .f 'x1-- . Y V,-fr ,shQ.11:i'r3wn'1i:i1:if'Wi5,qnw'qgfmfyai'wxslwagi-1:-. yQf1'ff:'L-rw-if 1-5 f,1'nf 1. Q53 '7 f H 449 S ft K L , r Elf w ' P1Q'2,f'-'U-,Sf H Ag-V pf' - f , V' f, 'fEf46'H-':':-.K-1 e5:'M1H'4f'1.:.'f:.'u'f te 2:1.l yg'5Ff'!.-ggijgdW7-lfcf f'? .:?'LVg?QiL'T:,g.iigjq-13?-591-fY-'Ways-,4'5v11,j,'.j1'-f!:f7'n:wLi'A:1p:P,QRV371-f - K W' Se , 'Y 2 'H , 1 ' x 52 fini,--,f ,' is - .Q'..wm,fff,..f,A,w,v4-..w A-5-,lv-X' l,fg. pb ,Mat ' ,V,f:m,., Q- '1.'A,,1f1,QQ ,,J,,1, SQ 5'ig,:m,Q,L'-we vgw,,11,q,J1.w'y L94-,wy-f.bfx-3 u f.k1'fQf'3g15g 1,'ff4y-:4g:.1,.z.k-fl,wi-,-H,,g few 5,0 , ,Q mi? 1 ., .,5as2,q-r'?:V5M-'TW-W-'.1-':-f'1w2ft 1iirmju,'f,g:5g3vfg,:5,gJimfs'gf.g.,ywLf,'g.j,C 5'P7f1'J3-,,3'2,'3Qe: if',,k.z?,,fxj-wi-1'P'f.'15Q':ffi?:giR1m,?:.fg-fg':'fy1gegykii:f4xergw+?Ay1jT,e:.,.,'f,,-fzffqjgff,Jpqikggf:Ffgff1gj-f 5 X 1 in , V Auf X 5954.Auf.f,g.,fb-fxjgm:,w.':J, 'sffiqiugsvrf.sg.A5Q-u,'X2f5Q151x5.'-:1ff',fl.u4g:f..'.Leg,',25w,,w1gc.w2gvviirw.axkg.wix1pgf,f:1uL'v5wffsxygaaz2faV-fs2api,bx4LQ21g,2ffwgfg,v,f.54:?,xb1,y . A , V, A 44 M ,- .V YQ wp U iff M 1' 1.,,,LNf.n..,-Me:'wi'-'f'.'-,9'g',-3-sf:-tfvli- Qmf-,:f':P, 'W 'f -'f.1f1c1-, H251-f?--,-ww sw:-92f:1f,.,wy,,. ,,:K3-w.cfwQf.',vg,,:f g'pLf.1fgfiffg',,Ar','4f.1f1Emi5:51-,sf-?fqf,1'g,-3x wg ' ,X g K 'Y ljfq ,:,,',g-15124 .fav ym,f-115-,w::,.y -:-,QX-'r,:',',p.',p'f.f945 -.ug ,ZW 4,,'g,::1,,N vm wif, 1 '-,zA,-1.:w,-mc, A L1 mf356-:X1ff3.',f'S::1g -'if:'Y A'-14' 'NYM 'VU''wie-glw'ff1'1'fE f M343,2'f1?w,ff'fr,f,QKc'-R' Q-X -5 -f 4 -2--gb 1- 3 'v f, :may ff-534-.:, 'xwgz,Q:r-L-Q1-gr' 1,f.Jw.,1flsfzqs'2.-,v4'A5:1,efl'5,gG'swfgvgmfz-wif-'f9v'vaY3ef-frm,ff-If F V .fs ' .V my ,. in---A I M f ' 1 M ff ,' ' 'Lw,4'sffzfwwglia1-wp: '5f,:4'qrw,'fsp,2 we,21.15111amwffqfem-afaysm'W5'-V,:gw',,.,.-LH, ima., - mga, . nw, f NY, Q f ,gp f + f A 1- ,Q fx: 1 5 H in V 3 W N1wgQfmffa'wi 4ifzen?-zwfgkgzeszgfeaid423:-'..v'2a-fmwg: 3 12 fgggf ' P Jw ' k L f ' 1 ' W Y' ' 'x' f ' ' N' ' U ' 'W ' W WW' MrfJ5wZVw,1lEZ.h v, 1' a'1Wf'?C'W:fSf:f I'-ag-i 7 A-im5,,'3'5:,zaigwiaJ Z,'v'ffL f-.Nm 'Aw I , v. Q. vt 25,4 J, f. ,s. .5 ,,. .. H, ,A ,v ,. f Q Mr A, V W1 ,- , , , mx . W4 4, dk ar. ,. Q. frffxf .W-H.,-'J .P-ew MQNR,-v us'-1-ur-, Ma-'4H,..,,-,Ybwwpq ' Q 'f 'Q f ' '1 1 4 -'af:1n5wYv'f,Lz'- y,'.rN'l'iw1,w ufvwue-wfz -,rfbivfff-E ,www :L f4v.f'-W'f'f:?'.Q.- w-MLQ''flf fS,4P1,-hmm:WJ.:wif?-'eww-,f-+1-x2'!1'if-21,52'ff nf 351.53 -.ff 1 R , . r 1, ., . s. fm., X, Q, JM, ww 1. W: Wx Ny. ,L.q,. M,,,,.7fi ,,., , 1 W L., L, , ,,Sn.,,- ,,-fa,-, ,N A.-, xv A.,-,4v.W1.,.x ,,, Wy. ,f.f-.,-e.5.,f, f., vw- vmnr, x Lf! , , Q5 .MfA,. YH Q Y . , 5:25-s wflwfig l. m:frj1wfmw' 4. Qu:5.,.?v:gLwffal,iav'3f2Q1f5aQ51v.wtg.,!fL1 lik?f,f4,g11g2-'XQQLMSWH3291-512,'avi'wgfQ41: 3 Qv5w+2ffagsg.f si J137l'fm'i':5H s .mv Yr' : 1-N. mf H 4 1 -H: 1,,:v ,Rui ,L-'ff s -'THD' ' 'VA-J' wil f'.ff-J'-VM. vi f5 'z' w2..H7', ,! '51 r'fffvy, 'swf 'lf1Q-6.'L tf ,H M ' 'Hb'-.J-.l'- L V ti 1 -, 2-W-'..:9: :' vig 2,afiFi'1V A112 .ax-fa WM' 1-f x ..,w,. ,-,rin -f ,-mm .ff E-Aw ::4,,fw-Jr.,-4. ,A ..1'.fu-.-wwf A , .,f.vw.9- 1, .vm v- A, mn X Q ff, 4 W., QW. V Y- 1- k,,..s,qfs .y.,,f-,f 1, .f,,vm,-,A-vf..m.9, . .Lx im 1. ,,n..-uf-ff W . ,Aa NY, An, wg .p.f,--.,1,1w.. .ff-up-4, J.,,,e-,,,.,..5-, 7-wwf, ,fx . w .mfhf f-,-, 1-L' .- mx Wm, , . ,w,,,3, , , ,.,l,,.5K, ., 4.,,,,,, ,,,,,,m T, ,MJ , A ,,,i,,,, rg ,T ,,x,.,,,,. ,,1g.w,,.,,m ,,,g,,,.,, Mm. 1 xg-, rv,.1,, 1 Rf- , .NW N + :um am aww n-1w,4if- 11 X -wxuf ,-,vm wwf mm-.wf f 4 4 4, . ff cf ff, my , .Q ,Lv-. LX ,fn M ,Ha A,-1, .um M -Y ,V 1, um- MV. f- ,V 'mfww-I ,fr-iwf1w,P,w-Nm.. nf. f x Mx s 4 ' g ff ' fr 1 fYf,f,mwqa-ak M- ,ff Q2-He'-Q1 mr.yi,-1,kgf'v,.MgZ..,, i 1:2 is-vzfyf, M, qw ,,,,,w.M-:H4,9,g,h:,wmpg-,,f,1..Q,,,.ff1Q .'n!A,zg.fwqf-.,vm -Lfvf,-.fys-,Q-,ffxyyff 4! 'Y' ' 'W A f fw,s-1.zimuaa-1M'1f:i:W?'3:w..mfxg,..'2:.,-Qxrg...-,xg-1'Q5qeuf, .1f,4p, fN'3'vv-'5,'-Q-,Z ,x:fgf.ff1'1ff,zf: LJ!Q.:JQm.f'.15fff-,'fQfg1rQQg1fk1'fefiyYffiitiff!Q4QJWS1'1J,f, yQ51g9f1i,S,'e,,1za,y3S27'g,,AQ5-Ea.j5?5 X 59351 Sy, 32125443545 IwzfzgmiV'?fR.x,y?-,f,'1, my :fx5,43Qg1ivtf: 43 Qgc,-'yfikywf 313524, y21m,g' V fb . wffrgff, Y' -L32 'I:m'f!fw,:.fw , 15512 jx, 3-, V L' ..,.5::1 -, w1gdq,,?n.3gg'3 , ,fL3Qf-v,4,f-1-g:,,:g5.gg, egg fg.g,'f,4,'ga?gffgg ,,gi,gfy1rE4ae, W 2, -if gifhsffr ' Sf I A W51'f..:5 Lima:'WAfffQ?Sf::ivy mr Ii.5ff5-Mnf.1bir,wfLffQ,'w'i-'a5f'.'mZfj'-cf65.252 M-i?aJ1',f':2 ,:'if-fi,'.4 ia'zxwsifxlr W 144-'wf:.,q,f'Im-2'fsgfl-igirwmaic ma-ggmL,.ffQ,ff'gv.:fa:.. hwy A , L.. ,. v ...y w'.2'M.15-U2'Hifi-l 3E5L :X:113f'f '.11'Z 'Lf,2 fig ,L,aff 1,3'fiffg+ Q' ,.'xf'.-:M ?:wfff,'f3ifff,,1gY-f 391-w'Q.- , gg' wg, gfpx Lf, ::L'?.xg3f -,L 'r'g'z'U ,5ff,fL,x: --31,ifg2fQ..5 44m.q wi? ?,:g-AQ, Q A ,swf 1-in fllfiiifi .g.9j,f. :Lgezz:'5:ifa '1'f3l,fw?:','1'YjJf 54:51 f 13? i i'J-f.piz'1:gqa5 ffG'Z2- 5 1 Iliff:1if-v.51-fYi'f-.'13451, '.?f'2i:i'3g'f',vlLZ3:1:l'U'f'-Si 'QifrIE1? f'7A5V1fi':1'?'1f 1554 ,Xiu-'L21'i'LL fi -'ifff 'fflg' K 1-g 15Fmif'5.??ii'-7f,l.?1l-fi'T+ :'i2'Ff, T' V.-'.1'g,.,,Q'N-2 4- W-v 1 g -,QM-I-11' , 11: f,,'.:f,g-1' - -1 L,-,Q ,- . :.,4 nf. X -,1-'wg--1,:, fM,, EA sfgpfyiff.,fJ'9AvIL-,QQ,'gzw1,g,'ivg'f. Qifmlflwg -11,54 qw-2 yr F A '- r ,.f:1,g,1 wx- am,f,,:1:,i,-fflzgf-1534 1, 1: A R uf: Q :,.s'f:,qf+ faq. 1 f 1 v-,g,'2fAm 'Kip 141 gw:2,f'v.'f 1?iv: f'f ?91fgwH+f1x . fhmwx 2-7's ffi:v.'f-ilwfegffi-?,v,M-1f J 12541-i-1E+S,',fy2x',f,'J-'ww , fi::fi.Sw-,f.vee1.'4fm-1,ffwzefxgfwgzw-5 5.5.-,1 4, gk.-.f 'ff 1 fl ff , gy- V -,J gh , ,uznwq 1,,,. -g 1f5'n...,.: SWL' in V K 1 ,V .y +A , .Y-gm '.,g.,N p'Nm.,A-5, NL 1.15714 my uH1q.,,,,.-,,,f,,q,y, My A.-.,. 91f5,rA,f,4y 2 ,5g.5'fj5CQif3wsg? 5 ,1, gf3L,ff, jmgfy-5.'1q'a'?,:i 2W,5gfy H11-1 .i,1,1f,Q2' '.gjf,'-v, Am: rf,.'5,-5-9gx,fE'5+yg'Pg.2f,f,g,ffg.'fjf-1.Q,4iff:'-fgw1a:A,qL2fg',Qf1egf?2f!-g9w,2Q.f,Y 'Qaw:Q.i4a1i'ig ,'fa,'3,iffafq-W ?..,2 ':fgg21ge?J:42113.1ff'ffig'ie.z'JY,.-xiaae,ffg,r:--Q4 Qs' K' A' 1 1,gggzafzfggage?W,ggf..'gifg!?j-5Lffggefwigq ?Qs'f2'-Wax 11:-Mi:-11ww',,e2f'1'-22 mx?-Q fg'f1f :wx , vias-, 3 zwym-xgg1g.i9If'3g4gqy'f.,:2gL5Mzf,4f,5 7fz+:pgQ34f 1 lx Q .ff2-K ' N -JW Xivlrfrf' Q' 52? f? :','f nfl UAV' 5,'l5?Q'3ii'7 1' i'9ff?F f5 ' 'ff T, WY' 1-43 fl 53' W 'M' 'J'f.XTLf K ,Ji3'f5'-'f13J.'.'L wi. Y? :ul Ti Jaw' -'klbfivfxff ,c! fN :MY '5'i, iA?4'1V1'5, 'VW 5 Q51 4mg,-Qagw.P:rfFmEpf1ffqf,:a,a: V :wiv :zMgu14?:'e-21-:-'wwe'if ifleiviwwfi mea?-ff riff 1,4 W 3 f wg vgifff,-QM.ffizwfswl ,f-W ,L I yy,wrfm'-:fgg,f,gJ.eg'w, If:Qin',:7vky,-,S-mg gwzgq,ugy,.43,5-.:,-M 1:1 5,f'f'1. tf,g' 1 1-GW1 -,,'.f'1, :fA 'v hwfrgfi, 'mg-'11 H1-' ' Ewifw W, Jiri vTfiifipiif'rlwiwY:-fg,-fgwvil'mf- A . 3Lj'.-s,I',fg, Qi .,Xg.p,gg,ww-15:31-'W,giw74w,fv,gff Q27 fgfm ,w ' 7a's,LQ1 ' ,,--,,,':m5'fify':f ' 'aff,5-.QV-,f,v:fLyfgQ,,.ffg'1?m.'ii1Qegfifoclif'-f5f:gk.f::?2. s1wfqf2sf'fgzf,1fa2g'QQ lr .K D, ,,.,m,, V.,M.,4y.,,,,, -, .W ,f,,,L,, ,T inf ., fm, N, F X . X W, kv .q,,, L, , ., 1, ,x.,L,f. .-M2.,,,?x.f,-,A ,X.N,,,,,T ,.,,Mx,,q,4,g -gy-,xgrw W. gm, TF .. f. , fp, -. Vi si,,-afJS'2:,x,,as,-,1-,aa f5f,',fw,,gMg ,X rf-4 , :ff ,qy-mgmp .1 ,,'w,',1- 5.5 ,mi f,.f-.v ff.. 1.f,,4-p.1Q,xQ,--, S-fwggef f, ,Q,f1,yg.:-,iv H mf 51,1 z' 1'v Ql3wY : fs-ww suv gmwzrfi-1.. ' 5 i'c'f'kl x.9 ' I' N qw cw f Jw.,-wwf1,1m-:,-My-2--,-f. wIgfys,-zfxm.X,V'f.g-A::f.:Qm. ,fmwaxf.gf::g'gf5Q.:',jxvfffgfs? iz! V 3 ,, 1,2 f - ,Q1-'f'g2ggf,gJ.,-5'z,':5v.' wr QV 'frgg .jj,,,-,,1:.x ielgf,-3Lg1,Qf gm- Zvi: ' ' 1 gig pf ,-1435-,gygmfjfil-,X-,'ff-',g.f,g1Q-igg,V -5qjygn,Q31-'ff,:,.b-3:35:g.L,-gif-Mgjiyzg,mf-Q gg1,'f,L535,,5 QW gf' gk, ' -1 ,S ..'z'Jw vfzf. 15 '9w53.tW1qgq wvw ,v,: QQ-Lf','y2fDq 2'-aff:-11 vwwssfw Y' .. , v va LW: wiv A-, V- w: cw5.:,'xvp.,w4 4,71-:.m ww ' , Mrk-ffL 'rif'f,7,4efv,f.,'?f:-wh-Hz. , W2 -'-'L,5?lf 1,,i:1lLgif-:WGA'fg1ifz',:f'5,g4fVgPf-16 MQW? ,.fff Qi .-3,7rwgg4: ,i- -J-1:.'gw,1fgf1g: f J vQ:'M, f:- :fx i'.715:231-'4f5QQ3Je'1fi f QS! -Yfiivll 'Wil-HSLHgfiffffvf -335222 'ir-vfski',i1 m?i2If157fE'.ii-Gai:it-fav'Ski,Qfwgi-5'iQ,7 Mew 12.-' 'iff-:zwfiyf f4i3WfYl,2f1,f'L 1 wiv:Jimi-Mxfam--ANcn6F,gf24'w 1f5 fF1fJ11?rQQ-mf.-.f.fi -'if .fi 1-vl'1.4w-:lim f':':aa-1.11W Q,'Hsf ia,ff:Ll W'.fhq3,Q4,www-L -:,f'f',:2'- ffm.-mf'Qui f-Trfihzl-1.'S'ei5ffQfi'?wg2':vW22'f' Ls 'Buff 'gylgarfzfx 1. .1., we - gm'--grxw ,my ,x,5f--Niger' vw. ,mfff -,,,,.g:f,,Mf:, yy-, r-,mq,gQw,g,f:1:w.fg. 3-Q fu.-, .f- , g ,:.f M 1:2 ,-,rw-fu v wwf' . w,fLf,:fv,,m p5 gf-gg' ,'f.g,x':, ,w,,f,w, gm- vxwiv H, Fi,-, QL za,,4'?Q:?:- '.'J,ufSy1R15v,N'Q'fH?'?Q:ifi5n1f1f31325-ififrvfyivffygbgqig :ffgwgfif-:lgg1f,,fwjf,..v,QgYfy ,vififgf -,Q :I-mr -' ,iff,gy, ,fi-xg5z,5f.p1g1.z.gz '-fxgiifxg .mg L .:',gaw.gf .,q1w,, ,v,y.' ,,-1 gf1m,Q..pQ aw-w:f.,,4X f:, ,-5 ,, .K g ,e,. ,A .,X,,41:,-,g.3A,,f I.-In , ,h-,,,:,g, ,, ,,,x,4' ,51 I. ,m.fU,f , bf, W, W 53, IN.. ., ,Jxgggf,fg,,ff,g,Q,f-g,g.:w,p5 . 11?f?Ef-.H fu .Q eff- Q:',31,f,Q,,'f:'?f?'2'QfQyzmfzhgfq 1.55411gnxfiiainure?-,f,'Qaf72,sf'.fl.: g'::'-pzgf, mfg ,ai-5 'Q'if,-1f:xf.-r:?,2-gfmm. j 55 ,gm 'fu:finMx'-'af,'--i.g.1ff.y.:'gg5,g1fff.4:5f3,s25iw.zg52i5. . L ,Q -X - ,Q f53,'.4.g,-fi QQ,-2,5-,gigjffiiw Q j1,J,'.,.wp+ykg 5, ' -gvrfgfsf,x.,ff,',.,-Q ,,- kv fYw1'wsvf5,,qg ,V -'pry .KW-'.,,,,k',,i:f 5 W- :w,::-f-:Q ' If 15 3:4 ,, J: ,.,j'-31.1, ' 'rj xr,.ggw-,VL5'xQf,g:f,f3p:f.,w21---549.-1g,faJ5,',mgqgq,f,.-45?5-ff:x5- , 12- f'gif.A -gg -wg ,,w,w,f,,1 'yr-.1'fakmfg132.- ff.g,Jf If fi fM1xf:5f-I-w-'Y '- . :Eff f -M 'v f'.':EY:f ' -A xi7'u'2vHf'1',22 w'- H fi:,.::fc'w ' -ww5L2: f1'ie?cJ'f1'wfl iw2? X 'L ' 'H J -X? 'WU Q f 'Q x ' 1 'L .Wg ,,ggfQ,gig,.- g.f1:'-.1 Q1-gg' f- w5'u..Ng , -1 gg-g- f-gf .,P,-wg.:,-,f:3,q,yxl:, ,gk 'B V 4395 :7L1,:,,y-f,, f , ,xgf:?pii'i'3f::q5v14fWfUwifrgfrfff5.k.fsQ2a7?,fi1..2.' Y3--f,:2+Qwv'1'Qj2izx+1willgeixiff' Y X 3 vb 5 L g 52 ff ,,, w ,Lag Q fm gf,gw5-,gg-fl.. 3, ,g,.,,g. gg-',.-,',g.Lgx5f,,, ,ia 4, 4 6 4 fm., f,.vjf.,wtl: Qin.,--,flaw-, ,:,v,.-Lp, 'jaff5g,:,,f1.g H ., fit 1- p+,v5.1-Q14Q,w!2f.gfgTs 1-f5Q'azugLg'.ig21,: 5,51-T5 1fn1-z'I-334.-Nj 1-,ff1f,'f.,Qfg1qg-1: gf LL 'gfugf , -4f'f,gz.,g5 -f,,-'f:q,, g:g1wg'f4:z'.ff-,-:f,g,g1,? f,,1,f?f:gJ, 4331 dykggg-11?af.f1gfiigfxgfffiiigr JK 2 1, ' ag? L mu ' -i,21f:EQN1: MwN fv'1-Y1f.,1g'15 :gk-w ,l M -:gif fffyyff- af, ,Y f' f.:'.q34f' Q ,, wry 'Q ,qw-'-,'g:,: ., 5-fyigl-,qw :njj'f7'i 2713 -vCpsg4L1sm4 ww,--Ef:'g 2 I 4 y 14 f, '1'usnf:.f 1-.rf ,Z --,,. Um.: w,Mfs,afS-Vvmfx, ww '1f.'ffff'fff::.f' f f.,',11?ffx,' -:nm -':-if --xv.: fm-1rMw,.f1 wo -1-:Q ,mflf 'v..e.ff,,.Hf v Q I 'J' wg--K1:2v.,,,N, 1,511gsm-,.1,,wff, 5,f,x1,a,,g new Ln 5,1-N, .fdwpff ,111-15 -fre ww:v,,1:q.1,Hfw,-.w,.- '. wmrev9 ,4-MN. 1' U''-NL:.L--ffff3ww'f,- 'ff'1fi'fJ'gax 2' will W .Q-W.,vz,wyf,.,,ww. L 2 'Q Y 2 f isf::fif.ffw2i12fv Q 2 4' fm A iff g,':gf4-evgfffwffig?'W'wr p rm..1f5, 41'u'1fHWff 1 'f -f'2'ff1,f19i?1-i'i1Jm7r','ff1rJ,,ww,ftfvffiixgfif:f3'fffi:wh-ifSf 'Q K 15,1 ,A ' fx QE Y '.:f-ww, wa, -':'J.wh'w'.w.1w-w .nw 5-aff: w K,-1 uf .-nf W-H fm -, iw 2111.41-.F ww - ,q f -P rx -,'1',-wfxw. f-.Ny vw, W , -J A. X' ,- Vp:-H rv uu,:,.gy 'fag11,1-,Aff,-lgim,:g,f2w'4 -,gr4515,..g4 ,,f, ,wz :rm .vrwiffi - fa' 'J' w H :ff V-frffz' ' Lfw-,1,y f f' '. f.w1.1,' f-'J'-f442: 2-:aww-ffli' Vim.-rf 1 QQ, Q P 1,112-Wffilie wi'-Nara 1-f-iaffvfzam E2-11-f':9f'?,si,af:1fPz:1f W1 X ff' A Q , 32 V H ,:3yfi,uggagfg'fffiffuffgpz1411,-,1e2,u,s-fX-QQ4-..fgxf:g,ceq-af,'3g5-Qi',ifaaf:-3,1 lwfef-''1L5f'3L1La:,nf,',fu?-'fs.- sr,fpf-mistgs5i,iQg5'fiimx?H.avty-e5JQ:jaf:-wivfv'S:aga,'!ffxwxigflfgafaxv, Q 'gi Ji' Y m 65' 'H ::- W -'xx my 3281-61 . f' 'f.fggf.2.i'Li4w:i,q:,yjLf::v 'igv,a',,if- 'ly wg VMJQ.,--,:' 1'1,JE, I-Jw v':,gzf'f5fgHg-,,:f- H11 'I-f,f0Q.-1.Q':gJj -.vf31w,:i'q! ,-.3,,f.:1g1 325.1 '- i-'g,f,,fy1:g',fq2?gq1fg,1',3:.,g-' A-',f2,m'1,,,fq?1,'-z6g42Wg.A1 fp Q, 5 ,ff .1 H g ,,7. Www-,,ff.,., - L,,.,, ..4A.1, .Lx-, ,QM ww ,M f, , ,mf M-.,N,, ,mrq -,Wk V--fx ,,2UQ1,1. i J, ,y,, y W, W V 1 ww ,rf ff , ,gf Mm -iyfqggm, g,.f?1I,v.mpw --ici ,.',1if3,,,1,A,:.,5,,g,Misa-1-Q.f,4-g:'f'., 4 mr UQ imv V fr-:iqf,gA,'waffg?1::g,A--Lx,Zw5'V2,i,,wr1 Q.-2.1.-1.x ,-JM',,if-ggf:Jf'z-gwf453,12 .ik.Qwfgd':'mf'.m3::'4' Nffii, .Q N xi UP ff'-Waifi 'ffffxf-fifzlwxaf':wf3-'Mewiwefcn-wwym.wefzv-4!'v' 1 ff-F 41,fa.f.,ff,-14-wie eivwvjf 1 Www w ,gwxi wfffnf-1V Lil?6-2445221245-giM,Q.12-513:ffm4g,f,.:1qQgfS9q1w22g5'fSiay+e.wf,?fv yi 'ww 1 S 'gig 'iwjgm Q3 ' - U - IA:-2 f?i'iff! i,'f'1:vfu:a,2fr:ffmn?'fXf1lv1'fE-f'1f' Q J QA M Y -V iff-MA,em1g,,giii-geff,wf:f:wz'? 41,fgifwfl'g'1,4fvf1ss,s,?if41gmziiff:,5:w,--'Algae A Q, Af A , B2 4 f Q 'vpkflg iw451fx-ew15,i9y:gaf'gQQg1,i- TQ,elsif ifz.L,4::fi1,Q:Q::1.gLL'b ,A ' QV, 'nk' I JW I Eff 5 f lbfgflsfw f Qu Q, gf fi ff? ,nn wr + f'-1' wk? ewif- 'ff 'sfwifi.-9f'1f?ss'AQ-.'WSPiw?a,'5.wp2m-w+f'w11: f f 1 Y EP '2 .af LI,-Xa-Mwivifwv---WH H'ww.vmw.zw,:w1:14a l.wf:'f'2 fsiafwff t:1.'?f'Yi,S,'Vfifw'f ft-'QV-:r ,' 2i.'f'r1'xss1.12.f:5-Kr-.' iszzhlvrw'-'.4. ffif'b2F,1fwx- E 1 N1 if x 'K 'WW' 'f :3f5'f'evi4'fv2.'f,-z-lil? if Q H' , HW' 'bk 'Tim Qi 'rl A R, WSW? , wifi Bw Y 1 L x M Y' P, ff gf 'f My L S19 P94 1w,1a .r113Q V 45-7 ,Q u,,-ff: 'Ain-'w1:,.:mJbGqa: -fweyr ,Mi-1'-,gk ,:v,,.ZrU-mpeg gg1,j1:x'Qe,-' gg 'sf fy'-15 .331 ynsf V, :!'f51,f, V-Va. e1kV.f15'2v-YW: ' N f iiyz::5fz,',4f5w:Af'E,r:412133rfmgiiysmgify:-:f?:.i,ffmf'-5i4gg5z.:gfjifgulwzffcfzmfffy-ngfqggafis-Q'-15111mf' uv: dff5,zxY-1,1:fx-fffxfsg YR 'f 1' 'wa W 5 Q5 X 2 M if 'RAKY Ag if 'f' N 'wk A? V 2 fb ff I if 'ai' it ff it Qs 17' N ' f ' Y x 2415 f ? ' 1 V f 4 A MT X '53 W ,mwg 2,35 7ff?i,gf3?1Qfif.:?f1f:aqslyi- j ' ef Q 5 Y N QQ ' fix E5 U fx 'SHT' v M an Q-1-,545 1,9 gwvxl, :Q f L S Q? 1 NK w Y 1. , ,L n,f,,,wf,.,p wg ,WU-,f., ,.1,. f Q pl g ' A ,J 'X ' Af M Q , f 3 W J J fr' 'if P' SQ M3223 fb 1 -J -f Wfmff..-, 'Quin , fqfvipf i'fb3?',w.m,:fiLy f.b.':3b,f-JiM 1'3',.5pYL'2' L 44f'M1,'f5'ff' 59112 . 'M' gui igif k:'g,.,W: K L01 1719 wi: 1' 5' ' 3 i A 'Q 5 Sify-MfWf'-ff v '-A UQ. W,f,:.f'f'1f V y2:'1-Mmf:512c.,LJ2 5L?11f': h.wii5Q2'.f'e-if'fffwf-'lf-nr,--1:1F4154'af'Y-2 , ww f 9 7' -A V , ' i ef ' mv pf if ' 'PQ Q 1 1 - 4 icy, 2, k1,y,,,Qrw w.Jf.?m:6a2istwlfgfsy.-,AQ+.fya1As'wr-, Q-7S1':'4nfjIfgr.f4Q:' gf-exg-,f1yf1fes2 -an X Q, v P , . 1 Q A A 2 K ' 2 L -' -sf , 9 , V X M L VJ -Qty?1avngii?m2,?,gQg.1.zN. yggiw .N It 4 ,S Q, f A in 3 H Q Q K Lv. if MG A ggfiufgr , ML iw 6 I ' x 'mf'r1f.p:r'1322ii3:,f.i.r.i2i siff-,ffstfgikiim-:fi 47 1 S 5 f A w M f f 5 1 ' x H 2' W, ff M 5 U A 2 iii? f M H f1 2,?' xy 1 XXV 4 ' f X. ' M 4 .1 V , + Q f M f 4 1 U ' S N, imgzizAwwtwflgwjfyzwiihwwik 1 fa , V L 1 . 9 Y , LN , 4 2 V x rw K A r ff X P gi Q vig , ., ,f1'FN:f'1v2, Qu' Q mi-,Aw,L 2' mfg' ' 1,., A TH.: ,, ,. ,,, 321 ya 1w,,4.,f,wf,.., A'-rgftawf 1:93-.fli' 7 Q yfm,zf1: :f1Sf. .3w- -A fgmw W IQ gg , .. :,,,,f X ..W.w.r 'wfrww e 1,1 H,nf,fV.3ywf. , wx: 'Q Y Y. . . 1, .41 fa. 2 m:.va': wf A .' X. . , I ?.'ErF'if4?l?fkt5'WZ9w :fxggg.e?54gL-wwff ,..f f wfiwah' Y Ji? 1 1 f.'f1mf,f-'Q 35 Q- W V . my ' g4t'wwmgy!gg42g 344, 1 . xr, . A., f- MW,-.!kgfg,l:,:.f .wmsmfkga-Ltfaifa -,V. A , VV.. .mn mlm: if H Q, uszmfzv-in W ,x f -f.Ff2ff11ff ' L1 M :W ,fn M. Q, ., , Q gk . i'mFW,wf2:4 -.lm EMA R7 'M fi' VN 55235: Lf 2' :r:Q,,v-uw L, ..5qQw,,,, , ., vm ff,1.rL,.K-'M , ,if Q 1-13 FL , lc bl 5- fl? Jai -if .isyff P-yyiifx,-'-A-.ffm ff fi gf?fIif,gf X 'M , 55' . mga 1.'Fw'lsnqgxqiiggvz gum, 15-Lyn ,Q qgffdklif W-+1 sp..1:.fLqL:i,,'-1LfI.w,gxgfcv,w -1: , w-'fa-+m:',3'.' vias. we waz 1-1, vmwin J L: ima '11 fm -ricfwv ,f,.ma,a'4Q1,J5 my ,gg 524,-t ff Q ,, A A-.1-wwf XL ' 'ggi F 2?g3IH1I-1252532115 1 , j, 'vw-'j.-w:f.fAxfwg. ,egg 1U.,f-gflffxve, A513 - r 1 x .1 X Y We mf, 1 fayy , S i .M W. Sh? f,..,.W -':T'e Q54 59:f,y,,pQL,1'f:,.?g3gja.-:fly ,-1,5 -mf, N fm 1-'Q-.M YEEWRLZ' ,M L. ,., w,,,..w .,f,.4,QQQ,,,. ., .,-mi MW 'Seq mfg 41 15,-. we .,-,,A,,,g,,ef.ff',35z'3 .,i31fagmig ,A .UM Lf, -fn .U ,i V ' Lf.-,fu V .Q,,,Q,, Q 4 vw.. w 5 X4-,,J,,,,y ,-,Lf A 5ve15+f?f -?hmf:S4Q miguxiff SQQSSW- V7:.Q...5k:-pq-eiva fy Q -Yum gf- gm-150-fmsfff sf: 4 , ' 15? PQfwiffEEFQ-L'?Z5??1fqQi?iR1'fff V31 x' wfkfbf' V equi 5s'S,.mqW-,J..x .,y,,,,i,11i.m3 vx W fi W ,Q M-as -AVN. n .1 ,,, M .,'.,,. '59, X f F , .,,,,, ,1 , g,5,.QfL f X 4 vc ,gi V, 124:15-x.1 -fgfu 1- X :ZH rf ,gf.-..eyp1,,,.Q,,,- x 1. X A Aw- 'Mr 1 :3?fE?zQ: I?54.:Kim' 5-i,'2?3gj'1f ,,?L2 M fjifffsgw' 'f 'f' H v- '-'fp 'J v , . , ,,5Wm35?:v Mb. N,-A 24,51 .. , ,, , ,,f,l., LL,m...f, q,M.,55,,,,, X Q2-if1f,'f:fLgw:,:, my ' ,M xz. -um--.wtf ,.,.QJ-55:2 f, .M wwf H 4 'ifxeliwf if-P731-A ' ,..,,f., M L,,qrfmhg-.g,,1...q3.,4 WL.,.,zWi,,,.,L5L,gi,i. awk, 1.4.1,A,,..x ,K.h,.xffx,X3 , :4y1'u-f4-'ff- L y V qi. ,xv 3 gg, -'www 4 -3-bf5,,,.- .afw.f is-f.1fZ45'-C''2N2Tf':3rG xffsvxi wk , aimm,,fAf,,-,a,,we-. ,, 2.'f'Qz-uf-2M254'Wisvf ,, A . 6. 221-.-w:ag:-Xnyrg-1. pvvff 4i?4Q,gJ?1 wftgqggiz J MJQ3,-Q21-MF? , ,5'c QpwN,6!fiAy''1b,5,szQia Qfviwf-1.-Q ' y-fr W rfgL7 'lffT 'W :mx M: Maw. 'awe L :w,,1:.A H 1 :,i. f 414,11-,,f,-.,M,',w, mf lf qw mi 1?1'W5f1Kf1P 5?i'5f'x22Q'hifE'M97h34'5+-26125 'H5 53a'5-,'fvM'1?2 it fs' :U 'tx' if fwQi1E'Msi?5Qcw'v'1 . 2 L, Ml A'fw,w:',1'i5f-M ' 'W' 'w-.,e1y.-2 .61 ww..sfiffz5.i,f .f,A.,2f, 12:-, Wifff? i'5fsl:25Sil1s3ki9 yxiff? 1 :vw Nagy y M.w,f: .,1Q,,Y.'..,4,..L.,,,M, .Y.,,., , we QQ-wx www x -wa .VM ,.vb-. ,Q,. wi'Q31Agj:.5fg,.:gLfi,::,: f2'jf,f7 ff Q-QQIJSH M' WP fm'Q'-af-2-'?f'?.,i5,f, Xpifqw ' ,v -Qin -f1e n:,k4,,,.,,-,waz f :, jQ'3?i5fQ5f?SQ-'1:?3,2X53Qi2v wi- .1-,f..Mf.. ,em-wiv MLS,-.:Yf K 1 1 .,.gg:,u,, If ,gn f,','h'- wif , .S ,,.A ., .s ' 21231, fwfwl-N .pg-3, .1 R v.5,- -A455 . Q. f K, ,. .,3,M,.. my Mv9'w11?X Q X MM?fw 7 ? A A 1 M - S ai V , 5, ,.y fs. '-:-Q'-Y.-?.f'1+,,13','ww rrwfzamsk.-mf, wow- vw.- J 'Q-4,k,. g.. J, .JN -Q14fQ.gg3EgQyiflgg55g:5E,5j:g.wi! 51.45.g,w,g,g,,::?v:f'f.f,:.4i5Qm srg?3,wzig,5Q:w--ef:-X2HWgms'W 'W 'W nuff '.. Sa .W,,q, M , , M461 fff .swim ,H . f' any' 2- N ff3,azA,.g4 .J lsmf sgm i Q' ' - 5 'V 'N ' S 4 9 ' 1 L ' T' J '-nw' QI 'V 4 Hi 'Y ' .. V1 'f fy '. 'Y 'Jr ' L , ,'--'F f. :f1r3j.fx 3w'f3 -.I'1U'.sJ'1wJFS1'fL77:g4 Mr . ,, 4, 'vxkJ'L,'1 -Wdf.ffw,.f1,-fig-4Q,,Mf in-5-,pig fmq,Q,,,.q,?f,,gab,gifigy5.mgvflg3.05w,..,-mg-.L,fy-h,g:.,.,,,gf ff, ,tw-,g,,,, ,, ,,n,W:.iPW.n1 4g,.1,-M. 93-31?25f2:'lf K'i?2f'5?f3Ffl '?iQJ' i,ifE1JaRQfef-MPmf Ilrwlmfwfil viii gkff:-fwgswqqglggz ff-SGMKKQ ,a:v3,1xgtgQ1i1,., was,u,,55Qwfz.rev,E,1Ml7 v,mms3g:Wi:5,5g,Lgm+.zqx+.1wgyrqflfffbyW24f,xf,v,gg4,,Q,fm mpc? if iq- ,uv 1- , rw? bmp 1 grg,,y,,:,,bp'gfy 4-.My,,,,f qy'1q:4, fw,.4g,1--. -1,,'a..,.',w3g1 NQWM zxg.,f-wg QLEN1,11-anmy-fgg.-42 fpfwfr.:wQi5f,3,4':.'5T1f5.:vQ fM'3,eA Qr.fwfff w,,.r,:avfi.k'mQ f-ixifpfifx, Vnwglh-1,1qx1.:Lgvwwl,.y,, w,g,wMVQ.gQgi.5,fp K M .1 gm gm R 5w:vf63,5W'2'5Xf 1:fz5,f?wHv3fi1?Tmf2v:fe -3435zf9:Q,p'wfgw,.42 :31::4ZC.?22f2.M7f2+f11? Tffh A'-fzeiw Q11 ,., , ,J .,, . ,. ,, 4 bw. 1. , .WM ,,,,L.,.,w . ,w .. 11 ,J 5, W,1w,y, M msg. ,-an .q,,,51-.,,4.uf ,W F5 ,wg ,,u,,'1,, ,, JA ww , ,Q ,avi ,932 .,Qf.,,4.,,.. xMQu.' 65-.v'jfSfi5jL Q 25' ' gig 1,0.?,f, fig qhgyg 1 M V fvfii,-fff, x5fll15.4'.'-. 5 flu ,1.T,'3S.w'1K -14'f4-VET :i1Lf'Y1i 24'A3. 3' 'SWL' - .WL Jn, 9? Q-111 A V .AW W , g,,M,?WM f,,,w.g,, . .WM .TA-w1,7,W.nv.,,sga,w, +V .f,S,w.m3 XM M 1,-'mw5KMM,n,-J. Q, 2' 1-m .XA Hifi vRg,nw12FSfg-1'T'fi5'.ii,Qfv,E-51934fsv1M g+giriczqaggfqyufffm-S31malglmLigizgggimb-13!'wf'W,1:11-Et.l?f'fsHk-1,-zszL4:1?'iQx,5ifv-?-'EQ'-vw ,, .V , , s V. A ,M in ,ff 5-31 al' ffz' Mxfagff.-W .wa QW'-A ,nf ea'H',g-.554 T rf way, ,4.f,.fH,pvwf2,wffw1i-,y ,:w,:+w4g b3w?:r1,:FYwi1r,,,.vJfPf-if. wffm:,'nA3?:LgvwvFw-,-ffgf' wi: -mM?4,!1.fH' ,asrffiffffixkpiyzigqg'mv:Wf1X:fz.Q1fE3Z'wbiqZqWsvsfQ,i,wif? Ws,3w1 ffL-U9-Aylfsv Q35:-x J-M .-fM,ww.w, fn,f'vfm:':4 :q:A5'i'if Hfff 1' .ff -ww W V' ' W5 3 ' V M i '52 A W 'wftwfvixf abfifh Lv gym,LfpHf:fJ2,f1fnWyQQ3r:,ff?ig1ka5-,f f.x,'QA22.: Ci-sfgypzgiiv. ?gbZ9,a12iaQ12..- g-Qiywhglgaf -ychfpgskfk-Auf! kf3,':f1iwf5g2f 0 ,s.J'm 3.1'! - 1 ., 1 4 X-:W',.,n mu 9 A .-N, -' ., U fx 'J F F 4, W2f,iiG'e3i7'71'QT7f7 W' z-.!1'Qi2af.:'w-:QWg-fp,g,ff, .af .-2 ms -rf. w Mv':-uvfvggi-.gi,qn5 7-fm-'f:uQ,:,,'Arffra :ws '2w,f.ff,geZf:: L, 4s 1 x -Slay-1- yn: 2-31,5341 ,Je W nf?-i52F.fE'1qiEw5mfeQ54f,1.gigA51KMJ: J-Mfg, 1 4 ,ma mf ,W,'f:f.:,-r,:1,,aw.,g,Y ww -r, ,www . , V , V ,,.,.,, 9, ,'W,f4:fJ f,,,.gn,'1m-fflzgf,-w-f5Q.. ,wh f1'rsf,,..,Z1'+'fmx, 1 2- y-1mgaMT3z,5fi15,:agsglwf-'W' -g:..v:-:fm Wmxgk Ljfvqijsgzjqygglgjgig ff ww ,fxijm +. M ,i3f-lah V wfzwf,wwf4,:.+w-f,,f:w:'mmm, ,. . L.n..'f--we -,,,f,,,.,.,V H ., V Q .Q W1 WH' 'Q f Tggsm, aAj.15,75Llpdgfgy3wgfy,iw4:-Q-ffm-Vg ,-af :ff-fa: ,uv X f.- ac? ww 'C fy qgqgw N1 . 'E si-iwwfr?fff1f:i9r-'QSWFSHESLMFifi' .iw-x?f'fQ'55 ' 2ij'k'i'Q2fP1Zfg '?11if1+'9g3gs5fM.QQgQ2f V, wi f, 'W t 2Y!3yg ' f .,- if N 1 ,Www A yf--f - ww Q W. A . V, V 1: M , 9.32.-4 ,L .W 'W ,4 L - , LM , y,,.wy.4M.W ? ,,g,,.,1,,..e, ':1,f,,,. 14 ,fx q:,,.f. ,,'f.,,, , , 115.gif ,ff-ffgv fgfyfw :asv A-A, 41 ax . far Mg 5, 65333 Qgmfffzj ie W. 5?K'5,Ei'?5'33fi ' 1: Mu wid wwsnfvkz W fp ,341221411f-ufwizzfifxfggnwwi.: ei 2 Q QP? 11 -'75fff'?,ff iiiiiffy: Sjiflffggg 5 .rw Q mgA1,ffg+m ww gm -fyfrf nw J W sv, Aw-?1 f':'s-1 .' K, -, ew' Y., . ,. V - . V ,, ., . , Y . , ,, LHC'-7 fin' '!r':4'1i'vW' jx. '1 -J W- Y!f'9 SW9'5U inf WSH' 3 'l TW. Q 7' D! ' 'Zz 3-1 ' :'- Z 4 ' 4 v'ffiigiiigwey:S'f+51r,g3f2-fgtifif1:fikfeiigifmvv-if-55013ffgafgifgwaff , he f,Q5f i'nw- ,gm Q fa- -fw--4-. ' ' - f f ' A-' 385325. cxffihf 5 fyfifrwizfg .. it 5 ,rf -,hwgfig .Mft js fd:,Q4rf-5 32:-H E , .x . fr-:',.,g' - W wg,-,yn as 1w.?wQ9'li'f: A ' ,.zJw,,'fY8w few.,.if57:f5'5kf3?9ffQl5,: N, -AQ. :T ,Q V 1 T.. H . ,,,..f,,,.,f .w,.!M: M53 ,agp N, .pf Lf-fgxgxym? N ML, g3Ff5545,WfQ21Qq?q,4fWgfgif'fWf 5535213 wwf? f g I vi ,f Q E 5' r f. gg w r u m ff. Q ,M-rf --. Aa 'Q v 4.-'11 L. 1 0-I ,-. '-f f Frm-fi swag fsfmyf fgijfnyiifqf' Agia 53954535 iff Q . P I ,L , ,,W, , ,, k L I + Q, .1 W ' V ,ix , J'-5 Q :.5,xix,m1f J,m,1s,'34 fswpgfqggyd 5, ik 'Si , A ' 2, '9,,e,'?,-K.: 'W' J1,14?.Q VVS 5' 55 Q. ,,, 55' J ,fhQ.F'.Q?3,,.v,ii Riff n A. ff, ,f, , wJ-,f.1'Mwmf ,:X?sMff ak il 'S 5 Q. 1 .gy QQ, 14 - y l w N -, 1- -- , , 3' 1 A M V' uf- W ,ww '51-Q -. , 5 ?i?1f s MEW1 1 fig? ff k,:,gg,.fwf,,,wuww:4v?'I ?31S1e.:r-W vwixfkf-Wai My mrffmp, 124, ff . 1 gg . 1 W W ,N :ue 452 at V 1:- wah Ki-232, G23 gag, my ui, ljju ' f '1 1m3'6Kf.f f :T 1- ' . , ff , 1 12 giigfgywgffgbmj 155535 ggfzir 5 QV? ' -1 JZQ5' Q Ha x 2 Q We A 349 WW '51 Egg. new 1, I ,453 QW W S 1 .,ff'ff ,,f'f,1,'f gym 71514 f' . gig, 3553 WU., Y. 5 , W R .k J J: 41? f .M3As eigHlf X , J J ww Q N eg? E J ,- IIMQEQ gg V? limi M 1, Q, 45 Q 1-, af ga? 4 sf 'wwf 5 gg Miz J fvf X: -'R , f ' 2 H 'Q Q' MN f Q q .3Q,a,'f,,a3,a1w- G1 2-!.X,,'2kgdQ:,f2+.g ' 4' ' F' W M11 fl 1' , Q fi A, 5, ,Eg S9-an H , d 1 A 4 v H phfgffggfw gray-:q,1 fagn,maQfgv,txifgifpnwwnf 1555 fgY35:.:f,::fwf1S :ww gg-wg! 2 :WweX5,Que'f'h5?25gwgwffggf,g,-f!f'.g1ig3if:f-Q23-55 jg . jg ,, Kfff., ,-v2fC'm'.ws1,v'w1'w:MX-f Lair X QW' -mf' es' ff' we-,QA fa, fr. Els. ff I .-xl, a :.Qw,9fA,w,34 11 1.1 5Wr f2W ilfrffxfww-lwvfv-H me f .fwv Lmzmfdf-5,wf:1'f75H'Q Sqwfswh pgr!45.,nmvf -si'L.'Z'f'.r1'xxw,f? f',55ifQ37wW-19-55'wi :vzzvfe-4. QM ,Ls 1 vywg 1-gs, .L- f-ff' A 1 -- -'H -'Q,'fMQ3f2ih zgfg, r5s1Ni15f'1fw-, Mm, My .x.'-.f,-,',nJ4f'M.,-,. ,M-fawmff,w...fmT H4 :W y --,tw .zw-.la w- 1 -:vw ,-.JA wuz- xy- 1- 1. :ffm '1 H-Qvvgf 1.1 ww 1w?f3,'Y:eef1. mr --gf! W :iz,fpf'1f- :gk flawmyf:,f--'xmwwwqw-wx wfzzyi? ':mg,a?,az 1-ww-.1,'I.q'Qw-wif:..-gm,',.'f,9L-,wr .- fm f .Af A - Myan-Sy,5?fx,gQ,,fQ,1fgVx.g:f.4,QgffM,m,,,,-fffgmi Ur, WJ,yQ3',,.-Gkuuvmvgwiw- 51-Q-K ggi' ?.1,g,j5?.1M1s.- . 4,L:.x1::Xry,f.f 4, Af-vu Y, xg 1 s , ' 1 L X iiw:f!f5'55'2Y?k'lZ?'l1-Tuvafwvg - 3.34, Mig, 'F 5 ,QQ-H 5,1:f1Qf5',Q,11'f f !.f- ' ,ff 22 W ,, fewgf Q- . .4 1. fm. 1 -, 'l ,QP-. L ,, V f WW32'fftl1'-ifX:fi'f5'QJaf:iz5:?Mi253Ws?,f,s'faQ??4GX X 1,41 , ,..+,. ., ,1 MQ: ,:--Nm.-,xvgum.faa'mfp..awfmnwfl-H014 J 7, 1 9 . -. M11 ..,,M,!f:..Ngk.,',V, -4 1, x M -Q, 1- J fqfvxfzw .Myg'Z1sg:QqE':5w'1gffh,iEf'fig-4f.,a.M-4,5 -4f5q:f4?nPiL'fm!g4:,,,fvff, :F Va-wx fA.Lp,f..,.w,J,' 4flQ,55g,:,fp ,ygjfgty QW., 4- ,ww Q-.wal-11,5 ,-w1',v,s- L mggjgaqwpff-,,, W-+G, at-,U,..wf,..-Gm1,w,fqxQ1m..,N,'Q ,4,wwg,m.W,-w,yq,w w w.ff.,,wm.N1 f1,,2,2x,w,5. U ,. A fffmmQi5.M5W?i5e-.g,5yfBWQ:'ek:gwi 5ivEiew.fiQ,m5fgf1mZbj -253, 3.5 migwwhi j2Hf3Ef.lgi,f51s55jA 'M-,Q., wwf We '-wsuff Hia- 'ff -fi-ff '15 -Q4f,ifMzh z mmafg Q 1 . en.: gf-ww -wwvv wQ1wf,-1.gw.'i,- X ., Qgwx 5131951 lmyxlm. Mai Sag'-wm:ff-wqw a'ff'qLQ1aQQWWI'L,f,,g4:1f:fW-zfmgj f f ,E , Q 'WZEf'1F:57b1gg3ifi3f'9'iEnTl:2.'Y 'ws5'f'qlW ff?f3 4nTfQV'WWNZWQ5555 4'f7hIff?i5Fw'uff:E3Efv7K 1'Y1?f:2'U',Q:'371W'l2 asekiaftw-M15 If'fwilalifmfi+biff'Q'553555:ivfifflf5s2HvAi57llWv'fkif1a,'Ww?ww'Qwi fW.,,,.f5,,4 X -,3,WM.,h.y w wyffiw Q wi mf 5 V Auf, J my A fm- My 2 ., My my fx ,Aa W gvwfw, 95: 54,Mgm4Vyg,.X,g4:q.Wu,Q1WMM'4.3glg,g,,i,SmQI,,Q.f,i,iX,Q4xefH n3mfg5,,i,gQ,1,,4 wwfwa. ,Jn fb 521.392, 4 yxwv . ,f5W,1,,r aww. .Wg vhs 5333215 4, x,,.xzm,f,f,545p ,,.1,I'5-ay Mfg, X fl?fE, 4'-,L ,fihwa ,Q fx 2 'mv lei: .fa-Lf , :-...1,X,1.w ---7 ,X 12 .awk we VU ak W, w '- 11-:f ' 'nf mm 'Sf mftzfsiv wwf, ' 1 kv- ff: 'Mk ,HAL-f., ,fi W ' X9 1 M Y' Gs ' ga, din! W.. QA 3. 1 .. vw . N .. W V , ' 4, leflzb ' ivy-9 rf -, fwfffw 'ifgwi-,rafwflf fm xwff'.i'f-L Wwnff ' if -' 1 . H , W' - fm i I. wfbx-3 R'31AJWQSQP-ilk?Ffi5W4fi5g5Qffi'4,a1-3,uid?Hifi'u5ii'i5?'W55kif4fgEf?,ggg?iggggQfflfwEQ9N35gftA?i?Wilf'?3bfyw-E'?5QgZji5:5+5?gii.,f5,fr?Q7f:'mlimM2-FwJ'a5iwiwggvsgg01,3-ff'E4ig giN,..f:1!xi2+gg,4i Qf1K945Xs9,pg,e9q'fvfw,figwQ,Q'g'zgpgqykrg . N ' E' gf .. f- 43? -vm , EQ .Qi 1 f A 1' 'g'?i'x 'mm fa. X gg Q53 234' 2 f 1 45 ,sf , u.wu,gKfy53,gWM.,v wan, . .W u,m,,ZQj,1x,g., W MM Mm.ggiZg,M1n ,xfggqf W 3,5,i,'1,Qigv,g. L ,sk P,fUf,,f, 4 ,vwfsh ,M gi xi LQ, ,. fi ggi EW 4,M,f2j9f'5Xew ,EW h A f t , , . ,, , , Q ., ,, V . fi? sf'-2' fm-fwwkiffi Swv? V .swi,f,:f'wS?eiaQffsmU-A-- -.: Q-Wmiii-13555:-5Hk5L1f?f'?WiS3lff.f-v 'S'Wg3'E4f'WfQ5'f-,M'QYSWa'?5,,5L'X35l.fairi5'?1E5 'l5E27Q5?,?qIlQl29wl565iv71flFf,STS?:ffi-f,j,2f?fll12u.'45C M fffira.-,ikwd 1 ffm?-wa zvis2:z11vwnw1ax:,wf.:'Mc.zwsfam:w.2w:ax,w:ie-'tsu4f ..nrfmv1f zamzegme .zfmfwfi ,.VVV ,. ....V ,. VVVV , V,... .VVV S .. K , .V... . , - Q .V 1-L ,LLM 'i.,m.,,,r.m ,+.:,-f...m5,Z5M,ggW.. ,g,iliM,g,g3g 2 J., J, ,,,l v. -43 V :hw - gg:-Q i4fm ,! ,3' ggi f ' Q, 1 i M Q Si mix W M X 4 V Q , M .L f 5? :Sf Wswy M ,Q uf 2 gm wa+ . WL ' if Q45 25 w,w'- - 3 W1 , tg' Q7:w,5'2fJJj',?4'Y-W W A ' P11-rj if 3 gy z ,J fy 5 iw 4i2v3'f'f',fH.5 Sf '+V J. M 15 Q fe .- Q fait Qifiiwimi M.-A G' gif: M Wmxivgggfmfiggk Q 52 1' W' :ig xgs,a5,,,,, qw, V ,B,5f4?fj,f2g3QiQt5Q2gA5Ss, ffm , X235 ,553 W X 1? QQ ' WWE' . Lg .,-. , 3 if iffy 'V at 5 . fi P- N! ww V: 1 ' ' -1 ' ' M ' .L-1 M :U V - ! 'Fin 2-1 Q P,-4:.J'??J-V222 5?? 1fff-'V'-' 'V , ' 1 5 , .9 5 A ' - ' fw f' 1 -wr ma .r'i '-wi' 'YC if- '-if W -V ' fi' A L ' V -, . S, Jw uw 1 -Hai 591'.f:' vb I' ,. mf. Va My if-.iff f'9f?'fJ N'5 L 1-QPSK' ,L 9 - 1 2 'M'lf 15,19P W,- 'Jim'-42 ' ,. 4.WA7 4'-'Q ' f ' 4+ ff ' '. i.. .. 4 'wh 'f f ' .fav 7-- Ji -'NL' ' I - ZA15 , fl A - . 'H- an mswfef , L e ifff,f4:.2wS:-2.12:-',ff1T?w: 1-J -151 mg. v .11 ,JM Q' ,wma iw 5 at Q R 4, ffff w.f1,,Q,a-v, y, fl fm, af.fgvW,,a.,Mffk1a,Q,,,3e'5 WWW,!,1,.,,.X,,,.,f1,m.um1b.,, ,,vMg,.m,,,.,f,,m ....g.fx,W,k, ,.,i,.QNs.,,, ,M mf M, QQ V w x V ,Rf ,. V V W H, .-. , -it 2-N, 'fw,f','1S1'f:'u-M'-. w7.'4 1,f1n? 5 :T-self: mfr 1 wv'?im-f.:f'f, H:-M.H,,1f,A1f-2: ffxff-f? iv. 21.32 ff X11-ur Ymlfm-I-1+ i'2,M ', ,men 5 Rafi wiki 4 r , '- ' 1 ' - ' Q H 'a ' + rnSMQEQK1ffF15x?ei'i?13iiiQAHeeLtfixfizvskkfiuzfwir15:1 'ciffiifif:lxi.M511?m:wQfi'Iw:zJrsL,.,'aw1ffSii.f5qvwi-lfHQ.,?:-aaviffxe?m:?f1s22l!rxs 1?4mrPs..5Em -. ff : M mst ih5QafQe?ZQ?5f1fmf5?f5?2EKfi5'wr . . M1 1-W ,.,v, :,.w'.fW.r1 52W 'H.fw,k1if3f, xf,w.1f, vw ww - ex hwggRf1A:iffgxfsM121gQ Q,-wf -3-at-fir: f-S n i,f'eij'fiV1-1?fXQl:fif4'3 'fiieifhpr 951, 1 , ,K . HW'ffI'fEWFil5Wl 'Al LY? 'ifjfi-5:1547 W P327 'Y'i2f??XYA '?f ffffvf' 'T' NX ' 5 ' 945, xg? .k:.4ixi-W1-5,53 w:A,wZQ, w,w,,cw.W, 4tf,.,a9,x,wf. , ,,5Npf,-rms euwi!4,1-ymmz'muA-ff g3fw??',Q -qt-my-,f4XQt, 6Q'r2,,,-.W-yy,-il-fx, ,im AQQAJE Qw,4gM.,. Nw 5 beg, , x Q A R ,1,g,,4-my W 335 9, gfkg-' A , . fl e' J. gg' if -fi ,,,l1g?q,-Q',i3.1f!ikLS5liQff,,WE7w.a?E..'?41'?' ay 'gif wY62l?'4'G' '. .fm 9 544134. ,xii-231 -gfg3Ef5sgg,gxm5Qm9gs, v:., y1.fff-S13-Q92 xigiwwg 4. v',mAvQ'gf5gw'5Mi261:vgi5'M2QX:a'1+:yQi'f,rit-352346iQua?m3y'1Jr-5gM5:L5yf'?'3w2aQ25543'5f,? 3?f?1mgYggq,US,?ii,1Qb ,, f :- , Aga I Y' '1 fs.. x I Y 4 iff Ji7 ,'?, --L- 'fi??1Xf '?. fizffvf, fm lxia' V 311'-wav 1 ' 1 , 4 1 23f r. -I 1,5 , ,if ,, .N , .K ,. ,, , mgM5.!.:wf3, 'H f. 35. ,535g-k,xj:,w::g3jg'-'z- fe rl-'igffwx 433- way Zu, 1 ,, Q L, Il, hw V k 'V jk A V 5 ri f., izrygwz -.'- :f.Q-1' -' ' -' ' f- ' U f ' ' ' '- ' W Ki' 'Q' mv Bah 4 Q SE' ff 'g' Q A Y 353 fx a. Q 'W' r 1 v Q' . ?v 5 -, , y - M .yr . . mg.. ,f A fa, 515,-:' -iw ifwg- 1 mfgfe' '14 Egg: Yigftiu QQFWM HQ fd, ,' mf: IIN f ? ,11l'1iF in J 1 f , yjxysiqcqii ' vu WW' f A, q 4. ,Q nd A Www: x ..-f up ., V ..vf., ..-,Q .V M 1 , w-- --.5 km , fy N A M SL wxfzff mmf WW, i Q ,f K f. W in V iwwf Mwggjw ff' 'i'HC'v?X 1, .vm .aysfi WQmv'3,1 W f. LM 3 mx ,wif A H ev, wife. J iw: K f 51.4 vvwnuzf :MW 'va-M?f3'iK fyw',.1rHn11x',fA T 1f2p2mgm5'f .LQ -ev-fWf.,M, uifwilfl'-W 1 Q1,,cflTw?: 12, M- gy ffmwp- ,W -1 li- ' +V 4 'waz 51 ww- fffziw Fi was fm: jfsifif sh :fm 3AgiQff1??Mfffwgf'Wiz ff: 5 ' z,qmL,j5ffi-5qf,.,s,',47fue-mlresmaxaziiggyfi.?g,5s.:' SU! gz.,g,5j,g1,,p F- vfizwi. H 137. N- +2 mf? i7 ,5,,'?1,Q4lQix- 'LH:.Zf,mfAL4fbgfliv Wig? gb., ,iam , L ,K 5 ,f 'Q-EQLAQM N. -- j x nl rw- my Jwlcfm'-4: w 'f .A'f1w:4:-X'-' 'P' -.ww-S 'Mun -- Us ,.12w.ww,f Q V-an ., -F fp f, : 'flak .pw :,'-'mm-.f-Q1 YU mu- iw, f?4..fw PM ' J ,A f' 'Lf N sg ,R Y ,w -'M QU ' 1 ' ' vf ' . 'ff- fg , X g W fCg5,,fy,r,5tQw gsrgmfjwgwgqkl. f,cgj122g,?g,KN,3,..,..m QW ygigigliwffsf , sf , S 3 v W N W r . ,Sy UW vvgxg fyffmwffvi V1m7w1,vvAL,i F51nt+,f3,.P Hu 4 ,Y q,d1,f,,1fgfkw!s1xf3f?gi Q W ,ma A 4 M aw Wwe., if 1Vv,q' k ?fk'1m.xH M g 'fmfw iw w ,wwf , ww Mw'MH'- - gf 4. ,, gh f N ,, ,Q .G W. M M, ,.xy,fi Ap,,f f ,wif , ..,,v .V,. uf ,, 15, .,,, , , . . V , , N -' .-Q' -, i :ay Q-Law fNffiiWYw.if any 2,: fzqv ff1-L:?,KZffyf',:.-,J--f 'w'!.-':X.'H6gi'-sr-xw,igx31CYX f iw! 'f4.'wqf.4Tf'HQ ' ,gf-3 3,1 M, M5-g,l1 wg mis-'Mv', W' V , 1' we 9. , ,V - -L A -', :Www ', ,, 1' F f, ' '-- ' gm ' W' -em 1 Q ., sf-A ff 'H J' JN'-4' .iw-Jw,,:H'iu, 'had 'WA 2- 5 ,?:'. '1l,fyclwi ,zu 'wi vg 'fif'-iv L .'L 15f'v-'- 'Q 9. 'A -'W L ' f if ' H51 ., 4 if .Jw new f 3' 1: .,11k1,g,x5,,.KX, V,,,.fqQQ?,.Jgq ,,A.QSf,,L5ffg.,pgf?3wisQwXW??g,115g,.g1,,Qj,QQ,1,qge,. Z5g2yggf,,Q,,,Xl9?v!, gem,ag,,f,.1:X.93,355.Yn3t5fki.ei?m,s5,i.3,lg14Q.'.3332-334Hgiwiiqlmf-,g,? .i12545,5s,1xiigq ,:gKL3,s.,v,v,,?f?5ffeiS,',. 5, 21. , 5, -, , , U, . .1693 +R'f.! W ' 5 A 'M 1 a P' xx W ae i v 1 gg- Rik., ggi , 4:6255 F rim . -V -,wwfvw ,W ,. .ww . , ,www f- ,f ,Y N.,-, M A 1 ,QM Wig! ' ' mvQP?vwfwsfkvaiwlw, f wfV'4'f1fL ,Q .'2-miffyw G A ,1w. fh ' ' Q. A 7 -A li Q, , ggi awemvf .m'4.:'sM1QfwfiSafrwf1g,21a.,9?.s,f. SW '- .W Q Q-, 1, fy. Yr ,, w,W,+ ,.,7. .Iv Ffa. .-5 sri :Mg agwli, 55,gfk,,, .1 , im jvrfqfilff Rh?3,RZ614f,19-',2f?rQ,ZE7Lj5?:xEiig2,lfygfwxe. ,?if,EgEQ,f,f,,9L5Aiff,w Qgwvgl, fan. .J ,.,Q,3wx A.. 4,,,z3gg3,a+553i.m2rS,fSg5,g? , 15,433 wig, --x fi Q V 'F Kms lv n R 1. , ,uf Az m1T,,1,,.x ww wg af ffww' 'J ,JN w HEX wud M51 lf' , qw 6519 Q, r ,,Q2.fmg. A N - A QWAAWAU f? 3- 1H,.f',v 1 X ,X Nw WW: 1 Iwi 1 In YW ,gk , 13 Q 1' ,f QF ,fm .2i,,,,i5 s, 'Ii IVBL 3 EQ 'Y wv5,1+Sf15'v4212WEa MN,-.,a,. a,Nxg,,,w,fS'E+'wL'1, 41. M ,. I 7 ' X 1 b Y , , ,, ,s?.,TEf.f. .-- Jf ,ffm gk ' J '?i?f,M's'2 ,ad 1133? Q 'E 'WM WT' 5 M Avgggx QL 133 J-rf If-n Q gaining 'wwf m if sl 1 W' LEG' f N ,aan , ,ri ,,gYY--mf mu. L..' L Q. 'if-f 11 2, ffwirzf fr 22:5 2ffi,f',z?sfLf. wwf J 2 Q ' ? '1 M2 f, 'ii.'5Zf?'fs ik? f , -Li? .Q F f?72'- aw I ',.- -1' X fl 2. iggffaigf 1-'if-' 2 , my ,Y 2? - 'brought from ravenous, brought to acquiescence, g neither or both. we saw the prophet flee but did not implore him to stop. it is kinda funny, huh, how we got this honor for doing hardly anything? i would say we did something, but we let something else more important slip through our hands! it's cool. no . . . i wanted to do more . . . to become whole, you might say, to learn all of it. that would be aImost-no- impossible. ' think so? would it be worth it? why, yes. ll 'Coach' epi Completing his ninth year as varsity football coach, named 1970 Teacher of the Year, and selected as a teacher advisor for the Student-Faculty Coor- dinating Committee is Mr. J.C. Gotcher, honored by Salute 1971. Fondly called Coach by the varsity football team, he acted as their head coach, he also supervised the activities of the baseball team in the spring. During basketball season Mr. Gotcher assisted as scorekeeper for all the home games. In addition to his coaching activities, Mr. Gotcher instructs government classes, ca course in modern problems and spon- sors the senior class. Along with the extra hours spent after school on the coaching field, Mr. Gotcher dedicates his evenings to the combining of students and faculty ideas for school improvements by being a member of the co-ordinating committee. Recognized by the faculty as an out- standing instructor, Mr. Gotcher was voted Teacher of the Year. Because of his unmatched support for all aspects of Trooper activity, Salute 1971 is proudly dedicated to Mr. Joel C. Gotcher. tomizes Trooper spirit 3' Taking an active part in the Student-Faculty Coordinating Committee is Mr. J.C. Gotcher. ln addition to his regular government classes, Mr. Gotcher instructs the modern problems course 28 it Q5 is fs 1 .,., Q. , M Y 2 if lm- , is iififivw , u man of enthusiasm and unmatched support for Troop activities, Salute honors Mr. J.C. Gotcher. Marking out the offensive strategy, Coach Gotcher gives instructions for the next running attack. HONORS 29 1 'M WV. julie Francis named Miss Blue and Gold Selected by the faculty as Miss Blue and Gold is Julie Francis. This is the highest honor attainable by a senior girl. The selection is made on the basis of the character, service, and leader- ship of the student. Julie is co-editor-in-chief of Sabre, and is a member of Quill and Scroll, an honor society for iournalists. She was also selected as Who's Who in journal- ism. She serves as president of the National Honor Society, and is a first lieutenant in the ROTC Sponsors Corps. Winning numerous trophies in tour- nament competition, Julie played on the varsity tennis team for three years. She is also a member of student council, Blue Jackets, Copiae Auriae, and the Spanish National Honor Society. Julie is one of the top ten in her class. Finishing the next edition of Sabre Bill Beard Julie Francis, co-editor of Sabre, studies a publication put out by another school. Julie was also chosen Who's Who in iournalism. N5 2. .mi ,qw mime , ill, ,f3?ifBfW' A Wu 1 A ' Mi? -Y .si Bill Beard named Mr. Blue and Gold Bill Beard was chosen Mr. Blue and Gold and Quill and Scroll. through a secret ballot by the teachers. Selected to represent Eastwood at The Clwerd, UnI10UnCeCl at The annual the Presidential Classroom for Young Salute presentation, is the highest a sen- Americqngl Beard 1,-qyeled fo Washing. '- B ior boy may achieve at Eastwood. ton, DC, where he attended seminars on ' Beard is editor-in-chief of Reveille, and the Senate, the House of Representatives serves as associate editor of Sabre. and other facets of the government. He holds the office of president of Key Beard was recipient of the Soropti- Club, and is active as a member of the mist youth award, and was selected nd Julie Francis work af the print shop, National Honor Society, student council, Who's Who in speech. Displaying the 'Homecoming spirit, Mr. Blue and Gold Bill Beard helps Mrs. Mary Dennis sort and prepare the mums which have become a Homecoming tradition. him I S., Personality proves edge for 'mosts' Perennial smiles and radiating per- sonalities brought the honor of most popular to seniors Valerie Phillips and Pat Henderson. Being conferred the title of most popular is one of the highest honors two seniors can receive from the student body. Valerie is a varsity cheerleader and was honored this year as Home- coming duchess. She is vice-president of the student council ond is a member of National Honor Society. Henderson plays the positions of half- back and kicker on the varsity football team. He was elected most handsome and is co-sports editor of Salute. ww-sf of L rl 3' 51.3 Valerie Phillips and Pat Henderson, chosen as most popular, monkey around during their lunch hour Pot Henderson sweeps the left side of the line en route to a touchdown against Irvin. 32 Valerie Phillips' fresh enthusiasm spreads through- out the crowd during a Trooper game. Z Excelling students gain recognition sbwiiat se? was 5 Q W K? JFK t.t-3 X it x M ,QL ve 67? TQ Selected on the basis of outstanding vocal talent dall Larson. 'ln addition to being chosen as RON Lange, Paul Polk, -l9Yl'Y Griffin, and VON were members of all-city choir. Vocalists are, members of all-city choir were all-region selec- Watson. Concluding the list is Judy Cruce FIRST ROW: Evelyn Tiffany, John Edmonson, Andie tions. These vocalists include, SECOND ROW: selecfed for all-City, all.,-egion, and qIl.59qte choir, Richardson, Chuck Forbes, Jane Laman, and Ken- l T i 3 f s i a E 5 ,251 KM' The Presidential Classroom for Young Americans provided Bill Beard, Debbie Cage, and Mike Woods with an unequaled opportunity to experience democracy in our government by watching it in action. Boasting students of outstanding qual- ities, Eastwood has a grand number of honors of which to brag. Within the scope of school activities, students have proven themselves by excelling in many scholastic endeavors. Extra curricular work helps students to develop their special talents. Judging from the achievements received through- out the year, many varied student activities are recognized. Besides the recognition of scholastic achievements, athletes are also recog- nized for their ability. Colleges acknowl- edge these students as scholarships are granted to those excelling in these fields. HONORS 33 Citizen hip emphasized as students gain honors Qualifying as semi-finalists in the National Merit Scholarship Program are David Atkinson, Rueben Casarez, and Klaus Engelhardt. They were among the highest scorers in Texas. Honored by his selection to all-state orchestra is Greg Shaffer. Bill Beard was selected as the outstand- ing Soroptimist student in the city and John Edmonson attended Boy's State in Austin. 34 E 5 5 Q I as Voted by the faculty as teachers of the year are fi 2 gi s 1- is 5, ii if Q. 9 2 Q Q Selected for outstanding citizenship, Martha Thoreson received the DAR citizenship award. 1m5l'!'l'..f't 5-li 'ai R if Mrs. Elizabeth Dow, Latin instructor, and Mr. Joel C. Gotcher, government teacher and coach. E . E 3 Q ' 5 i I Selected as top iunior students by the Civitan Club of El Paso are, BOTTOM ROW: Carmen Medina, Jenny Picken, Debbee Vasey. TOP ROW: Bob Black, Kenneth Ramsey, Paul Polk, and Rita Chavez. laurie Wilcox, Marlene Richter, and Klaus Engel- hardt exhibit the creativity that enabled them to win various literary contests. Laurie took top honors in the Voice of Democracy contest, Marlene won first place with her essay on Sick America while Engelhardt's poem Isolation won the competition in the Fall Festival of Poetry. Devoting their time after school and on weekends, Troopers maintain their enthusiasm for activity. Many El Paso civic organizations take an active interest in students by offering nu- merous awards for outstanding cit- izenship and service. Concerning themselves with govern- ment and political activities, these honored students fulfill their role as citizens in the community. HONORS as Journalism Who's Who recipients are Anne Markeson, Lance Murray, and Julie Francis. Departments choose Who's Who Departmental Who's Who recipients are chosen each year for their out- standing achievements in a particular field of educational development. Students who receive this honor must first maintain a superior grade aver- age. Not only must they have a high grade average for one year, but throughout their high school career. Chosen by the department chairmen, these students have exhibited that they have a special aptitude in the respective subiects. The next qualification for this honor is that each student should concentrate on that subject to a greater degree than that of a regular student. These students show an extra interest and ability in the chosen fields. To be chosen as Who's Who means that the recipient is the best in that subject. 36 ,A gn .. , gifs it iiigigsfww fix: se iris Exemplifing the ideals of the superior music student are Who's Who recipients Bob Banner, vocal music Mike Woods, instrumental music, and Mark Crocker, vocal music. X Outstanding students in the fields of foreign languages chosen as Who's Who are Mike Woods, Germany Kathy Donovan, Latin, Gabrielle Voelcker, French, and Bobby Olivares, Spanish. Standing at attention are ROTC Who's Who John Daws, and Sponsors Who's Who Carmen Alvidrez. Who's Who are Lesley Penley, commercialg Peggy Chavez, VOEp Sally Moore, homemakingp and Sherri Mitchell, library. HONORS 37 2 1' Every field of study is represented by a Who's Who. From mathematics and English to gymnastics and physical edu- cationp each has an outstanding student. The outstanding mathematician must have an analytical mind, while the suc- cessful students in the athletic fields have a well-toned body as well as mind. The outstanding student of English has obtained a knowledge of that subject greater than the average student. To be named Who's Who in any particular subject exemplifies that these students have strived in the past and will strive in the future to do excellence in that particular field. 'IF as Also named Who's Who arep SEATED: Kim Blomerth, modern dance: Elba Gonzales, gymnastics. STAND- ING: Karen Thoreson, tennisp and Barbara Caraway, art. ,we N55 lc d B'll B ard s eechp and Martha Thoreson, English. Who's Who in the literary fields are Klaus Engelhardt, Englishp Terry Shambroo , ramap 1 e , p 38 Also chosen for the honor of Who's Who are Teresa Anderson, Trooperehesp Tracy Lund, Pom Pon Girls, Pat Kennedy, girls PE, and Jeff Bale, boys P.E. Top students work to ard goal Also on the lisi of Who's Who are Carr Sfrong, physical science, Klaus Engelhardf, mafh, Martha Thoresan, life science, and Lance Murray, social sludies. HONORS 39 WW' T Leadership, scholarship, service, and character are the mottos of the Con- stance Hulbert Chapter of the National Honor Society as the group exemplified the ideals for membership in NHS. yignwwc' .aww Highlighting the year for the society was the induction ceremony held in February. The theme for the program was The Brotherhood of Man as forty- three outstanding juniors and seniors were inducted into the society. Excitement and suspense prevailed as old members went out into the audience and tapped the students selected for membership. Special guest at the induc- tion was Mrs. Constance whom the chapter was named. Hulbert for Other activities for NHS included the traditional Homecoming tea in the library for the exes. National Honor Society was also in charge of putting out The Garrison, the student ciirectoryz Mrs. Bonnie Lesley and Mrs. Paula Turner are the sponsors of the Na- tional Honor Society. Members of Senior National Honor Society, as they prepare for the Homecoming tea, include, BOTTOM ROW: Mrs. Bonnie Lesley, Robert Eggemeyer, Tom Lyons, John Edmonson, Carmen Alvidrez, Valerie Phillips, Martha Thoreson, Klaus Engelhardt, Rueben Casarez, Bill Beard, Bob Bean, and Mrs. Paula Turner. TOP ROW: Debbie Hurd, Debby Yarborough, Teresa Anderson, Anne Markeson, Robbie Farley, Barbara Piram, and Julie Francis. Not shown are Joy Stallings, Mike Woods, and Janet Persons. 'Brotherhood' stressed as th me in society induction ceremonies New inductees include, BOTTOM ROW: Paul Carver, Fran Kolster, Susan Price, Carolyn Moody, McAninch, Jack Daseler, Ken Ramsey, Carr Strong, Polk, Becky Anagnostou, Cecilia Sanchez, Paula Carmen Medina, Diane Autrey, Evelyn Tiffany, John Daws, Keith Russell, Chris Gorman, Jim Aydelotte, Lisa Wallen, Robbie Venable, Beth Carla Thomas, Jennifer Ruth, Marlene Richter. Guthrie, Felix Loya, Von Watson. Not shown are: Gallagher, Mary Powers, Mark Crocker SEC- TOP ROW: Anna Mae Tarwater, Barbara Bleakley, John Cullers, John Hendley, Paul Ferguson, Tom OND ROW: Hope Huizar, Kim Blomerth, Judy Mary Zizik, Allen Gamble, Michele Mason, Pam Luebke, Louise Loiselle, Mike McGinnis. 40 Mr. John Prestwood receives a gift of appreciation from NHS as Mrs. Bonnie Lesley approves. Jennifer Ruth receives her candle from Teresa Anderson, symbolizing induction into NHS. Jubilantly, Bill Beard congratulates Carmen Medina after tapping her for membership in the society. HONORS 41 ational lunior Honor Society Now in its second year, National Junior Honor Society has established itself as the largest honorary society at East- wood. NJHS began the year's activities at the Halloween Carnival with their traditional hot cider and doughnut sale. Under the sponsorship of Mrs. Jo Sue Matthews and Mrs. Ruby Jo Sherwood, members of NJHS surrender much of their free time in order to participate in service proiects for the school and community. National Junior Honor Society is composed of freshman and sophomore students of outstanding character who excel scholastically. Officers of National Junior Honor Society for the 1970-7'l school year are: Steve Hanson, president, Robert Barnes, vice president, Mary Bom- bard, secretary-treasurer. Sponsor of NJHS Mrs. Jo Matthews speaks to mem- bers of the organization about a future proiect. Members of National Junior Honor Society are: BOTTOM ROW: G. McCarthy, H. Samuels, J. Bean, D. Robb, L. Price, W. Soza, G. Smyth J. Tiffany, J. Hendrickson. SECOND ROW: El Thomas, C. Hill, C. Tinaiera, T. Hunt, D. Kelly, R. Johnson, S. Warren, J. True, E. Loiselle, T. 42 Baldwin, K. Merrell, K. Dorris, R. Malphurs. THIRD ROW: C. Stevens, L. Wright, M. Harwood N. william., w. white, s. smlweu, o. wenaef T. Atkins, T. Sheehan, S. Thrasher, A. Larson, S. West, G. Voelcker, C. Barnes, P. Hughes, L. Kilstrom. TOP ROW: R. Barnes, K. Nelson, D. Barron, S. Hanson, S. Severs, G. Miller, P. Voorheis, B. Donahue, T. Davis, D. Waye, M. Durr, J. Sanchez, J. Segapeli, R. Scoggin, B. Villarreal, W. Kettenring, S. Hurd, J. Hass, J. Dzubinski mducts outstanding underclassmen Members of NJHS are, BOTTOM ROW: M. Gilger, J. Bohanon, D. McBride, J. Kistenmacher. SEC- OND ROW: A. Bailey, A. Matthews, N. Teran L. Alvarado, L. Pleasants, A. Hendley, S. Snider: M. Catt, J. Cowart, G. Johnson, J. Wolf, S Rhymes, A. Martinez, S. Pfoutz, D. Mueller, D. Haynes. THIRD ROW: A. Cochran, K. Paxson K. Kistenmacher, L. Hawkes, L. Faxon, K. Halle, P. Kurns, T. Davis, B. Wright, L. Bain, R. Zamora, M. Oaxaca, E. Bartlett, C. Nichols, K. Smith. FOURTH ROW: D. Bruce, S. Fiend, S. McDonald, L. Badillo, K. Tucker, K. Holt, M. VanCleave, M. Bombard, B. Cram, L. Fleischman, N. Lynch, D. Uroda, T. Sanderson, J. Olson, D. Smith, S. Collier, S. Badillo, M. O'Beirne, D. Lane. TOP ROW: Mrs. Ruby Sherwood, A. Kusserow, S. Strickland, B. Canavan, A. Hosley, M. Sherlin K. Thoreson, W. Lanclsheft, O. Barcena, R Stevens, D. Ziemski, J. Williams, R. Bruce, J McClain, K. Pickett. K. Cook, J. Thompson, K Bentley, S. Lyons, V. Wallen, D. Lamothe, S. Meister, K. Rathbun, C. Clark, Mrs. Jo Matthews. Mike Durr and Elaine Loiselle confer with NJHS secretary, Mary Bombard, about a new proiect. HONORS 43 5 . wk ,uf Members of the Spanish National Honor Society include: louis Barragan, first vice president, Mrs. Linda Davenport, sponsor, Martha Loya, James Kilgore, Martha Chavarria, Barbara SN HS sees high school in Mexico Taking advantage of the opportunity to see how the schools in Mexico function, the Spanish National Honor Society was invited by the Juarez Preparatoria to view the activities of a regular school day. SNHS, in turn, invited the stu- dents of the Preparatoria to take part in one of our school days. Spanish National Honor, after a fall induction, took their annual field trip to the Juarez marketplace. There they examined, bargained for, and bought many of the curios on display. La Amistad Chapter of the Spanish National Honor Society also included the bullfights ancl a charriada, or a Mexican rodeo, on their agenda. High- lighting the year, they held a dinner at La Posta in Mesilla Park. 44 2 l l Bleakey, Debbie Clemmons, Andy Guerra, Club Council representative, Julie Francis, Diane Autrey, Keith Russell, secretary-treasurer, Mary Skerkowski, Ana Mae Tarwater, Barbara Towns, Debbie Cage, second vice president, Carla Thomas, Bobby Olivares, president, Belinda Gafford, Valerie Phillips, Debby Yarborough, and Ed Downs. if uv Sponsor Mrs. Linda Davenport and member of the Spanish National Honor Society Debbie Cage watch president Bobby Olivares award Louis Barragan a certificate of membership. Quill and Scroll honors writers x 2 1 Quill and Scroll, an international hon- orary society for high school journal- ists, held two inductions this year. To be eligible for membership in Quill and Scroll, a student must be either a junior or a senior, in the upper third of his class, and must have done superior work in some phase of iournal- ism or school publications work. Members were inspired by the na- tional Quill and Scroll magazine to enter numerous literary contests and the current events contest. Such con- tests provide opportunities for scholar- ships and cash prizes. Officers for the 1970-71 school year are: Ralph King, president, Anne Marke- son, vice president, Ann Savino, secre- tary, and Lance Murray, treasurer. Sponsoring this international honor society are Mrs. Daisy Meacham and Mrs. Bonnie Lesley. Ann Savino assists Gail Harris with her Quill and Scroll pin during the winter induction. Qvill and Scroll membefi Off!! FIRST ROW1 Shahan, and Louise Loiselle. STANDING: Bever- Lance Murray, Bill Beard, Rick Lopez. SEATED: lee Bruce, Leslie Penley, Rita Chavez, Charmaine Denny Cunningham, Dennece Knight, Ralph King, Chavez, Janet Persons, Debbie Hurd, Linda Bat- Larry Hicks, Cathy Gouch, Julie Francis, Kim tle, Debra Bean, Debbie BUldWif1, Jennifer RUTH, Laura Fairbanks, Brenda Bolton, Maralee Gelder- loos, Kathy Masters, Sheila Rogers, Norbert Barcena, Candy Richter, Bob Black, Tweedy Steed, Ann Savino, and Anne Markeson. HONORS 45 Members of the National Thespians Honor Society ROW: Nancy Draper, Alicia Pier, Vicki Walls, Wm. President Louis Barragan discusses some club news with secretary Nancy Draper. Thespians re for 'l97'l are, BOTTOM ROW: Diane Hooke, Mark Tanchester, Liz Snider, Lisa Scheffler, Stephanie Harmon, Terry Baldwin, Debbie Baldwin. SECOND ach out for goals in dramatic art Preparing for a future in the dramatic arts, members of the National Thespians Honor Society strive towards accomplish- ing theatrical goals in high school. Thespians work in -speech and drama classes to achieve enough points to become a member of the Thespians. Throughout the school year, Thespians sponsor several plays and contests. Teahouse of the August Moon was presented in the early tall. lt was student-directed by Terry Shambrook. The senior play, held every year, is also sponsored by the Thespians. ln the spring, Thespians look forward to the one act play contest in which they have won many honors. 46 Gabriele Voelcker, Kim Smith, Terry Shambrook. TOP ROW: Keith Moser, Joe Spence, Robbie Farley, Tom Davis, Allan Johnson, Paul Polk. Newly elected club council representative, Terry Shambrook, smiles with appreciation as she accepts her position. TELEPHO Junior Optimists are Carmen Medina and Bob Black, sophomores, Mary Bombard and Kirk Nelson. Exhibiting leadership through community services and acquiring outstanding aca- demic achievement are characteristics of the 1971 Optimists students. Eight stu- dents are selected by faculty ballot, two from each classification, according to their outstanding achievements. Chosen from the freshmen class for the 1971 Optimist awards are Jack Lemmon and Debbie Uroda. Optimists chosen for achievement, service Seniors Susan Price and Bill Beard were chosen for their class. Susan is active in EFL and has won several informative speaking and debate awards. She is also a member of Brush and Palette and Der Deutsche Verreins. Beard . is associate editor of Sabre and a member of Salute staff. Participating in speech events, Beard has also won sev- eral trophies and is active in student council and the student coordinating X Q committee. Beard also serves as Reveille editor and president of Key Club. Juniors chosen are Carmen Medina and Bob Black. Carmen has achieved honors in speech and is in EFL. She is also a member of NJHS and Der Deutsche Verreins. Black is active in ELA, EFL, track, and the Chess Club. He is also sports editor of Sabre and a member of NJHS. Mary Bombard and Kirk Nelson are sophomore selections. Mary's activities include the Gymnastics Club, NJHS, club council, and Entre Nous. Nelson is on the B-team football and track teams, and in NJHS, Debbie Uroda and .lack Lemmon represent the freshmen class. Debbie is in the band and NJHS. Lemmon is also in the band and NJHS, and plays freshmen football. Senior Optimist students, Bill Beard and Susan Price, work on an interview for the paper. HONORS 47 YIM 1 f L, fH TT7':?TfT'?f '1,. m'ff'w.. r-fave:-vp f, : x'S'M1Y'ZT1', ffwrf- , -7. 4 V? 1 . W J, . , A V 1.655 F f4a,Jhfmg-v1 2 f 2liS- L-351'is--':e'f?1'f'w-tifffainqK.f.,:Mf1iw'-f-3'Y' 'haw ' W 'Y 'Sv u1vmv'1 A-gfgzkg, 4:11,-J 5, mf- r , X f bg, f 1 2 1 N as if V v L A' .wif .hf1wlU'.21 1. fel-gm r?5mRQxvg,?g?g'g7i1i',3t?r5ff4 -Wf,:f'.x21WS:r::w,.'-fi--QfgWg3iiif-1' yin.,fgzui- ILL-fft'f354-f,g,ag511 ,w.,gQ,QxLg4. -. ami 3,14 EE w k..-K Q 1 2 K, rf ' ,, fQZ,e-mf' ,i1T,,,a2? .4g.,,?w- . eisgmt,-1,-2,hx-a.rx'-Zvi-vwfswwwffvraffzf'Nw'g4.fG11-aw?-1'h'M14-w524gR5e ifa:g?f9ffmQ,um wzfzzfwzwvfa avi-Qif'am:4vf'Qg-qf.,5Q ffwmwfwwgi,-55':3.g' iggffsgfafig 1 -'w 195431, f 1 iw -'W -- .gaygif-QQ: 1 1,69gg.., 1 rw-f2,1:.fi2:fu,Q2-g.s2ff:v'a'i:fm-exfuferfsiw.fmwww3?-MWQNHWersf?zidfrffff'T?2-1552-HP.-gwwvmzf,1FdfifiBff-wk2f-fL2?,mLv Lj53'r-f,'z-ia.:23-1f1'?eRi,,EiW:1'Fwg.x 22:..:m,'wa, - Pa 2' - Q :531, 4,, 5bn- W 1 2- ww 1 - . fazwffzl gmzrvfvffghflfrgxf:'?:f'1Pff MMM4vsawfw?S 2Fff''W-Hl:f.5 Nf,,.w I-xi .fm-++f?v1w '-.'W'1i? 15-W ed -- M, qw- w w 1 'f is , 1 mf. wi V-,rn 1 we ' . 'Q - im: f Qldfx,4-n,..gf1-?f,,qbQf-L:a-:.-M-v.1.m,f.f.9zv,l'F.'f'1y il! 'fi-'lshfgf' '3ni'l,5v31w1v-f,i,E3.'9v'-1 mifv-Mfg?---I ' -4 MQW' -wr'--'5'h-- -wvfiw, Jw-,Y If ' f 1' K ug? - - 1 - H iz,-eg-,if-I ar .4 ,af -. ww! SQ 1 -R ya 'f U5 EN' -ff-sw Q-2:12-hisbapzmwi.LQ:,:w,:5.w:?v:'f'34-5-fwh:sf'fel,+Er'?w?fwk,ff qgsslfchzlfig lfgmgew-lfsxffew? S5ffsm.fwS3fg5'Z3af-5ggg,Jfz5E3f-'Q -, mf, ,, ffigk ,fflggw . mffiaivigwfkfg 1. 2:-'nw :1xf.QtIifff1 ffA5f.4H71..v'Z 43-'wf-551213331fiwiiiiliifsigfqbgf wr: , :K - f 1 :gt 1, .. , I -' SiQ+.32?3'g5 1. fV'4a'Qn 7f iiW 1 ,amy ' Wf K- 5: .- -. 1 . u. 'b pig Tijlffffw- WEN: , fi iffi4f1w.'J4f1.-f.'ig.fAf,f:g3gg vgbf'e,Qfi'iy5'?z, 'NW WL' ' m f? r,eJ:5 z 49. -v- f.Iv'i3,,m 1:55 ' - fifw5f51 1'1':,. +.':fF'1- 1-.,.'. -54:1-. ,f1-fr m:f,f., 'wH': f'!i-m1br '3L-15 '3'41f'Z-'AJV V W 1-fmf,-,qgfgg mfiu,-fgYXH4.w.-L1,.y?.fv.g2f .f.1vEQg.',9f3 , 'igfpx -'55 .mm .1 f W - -. Efairaeyf 93 . r ' .r ss 1 ,M 'a- 1.-'Yf' r' 1 m , 1 Q: 5. wi- ,. vu 'Lf1,gg,+f,g aw. .dqqfai vw.: m,,, SN ., 1 -1 1.2fm.ff-inf-fwsfwfiw-:Viii..ffmgwffft'KW-'c1:??'Mfxc'3'r?Qff31fr:'5wIf'Qh,,.,:ww.gff?!'fA:e mf':,yf2'w- fix: M,a-MH V w m1g , 4. - hav H I .W 1 W f -v -JN fvw1 ..5.vh?g5JiffqQg9?afgf22H2f,,' 5-sn-pafffhkz,ff!2yf5,,we+.,.1hf 2wifgfiarimiliffxtwsmzmwirmyQ-?wiftE2ij,gfHEifz,5W4d:,zfbefwpgw' H If ' .f,pr,w,,.L fn .vig-.E 1,3 QQ, f .J f- ' . w QQ, 2 1-1 1i?tLK.Q., --, -, .f ff'-In35 '?f'.'Qi4?W12?2Q5Z?2i 2 f 'fs wY.W'f 'MSE f3, E1?A ' WWF Av gf ' 971' 'iff f ' Ugimfgbw' 'QRTMRQ :QQWQaZwwssNaisbfiiiiggaefwfwi'Q4f3gfQi'f51gig,1,.QxW3M.. - 1-:Wa t2M9if'?2 k '6g'g W g 'a w ' law w Iikiigffwzwfdmlwf,FAf'fx,55fm'aieiGa Yfiv5gfsfMw1g'454w1d. PM 1 M9395 N agin f w w'5fw Qi 3. 'L Fw . M wivega JM. R, 3 'x wa-f4'f2lxHf'1i.M,--sf2-:1pm-1fv'fff-wg12ts1.:Qwe,f-lsw21K: Qg9'.kgg?vf4v,.qwuw- 'aQf-,aww-142-wmvgmfuf-swQAM. Qhaawffgvf Q:-hwgiwzwww w 'W e f gr- 'M5:.v:h1 'wh 'ff '1 ' ,'wf,'a,m,:g5-4 4 Yilllpi-2 fm-: 1 'sffw-QL:S-wwssfzwif.v',-meszwaie:!?gE4w,,1:w,.'-. m.+::,,v Wgwi'-mm:wES1g2z11w-wwfnw!gmW,m3rf,,,,3,gvwiygyvig455,,qw . , M , mg, , . L 5- 13 ,7 f ws'?f?53f',i4- w'zlfYf3Fi5wf +94wv5 -'-I2 . L11My,Q.11-',ii-gy34.-sw..gv.f6sW?wgfflefgwgmflmy-xy.,5we wAsf:1,:g,gQf.fM3,.i,,gX,-,www .fisgyky ,qu .- 55? ,. , ws W E-f' Exim - - W ,, -A g Wilma, ,F -an , f A M-?fJI'fw'f4Mei42':f?f?f6:1iifif '2:f1'2a':7?rf:-fffxigyffiv ffm 2-fbi! ':M.f4 iwwx5'W'i .effifiiiffff EWFS 5 .' Hwfixf' 1 . wiv- is 9 Ffszii n 1 - , 9- 5 '.:53f7 W'ffZfsif V' f5f!'?51fEf ' '- W ,-.,,wffr,.,,.f,-:gif-rw ..f'w,.t:fn,'.H':1'Qh3px-,443-iiiferfgwyymnv, wgyw-aguiw-f:kf' gf?WgrE,mvr ii,mZ-xiigffhsaxm. 'sk yfjfq,-kg -531 Ai 1,3654 -ff Ai, '- awp, 4.4 'IE wig? ,- Wigs., - fmgqkgvamfgk ,Ijf,rHv,ggg5Qgg -5 q4,Q42g,L, 53243 W, , , 4 :,.z-wg ,fm.f:,.':-qv.:A.,G-,hz-'-fqffvvfx-.wsvwwfqryif im!-w.,Axfm,-Mak, -4fu n:f,,gw.f.u11.2-wg,k53a,,, :ugw-yegfaigzfkv :M-gm.,-1g,,.z: -, - 1-aww fw mh: ., ffl- f gf1,q,, QQSFM A 5: ' V wygfgglgsza- A f, jg-mwkry-g'J?wf'N vw. I ', 4 L.: wg: wer: A-,w,, . ,-V fv, , N- -- r-151Qra2f':f,'f .:miw.-?:f,'r'fibn1.E.nf'+S1w?4f2f?5?'fa1?fxtfs9vs?gE2sQf-iam awawgqgfkwkinwgmzs' Vgfm ', ff,--' ,gmv3j?'MX?Si wfgi,-f Yfflf kfffw uf, 3 vm 2' 5 1 ,gl A v1rQf,5ff' - ffiilwihff-a33L2-'fEff?:LE-fUw:g2.fPiGs21+-ffgliifilimhfiaiff152961.!i ?:5i'35fifff:fffQ?FW53322:!?ffi'IQ2,p?5f1f-fgifi-five i2Nf2i4G2Efgy .,..fQ?' ,fiafffb ,hu my 4fQ,g,3M?f?:f'5fWgL.f gmzlii 1. 59 .Jw 9- ffm ., 'TW '- 2 a i iw f54twg:f:h,f1'5:.vim-4,Q'-.fu.qv,,-A--.:z:if:mf-fx.,:gg-mix.-rg:':4'g514qv:y,4:.yg,gQ54?IhSz+fv:sdi :Hiflmgghffxg.,WiVEi5,,gqufe:gm ,,-,swgya-' fa., ,-- mmf ' 1. -6 jgiuf., ,H M'--A . ,wr-M ,. fu -ff- . . mf,--,,f,f+.,,1.,:f5s.4,',..-,,.'-,,5.,,Hq,-1-,6,aff,,f..m3.s-,'-4, gm- 4.-4.',g,.1ff..,.q?,g,.3ww-.L',1f ..9l,,.,,45- wg v ,xi'.Qg..mvif,f5.,xgw,M1,,gigfQ,-pgggQ5Qqy, ,..-Lg,1., 1-, 4' A. 34.4 f2,,,w4,,,p3 -kb, A x Q .- .k ,W 45,4 -1 A ,, .khfgwgf iarsfssezgiff?-Wf'3'fis'f-f:ff'A.GZv wifi1':fQize91.3w551fL5iWgIfNw-fi:wigf.21,1fM?f313i2:Gm5-wx-QYESYQQM-5fQifsaii'2fmif2i,fic,-wif ' ,Q if 'mel - 1 ' . ,- ' - fff E ff 15,4 X X! E+- 5'f'iM1a '55 211:41-.1.x,:,4 1.fv .m r:-'s,g4efwiw-.,-'pf1r,i6y2mI ma'-mw:11w.fAfw:-':awgvafzwifv-Ph .W1iwF1-'H'-5,f'. whkfw213266Hfffwgss?-x1v.11fafF15'r'iW95-4-'f1g7'fE-ww 44,5 'Ma- -'fs 1 '1 'f 1'- W , f' .' 'rv .5 21 1' .315 M- U: 11,21 :,,f-1-Awwswf., fmw.--miwI1,--11zfwfmM::24r4fm51fV-:wf.fw,QL-nf',,rMfvfwmbewfe-.X-I.,mm.:-SQ-f'.,mw4:ff-122Seygwswfgaw'Q?f,V.'i6'ifV.sf!.felvL, Q :wmv ba-nwzlwwfmmw 41 ggisfffgifife-1Q?L:w,,9,55gW if H W - g, wg P ' 1 '- f5?m..., - . cw 51,31 'f 1, I .-HA ,ffQ, :w:axwr rf:-w'a1La':L'f:fr+f,,f.:'f4fmfaeffaf'www-fv'5?4semeJff-:laser-yfw5-M,.p5g5fa.,-lemme ,a5va51f'1.qjw,nvzfw-uygf wil-fXii'?:s:1,:gti',f11f-mix!-:sameyrbfeyimf'Luwilwfmp 424.F' f Y ' w h .MV V sf- feWffH + M ' ff' 4fw:f,f-z'-wifr--f'wf'.imx!-fl'4:a5wi2iw:M'mf-f'wY':1':W0f'!f.f-vwfvsmagxf'rd1z5f.ffffm,fwa.'.wQJ' min'-fHfrif+Yf11,.+S,fx: nQf'Pf-PM-FQ' f'25.,'f?x!'Wfe5q-M.s-.vfno X-aviim-mhmfvQl+n3+f ilE4'1'ms71vi-uh, G 'l15'Y3 . ww. Y P . V f HS' ' 11' yw'-P 12 .ww f- :- Y-'Mf'-. A vm 'b 4 -.1 f:W-1f:f! :v'v'!I,f x-','.-12ff'!'.-W-V FWW-i-5 wa'-frzfafyfvwf .1,2f'ww wi rx ,- -W' A.:-5.-'x i5If15af 'H '--L21Y:.M:vHv -vA.tk'l5h WY!-ME'fpr'-Mqqigu-fMw'1LZ,L'K'H, ' eQ35Fbfrf2,U!i..n - ' xr ' ' 'F fy W' X ' I ., , ,, pw- 'Mn W 'gS 'Mig' '1v5u.? J! 7P5iFr571 '1. f,L:.w..K--qfrfm m,1:31Img,-mi:1-g:f:: 1fYM:7ww.,,-,w.'F-fw' MMI-:L-,u2--Q'-.'...-5-sarvvw.-wap:-T.,,3vwu3??q?,:-NL -u4,p:.w+,3K,1 Q mwxmf.-W-.Mn-eb, f'p',yi'31Yil'3 vii -wif, Mm,-W s 1, M x mg , H w QW aim ad, I J , 'wxiw egg- 115:52 -iw -,H D wi?-ewwf:L,-,M m,,w,fH2?C':,f.f,91-N5-:K?g1.f,1Q:?gvQ'A?.',:,-'ig,w'nw1e'g',w,YMQ-fbgiwf'myffzf-lziimxl-,1l5 f'f:wf4:fg5.0vWgfffv,Mf'2,,x2:S '1?fM-1:Wwwgflffffww,iefgQxJf'i,QRe!'zgZ.QIl?M'JgW2?rfffCw.f 4'fHWWw'L45ggf,W1-Y3S:'i1'5Ly,X0f5?1W5'rJ 5'gig.'my M3-, , ' 12 92914 W 4 -A ffffff' 4' if u1'1Y2y ' K-iff-f+ '4 1 , - 'QZFEQM M g1+4.w:fffy,.f-Q1isJ'-1rim,s1'w'Hfmfwf2-q1'1fL:p,,f1f2,u's:L.wggf-.fn-iff.mfwQWx-wswzfgfawAww-nv,vfar-WM.r,sfcMwxnfe'5,1Sfl'157mw':-mfwmiiw' w'ff.,,,fi?Q.,M.s.47fJW,khffffaw ',w3gf3'vw.'g6,.,fEWQ ' ,:. .zflwcp - f v Way' -' .,,W.- .gftii w 9 HM A wlsfrmg -,ffxwifz-1'f-.ifmffff,:+:w-TW-vmyz,L' h5wfgg5Qfg,w5f421,f,3y afmgW:fg1i+,-Q4 5:fW?f.w.xg' '- 1. .4 1, f , -M: ,wfw k 'Dwi'-wa, R: 1- vw- ,rfb 1 wx-,A,m.wq,wL ,q,f,,., ,:J.f-'gfn :mu-Qzw.-,,f..fff'1r fy-', Mm , ., . , ,. M iw x F MM ' fx -H 1 'x 1' N 335 1 'W X f-? if ei Jie. , 1 if f i4V fs 2 1.362 61 WJHX ,,1. I V1 :Eid ,n ,W ,mf Hawk .,,41'pwj g,g,M ,tlymuggzu ix,gmQ1,4,A ,Qi .Juv Q .mukjfg ?J6ii1?X6YfcM gag, zmwgiyy W , , ,. L iL1,5t,l,n1pV.ii,E3E,gE:.,?:f , aging? , ,. , U 5gl,,.,:3 X A +1 Ili ww H mm , . W fm ,f f M we f A 4 vi fx 5. Q -2 fb, ww Q - f - ,. P -,x1,:H A 1M,fw,Q,wc 11' Mx u f, 3 4, , H Q f .L x, .hm aw M qtvw M ,F1 ,M p L , -JI ag NQIQ g W gg, gil? .fm My -.Wigs .Amt . . ,rw pm ,W fn, ,swgcg , i .lf , if mvHLz?kvwm,mw My r K . M y,,q32,i,CMxSsglg R asf!! mn, 455, 'ggi P , Y .V I 4' ,K f, 54 mfs, , e.,g5g:9 . w. yn. ,pr , 1 . f vw ,-7.1, p gg. gg mg., ri b .h ,QE . 5 'W ' g,4,.'fl F, . 335.13 111 U31 'F fn. K xx' S1 1 1 V R N H R l I U ?Rv:3IPK?' Y'-1 xwlfbgf x1Q1c M 1H?gqQ23ii'v-i'1 W IM-L K -Ent' i 153554 .- a X A ' t -. .ww mf 3. c .mf f,.v ln l X ,ww Q 4 'afvrX sign .Sql x X w x Ez! .2 , . une X x f 121 x 1 1 1 w 1 ' af ,sf 1 11 ff L A 1 'L 1 ff X Wfifw- Sm Jw 5- AMM ' 1 1 .J, 2 5,2 ,Hal 511 ' WN Y f M F 1 a lr 5 5 I ff fn 1, M JU ,M fx H N W ,L um, ylgflqfl Q,,S.'flg'w W 1? f X k UW? 1 Q , ,V nl 1 M , is iv M 'A V tri X fhgfiv ' . A M 'Y11lf N, 2 ' 3' , 1, S Him L X 'uvi sly 1' A+-I 5 A , ,mn X 1 gg fx Q 74 v ,7,,,,f1 5 ff ,, A ,, A A n 4 ' S ' he ' MH' yuwswg 4 U 4 fxakxfpafn , X, f :www 1 fwffr E , ,U I Q 3.51, A 4 4 an wi' l I, 1 ,wx -hm J X 'l ' 1, 4 ku vb. I Wm 1 x Q. 1 A K X f l Q A r W5 1. -4 5'2 4,11 1 Jffvv MJ 'wniav w mff, ? 'A V sm mv wus W 2 ' P ,fr fx 5'j32lQ:1,?J an .-H 12 ku 5 l 3. Q E L' Ng-gQiE,?43i.'53' g i ,..jf..ji51j25 T ' , 3-1, -,g,. ' H K, ,7ip,'.t Tr! 1. fy, 51 3 yi? ff 1, NM: 5 J- 5 ff fffli S1 9' 'fav 'Q F2111 'i'iif4 'bL' -' 3'Eyr9f-9551355-3'fE 1f'irw,fff M 4 W ?V 'w JR und -'qyif six 3 Q 'f gap 5, f -,f -'xg x P Q' ' ' ' 1 fw Q 1' H, 1 'G-Ntgfr-g,5'4jY 'ii ':?'fPi 1.3 Kw,3f?fe 'Ql L.1wg'fi5g.ifi.y:'4L'ff 1' V ., - . 4 . -.A .A-. ,. 1 0, 'T ,v ,. Awww lx '? Vw 1' 1 'YU' mv 'A J ' Wfwafil aww' ad M ki W ' ' H L -ffbffinsi 1 fl was KW ,W ,mf-r.f ff M'F3f'-A L iw 'W sl ff fn 'Q' b M W5 5- yS,.,,.f' a' ,H-4-qYM fiQf J-Qf'hq!Q??Q,.Q1vlf?Q2iQ, . X gym' Qi-A in + ff-A fa wa X5a1Q,,fQQusg,. gw 4. 4 xx v g,N:f t,5wSgLA,w,,qzHgi:Qf2'g+ .LN?,2 , X ,mf nf. Mi , 3w3f'Q,EJ1rw .,. ' ,AW w',j',t5-Qin x, fqw11'gf,1,Y if' ' Wg 9 pi, ', ,N i,gSiM:ew,'l' 'sffiffki a3i53fffv1M ,ri U 2 L' W X AW fx ' ' K V U .ib'?W:1V'2' q w?'2W+if L5'Ht,'ffi'f'f?'gif-'W ., W 'A ww W7 1 x ' ' ' ky IF 9, , ,xl R x-' 11,38 vi Z! any in . H 1:-N. ' f '3.9,,f:1,f,, sf a in H I' gui X if iv fg 35.22 X x 1 Mi X xlffx vux N: Q H Km 'N Q 1 va , 1 H 1 X ,M .fx HK mn R! VV: . L x ' A M Y ' N NAM' fvxvr 'A 1 51 1 x J ff w'.,' f V 1 vi 1 M J 1 Li. 1. X W lb: W f x , 4 ff l , x,f,gM,sLf aku My U1 X ,, Phfbx x H! ,rl 1 , H PN 1, ,r Q K. K -, 1 , g U 9 'Lili' ,Hg K I 3, 1 Q N, w www +R Ye' x Ax I-' my X w w X ,fm S . f..NvY' 15' WY M r 1, 4 YQN ' vi ivffoyywt 95' ' ,xx Xy7U,Jrf a fr in k sh +. ygf , 'Wx hu 2 K4 f A MA, ,J 1, L in gl ifkzaimgi J'Af1f'3LfVm'x N, .Aw In .ww .40 , Jw Qqqwff Wim 4, QM' , Q , ,f U 11? fwjfffwo M X wfwvl . . xxx P' 1 f4E'N3'.111,gg f f 6 ,vu X A .A J A K , K, I g , Ugg . rim g'qL,,: ,. L :rx - ,X 454 N , Y ff4f,w. wif' W-1 '1 W 1,-Q 'M fuel W 'N BU 1 X L. H ,um?vw,,Hf.'J2lmiFqy 1.w?,i :L xf .Jax 7 Q W NJ 4 r . 1-W 4 vw N A mp, . 1 mx JAN 'X Dr l1'! IL! M bm, maxfw rj 1 YF x ear, N 4 x ' 1 W f H 1 H111-sz I x 9 1 1 M: mn ,A xv. ,v ily . , lgww ,f qty wtf ,xjflwu :rf A 4 ,. w I ' my , U ,fm 1M 5 X 'Wx X mfr' - l INK NNT X, H., 1 X x 4 Q xK'NkK'1C1U , f W ' ' IAA W YV' K :A 'L mY22'Jfm'N xfflvuxwx TMA 1 f 'V Q R ' Hip, ,L ,H P 1 x w 'Vw 4 K-J Aww,f,,x Vi fx HH!! m:JU,xp Ax 1 ul H i . 'M wp : 4 , . ., 1 f 1. , 4 L, 5 L Mm, , 1, ,QM VU W y A ,ine x , 1 1, -Q' HW x , , vm-rim! 1 v MM ,A '1 y U. 'sv , K cyiuwf ,K IW '- wwf . , , fu , , M f :qw , A 4, .v H I ,A , f , I, P2 , B1x'K J . mmf fa 'tfvvtg A1 N 'rx ' 'q L ,' '-.iY,Uf. HY 121, ff. 5:5 x ' jx, in M, ff rv i fl gvxlhl 'fl NN Q HW A 1 at ww N + wwf x 5 1, Al - 1 V A , 4 - . M1 s., P K 11 N X 1 in I7 R if, fag? J 4 , M if. I awp?-1 y 11 M xx J lg ,mmf , , xy , If x D NNN: mx M wwf ww' M wi, :HK M. 5 N wx ,Hun J ulfw 1, mf, y A , . , 1 , 1 . .. W U ,xfl A, ., I hi . ' fr gn , buh xml: L xg M I fl xx M 3 Q ss Q 1 7 2 xvhx ', ,urn 1 .1 wg 1, 1 J A I x 4 5 1 1 Q N k 3 iv A fxxflf ' ' Ax KS 1:,n :N fx - -J. ,N X m,f,5,X, Lx.. R ,'gL,x,,-f 'F z , Q wwf 1 ww 1 .S ,X ,.,. s rin KW 1 'A - x . ' 1 CHN . X - X M 1 . 'H' 1 L 1 9 , ,', fx M 1 f N my N1 Xa 4 W ur 'S ffxg ' fyvw -44. ' c yxzmsx-Q .11 '1 ,J X-1 Q f ,Alagi C: .Uv ' 1 hue Q, Fw' ' 55' 4, n-H ff nfllx' ,gXxfifw,5L ff 1 31 Y4 kLn'wfiV MH, Q 3 ',fflfP'J'Q 1 ' H' ' 5.44325 F 'Y .4 , , ,f K, Q , Q ,, :W 4 f ,, M :sul vb Y' x Y Hvfefka z1i'97fV'f3'-'VIE Q. , ,,' nv' y ywff ' 'haf-'f'Lifff9x'W1'i ' 11 ' , mu fm x, ,1 Yc'f.xJ,s5,1V'v,,xff 1 AN 4 f n M.-,vwn y v 1 I. fff. 'E-1 -. pw, 1 f . ' r -Q S V Qi f?l?lQ - : H: L -.M , X ,qssgp Lg- ,,wi,5:g' HQ? x18 v V Xa- 1, JF' '1-.rm WW 2' 4 x V 1 W if ve K5 ' 4 IWW 'Mfg 1 Y' W M , ya, Qifhll '.f4qfg?.V , www-wfizyg N I www W, U :, ffwfn f, f K mf -. - , i , AFW ' F? N 2 4 -P wx fllfiqwk 1 wh xx U 31. ,tg q 4 avg!! cu x -fvrf s ff nf 'fx y 1. 3, 7:-fi 'awp 1 YH 'V f My 1 1 w 9 QP L 4 v W 11 gk iii! 2 r ' AWN if ' v 'vi 4 ELS-Qiifff5i?'fEf'W52A4AQ1W,,f'Wg 'i'ffgiflk 1 mf. f. ws V H. Y: 1' - H .ds-. -W a' .1 'M' idea, fm M., ,J J x .4 v , ,- tg mga,-1 M of .1.'s,,,v Q-,,.,',f. A A f.,,,, fm . r :kv M'-,wi-,-1 M fspfzxx-Li!x.Sa1.k .1 :wfj1?m3'f, '..fg3p' 95, f-1, ' , . 'wi -'wniiirf f liz? ffuffwt ff . i' Wim: -mir Jaw: P.u2Ff'f urf+5EWvtcm? ' f fx L 4 Wigs? '5.?Q1wi4ff5?f 'gkfffwii ff 1' 425fiS1If. Q1?' if ewigf' wg g,f1'fwf:z'mf1m2.ff'iai 1,1 .. at 1,,ff::g, z., 31-g, -H'S-S',2'mf:,---bf-: aw-.,z:, gm, f Q.: .fiafgf xr.: W'6?Qp'52z'.,',f'x2:5Ws1 ' -my vga.-g , 5951 ..fQj',- mglfg4Q15.'.q, ,Q-.give My - .,, qn2,,gYxg',y,j3 sw 1, ,fav mvfv ,. N' ww zf'y,giff'Y','u-fi 2: :Ha .. ,1nI'ff'f. .f ' 22' V- -FQ: ri! Zfidfi fifiwf 1 ,.1:1:'1W1? 'MH 332295 Q ,fi-fps' , 1 :lam QQ c! 1i!.2 xg mi' .L w'f1?e-fi-53.11 2,'4x,,,w:W :yy 1 fi: A-fw M.-1 L1 'y 1 iff' xfwicgl ,131 ' 413,24 -2 5H2'f :i- gha':'4M'35,'f' f 34 L lg' f. g1gWf1gAf1e-5-A m,2.gf'm 1:Aif'g,.f,f4fa3Mef'425 L! w--iw '-. .af 1,f:'-,1 '-:1 , , b, Jw-H S 21? -1 E?N.Kf.:4'w- - val. -wb M- vs-varl Q' 111L,v'.f L,.1w-Y: f- fm 5 !ra,:.'f-:- -A A, zzz: ww W,-fx N ,gf L Lp 'ywgi wi .gezw ag-A ,fi i 'j'fa'w 45533,-u :'.-if: 1 Sw ..zgeff:g,gg1 we ' S ' ff...,5.v.5ff5'-. . 3 ,J jf? -3' X,,':,--'M-fi-,?11g:'1-fp, if .'f,w,fT,Mugs'-4xi.f5-Qvf-2,.f 4 4.1 ,5f,.?y'S,E'Mf via- gpgr? 155. 1' ,xr 1:-'zfrbfr w'.r:f.'rf!',g UXf ctr '-:H .Q...v11y'-'fr,?Jl,.,g -fm fm.. r '-ff,- 1-Yu,--.'w. fiwwfif -- 'nf-:za 'fi - --1 1- c?f fx'v x.1v1 , vs, mr'-'P if' V5 ' Fiv:f..fa:fi',v. 151, F w1.Lf-?1f'vW'-sgfinrfren- Bw? J ,l,M swf ff H Q 5 y ,zurif-va ,L 1 if '21-5 237 9 iii' :FJ L 1EEf5?:2?-P135 .25 f 1-'f 1fJ':fff' Jf7f'13i iSAf 192-'1 :'l,.' FU:-zfariginf' ,,K'?1?e? iP?f2er'-9 13325 2454459 1. 'Sri .ffxf-z f' if?f'.f.f9f,fi!-'ZVCQ-111 w2ef?: 1gf.1+i53'fg- .fn-'If , . . . Nw. . ,. -.H 1 7 . F Q.- ,,-,g1.--,, ,-l,,.,,,-M-w,.gx,,,,, Q, Y C !.f.,.f. Jn, ..7f,,,,L,,,,,,,.,,,q,,.,.,.f,,,1, gs., 4.25, .gy 3, WV-'sgk :N rilqf 7 4 1..41:f',--1 'Sur .. . ,J-?,f'1, 4fuvW 1' N -,MW,3,, .., nv, , u9,,?XaiQF'E?X-5, :Xi 2 L in u :FL Rayz. -,-:.,72gf,.6 .Heil '13R5,j:,xk .,1v,5?:.-gf f'1':::-Je,-,yQf- 'rg fp, y -.134 QM 13- W-fr: ,gm '.'5n,gF. f.:--' 1,-, gg? 'A :uf-gifs 3, ,y1gh,.'v', I vs 3' 5 W., , ,Q 1 'f. 1: 22: ., fm-Q'xfE:1 S ' - :',, .. -1. -.- zwstk ,mv v- 5,3-L,-.Q Q af'--, 3-V.-4 X M4 35,1 Him' W -aw. 2 3:5 Z: 4 F M515 Qffgf ' Af N ,gf-'4Hf2f?Q 'S3QiJ ici 'v 'Q 9515 'HHH' Tuff HNTV. n?.p?12?If?5:j a? l'9f4Y ' W?V'?f , .' Q W, , I . ., w,,,M!x. f LfQ,xuf1 S- hx amy -, fix4,g75,f2YvJ gg:-Km Q AN 1' we ff, QW gg - y. fiflfrxiii?-llf ffl! Sfi3,f5fA'7f'1Z ?S5fQ'-15 ?'X 'AfE5A'-' iV'ff i1'JQ'i?- WQY1f Eflwiii'-K., 'E+ 'J' tv if -'iff' fff?Wi4W?5 1 t ',3.,S,.i x v,.y5Af1, Q Wim, 42,,'f, ,.,,,,.1v, W A, ,Q Qznwf-5,f4i,iM.:y , .rimn-We HSV? ,,g,?giq,5i R, .. -Qpgwp WWW4 iffff'.A17V-li'Wvq?+4 f 1',ffwvg5yfM,3,i xgfasag I 1.--f-.ww .bggfwf 2 , M k 15' .- ,1 M., , ... X 'uf 1. f 'Q ,.' . 2 . ,J by 7 rm Iww'-+vf.'ff?? ' 6 TN 5-i ?i?i 59'2' fl 1 JF ' 5' f'at72JwAiE- ?4?5?1Qlcw'Z: -'L -WQWRLIPEXNQ L9??gi,fL f?' 'WHA WE ' W 'DME 4 A f 3,14 pvi: x,f5?'cH -x -245 x 'Y5 Ke 'QU' 4 My ay' S 6 :NPS u-1 ez- K 3 ll 7 w , ff J1,,,,:jp?,.f, ,rr if ,w,,f xqf1AX 5.-,,3M 54,31 L+, S4517 vf5fWw.y:5,a3y? F,-,YZF ,MF :nag 41,321.51 MS?-lg--if ' 'ir . ,Mg z?,.t3,,1:, ,www fu A fqmg. -.. F .3 P V5 4 ,,-444'-fmx, J' kr' Q 21.295 'fp P 9 4 P gs ' Q14-L: Fr ,I AQ .fivw ,yi H w5,f.-4'AQ- .-,NV Q.: pxfiav' H af, ,guy . 1. mlifgffw-Q lfrmvwgkf G wE'45??l'g-,12g44g3gLfL 5zN1zf. N- .gg .. , ,nm g,13,3-fyjffjilafxcrigfsm1Zg,'ij5g,fgf3 f'f55?2j'.,,3QggfJieE7 4QZ,,fgzif.1g4 A' 1-ff? :win s -, 1, . 4,-:iY?' ,,,, Mwwmaggam.. 4,5553-5.,5-Q ,M.,g+,gwkMw.V W nga, .gg - ME? . A J! A qv - , W., ,,,:1 'f,,,., W-at ff A., :,f'., ff f J .- we-,,. .4 ., fy RW. '+f'fwA2f Vw vw 'aw ' HW? w IJ'-Y, EMM' M5 5 :'NIj'5Ew' -A, I .,n wh-V-AS. if-wifwfw wfwfi.-f'E1fv ffm ,Y . 1, M, , ,WM . 'L ., 3. , ,,' , , . ,,, ,Man U. V ... fs LW 1 5f'w14?M'Q.'i?2'? Mfg-aff J' 6WsiS's,1ff:W'g ' w.'f 1Va,'3f9 v fri yw!.f'2f.L151ff :ii+ Q Wf F 31,2 NW , 5 ' wk:-Elwfif'Eil5k5,NFWk.EPl'if 'h -I f S!.1ff, 'Yf2'w51 fA,TnK'SY7f, Ai.. :H ffl: A 'T , WX , Q, Tk X Y ' Y5, .f'4 7lJ9 e ' 2 -f 'iz' fwyfflg 19. -!f','-frqffg,-g Lf'4 mMy1gf- 34'7, 5v1A,7, rg--1 an Y'-L, gel,--i ffm' ,. 5, V- .: . any 1 5Y.Qf.nfMl K , Lk n,,fk1,1 Y 5 4 w, 535, M :ww 1 QQ ,u 'nw jf Q, ,af Q V vm? Q 44, gf vw L vffzk if Asda. 'ki n 1 Wx xv' y X-1 ,sq , In 2 .-ww K5 Us-:+Add-e T ,f I 'Qwf Q , x 2 sh f , fr XL' S mx: J ,T A rf,-5 1, -, ya J'19 1xQx?e xL,ffi'?ff F4 fT9',e.Qg4x ,TM , 'f -mggf' 3' fffff, , ,L uligwgliik .5 is wig. , qi f '-1'.:ff5ff.q-5 1.51,-11, P+ . .- , .-xqm ,vm 'fm 4 ngwv'-Hykagfiktfig X f S, ,Q--X gh gl 1. ff.-u , :,. na P va, 'fa -ayih - 43, 'Ww+?,a-ff'iz,i55. 1, U41 wi ,mq ,f sl w -1,11 M w mum 2 gs, My Q 1 435, 51 .-,V i,g1X Y, 34 252 Q. 1 A Axefk 55 4 I M pq 461- 'Elf e 2 .UM fx wfcf - 331,55 1, 3, M Y: C, f, T if gk 5 filpi S5 dvr: x affair uk, mf :VS 5Zx4b,i1wIx,:. .:,2v.15Q. q IL. l,..H,i,? . ,A-V .uv - A. , jHbw41,- 1 fy zgfvg -3:4sag.wwg -, 4 -A ff 35' xr 1 A x H 5 5 if A 1 1 A X , 1 I Ltwx.-, fwawk Y ML 54-I M-1 ww, .zxwpfy-'Q L, ,Q nf fw , 4, ,111 4, Iwi 13' ,y , f w .'cff5vff 15jifW5Q5?1',' x:,y-ff?-f t13? ,f if 'W g f??fWw'V5f.'l1' -' ,, F9igQ-:fi.:f' ' vw, x,s5,V,1,5,m 3 ,',,QA5,,,,,xw , 4. kv 1.2, v .Uk . '4, y -.F-Q. ?'P4','f' 'Wh . N Y , H , , , ,'Uf 4wfJ55fgyQw,1.',x,wwf.LQ af.f',yg. - Y. :ws A-yrlyfyggaiaf Fw' -i-ff 7 ig 3 , ' , .- 4 -'W Q 1 1 ' - .. 5,3 V-. ,. f f,.:.,,a-:,-,-.1' 5, ffiufugfvll .QSM . ,l,.!Y'F ,ixvfj ,. W ,. gtk?-Q35 :W , , 'W.. 1, , -, ffi,,.f,,g,1:nf yfylvlixgigfawtwf,Q,1,,?f5jff1 rf . X. r '.c:22mf5Jk Qffxifffi, MQIWAQMM f,rmXa',-1-1'.,'-Qhweyv., 539 'vb slfvvnw' M-xfgfnnzk. I-ag, ,f ,f N- tx? 3 'NML14 -lf X.. A ,- M- Idlhdwtii, Q- H - ff 1 ' !fL'.1 w2X,'g2 '9,K'Q5g'fq'm, -' U. Hxffv'-1 29.1 fi Vw 'PW IW. 4. ,-,M 15535-H ' .. , -F V . 1 ?f '3 i?:'.L ' QQ 'filix' .fiw:'iff:i?? . A - 'S .2 :2f5?f ?33sE 1+ NW . ,, 5, 5,4 w,'3rwg2L'EkzmrxQ1,f-Q4 5u,,5 .79'ie.wL,, 5 -Av 3. 3 L ix . -h,.,'g,nz-4 jigiisiz Ja,-I-is J' Hxfegw R 1 1'x'ffwLM1ga,,f+3,, , ,Ei if if Hx Q M A N K 531+ MJ,3we.SM'1f?1',r,.1 x Vksgfxgsx 1124 V+5 ' , ri H Piifrifvlf- rm 4 15 , Q1 H 4 S - Vw if . Q QQ if Kim' x -P f 'M .-gy MQW .MNA ., ,kggvi riff, .smn,1.fm,f..,+ -i -Avg MLS,J:,-- - 5 . Y dw. :Eli 1 1 Q Wy' if 1. aa'3.w,:4,- -X, .wg 35,6 Q1 pt,-,4 ,' '- 'M :.ri,f, If i,,.x,LMl, ' fa. S 1 1-pf . 5 ng ' ,656 :iii ,Q - WN, 'I Eff .-f?f'z9t'1 W J?-H! 'Ran Ziff 1433? gif- law--WL ' 'Ji-' f A 'K lf U : ' V. 'C ' 1 V 3' . f 'F K 4 , M ,ffl-r.'m,,.:7-g.' Jwfwh .,,4gL,3.,,,g-Y. , A f ffiffw,-A El ,zisfufg-I . 0 A . 219 A' ,, ff Q V-5 ,, -.ga H , r 4 gm ff 45, vgEfH?if.s:gi 'Uf'fZ'f9 Q 1 f-'xy .' ' f:'.'f': ,HL ff' 5.1 Qi ,hm ,,Ii,13!w f kH?A,I,,W,,2, f?j:!F'Q,L J My pf,gffQijr7v ,I mush M. L X2 ml , V3 ' 1: :Ji -' V N 'EJ N1 Jiamxl 1,kXiL,4'1'f1nLXf1 wxxHi1k M9 ALI, ,avg Q N' s I 5 jew H 'iw' A 4 '14 M at wh K 'A'5'??5.M'EvV'1fM1 ,J 1, f D, ,wSgWUi' 2 , H' 3.135231 b ,W PIM v wwf, ,. 'ACT . . .,'?'W?7ff.f , 'ffm .'e1',',. fue -iff, ' ik 'gin . A . wi v F1 gg 1 N ,551 Ep fn qw,-,-. . fn, ,y,+.Ax.i13.m,3 WE. gK,g,:bj.-,nu 75? 'Q ' ,'.:.g1f,1q1u2gYf,Q 1. A 4. at X. uv 15? Ti - .1 I 4 rj ,1?ix:2.i'E.Zi ?1i , 'Nw 3f :'1Tl'31 X2-P3 ,.3FP5f5W'if.?33Q ' , ' V' ?'zi31:f-'56 ' F V .mn - .X .1 .'.u.--.,,K,r,,x.w .,.-, f--0 f. -., ,M , -:Y ff , 5 v If M Y- - 3- .f 9 - ' 1 ' ,,g?94:.!.Q fig qwwfif. ,nz-,,'fg! fi' -W 1 ,, ' ' 'B 'ffViziffyrEf:?!f'si'f?affW5i ?2if'f2f 2 Min. ,M ,, f A, ,vw .1 Mmwz. Hy .-in, - f , ,!h3'..f.f w.g,,,f5 1- . , .wg -',-.-'-:,w.v. 4-ffl: :.,f.:',, -WX.-' x L' S' -J,-f , 5 vi-r 2-fy, J'-:vw .w,w.?'i YQ 9 fir A ... N . H-ffm, VMYH. .,. .. N.. KR. A X ,. ..a.e.'L9L,1x K., ,..,l Q, -Q 2, .mul +1j, ,f,.94f5-Em ,fl 'H hw., N' W A f :. , , 9, .., ,, . ,, ,, ..,, K . .. ,x,.,,E . . .X , .. g. 1 if U,S,!..?,, gpg: .A'f,3y?rv.v, ,ff ., I ,Q Wits Exif! My - i-,fi '3-2 K 35- -,af'-w.'4',1-bg!-:gy '1f.-,..-: g.yg.,3,f,2: Qg:y..,3,-fi,g.fXI,f,i-' mf gr .gf gn ,if 5 wwf ,, 3-:..f .5-' ,c ,V-:,-0 9, pl LI,g,.W4,, AM., Q-W, . ,ex ,, dxf., -,, ,, . ,V ,J l,5.x,A. -lf-Q-.,x..,if,. ,, -c E. Q.. we '.,-K A, .,1, X -U ,Si ,f ,f,. x ,wx-M 1 -W-ffA1X..11ff...f-fzf yf Vw ,f J 1, + W , 10 .Q , . r , x ,Q -f M , . , ,A . 4 , ,.2,:,g.1-'-.f,::MQW ,gfilzzfmifr f- mw:f,+,z nff:fy,, f,w6, ,.',.mf,- ',,:,':1:ww--J iw eg ,wx f W . -Q,1,wf , we 1 Q' , , 35 1. . ', . N1 f , ff ' rim lfggfifikfglig ffZ'?3Sfr.gi2Isfp?3,41g5'Ij gf2Q?pf'gi? '3:3fRM3J':,3 mvfyygi. h If si 'I-A A 7 , ,Ah gf A 0, J H - P? gi 1. 'X 4 Q , fry! 1 ,tu X 5' 5 J A Q'f,y:w5f xtfaex 111-:j.'g'11-ik.. ,qffxcf 5:-,!::'ff,1:i:fb 4: .. 1' , '-'-W 45'--'gw1w?fs'f': fx .' Ziff' , 1 1 -1 g'.'-:wg ' -z . 5 fab., ,A mg, . sf 1 . , . 1 .gh 1 S. 1 -,x,x-,wh-.1.--4?-,!' Q. M-+.:,,v.'-S f.f,f1n,'15.,3.+:A1,Z:: w,-s:.5 :.':,w,., ,- LX.. hx. . ,.::.f-., 5'fna:f1vww': J. M fm 'iw ,Lf 4-', fl 'Q :. 'A' - :X-A f K s . w -w 0 ?QiRf'1f1QiQEmif,Gizzxirxi4:Ei:'fgrs,gQ W ,, -ff w l 'Q f 'PA RS gl , , 1 g V-315 ,wa-i, -.:f',z,:i,2 H:-'f:iw'f4:.A 1,'1-.ggrafgf-:1,'4::'g-241111,11.ff41.1 I HflhfflH-ji-q?i2f1 '1Efff'ue'-.gif-gg Qwrm' ,Lani -- -:fx 'gn 52-W'5Q1.f m,f,'1 4. R, ' A fn v ifs.f1f.1' ef-L ifisi-.iv.fw'Q'-21.2354Ska,-L.A-W my51iwffvfb-M92-Hli w iff' 21.-'-W fzm- -.Y 9 2i'3 E5f- New ' hh 253 W 2Q'HIfS1-f51',',l, HQ7IQ1,f'jQf2f 3,fW?6i'353if:1ff'9f5fiLfEff'Wm 5'L'?-Wf72:f?ff3l:'f, :-f ,Lifi-:f'9'.7 21313-'Qfifjijgfi3yjj1:9.fLi-51. fl?-' F Eg 1 'V :gay 3 s I Q-j'igy..4:-3sf,-,3,gan55,vq,zV i:5Z4-.wggs-1131?-sp 'frpggg 'Fm1-wishff:-I'A'X':'.frg.7gL-555,in-'5A'24'gg1ggp5a 5gfig6wQff1,g'.,,3jdy!,-52f:r5:Fgr6'.fisy5eliiyqfq, ,vu L -A - 1- , wg ,F ,jk A x fif ?,mf2Q.?5gQ?mfffsf K 3' Sv f 'vw ' '..xfq-'f',1X,'5,,, psf '-2 -,-:rl-2 ,4ff'5i3v'x,fx.., f fAY'C'1 Wy haw- .I3,.'Z,'fv1- '-y?-,1? m.,YsI' '-ezfwig ,Q hi- 1-1,6-' 51715, W .X 3-.Nu .c-4Lu5,m'. asf f:f:.,,,z34'Q:3-.:2'1f,W, lfM3fQ:41NwuJ -'-6 .J - F gd aid ' -A., Q-h - Q - 4 f , . Y V , is 2 +-Qfefsfm.,-1 ww V,y,-vw,-'..'.1wf,Q-:my 5 ',,::x.-1,-,15v,'.,,f ,153-, 4:19 ff' fwwfw ay, E.. mf? u,,.X,,w4w-w, ,Aww Q, ,,,v...g- ,l L, e , MJ. gy ,xi +V-2 - ,xy 5. 4' ,- J MM, f, F' wh K, X, gm 2 fr. 3 u Pg. 5 W 14, 15Pfe2.:ifJ.afZ,uil .i 1,'tfsf1 !fE': ,VZ:f.w'ixi5 '-i f'i:?1WMF.-J:'5?i2S,N'vf :585w21T?f,H5l11!,1fe554434P5-?H'1'1CWffHfHffwfw:i.'5z1-f 1 fuk rf'sgT ..ff'.?3',i:f'5?,wifi'fffyffiffifyfiT12'F'vI??k1 as: www f-gf in A ,I -CQ 'R Wa A 'L+ ff' W 'gn Mfr' ' R 5.LQ,f1f,fxf55g'g4-x-,gif,:XgaQ,g.,g.g5fgzmreg,ffwf,g,fzp,15g5gS,mprie2-2,1,,1253nm5gggg13L?:?fafffa4q,Qggzy,qlm,,Q-fvqanf.Q,4g-,aggjijyv -fiygegw fig? 12 ,Q , 355554 df? W ini, yeh? iw P N uf NS Q '1,1a:'w1w'g:m-,f.':L wt ff .f eT.ls'Pf2'w 'vfiwrfw 4fM,'fr: . -Q Nz fy . LL ' N ' :kj L, i Q'a2,:sH'wF,fw.r-ffnJV- i:?w'1,L, V-lb w ' 1- + M f fu H . law-M,'J7wG'-7'-X-, Qi fzh-,mr--,n. L14 ,L , in ff M. 'ilifw''qiywg-SQ:.f3F-:Hwfvf mv-54, fk'if:4r:1-tiff -W :wiv ,w'bv'S'1 kb 'M '4 ww Q' 72 Hn , '. , 'f 2: 'wsww ,,:f,f.P': W -- gm f, xg ,, ,f n'.1f,'1'x-:s':NPwWK 'P 5 7 1 L fu? ' R aw Qw,,fZ?'ff' QGNQQQQQQL ,3f'ffkfW'i,,!g,C1e??'nr?f ,Q'g'Q?fF'Wi7i' LQ' A 'I-'--Mid. 1 UI: ,.1'K!-V Z. 'f 4,c':C:4,i ' 55 WL' 'Viv Nm- '5?f'3'lA7 Nffsf' ' 23 Wlf sZEfQf37:A 55-'f Wd - - f1 'A3 7' M -.Q 1. .TW Nf,-E5? i'1V37'T-T. g':V, ,-5 fail-K i 3lfP '51Zm3 -3-5' 1?9FfwfJ'fff 9'2f fl .l!L'f 3: H L QQ Nf2i,gffH',1'?fi:ff'ffi3i-'ixiqzffkrifsvlyiiiwb.Qi-132Q.1.'l:'3Lfl3f'31f5'3?l555 'x.:ffbl35'Sv:wigiffiszg 95534, FQQJEV ?H3'S5lf3 f'.'K-iakf' cp ' ,fi 'E 53 3 9 xmLf',jq-i5Qrv,xQ fir, ji Sq! ,2pWif'ffW'x 3 'I 6 'ztil-f k'i5'f'f Ftvifrf' ?fli5'-'fB'l :f'3f'3I1- f:f '1v:h-.5 H aim: Tf'f-f1'5.-wi:-S:.:f- -'ffl-. X:mi:f-fF'?'. 2E-fQ'gif :-:hw N' fe 1 2' ,vbZ.11:,'1:iff'TfEfij ' 'J'ii?2?'f ,nfY? '3ff-EY, ,!' if-' ZW.-Q'1ffQ 'f ' i ' ' , 9 . l :-iw? 4 ang H ' J' 'H Q fff P vw ' W5 6. MMV' L? Lgg2,ix:g,5'.a1g2,3-5:-j:g.f v5'i5.f,,5y,:34:15. ,ij.gj,.Qtfi1gyy:5'1.51511.1lj-gg4-Af,z,,12ggf35-A1,.,-Qihj'129915,-:q,',l,f1,'1'gfx-QT.,cQ,g,gg3L555211213Qxfiygg,5,fLQ'f.',,i-ggfgixfgggngi3g,g5qr.,gi55s92::f3.3ggf',,v3QQj5'Mg ,fs1-Q,c3gq,g.'53'g5gqg'gr,'q15f,gA'a3: 4 v ef 4 g 2 , , 54 b ., 1? 'L 1' 32? '-2.1 '11-. ' ' 'J WIT 4:2'x,'.' 5':1-3 '-Pirix-A-' .'w.1'F-lf' ',1'3'.' --'ivy 5--419.2 9 l'2ff -.:' M-' '-'v e3'Lf Lf:Y 3?1M1'l'ffi,f? 'i -'KY'3'1.nf'1f.-1'-X127X441i?1J 1'9'w2ff-'-L -,'1,f.'.ff.ffh:Y125 ff-' Yr: 3 ' HW 3'-cL5. f-'. :,:553 7' Y I 1 V Q -I ' 1 54 I dx f x A' i 'Uv'-rg ,-5-'W ' ' 4 ': +-x -f+.7-- iJf'ff'f , 32 -gf, .ffi -',-1,S'f.','.'fi :X'- -A -,1 ,-5-,,.'y,--'Q--3--vv-' -5:02 5.140 1 -ff-,.1m-.X ',z1':.z-f .QA-ffffg'-R 1. 4. Uv. ,J f..f-51. x:1,Jvv.'S-.: 5v:.' ':9f1 fH-.wf-,1:-a.-.1-pf 'fu , ' 21, Q v QA '-'Y it-P gf, F K, 1 K 9 viLQ.Zg. , .'2u','-iff '.'zl5q:jfu-2.1'Q-,,1.,,11--my-5 .Jrf'f.f3flQ,'.2varaw?-.'1g:j'gfgg1j'-v',2-'gfE:,1i'g.-'ffm.2f34g,,g,gQg-3g5gl.g J,,y:5gs4g-lffxf.-I-gy-','qmggvg',':Lgge'-3-,fx ggjg-'ge,rf:3y,:M-g,15fjg4f3,g,' 6 X , -s y ,, L , x, f fi f , K fx. Y ' 'Fifi:'ff-f:::'f'I4fSlf?,fi'Z.fifJ.ffiiii-fffif aifiiffs' ffifilff?QS'3 5i2fi':fa52P55-1ielffvfkQE?L5-'iiiiiiii.3?eT?'s?ilEfxlf?-5:'QfAi11'5i'til',:'i7,if'5:?27'.'f.1fLi-95155 mf, Eff 1 955553 if K it 5, X ,lm .Q Q . .jQkN?'. , X Ven' f-12152 '- l -:- MILF f.1fX:i9if'fg5v:,i'ij1f,1'-i1':':3igwEg:,,.f5,:fy',iv:,-gg.f, .f,,,,,su','tg-Q 5-2214-fig'gifg:fg:yu,:ff:,gg'F.'.j.QJg':',e . .W S A x 1 v rx f ' v f , ff 1' f - X ??ez'.pf:?i'rl , , ifk1l5':.-.--'Ml1792-:Zs'Qmf fl'E-?ai?'ff1:?1i?359, 'R-'gsmf'ifvfsi?f.ii191-s-TK?ETlfS3i3'iLi2,1ff5risf3Lff'4'?iSidff,:'fEfiiffwfi'5'5?F3f35:kf'?L5A'F31-92.1543 ' W iw HL ' W 1 MQW 313 2' fm W ' WM '1 x ' fl.-1 fZ'.-'GU' -1 . -Iff.:fx,1'1e,v 'sus -anQ.-,n-.:.efffvsjf-sfiq-f-M1195-ffxzaffww,-',i 1 gmfrfffwigawf'iff'1'-5-X.'.v1'-vffifvtfl-'ci:.--,::ar'212M.jQiwwf-izwfi-'4:2'?'fw:f'fS2?fffsfsf 'mafia' 1 ff 'W 131' 3 Y 1 ' 'f J iw , iff rl Hi ,Q ' fn K ,,:':ff.'w:9'.- . .Y , if Q-'lg ,K-,1.,. 'w'w:.v:'f-.f,'gr,'1Mr.--'wPsg.h rw-vi-:i.1,x.-fyfzfISM H. 5,l xICQ-xF,1Lhf'fKf'ff'f -1I15f,2x,9:7wi,flf'IM-wlfifiuwiw.gT,.:fwQ,,.,,1k'w'w'1Y1fff r W' 1 ' K mg, gm, A fi . 5 2' Cx 'H ,r ' F f1,i,P1-'1.'u , ' . ,, ,W .2.'-'QEEQQ -i,pi:.::35 i-iw '-,f f'x4Y'p .w, ,fJ:-qgi':f-'21'Lg':x'yj1,hf i',j3-Y-3-qw-kg-H, Sty gf..xeIfg?-Lmj:i:1:mg'1',5?'4L5f,M. Q'W'g 1f,,3 H5 kf5'4g3Ivj1 -g'fgg'1YEg.'j'61 j5,,'5p1fxwuifx-qrs' gg-f13if'q'N1-I' 'X , 'E 1 4 'J C ' J ' 4 gb 29 ,f vhs Aw ,J 5 , ' 491 , .,v 1,6 1mAf'1vv.y,-' f w V1 -' f'-- ,v'-:mf--f v -lim-X 'A f 'fww' ?f 4ff- m1w:X f' A1 wi-,f' ,Kif'fw f.f'1-''f'.1afr.lfw 1-f'f-hiv'-f fi'.E'H fw HH' f','vYf' '.'2 4wi f?!i?'44-'w-fi' 1 W 7 5 7' 5 J if I NU ' ' 4 v wi w eil rw . ,,, ., .,, . V., , W. Q, .Mil ,,.,., Hx ,fl 1 ,41,., .N,1.,g,,,,l ,,,..,,,Xp ,. ww .1..f, UM-y,..,,1,.m..,1,,1,.V4v,,1 N r,,, i 27,x ls Nad .likihfggae W New 4 zg.,L-'xg mx 1,4 , s '1:'lJfa.,xw! .jfs 'f,'u W,.'g'f'1QX' ,,'f .Mqf ,' -1' Q gg vkffyqgxqzfy1g'gZ','fIfw1- 25 ,gWQw,'+1- f:.-W'Ji.. bp' .Wi-,w:'w1LTm,1-'I'gmfi-.:1'w'ix..x5.,'+wf2:r' ,25Fr1wf'1!:xW?3,iIw5'jf'V+ bli,v?v K 4 f p 5 Q 1 w 1 5, M Q Vg, 3 1 A A 7 Q M-, 2 .-'RW' mf Wu, 1.-'rffwfwf M-mx-mf., Qs, 'nh ,wfrnkizv 'ML,'.,fxT31,-A Y' ,a eff- 'v M-11' '+4'Jw1fw Ay-:MN rsh. 'W za 'H 36953 :wa iv iw. :Wm'',,,:e1.-W'mLf-Wf-ss'3uW' :T-xi' ' f ' ' Uh? 13 A 'S Q X N 51' X Nw V X iliE?fi'f'S'LxETw 5, 'Q'ri'Qffi4i'lE 5L,'lT' ifff'1'5?i5'i2ffE'f,'.2252'L-itfu'2flf'4i551W- ?fY'2ff3'rffijil'-15'iWl +2'5v'Zfl1'Q'Q155-fi:iWi'H?93ff-Ylflflliff fl''5'C'igiifzi?ff'?'iff7515iT5i:-23f'1i?5': N 2 '-?4'm3m'f Wm My It 9754 Ar 'rw ' Lim ' W K k f' U 'fp' F' L if w,,-,1, ,Vv ,V nw. .M .D .-1 , -,-MV. M ,- ,ff wfw,,m.,f,f,,f. fa 4' .L-w.,.,. -V kf,7--r-ww Q-,,.-w,f,v-I,11 ,.-,'.- Q, ,x.,.,rfhf-www. P A , - M N v ' ' Nl ff 1' fwinx .-x,,,!, -fn., 4,-g.,-1. qw .A.,- .yu A vi,,'1.f,gAJx!- ,' fy' '.N,,.M ,M .Jx g,,,f1.,n-s,.f W1 ,www .nfgl-X--X1x-: M'.wf4-+:Qm.s:m -,w1..y.g-. Y-,,w-Q fgfLw,w,:.gQulwfjfv, x if MXHLEQIQL K4 Y ,X K ? fgf' , ,B A , A, 1 S ,I iw 'Q 91:11.-N,.ff1: A 1 v':M 1- r ffrfvfemf-feeefw:+m's'4- 'v.1ef:?f2:+f2ra.wiff' X X 'fl m ,Q f ,- v mf' Q1 w f- s P . 4 , 5 'QL f-,s 1 2' ' if-1 ' wwf V-f'f.1-.Nik ,-' ,gl 1.-If-f ., 1 Q - ,UQ ew-'fglw-'Vg-, :ww1.aMgaf'.f5:,,-5' wg' 5-.M-:,.x'-ikfgfg., TLw'-f,-gfvywwwr-laffr1.',-wi1.1 -Q'v1-egg.:-,ff.:.fzA,-6 Q , , l' MS if Y ' 1 W 1 1 5 f X kv if if ' 'A 1 if, f - 'f 1 -,EI , X, Q- ,i HS- 1 3 H'-5 .fff'5 ff -' 122. - HX- -.YI fr, ' -,ff-' 'Fi V, fa ' -ff' A T E:-, :F :'Q,f':1.5 ' 7.1,'X-A-xilffz U21 f-'. .- M' iw , 51. fiIa - f -' 3 5: 1 Q W 'X ' ' ' xg 'qs f vw' K v 55 1 f g, A, ., , X-4, , . ..-HM, H ,,fgi,,,x- H K .A -,ming -wg, wq.5,,Y,ix ,fx.'..., 5311.1.inifx,-M-72.5.-gm,-?,,?5 nfm,-, ,. W 1 1 P 1, I ch J vf , -, v 1 f , v f f ta ,-1 :-H-N, 'sz G 'L . 3, 1 '-,- ww- 'fm I :Jw Q :H -Q. ?.. v'5'-9.5-if':19f'ff -'.-N-vw' ' ' ' ' 'Y 5 'X ' ' Y ' 1- 4' r f' 1 wily' ' A F' 1 A - 'itz-zQ'g,1,-fn K .X -:ghlgg cw-4431,,xgqYegg'fs-4iQ,.:f.gf3x,g,:.fgg.4a5'gC,s,eg.xr,,gig!f',k.f,.:3-f,if, , , 'U - 1 Q 9 1 , vl V 3 3,7 g ' 'Q ,fs if , J? ' ,w , 'aft ' A my 1 J- . , V 1 - K - .nm -' 1 4' V ' w.f,:-' Mg- .. 1-,,f-f Q wo, 1 -wkfbf3:,r.!-L,:,y,Iq-I-,,-K. ,V .,w,.1.,, N P Nw A , v A X 5 P 1 N, 5 x nk , 1, .1 4 :- bf:if5::'.,f-, , .. ff-:Ava-JPL. ' 11:23, hw.-f'v LW'- ':2'a:I,j, '3' ff ew x 1 R .1 P If 3 H S5 1,5 fi f s .-' A5259-4-.', -.P 4' .V K Lfgf!, 1,51g-'f' . f !',-:'L'1fi:-f'- .gk-fa'gf,gf'T':-1f1'f,6''fle4.1.Ev,4323-2f,l:1jWim-'g', f x ' , Y I 2 Y -,,I Q, V ,J ff lf yi 1 if-1 15 'IC' K ' 1 . , p - - -' ' ., iw? .,.J f., 15-if 1,5-f.:r.L,,,11.1,f'AHx--V? V' .mv 1 , Q x v 1 1 1 r g -, , Lyg: , -,--Mg. my , fH,,,,. - ,. f4y..J ,, ,. L, ,X-. ,V Vx. fy. ,,, ,',:y V,-'J-Vik, f,,.1,,-H5151-Zk.,:,r x,,g,,.A 5 ' 2 n Y I fxf' Al , f ,g ,9 L3 fi , I , I , 1 1,7 M1 -J' 4 .' -' ,:.,-4.1 1, .-Va.. mg -,ti ,'gg.'::.,'fyu,, F-'CQ-I ,,m,f,i+v s..,fr,-,,.i.ygfm,k 5.-:xy ,I A i,.1:,':':-if , 1. 21, ' ,fjxgif j . ,UX'f- ,x,vf,,-,flfb-,fA'1,:-X., Scif.. 112-,T15.g, Af.'Q'1-FS,'Qp'-Qrh vg5f,,'vif-nw-5-'lfaf-,I',v,'2',-Af,-ms-,,59,511Eff?32:5i L'5,i-gi-Ffff 'ff N X 1 ,K ' ':, 'I E, if 'Q I4 :wg 'WX 3, Qfx 1 la' fx3'5,2'ec H1,,3gy Z' P 'M S ffiff 7 4flf-'-'Za'f :w4 sD 'V I .qv 57f'L t., 2nf'-A'1fv'51ffag.:1 A' 1' 1 5 Q vq. 1' Q fx f 6 + ,gif R1 J , f L A , w., 1, M' f 4:'3:1'-MQ?-f'W' ' ' lfff V-V .'w1H'?LX-fff'-Ili'P 1fi:Iv'E'F1Q71il' -553Qff1ii':fH'f5ff?iii fv'fJWQ'. f ''fi'1'E..'f: 1'K1w5'w1i'5'ff2?Ni'-f 'fiffl'DEW-9'2lti'1?H.'rjWPff?5 H1 ,Z K f N 'D L 7 -'H 5 M' if My f' 'N J AMX if I 'YZ' lf ' fx ' f'f'i1Xf?.'f.3 -iff, f'f'-7fi-pi :A-1' lwffil-3351255521YfizfiizJail315lfff',9f'9E'?.1f,fiikff'flfffa'L'.?fffi5f5?L1 ks 'fy K g M fi f,, T S ' pw ,W vg 121 3 U 13-fa-,M '13 Qapfsb ig f,-41 di 2155 'Mahi' J'i2 X525,'3gf15g4 X v fi- V-X HZ www- 1,vf,,- X fy-1.0 'H tg -fg ,,' ' 'wzxgf'-why, :few . Z- ,:x4 'i -'va-,'f',1w1g ,gm Q yy ,, w fiat. gay 1 U W 'Fc2f1'r5',,2Ef'E--49.1 1n,1'.v.':wfglwif.yfffslzwsszwjizr-X.'2:'ff-:1mi:xgf ,,s2frf-if-givefy.vGi?f,5'fgf'Q2wN'fl-:gf'-zyfffwf' 031' Q, Q ' Nj V w 'J Q ,M W 1' uk,:ff?, N 559 fafg fkjifffff -Y ws M ljgfig, m,liY W xi Qppvixl VLH ! fwrm:1,tx-,' i!M2'2f3'vv:1fT,f,1'r-wma -,Gakqgif,.:5z'e,iZim..:S'P 'i.,1',,hisg:s.1,.:f+Q .af giepim f X Q X 'I fw A r I , ' w Y 1 Q Q53 'if ' W M '.hs?S y' 15ffffs2ff3Tvf-1 wf1wiw.vin Nfe'Kfe1fwe'eswx-ffvi fsfssa2-ef' fi we K3 ' I2 2 ' w M Z: -H 5 Q 1 Q M, 5 mf ' 'Q . 4' Rb' ' ' W A 5 if f',r'g'.qf'.hf, -fyxjffgwf Lf,-g,x,,,..f,s?.'.',.-Jw,-, ,klldgfyfxiwgzxM,-Y-.ty1,:rfL,-f f-.f.Sm3em- :FQ2'.?'.4J,f511H,fi,:2Xxi.fOM'-..-,gi7i.,fgLf5Fwlq:?,f3 N ,z 36 f. arg fc ff HW 4 1 my ' fx? 1, DMN '-Mn X' , J xl' 1 X W G TQ 4 1 Wd g,g4al:5Lw,,, r.',gf'x-,'3'j3,'j4.f5If!Q'-53,1511.31y,',-41,13,'ffjfx,q14f.'!tQ5 QQ-i,g? ,,,.'2i1'Ef1aQ2Q:,1?'LQ,IgE'1fEf'-,'ixq5.i'.a61qfIA',,,q, ififigj-ff:f,31,g1?gj:Q-iglfjgv 5, 'F 541215 iff' -?FJti.,':6':f1fg3jy , N A ,, 2 nk , , ff 3 ,g Wi' L M AW r X my ' X' X ik 1f.a:fvL'1.zz-'21ISL.-L,f '-,'J,'If,x'!:L'ff, .Wy-fam fh'?iX'f,4.'.-'JU1'YW-1f3fi:5',Ap 2.11212-5g'711,, Mygmsf5fwa,',?n.Q:4fr1M3f,1ftL.5ffiif:WW l 2yq.,Ji-,ffxi 5 -71 WX ' 13 I WE 3' . f I' G J . N A Q , 'Q rf Q55 W4 'WSWX 9 51 A x '52 1 fx ' ff,sf2,r,,1:,,f1i,l1:,.,,-.5,,,1,,f,7-mfr' uv:1.1-',v,f,.--V,3'-'ffY-up-11 ,nmAA,-f.xmq'gww: .q4ym:w5uw.:,.3.-ga'vi'-Ywnxl-'1.m.Lw1ff1.,'f-in 1. f' 'H vi '52 1 ' ' fl J x E1 35,4 1 W M, Hs, wg 'f jx, gm 1 f 4 Q-,f'2 Q pn ,g,f1g,4y,'5,3, 'flugzf 4' 'fJg,'r::,g-.'g.'g, -vcr, :ef -P.-1.2,pm'5.u.f5s iE,f4'f,qffl3, :f?7':'g,ruff J:-1':,,.Q,,'y:,g'j'f.fJ r W N sf -'G 1 I ' ' YY 14.243 '1- 'f1u::, -: 1A f 7,152 ' .rv 5. 5 f,'21g53f5 5 N f f' 2' ,W iii giEQiQ1QX5i '2i4+Qff?H?22'fgiff f 33 14 W W W3 ''V'L4g.:f:1f?:f'ib:f'lvl'iirfjj5:3 'f+:55g-?ff'fy3? L'YfiafQE4.5Q,fi3sE21,?5-qfsff?-1f,12'Tif1.s2fj.'c2i1T--.-W1'y,f5'5?J,fl ' Q ,xg 1' 3. 5 fi' ' JM-if wi Q -,gif 'C N2 ' Q If-1 , rf 5'-51' 9 Q fr-'waL-'Q .,',-1'15!:.',.ffm,'5,f'gf,'-'.F515!k4'1C'I--EMFPLLGE1-iii'-'iffPEIEYT'Gfiiifbifif'-- G4,fT1ZFi 1i!P'biiiifrfifv.-2'i, 'i'25r55lf2612 '-iahygig59 f 1 '-I 1. 22 ', 42335 gg gf-' W fig, 'lafnifg N2 'kiglglfj' 4 X S lr xi- ke?-Q , Q L.'f-ff Lu V-'uf-iss :ff.v:,.Lw-'L'-ii:1:',:'.''.v4f1c1.f2-'-isa''--'fc'-in:,.c..,1- fb-.,Q-'wifi' r .gg QI Y w fi Q ' A-fh . fi 'wr-S v. 1:--W'i7 E1+:,'-.fax Jaleqini' LW'--if ::v.E','Tf'f'Ji J'n'.f'1:L2152 -:3-T4520:15-:s1',lfaQ-f:':f,,,rfqC'i1:,1--Q,si.,4,Q aerf F914-' 2:W'iqr'3'P f 'S + J-3 'ff .sy Abi , .1 if X, ' H 533- ' ' ' gf' fm,-rf, 5.2, -as 'f 2-Lx.-1frf, Jg.fa13'I'im12-.'.H'f:,,.:1:5wk,.1-f-'Mm-If.Q-'ffff'-fl fa..'Ef-.'f'-'Sf'-'1Y::ww.:w:,'1fA-wflm'4w.Mm,+,qfu,,,w ,v . ff ,1 V Q S W 44 451-2 A Q' ' A F gm . 5 Y y..:y,g-.4,.e.j,,'611,411-:f55fa,ugq,.,.,.,,fgwf53.1-A-7--V.,f,j452'f,f:1EgH1'eaxqr2-,pf-1954:-1i.4j',if.',fY-r ZYg1S:1Lm: :g!?a'ygf?'-:,. 5',v L'ff'D ,,jiQ.1 H ,J H X, Q4 gig? Y 15 A M f-58? ' 'A 'Q K 5 E, W ' Q, wiv' Q 'f P67 , Yi' nw x 1 ' ' W if Q' x ,1 f, ugAewgf, , ,-1 Ak 5'3g,1fgg.f?1, AM, 9? ,Q we 5, 1 ggi. 5 5, 'WZ 1 5 Aim - wi qi Q, gm 1 1 :1,wf,,f,u,f-. , -,':-Q..-fy. f,yf,11.1:i' 47... g.,-,1,y.-KIM--.f.1-v ,. .mf ,::fP',31. egg Gza-.-351' 1-xx,an-Wy :hh-'zal,Em,, 5 .sg -- 4.gzw',,iff,:. ' L,-W 3.26 y 1 fs' 1 s . 1 5, :W 3 ,fir gm X Q w,,,,,.f,., X, 4 -SA ',,5wf','1M .,f,,,,f ,,,,. . L, . 55, ,Q Q my 1 v 1, Lx Q 1 .P nf mai fl L in , FL 5 I 1, J SWG W ff ',i3ywxg?j'g,2ffg4X ?Q,,+.fQ 24,6 ggqgggiwvl 2M,Ji,g2H aff? 'ff , W ggi.,gqyq-,Qg'.,S,'gfp,if-.yi-wys.,wygp'gg,H5H'w,315-x2:,Q',,'1'-'-g'fj:fffL,'j-'5vS,1'f'QiA,,fyy gg fy cf-K v fkgh5l'kfw5 f'J Mg. X: X-,Nga , , Q 4 if H mfs, 1 3,5 1 Vx, ,ff F Bibi? Q Y, 4 fpggghf H H. S W ,N www. ,, .,.,, , .rg-fl-1v,1,,1,,,. .e. f .. M, ,- -1 3,,,,f., 1 Y xy- ,- ,1 NV Y. A. HJ. f .N p V g M s x, 2 ! - Q A :fixup yvfffv 1 ,- ,fx '11-.',-,-fwt'-1--f,u.f'ff51a wwwflf' H 'fr -Q-wwe .K-4 v Q, M:,rfLf'5P.,X.-1I- -.f.f9'Mw1'.-W: Q eff: '.-.1 , WLM- FM, c Y' MI ' 'WW 1 f We x 1 fy - 5 r l PP is W Q an M6 fx v , , 'kgs ff ?,'-quiny' -f:.p':f 1:. J1',g.:-mf1:15-Q 1q-,ce,'gf2'.'X'g3X1-e,f,aa'f'4 -:fam -gn,yfliwg-:.'f -'L-'fy 45' AH : 7 f' x 39' ff A lx Wi' iv fgffgvfk was V45 A U' 6 ik aSf'f4fg::5s fgaflwfim W ,Q-f Q52 fffff ,fiL2'?Qif:5. if :12iX2yfq,iH,i,-35,312 gig? 413+ 1? 'Rf , W5 M5 M 7 2' K ,f . -,xf'v',ffiH-5.1 e 'f:If':,,5f2'fw,- ,f'f ':::'w'--ffmsv,:',f '-J., A l,?s5.f,m-hk'21v'1.1.2, i'-1 -f?'ffQ::'b! I 'ehVQ f s v. I 9 T' L x Q -:uf w-,.- Q-irfwfw-..xi1,,.-mvlix i5f,e1.,.c1f.ff'J,,,z. wx- ,rf 1 ,,f.-2,1 , ,, Q, V. 1 .V - ., :,,xg,,1 qw.-A wang, r,,,',!-,v,'1f1q:' WSYSQA., P+ YY f P , W Mi A , Jia Y W v ,Q au! Q, 1 '13 .- 's -2 Maw v :rw vw: ,1x,f.-.w:.+Arf .' J.:,w,.f.,-.:.:.e:-14inz.-My 1 5 M swf? an H A S 3 9 W' -51 3 'P 1 , + 2'x'f1 4, ,f,,5f-- J 'gifs 1, 5.3,,'f1':ff-p:- ,-.':1, vmxqg 1-f,'vg..fw!,,w.Q xw.,3.-,Q ,N3:..15.f, 4.i,.5if,:- gp:5w,w ,. ff. -, :w,4,,,, ,MQ nu fwwii- -gfg, 45 wx I., .,f.' X If 3 f QA gn JJ L5 4 1 1 x I V fa age, , '-,P ',:-,L.nN,: -,..11'g-75'-. -'fvmfl-fr-' Ms 1' ww maven T,-kv '-vm' 'K .'f N'6Y.f4.45X-:.iQ'f1!wf, '--gr-:-QA f :4 ' ' 2 , Y jg! 1 55.1 QW., 1 4. 4 J Xb 4 1 f H-.V H15-'K ,,',g.,,v, . L-ff-1.3--l,vg..T.,'f?:1f,5,1Zf-Sw-,fg-.'Vggfx'-'Q Haw-,.3 3.Q41 ,1g.pL1v.xf9I,cw4,-TWfm1,X',5'+:'f4,i,I-nr,J'-gg, Vaq.'-M13-ii' gg:--Hu?-Q-2. v11,gx2j-L!fpf. ,W--9' H2 ,I . ,k 1 , gi SQ. Y' A , AS 5 ' Q 2,3 nw ' 'gk I Q 'QV.1,:'- , .'-11-4-IFS22 iiaff-fl!:F-Q1'fzf.H.1,i2'1V'f'W:'w'r'f? i:4 .wil-'221:i?43P2Wf,.-vsffffXf. ? . 'if b iiffftgi H ' V 1 MSR 55' A 2 'wr '-2 3 f ,Q 3 iw? A f I ' Q',f'i1ff .ff i'4sf-':.f' '5f'+ew2QQ1:f ff:1?::fcLQgeieiifw'Lies3212-uf if xl' 5 K Kiwafiffi fT?k5?W1?Q1LeQ 1?iiff'V'W'3'li M swf fb 6 Wi ' X 4? 'if :G-A . 'wb -1 - f,'..,1y2f':LEJ11,'z.-5:3' 1-EIC'-f 'g-R'-.,'i,'viii' , 'Zia ffii ' ,'-img -4.f.11 -Q11 -'u if-'g3f W 'Qv1i' -' 2, 2.4: Wi' jg: uf. ' 2 1- iii 1 , 1 eT'3wi1f'f9w'w?fTf-f- '15:J52E53Q.E+2f :iiiQ92-if :1S3?rff:12'- 'E v V4 ' N1 vi 'Q te 6 '32 A' fill' W1 f 'ff f'f3i1i,ftf 1f 2 f5A'g,3,'f,,J.Sa26 I 3 fo , fs' uf ff -iw f 'fffuiff15:-fa-La'f1'-ffiffwf2ASf:-'4-:vwz1.,-wwf ?4':wzfsfzH--W, if 51 'Y ' fi f J ' Y W 1 iff Q ?i2,y4v V A WE- 'iff' 2391 'W S? ,df H f wi E22 193' Q' W W5 wi 43,5 f, f-:,,1:,,.'sjQ1ff 1-:':3f.gwgeJ, :Q-4..,,eff-,ff'94fw'f?1xr.:Q,.ffr,5:p.'5!gin,-'iiiQ-gm14921-',ffg2:.:'gffffw wifi X, il , 1 5.155 , 21 R u x 4, , 3' P 4, , M .2 S fi, atv' .'v,w.,1-UfffmA-,'w5.,,1-N'i4?,'Y:,',1.x,,5-frfy.11e,'wf',-.Q-21.-hef'ax',ug,'g',pfef 'lE+1zig.-Sq '.y,1:2y,, ,-Qgwmgzpw-3,-'fl-5.rH2:.'fLbL!.,,w:,qZ+kH',-Wh-mix ,fm mm, 2 9 +1 5 ,QW x 712 , J 2 WM Qsfgf ' ix S 4 N, 951' 'Hvfff M W 1 :gl X 3 ' f , v.m'?H,gqf,, syn fy'x,fx..!,Q1:'5f111-5miie.,rw-w,':fjw: m.H,.,.f41w4f.'.m?,q1Q,s.:-,xfe17qg1f.'m1r.y MQ .,g:1.e,.-g44,.y,y,m-1.:g::4,,ZQ,fHmeNiff-4 J3Jg.1'Pfe: w. X Y f sg v , 31, ui fa .ff ' YW 3 Xi 1 , 11 XS P ,QQ , I f 2 is 4 1' ,Q fv:-K, K 'f 5. ef. My Q xv-1f1m,,,1 1 ff ggi I , K :G N33 5, , , :N ga, ' -L pi 1 W' 'zz-iw-J: -11 -ffffk 'www' I4,.,4'Ar1 fx 1 ff. 'vf.xW 1,Q,f'.'f'Av2 f7Q9F.-sf,-'w.y+1V.'fw', ',.'n?!4,,Iv,5,'.u',f.1f,42h.1dv,'? 2-.f', .J y-, ,.J. f-+C gf My-4 .rr xviwfr ,xii yy ,, H+ 5 ' Bw ,YI 5 4 9 0 '31 f J Q51 4 M ,, 'f 1, Mg:-flif-.lr-'.n,,'fw,e5-.1wPv.,1v'.'fe,,-. '51wgyf.w-,-ffm:mf','wf,1,i1L-wt:-:Q:M2-fffwmi--Q,wf M :mmm wimy,mm5fwxtsGqq:w..:'fQis zlfvafp?-'i ','ff'H'2-Fi:ff'e1rwf 4' :k?L:??w1 fam 1? Q QU M H , f '--25x 6, Q J' 'ff ff gay ,J X 1' Q lE:blf'xf'VflCf, 51Q ,,''J,5,QJiQ1.'y1.'f.35 ,-1,-12':'f3:-.AjI-Nf:,Jfv 5XqLi,If11-'T1 1,'ff:'Z'k?f5j,-W'fUl'xh,1f'-,-:'g5lf?1Zgtywtilxf, w'e:'-miflznQ-wpggm',4gygg,.v ,mv fy-,,L,11v:,wy25 N 3 4,11 vp ,n fl ,NJ M ,sig 1529 ,vp 'fl Y 5 1 3 4 gk W - M ff X We M yf.',ifq.',,5 H :4:L1W:f,,E::Frmg.?,f,f','f:f,f'iwfnzfw-afy7'ew, 1297151.Qvfygr.wfgm-:-'A:4n,1y.,Jf,5,1-zg:,wf2:-ww ,:,f,'.Nm,g54'1fg!q, f,agfg,,'f,L,1x:,l' ,mae1R+,',5Nw- . aff Ml 5232 is King 1 f wig? 1,'Q f 0 4 1 K y f vjy F WP 32 pr. R , 'T'f'X!,ff .2 Q25.1-K.mS'J'-.2-',-ilu,-'f 1,',N'fQ,QH't:5-W'.'jA,':m '',x-Z-mi' ff' ,gi fG:ff'Y:Jw i'1ygase,f'f?'',v'S'rf1-Nl. -5:84-1,f,N:.',yw1z'H,sgfa'lu evzhpgw 'Z''-.'gJ.'+5':',-fwfrIJHZW W' Q V E x S U i W V 1 W 4 ' ' 3:- lfwtl-i2vr W 1' 1xI,'WfL iql'g'fXif 2 fe M350 aff sf 'S 2 K ggffw 1 Z J - K 'Eff' W M 5 5' gy 2q's,xm+: sm.f2:gg,:Sq-Wwee-2,22V:54:f:'f2gf-Ai?-:v:f.fL-,xy:wwfwrgg4gg1fv+qMg4251: f..,1.'ss-1 Lf?a3'2-W4-sQ'f1' , I 'F 1 X wif. , .N 5 54.2359 Qgfuf' X ' 1,94 851' fi 'M 4 E: E 1 1,5341 -f-' xeLY.i',n'1 I-iv.,f.,qvv:,-425.'ETHG7XS'g3f',, 'i:f''-' ,,'9M ','ff f5i?K21.6 4' :EWS :Y Van-:WI-'','--fwfif-rffvi -:E-3:52 'af' 5 4' '1'G,,.p'g:AT:5g3 Q gw gl A 1 1 L X pg , f, : ' wx 1 'E' s, ,. l ,Y 1 -Q , 31,f'N.' kwin-x1.'7 xx,,1r..,x,:fLf ?wYDw: wk- Mas'-5,3'b:.:w-VX: 01:--Q-q..qf:! ,P ,- -'.1,..uff-A :x9.w-'Ma ,-iff..--,.'-04,-Y-:za 2, -fa' .' iff' 'M vw L 52395 F Q 'Q 25' X-gv Q . sv mf-ff.,-,55.2.:f,X'f.5: -5ff 1f1w,1-wffwfvsfffgfrwi, 'ML-.-Hur-6-X'mmm.55p+,eJ'1a:m-'1-ff,:-f-- ew--5:-'M-:-iff : Qu fi, 5 sk 1 15. w w , if Lp 1 Y Q, fb, 'f 'FEW'-g'x:T1':-' if- '1,pifwrE-?e:2'Tf'?,f1'4fi :Y.'1L.ffaf2fif:!,L43:1-fffffg '1,,'.zw' 'f si? 'N ,ea f ' 3 J W -K y g h 'wf 5 yu ?f'XIxVgs:1ffifW it Wa? gffelf Y' 1 fa 'pf -if 'Q Q5i?m.'Y5 f' f fx Mg 1- 'dl ,, fn pg ' 5 we ,sfljkwff if f, w X , ig Qqw 'vff 3 PDQ, 5 , '41f'?i2Q5'fM, , QL lam ' sr G 1 ,QA ? Qy1:f,'-J,a',m x A .w:f,?.gf:w:f1w'new :Viz af .J':5.-wxxrf- ', 1, S-52-1?i5'41G fi':,-Q' ww A-1-Aw mx,f,,: Q::'::21f?':mm'z: A 349, . ff 4- ,1 . N J., ,fa f w , W -1 af '-QMS --,-,nh- . .LA -'MM-.fin A ,MM Q.,---.vk ,W - -1 1 -.ju-.X ,auf-, .,-ww yf ff,-1f:v.i,,ff'S .1 , A Q,-,g 1 'N , , , fn' 5 1431 -Q 3 fy I ,rv -1 -, f f QF S vgm, vu. '.if!w'+gf,u.-,.' If-Qv, :mug k,yw,xf.w,f..,,1-nl, ,V 'tw ' .-WJ? .1,,:g.x,s ,,,f,pf,5,x1f-:va--5 1: vf , .,-, .A ,Vg-ta .W ,Q 4 .:.,' wp: ,-f.g4-,Z?va,5T'L, I? 75 L4 A1 'Spf M HQ gg 2? ,4 1? 4 ,fa Q I M11N,-lvw,V-1,S11-':.f,f!:v-i:.1.:.xi Q.-71,,Af1','Z:2'1'4?Z,Wu f,mf.e,.fu::1exx1n ff1-WJ.wbzs.fA'kw?'fsm'rn.,:4f,Q.-2f,4:ff1p? ,wgfgvl--5'e1 'F 1 yy Wu, 53 Jin' A-5 sf-'Q xg., 99? gel xisf, H' ' v 51, ,ff , va, E19 'Q aff-,ftp-,f.-1-m'...w:2-fvzffxw.:Z?1ai'ffwM,vw wwf:1'.'f,'-ff-Wy'mf.E,.g1:gff:,ygfgfs-fw..,:wf1i. -2, 6153391lfg1fjS,iJls52Ug,:42,3gym- ,A 'me ,gfWf:vg, e im fi 56' wk g If ia A 'fu T ,, ,gs if QM H EE 3 5 ff ,3 gy! -, 1 vyQ::,f-x-,,qi-fn,'-fw,gensQ,-wfaL,'fqJwrig,5g?f332Qg1f+,:g7:i3 :MQ,,gJf,,,,+.w,,hg,f,.wWgw .5591fp,-,3'fy.'-:w,Lg52,gP..1,:,5:-9.if g,,1Q?g2W:-1g.f:,,Q -vx-,fm-325.33 ,1 'R 1 QQ ffl ,?2,ga?31xg f IPR H3 gg. Q jk ' jf w fgngigfg-gg in ,, gag ff--.mf-'obrisnwl-f-1-'rww.,1'c' vm-gm.ffseww::m,.wQ an .ze 11:5-Q11'.4rgv'af1:' ff-:wwwmrfsw-.-mfr? 'mehr' ff' f vc' xii up 2 5 :Y 2 W we Win M . M 1 Q N ' 1 E -Q1 iw 'y1ww1:i '1-Avu '1:'vg-iw? ff,L3'r- 'fyvifr f- Ew1c!e4,1' v'.'1X.g'WE yff'ya.- S . MIT'MJMV1''- 'M-K-f.'f-mf'Yh?21-2'f 'a-'Q'-A11Ll,:f. '6CCx,w5 5: 'V' '.U'4:ff1H 'ty-, S' f J' Hr sblpl- 1 LP? xg vw Y! wp with ' . Fig 23' X 3 ,W ng if EQ G 'W 4 'tk 2, fi- M',',.v,1yJ AJ.A,fw,e:.-M1135Lf',.wi,yy,fL-a,,f.fg5,f?,f'x,-, -,-I-'fy-,ygxxg,Nga-'Ywin-ima' ww-f,vL:J,w'L'-f,f.u:'L. vb-.'m'jm'i:Pzb'w,. ga-v.mf,'l -LM, mv W Q-': fig' 3 P W5 gi' V' '51 X 1 AWK PM V Q SL P 5 Q H ai' ,W s fn A v ,J w' 1 ,243-,Q , 2,3 3.4 my 14.51 ,yJ'.,: ,g.f,':4MX:,ri-'- '14 ' 3 ha. -.1q,Agw E 1 f.A,,,,,1i5mw 1' Ln -,1w.1U:,J '1::4gf :EnQ'. Llfqyw w ,. +,.,.4x1,5, qff2f3,142v T ik P v U J if 1 v ' r I N 1? 4 M -3, ?'5,!gV l1:,W 5xiE'x'4' Hft'?- 'xiii'k:1gl -glfazyprfr-'JA l1ii'J1Mq.QgZ',N' N133 R53--','69.x5 fgif:Xf8'W:175'.'v' M1331i1'38g14k35fr,' -mgf5H:5SQ12Qf'5 . fif'.,:YLgz yf 'fe,'i-wq,'wi1m2?F5 ,f 1 ' fl W' W9 iff? 5 1 X W Q?5,ig'2 Avy' KM 355' A Q 5 A 1 3 H' y v 'ff 1' gg ,affiz22:4Q711:fie5'fJfzfnY '1:qL-W:fvsmzryuzm5'221is:f1f,g div iw ' 9, , g JW epgiif, 3, 39,2 Q: .'j:Q'gq5ff?Wgkf5 MB ggfivi Y A ' gm if 5 W V W '- VH My , A43 ':'w.R..u1','4jp'a,-:5i?fyi-,g.5J',-Rfs,.Q,fJfim',gf,:.y'-sr' 553'3,- Lf:S5,i-,Q-M55-kip,,fgf:.m:rQ'ry,v,fu:,,,,,:,'.-?,g:'g,'nL,4r,xLg,,Q-:Sig im3'fA5.J4,,5,y:'g:,ymggg-,AWg53::y1','l5,,'f4QI U, 1 MVK ,x K 1 ii M W, P' 1 A 4, ' f CQ ,W ng, .1 U M5 , fx f'wH43.',:,.ff-.. g,nw.1'a '-Mimi: ,-..,'5w'!a!1,--, 34:1-,4,4J.f'fav'.:',xw55x1,-n,'1-ww' .gJ.,5:v, gable 934, wa f'-,yf.'r.w,-wwjuf-.5 'f:,f,,,3,g-Wyu h,,,.,3,L,y,.A,f11,.,,,j.Q gg 5 x 1 , Q, .1 ,, U f ,QQ . Q53 13 bg? 'a H SQA in , . ,V ww JW.-v,f1.,,, f, wrAm-,Rm wg5,-mm:,,,f.m1Wfl1,f,.f.,-M-,,, QW,-f--.-p1,w.,,Q,p4-J-,WM. ,NW-,,,,,.,,,s,,g,,,w.. y wr g f ,3 , fy , 5 , QP s A gi L ,L va, I Ja, gi n f L A '..-nib 1h .'Q-i4 .Qf-'f 'figWSE:-1'fAf!F1-faizfzghi'ffYf'. b-:g'9,Q+.fvirgfvf2'.Wz5Y-ifw f,myi1iPw 5:-+f?1q+'.'r11ffg'1-.-1-m, t'KT 1'f 3-izfi 1 1' rf M- 51' ibq- f w'f,f5:qff 5 will lp, In 'lg 'ga , L 43. x Q34 , , 3 Qi rg ff ' ,X 15 Wg? 1' ' 1 3? ww v fvit-vrfl-f .np f., --vrmw-wwf-:cf Aafizrv. in-.,.H' ew 'Q Si xv N V 'S ' QM '31 dv 'Qs it .vghv 1 .5 M5 3J.y1.'-. .-,:vfSzq-sjyfwj pig, 11,555 ,,Q: f'2fy-,,,E,- v3:Y,h34.pJ:'E.,.mx,v1,i:5,!.-.'-f- ?-M14:vC'1c'5 1-,x5.,'+ w'-'5,vf4Z'.p-. ',.1.,,w,y-:rv ,tw-,',1.v K i-me x ' ' 3, ' him H' ,, fx 3 Y 4 LL P gfyffwgk 2, X 6? 'u f v,, a. L 4 V31 .Gy 1, f , Lf., ,Q .,fg,,, -, , .-Q -11, Hz., ,wh ,f ,yr ,',,.e-,mm-Au nrfym 1 w fb I, v M9 Ia x N- 1 if f Q ivA-22-ifqfsf'.:1P2'v1b,,fdeAX55-'r'iV2'a5?'E1- 1Qew,fecfiwvsazMig,-532-4539:-kirifzifaqflfukyyf.415Q1'1f'1 sf'-jfy?i:'?1nf1e:ffljfgii Ji ,, -'ff 'IL - , 9 'M lx? fig 'f f1ffA'? fF'.'dffff415, 'e,l3'4-330 Q Pgggipgyyfggi 3 , MQ' ' fy M 5-fi ,31,g.g,.5 ,uf hJ',.'5 5,121 5, ,-jyg5'K5g-9515-ng'w'y.Qj,'r. .1 193,fgf:.y,Q522.i,f.'gi '-3n,.5 ,Ez1X,.,,-.Q:f! ,..Q?-1.5 1 g'1,.,5g:.,,,.1,l,f,fw,:-zf--j.xi1,,,,L 3, . U, Q ,X K . R - , A 1 ,L 2 A ,S .Y 4. L1-,Av ., ,Q-,,-.14 A. .JM ,ifhf-,.,,b,g'.. HC-, -,-5,-'rm-..r,,,xf X-,Bm -,gm ',,f.f,y.5, f -ww. A 'vmyff ,.-. uf' -, L. :x,x'f4-,Riga K V 11' 1 2 2 v y JN, 2 Q ik -lqbggf -gi g I 1 2 H921 54' ,ig , 3 4' ,L j l2b1C,1h'-lm 1',A1'-.'ef ?c-1,4.1-'.Jf 1'1'2. Iii-Sie-,'1f9.f'15'f 4:22 L, 'WNif.:-M mufrrflff-2:-ikdanf'Pf11Ib':,.ri-1-,:J f3:x.e-E2-J'-522'4':+- 5aS .g'-, '3,5fr?'.231? ? Ex 'X s' 3 4 J f 9' N 6 Q K ' W 'WN 2, .M 'Hx M fi w 5 x ? f H ' Y ,M vw .sf1:w -: :-QQ-,..,1,.'-f'--., .:.fggf.',i5,'.sg'-2',:,',,ge1' 1ff1bgv'a'41:2,f.,,Qe.'gs'f9a'k7viz!:E .',v:g-1.4, ,ig 1, ,glgn-s,4,f.x7x,3, gg.f:5A1jr1:,1f ,v 4 ,x ,, H X , Q 5 .4 H my by 1, r, ,, 1 N L3 11 ,wx A . Jr? f x.,,A Q:-,.:-,a-- 2-, ,IYWIQ-a,f1,w-r X A.,1,:Q1V5.g, -v,,.,-,f- pq,,,wlu v.,a .Q ff g w up fu ' f ,f 7 , , 'a D ., ' ' L 5 11 A , WS - r .gr 1+ Qu, ik N 3 1 'P .Q w..3f.gf iw-1sc,:v 'f.,-..u:-e.f,:Nn-fvf--s.:p'f-.,.',fsm-,fiflgevf-:4fg:v.,5'.f---rl-f,Q,-,-A2gv,:f.f:,'wf54:'5w,zvwfw' w,n'f,,.-315,-ff, f .,4.m,1 , 1 ' ' . Q xx, .,- , ,M wg Q ,,, im f , P f ix 'fig ff' ,Q-' Y M w.u':w.-' fm,.!W 44'--0, 12:1 ug.. ,:q'-X,f,','Fw:A: ffwwi,-'1 uh-s.!,1,'f'fgc-wi Alb'--'v-P-, wf'J -'X 1'E1 f'1:S.1'S3f,..v', QL -2 wwf- mi. L1 ,V ,J v 0' r X v I L , , 4 WJ' X W , , 3 sn 1 NS' 5 . ff Y 4, -' Hi , , A A41.Q,:-.:,f'-'- 1.1fx:.vl-,-'fv,1:t4'.,,f:y:1:..:,.,s,,g5g,4ge,fw'v'fig,r mv,.s1af',f4:5.X51:p:2w..'Qff-v.y,4.f-,'.-wt-'ui' MAPS, vi:sc-,,fm-:mf51??',!1 -,',x?,.v,.-.nvfwgu M f. N- ,gf ,p ' ,lf ,, ,qv H wi, Q, ' X f Q . A Y - If ,Q ,f,QJ,f?v4 'SW ,A , ifG13f'.. :w'.'2.q'im-,'v,,-Nm:'1.wi.f ,Q,1a w-'Q:f:gJ'f 'rw-rw'-'fu-,vt-1 .ww-12+--A-wf.Q?-X: gil.-nzfiv.-i,m',' ',wwi,1 f:'w.v'2:-2r 4,'-Lf.f.-w'f:qf- 5Srfv?'fl'. f n - ' K 1 1 ' HI. .5 M ' Sf. f . 1 ' I 11 A .x , HH X' f, S 5, Q 3 1 5-1 f wi M f ,- rw Lf:-1-x v Q,-Aw 1 ' 'ff' .IMF-H1-' fn.x,-:n.nf,:m.-- -gms.-',,-111+ ,v v'-1 32' Q-: , -K-:'f--My-iE.+1 v 'f 1-,L ru-f' -:43 ,'v ' 44 rv 1 1, 1. ff U 1 A ' A X 'CX 2 f xy 1 1 4 13 U 1 Y H r 91 ,fy el 5 'L 4 QM A I f'f,nz,wi-xK- rx.--,. .,w4f4-f.-J.-4 -Xrfgfm,-,v ,r, . rw-,H-,.yp.,,: ,.,....,L -gf-1,1 qffigu. ,qq ,,.1,-.W ..,,4,,'1f,f,1,M--W4 .X Jwwu-P, ,fp , 1K..l'..1-W1 4, 'mf F x, 4 15 . f , hr ' I X, V N Jw ,v 4 f., g f,, kv j f f 3 ,Q 4 mf in B , ' Q Q., Q, u.. ,avg ,g,,,,wx4y,H:.g1-,A-,,,f,b1.,,q.M yzrvgggxf A-Q' ' w,'mg,,5,415Z,y,., 1g5,m,.,.w'Qf,g 5-mug,-ffm L,f e:pg's,'1w.gvf 61' A 'qXM J.-,1-,exif 1-w ' 1 v j f, s 3 1 J , X94 X , , ,Q W Us AX, A I ,K ij 1 - Q , K 1 1 A H+ ,l'f:..,,f-X-W-,.f,J1,.,,',ff1.72,-,!.,, 5. 54 X . .1- 1-.fwwm.,,,, -,W ,Mk uw A Kylfsgw-,,,-q,.f,1--A U w-ww '- ,v Q' +.'f ' 4, 41 1 In f'l x Y 14 1 , x C M! sg ,L X73 Q1 a v r- 1 ip, . v 1 I - -H.-ww mm ,,w.s'MW'--,wx1,3-,,-- ,wif Qf:'f.f,S ,vw A , -4gww..1 ,-H:!A'Q-vw 1 1'z':f',.-'iw - 'V'- !1, 'n?fs.L-QHK5wfI'ffX1:'f-1 -12+ -A'Y.ww'1tiw,-' U ,ax T ' f E v fu XX Ala- 53 3 l A dsx Km -'iii ' JJ L .-15 ' 1 'f , fy 'W W wi A 4, B l L 2 Ml. w'Qww.:'.wL-1f'f'fw. '? n'-rw'W ms-:Ni5,',z, 1:+.1.w:fsEf- M P vw'w1':fv2f:1'viiff.'g .ffwfifffffi .fv1?'? '7' -ww' M' W M 1' W W -'S U 'ff M Y' lv 'U if s A 5 ' f-59 ff W 9 ' f H f xl N - 33 Ye? lm W Q5 'VHA-ff,'rsw.js-f,:1i,N':,y,g,gA,x5,.',qgifgN',QQ-'gf,1g1fQ pW,g.,ww4l'H!'Lygugfguyg.53,Af:fif,-Mfg.-,.'x ,L pi w1giA,:.uw'fn,g1g-,'g':-4.-gm,mg 'g'g,lgfl: ,va,xgf'Qf,, 4' y 65, H wg f w by uwelsiy R , J, L wx tn 533,35 mf, Q W Vg. Y,i,,2l WQXW , 'l im V 21 ,gem ,-H, -.' ,- Lf 1,, ,mv ,W . ' -'J-aw.,-:..',c'g an ' w H Qu-' . , my- ,V K Y'-fm,'X'4 -473'-Avf-fmn-.,g,g-,wi Lf xv.-lw.vA,',-, HH- La, Q 1, ' g 1 -S yu , 3' I A V Q 1 K if -., Mm g 1 4 Q 1 3 uf v M Xafwyi , 1 A M iv ' H .-N '.wf,w ,,--KJ.: -T,-H,WL5z7,,vfM' iw.-Mfn, We9,'f.5f1:v5xz,.,l,M ?w,'.K,il1-M,will.M'.:f.x ,w.4+fRx'w,f-,mm :ff.mgf,A,x-W-,Ariane-. ,11 .P 15 . N 14,114 X. X5 .B vw ', 1. f w ,, fx w . Q lim' :Qi ' 3 ' ,I Q1 Nw fe-1QM,-gf-4,gglw-,a',',. :in mf fV'1g'-pt X-,-1-1-,ww ,y:.m,ef,.2,f.,,1,.,,! lJ:,L'Jy,:1 f ,gm,1',,w-yi,',g.,,-.ggMx,, JU, pg- ,MLW , flgmlg , , .5 my ' my K 'X 11, , if, JH?-Qfb 9 X Q W ff ilgfyyff ,A my ,I ,- V- .ww 1w'f,'fm1,.fm ,wry wwf-w,:ff.,w rv M-X-4 -.ww-f,f1.w1Y,,.-ffH,f-.,-,fu. ,-,.-,V ff w,w.wv vw.: ,V--wyf.,w,, . -in H ,x fu v L 4,461 I J Y 1 1 1 f f 2 A., .3 iw' . M fw M1313 , , ,f X sn: 5 fy 5 J , , fx X Sf ff' V- :,r -'u:'wM.' 1 ,w q-E,m.f,J:,v,4-n.?,fN-f 'I-d1'.5u,f.H qx 'vcr -f'Xg,0'.x--',.,fp,-rw1 '-,v.1V.f:!fg5L,:'w1i-f1' ' 6'w l ' '5'wn'- ' YS, 1, W1 5 f' M p 1 f 1' 91' 3 ' ' r N x QS X f' ,JH fx V ill U54 '71 8 3 if 1 Q 1' ' X f f v x.,x,,f,,,,1,.,,,,.,.-wxmugA,m,f, W2 --5 '-- ,V 1 H . . - ,xy.,'y., qi- J qw Qt 1 1, , X 4 wa H M35 x 1 W z 11 4 cy, 4 4 Q A - M 5 5 ,, ,,,x,,:, , , ,Hn,.,,..A-,.,,.,l,,,.,m,,1,,,.,,ffAJ Q,,,,,..f,,y,.,l J X fs r f ,N I, , 1,4,, L ,w M 9 Q , , ug ,pg , ,Wx , L z ,4 yt g w . ,:p,.,, W q-1'.f.,q.-w,Q.:vf-',fw.,.+-n.,zzw,A,.,a,H.xg-i.1w.'l-gn H, 'Q ki A A sq , ,W 4 xx U wwf ,rf , L,, g, M Hi ffm ' X w 4 M O 2 Sri? M x T 1, v '52 1? dxf ISK? W 3 P, + f 1 ,'flPv'Jf1:ffx' .Cx 'JP 'f44l mv,QN,,'fv,g4 12's 5'Q3r?L'1.,'y' 1 1' Yr 2- 25 4 '5 I' 1 1 f 1 ' v 1 u 1 'w HH 5 1 f I7 A r 1' W: 1 ' '4 K ' f r 1, VHA 1 Eff. f We N Y M Q, A E. SM fi?12?'5ff frw1 s' wx? 185 5 1 Ms? iff nf If iff' Wi if ?f5Jff 'IF' as Q 1 .flfzf MYR Y' , Aff, 5 'Vw YV 53 , .Q Nm ,fm U' ' W gl fi MER al 'J 1 H 'if1f'f'Ly'1g:f''y..'f5-ff:'g g,.1g:T-Q J w ' ' ' n , -,f -5 Y, 0 f A Q X , . vg VX 2 if 1 My . - ,Qu - wa st f, as-I 2. -21 M Wi V if ng 1 ffm 9 ffwwi ffwz' Q V Qing' r ff -1 A 2, F Q 'A 1 pi - -we' ,fa , 1 1 2' ' Vi'-'f x?5-x'gf5':gE5f31,:Y5:15 f 053' 'JH 'Y ' 'R 'H -V Y' 'S li 1 Aff' 'NW' ' il3'+f7xf:7 L' V VNU 1 , Mwfixixg 5 s 'Fw' Je' fix + N' Q 'pryks Rf' ' 6' x?fZ5Pg9exW: 1 1, , 4 , f x .5 Q'.,,,: 1 sw-v,-W. -1 ug. .1 .A 'Agua' W 3: ., f N,-ffl, '.:::1a7:14::l,.i- my L 1,44-'W f ri-'Q 4955 iw af ,rv -,.w,bifyA , 'wg H. wr, ' 12, -ya '- -f wr X ' V I I A f 1 A Q,- ,f,f.1i,-. 'f'7flf-5 'f1!v f3 mfs 1,-:Z, In -M we fgxv',+f,f1:fef' nf,-'g H f-P 1514-i1:'.w ' ' , N f ,, gn ' fw ' w V J, N fu? ,I X ff ', - f, ,Q 'fqsgf5m?'?Q,,a'Lwv,g4Q1gf'T'1r!. 'iff.,pJ.2W.51f.,1f01.i?Eqf,gL5.''Er'-'.3-.En-131.g4'fn':E1i7 Q vi-121.x2,fA5,q,:xe?' gg:,if3g11v25,i?' E,.E?? g'fv'f55Mcf?f3g Wfiiscigg -L-b2:,- f P 'r 1 an X f A s ' ' ,iw .ww iuufm-f1'N A W u yi 1,.: 'w':- -11,1 'dw 3'-www.: .ww www, - n w. , v, 'mg' 3 wi' if 2 H f fy N , U, ,4 3 - f' va?-72f1ei2,:ixJ,:+ 'mm .' if-,ii-, emyfta 5,4 wr ,A ln 'N h v3'fgf?u'g W, 4 r,- mug- 1 M, ff .K -P ' Ny fy,-:',' ,M - ,fy ,- M. 115115: W3 'L 'liar 1 'k U? K f TWMX V x fkkw f ' 1-' IHail?g-'935451WWlfi'7fWL'WX'f'52IbG d?3 :h,mQ:' 6552M''Wt1l 'W?'72'f,5g1Q,li'Wiwf 'J f,.1',,L H v X , My X H' M' ,W ' Kg pf , K ' ' .f x ' X . ,:. 1 f 5,5 .12-fx Q: 'ff.-w'-Q.: f'h,FfQ5f1'Si7F',fg, 5-mi 'e'.a'a,z,1w,., r, M, 3'!2gw352q'Q-f1', in 2, ,awfzuvrg ,wwf 'A H in ' I 'X' K' ' f 1f,x yn -VQVN: 'Ny-::,'e U -' :H-7A,,f,ffwf+Gf'-' . 1 fm my ww rM,'w'51f.,-ps -,.1.?g,vU,ww'tfm'g,,'Lqrw Q-'1 'gg ffwqq ,4 'W' H H x f - A , Maggy 2. -v, ,f.M:- ,A ,::.,4:L'.,-A LH,-vI.Jf'.9g',.!' iw. bfjfig-Q 'wwf 'ai' ,gwjf dm Fw W- A L My f J 'A-,'5.,ni .K: SIfv'-M -- 'A ' K .' 'iffiillffH561WW-'Quwfy L: ??f.w-am. w fPW1!5j-I'vw'1- Sfpevlixlg.7gDf!?,i 5i'fkNP,73111 2, frabiiif':UEf5figQrW Wir gQQgfiajw'T'iwfKi'Tp1'f? x7: ' uk '-. v, ' -gariffr-'2.' f '--eff :fi NNY?-215155.22 ,ff125+Ii-,.,s-f:2ai5,2fiQLia! -hw ,ecif .sm-?f 1nkv.f'f.4 f mfg,X234-ugqfzfafwlr,bv..Vv ,:,,i',z1' 'wg , ws ,f wr, ,Q M' w :wg I-Qj'g3?4g7,., G, ' f' ' ' LL ,FP f1'f .Q'eG3f7ff' ff? -'1i'15.2,,:'.'7'-1'1'ii5 53fff5Y5lZ55375351l3iT'if5'N-f'vX:.Tk!W-?x5ffffii?5Q 'g7: 4,Q?55ZAif',f- . Efigfvfffg fl' .Q ' 2 j1msf..'1E: ff' -, 1- ,, mx ai-Vilas-5N951.2z.2e'1gm2f:'12 :J 4 .Awfl rf'-xwtifzhzfpw:frrilfbaiafiyglz 'ws- ff: '11gfvi4sgv'?WPFf H ' ' ' 'mf 12 ,f xiig:-' ity,-'QW -, '.?,'a-g..r':v5a-agar: 3- 7915- J? 'f.11,..-1.5.3 za' f Q32 Q '-R asf.3Vg3,,ga6-.'if3fy1JJ:Zgfvg-1 .2?.1iw'3i5-gaigf! bs? ff:'f 5'1'.5,.:l'3 QJLE, 1,258 3,-Eg-,2f 54 -' +fQ 'w:1iQ,-3 1 . .F . ' 1,5 3561, yu K .4 .,:,.f GU- ,,.,a'-as-in-,wz1gi'1::.2f: ,.-alms, I H . V 3f1f:w.1,V' v'Q1 , -vb-diifrixxsvvy 'inf--tw: gf? v',5H -Lm1f1S.?4fr , ,,wfgN..1g-if .A W v.miTQ4gM'fR?f,-Q? ,iz 5 , N J if-Jim' - iw' ew lwffffpffwz-.: ',f ff'1: 4'e3fsf:12 .a,' -fc-f .M!f35.f'Pffxg1P ZW'i'LK:.''Ef'Y '2-lv? IJ- 111.1- wr-xwive Man. .wx-msv.'fu' ' -f f ' P- -cw 1 U 41 . . , . ,515 f5Tif,E.T,'f,1f, '. l-Fi:'fi'1.E2': , -M Lffqw-,,m.ff :Jw bf: ?.iY41i1 1 '- 4,'fd .l5, .:',Pf':L1Lvs' :'v'-v4:i:-Vifwgw 'I -Ui ' H ,' 1-' a-Jw'-,-.fQ:'1 ?ire :W ' 17 ' ' + P' Q Hr: -'f'X?'i4 fcffi My .1 TW rv-'lima51u1': v zfxT-N'-1-'x 2'1X'-ants'wzxa-frril-zu an m:1f'f':,.1-Qf:,2'ml1-RvwifzlwrfvQ',,+'w'-W-1f3f7i'f4-f?-x -Mn: '-dye -1' 1, -if f' ' -4 ,W . '11 L 1, '-:ggi ' ' .- -ff' Ifwiwwfi NLkf','ff4 '?1IA!' fgfvz.f'1?,!f-A iwqrg, 'Inf ,fQ.J'f5.f ,,g1'X'l:?i'-C fb 'Zv'-3552-wN1.m,-I,JVaj ily 1211: 1,:7x'H5 U15 H5w:52wfS?4' 5 Mx? ,ia-1,7 LR:-. w?ZL'wf. -g15fL:fw?'J' m-1,TfHgf -fmiefdw '3'gFfXh Wfw.PY'q1r1 1-Nl' 5' ' - --4,5 35' Ji 2 'Z' 3 A f 9 V '-fic' WH- 1 W F ?v3ff5ff'1 'f-:'.Prf.f1'2f'H-nf11'wwff4.sKw-14Lf'fQ2-Fifi:s!,f!x'f'?14i.ff4fb'M'!l5i?z,5fiW'ewQkii1'ewilwuiwzfmf MSf'f41efza2wks- iw-'Hffff-'1:We:f14 G'kff3b:.fif4G 12'-viimf if'iewfQ-m'w-wizisiik-:-2 --1 fl ' Y .. ' V-we-' f X A v ff 'f 4 fr -PM yiefimi vlfqf, Awwg.-a.i.,f.,Lq,m.2f-1 -.xflgmgapwgg-nygRA2, f,,-,mf wbfxyawQ1xie.,w.w,:.,5?mgimayi-,khL,ffg43wnW?3f-3122-gagX'ff3?MM5K'f',flD'f-iflgga431-wk'-ami- vt-,gwgw-'qXw1v4f56'Qfi'1z3g+5 igYi5w,9?,'ifXQMff5Q:L . l m ? Af '1 yn' X1 P 'f , W Q '-- F v v 'dflliis wf -'wiwxifgri ,. mf.:-w,,4iaB',14q',jCQg: 1fw'ff-gm -X WMMW.,QQ, -f,.w.4f53gww ,u,1n-,K,f4,1g,1M4,.f,aa ,cw-,. nat'-1-H,.n,,wyQa 5' We 7,-e,,fMg9. J' -w. mw.,Lg-2-.ukrH-,H Sq-+!xqyN.fgk'5!':r,1?1,s My-3 Hg, g,3f.5wg..'-gayq.-,-H ,-W .. , 3,54m6ws , , . 9 M, . ' -' rs wig Aa - '+. . ' M www -xg-'aw fm ff '--rX rWw M-v1yE4fYw a1e4Qy+v-wmrfi-af' W'um:f'aw?i'f:fw1m'e22v'mimi-I.-v1,m-Mmfvlrsv: 41-1w?4k.-1x'w'3'- 'xafgnwa -mmf. mz53'm ,fwifhw J4W'pNq 1fwgfwS QMQPQ: -A vwfmfiwv gf B , v- My wan -. N fl ' f- - wwf 'ff ,4., , : 1, :xx .ww-L f- f.,-Nw 'my-f.-,.1Q1V,A ,1,fyq3-JG w.,,xf.y,wsf:f ,pfwfQ.m,,1g. pg W. Aww J. ,, Ml,MN,,,,,.-WW ,L.,iGfmW,,, ,, ,.W,M1t ,N I gp ,WL Ag, Ly! ,,,., Ms,gN,4,,,,Pgw A,,g,.,mm,,g-,w,,.1, , W, w, , ,, Nw gg , W ., JR 1 , W ,N Q.,w1l,,xg3Q, , H I. .,5eg,,g,,L:, .mu-.:,f ,nfQf,',w.,:.r-,mmf-1,4,,L,,f,wf.,f.:y,p'.'::gdxxgf,H,.X,5.--,L-,11,-,rwbpwlaff-f5,g.1fp.?w1,-, ,V-5,fg,.p..k7-wg?L,yW'.ff1l?2Mb5i Qqgggq 4g,,M5,,5-,,,.ygh,-..,,1iQ .bfi 'Q ylqgr-,-.w'.h.Y'p5'P5Jv1w'www ,-,vEY5f1Q5sff,f.'.q1 2v,Q4,'.f rx 1- R Q-S ,f , 4 W v fy, -gif -, J 1 A3 ,,, H-f it L. .. ,5,v,,55A,,g,,1 f.fL-,fg.::Kg'm mwry-.-was.-fm.iwgfmrkl.fw?mwaf,iaw'v.4x.,.l,w:,u-yaMarianyfslwiywX-S:'y,,wwwA. ,fax vy.Mm?xNMqw - f.,,!,3 15ff:,im5',1,wfgm, ,wmfpxarmfyLvgMgipgfsmmy m,frm2w?W.,m15A- , , ,, . , f -,1 fp ,qw ,Ak 4 'wr f A .4 ,f 429 ' ywm Q,-um , z xw-:M ,fx--wwnrifmfaz uf .-q.q1,a ',,fxwax,-fy,-,I u,mm2an2zw:2WSE--ap!-v.e' -v,.L-'+.,w-K14-'vf4wb:affm1:25, vg.ff,a3f45':,'wye-wc3M2'5'?5la 'HMA-4a,..k fpL,w:k.'1'. wwwmfeqfgcfrwlfiwiwzwX , QL -wgafiifm fx Aw-1421 -if +1 Q Q '-A f W-SQ, ww-vm nr' -.x.-fwd:x.w- mfr'fufnfwyw-.Mr L.-1-fwffw'wzw-qwzf-'1M5 WPC W4-lfsf,-iifzgalwusiM42-f. ,u:mfs:,yawfh-Iggy-,f-M 4 33, 2 Qywmfzvzfx-HM.Q-A,S: heM.erXmvegg.-2,159-ff5.w QMH5-xg' Q l'i f,l'1',g,L1f1ls-5,,32v?S 5, ffm' v-me 1 . wh 9 M . gg ,H mkkfiss F 4:f1Mvr21. ,'fx:' T'lwf1.'1 fm Yi? 1:Hs-6'Hf'lv!'-A-f,m,f,y'1w,'ZI'-ff?'c:f 3? ':1i..'Kfi-'Y-2 w'CF5-'MIM MS7'PIWMJ5-vi?-Q--:WAS-xwlfx'ffWR'xf1'?'.Ni?f,5'E411.MW11.12-'54fTI3..f mf+Pv:mef:w W'-fit'fFLgf,1v'+E.fIX1-i':QsQf'3?1-'ggfsgwfwff iw-2 'pfgrfw-1'M e fum f' Y -if-.Q 'ivyy-Q'-v' M,ha:4 1-vf :Y H. .Mi :wfffiw '1l :-twffbkflffllim?b'KE'f','1fw'rf-f.fHi?S'S:m11.fvf.:f:-QvwgnwcxL-1?fn-av.,Q.kiwffy?f .-bffvwfs'J.g.6xw. f,2f-s1:fg'fLa9fSfw'.,nSz qv-pfwwfglgigid-'ef'wrg,1g:ff, s,ffgL9'112fmy-, 37-W--:W ,A gqweifbgwk f:,fsa,mkp' -V, zbsgvff. iff' , -'W-'lxw-NP? ty M 326215,-sw-1 Juv.: 5.325 .M 1 mhz, am,e,s,ew-,-.,',1w',',', f9-.WL-,z:f:':,-qf,fbe',5-if1 ,u:,K.nf.p1,vJ,f.g+.f5.:f5r3my'a,g-uw 445m ., me.Ln1,-,1,f'pw.Q-1.2,Yfzv. w-wpgfrhf +:,xg--fgdwhyfr5!s:4.fww,ffQrm,-5,f,W,x, -, wgfigf -Asg.?.e,g.fvP lFg5wg1qf'-1,5155 SSSQAP wif- -n2',g?'Li49gM TQXE4 --2 :L-S+-Lf,-9, ff'-. .-I A ,qgw-,-'.1f y f Q'w.,':431,-,-ffxqvfxw ,,'ff'.'-151-fx:--f:',f,w -:xi :4',.l,'pr:-, -ff:'::',-Z'-Cm1-w3:'n'Jf mp 2v...mN1:5-?f,fc'-.Qyvm-1ifgffhff-:LSc,pLf'-is zxwfxyw-l113QYu1,fvm:fLs!- ww ,bw 52, -if-KG:-42:9 5531332.53 5-gy '-Ugufggikfi. wmv e qv-fy 51 was -g pffzszi gwsn-1 - X . ,,4'.',-fnfi:fwa.,-f,a:xs'-,'61,425-'p,q,q:gAH L-1,-Q-ff.w.-,',,n:.:fi---bw:-.-.::,':I-551,535-4 wg -,rr4--:-f:w'g-Q-fafgwgjpg ma-f.9,Q,yg1,viAv,,Nga-J-k?p'fv,q:aA:7,5v.gi .,::gQQsM:g,fqY,rQ5.,LygQg ,bgazmzb-gp.mQ3'.'gx 144 N' fig, 053: !3g1m?gfs,4gv,Q5n3g?5ig3gsQm.'E Sw vdgwffesu fasfygfr-, - H, .V -, r, 'f,g1Kf'fv'.jaT.1xi'L :cy 'f.v!: .'g1L: f-th -fn -f-12'.gf-,sg.gf,,'.-..'gafai,gg.1y.J-'J-?f'.q,1QQQ.e'-Am-7,'.4::Lf:m,'xuQ. -1g5.f4-,fpzfef-K'-142135311 L,,'1,fwf3fw. aa,1i4.w2f ,,11.:,1.7+:b,i x-HQ' -3-1-,gg-Qy'fgf.'m2Y,21,11,g'v.w,- :41.w.Q ,afw,,,3-,.q:f,f3,:gi.x,if4 ,-:-4':i3,7gg- 33-n'gg'j'g,sf,:ea,f,,.yg.f15,,4tgi ??.,v1..v:M5 ye rglzgzj.-A .2.1'xP'-'H ,f '1'.--,z-Y' mw.,-.'.r: 'rgwawar S'-,mai-Qiaggrw45kz14-f,m,z- my-wr :g,'m:g,, 1T'ifw!YPf.!f xy1f1u'ff-5.-J:29,vfsa3vf+frWy-wx.ug'.gf1-vfa4G':lQ-'w-.-aw---ff2f.g.11,':,wifiqk' W',ff e'H-1'3.:gggifsdw?-6t.'x'.Q'f5.aw.fL wrvxf. -'5g1glfYz'?.f1fsifniw47 'V f .fff,'1yLl'i'f-rvwfw ff 'fx 2: QV' :'- 4'-1' ' 4 .1--Q. , -N.-.A '.-'.1'.1.---vwnxflhi' E--.zlflgiv :H-'v' .-if-',-:,:1 Iulfh-.'11 'Wm 4:---ZJVQ3? fi' 'if'HXA '-Mi.-5111.-Wifi'rP'12fP,fN'fk54c?-v Q JSM. ,fi'r!'15 'sD'iQ! ' 2'i':?J?u5f'v fe3,vq-w.x-f1f3 lX-'k'35-'Wfri?-f Liv-wr?-113:wi:-hug'-M2515in-' ,E fm .1,,3L5K.5Y-if fab' ' M1125 wtf '.-H5761 K fm ,-,f ' H ip My X 'M pw V-1.:'uQ. 5, fx Y 'E-Q 1, . 'g.,yf':,v .l'.---:1li,y ':'f Srfv'-Z4?gv,a'f ,s'vf'f'1,-5-GM-' I. 'six ,-14.3 4 . r,-4H 3 - ffl- 'iv'-L 1:Aiwa,-rv-2?-.,:!,nz'-Q' MX -:y'1,4' rC'1'1Rr': yr-q'11.S13Qi.9fvi'rQsSg 1Y'.,,1w.f .ff1.r-'ymffvf Ysg-1c?.:zfK'f'1,,.-W.qufsqimf 2.'4:5'fgf-S 5f!:,fw',v.1 -:in ebixfgl . ,-fav-1, y -J-A-V -'. v 1 94-'- 'V 1 f': ':.xa -: it mi? eff-.faxa'iwwYH'.'L:wi 'EH'-'1f -5--'--wir 'nab-tuzrf--'JW'-1n'-,-warn,113:-1,1v1yfp..':-2--21 -wf'fgxAm'1fiyk?Qmm H' fifvigwsf'--'fill -255-pu,-15'c0.j Fifi-fx :Af gfgwygss. 'anna-:li 5' f,v'f4-Jffmf' ,H ..'v,f,l f,, .-311-ficirfifwfrr-,42ifv,-'1-'rf'-ig,21'1-img-'X fgy5k. 'm!'Y445.257-f'H?4ljg,f,91,1fJ'3'.'1'3!Wfg34,'P1'f 5fI'HJ'-?ilv,WsH'fv1 f'G:f,.f.X,9f'YN' 2.'rj9?,'vXX1?fge1,952-Ati?-ik4241.4-'lilky-fi'-,sffivfrl1fF1,75I6 ff?l'Lfa1L2:'--fM,.'353-.,,w-f 2s- wh vav,si:.f4a1xf'.4f,+,P-.-,55,1w,'f,xiilp :-i'.-,gf,wgst-54pgvy- K ,,--.vfyiy 9555 I-lm-fam,-,Q -3:41 -xy,w1-',e.':w-.-.--'Lwx' N1-H:-':f!.1vv.1f'1,:wwf'NME-iv':'25 Jr11.afa'-gwwfg '- I-gm .Lo,fpW2,'-s Mgm'-P:'w:l'Hfa5af Mml,:x'29:Y?'.5-2.2fH!:tr',-A-fg,S1:fQ:12gfew-3fff'11-12wM -f.i:rf32'1'11xf 'ff.wQ.1w,J.!qf.'fl-M,a.A-'fghih:P--31f,g2rfEf:1?+P'fg3f-'Q'lqijy-fiwkakeff 25?,ag,fnEw1Q'xMiQu32QS fx rw1:wE11fs4,eEf wx 12.ir.'x--1 min'-pmzf-?.'i'.:'5f 1422:zf':ffw1:1v+5'f'sH551-w:1m:f,M'-ax1'rw-15.193-g', :5':QMv-,w':,'-fix,vfbwwffgffg1L1rY'::'M3wld,14it-as1-L5y11.4vwnfMsffff1g,Q-Ef'ev:'zwf2'2!?le'-m:3P.Z'EfGfifegfvxiqrfww'fYwgff-f-'fvf'?glWa'-3-'vigeaffffm Vg X-ffgUz:vgs3f:11 1 .Q-fk'fY1fPu2s5 wQQQAIQGQ-442- ?FIi?c-HQL1f'U FP 2' 2. .i 1-,,w.:'.-sf-'21H-2:1-faifgxyv,-fas-mnew-:vm1'v:--m'w'4wifvsaaf'-Lwvf'-g'Pmy,:'wg+-'iwS-rlffselwgwia'aar.e:vQsQ,f2x'f.w.'.f'mf+ fcL-Nvf:L-v-:KHzY'd-gcwSfxSffbf2q2:.,af3P,Mh7v'-1 Wil: .'fv,f:?i2 f',5-bfxffh ffi .hQ,'1Y .fivix4sfSi2-'f' Aff! ' 'MAG 'aw wan lv NM'-2 -f mv-,f:n',2f..1w-f'fa.aL w3T5if':3 'lrfw-.ZWQNQfwvlf-,':fi+fSw1GfG5Qn9'y 4 .RflHi3 f'1 -isp-wifi!-GVJQQ'HFQY-f!14u,f'y!f-Elfi'-wY ' if fiybf.-WS' 152339741 X'-Avhkwisff'f's?fxi 4v'v2-ff-V11MINE?-: ?wgYi'--11D x'v'i Viz'-.'i Pe-lb H .f '9Yf'ffS-95 - ' N' M yi . Y ' A 'Q 1WW' E519 -, W Biff F-Sq ,, ,, , i A. 1. ,.,- ,-,.. , . -, W, . .gf 51,4 .X ,A .uw Q.i'ww'1'5.5w-.. qt'-fxww wh f f-1 ev--w,.,gz,f1rw1-franfmfM--,yvffvi- . - Sv 6? ff. M M. fag, , -- lf -my ,,4ff',M1,-1 - Af 4, ww I sq- lm. ' u Xml'-,x L',.fg,wf.-:,'3a,. .vvgvvff mwpffl .-,f41,4f'1-,ig.gw5:f,,f-S,-,y?lfiPn'+f-9,1v- uf,-A F .m,A,f.f4p,J wlinfiai'55y.,fQ-ii.-visa? ,gU4wz'w: -r:ms.-1.5-1---fm.g,r.qf'.wVf9'1-iw: MHFQFLN 5, W 15wf,,9'm 3f.5f1.'q1'.:wL3215rf13Jiwsgz Sw- gggfwvg We v- 715-,hh 'EW ,J iz-54. 4-fffkllg V M, egg-H. zlggtfwfg gwgcf gy xrfg,:h:'w,' fmfhg,-Q 25.55,g-mx-92,-.gg3Q:Nmd-i.Q,.,Q?t,u,,13fgiyfuswfwqgfgh Jf?1!1.gig.f1.:wgg,Mvg,,,5f211imgQ,xg5:,'z'x iwgfmtzligfmfgyggzfB-Q91123.-fEfqt51.1,Wiki?-g'i,-'yvlzf+1,wi'f,19nEwgf7f1f':f,3'-Q2'fm-b2,1f'g:1f,A1f2vJvefifuiw 5 H2234 la wi v .- -HU 7 W H V: A H f- 1- mv- www, .w-.ww.- , ,.' ,-,ww xg ,.f.,,.,Wm.A,,x.-1 Y fu K . , W- em.: fx, .,1g1m,v-,lfex,,-f 1W.i,p1.ef ?fi7514.-,9-41,,gN.-A., w figwx 9 1MgM.,,,jg 1, A- W, 'ii W .4 ,,:,,- f, , ,- -nj: yygb 113k:'4-'w1.-bm ,...g.1f,..ffw:,w,g1.5,-'m1.e5A'1af:5:E'mpywmfl 9'5 -W-? x'sQ-1'Xf,bfwz2,fi514?f5f'EwA fEAggfVf'1.1Qf3Qrw3',Hsf3:f5:5Pfwg?f1'gt?nfS-1'f.5'-5+fsl5kXf.i- '2535'-43'32W?x fxwWi1f4Wif'K:4'hf'l 2'r'55iL'5!W? 'Wi W' vfifff S ' ' J- K '- 'if ' ' A .L L ' ' , XS- 'f , .s i do you remember homecoming'-' i didn't go. 4 do you remember halloween night? yea, i went trick or treating do you remember e-in-e? what? eastwoocl-in-elegance! i didn't go. why not? i don't know . . . you're missing out. empyreal of colorp of splendor and magnificence of heartfelt enjoyment, of tearstained happiness. so many things. things that instigate carey maybe anticipation, but they'll never be quite just the same, and this year they were most worthwhile things. Davette lu n crownedg exes revisit Trooperland Exemplifying the heritage of the Troop- er domain, Homecoming 1970 revived memories of students, returning exes, and teachers alike. Halls decorated with bright blue and gold streamers and scalped Indians depicted the tra- ditional rivalry between the Troopers and the Ysleta Indians. The early part of Homecoming week, October 5-9, found the various clubs centering their efforts on the decoration of the halls and the construction of floats. National Honor Society planned its traditional tea, and Student Council members organized the car decorating contest and the Burning of the E ceremonies. Students connived and de- signed top secret plans to spruce up their cars for the traditional contest. Highlighting halftime activities was the crowning of the sixth annual Home- coming queen Davette Juen and the presentation of her royal court. Escorted by Pat Henderson, Davette was crowned and presented one dozen roses by principal Bob Bradley. Also honored during halftime activities were duchesses Valerie Phillips and Sue Phillips. The underclassmen selected representatives to serve as princesses on the court. Rita Chavez, Donna Phillips, and Kathy Ramsey repre- sented the junior, sophomore, and freshman classes respectively. 50 Duchess Valerie Phillips Duchess Sue Phillips Escorted by John Cullers, duchess Valerie Phillips is presented at halftime. Queen Davette Juen Princess Rita Chavez Princess Donna Phillips Princess Kathy Ramsey Before being crowned 1970 Homecoming queen by Mr. Bob Bradley during coronation ceremonies Davefte Juen smiles of ihe capacity crowd as she travels around the field in the royal moforcade. ACTIVITIES 51 Accepting the Indians' challenge, John Edmonson defies their victory sign as he breaks the Ysleta arrow during the Homecoming pep assembly. Violet Gonzalez steadies the Trooper float entered in the float contest by Copiae Auriae. 52 . W? Lv 5 ' 2 :W- 1 'I ew:-it Trying to remember their old cadence, ex-Sponsors march behind the '70-'71 corps to the pep rally. Traditional Homecomin welcome returning troo Traditional activities ranging from the hall decorating contest to the burning of the E marked the welcoming of exes for 1970. Among these traditions were the National Honor Society Home- coming tea, the car and float contests, and the selling of blue and gold balloons prior to the opening kick-off Friday night. Presented at halftime was queen Davette Juen and her escort Pat Henderson. Davette was crowned and given one dozen roses by Principal Bob Bradley, concluding the ceremonies. Duchess Valerie Phillips, escorted by John Cullers, and duchess Sue Phillips and her escort Johnny Eoff were also presented during halftime festivities. Also honored were princesses Rita Chavez, Donna Phillips, and Kathy Ramsey. Their escorts were Steve Hastings, Kirk Nelson, and Steve Belknap respectively. Practicing Friday morning for the halftime pres- entation that night, Rick Coon and Sue Phillips listen to instructions for their introduction during the coronation. g activities per exes Held the night before the game was the burning of the E pep rally. Winners of the various contests held during the week were announced as the Rodeo Club won the car contest. Olon McClendon and Rick Surratt's entry was selected as the best float, while Yahna Phi won the hall dec- orating contest. Climaxing the pep rally was the burning of the tra- ditional E , constructed by the senior girls club, Yahna Phi. ACTIVITIES 53 Sights and sounds of Carni al fun fascinate both oung and old alike Cheryl Bartlett Mrs Harriett Dorgan and Scott Key market odd collected items at the rumor class country store Colorful booths beclecked with streamers, a dull thud of a confetti egg being smashed against some unsuspecting person's head, and the splash of a sponge against the face of some poor football coach: all these and more were part of the sights and sounds of the annual Halloween Carnival. Young and old alike came out Hallo- ween night to haunt the halls and cafeteria of Eastwood. Traditional booths such as the spook house, ELA's sponge throw, the FHA cakewalk, the marriage booth, and the sweet shoppe were among carnival favorites. Functioning as a money-making proi- ect for the various clubs, the Hallo- ween Carnival is sponsored each year by the student council. Donnie Gardner shows off his dress while clowning with Mr. Doug Littleiohn at the Halloween Carnival. 54 E1 , s A , i i v-swf , ..,f,r , 1 . 1 1 z A' James Kilgore blindfolcls a customer at Spanish National Honor's booth, Pin the fail ' x Charlie Bones hangs in his corner of the senior class spook house lo haunt all passers-by. y. Q on the burro. ACTIVITIES 55 Davette lu n Cro ned among the Under the direction of Mr. John Prestwood, the Cavaliers provided a program of several selections for entertainment during the most difficult waiting moments in the pageant. G' 'tx Q l l Davette Juen Most beautiful Davette Juen poses with Toni Andrews, first runner-up, Pat Henderson, most handsome, and Sally Thrasher, second runner-up. 56 I I jewels as most beautiful girl --UU 11 - A Cathy Gouch congratulates Davette Juen immediately after she was announced as most beautiful. Jewels became the setting as fif- teen beauty finalists competed for the title of most beautiful. Davette Juen was crowned jewel for the night as Toni Andrews took the place of first runner-up and Sally Thrasher as the second runner-up Davette represented the cheerleaders, Toni Andrews the junior class, and Sally Thrasher was the representative for NJHS. The theme of the tenth annual pageant, Jewels provided an excel- lent atmosphere for the coronation. Davette Juen was crowned by last year's beauty, Rosanne Kilmer, and presented a dozen red roses from principal Bob Bradley. Present for the coronation was Pat Henderson, elected most handsome. Topping off the event was enter- tainment from the Cavaliers, directed by Mr. John Prestwood, and the modern dance department' under the direction of Mrs. Kathy Teel. The beauty contest was held on the evening of November 24 in the gym. Decorations were provided by Mrs. Marilyn Steele and the art department. The emcee for the pageant was Bill Beard. Toni Andrews waits for results from the judges. Sun Carnival festivities bring Q... ,,..,s. iewm Trooperette leader Robbie Farley signals the corps to begin a routine for the iudges' stand. 58 Trooperettes stop for a dance routine as they march in the annual Sun Carnival parade. ln the distance is heard the clashing of symbols and the roaring of the echo- ing drums. Then along a green field lined with enthusiastic football players march the Eastwood High School band and the Trooperettes. For the third year in a row Eastwood has been given the honor in providing the halftime enter- tainment for the Sun Bowl game. This year Georgia Tech's Yellow Jackets took on the Texas Tech Red Raiders. The game took place on December 'l9. The halftime show consisted of three different scenes. For their first per- formance, the Trooperettes danced to The Magnificent Seven in western out- fits. An Indian routine was the setting for the second portion of the show and the last dance was of a Spanish origin. The grand finale was the opening of the American flag across the field. The Trooperettes' umbrellas made up the stars as the ROTC department stretched the red and white stripes down the field. Bringing honor to Eastwood, the Sun Bowl game was televised nationally. On January l the Trooper marching band, maiorettes, Pom Pon Girls, and Trooperettes marched in the annual Sun Carnival parade. The Trooperettes also performed in the Sun Carnival Basketball Tournament. Mrs. Barbara Prewitt, was the chore- ographer for all the Sun Carnival activities. Her dedicated work was ap- preciated and termed by national tele- vision as spectacular. ......-W-1 l l get recognition and honor to EHS Maiorehe Jenny Picken leads the way for ihe Trooper bond al the Sun Carnival Parade i ws38 v H iii 'HUGE' 'l wlunna.-I-,E ' Performing in The halftime show of the Sun Bowl game are Trooperefies Jacque Bates, Party Lane, Carolyn Moody, and Chrisfine Rivera. l. IRM- .W Q , Q 5 1 R ...L Q gf'- X With longing eyes a child ponders the reality of Christmas. Santa Claus, reindeer, and the Yuletide spirit prevailed throughout the halls of Eastwood as Troopers prepared for the arrival of Christmas. Kicking off the festive activities, the art department took on the job of decorating the halls and gymnasium for old St. Nick. Modern dancers, the Cavaliers, the band, and the orchestra also prepared for the traditional Christmas assembly. ln the spirit of giving, Troopers scoured the neighborhood in search of canned goods for the traditional canned goods drive, and Blue Jackets arose early on the last day before vacation to cook the teachers a hearty breakfast. 1 60 Peace: a Christmas plea T With the help of Mr. John Prestwood the Cavaliers presented their annual program. Senior Sue Phillips puts icicles on the Troopers' tree to add the finishing touch. 'Q Best dressed Western Day winner Larry Hicks sneaks a peek at Tamara Atkins' garter. Western fll ll r, Playing the part of a wooden Indian, Phil Cordova poses outside attendance office. Da displays originalit of Troopers Following the long-established tradition of dressing western during the week of the Southwestern International Livestock Show and Rodeo, cowboys and Indians returned to invade the halls of East- wood High School and the Troopers were called to subdue the uprising. The Student Council judged the con- testants on their appearance and the originality and authenticity of their Western Day garb. Larry Hicks, Phil Cordova, Tamara Atkins, Bonnie Jones, and teacher Mr. Richard Moorman, were presented tickets to the rodeo for their costumes. The winners were entertained by the bronc riding, calf roping, and hilarious antics of the clowns at the rodeo. Television personality Festus Hagan per- formed for the occasion. With saddle over shoulder, cowboy Ken Lane 61 glances back to check out his parked pony. .rf 4 1' rf 'M receives salute of crossed Sabres Mai. Ken Blue escorts Trina Williams, princess. The queen and her court enjoy the first dance of the evening. Sabres and Satin, the theme of the annual Military Ball, found bold, red, white and blue streamers in abundance. initiating a new tradition, Queen Debby Yarborough ascended to her throne from beneath crossed sabres. Debby was escorted by Cadet Col. Mike Jones. Lady-in-waiting to the queen, Carla Thomas, was escorted by Cadet Lt. Col. John Daws. Princesses of the royal court were Kathy Breton, escorted by Cadet Mai. Pete Hosey, Eydie Griswold, escorted by Cadet Mai. Joel Bass, Anne Marke- son, escorted by Cadet Lt. Jack Daseler, and Trina Williams, escorted by Cadet Mai. Ken Blue. Completing the court were outstand- ing sponsor Carmen Alvidrez, escorted by Cadet Mai. Tom Halleck, Drill Team sweetheart Toni Glardon, escorted by Cadet Lt. John Leftault, and Rifle Team sweetheart Irene Paz, escorted by Cadet Sgt. Mai. Lynn Mullins. ACTIVITIES ss Su Phillips reigns over Zodiac at Eastwood-in-Elegance festival Queen Sue Phillips Spectators stand as Sue Phillips, escorled by Armando Dominguez, descends from her Throne. 64 ...A- Debbie Miller and Sue Phillips, Eastwood-in-Elegance royalty, discuss plans for The annual festival. fs. .....srM:fv-f --grvvn fi Debbie Miller Trina Williams lady-in-waiting princess Charline Rivera Dannette Rollins princess princess Queen Sue Phillips reigns over the splendor of Around the Zodiac during Eastwood-in-Elegance. Toni Andrews princess Glittering personalities were reflected in the astrological atmosphere of the annual spring Eastwood-in-Elegance fes- tival where the theme was Around the Zodiac. Honored in this special event was reigning Queen Sue Phillips, escorted by Armando Dominguez. Also honored at this year's event were members of the royal court. Debbie Miller was the senior lady-in-waiting and escorted by Bucko Guy. Elected to repre- sent their class were princesses Trina Williams, senior, Toni Andrews, junior, Charline Rivera, sophomore, and Dan- nette Rollins, freshman. Escorting Trina was John Cullersp Dennis Koehler es- corted Toni Andrews, Steve Hanson escorted Charline Rivera, and Dannette Rollins was escorted by John McClain. Several organizations helped to con- tribute to the putting together of this year's theme Around the Zodiac. Mrs. Marilyn Steele and the art department decorated the gym giving impressions of the zodiac and its signs. Also taking part in this year's event were the Cav- aliers entertaining with a selection of songs, directed by Mr. John Prestwood. The modern dancers, who are under the direction of Mrs. Kathy Teel, performed various dance routines. The band also took part in E-in-E. Queen Sue Phillips, was crowned by Mr Bob Bradley, principal, and pre- sented with the traditional queen's scepter. The queen also receives a crown with her name engraved in it. ACTIVITIES as E-in-E representatives are, KNEELING: Lynda Seelmeyer, Terry Shambrook, Rita Chavez. STANDING: Carolyn Moody, Vicki Speck, Kathy Mosher, Sheila Rogers. E-in- What a lucky astrologer would have forty-five such beautiful subjects in his studies of the zodiac. Girls under Aries are the daring inde- pendent group while the Taureans have a tendency to be practical and quiet. Geminis are the most noticable be- cause of their flirtatious manners. The sensitive and romantic girls who may take the evening with a few tears of excitement are the Cancers. Leo is repre- sented by girls who love the gradeur of the occasion. E-in-E has a way of bring- ing out a set of litters in Virgos. Libras are those who seem to have an air of refinement and elegance about them. The crowd seems to evolve around Scorpios because of their magnetic per- sonalities. Sagittarians have an inde- pendent streak that causes them to stand apart from the crowd, except at times like these loyalty to their school makes them fit right in. Capricorns combine their practicality with their drive for success to put them- selves at the top of any social ladder. Last of all, we see girls with stars of idealism in their eyes. These girls with a deep sense of dignity are our Aquarians making our list of the zodiac complete. 66 ,1- . 1 - in . L I 2 '- 4 l f if I f K . ,gm ' -f ' X26 5 X Ye. W, W Si me Q X, A sb- ff ,riG::aws,..., . ..,.,. . fl M, Brew.. . ma fr-f . r sess Other Easlwoodvin-Elegance represenfafives galhering in the lobby are, KNEELING: Cindy Gross, Diana Blue, Kim Shahan, Debbie Jones. STANDING: Pam Nevarez, Mary Hall, Davelle Juen, Linda Taylor. for flight 'Around the Zodiac' unn- s 1 ' S ' Ml i 2 l Q l l l i ' l i ,B . . Ofher girls of fhe E-in-E court are representatives Kathy McCarty, Susan Oswald, Martha Loya, Patty Eason, Wendy Hardy, Becky Anagnostou, Carla Thomas, Janet Persons. Completing the court are, KNEELING: Barbara Towns, Michelle Mason, Susan Sfepanski. STAND- ING: Diane Hooke, Kathy McCray, Kristi Golcher, Marie Milchell. FLIGHT ARRNE5 156 958 FLIGHT DEPARTS 4 gr lr l J , J Royal vlslfors are Shlreen Baird Duane Olson, Kim Shahan, Sylvia Lopez, Georgie Ferguson, Davetie Juen, Janet Persons, and Jackie Magness are also royal vlslfors W, Gr if S W mir Z.. 5 Other royal visitors are Belinda Gafford, Ann Savino, Valerie Phillips, Dennece Knight, Julie Francis, and Anne Markeson. Visitors attend area spring festivals ln December the student council selects the royal visitors to travel to other high schools' spring festivals. Seventeen girls were chosen this year on the basis of their many hours of dedication to East- wood. These girls were members of various royal courts. Attending the Jesus and Mary festival was Shireen Baird who is a member of the Trooperettes and Epsilon. Diane Olson, a sponsor, iourneyed to Father Yermo. Cathedral's event was repre- sented by Louise Loiselle who is on Salute staff, and is a member of Quill and Scroll, Epsilon, Sponsors, and Blue Jackets. Welcoming Gail Harris was Parkland. Gail is a Trooperette and on Salute staff. Tracy Lund, who is a Pom Pon Girl, class officer, and a member of Yahna Phi, will be at the Radford festival. Kim Shahan was chosen to go to Loretto. Kim is a Trooperette, a member of Yahna Phi, Epsilon, Doowtsae, Quill and Scroll, and is on Salute staff. Present at the El Paso High event was Sylvia Lopez who is a Sponsor, a mem- ber of Sabre and Salute staffs, Quill and Scroll, and Blue Jackets. Georgie Ferguson was greeted at Jefferson. Georgie is a cheerleader and a Sponsor. Ysleta welcomed Davette Juen at their festivities. Davette is also a cheerleader, Sponsor, and received title of most beau- tiful and Homecoming queen. Austin-in- Action was attended by Janet Persons. Janet is a cheerleader, Sponsor, and a member of Epsilon, Quill and Scroll, NHS, and Reveille staff. Jackie Magness, a Sponsor, and a member of Salute staff and Yahna Phi, went to El Paso Tech. Bowie's spring festival honored Belinda Gafford. Belinda is in SNHS, Doowtsae, and Blue Jackets. Ann Savino repre- sented Eastwood at Andress Aglow. Ann is assistant editor of Salute, a Pom Pon Girl, and a member of Doowtsae, Yahna Phi, and Epsilon. The Bel Air Highland Highlights was attended by Valerie Phillips. Valerie is a cheerleader and Sponsor. She is also a member of NHS, SNHS, student council, Epsilon, Yahna Phi, and Reveille staff. Dennece Knight, who is on Sabre, Salute, and Reveille staffs traveled to Jesuit. She is also in NFL. Co-editor of Sabre, Julie Francis, was present at lrvin-in-Orbit. Julie is also in NHS, SNHS, Quill and Scroll, Blue Jackets, and Sponsors. Coronado-in-Conquest was attended by Anne Markeson. Anne is editor of Salute, and a member of Spon- sors, NHS, 'Quill onol Scroll, Epsilon, Yahna Phi, and student council. ACTIVITIES ov ?5Ti.E72?2E5'1-W-if2ffJN.'fW:xr-s-- wfwm-W,---f-M-.WW-..,.....X . .X .. . . . X -.arifmX.ff-PMM.-6Q-2-gm-wild----.2-.-fv..1-Q.-wsffgjwgyw - gvfgigaw''QfQffw5W:fm1Wff1'W57'4'97f?'W' f- .--f----gm - V. y.- X... .. ...- . X. , - X X X-MX mf -iw-'Q f In .. X ,X , X Sfgff-4.1223f'.ff-im -.z'-'amy -fX..:...wIsg:---7.13. grin.. yfliwxdsiw-iw -ima-Qmgix 'aXw,'-.- 'ass-H.: .ll .. . sire-.m4 -:wf.2:.:--wp H159-:im .4 '--,J.i-.'L1L-A-fer-fffv Jwzliv.--..X . W'uWg uf fxycfayw .ef?.w.:fQgi. f:5.?h2.iv-5Q2i:QS15- -1-..-ww . ...fm-r..f:.X. 1f.7.,--4.3-..W .1--.,..g.-Q.. .mm X.-f-.gf Wig-1-,M QXQT.-... Q--1. .--4-4,--2.4,-1ei.M.X, ......-r.-Slim-.W a....-13,g.w- .wi,ffm...Af-.-:xmwf---.,5-....gf .-. .1...,1-iaw kg:-. 4-fq.-p.,--.P-mf-,xg-www? ...Q-y.fg,y.,X,5,WWg.-1.W5.5w X, 4--.X F. A-.XX. .+. 1.3-Q -XMS-.www-f.X.,.X ...m.g2'eVf,w-...QQ-.5..,QXnf....Xs..-.Q 1, mg'-:fvA.fc-P1--'.-f.g.--'rsfvaygw ' 5 :Pi-326ff.g.-..-a--S1-www?-f-4-'-fww-55,4-WX5-1--.W 5.5!'+,'..Z'f.'i:-51cXtg-Q. -Pwr 5---.SJQ--.fmsmgkgwx-gafgwgz-ff.-gi-:..-wt .1 ..-Q.-Q U mpmr' www 'JXQEQSWWS-1-w 6.rwAmiggf-3--uf.:-f2?s,ie.2.fd5-f...Q'3efQ.m.1:.g.r .ff-.'...agf-.-L-ff-a :QQ f4g.-.wg-mg.-P---ma-.ii-g-.-Hilgpz-1-rQX,Xxs-,fsf..x:?s-.-Indie1Wg-.-w'-:si-tEg.Xw,.,,..gf-4.:i.wQ1WXf4..3.-.5X5fr Jf'j!s 'Zf'HW.HV2'4z.P.1,Xi1't.g-2?1i5Jz1255.225-F. we Xi,-We-.,'Hq.-.y Y'X914-gg-X,Qwe-,ks2w.fr-.'.2aS:1fffXwwe.W3-?w?.m:2.:af' :Xf.ff,g-13-.1,-agf...g.f.-my is-.421.12--X-:awG.:-A-gwim-..-Him-.W-.2-.w.mv--f.a,y1:.wg-Q. 45-.1 X .f-Fa-Q.g..m ai..-.WX-swf-52-. .-fmf.,,2z M. - .X-1. Q52-5.-may-5. fg. iw 5.-M.. ..g.,'mi 2gyff -5.--X.-wg'-gg.,.4' .Xu-Xa9a-ww...-jr:-XQS -. . -5--Ma:--gf-xv.v:.4G'.. -1 Q.-.wsff.w,,c .-.-.-..g37gIi-- f SW.-X,:.y-..f fIffff-M'--f.-fm.:-I-sw,f:-fr.:-M-'-11... mms-2 ie?-4i5?s?v?11.Q-6'.'14'25f.,1fr.2.v-i-QW-t'Scw '1Y . AM-f....w.-w-wsfvyv.r.wf' rw w--.-5-.-.yy-wi-..zsPfwg?X---M---'--:4'-rm.-2.1-HX -'HM ff?'. ,'-'I'5Mi'7i5':f-f .s.1..wi.L.fW.-:qi-z.f.:.-. .-.-WWf-:gf-a-xer.f:?...w--' -:x'XEi1?H-.-fgzifgw'-'W:,w.. Qa-- bw..1,X5.Q'1-fXf-1-3.95696,515--3414h.1'--wf-iQf,f'HsN5a5F- -- f--,wc-Sfvff-,va:??i.?fbm.-51'1 .3-.-15.5-1.1--+P-.''n--xii .AXQ--J-Q-lim -Hx. 1af:.'s4--.Qaf-W1-faM52--9?..m!1-21Y?-4-.f:'1.-'V-'1-6-.sv-2' Q-.wi -.W-ff'-'Nf--ff--tif-il--v.-qwfw .Q-aw Q.,-X5.. XX. 'ff-:wi-fff..Q. -'f.4-:N f -'J- -X.-.--3 ' X -.ny W-.-Q f- ,X.-rf.--1 f gf-Q . me-..--W'-. -if f-22.1.-..-f rw --- X --2-X-1-X:-31.2.0 v-.21fffgg?,f9'1f-a..m,-w -X,..gfX-.-ffm M- .-gi-Q.. . ima- ww e-1g.m.g.1'f.s-- Q-wr, -4fX94..Q..f.- .ef 1-1, .5.5-.1.1-X..f..X4:.XfGm.f.f-1.J...-.-fm-,....X,ne.f.4-.fa .X wg-X.,--.f. +-1'-f--.QM-QX ...asm.5.31.-..?.X,..-.,--Hg.,-..2XtX.i-1 16.-1 -.,.y.gIX ,gm-s,4..X,w,.,-.gs.X, ,Q-.25-f -sv ,5Q..9ms4.e.2.X'-YZ 337521-Xa.. ,,.XX,.-..X.g. X-,...-.....XX.'g, .,.,.. -g.,.g'X...g.,. 1.5. ...ygw E..-.,....-Q., W X5-.X. M.-...MX-4-ng... X-aw... ig... ...X -.X--L.. X ..m.w..-...X..--,-e..f.X4-cw-2, X.-X Q- gvai fs-1. - ... JJ' . .-..! .mv fi..-9' y-- 1 M.: ..1?q.g-If X-age.--.4X .-3.fu.-3.-L.-w.,,w,-.1.,.-in.,--.X 513231. -msgseqs-veiw.:f.5.. ...vi-,X--Q.:-gfx.f --E.-.S -..:f..f..:-ff..-vis -.X- 1- -4- .-SGW: '. --...W-mf.-Q-QS...-21:12.W-P '..-.,X.X,...QAM .nfl--sm 2,w,fr'9-- .S-ff-.--:i-3: -G. .' --X .'..X..f,,... ff. X.- -.izrwanu-fEw.f--'5- v,-wG '.-.A-J-. -H11-.JI q:.2.e-.w --flwf-f - .-1'-vc-1.-2-N.,-f '-'---.rf--S '.,w29..:s.f.- Y:-14--awfniv-.1Xf-af:-1-.-f .A-..-425?f1.:.-4 Q.-4-.2if.-W...--.--s.f-wcwmfaf..X-gf-.h..:,g:.,gg-...swf-v.1.mf.-1...1.0-1.,.m. .-1--...QQ ...-11. .-X.g:.ef-fy-14.5-sb..ww.-.-41-.-X.4 .,- X--- 1 4.1.-,. -,f.-X-X. - --1. -Xzfz, .1-:,..':1 43.52.-K1-f.w.,Qgl..n-S-Q-.rw-f.-...limi-1-S Zigi...-X-f5h9a..,i-QEfbfg-v'Sgqfy,3i.f,iXMSwQ3.r-- Q-A-.5.f'.fgy -ifrfiisf f.'? J'1-Hyifu, 5:m12,,5fiz. ,.fg,.X:,-2..---gQk,11g My-fa:-.:...,!XL.f 1. .--1...,..3.3Q.maby--1..'rsav1?f'w-ff.-W-'z,.-wx-P-f-:.'r:m12:- -'-4,w.g:.f.e---M... .mg-1. QW .-tw-:iw 2.-.yi-0.1.-.... M. 2-away-4g.::'.pi5'-Me:a-iaf.s1.f--kja 'gri2. -.wh-,-QX . .zf.-E-2f..i?f5Xz.fL24g'gL?fii-,.91.p:-.yhmgww-.avi-iaqxfzfx.newga.i1gg.-'gwgqzf--9 :.f.f:X,,xw-.nw-Xt-4129.554ag...sr-'-'fvfzff-2.gSS4-g53i:f-xe-1-Xv'-'fm--:A'.-fi:-mmf.-f+R.z:.::eg-f.'p.- 2Q':?fk-L'fZ'1'4f: .413-1?2'ff-'if ':4fe'r1: diffzif? F5114-5lqfi1'9'WWE'-fgihxi15-?ff'S- ?1.2.e:2.Q-2'i S-if mm..-X --H fx-1 iv Hfilt-if-ww' :WA-af M-QQJ4-,af -''g?ff...?i:fQ8-fini:-r5.2.. -Qfwf ii:-X,g,i2fffH:4fE. 2 ff- fa-n-ui .WJ-A i. 1 3-.wif-ff-I 2212-21-Q-Q -fears---I-an.---iv-:ff fs-.ggbfmb--3-1-2 mg 211-mf :gm-3.-Xqf.J:,.,Q-X,g:.gf-.ge -rw. .gag-.-4.-af...-,.c.Xg..'-e..m.4.-feb.,SP-'Q-.wg-E-.'uff.:..wwf -iv-:,.-Xw ie..-549. 1.2112-ww-.wpf-'.q.cf:..-X-. wal?-fi.1is.ff1.4--1-ffml:---.5-kr:A gffe--gp -1,2-Q a.-:-1.11.21 .4- gwafifisgw.wa-4-f---ff-f-51Qwwr.f:f-.e:.22----W-'fuirf -2f'zf'f.:XCff gi-2'-Vw -1w2- .-ff--N .fw-S-ii!-frl'v .r-.i.f'f:.faf.M...ex2--5-.:Qfw-Qs:-smifirnw1'-.fm-1- 1-.a J..--fp-ax-:ef--1.f.a-ff.---'QX .-'--1..2-5-3.-5-t-Q-.-f.1f:-Xse:--.2Xu.-S2-.::Xq.gePY.:----M -....--JX44...:.-5,5X14-5-X...-. f, -1 .-15-14115 v1gm,.77f1v.w:'-.fy ..wfrue-fs.-.-wlif-.4.?i-i-:-.-f.RX1-3,2pi,5g-.Q - Xw-.Nl.f4Xf:-cw, , 4 X- Miffrifa X.f -XD --1.-is 1--g:mX,5.1.fi-J--F..-Q.-1 3-4:z,.:.w:4f..-K'2.41S-.r'..--X.:f:Xgi:f4X3-fkf.ff,'--Eu,Si. --fe-qs-fmye.1f.':-5.-mga-W -,f-...mf-..-gn. -gc..::aq'e.,5y.w..X. 1.-5: 6.-.,iX-f-. X ff.. .1?J':'f. :I :rr-1-we-f .,fX.,.5XX:?+ 11211 1 XE-5. :Ffh-I7T?gi'Fg -WG.-4 -,g-p. -:m-.- :.Xg -iggggaapf Q-mf' fw'i3?N'MQg1 fggufgf-q - +2-fm Q-?.w-X111-4. .aim rg. .1511-M '55Q95g-,iffm :aww .Mix -r L 4-vie? .vm if gk- eg1?ff'4sil,.E5ifir 5i44a:-43. turf .-.-:,.g-X. -'s fif.-XXL-S. ai 1 . -1 isbispgs -333 fa- as-XM +2,ff'5sQ1E63.1if-2.-ffqqw meafkmfmsfizga--ff 2.151-.X ixuffa miavzf:.X.-i5X5...f5if 'Q!-'wp-sw.L--.- . -.452-.g..9..wsw,5f:11g4gf5-si-:g- 3554? -fzzmrf ,ifwfffifg wh-x:SHv:'a.vgnfgw-.:..-Z A41-.Cy.,,w.v.Q-.vifwff -3,ef.:g.-y gg: H' -if .hy -fum -9 3-'iWX.:.,4 .-D,-Mg-fg5g5.X,.:. .5 X-4--'..i1-X-X-'. ww, Xf? xS:w'1vgh-f.-..f.-.1.-p --ig-w1J.wfv,:....X-:ga-mf--f'.wf -- -mm-Nw-s'4f.s-fitf-Am- .-inoff?f-si.Zx'Gwp-fs..-'-'rgfgg-A-1-1-45Y.'----Xvfn f,.T-.1--.rftffi?-'-':-e- -X .1-f.-XJ... -I. w N- Q 1 - . 1....:M'j+N -- W fwjfiff, - 4 b A.-+14 Hz -:J MY -4 ww...-. -13 .wg QR 2--FW-'-.Sm'A:---'-'sb W.. --55-11115 -ff-gr.-u-' 1'---.5 5--fv. ,..- .,,. -xg'-X42..-r-f?'2'..1f-!.:-.ww-mw. --xiw--..---.-AM. M mv W--,wmfwv -' -.. .,:w.--,.' vi... ' -.15 Xfx--.-'mrff-:fi 1 .gifs-.-ww,-.,5 a.Xq,4.3,pX,Jg1,X-,-5-:iQ.L.f.4,.,M-fX-'-fa ...1-. --X fm, gg. .ul if Mm --i--wr. 5-:e!Q:.9,.,x-f' -. -1-215:-fd Wg-MX. -'.,X-.X,.f.X..,..., -- 1 -e X.v.1f.1QQ,.L.,.. -.-...KM .. W. f.f..s:.....XX4,...,-.-wX..fXwqe.- L.-3'9A+nJ.mX-H X,'X...-.W-X-.-..,3...-.Ar...-.mg. .X.f.,.x..XM..X,.,,.X.,.s-. ,..Xg,,.1..X LW,-X4-.,2....:f.-. mga we Q.. .XM--Lv .mv w. X2 3 W. -f-'X - .514 JP' Via. f- --4,252.45 -ff-L X. '13 i4l:f5' x .-sg. --Q-w LFf?J 5' exif...-Xffrl.--I.: :E - +,y5h'-. 5-'fm Q-K.-4 fem' 3+ -.-v'. '6---.-. ,.12?.-X--. fel. -: ',' .--fe-mis?-X mi. r1.':- -12 1---.f v.X:--fl.-Q-5 '-1'.'.1v .:.-3.-fx... --' H A ' ' ' I x - 1- - f W --iw . .-iz-1:.'-.2-eww..-...X e:fQ::iLfifW.f-2--.555--2.-Tia?-Af.521-.W5-1fQfI'f.2f-ffm-1,5 1-1-1 'A' Q WM W6 'Q' Q ' N 4 i'W'A' ' .'LL'W2-I--M f?4'3'i-1342-14 EW! WJ? -X-X.'1'.,.fg-. 'f -9.-f-. 4.5 . X X X X W X X XX sf? A .- XJ5-wi .f5S:.w1.3-X,X.rX-12.4--.Q z-AEM,-5 X . .-XX... X X-X -l ,544 ,Rr -ff? X A---3--53? Qg,W.a:.-X .Wu :wX'X.XMN. .X9Xx.W.gL5lX,?XXj my MWXM XX M W, X' X, AW . V , I W A XX . . X . an .-..X.X. X ...XM-.XX..XX,X, m-.nw g,,.ygs.,?-14.43 X X XXXMXXWXXX . X XX XX X .XWXXXX XX.XxX.cX,X'v:mXf W WX:iXW,Xn?wX -,vit 654.115-. 4 fn. M. 1 11, My EP Q32 M... . .. ...X .. ,. .gp.,,. . X. X XXW, , XX ,MXN A UW hm I M x,. 1 '-M'----' ---- --. X. ,X., . W .--f v 1 fu- .1 4. ffm.-Ur. XX . . . .N Q w Q Q. fa ax .12 .pw-. QQ? MW vfffw 34 Q U ,W X., Y., f Mkt my V MIX V KX -fx.-f - - .. . va . , 94' if A N. Q...-rw. . -11 .in U H- 4 W .2-SM?- '-if. Q .4 -my M-Aw --,TW-gg--H -H1 .. .im .. ., X 6 79 br -.4 wtf 1 -S -. - TX-M5-xii 2...---.M-XX... -'fy-5.-.Q . ...P .af ...am .QV fi 1 W.. ,XX as qs... .uf fmji- - ' ' ...Q X, .-.-.L -.-- - -.--,Q -I ---.M '-'.--M - -.K --..XJ.4X 5.4. X ... X ,, .- Q., 5. 1- .u X- 'Q-.-N, .X yy '- X-p ,-,, ,g--N. XX .X .. 1-. ...XX XX,iXg5X -.X-XXL 3 -X A X-f xg 5 My X -.X. en.-yi X...-X,'.XX-'W X-XX. ,XXX-X. .-,XX,X..X.X-.-X.. 1-. ,Jw f- - K -- -- 9 WH- --1. ' H' ' ' A wwf--W 'W 'f--'--if-'511.-Jw.-1--ff.-'.. ggxgsgpkf-Viv-2g5.5jgg1.XX.iw,-3,-Xie...'fx--sw--21-fX M-'5XT25Q5w.ffw ' f ' 'aff' N -M--Q - hi .MX-4f.-y..X.....m,zQX9-X.-3.5.-:--'--rt-'L:,?,.'jN-Dfjg .z 1 M 212- .5 X-gf-'VAW'f':i.:'w:P'3w .X Q.. W. ,X,,,..,... 5 x 4 . .- .mznfi 3.--W fr- -sv -1.2 W J y .,-f-Qu w-i123-i--f-:f.H 2- -UN-.'-X' 1. 4- vp.-rw. -XM .,, w, -.M :,X.X,X , .X .,-M3-f J. X -X My X a. v W.. Z X.X....- XX X X ...X XX X XX XXX X X ga wiv.:-E'i -XX':.Xf3...,m. X- X...-'mV.:.i-j.'l ' .viq...W-Wi,-.-X.fv9y5Xggg.,, :LN-,Wpn --Xg,1,.,,m--A HIM S1--:MX ,424 .4 .fg 49.-,:fX.-.SX ' ...,p gf.-7 N, 'v X -1 'bk-1''-,.3.--w4M,ug.gX-gm L-.'vg'::.-...SQ-XX. w-414: -X,-'QW' ?f-M '-..1-win. - 21, Am- 1 -3.X...X.+..-.1- r , , ,- . .. . -. , . . . 1 'K ' .QM XX- 9.5 -...U Xxg,-X.--Xg..XX.,g1 -.-.gy XX11Xf--...QM -.ff .XXXm. ,-.X- -.9 ,M .-,QNX g-X .X.ZXXg-S if .5-2.-.. siXXXg.epfw,v3XX,-.mm.,XW- -M X..X4fq,,X.., .. X.,5...XX gg,-3.5.-.Q -...Ji ..-M 55--,.,X..,.X... ..rX..X.Xu,X54X4 Gx.w..yX,-X......-1X-1..,fu9:.X.,.:5,4.X.gXX.,-,,, ... X k. -wr... XfL.XX-..f .'-F... fw,.n,,-X.-XX X-1414.--XX..X, . X. -X1 ,.X1,J g X- ...M ... X, . 1:4 1-'l1.2-ffi-.2-my-9 If4-vw.'.-'ygqfsffgee-isiii:-fgggfezff JMR If 2-iw. M--. x-LW' f:fffi.f.- 3-2.-5.5541 -i FQCZZW lim. --.W-XJ:--f-' nfl' mX'.r.-xff-1--111 Q- HQWX QLz?ji.r1 '-Jr' H-M-,-Fi. '?1?'ih?ff -fs-.--.2-mf?-.twevd S: .E-A--1: L. i1:'flf2 L--'tf-:RWLL H22-.af-5 .-1'f-.1-Mi-'11 -. Q---HQ'-Hi?l1.'i -23'--if. -f ffse'..f:- 1-I if- '-'fr-'f--Y -fu-.1-fX4.e.i.-.rkrz -W .5.g5ffv:.'f-f-vw -1.9.-mK5-'-Xf3w--'tfx-'z-4'f:'f.1'2----we-1...-ff-f-Y-:5-.514-.?.'..sb9:'sl-.a..f'1-r'?f.-V-fi-vs- .f'sXf:--ff'-2 bi-X. .-'.-1-w-1-5.?. ..--1 :3.X1-.f.1vXqv-aW:fg..X.' fans-a-.1'x.::agf mf- -3- '.-iw 0.-.1 if---mia-...---M X-f - -.QR-1-s.X,,, My- Q., .f-.x...N--X1- aff-inf.. .mfff .N-L Xmr..,g..p,-.,...-.- Q. mas-sfx.4.g'UX.X4-QX. A.. .-.X,.-...A .- ..-M,--.y .Mx ,-:5X..,.f,XX...-.+. ,,-ff.-1.-.,,. -,. X, f.-,.,,.f-1wX.- ..-.-.-.fX-y..,-- .-.,,-.ya ...X .. .. .. X... 1, . . fX.. --.- .. ...H X. . S1-.-FJLS X-zu.. '-.'-fm . 2gf9.wfswfiie-T-EY-41.511-L--:L527-..av--1'CHQnf-2ffm-.gl-.-wg'-Q52-P-.-95..1,cX-1.H.gs-if-sg-,X.5.kg9--1'gin.','-1.W'im--.','-'-'1g,-XX 4Xfr's.,-yy--.::fg-asf1.-.X-cw .vw 'f.-:.'!'- --,1.--- li-.zz-...eq -vzmi-..Ixi'?.Xff2'b:.i.-i'-X -.'.:.-NWC.-. +.-X..-:XZ-X.-aff'-11 mf,-:, ?1..'.--'-wg:bag'-'.-5----....sw.-1-.X'.'+-I--.f,3.u.-zg- 2. - 552:-:-Sf':w-. .1-r.-M .g-z..-Q, ,Xnf-.:3-xenwg ::g-g..:.g-X-131.--- g,f.?e,.-MXIT.,-.5--5 5g1...X-y.y1,.-,M-.5 Rf,-,,-QX.. .W.Xzf.g5pXy..4X.,pgpXgQ.:.:,,.m-,Q'.-1 -.pq X-nw...-2 ga.-Xgfg em,-.3--X. XCXX:--'fn'-X---. 1-' nf- -XX...-.fX1ge9w....:. ,X i-X.: 1... gf.. -...Q 5- U15-5 255511. :uw pw, s.-4... .gf-X,wf:4 Xz' fXggf3g..'rf -ffm' .X 23.3 .X':g:.1-Exz.kYq.?,5y.si5g?'.ge2.-milf5'a-,.X:q'.-:Sf :X -X5 2 ,Lt- -mfg,-'-5.5 inf .5-1-.53 . - -5 .3-f... X-.r,5-5,-,,5 ,L 'g,:9v.,gX,-33.1-,gg .u,-...-.g3.g4'- -'X ,Q -eng-4.1 .-.f'f,13-.Q.-.gf . .p51,X --X ,M-' af-. -'1-21--'-fs!-f11-5-1'.'0f'-----1--Ni' 12:1 .GK-aE2X'ff-f-.ffgigi-'-51.-z:'X-' vc-a.1zw. E'.f'H'-Givis wi--up -6.1152 4.51--fe:.v.---pWXf2'---'.-.-A 1 -... -1.2 :waz 4r-.wf--wvs-f1+ag.f.1X- 'Air' -'H-X4-. Q'-1.5-nw'-f.'- :f..-F- -affXa.-:f- ff-1-g.X y-.'---wir -:X- ' wma.-F4f1:.-'flfr-.sw--Xi. fi'--wr -' .mr --,, 1,4 1'--g'.5X..1 X LZ... Q,-1. f.:-X-.X-. ,.,X. -...J .f- -- A, ,,...,.X-. ,gi-.X-.ff.XpX,..-.2-m.,..:X,g.,,.,.. Q -X ,. .. -X,...,.1.,,.-.ff-X.. ,--...Q -W.. ,.. -L. X...c-,-,Xa 1' ---A-X.. ,,..-X Q,XX. 1...-.X , .-Vg-,.X. X. X....,.g5g..X. .,,X.. ,.,.. - .,.. w.. . .X .2 we . . 1-IP'-X'-ff'-1-.1-1-,-WX-.2S f'.. --1f.ff-u 5.0 - ff- 1-J 1-p:..2.X?zfe:5:2f-.r f'.ef:A.'-f-q.9f2.'.2411:tgf..1l'f.-iw-59.9-11.xz1fg....f:5Ffji'X1pm,,.w'-Eqfflff., X.41-fy.-qw31-W...-1.-.-15-...-2,44ffyfaq.-f5g.fX,,.,.y1..,-I .1.,.X.X.,Xl:g .-- -Z X-.X --.Q QRXXL, XX-f ...aw .-3.31 - g .-X:1qx-- ..5gg..X-.....,-X..g..fg.- ,....fQ.X, gy,-.31-. L..-X-XX. XX X- -X 5 . . .-X . .Xr-W 'DXQJ 3,1 HQ... X1 sX.'f:-5-.av-ng:-T'G1.'.'..,.,.:f..Q:iff -225174.11-af: J.. Q,---5.7-.9123-1,321UQ-5-'5'--?aX5f.1?f-fi-:i :.2i.f':gf.1Q-'S-35.51 X-.jXf.,r'5 5-33-X41i'f:..1'?...GX5531:Xfii- ' tl-SM.:':'f1. i-af,- .+-1,421 ,X f1FAi?'fi22-,,'? 'K .1.'.-bhp' 1.'l 1 .3'-fzff. 5-l,Z4,Q1:q '--FL-1 xi' 'y'-f.. X U. if-' ' - 5'f.1f 'if' f :QVC-if 1XC'.ff 31'7fR3-'ED 13. 7..'g'11i f Wg -5.-1f.f1g.Q-XZS:'Q'5lC'.JX'i'7.3'i .3g. ', ff-'?v, '1 y' Cf -:5 1X!-u'i f3tf-'EXF7'JQ '4Zif5-' :'f!.'-g.i'.-wh-1-5L,.'L,p:1..'-7--' fi' 1,5111 'Z' -2.f Q,?':-,.. gg ,111-J - 1X 0- 'aj-''JJXX-',,fk ':X-r?.X!'sJk5'j,j-f1'.,!f--f 1 If 'Xj 5.2. -, 'IX- -, 'f . -g: fX.fXii1 'W'-'-I 411'-' ELI 'v'1Yf1,i' .G?'f'l:L'.'yi1' X-2' -7 2. fl-. -1117 f.X - .- -.x 4. --1, XM.. z. J.-4 .-V,--.vm :f.m.,.-- gf..-,. .. .111 X., .fu-.1f..--.-1:-W.-.X-.-.:--.,:.---.Mix 4.-. -'.-X-'-14 .--.. :..+t.-f- .:-L. .vff-..1:-21.-.4-.. ...C-X. P. .1 - -- .15-:fm -,iffy . - -.1-.V :--f- .-.-'- ---. 1.- - ff1 1u1-2-.-56-' ' - Q . -ffm.. X . . 2 .---12511..2-:Tai-4-rf.-,Q-X',vm-..fX.,::,.:.'-.43.-c -X ...Xu rf.-m,w1.mv HX:-Q.-.v.---1 fag1-ww,-1.f..,p'A559,.5:-I-:gg--.m..:y':X-2:Q-4.-.!ff.f.-f1-'..-23.--gf.-X-gg-4....fm-. ...nf . -1-1 .Q 51. ...-' 1,-2 72 . X.'--.:X4g.-,1.g1.-.- 1--5'-.-.X--951 .--X-:wp .M '- f?.f..2gaiggQ ,L -.gg 2 3-1... ?-3x,f9rffsf-y-gf:-- .'.-.i5rj:1i,'f.a-.-.nw-rf:-gg-sgxra.f'55..gf.X,a-5 .Xgf X..'X,gX:-jf. --Xj,...EX'.Q'-41:-1-1.fri?-G-fegeiliihs-1:55-I f:'.f.-mi:-.ff -,fi --'-1--if -.fix i'i:f7?Qi'1ff?. :Fil-.':43XQ-31 :L- i'X-w,1i-..f'.'- 5'1 -,'f3-W 5Fff1'1fF5f-1X:l.f!-Eifzgwrffa-er-5-Sq'-.fei-:fi-.X.--rf :Fe5--Tifi-sf-iyigi--IX:-.1-.gf-.--.-.ffrwf-. . . -15-Er? 1..f...51x1-9-:XF--I-4--ge-'f. 'fre-Q .:i:2i'sf-2-X 'X '1. ---Lg'-ggi .gf--Myew1-1915-23.1-191-1.f1Q:2-4 -Qi-iw-ig'-23:75-Qhyffly-. Xf.--:X-JE: 'lbf'6 .'Qi-Sax-X71iff?-Xfiffwg-Yiginki,-?3.y-.frmfigg 1.Q-5955?'i'9'. v'?':'1'6+.'7:'73f'3 ' 71'-Yi:'55-If-953'-5j?iN'J37!f A2-X7--.KX-'.XH-1X-W,-Xi--ip..-S--.-.ff Aw Qilii' 1-4 -.:31':. ' -s-.Q-j'i'f.f.h1'2i.X sifikff- .,Q'-:.2LJ- Xp'-gf: 123.-gig 'wisgifagf'--341X .Xf.X.f-5,-,Xgi,' i' Xs1j1s 3,gX . .,.4.j... -gffm?-'--'ffg.,gXfj.g5.-., ,.g+.mX,. 51--.55v..w:X,1NX.1:. 'cg-X.,51X3jXgW.51g.ygX. :gf .ggi-53 -,X .3 X ,f5jX,.aiX.X.-gy- -9X.:f5.5 . X - XX.'L'.t2. X',-..'-iz. - 'fi-' v rf ny- .Swv-.1-.. Xr.-.X.9.X-Qi-'f.,,. Xyxgpzf .. ,X-gf. -.swf-.wX-. 'DX-.g'. - -l-X.-L.u-Ji,-,545 .'fz--'Wi--Q-.ar f-X-me er'- y'.f-'.1-ff XXwQ'-wffagg-?-X-12-X-JX.hgh-X'-W'-- V, '- 'XE--1e.Q'1-XX.. urn ----Iv ' -gf g' J 2 ...Xu XX -fr-X Q LX,--,.jX-,,:q,, -:Q-f -,.-. . .X -X xr 1 2.-.-,E .5-X. X . -,-,Y..'.5-1.-.-.wfzf----'TLSK.:?..-X-m. -...nbX...,m.f-.x-X-.,ybgfk-s-5.1.-.,X..-.X,-.fg-f,3X5,.X..--X.: XM.g,X.Xx.,.-,f..yX,.an,W-3+..g,q--.'n.gy-he-X-.W vW.-1-.....-.-.-.-XX,.w.-9.-X---XX .. ...--4-X1-4, ..+:.f.Q.-f X X .X.,.-.....-- . . f f - 1- up . .. .. - -X wa. X. fr---: ..X.-.z. rw- X- ,: '- .- -GW - 'w--- ..X :fl---f-v M..-'f .'-u:f.- 1. ,VX --1 XJ.: . '-. - ...svn-3 -.-.H 1 --,- -. -1--X -X-+--A...-. , 1 .X -.-.J Y'-:H -.X-e-.X 15- --.X-.XM A X.- .:sf.1-ii -Q-Q! J -X-: .. -Tp f--9 kr -1-X X: ,f.--1 9 -'5.f'1X:-gg Q.:-'-.. 15.-5... u-.-.Y-5-J-f .g X-'XZ ff-Tfwf-5XiT.f -'7 :4f-W1X551X3f.e!f ...e-gf-Qi' -P -1-5 E- ' .1--.1 Q-I -5 2-. fy 2-1 if.---,iw-g.X.5.-. .. .. -if 1-. Q--'.-X21 X- ,XXX 'Xf .X X-w-c-3 7-f ?Q?f.wl55'f .gg ...fy w Xa... 35-Xmgs. .gg 2 . X i.'aa:i,z-ffi Xi :T'g-1-'E-'Q .X-Ifgn.'.-'.-ffl 'ii 5.435251-'.. f?,gs.Xg.-'wi--2: G--zAX..?,-1,fwjcliifiz :fly.figi-.X-T.--X-X-. -, j:-,XL:X:X:f--Y,-X. gX.a3t,--.Xf ff.?m?fzg.iQ. .-X-1:53, .1- 1' , C- y--' In-.1-Xp .fp -. -.1Q'wif.-.55..'fi1:1r::g!. XZ -52.-- i'-W vX45.5.XQ'r1gzXs1-:1'X 33 pf.: - . X H H il 1 11-P-y.pfJj.g''XX-'L-.,.Xg:u-1-'Q-'Q-.-'-'Amfx!---XX'XgJ2'j----y-,.,--M-:Xapki:5y'QJ?355n3g2X--12-...Wi XF? -...Vw144':X..'-rv?-.g1,zg..3.-I-1-.mgrm-nfpi.-QFXXL-j,cw.XL-.?X-,X-XV--X55.515-.X:.':,g-1-.Xy'...f...-XfX:..X-X1-3+ --gn g' ,gf X,-.- ,.X33..,-.j.ffff-f,-X5 XX: .X:X.-,- gn... -, - -X . ' X- .- XX--f-. -, :-.-V. X -rj. :XX..X,.-.X ., -XM-. .X-.W ,X ,g...X.X.,.XXfX ..qX.yf.X- X.-XX- -.3 .XX... V 1. X- -, 4,-X...-:X--..WA.-mg.-..Xzgfr-wa-..s:.fa-...XZ-.-.-531 -.X.X XXX-.X-X .X-.X --XX...XX?-X.X.,..,X.X4X-...XX .,,XX---4 .. X .,Q-.,-Q-.Z.-HX-X---5-f, X,1-XXg--X-- X - .-,X - . X,Xg-.-.f:X- -X --- . X . kv--QQ f- --...uf -::--.----w--1.--lm-1...-w pe. 4-----WRWY -sv 7.--Q.-4 1- -W -wx - - --.--1.---A--..f-.1-1-.-wma---....f.-'-fX... L .-.XM , M -XX..1XX..-..--X-.XX - -- -,f-. -...f-.XXQX-.-.,Xy.--w --1.- M ' -' 'Nw X-.. . -4 .X . ----.N .. -.' ww -Y -- I W--.e 'QWHWi?-Y-fVP? ff'ff1523-61Q5?'v?-Wifi-?a?xf-5g2T3a3J?-l'ff.ff.1'?5ffE.-Wi'75527wig-54- l'f4.f925-WG?EQ-El-5-F23-ii?-Q-RSEQMif-Wit .-'i'LL.Q'ff-7'XTUI'lui-QWE'-'-Q'YTQ'--QW-2.ff3--Pi ff'---.Qf'1-.:. f ' sv XX fi -. !--'9.fT..f..-Q1- 2'-4-':f.'. -'H-- '5-Af .-G-'ful---3 ,- Q,r....wQf -1-5'X.z'.Q4 :'i- -Pi' fl..-az4'.z'W' 1.-'Ms-:Q'f:!5 -Q'1'0 f?'.'-'iafi 'r l'.i:t.5:S::.-X-. JGX'-V--,-1 'WJ X2 -.'-W' J:fl!-22-1 fCix,':WFWM.'is-W.ii' 4-iii'Fi12 ':-21.-ae' .4.W':-'-'im--v' f. '- -'Q-'-9511'f3--?Z '-2315!HSE?-zz?--XA-nfl'-V .1 f X Z w V . .J ff' .1 -I'-'..'f.15 ' -4 DBX: 1, .-- X m L V5 4.2 -1.- f--511'feqii''wIzfX-j.g.y29'ff:4Qi55215S?gi?i5kF:,4'if3fr-??57iik.'F-C-i3i'3Vci-XIlf72'g.Q.:J Xfl.Xg'1-Miiyqg-fry'43'-.-.Xj.w.i:'2.-Qi---KXQWLQQQfe?51.3-'::Xr,.YY52.-fimi.-., X '-gl--.fx-1,,X2 ',X-0. 51-Lu g'X .X-Xi-'rig..Q-War. JXX-XX-f - E-2: 3-f:zX..:..vi. 1- --L 9- r. --rw'2a 13:1- --!fi'.1 :. a.-rI.':1a -W.-P' fiiwf-Q?-.-.'.da:J'1-f 9-E-3'LX.Za:-mwtiw 'J-X Q 'w,2f-ye' -S3 .i..:X.f.---...QT-'.' bg.. X:-.'.k.X.-X 2 Q..--.X..X-y.-....g XgX: --'g.z.X-rg. 1:X Xi'---',.7--Q.,-ax, ,ifXX--'4X'g.,.:.i-LqfX.' .-X'q.-fg..Xg- ' fi VX 1f.35xf'.fg53:-.2-.-.--,f'-'fi'Y -91:-'-5--..-.f-1-27g11ff.3iF54c-wiS13-a-ixivygi-2fisff--X--Fr lf:--'f??X-ww,1---f-:.q:fE:?fS:vw-ey:ifff-11.-.1wif!--waW--.-..'.X-1-12:5-9.'.f'?3 5.-.-:X.--...nf-.':X --:. X-. C-.X .ff .---1-Lg.-,-1:faX5.,X---X :fem--.2,? Q -V3 2.1: .HX ...XXX-.. X-M1115 .X 3.2, uv- 1-ff 1- .- - .w-XgX1.f -z-1.5 4,-QIX .,.4...-Q JX.: .o...-..-we--,,..f,-1. -.5',-.,-.Q-F X.-,,XxX.-X X-XX...-. ,X-.XXQ-mf,-15.-Q-.X..g...,.Xs.L-.-.,'.... X .. 5,-X -... ,XXX-,z -. .M .3--X .4-.fXXQ. -, -X.X.4x X X.. - .X -...- ...XX--.f X.. - X .-41... 1, ..-X.. X . X -'-.-,X J., . .- -1-ggP'.':fi1fXf1:2ff-4 --':fs'.-::iXf4.z.ws-5:2-.-1f2.f-.. -r?1:1X1-9e.X14.1w.,.'1. V-.'f.:1.5:2f f.-'--...rg-2 f--f-.-3-.--. :':- F.:-Q'--:.3' .F'-f-- '.fX,k5.-fifixgqfQ2'S:'3?f.J -1 -- X-1'..--iff. -X' ' we .2415 rn Xwg 21'Q2.X'1Xg?n.2f.-1-aziir'-ji-'M-'X' : Xf34iv-Q-u.'-.1115 5-YZiiffigfzfjf-T'-'JS-FL'affix:Ll.X'..1'p?i'-.'I'f'X11-ir' 'V .SmQ3.15gfl-if-Sz?-E.Cf6:f',e.-lyk-5,qX...gfX1'jim- :gfX3.:'g'.:f-.Qi 35,,X-J'.1g.X.-X. gy'5.--'X-.-'-sf.,-.5 XXX.:XXiI-5 A-fy,-r'! X ' S-g. ,gif '5,g5q..-X-wg..-X. ,.X 1XX,fw-.X..-'j-frj- .X. . 1-1--2.2: 5:5-' 'JfFlfl7'g 2 .--max. -fa-:-. Q- 1?-fp '-2' Fan- 'LY - ..J':XL - .Q 4- ..-gf.. L L 'if ',f1-X1- ,Xi .QX1-:fl'SZL.f-j 2Ql,.ghX.3 ,'-Xu F 52,7 X',xf Tlx..rf.j4f.S,.-25+.ff-iQQ.,n-5.57.2 g-,K-,KE '.X. 'X:,..A A .mgij-iw.-g ,Q filly--.X-a-Xkjijgggfra--X 'XX-if-1-tj,-'-,:,A,gig - XM- '.X NX 1-.jj1J.,f' i--X4 Q ,gi tgX,k1,- 7, ,, X V'XXl,-,- Us-Jgljsv pf Qu- : 5-g XXX . 'f ,159 f 1,5 ' ' Q V .X wif '55, Hg Lgi..-15:72, ,X,,y,. .I 0 jj Apt- ,X ,g '.X - -'AX -K1-',f-p g , -1 wa.-XX... ..,.,X.v. .,..X..X.ff.-F...f-.g3,....,XX K., .XX.X.X,n,,. .- .,XXX,.X QXXXX-....X,.. X . ,X.X,.-X Q . .X XX.. . .,,,....,Xp ,X .,X., . .WX . ., X. , X.. .XXX,X ...,,,,XXqX. . '11 -iff ZFKT'-ax-'HT115'-.1-?'.'v.:f.:'.t'f:.:F-j--,'-FCyi--35X'-M-IL...fiavvurf-X1-5--gg,.1--wg-' -vi--Q 56:33-5.525125-w2Xr4:3-g-Xa'.-f-'7.X-, --1..---sf-X. ' .-1 Y W,:.'1X-'.':-.. -2 J--34.-'1.'X.X-14.1 -X:' 1 M- x ,-'3:X H- 5 -Xpyfs-,:IX.-1 Zlfifi if 1- T5-75112-f 7' - - X ' Kizigfi-i.i?..X3 :-1 5Ss??Xg-fi . -?.-'EP ' ' ' fiifi-sifi'-fkjsf. G f f,-1.17-'...fi-. - gg:-1' . s-1. t- X.: -Xj 1g.:1:-'X X3 1-. '-fggl.-4i-'52-224.-gg11.'.:.-.H5,51 X. XI '-..j- 'q:f', 1. 'vX gf. 11.W-21'--3-'15,,'g'i.g f.2Lf. -- X. ..--.113 ' - FU-','4 rf., 'y' X1 X 3' -,.- ' 1,2-1:1 -'X'i:-'..6X.Xj...:3zX.f. f,:- V 11 3-14.2, ' 92,-1-:XA -.--.. ff ..-1.11-' ...E-1 . rt: -' -. --. -e-.X -1- --: ff-1...-X-Xg,.fX:.g.--.X..X,X. -S ... - ..,.- .5.1-XLg:.'g.-5- . Xr. . -. X . XX., -- -.. ,- ,X X- g .4- ..- ,- .X,---3.-1--A ,gm-X. . V '- . -- - V -. -2- 1. .--..n:'- hwy ,. X--:...,w -.. XFX, ... ' - ..--:H-rr ...'.- wk Xi-..f,.,af.feg-.-wan-2.3-.---X-.--4 .fu-:.X-.. X.X,1g.n- 1.1...--X....- me .. .- -f, - -,gf--.f - . 1, V - - .- . -X -f 1- .,.-f 'L'-yf---vs: 5 13 Xf! . -1.9375 A-J.. .fi f,g1zi--:.:1-,-'f-.-.-f- .--ggX.qX.'g..X1, Xu -fig: 5 X.-gufam-Xl. X :X, X.--XM... y,-,- ,.-.X+...'...-a1f.f.- - '- ,- , f...-: XUXJ,-,,1X . - ,--,--,X X X, , X . . X: . -g..3.1X Xg. ' .. m y 2 -- gg -L 1.-f-aw '-.gm -1- .1 .-Jag... .f ,'--:tw .-.ve 1--X 2' : --wr-H1 L 'f. f,-PV - nf... .,- .- -- X Xi:-. 2-. 3 .. . -' -.-.If .1 1 , .X ff! :X 1 if L'-.,-I-NvyXf,js-g:?gq,g:X:v. Xp .-.X,y,. 51,2 ...'- ' 4 .-X...f- ,4-2--:fi vp.-3 .1.-.2-L . 1 -X.'g.X1.-.5 -X -'z .,,.s.xq-gf.-. f.X-Q-X 5' .is--'rf f W .---i- 1 1,11 1 .2 -af-..f.:.,g ,5 X. .X . -,X:...X - - - X -' '- 3,X1..--...-,X- . -.X.-'--.-'Y N Q H ' , '--. '-!.,' T-' 'Q-Q' V .5-.11 -H-Ju, f..' 'f 1 1 W' -1-N 55'1.'f'.'11A lfi:- F ',v- - 1- r--'Sv- ' -17'-'. -1.5,-f.-X1 -1- . X-11 Q .- '.l .- '3. u .3 , --' 2 U ' ' T ' rf' -1 A '.' -. Q' V fm- 5 .-12' ',' 'fl X..-va.:-.fy..Xff.ey Xy- X.-X -- 11---vg-..y .u -1 - Q -- ,May-:X-.XX A -fu.--.ig-X-1'X-.x X -.f--f ff - - '- gg -. '-1. M ff '1 .T'.'L:1--'J9s2'5lE1-X.Mall-.-'-K--??3.'r- 117-:.+r,....1'X'--wr.--X-'X.:X-fpXa-12.5-.'-sf-2--SXX. 3?-vp-2 X-2iXX::-XJ-15-.I:'.1X-Q. -Mg .X -1. 4: X L-.5-4-.'X: ' :Sf ? ' 4 XX '1.::,:4 '. -'--f.-'.-'55 sus -L..-. if--5-1,:!a.X..:w .g. -X:-7'LsX+ Qsp-1-.aw-.e....-w..:g11X-if1XEX:5.H-tx--.f. . . -.F . 1--uw XX 'X' va-.-.,grX5-f-.,. X-X -115.51 1, nf X ...fi - - - V: ,,, 'r'i:i:e':,:X.,1r'ij.z.--eX.g-X-!'- '-1.-v-5-L,'1',gzX1 '!Lyr'fp-fXgaf.fe.-igfwgi-g-..-5'-'--.,51X.fw?-2.-'15,v2.fyX.,b-1-4. -eM-'wgfizh-ie-..w-X ie-5.-is-lf.. f. ff. ,- -1--i-Ta,-5-.'. -X.sX X-X-Q ,.g.- - .zgu-X :X .X .-2'--.. XX-.' .X - X ' ' X.--X-.gg '.-X-jg. '- -.w - QQ. .- .1 X -Xmzfemsg-2.-'H ef-.:. 45-.-1.4.egg-X..-.1-'XX' '-..:--,-fA?fg:w-H-gfvs-uewff? fi'.f--H.-5:':.-.',-Sfzsafi' -1,-.L-. wgu...---id'-. . '-lig-.rm--'gf a -fi -3- v' - - -' . . . Q. . -wf 4 fl .9-A 'f . -fm.----'w:vE- --f-2-1:-vw xi-f--1-iw-i-'w----.W151.1-in-2H. fx..-Pr.-i?2EE:fw..X:4.X.f.H-.X-X---w-1fX-.:44.3:.zf.--We-.'C---afr.'ff-'zx'f-v-.-v+fe.--45-'-2X,f.'.-Siff'-f-..-:QP 1.2-iw-.-'vff-rf-lr.-1-.5 E3'f4i,'. -an V .. X. w - X-1-.-'. iq- -- -,-.-fx.. .. y..:.fL1.w'-2X9 X-aw-XX ivxfgf .mx-X:-'-gsm.-X554 'aff .ww-.XM--s -fPfX5y,ggiwgw.ggqj-vg1Z:'1'1gX4:53-v:,f vw' W-fy,-5w:..X fs gfskf'--1Xfiic' iw..---Q..:..-..,-.-.-XAlLw.NXnf.--f..' ww x-. X..X-Jf:-- J .nm gi- -Y .-L63 Mrs. 2.-122:15 21162-Z1-Y:af:-rg .-'..-H. .X.1.XxX.J-.-5. far. Fi. mi.. s5g.X.X-x,XX-X: ,X cg-:X.--.X-1.--f--X .,. .-5.3 ' L . 5X,fe5..aa-.--.X:,:..X.-1-'.w5sg...twQ .5i.Q-3,454 .-me-1 Jim, .X-.X.-.-Tu 1-' Wfwf.ii-fm'--.g.w A141-X.Xwfv .- ve' .g..XXqg,- -gg-2.54, 4'-TiX.,V,' X:--fm-.iwa,.s'Q2i?-ag-X,X-'lQ42g.X, '-...:....wy.3. X:-.ty-'X-'-5-mafy-:--:Az-2. xx-fag - -, rp- t- Xa. -DM---6 wwf:-.' 25- '? 11- .1-1-X-Q.-'Eid ay-fp... 3.1-,Sz fm-11 .-'Z -f-fran-153: P-gf:-iw- -WQWQUL.-f --gil!-r --1-1-rf.:-.L-.H-ffm-1'-A-541'-aww-uf-'Z'-5-'-va' ..--T.-.wwf-f'1:-:w .'W'x-'-:Q15-'fiafalvmr V-5--35,.:s -dim. .an-'Mi-12--ff--'E.'f-'4fvrS'ymw-Q-:af-H..51--mf' ww L---1---1 .Jw-'-'f'.-'ww -Mwyf2Y?- if wi..e5'v,y.f- 7--- 'Y Q..-vw..--Q1 wr- .ef --.-LM.. -' - --..,,f.X.4.e,' N3.w-w :- 14.351,-. nh'f.g--31 FW -1--V.-.MV-'wxxXf5.. :gr-.cw -X51.1Qfe5-GMX F.--1,..pa.XiM -laqgs 'A' .W---.gf K'-.-3.5.55-1ff'X'-.z...c.-3,.Qf,Qgg.-x,f.1 wr...egg-'xg-.XX-Q.-'-if mf-.1-5 -afgf,--X-: 9-Xw':i-4'.-5:5-fmxhlx-3yXQ.-?'q-an-1.3:-., f-1.-1.1-11. --Ng---Tr,.5..X..h-K if.-W--.Xifag 2f52,,z'5-mf''iZWl1'H-1572 -1'-'-.'n :P.9.---P'--Tw'-xy--.LW-2' .iff- X-Xfp. '.3::wce-gif'-A Wa? MQM QS- ' GM---+2...p'fw QnL. ?'1'iZ5W2 31-Q.:-z., .-1224-high-.W-f5gfS3'w.:1?' , .gm-QQ..-X2-f W -A.-5 5. XXr:w-X-43'-5:52-ym f.X,.:'- --Q.. gg--, My ,fu-36X-3.551-,ir-.fg.: .:g.-.g.X.'--M:-5-gg.. :- .. --hr , X125-.gi-Q3-vqgfrffmffg -,-,gpfif-W.-.:g..p.1 :X..3 .Lg-Xw,.1g. wg1.-.X-:lm-7-...ii-X5f'a'Qf4X3--f--X fs2.fw.---b11.12..e5-5 wb-2 2---4vrf.y:Wfx:5i3.4iR6 .f-55.3-53g-ziaXf7i-f4ffQf5g.i12QFwqmvg--'-qMP9..f'f1-Qfgfe-ay-.2t:!f.f4fe.1 .5-g.:5-55-gigef--r-wrvv S1Wi.X.xX.ye-kgwm.Xf:--yrs c.vq-,waxy5-44-gq:-,ef-:gn-'Xlt fx-.ge-.11-Q-Xaf.-.v!.g,g,1.-.'-6...g,g:,ffex54:izfmg5e.4q:a-gmXXX:-159.11.XXQ .1-qX,,v yr,---.,fa,g.---WX. -1.---wgfa.,Xsw?w.-sim-.X--Q.ff-XX...--r'.7X-.-.Xuf-e-.-..:'+1'1..X.4f 5X- -W1-Q-XTJX-gy.. ni:?5.t15+?e-'fd .'..5-fu. ggi..-x mf--.-f.y....f.f4.f-HN 3 .4 -mam? w -fail':3f 1:zT'-?1 f QQXWHX va.XwHYKw-.z 1rf.-,-1-- M'-WK.. lk-'I-W-'xzkfe---.11 ish,-.wf1-fX2m,:S-Wife.. -fig?-::f?1fgt?'rw-WL'-2-'1M,iQ-13.2.2-.f'.---Q.. we -'..-A1529 41fQfl1:f?V'iff.29?- -Sffgwyf-Q wfsfww- -1 1.-.xi 'frm ..v-w...--...wX-13se'i:1mf15.:.,-Xf-.M ,.X-5- mf.. -5 a-1,--Xfgm-.,..X..M-.-X..-i A--XL. .1 X-.iw - mf -- X- mm- ' . -s.,-'XkQw3.'5m-.Jw-.-c -M - --W .-- -M- -..-.flw--gsm-uf-:warg-wiv. .A--fm-.-lm-1-v:fl-ch. aww- V --.2-ww -f.s.,f...,-.-f.1...-ww-a -1 X1 .ww-.1 X. .Xw am. -L-.-..X.1iv.-r.--.-.-X-:..., Mn..-1. .L 1. .- -,Xs-M4-Q... .f-X.-f..y..9.- -. -.-,X....X.X-W.. X-W...-Q. .i w-X-.-X.. -W f A -Xv X.-we .- .--1.---9 fx-.121 ia.-S+ '-'-:..iXX.-- ...nw -' :ST...w, 11:-:K ,Q--'NWHY--S - .-...Q-M ww:-Q-Zvi-4..af-.5 r.Kww.w.v-m.4f1m6' Swwnfrwv.ffmmx-f-ig-W-eww.: -'fm'-W-'-W -vw-mfs H+- .--4--fp..J1:.r-Xfm. Qu., --,X ...X-qw.-4.1.2,-uwQw:-w-- --. s5.'.:.'- Jf....:4-B -W' +.X-M3 X. ws-1:1 gi--g--1Qifw- W-..1g-ww,-yf.-wp.e-,.-1 .-,X V. .X-pe 1-sv.,---,.3 :M Revs- .mf fc.-P.--L.'.-TX:-:.f'.QX'w -X...--1 -gXX,,f f- - f:v---'f.wr.m:v4Q,- -1311Q'Qg,-zany,-M..-'.-.f1g.f. ga- fem-,aw mu,-' u Pfu.-f---XX.tr-4w5'ff-iw?-S'gsLf ..-1:-X-qu X.. .J .X.z'-2? .E.f3yg,,y2-gmjqi--W-rl,-Q -Q1--o.-.-.uX3,..ep,-.5-.h--M.-gg--..-R-fu..'Q.e-gg..X-,xg-'ng-E-z..-.rg-gf--Q12-vqX'-wr-qw-nfN .Z --4'-.,.-----.N-WX fb3--1.173-,P,.Uma.fy-1-.X.X'ii.-,.Xg--,-4-1.5X.X-.-35.3.--:.5y3-.rS.,w.X..,.kXw, -waibf-9fg7..gk 5- 1-+35 ,7f!.'X.--,:-w-'-- -.f-w,:,y- ww- 3,.w22ic.gg.-iff .,fg1.w..a-1,-'Qc-1.41 uwgwib,-1--.-,ivr2fw.'-X51g1,.f.ms,f2.y-14:-.-- mc.-m.fr',-Q f:f..:..1---- -1-X-.--:1-saf.X.re-.sf--.'1E'x-fn.:-'x.-.-'H' 1.-,--1 '-1:-.w:.:f-iw ai-f?,i-.Jet-me -.6 A-fkswy.-Nr: XA-ff-J .-P '-:w'.21fwf.- -44-ve.-miffa-.U-.4-1?-. 4. .L-J. 1--:-:.'X--,:.f sw W- ..eXf .--wsu - X.--.-f--.1-.:.-3q..:-X- -.4 - 1-.5- 1--1:--1 -X-...well mf-Lf -1 ..--wr. vi--'Q -.--f'.'.-W,-xt?-:-fc...915-...q-A-wif:--Q --3-ff-' .fvwi-'-J---'--'-'2-v'-.---M -ima-1:1.3114--,fx-.fX-vs. .f'M'g4--'-- -.Q ..y .W-'.X.:-'ffiv-.-X-',? -X--...Q---2.-W.-.--.' wx--A-3... -:X:A.:, . ..-'. .-.- Q---X'1.-.-MX.-.,.,y ----rs -1.-Xw1..X.....:.... --raw 1.33.-E11---9. r... .H- -J-..---X .Jef--.....a'-.L pvwgfguvx-Q, 'fnffi'-ww1...,.X,--XX.5-X...-.,--XX.f..X.X.p.X..-.1-... -5 -mx.-.X.-Xf.:,--mXff-, -Q.-XX. ...XQXXA X... X X. X ,X ,X I.. . V ,X .U12.131-:1a'iF-5.2, 4- vm '4 3- '-.-ww.Qaai:iwwfvhy-.-X-naw555.551-X.-3-2-.f15.g X4-. 4... c- -i17i.f.g,'C-l uf.:-475.4 ,W-5-fl.'-34'-if-ga,.P.sf.f gm-we-. '-fgQyL..:X--4.e.g--?X.,.-5-3.-3 f.Qsgw-:.f43g,.Xr354- :mn-X-5:-Xf',g X 'qgggaf 2:isgwg-:i..:g.f1n2XsFw.1'-. ---.-X - 1L.Hgn..1.-R-e-'g --w4,'?- 2-1114.-qv., .951-:gGXfuw 1-XJ wa 4,3 21 5- ff -.f-ff.-2' .mmf .51 Q 1-f,..-11:-.Nr F..-X-X.. w.wf..H:.:XX ., .m'X---X.- X- .Q-..-,xx X WLM... -w-.3...,f.w:f-ML-:-af-. -.-M..-.-+..-:-.:-4,-1- wr- Xa..-:--1 ...ff ,-'-X4-.swfQafwmf-.g.,.4.4 gn X1--:XX -. V :1-.- ww. .gr-an---X.. -mfmwaw:-W.-, , -- X. 1. : A- -X.: '.-pn.--X V -.xx-XX. X---X.. -1 Q. ,f - V 5 4,1 ..g.n. 4.3-..g-K...-.-1.52y-nf-.3-,.X-.4.-..v:1+,pw-1,y.X..fX -X, XX.. ,X...X,-.H 4.-Hman-.4 .. x...-5, -. -1.2,-X,-W-3 ,af...XX.-1-veg..-X-,-u-fXgE-f..- 2-F...-W... ,,-yiwr,--.gf 1?1- J..- Q. sw-4.9.-fX. n.:-9. - L. ,. f ff ,Q 5 -1-fm ,X-Xa. X L.-Av.-XXX..,,1,. fx. X.. 22-g., ,X . ...X W - - '.-L1-.-X-..1,g-K.w 3.5. 1 .-,'t,.- . ,fwr-s. --I -1-m7X.f-4--sqafqafggef3-ffvgg-41,1-55.4 2:1 . gg.-W: 3E1.,XXXe.g.Xg-,.XX .fg3.,.iw,!.,.'-. 45 XX,...fX,.lrf-X-.-X--..,., -5-X,.,,gX.X.2-5. X..-,XA -1.1, qw-5,'-.X.+if,g,y.:: -3-J.-1-1 1 .-Aff... :.,,.1 ...Q in Aga,-'MQX 57 xg.: fy.. .g,XX:..g..--5-X',1-iff. .X--X-1-XX'..X ',-.-f. .e-ff:.?-3-?,.g4..1--:AJ.-.,'.,. --L.: 5--DX. 'L -Xu XX.-n . 3 19 ini?-sf. 5 ---iS 1v.'Yf'..f'2 .AZE'f'-2-21-31.- '11--af 2Q.X2-u SX--- ..-11'-'.i.'1-EQ ff.: ':- - -'-3 9 'iCJ.T': 3 ..L1 X-5 -g., -,L-,Va .Aw i' ,fg..:.-,-.Xf . .aw-uf Q-: gg.. 24: ..Xg..5-1.1.-5-.Xgffu..Pg.. ji,'--.+,m-f.-.-,s1,55as.2.gs'551f.'1?iq :-L,--.-.Xhig,LX-g1X::xj.3 - -glaze--if W,.igX.f.,-wr'-fX-.fu X .-.f.-.'w..'i:!qX'-w a,57X'3:6:f.-'13-1 --A . N -' - X-,.'.i'i'-1.11-X - wen-1 2. f . 2 -9-,-rxiw. 11 Pi...-,af-fu 5X'-..s1-.-I- -fi12:-'..-Ifgegfcv.,:-jf-93 55.4. 3.1-3 ff.: .-M-1- -'-rX.-X- X X. ffl:-2'-ef iff 1 .-are v P'-1-5.3.1 . 1-f '--1-f inf--'----.7z4'.:-mf-.vwve- wf-' '- '- -':-V..-11.2-Q12Xa-2- :gif-.f'21':-ff H e-1-1 T'2f-. J--Q-fii 1' X. -f'2?:2wW.v.ffffff.'.:--. -f-.XLN -'-.X. V N-.-. 1 .4255 X :P +1--. - .. - 'IMC -if-:.f-4-.:'. -u----. .11JK.:X-.W -' 2'f'f.-Q- .2vz,e:Xy-Q, nvkcgvfhf-'. wwf--1-..zr-X-:.Xu-1 A+- 'K uw..-mfg'-.3 -fri. -Lgf-.--P'f,ff'.x4zT2-fm'-1. f .,:. aff.---'-wif 1Ef'X.-9- 1.42.3 z...Jy,f-....: 7.--s..14:, .,.-1: L . f if .f:, -gf-14-Sf-:f .fu-. '--' -'.,-- 'TT 'M -- . T... fav- -3 gr: iw.--1.1. '- 2- 1-f - .1 -.1 -'XL gy..-,X-.3--.'Xg.:.g:'X-.Xg:,qx,-5.14.--'.:X-Xz' YQQL' zg-1,.Qqcgfaffgn-1-.',9fzgijg.?Q..:.,yfX.S1g.emit3,12W-..-f.p?mX55.-,gig'sg-1'-g.2if.:s1.:,g.---e.-Q1-.'1X-5.1.1gf.'fr.-.9?q-'c-5- 1-a15,.s d, f.-3-Wifi.-': W --ga-1 4-.--.3-wr.,-.L-y.f,..t f .... .-X4-. 5-L '-g .Qgrf-,'f'g-1fgzrs.-gf?-:wg-X 'f .1 .-31 .2 X :g..l:'f.f--...Zz-,-X. f -- gif... 5 ..-':.f.'-:iw-01.-v +12 '.3.I-113434.-gffiww-.1-5.-'Y.v4g..a's:u.,...- we.'ffqigweS-Iv.:-wfX.-3.-1-fe'.n'fY-faai-.-'gm':rf,Xf':X .2-- 6-,-'5....bg-.pw125.-.kwa-f .,a:sgQs.-...Q ig .Qf,,.:.-gf.---.X. Xp-.--P-.-.1,Xp..,.n 5-J-,gg.:. g.gr3..,...i1... gg-3. -.gp -mf... -X - .Xgp-sq..---g..1:XQ. 1X.., V X XX fins..-.::.r1'.-1 .- . 1.--.f rf.-fe----..,Z .:X-5-1-.fgv!:i.:aif115 ,.-1:re.gaXf-2 my S., if,..-.-.XX'..,us,..'ir1gvf1.-53255.gif-55.-'X.f.X...v,:n.f-.-.1-H., f.. .J ..- :Lg.::X'.f-.af 'mam-:rv -.1 Q.: 5- 1-1 ' X viva-sf. --.sz-.'- ...r.1 QXX, 1 -. 1.20, .2-:' -'fr-??.Xi.1'1fm.ff-Q,-5-2--. .f X-.XX .. , 1 ,.. -- X- wwf.-1 'ai -. -sh -.:.10'Qf.'X -fx As . nT2-' --'S .fvffjj-.-.'..gv:g asv., 61 -'.-qi af'--411.-25, ww- f?f'S1s1.'f:f?-JXQSQ,-.:X X -X. fe-fy' nfl 'f U-ff--'-2 'f- :Lua mf Hag.-'E-W 'fv -, f' V 1-H: wg .. ' - - pf .f -1 XX X:-g ff. 1 X- -:X ,-: . X - - -- -,rg s+9-?f---.f.yXv1.--q,-X.- .. .' .X X .. 1 -- as 3-- fXmfpfimi-ffx..Jr.-'--.1-' ..y..'.? -'HX' 5u3a.E.L2.X-wk-'T2fP.24f,':.m-F-ragym- aa 1 -:'wv:11.1jig: s:Xfr.X-2.5.5-fn-:X1z32-iVf.f..X-1-35':'4,g.-5 1f.g-pg--f5f-.sa.afiv3-X-f.-asv?-X1-ff..-E-'-'-'f-fini: 2,-X-wg' f -X.gsvgpXrvXg-z.--.--i--:.--3-nfgf'-3 '.rX-.X. '-H-1--...f-.-1.-, 3.---'3--5 -Q? - - -1 X 2 . 5-.f.f.5v5f.i:'-Nz. gi-Zf 553.5-5 3 Qeizg gaib'- XtfX.4-X ff.-1 'a -Xf59wt- sagf-me +.25'C':ib4fY5252gJ,jf-fl-1.'f..:!55 ff .up .. 1: X X .--kwa--5'iilififff-WQ'-3:.2'-WfszwQ'-lliflix'-535.1-laeitfgie if.W-.-4-ff'-fififmpflfwgl1.4545665295 5.5-?V'2?iw-J41'-zfif.1X.Si:'Rviff.'i6f2.ff-. -if--HS1giijir1Li2-51535-9922.4521fi-.1ia-..'-2,2 .132 5 -- -':'g.-.--42 92r2b..- '2-:G-11.2 ' 21 .12.--- - :fl r.-.'.W::v :f2I'fL-2---M W--:,.L 0,-1?-W iw wi. 'wf if! 'f .MXH-v f.-Q ff:-LH.151---1-52-1-1'-'A If-H 'mfs-1-2iw-454-+wff4+2i53s'-' ff-W--314.3--'-'Q-'Ha-LH. f--iw ff- --- . '11-if -2 'f- .J ,Q . Y :- --:L-ff'-fl-.'if4'-.-1 'Xf--a'..:1h -'W-:ff'-3-'E+-'gn SL..5423-Simi.-ffiafw:P?3-my-+.2m'-X fyf1-MJMA:ig-w-wibakw--52.33 miie-g...,53wai'v1.w.i.hnvfi.f'-gf.. me-.H57-XS.:-iw?'g,rifI:.4i4rff - 'f1?1'.fTi--.fk.f:4'2j.11.2m:---3. z..-.L-gnu-w,g..gp.xseaf-gg 1... X -' -- X X -g' -X--X-1 6,---...wg-' 5,f'-:.-s.si3-ff.eai-r..g:- 'X -1 fx-LA im.. 2'...1.2X..Xf - .-L. -:MQW2?.rf:'f.Z.x-':.-H-1'-1:2-.ffiw -4-'vawr-Fw?i-wwf-Mfg.--2 C-x. wziw-if--.Agnfggizimgw.-2L'-1.-wif-..,--ff-i2'1-Q-.wif--fSw 411-Q.-1.5'v.,tf,.--,-2.7.4 ..1'.--..1,Sw'.-:.- iafwww. HP. '-W-1' -ff! -mv. .11-ffww hi'--Sf-f.f.v l'-vm af'21:ffzf--Q :X-iw -19 14 ---'. f.Y mn..--rf!! ..:1-3312: ... .-X. .---f:.-n-.,-.'q--.f...--f.- -5 V X-vgX5..gXXX.g-,Qs-4-.g1i..3.?f,Xg?. i- --f..5-QQXWXX.-X X-XE...-W..-.9 agW.-X---'-1..p-?s:gg-.2.m--g5..2-gXXsMrx.:. ww- LW- M-.Xa--2-WX Lizi-'1-.ww -sg: 1f.1-W-ew .,. X,-ww X-...Q iw - QQ.-Q-'-fx.-w. .X is-H .X r'-H-Q--jgwa.a.f.1.evfw'-f--M?Sw.ff---.-a-...1'-.'-aw.-.-.f-1r1.5-w'm.-i:f5W?4?LE 2,jrL.5'.s'i.x.-.egwf311:53-p,Y5Y'i:ffJWfF15j' r .wQeyg1.gv.-Lg z--'Qkg '-iufwf-.WM-.X-3-fumvalfgqyzey-1-qwme-ff.xxg-X-Xm.-pf.:-A---wr:gescs.vii---.Q-divx-652.325-gGig:+e'.1.m5,e'.:'.w-.-2. -1-. .--.W:z----:..,r-'x'-f.-Iffag'-if ----sf 1-Qfwijv--'Q-X.-.--1-'ma-:J-'1 5-2,.fgfz..Q3q.w.g1. .-- X,-1,1W..--Q,-r,a.1-...gX,.Q-eq5.1-a.,2f-wi-.46042353242 f.1f2i5...-2br.X-s-X1g,-.211-.fgvXn...Xw.-.f..ax,:5,qj1M-:Q-.fgirm my :F-Ks.,.X.,m'-..4-i..-.-4.3 fffXq.f.:kyy'.X,..g2....M3,g,Ag5i-.X3-.E.f.4:-vm.W-X.--?.Xr:X .Wing .1.-gin..-f4,f.s-gl-54-.fg4 -gfgmvifq-..f...--.X-1gp -H ,.--is .-L.-5.-g...lufy:-Q22-.Q1.fwmqszfsvf-11 -.pq-A-.Xr4Xa. .- Xrf..-,tv gm.:-gg-.fX-vf:'g-f ..f-mfffffs-...wi 2-5.-Pfawf mv'-1--1----:H fi- -Q1 XM ygidsw .fy fwffrg-J-Lf, yn-Q-K-2-fzqsveii?'avg-fr---Ffwgfwy .zwfmgwmrf-:iinw mX',m-Mn pw-fflrx-f'a2i,1z.L. --3-gan'-f uw. -fum-r. wiv' gX..p..-fA.,,,.- -f.:.f-v f W',v-:Qi:?q'f :tw -ag. '-hs?--X..-,Sify . - -1- .1 4- f. gf-A-r',XX 3-. .XXX -5 ml- 3.51-.kvQ'1-J.-.L-fktiizif -- .1fg5,X4,..X1-Msw-wv?.-.x?.ajK1fyM,XSf--X.2,,gk:4m-efzavww-if -fam, .ff-QW.--f-,-f.,M-.fry-.3,--mms-mlm www.. ff'-.-fP.c,f--ml-'Tza.,-....-.win-.1-.,f,g3-:wif-.iw-.. .Q-.--fi.:.w+fv.X-i+v,ffgg.:--:Xi------,-'fp-M51 -mf: X!:w.M..5l1fT'5 6.-:Ev we fif- -'-X-fue-f-24.!F..:a-.- -R'.1.:Xe 1' W.-M.nw.'--f--fav...-f-J'-. W. -143 : WW ww 1.1-,WM W'-g,, wwiww- - f W gffg- - 2-airy-.--ew-.W .Mww.-J..-f-X'Xw ...vs miW-sa:-.-g.-uf---w .-2.7.-w.v.1m w.-Q-X-1.-1. -.-'--.rfw:z'.w-rm.My-.g..sf33f2-WX-.11-.1-'-y-.eX:w5 wg--X-f.f-'-wa-2 1191.--'.f.fz,f-.:v.' ' ff--.Q---,r --1-.-:'f'-A--w -mi +-..X...,XX, .gg-f....X. X.qfX1X.,, ,X 'X-. ,X ,ff ..-..1X,g,,,.W. Xq. SVl'q,,,,.-.g..,,,5- -.1 25. .Xf X3.?f.X,r,,mX-- 3, -fs 0. - XX ..,2Q,1.-, Q.-m,.,Xsg.,X -...--,.-.-Q X.. x- -A-, Xu-'.n.Wrv.wL.w--pr-.. my-.. -. .. W:-..-.wf,z.f -.fm..-W 1--nn.-,me .XX X..y.-.X-WX...--..g, ....,.X..ff:Mmf--.-.X ', ..f.- X. - . ...-,A .Af- --4.111-'-f'1--f-ff' l'2D--.-'--. .-.-.-Q.---c--MyX.Xfg,-.-M:-f---:E-ra -w,Q2Qx.w.M.s- 'F f W.. M -.1 -may A-1,-mea .4-fiigilauff-54-5-yh?1'gm.T-bw1+LvY',wY15E'wf51f:-sdgi.-W1 1534.34-51,m.f.,-gf.-Why-ff..-2.-X,-.1-X-Wg'-X-.',gw--..-..,.'fisfefs--1xSsf:1m-ay-w,-ping..-..-W ..--Qs.-.X XM.. X..-ze, wrxg.-x-X.g-my .sw-1.-.-...X-wg XX..nW.,-X..X.--X.-KX .-...-14.-. L2.'g-aw-:.' IP-. -My'-'1'i-122fk3fHf 13K. -1-Q.-S.-Y-zltmbf-L--ef M my .gfdw-..-.K4,2..aru.?22r-'44 f.. 1Q55Qfm'-Lg-5wif--myrv-MX..-W2gk-WQ.-1-gf+-'f:a5x.-.e..v-M5--Q4-1-Q-aWX98f'p9.win.212-.--i---fm.f-:EM-H-fa'a'wa'5iI--emaibwfwi-mff-5'h':-gf-12'-?w 4: 1-:M-ff--Qv-mem' .ff 1-.a2W:sw1fw,:1... L-M0 ww'-fff--fm..'wif--.:.-W ,g2g... 1Q,-v,.2'Kfq.-.:.,.--- '31,-im -X .1-.-Q -.,.-.msmgnipkln X--X:-Q .r3g.w:- 3:..ga.q1g'm7X'-'9X.4Z4,.f71g, . -.gm--ig. .tl--msfiga-ug-X-wX.XX...-yy...-.4f..-...5m.-W-.11.55.1.::..Q.X?QT33f5:ga-,gpg.-s-Q.-L.,-..-X-.543 Q--745-.-,f...:g-xgg-ef. J :sf-A-.ff-1 H.-'g,f.g.: -,f.gf,-.fy gk, .1 :g'2-gm:-5-3,2X++e..fwX:fXzf-fm.Qgp4,xa.3..vaaf.XX .ax ..--.-1--fm -N M.-e.Xf 1 -4-sa....fz.:M'+-2-f-1- .-iz..-1-:.n ww--:vm 2'.-Xx....-.fy--wwawf'-1---Q:-mv aes- 5: xg- -xv www' 2--w.Q..2pg3 .z-.4-2:-'. ms-if-.www . ----ww..-,..X.z.fr:12---.a.fw.-f1.fN-f-fxfnm'-11.5-w-ix--'tina----5-.''v-:ww -w:-..:-- .sz-4-3.53.1-f-.2-W '.v:.6-- -f-.-,fr-.-A-W--4-. --1-.HQ.-Xz...z1'-1.5.-if-W1-A.:-..-v 1-.1-'.f. rc .-17g'fq,'-.- fn---. ..-. mf -.. -mv .frX.g--.- ---X-x-...---mv.-X. --fs . .. B -1. -X .ff - u - sn... - .Via--im. .H -..--.QXX -v71f-1.-- X-ws.--1.-..m .hw 'Y-im X- ...ff -- f-X.,--K-X.v-fX.-.', --.fX:X..X..XX. -.rf .iq-X. .X ,X-...X-.-2-X f...-. -1.,1X...X?.i- . . X. ..X....-Xf, flu. .1X my 5 .1 .1-af .4 -X-.-Q-. X-,--r 2 if-ami1a'Xg--xv-2-'-i,.-be-11...4.-'ff -a .X .zfifflizff -41:1 :f'.2sX1iXu-uri -f.5:evgf'?.- rm--if-. .-'-3 'Y-1.3.-f'Qi'Q-.-5 F-Xsifzr-,-X.-.Q N21 -5:-. ..:..- vwfif 11' 1-21r'.' f?....11f-:Zig 1- im-2' 5-.a.gyX-1:vi-xc..f'f.fe-'L'-'W-eQ.uXX,arm:ff?'..'f.-At.. -LM.,-4' ..'-.Aa -wgfv.i.fw':-Q54QM. i-1'-1 4- '11, .- .1-5.15 1--.'r--wg J. 1X5-:XX f .Q -few...-.?: 1-. if WX-fi -i.'f.'Fj-- f f-!x1a1f'gMsf:.v-'S-'5-115fk.-f-115544-p'fffivfmiw.1--'ngLf-a-.-iv.QLQQE- fr:3..fE5h,-Vg,-1-w'-iw.'M'--g-X-...-bC.a,-K--1--.-,'C.Ei:-af .--digg .1-vtmma.-.,. ff ,:vFg2,v?1...1'X' mr.C ,--H fJ?:.4-'iff-15XW5i.f?a:'f.?Y1T.---'br '?-.:-'mf-, --.J 1454--4 pa--fr -wf-1-X-.1-avr'-4 m-1,-N. nw --xg - x 1.1 1 ' '-X- .14 X, .2 -,gp K.. 'wg 1 g ,g pf..e.:ifswf-.g,w..Xr,vg. cw W5 X..-...XX-X Q..-. qw g.,Qrf,.1..fh-ga?,.,,X,.-r..-X- .-XX..-,X-fXi,X:-XXXL-.-...X -X-qX:qfsQ.:-XX 5-s...1X.f.f.-0 :f Q-,gXa.--WX.. -X..gX...,.-X- 4-f-..5...-1.,uq4X1-W:fX:,u:4Xm,: X:X.frf1r--,- - 2. -. ..f rw.Q.-fha:--'H'-'.f-5',m AMX, - ,...'f, .- - 2:-.-'I-2-3, :M 3.-M7 .. ,--.-X1-1 1- .X. :X--grew, gm-1...-X,.Xzg -Q ,r.-11... X-...isa-Q Ng.-5Q.,5...f:.z:-Q --Xv,:--X...--.X- -- .ef-:X :rf X--1-1. -f-,--.1-.-fwnX:'f..H-'1-- --1' nw. 4-En.- 2 w-- -.-,Am p... .f,.g- J. .X Xf. V- -fa-Q.-.X--'-a:X.. . --X -1 X.,-ffm..-y.1.... y..Q'fg3,15.f.fS:akf-...-...ya-...g..X-.gm--f1.....yvfX...f.-L-X5:-5-f.f.-. .-:W-..:f.:?gX.-.Hffm:-.wx-f.---I-MX -e-X.-mf--.f:f.r.-as 1 .'::gfX-..X--.21 ' 1- --w-.X?:.-- -1.15. -X---Q-A---3 -a--2-.mv--. -. -Nf-..---..-A-1:- f---'f.11A.J www. f--X -.- - X11- -. ---.M v.. -v -Q ---...ii f..trgek.:'..Xhw.we:f+-..-.-rw:- 1-,.f...mm -X-9'wgfaq-5:s.z2f::r:nz31'f'11., ff-J- iw- -.3ff--ugV-Lgwh:Si-2'-iff.:-'ggfifg -vg:X.X- -... '-' A-i.'.-.gm-, -A-4 ww.:-X -.f..X. ...i.:gw.X.g---.- ' yy- X.,: -5. X . -X --XXX.. X . G- A 2- SQL- 1.41 Q. '.-if'21:f'1m-fx--1.21 x-vii?-X,-f'-mi'f:'i'fX21f.?f-:ia-2'ff ff fLf3TffX.er2-1-X1.-.T 1.f.Pw f -.-afdxr. ftvfvj, rf.-Hx--'1Xf1'eff-..Qf22i'--'Q'-'.11.1.1sw:J- :-ff .i z?4?5?ifK.fTfqf...-'Hnfi-1-.'-'ct--.1-Lv. f.-gsfff' -Ke 1. -. :NX-1 . 11: :..-1X.'qf..-:.xf'Xw,- -sf 'IX-.-V. -MQ. mf- -' -.fmfgzf-...Q-532-51ufm-.f:--,'--1.-,-.-1f.- 1 .--.1 .1 . -2..1.'-,Ka -su..-:.a.a :X .wfv I - 1-' -'Z-.m1:'Ez-.1-F Y- -k-.4 ..2'Qr.z. ff--1 X- ...'x, .- - -- -- . -X.-wh 1 . .Lg-.5 .-ff.. X. -T X 3f.4gX....-..f,-..gL.ff.,v,.:f-is-I' K-1.4-v - .Xg-.'.e':. . muff . ,vX ,,- -- mn- .M .r:-.-e-gss-.-,-z..- '-.5-Rf .1-5.5-..: ..X--1 -Xzffzrg'fg.1..-m.X-..fgf5g.X,.:5.y.y-.:..-5...--'.X-v f 5,1 :fin :B---mf--4 3.g1Q.z':fwilufv.-Q-.e.f.1f'-.-.y , ,-:nz.--x.'-.g.g-..-ii,..- --.f ':' -'-' -Q. -5 1 '- f..-'X w- .. 5.4, 2-v..X-.2-.'2X.,-ra 'E.-'ra -:X--'- -1 .. -X. 'g-fs -gf-2.1.2-4-Q.-+. --:':egw1'- - -. X '-'- 1-1' wif- .f-. ryfigirfrfrf'..2fu'.z-.5g.gf,.-if-LX 5XX...5ff-Y,Q-..gsti'g-?.X3Xa.X-qgagiu6Q '51-2'-?'X3wXx-.f'rk35i'3X3 5Q1a-f,h-f?fi- ,wif X15--QQ.:-.Qg','.ff2.49-. jlsiffg-fg.,'1.'X X-X.,-1.5-'1:3T5.3?':2Nf in- ff - .1- -'1ST...tg1,xg.1:'g :.-p1.4.X- .X T X ,E-1 ...QL ff:1,--g,3',vXf'-.'..--.3-X - '7' 1 QX . ful 'f 'i 2'li-'W W . . let? -' - Vps,--ap: wgX..--if-fm.-.3545-smx.twfxg...Xg-.gg.,.5Y1.y.4gX..-...X.Q gif!-f1'n,f?-xiwffzcgw 5-f:..gi.g:.f-'fra--1.4.5-.5-,:q.,:13...--1.:fin-.f-,,g.-:.v-, X.-Xl...-'.g,f..X u.-.Vw-.1-.2431'.--uf-X.-5.4. Ty---.-, '...-...Q - . - -.':g'4p., 12St'-X126 w.T5i2gk.z:kPPf?a1--7 'M.af.5 x:f.XrA52.' tag..-.,-ifvgffgfffffa .:.1g-?f5r1,f?3'a:.'5.56-gt.,----2 .X.x,-39',2:e,X-.-:-X' 15-.1GQ..---..s'H:?2E'-LYSif: 3215? af- sgfiyf-., .Ib-E'-' my f-.-'-X1 :gl 2. X5-v-ff. 4:51 44-'.'X3QfgwgL,,fgf- 9f- L-:ff ly-fb.-5-I-H-?..g,.f :Saw LXw-a'.x.--m'-i-X25-f.21f'v?-s5,X:334t-flfesfiiigfssw'-1.-1?::-1-'...X -3--X.ini'--it-M.mia-'.i4'2g':i2,2'f5i.-ali--.4-..isw:g.1-X:.gtfv-1,-2'f'q,.f3-fad-gzgzy.,-fess.3vg..5'.-4-ge2.s4:2ws-Mg..Q,5.g5.-y.!:1f..,--g:.,.gzX-X,X.5X.S:1-Xgw-J,.g.X5.-XQX-X-:.X5ag.X.qgXfgg3 .X-Xq..qX. -Xa -Xi1.....,fE,-.X,-g- 1 3... gy 51 y... X- Q '-X - - X . 1 97 El?fi.-2-.,waiu.:1'.-.iraqi -.s-wa'-lf'-f 141-Xf'-ff---s-H.-U'F W- 2.6.vi8f.:'1iX--.:2'-5-awp.vzif-ww. ---f-'1.f.-Eifw -vi1-.1-'24.,rW-1-:.Xg,1X2:1:-.. -.221---'X4-3 ---. .11-H-N1.7.-Fw.-f:L1:X:fL.X.fi.'ff351f?sif1.f-fY4rm..'g'sX.-'fgwi-wk':,g.X ,-'..f'uXH6:3 ,3'.-,f:-L1fs-wfX..-g:- M1531 i.-.--Xe.--2 X jf w :X-U, X- . 1. 1 .-e-igfmazz?-E'-QMSQQQKXSQ-2,X-wg!.il'.-9,-S--gf-1...---pi'Q-af.-fbf121fp:.5q2-9Mi-il--CX---T::1f'h-.Mff?-1-wIQ'iQf5f'f'22L...?a'eff'9r vf 5.5125:ga---eifzffqr:3fX.g.fg2-Xiu.,-.,if-X-2.5A X--..XrZ-'i.gYr.faX--Xm,gf .5Xf,p. .Y-X. ,fmt-2:'X-+31-X-..-Xg,X.1g.555,2311-gpg..--XC-r ugh.-.v'gf'.-'-.r.5'fX :M-.QXX-.X f... --:Ip--Q,-1 -,::X-.,,4t.g'.Q. 5, 1:-QQ. X - . pg g.:xQgf:z....9i1.g.-- -Xe' X- rX.-r.,XXV-:L -..1.f'g.. 4....w -5,1Sx-U qw-4- 525-,.i1.1g'.4, .. 'gGgeyA.2r.-Q5 .L,y'.g-iz. v.qf'f,5-a::sg-,,- -61'-'W-'FH.': .:vz..:. V-'-.wi-f--gin.-iff- 'Q-gm,-:Q-.f.:---.safe-If :,g-'egja-.,:.X .'-H . X---Af-. 1.ae.a3-gysvfel-sw-4:X-Q. Q-43,-. --L:-pg -- --.-Q-XX..3-.Q xg mm :Xi X'1'f-?X.fg'. 'frm . A1 -.'- .cf--. '- -- WX 2'-.iffw aw'--a.'.e?4'..4f4 -7?f WS.zw' 4f7qXQPvfWfnaFNi3?19f wif '-'sf.:f--Q-gg-2-3.-X.,-14. 4.521.g-3,Q.X-gffff'f.W'?R:f-wi?-.:m: u.5?M:e-. g.,.-e'X-ffofqw.-. fzffgq22wm.wJ..::hx.X'---X-5-F-f 5-v -7 wx- My .-1.5:-59.45252 X:--X.x,---X.-1- +-Y....X,w..,...X.-g- uv. X-5... .X.X - . -....-,X-X.-..-:.X-..,-X- X P122-rwfm?-s-1-.n'.fX.Q,.,-Y-zeww-'--,X::Q-.'-y-..'.-rv---:.f-hmme2i.g'??:QyiWZU2'f3:1--.Sm-z2.v.w-:-iff'MQWmmQ..qwavs-35.1-iii..-.fe-ri.-QXvgwqswrfX51-.vw-s 1?.l1'Zg,.1.5--gyggaf --P-:X.M-q..ff-:J-.'.P:L,.-,2+gi.. XXX5- -' 5.-3.32--14.3-1--:-Qw ,Shia-.Lfsa-'aww-n.P:.m.i Lrg- --.1352W-X1-.71--fX.w91:.31i g?f.:w:f6 r .wENQg-Xe,.'mM.- .f .f-.1-',fy-,,---gig-,f:'fw -My-I-.Xfgsvxmffftg-Q5g,f V-Cb-A-1.15-J:-X.,',:f.---.ifpg-1... 'XM' SLIM '-z- .-...Q-4 X mfs--2'vg5JQ.1Q-1fgwrg1X.-mxpw!-X1-11-,1:'1-X'-.mr-..XX--Ja ..2.3,-5-.1-wTf.1H'msffei.-Qevwfzfiw-wXE-,yf vw:-.--'?.1 ' . ff..--.3-XX.-.X-1. nga.:-QQfX,esef2gJpam.X-CQ..-933.-X475-as-wg--v.wifi4:2-gggm-ggg?EwgXgf-xiii- .-.2f-iiigifye-M-1-1.82.25 QL-f,x-.T---1.gif-.iffy-295.-raw.-14+' fgi :gm-s ..fy .X Q'-if-l--9 mf., -gwiapf' A'-ilk Y '-?'f3i.11K1-5?-if vi5 :Pf.4 ?'tf-'We-:W 'W 'f C H-'Tw1.-T3:f5iv4.Qp45-vdimlfzmai. -.X:1.3: m.X',:.g-.-XA:-:...gx.x,x? my-XyfiE.f,z?Egg1g-.X:'-W.3 qgygqmf-.,,-. msg, X.--1-X. :AW-L zg..Q.?Tt.5Q1-aXy-X.-...--.w1.1g,Q- ,WX--X1fg...y -W ' 'mga wi-.? g'f1dzw9.3XG..-.qef.m:2.1fi:'X-is K-ff -4-sway.-Xp..-'q.X '.-2-14.155--g..X: Q. 1.-:':fgf .3 225Xf?zfX3g-F --.X-, Mtn X,j.XX-.X-XM, -1,-X-E Xf.-..X X ps 'JFK --f .9 - :af-fi 4-7 QWSPPRQ 5. '-PM-'2'-if- 14 'vii -7.3531 Q- ff -if-: Miif.-rw----f-. if-My ni ---if ' f- - '- 2-X'-:-31 aw ge. 'f-Qi.--f.:fgffffgz-zy.'X:v.fX-5- .ff Mi -zfsv .nf-... if bfa.:,1.f-.Q-'if'5w 'St .X 5-32' .wp-. '--XX. -2- 1' wr, XX 3 f f ' '- -'ffgiff 21-Ui '+ B-5 '12-1-:f21f-WH -.::. '-222.F1119-.2.iA.Lf2eQr,-fifm-cs33sf X245-J-.':' -.if 1 '. Y-leg'-.X-'-2'-ff -Y X- '11 i- is 3-m.'1f22'. IX.-. l-E I 'Hy' '- if .i . X: v. ,'x-f'2+.5X-1-'ff . X.3' .MQ fp-'za'-M051-,,f1g2f-aeQ3-.Agfa g5Jfh1.'5?Y-it-w. X.y-'kg'-91 -,,'Lgf.r'.'1y- Aria- 55:5-Y:-,X.gy:1,. X ..X:X...--'f.w1k'v1.-5.1 'qw 'L '2f,w-.X.Xe.?.-,,g:- .Xf,X.. .WX-.-,fm 'X,,..X!,1X5g .1 np.:--.--1.1.-m.g..g.:.,..gg,-.-L-'.,gg-.----vXjLX - .. pw gy. .asfh 311-qw gX,,.X.5XX --uh, 7,3..m.,.:f-1.315-3 ,gf XYNMX, XXX MXH!-.. wg--.: -. J, -.XX .3 --729 .1. 51... -... X. .gn '. Q- I5 zgX 315-,xr 31.4. '-QQ-'A :ol-:Yin ti.:-g .Ms .za-rf. -X.. 5 fp.----. - 5 X- -.k.fu,:'-...f-sf!--w. Q.--- .QX.w5.'--'1:y ,'.gf,.,-'wx -f-WQXQ311. . lf -., -f.X.sY. X- -J X,.! 1-'.LS'3' --:-Lg:X..A.1.f- ,..Xf:mf..--135---'z -.X 4X .QW 3,-.X.--Xb..-1-....,.-4-9313, --X .mg XSXXX Xf...-X -X-g. gy- .- yi - : Nm -. 1 -X .fT'.5?f!fl:'.!l'32iCe2 r-if-2. f 15-: '-12-51195 Hs'-2 if-4 '?f'if53-Q:-11: I1i1f2Xi2ig:E ..-5 -'YZF '1.- ff-.-?'f. 2-.IFJ --1 fi-11-ff-151 Q., 'iig 197 -.gig1:,f'jfLifi-E-'E-4551? --5:59f1'f-,'N3a.5iE-ii-'X--3-Xfffltii-if'Q?I453.ff2?sS T 215253553 '3'-if-1a1.:Xf1JIi.'Q:X. 'fEf'5f2Q1l:gf2q3.2-:fL'f.'yi i1f5. Sw .. -L -.5 . Fg'E.L !-3' 'Xi' ASPFWTT-Qi'T .' - kilifi if-i2:Wf3fll?'5i-5 51-Si? '?.'f'9 fLi371 5355551Qgl-ifffL.'g-575'I-3932ff- .. :T-2 P T-'421'.vlffiliii-2.f3-5-'5?.Q'H3f?QgQ-133 -jA -- 5 mi.. -.!es:v..1ii1wi3-X --Xp-X.ii.-Xe-p 1.5:s.X::ggi-.iq-f, 1-i 'ff--.1 -.59 X Jgisfg sg-XXI--X X.Q.ffXX..-.... Q-.X-X. X,,. -X -. 'Xf,ggi---.'2,fff.'2-33-1?-rfE.g-2.?2'.5'-15 af3pXfi1?1-':?f':3 -1-if-3-.:.,Qy-,MIf'.'Q-Q-.-fm: 5-X-iff,izf:Q'2gz.?2.gX1:?a:2:?':j?L',.q-'Q .gy1-,XQHQE9-fX:,1g-1221? 'Xf -Q'-13211 -zum-.gg-a :g.w'.xgp1'2',':4m.1' if-Af? X,-52:X-'iz-'-1,.ff,..i.g.awg.2gz?:Q5Q1.5mzfp.-ifgi'-gg-::Xtg 'gX X.g-g-1Xxjyggg.ff'X'32 E-Xi-.X-S.,--eggs:pzzrqq ..::2.i.WX'-,.X:f-..:7.-gX'.f-.va' f f--...ig-X,.:.,'. .525 -1 '--X..g.4.:j.,2 .l'1.'., XX '- i T-ig-Wil?-H'--gm-'F.:-FQ :Ifi1W5:1f-3-32 'iciiifs--sf? Risk-gif,-gff filni -ff,-Lffgzllirw .fbiff -53.1531222232 I 5 '-5.1.11 -5,1 Nff'-9-Gil Y..-H-.i1!.7i? ,:'. -'. ' ' .1---f2'.X22--5. -2 'X -' ' 7 :2gis.XS1i5g.gQfXg-XXQNX,Xg:2.?XQX..'..13'fggimifXQX2ifj3fXX.igj4?2.jggXf15,'i'ui2...5'..iQjX.-Qi.g5'.1 -'Xq3f',ji .5-Qg5.5Xi.3'g,X.1.-535.-f.,XfXX'X45g:5.jg5g:.X-Q X -g?j,3j-.Q3.X::XL.:.-.3 ,515X5.X.,XX,?.-.gXm55XXX:.X-- ,XA 4 . XQXXXXX.-,XMB-57-,m,X:XXA XXX- qyg- L 1 .5 ...XX-LQ -Xg3,.X,XyXx 5j:.yXX'.gf-P .'1f.1fg-'f'X-.'.1-1X.v- -XX - ...ua-5 4.54173-.1 X-. 1.1!-1. wX'.-..g- Xp:-:P-.54X.,-svA'--Q.3sXX-'--.--':--5--'.X .- 5 1X1-X. ...X 1 X. X 33. e mg - j- X 1. :1. .sq -cw X' - 1:-X4 ' 21?--75--. iff? 'W.'. s.L:-.-f'-7- -.Em .L-I-15 P.:-9X.T'1 fi1'i. Iwi ' - M ali - f k P P. ww A - . r ' HX' -- an F--4-' ' ' --.fX-y:.f-f-1-2-.Q -,.-.---f-eM'.. -4- Zi' s:z2gcZ'e9g2f---F:fk?fw-Lfrrf:.:Xt..1..y'--P HWS:-1. .--X.. --..syw-w-X, XL. ..-,X:.f.-gg:X.- .- me .-f wr- - .. 1 -f - X 1 . X . - r.f:XXX-'--5--Lag.XXX-.-1..-.Xp:':.X.q.i:, -u5u--Xw.v .'z-X-- -AF-2X'x1.g-.'-M .a'v-'QF-QQKQQLwsz-f--LW2.35-'fn--f-- .4--ml.fi-'XIf'W.-p-1-z::.-.5.3a--9:T2.-xlW-Xi4i.93A'2'-'.-iw .-WC.UT- '- .f h -S'-'H'-ff:+-.-lg-if-'LS : 121-x3'g.f1.f:f 5-X'-M:-1.---.X -f-'.f..'f,g-f-.- ff.---.1-XX-1 .-X'-. aff?- r, 2323 .11--rg'-Xwg X-Q-X1 5- .aft -X 7115 M--ff:f'-.cm-1--.f.+5ff.1.a-Q-4 A24-.3X,q..3.X.-gffx-wawfw--yfeg. .J-ff-sir!1-:Z---ff .'J-mv..---1.-if-'f-s' -Xwa--:'fff. w2-...e-.1-Q -W-a.f,'.3X ,,e-gi.. 2 --H l-Ci., 5- -1 .-:XX--MX-X.-'e yy- ' ry X...q,gf:-- :gg-S Q-.44 Xi - a 'f X fw..f-f.-if.-?11N-wg:c.'.m-ff-- vegff.fv---.55-5-w idxXxwQfsw-3.XX-. 11'-2.1. X.X:a -:X .-.X af. X--- '52--g.1.1 -fig..-psy..gs1-sgifigf-.nf1-5-.M---.-'-X-.X-2:Qtr-X Xf- .-X:-X11 -W A114 fm:--'-.2-X-XiX1:19 '4-if-X--.---y -gif 1. . 5.-Xe-'ff ga-SWXQFJX.'-S'-MX-1,-'-X -pf-Lgwwx Xy,Q'X-jf':g1X Y'fSg..g,i.'-.q-r.MW2XX2?2iL.rXhQ1M:'-.'f.:QXjl-w3'-XX.-'X.gI--f-.X-.'.fXx,f. ,fX,gX..gM,p5y,.Qg-,,6:f.Xj-.4 X':g'yW-,-'.-7'-5. ,XX -X.,X,.X.AfX.X.-a.g.'ggg.,---14.47X-f?XggpzLXg. -kj-y'-1-,,,.X-1-yi... 5415X--..X-Q-XM-Hg,..2.Xz-gX,.:,,-XV'-5-ig,-giq.-j.1XX-z-.X'-g,-f-- ,QM X.,-Xg 4 Lvl.-,-Xi. 13v.X-X1 ,: -X X. -,X.y--.-X-g1.,.39 X KX, X .5-.-5 Sig.-.,.v. -.X-N,--fig,--ag.suv - -.g.'.-px-5.1-r--191-g ...H--Xj.--XX: may ,:X:. -- E. :X4-.-fX..--1,-...X--.ggi 5-Mw.XQ.,:f..:w.,5g,-fx..X-.gg-..1-ff--. w,X..3X-Q-,V Xe-.f-X-gp: -.,.f13f3g.:.X- --Xa-Q..-.X-v X--.CXJX-,...,-X- SM. ,MP,,X.X,4.Xg.-g,X.--F311-X - f 'X -X 'I -.9 A-1. XXX-. X-Xf,1X..,.- ,- XX --f...-...X. . f --X.X., X. .. .X,.-.-X-fw 1 -X.-XM 4 X 1... .-zu .-J, if -X, .X-X..g.7 :-f ., 11'-'L ?'.X.... fu- .X.g, wg arf.-Q.-1... ---X -- ..--- .-.X -7 Q- 1 XX.--t. .. X.. X-X-.. X-X. Q'1--. 1--.-1'-.-. Q.-,X--Xxx., f,--11-.:.' '-.a 4.1-N wwf- ff. ff. 1' . '.: :.f J.:-.--X. .,. fy:-X.-s.Xa-vagaf., .-1-' .-X-X 4. uf XX' 1 .-,-- X . f1 iErg.Z1.s-.-Q- 32-Q3 Q..---.mi-gr'- -f--.9felt-.:---if-X3-si.2?fQft4f.1...f-X'- me- -.-.L-if---5-5 .wg--- T.-1-X -Xml.-2 air--. 1. --.afz-X--i '-as-2:-arg' --U fl 42.--W---ff' DX. -1- 99'i2-.fh'.ef--1- 2'-fr-ix -fN. 'f fe' 1-.4-.f'.-'-'rqls---. .-W - -:XM 13'-1--'Xf , iff'-4-X-21-. X ' . ' 5 - ..,1--'-.3 N-.-P wQCtf'li3 ' Qi' 1. .XL 2-'L-I gLf13:?H! .. .B--V-H -fs H-f L Ziff' 5 1-MQ? rig- - --.-.:Xfip'fX- -m . T:-1 -','fq':XXX .-X51 .. , .yy 1' . X X'-' - ' 3-.---1Xmsg'-fr-::ry.XX-11. -15... -egmlvi.-Xigfwq-'jig.-X.,3.2,sy - .U X - ,-X.-1.1 -.- --X 'iff--' 'Q-1-'yrl' f-'--rS...?X .-Ya --af-. '. .e -VW.'R'.f'. - -1-'- M -1 .'-- -X,X- . - -.+ 1 -.- 4' . ..Q .0fI':--4-o3ir-- wx: VLA.:-X --ML-f.' 'zf'--.f-w-.'.'-- IMww- X .. -'R ..-'ufl- ww v, 1. X-Mfrs.-,l..' 21.1. . -2-z.: - ..'1x -Ch' If X 1 . A-:-.Q--f:.':Q'-fi-f'-I 3-wif:-'r---'X ' 11 Inf- 1-. - 1 -'X--f ' ' 1-5--X-1' -' 'f.95'1'fF 1I7 -. '-'-. lf 7251.12 'i '--' A 1ff e'f-W'-'I'-FA-1312? 'I-'J-if1 7vf7t'-9: .591 'W -S -'h1i.' '. SST. ' 15-5 -uL..' 41-3 -. XP. --f 'N - '- , 'K--1'2 H 7 fr?-' -Y '- -:1-' -X 'Q-4 .1--'M . 'Z' 5 . - 'X. . - V 'L.-.--.1. .T . H 'ff LL- 2,-'I . 1 'II ' Y ' X .'- - : L ' .- 'GHZ'-ifii-.wi-'PQ-1--v-f 9'-,.',- .HN 1 -.24 H- Q 1-354.-'.i'-.1-3 'L'.l'T1.' .: L :X W - 5 ..X A .x .' . WH '.'.-'We XL?x fE 'LP .X '-.7 '. ' . '-5. '.--5 ,' ' J. '- i.:V..i -- 'N .1 -'- if -1f.'. . X .Q-'-3' ' --1 - ' . V1 ' -K -'- --y. ,-Y, 'v f- ---' . . ' A 4, x 1 . 'X 1 '-f-.X-':fffx1 --mf. .'-'wr' uw- -X ..- -1- J'--1:-S--1-fe-r.: '-.fl--.2-fi' -6-f-W- . MX-v'.'-!-':X.L-f .M-:.:.'fm.1---f. '.,..-X I- .-X. -.-'..-.yi -Q-... v 1.1.-X . K 1.2 ff X--.Xp -. -5.-X'-X -. .. ..X f . ' ' . - f X- 4 ...X,f..... X.. .X. X.-.XX , . X- XX ..-,.X .X . -.X,. X-.f,.,XXX,-.fXX-..X-,. XX-,.-,..X..Xv.X we 4 .H . .Xp -..X-Q...-2. .. ... XX--, Q. . . .IX X 5 .. .-f . -cg., .Lf Xf .. M . .- .- 1 X -3 .XX f -X , f-'E bf'-'Xlw -L, -ff - '-'flif-1-'XX-Q-:.' l'X....'-i.12X?-.J X ff- SLXM--X'..:Q TJ 1-fff-fa X-Ja 1 -' X. -Yi Y' ' j-Q.. :eff . 554, 11:-15-.'X -. -. . X.,-31 .T - 3, -. MX..-1, 14.-XX1. 'K X. ' 4- -- fi L ' z- ' Q.. .- . ' A '- + ' ' - T- . ' ..1.--I .' 1 XX -X .-. . XX--.X '. 1 ...a'-.5-X,f-w .' ,:.XX.- X. X 5. Q: '-.1 . X..7e..1' X. - --.X-'.--X.-. -f X - X ' X. X . . X Q - --1 2: ' -' 1'-Y'-J V. ' - f.f'.--f! -?.'I..i' '1'..m, -.1 :ik wb ,1'.f' X H , --1-' -X' 'Jv ...J 5 - 'w , -f1XsXX:- XX w X- X 1-f.-,A---. 2..1r'n'F-.S-2.f.-f-'ffw1z f.W:- .iv -f 'n -: X X.-n--N. - -X X X134-il u-.:f:X-.ff X-,C.X, .X5',..','9E.'- iw' 'XL--ylf'-L,-fggi''E1..f.:w 1145.5-ft',ff'.-f r.-.XX-.'1zfXi.-2 fX -ff -5.35-.Z-:X-X-' -j X - X XX:.'1'QfX-w-1 X W. . H: Q .' -' - fX.'-gfg5JX:X..XX-:1:- X --gf:-1.1.-.-gmqv.--zg3,gf2,.'.ag1.Q.1s-XX.--.1-an f'f':ff,1.- .- -as--.i.f..-1. . g 1 xr ':.X, .- - -- X. . X 1. , aX:X -XX-'X:, X::x,... 124 .- - X '- -. - ' 'Q .X X XX . X ' XX .. XX 6.3-'Fr..X:,.'3'1--'.w-.54-4.1 .gg-I-.J.g-MXTE.-1.1,J-X3-.-.:X mjX-gaps-Q--2. ..v.21f? i.-f.'1. 1, n:flfX:.sX.f:'g.-.XgX.ya'faf?'Mwi.-1-.5-'zvgq-.g'.L'-121-Xig-if-'3.i.-y---..'?f2-'XJgfggf 'Q:Q':?-.f.' :ff 1. -.f 215 --R '- ,.v.-'. '- -g'.X5S2:2i1'fX:X2' Ln 1 -'g -1 E. ' uf AjX...i- 5195- 2-'XX-4 2,- .'.r.,f -XXX -- -3 vf'-g.f-mfr.. .1-i-I-wwi..ff.s-.':11--M ws-'-'-w.W'.H-5-'K'-DJ--4 -1- X-we 5-..:f:p1-.f-4 .-w: .. .---- 1 '-.-f'-fm-1'.Y---:vw.. - -- - 'M -' - mf. -3X -- .Q -. .-:v-- . .- -1125Sjf:Lf...Xi:E.1Xf.?X-.gmwg-.1.-gyfsQifnXX'x-rr.-X.mi-.-2.hz-MgQg5sifg-525535-1.23nyvadvtf-1..5:?1h.1f-Q'-ri-'-'.:-51.2.-4-a.wg-f.'.Q.X.5if-gwifiatiaiu-pa.gms'lzfl-:'1: f-4-'..-:.'.-MX xi-,:.'1- ,gi fig. -:.-.Xgz'.XX- 1-.-5 -. Xgf, g.g.X-Y... :WX-.-.fXSL.-'X.qi-1-XQ.lXz-X-X: X XX X-57:5-5-.gXXg. 3-XX -- , -g,..,X3-f .-. -XX-X X 5, X3-X-X.. -45.3 .-'X-jX -rw-2fz'fN'.-Yw+l3?--Y-V11 --f:-NA---.a..1T' W-2. f f-1-MSE.-5:15-ww'-f --Me-1'.-1'--.yy-G .'HP 1'Fi, M- .---:--'.gr..--f-Iw-slams' ,.vX'-.5X,.-.W..-X..wn--'xw,i-'.----'5-.'..-.H-X-P--1X-IMXM...mi---.4e,.h. mwm,XiX.XgXu'-L- ff. .. .-'-.--f,wX'vXf.X.-- sf .- VX x 1: .rx-.-'fu ga- 'X .- -: 21X-- iw:-r -1 - x'v.'X 2: .H '- s. .-A X Q' -.gFiX.f5532,1mln L-3f'.-:'w-a-.f- . 'se--LW 'f- '-.1-fig.-..-fy:2'-.'-1' '-TX-5-:1f.,A-rm-9'f. .-wavy' ..-5.59 Ji-1.-,H '-W 1.11,-JSM--if-Xi-1.-'Y-fit, 25'q5'X--3 X .1:f'Jw-f-':- .mf-'-.QQ ,.w..mQ.-Q. -zy.egsL X925-.2-3-2-.--X.'X-I -23 P4--X----fXJ .i.-1' f'.-?-X-.rw-'E if aX'XXif-X-:--11-E...Xy-'.L.X--e'X-U'-X .3 -,.'..X1:3rX--.--.-1:X.Xa J,-X. V,-X 1.X..X.-. X- ga...-.Xq4 .Xp-X--f -ff:-g2f'.ey4X -S--2XX..f-.g5,-.f.-- ew..-Q15--X. ga--we-'.nv..-Xv fL+.3.eX g:f.-X-1.1-...ip -nm:Hfw--S':--1-a.-ms--.X.M-,.:-.--f2541- a:2f.'.-wg-,Pi -:':'- --sf., '---.M-4X-Xf,X .4fg..L..':.qfa-,iw14...X-3.4.4.--pg.Qin.f..51 H fu. fn-1'1f-.1-.fn my ---,aw .:.X:- .-- i.wi-e.--:-- V-1 .1-'2-Hfgruq-..-.Ikw--.f.vm.-'-.sw.-35...--sm33233:--1--X4?-mq'-'f1vi..1f'af'.-wfavu-.Wiwi-.MX wfhlmw .aff-13.-iii...5r2.1M'Jz.'X-iw'QM-'Xi -'-'-:f'fi-1-'ASQ-ws :--.'21:S..1'-v iw. X--P,-' .- '.fX.-6-145---2'2.? q wfifi' .F-ff--.2-4-E QI-.-'-iw --.Lb ,--.ffm-.XX-.' Sw'-:.-P1-JNL --.Sf '2-X. ff.-'PW--w,J1l N1M5.'r?-w'i: f2- 1' X X X, .-X--'XB -.Xfgc-'..L'g .EffL.f5ff 5-1:-A'.g-':X2.-.fav-Y. +1 .LX-'wggr.3. .h'fi11i'lz?-5.212624-32 -1f '.'.f-:f .,-Q 1'v53mXT-aJ12f-'.f'? ?X'-1 -.ff-Xi3f-.3 a-:f.h'-1l1.i:-133 .F Nr- r .X LQ- 1 ' ' .E?5:?'5iI'5Y?..g'Sf4'i'3.f'1flV'f-'--.5575--lirwixfWU :Fl-'liRXQXLEGESEPET.-hQ5?!5'i'Yf'1fff-ifA3122ir-f-V'-A-T..il -'MiaI -'Ciw:-2233-E: 3'1El?Xf. f-X 'Z-.XY 'iflvbklf TWT? 1115-131---5 53 .WN fn- SH f Vw31:71-351'-f?Xf3'.ff2'Iv'-1:,g.fv'.gQ'- 'cf 'liz'-111 if'5:.l.h. fig- vig? 1-f'r 1l.I,.C 9 f'rAT.g-. F-lwkii'-Xi' ' 3?-.Lf-'za-.-.if.' 1-'-ff: '55 -9 -,Ai-.26 - 'ff X -.-5-'1'Xf-fm. -2 .JL-5 Mqz.v'.f,.f5'.L'.-1.--1-X.'3gX,f 52,2 W-gjlvwx 'J .m,.F-'gag-if-,lag-ri.-in'f.g Y-21.z??f.,L .f .: f-. '-- iff!-54-'4----'f-K 11:2 XE. -TTY g.X.X.- Iazffa-i-me A'13. .?'f' av.-'-ff.. 'AZ lu--.. -5 f-1.5922-.'f -14 .+I X 'g ' -2.-H '--wr fi-.15 1 -- ,.:.a1 ,- 5 ..- ,rgv sq.-.-5-X.-S.Xf.-ftr. f.'.:-x-x-..:f.g5E-Q g.13i3X-5-.Xffo-gigs.-.M51-f-'f..-. rpms- '.-Q3--Sn-.. av-mv--gg. gripe. .:1s1j'.?fP,-1 vs -1.'-vA':cw-'cg'i'L'S'LJy1?v:2Ji1X-X,g..- 5.-Wy, .'f'r'.i, mf., :X.1pX-1x,'- if '.4i--.1-in-1-'41-XX-.215--3'-1-1pg-P.,f,.-X: .ogg--:Q 54-X f X X ,X Ty.: .QX-5,15 .,: X- X-.4 .1---XXX51,-.X . --.3-., -.-, - . .1-.L-.a..f... -..nz-i.fr.-.-X-1-.,Xf.X +.X.-.-X.:-X,..f.f,.-'-X-'.,:y-'f.- -.--2-Q.:---Q-yr-f-f-'zz 1.--.1--1- .-4. 4'-3.-1--aw ----' H KX. 'f : 1:-me wp..f-'A'-.-:.mv.---1--r---'ww 1-f.-' 2 wi f-1-yx -- --'-.M -rl'-I-55 . -:--'vw' fum' f'.-:r--f.-ww - 2.5 f,3X.,fi53-.-Xm.-Xf.....Xu..Xw-.-f.v5.yf- 1.-X..... .fX..f. .SX-.-ff-.2 -1? if - .ww r-.--: -,1XX.,g1.. if. -,-.-'..X,1- '-:,,.,-mf..-ii-.fw. -,.-,-,X-...Q -. -X ....-H... -,fy X..g-- X, -X.,- gf- ,. .,-, .X-1. --.X--5....KXX-,...,y1-1---X-.4 -X-z., X-H.,-.. -,.-. J f., ,.gfX5.. .- . S --n X' 1 Q, Q. . X1 Xf .X-X-mi x.gX.n,-.. -:f.X,.1...- .X,, X?.X?X,g,A1,g.XS4,4-,Q.Xk,..,XgQ,X. Q., .X..X.m-we 7'-wX,,.Xg.X.3,-.X3,.--3.01JN. . XX ,-X.-Xt... . ,.X.....X.--mu.,gf-Hy. X-F. .Xf -X. , XX .XX if.,-XX,.X XX.X.4,, ..1X.X..X.,- ....,..g XX..-Au X. XX- - , 1.-.QX 2.X W. -.X., . --smffiif-. Y- z:5'i'fff1'f2-55--',:f'4 if- wcfz11'4'f2-WS..-Fw-is-Lfrff-'Eg-2 ff-2'-M 1:-f-3-K4-Wi-s Qs. -2 Uief'..X4w-wX-- xii'-w:X -'Xl-'iefwrff ii-4a 2:.. 5 ws.--X --'. - -' 'X '..-f-w.--2.'.---f2a- XJ- -1.: w.?'5f--ff--'-'---ri 1--2.:..':--'f -'-4 X1..-2,--wif. gf, 1-.-Aw X. X X - - . .5g.-..X.,,.g.z,- -2. Q.--..,Xwx1..Q,.,3.w.?..,ag5Q-.fg.,:i1a.-. J-.X ff-.egg-.-X.. -Q.asga...-.X.X,,.gQf.X.gwig.Q.f.-,1.-1-XXX.-ry ge.4,4qXpg,. U...-..f. ...:X-Xa.,-X.-.1 .gf ,,,..--.:.--....X-X.-f,,,,.2,....X.,11.,.X,,1g---- . -.g.-.,- e... -.: XX - X- -, Q. .- X-X-X-.,-.1.q..X.. .X - -X X -- lffffw-0 -111.3'.---if-f'-11722-Q -iii-N42--ff-'lvifl-x1f.f4-FQ ri?-by...:,.,L,..,,G3g:mf3v'faf'2222'iSig,5.-5iTf.'4.w-.--Q ..x--W. .-.-,,-fn..'.-,..:..jf.--.3.g-:-Lf,.z-- -M:-p -:-.-rg.-X X-...XL :L--'fs .-1. - .g,X..f,::,.i' .fX- - --mag 4.gX,,X.. --f .. , X , .-1-. . 1- 5 .se ...- f -hp--.44 ag --f,.. - -. X . 4 .5 -...af-. -. f-. -f,.-- .:..--,. .X .. X 1 . 345 1-.-,-E!',.-.--.xp.-,,f,---Marv.:ip--,...5-.I-,,...,1.. L,--XM X. ,V -fb. ...-.. ,X ,.-.,.X- mga,-. .. Mg, .-.X.g, ,f 5... X- ff... .X X.5, -,- -,X-. .XX X..XX.. 1.1. 3... X...-g ,X., ,X-X .XX-...sg ,fra -au.. -X.f'fg,?4iw,v.ff.f 5Xg,f'..p'-ngpzeg-F-?,J.rXw?3 1'g,'f ?g? X-'.lp',q.5-,.gff.v..,'i-my, ff1g.Q:5+m,f-.-sy? 01375-I.-35.-az ni.-1...-.X.5::h-div-af' rf:--1: 'nm-.f 1. :-1 '--'rw11'--.:ri..J-2'-xrsfyvffd- - T35-N ' - 'A af-ffm-fm aff- ..Sa..2f1: ' h44f----e--'-He-..-'.x-J-wr--rf,-ff nf...-..'.y . i3.,A,4..gX.-,gmgli 354595. a,,.X,.- a..i.l:.:,X.iX ,gp5335,...i .x..5.g3.,XXfgrs..i5- ..vxjxa-:-,.gw:.M-,,1.Qkxumz-4X..g..g,.-33 Qwsfiq.,iw-X,f:.,.1.-Xi...,4X..Xm,X.-X. X,.-X5 M.--X,,3,,..,.X. 53,1 5, dm 3- XX XX- 4... X .,., ...7 .-z-f, 1X4..5'XQ5.X ... .Xjv-XMXXXXX. -.--M --X-X 2.1. 2 --ww .4 :. ww-, .W - A ...--...--...:.. ag... .----. f,-.f, -',.,X4pffv...-. z.'e'fv.-'MW-..---Z X-Hz..-X -12.3-Xa-1' -:ftf:,-1 ----.'.A!.-W. J w- '- . . X. -' 6- Xu,-. .:--- X , ..-5: ---,- .- -f - .4 -fm--qf , 5.1.1133352,meg?g,5X.y?5s.f,'-Wqwf.lX.?5f.3.,3-XgfgiggiX M -.ggigigjfi-riwga .XX.w,.g-XQQSXXX.2,,37x?g'iazii'v1aQ?:35gXyfffnggigi..Q-Q3-2.3-3tQ12X?5ifg32w.EP5,?Si?.g3?4-5-5g.fg,,:fg.V .1f,. 7,u..'B.,f- - if ':g?g5g?-'M 5 QQ. , gg L-X ...L -1, 2355.31 'if-.pf s-5'f'-iazgfwffzifLf.. '1 Qui-.-'g -wr...-' . :..X.5?fi.5.:-W .Xj-2.5-5. A-gp. Q X,-!gf fa.g? ig gf .zff X:v.X.1wq:.XyfX-L: Xwgg, A... . -.--XX .K 5,--HX-gg X.,f1X.-.XXgX'.-my.-f,g,Xg-' - jx- .- . 5, .-XXX-X XXX M,XX,,m. X ,. 3-,X M, XM X.:-,X wig.. XXV., .XX sw-n.e,.---rNw.--:ff-1-1---Hifemfvi N?'.5??- ..--f:w.2'nwXg--3: -Hiy 45. -fx-1,-.1 -'AFA ,'?'.w-Hzfi 2---Arif-2,53 .fi 2:1- '?S'.:'m 1--Q--ef-X-..f.1 zw.,,.Xf'5if,1.:'?:-vzw-.v .fkx-'S-uf-zf-.':.1.-i'1.-u,--:..- :----My 5: -.mix-..-..:1. ' :Q 394--1 w . 'Gp -5, 1, -.iw 4-f :..,- iv.: .1 .WH ...wr MX...-1. .fg.zf-Mfw :g?u:2sw?'!-4-..m--' -his-:Xwg:-.f.g.z.iffvE1if.fwP-'f .1iv.fv-fi -ef-.9 --R::-wsf4.-wsumix...-1--2.5256 X 1. -4- -. I-:I f Q- 1.-5 -fs. -e--2.f.:ff.-S :X-vf-Z-.wr-Wfiw-A-fr-mckgrfwd4. -Sv-fm-'s if-fL+5g.5,w-WKW..l 93.1, :5gl.w. -..'9-iw.-- 2-.wk-'Q-J-1 YY'-L'.Al5.g'.i Qu. .ic-'Swannl.iw2'fix3'i5fffviff3g.-'---is-M...-w..f.Q..v...2-g YW-QQ,-.gg..w4n.w-vbfa. 6-31-Yffifmffifzf-1-'iv vii. QQ:-1'-Q..-fS,:i'..-wp. w.f1X.gwz3gv,fm. ,ggi rpm.,.5-.,X-.Q--X.,-ig--qw Wa :wg-gg--,.4X,. .Q-5.Q..f.....g:3,..,..fQ-5.35.-.Q.w,.:efX.X3g-,M-.1-p,.1...1XXzg..-zMfX,,X..X..wzz.q.Qg-..ig.5-X1,-.X ., X.dX..X..X,gX..X.,-QXXXN3...,Xf.,XQX..,.X, -.-.,....X..-XXg-.X kg- sm fp--1... 1- X'-T. mm.. we .-31 U 2--wif:--x-7 iw e. wp. 1.-.M-4:36-4. --g5,....g-. ...kv X--,fm .:, .-.f.-.mi-4.4.:?w1..'.-.'Uiw- .fw.ff-:wwf-.X ......X-f-.,,,.-X- ...X-1,.v...-W... , . -. .. .M-gc -f Xf...v, X.-:5 .M-fy....q...,-.,XXX----WL.. ...Lg . -. my ...- XX .,X.X,,.XX -QW.. .f -5.1-A-. Xwf-X-g..gX--W 5-.X 4-, Y- X .L -f2a..:--w....m--- .-vi..-Xw .4 Nm wg-few.. -wa...--. .4 ...XX .-..X.-.X,- -.Q-...f.Xm sa... Xqq. iw- -fi...-...M-.-. ..f.,-1,1.,,X.- -...T .-X-.sv .,.X,.Q..-..X-ew ...y-,,v.,X-.X-W X. ..L.,,-XQ,.Xf,.X,. ...-., ff.. .-X. .,-..X..,..-5. X... ...3 -,X XX ...X .X f.,-...X-Q-.X..-wwf.-.-XQXQX..1-A winrw-.-Yi Q...-.. .Xf.y..--f...X.. X ..,4g1f52. Ag-Eg.-.XM-. X-. 1---X.. ...XX --,:..X .3..X...-X-......,f-455,13 Q XziYiX.,. . .X-fm, .X-5,1 X. ,X .w:.X-f.m- 5-.351-. .Ji-,-my A M- .-fm-U...-. 1... .5 ...Q-:-'-...s1,.2..-we-xv-.1 akfw- .- .----4-5-r.'-fi'--u'Xw 1.--.-ff, few- .M ma. . .sw --.-.- 'mv -if f- .- Y N'-'-L+ - K -1 -Hx -ww Gs.-'r-..5-. Q3--...ki .M-Q.-a.-X-.1 - , - in ..- M w.,.w,4.g.. .+- .-,X.w. .rwfig 11,X.1-..-Q.W...s.---9 . AX.. ,I Q m,5..xX.a. Xmgfyg..-gg. ...X-ww W X. ..4,,-,.Xw...,....2 V.'jf,.a.Q . if-.X-.4.f .f. 7-X :grin -X .XX X.-...X :,.- ......X... X.,-.Q ...X.-XX WX.1...b.a X-X-4 ., .X .9 .f....X,X.,.X..5-w-XQX-.1 X -.,v., ,X2.,.- Ms. 5 .,,e...X.. 'KMw3-.-1g.S.-.v.r,-e.:ii.Xs.-www?-wif 5.-.G2'1M.---Sw -. N '-wwf:-U -ig:-.mm ww!-.irh-qw'-:?x,f1-1.v--N-+5215-ag-ff-Q.--.sv4.---mm. -.wx-1--ff-GMAm..:' --4. --'.5.-.1-.1-. ...--wrrr...-4-2:w.g-gym:-W.1:swf-.mf-.-2-.-f15'.Q5--fr----.1 -.Q..r-Qfgffw2'---f-.-W.-X-1.--w-wwii: -41-.we.sg.X---M-JP:..-1.13.1.:--we-.-av.--.1-.ff sm,--1'-.uw-g..'.z --g,--7-mr--. -em-:fu--5--1 -.3-.-'P --191-Q-'QQ--Y y ,ffm 1:34. ---rs,MQfffQ,wE5QWff :F Miiwa- iff' ww-M24-r.--fi! -1. -W-f .-.Q-W.w-wi- W M. WW 4. J-0.44 J-.ak K-I-Y..-f-.2-1325...-wzizdffas z1wh5-.ka:.-1:wf.- mX.az-..Q.24i-.-+.'g- ,.:.f1.2--- --.-.-.-XJ?-fir.-f Q 1ft lYg.12'3A5.,.v1.'Yf,'..L,J'ff..zP ,g.,-.f.,..m..1-..wse.'i.-.'--1.1.-1111...--va-,-w.:-2-'-f.-Ka...-.-my-.vff-1 jf-1 uf 1--'gag-wp was--if.maf-1a:e'Fw4:--N i-w'5'w'vf'5f'f-f'1M- -w- ' - 93w'Qi'W-we--H 2'---Mn - .-M'-M :X X -M gr .X --1-:xv f .mq,Jim.wW--mg.-2---Q -X-mf.-4--.fgX'.v-fx.--v1--2 ww ...J .XJQXQ-f?v...gasew' -ge.-fl-few 5.-M 'ws -...'.,p:XXf -.a.X.f1'1:-f- .- 1----ff-1 ---2-M.tw--...X-f-1-sw ---:aw -ww-.f. ---- .F-5-Xf. ..-. -X--X f fn - --f-----'-.5...'-M-w'f- -wg-3. - - JJ '..,,..mjj.-y. --XX. .X . -X . .- -3.4. fr... -1. .,. X. X, m...,X..:. ...ma-gn-.4-. y.....-.-.-.-M.!..X.. ..-X..-,J1.z.m-z. .2152--fi-x.3.-xl-XM.,-5-1.,.,g XX.X...-,g-XA...--X...m.XX-.X....+..Q...,,.Xa.X.,.,X...w.- ..fX...,-XXXM ..:,A..-a.g.- -1 an-42539-Ry?-l:QQl..f9-3'-f..:.f-Q. .ZXX -,mm -.,X,vq,s.-we .. 2 H f-. X X --X-5 r .5-vy....,.. HX., Q.X.vhp, -aw g 3 5 Q- M ...,,,Q-4 g-Xmeiw.-X wg! 55,52-f .... ..X...,. g.XX...X,.- ....-...N-X,f5 XM... REM. -WX..-f.S, . --.,X....-1... 5,..W....Z..-..X.-.W X,-.XX.g....,,. mmf-. ,XX--.-X .,-yy.-X,-9.-,Q--X,MXN--...,X.5lX w-m-.-wff1+wi-fa'-- .4-H--ff..f:M-ii 'f-n'MafwP- 5-11 ff? 'Q wwf!--.W--W-.X his-is-wwf. - -.SE-' -ah-fwf-fir' -HAM fp-15 ' his aw..gmifyggf?-ww.-.--A-ff..f.-D.wfm-.sffaqf-M-1, 5,-...ns 25-W wh-raw. -,www.mg-.wX.c2.-M1M..-'Q-if--rg...--.s..-.Q...1:f-..--c-mr.--...e1,1-sv--X-1 .--2-3151.41-.FX ie..-. rdfvzfwzei--ai..zvvv'-'WN'-Sw-w f!,w-16fX:.fe - 5-E-S-.IQNIWQS1-, hm. r'4.q.M: E .Q .241---w-7-635 rw-.X-1...--'xw xp- --A-.gwm-1-...X-.vtizzf-.L--.9-i,Q-1--.nw-1--fsWLf'-ap.-fQ..-aids.1 saw. ,w M.LP?f.5-if-1.-W-.u.' wwwwant--w3XcgwM-..v-3-.- -r-if1-1--v.-N':f'--1+'r-.M-1:-.:f:-af---:ga411- Eiq4--Xp9rsgw,X..y-wX- -qfg.l,.'- -v...:f.-ff-!':.'.g.15.-'Q-ff1.nf.i1,g1.,-13-QQLALS. . , - 3, 4. ww-if y'zj5:'-Q' X: -,...7'iXQ2f,.,,. Xr.-------f - X-.fi1,f-- 1-:fl-rff.-MX zwyiasrfif-A -Xi. -ev wr.f-.':X4,,tr-.j.,.-.3gm.--x...,..-X-'..:1.,,.Xf'1v'ae.., -Q. X.. ...- -v-W em- -Swim.--?.4r-r.'gbgifm-'221-.five--gp-:w.:...5.:,5.i-fgg-Xe--Xp-qf..X:15g.g-.1-N-'F.9Xl2g.....-.-3.-X59-,X1,.,,5 .A-r--.m4mg:1wf.Q...f-if -f+- Wm--f .5-.. gg gym. - ww:-r 1- . -...w 'ww wg. Www' M. swf --- M--1 it -w mi nf' xy -P .Xf......fXm-- f9.,Q....,-.-4-'.-5--.,w..-f .-...wi-5. -. . . p?mW.-f:fSXwf-?.p1Q-w:.w-E- -X-f-av-.X--..w -. ww- nm -...1,.-wr.-2.----.. X.-2.1. M-SZ' fc.. fm'-1--'-.ass---vxWf'2f:.Q59 .4 wwf- -wif an-XM, ..-.F-. av- I -2 K-mi. -,rv ....-:sg-...w-iw az- -Ji--wr'y'-6129-..S'- ww wx? '- ...-:-.--.-mr.5- -M3-..--xx .wa -.-Q..--'L-w-XM.-.Xi -Kwai.--X .e QX w,-f.-eww-...wwM.-.....X..-mv-F--aw --.N-.'---W-75.-.zz--wa-.'X---v--4-.'.:--W-m-.3 ..2---ww:--1 ef-,X -- M-..ggy,Q,q. ima,-. M- 1.-wg . qw M 9, . X. Q.-Xr , .MX --'-:MR-,-1. -L. 5114-.V-5,a5..m.. -g...g.g.1qwf- .gm r-ask.-mqwg':g,Q'g.-15 v5,g:..X- ,wfgg-1-eQ1--.,.X.-we.--meXe--13'2fv5...e--wgg bfi-nX'1L7fcWxv:LGK,.Q.x'?'-Q.'.L-vm fm-..,f..4.f.1a-9.-J-X125-x,..w.-wmggw...,.-,fy X...m.:1:mfX..pN1w.w1.. 74.-S1-2-1.-...M .X. .e-1g.?5sgb-ffl?.Q's:,4.-1+ -.: .-f-W.-..-ef!!-.. -- ---:M-au -1 -- -..-.15-.52-a..-..Q..g-Q.-.-kv f-...W . .gm-.+.gg.X1X! r -U-..?S.:..1.pyxw..w.y..w-.-f--M ,qfimg-Q-... .Km-'2'rM 1iiM.1'5L'--. ,. w.-.qw 4.-.lawn-.xgaf.---.-.-1X-v-.s-.ws--.5 X. -.-a-..-w..-f...wes.,-. M--Q--...-X...-.-,.--X...X ...X-XM.,--.,.,,....-.X 1.-f -. -:..- ..-.1 at ----A -,..-f' -i.-. sw- -www wad,-gi -fm -if MfWX,f+m.fkQS+ .v..31y.f'..- .XE-,. ..X5- --W-T, -, .mm-.-.X--. -.-.yn an 1.4. wp -.J .f wx. -.- M. . --WL... vig. X..-M-.4-rwi,.vpXcfX.fZy-X.. At, ,.3..X,y....,,.-...vs-Q.,-.4-...la .wQ..g-.,-.- .X..X.,X....,m.+.,.,X. XX... WXSXX -+'XffYfm-w:---ff-X-1fw..-4 -'-1-1'-Pxfea'-X .hmwhff -:Y-:2f5f?,qfwLfff X ..X-., 3 - -rw 0- -5... -W--Q -.M -' .w-f'vw1g,s..f-, -...gww iw--QL...-zbw M Uv--.'!f-he,.me4'1w'4--?55j5E.iQ2.fwv'ry-2-12.-i'fr' X 1921- -l 11- . .N- W -. r-A-w .K-1-ig-5 XL?f5Iv.'f. a5.v..v-.-.Av--- 3 ---29--gi -,-.-mg 1-m.f.1K5gf:.fvf1?:f-'-QX5.'.ff-R.--Q X-1X4f:-.--g.,c...XX-,iw Wg...-...Xy -. 1 ..ff...XX-1...-:MX 1-'f--4-1...--N A-1. xy. --...NM-.f S-.XXX.X sg-va. -f,,61'.wfV3w--fPwy,.Sw-,--.... .QF - -2--...-We--r-x.-5-fam-f.,. -E----.-all .--..m.- -ar-f-f-1-.1-Q --..- e.'-sG'n.:'X.-X.,-4-X1-.-W -w1ff.,4m..s- -e..M-.-.W .::ffa.g1.-Q-Jaw .Q--1.....4?s.., an .- .1-fxgvf-gms.ffq.f1':-.W ..--AX-M ...-wi..-,c,a.N... wwf ' fb:.'-f-fy-.2-,Qu -1--.MMA--,y1.'Qg va . N-9-.33.m-fx-Q-mfiggjlpqy . .5 . ,. ...fun :i-.X- 4, -my.-.XQ,5X-..: .. .L 1. -7.51--.:-. -X. .rv-...Q-V-..:-.-,eX.3,Xs-el.-..avXgag3fq.4-X.-Mmd..-, 11QQ5w,,v.X 1.1-I.'A.w.X,-....-.QYSQM-X-snr?-.ff mf.:-Kala.:-J-Larf.-Q-9-12'..eff'k .Kw'd..-.w -- wfg39ff4m,x--Q.,--f-3 rf.-we-3-Q..-M .-. g--ff-f: by 15... :QL Wwzvf-sg.-.za frsfffisiw.. 3- FW -. .fp f-1' ff aHNurw,za-ww-.su. .1-.--2X-1.1.-ffm rm u:'?v.'f-MX--'4-wgefigfiff-r.X-rw- -- - .. A.. . .. -. ...W - X... Q.,-is be . me-1.a..4-.ffxifgifzzgff X E?w39::-Nffigfi: -- - iff 2:'s'5Qi' . 4.-pg.?e -itE2ffi?e'F gv'3ffi-..-:fp-:prf..3ggX.-gi 1.4.55 219'3-Lggfzi-.JX-2-..-4Xqw' S531-5 3...q-5gg1gi5ggX..5g.- .X Ay... -X...1.-.Q 12..XQJ.Xm'.5.f..-zz-4::.....-'lf'..3.as2..m..'z.r2.:f if apigggqqagq-,g5.2-pS535.,X5XX5Xg 11.2. .. -X .. -.....X.,.,.....,-...us-.:,.X..f.4..-...mam...mm C that sure was a hell of a test. yeah, but i just finished tour of lem.ll- in one class? llyeahfl come on. three, yeah, sure. maybe it was only two. school everydaydayclayday daydayolaydaydaydayday . . how long can it last? you're a senior, aren't you? yes . . . i bet you're glad to get out. i still have college, then graduate school . . . man when i graduate i'm leaving and no more school! that's stupid . . . and that's probably the way you'll stay. ll ll Staff copes with peopl , problem Taking messages, delivering absence slips and running the ditto machines are just a few of the iobs that keep the office personnel busy. Writing absence slips and keeping attendance records keep Mrs. Elaine White occupied. Mrs. Mona Gaither is in charge of books and also runs the ditto machines. Aside from being reg- istrar, Mrs. Mary Dennis sells everything from football tickets to Homecoming mums to bus tickets. The counselors include Mrs. Paula Turner, Mr. Robert Duzan, Mrs. Nancy Morris, and Mr. John Lynch. They are kept busy by making schedules, setting up tests ranging from the SAT to scholarship tests, and counseling stu- dents in every way. Mrs. Sammie Fourmy is secretary to Mr. Bob Bradley, principal. Assistant principals include Mr. Lee Dodson and Mr. Vic Clark. The director of all stu- dent activities is Mr. Jay Martin. Mrs. Elaine White patiently asks a parent why her child was absent. Smiles come from Mrs. Mary Dennis as she runs 72 paper through the ditto machine -S we f f. , ff -f 5,- .Q t.i - ' fm f2f'siT9ff-hifi-ifr4Q 4i2if'ff 3 3, T Q11 , .tv 3 'Q is IFF' 55:'xx,' 55611 S- 1'5'.l' l 5: Bag 5? C . 7 +5 aff, 5 rl' :f Q., ,RVN Sponsors Valerie Watson and Randi Rutherford welcome new Trooper Mr. Vic Clark. Bobby Santiesteban, courtesy for Mrs. Elaine White, checks the absentees. Coach Bobby Lesley and Mr. Bob Bradley converse in the halls about the day's activities. ACADEMICS 73 A S During open house, homemaking students Denise Creek, a iunior, and sophomore Kennie Sue Bowie prepare tantalizing delights for their guests. Hom makers learn household skill From cooking and sewing to tailoring and upholstering, homemakers attain knowledge for the skills necessary in caring for their future households. Child care and patient care are also included in the curriculum of study. Beginning with cookies, the home- maker gains enough experience to pre- pare a full course meal. The sewing class provides an opportunity to make everything from aprons to iackets. Every year the faculty and guests are treated to luncheons prepared by the girls. This adds to their experience in another facet of home- making-entertaining. Working under the direction of Mrs. Billye Freeland, the homemaking de- partment constantly explores new areas of household interest. Assisting Mrs. Freeland are Mrs. Connie Steel- hammer, Mrs. Brenda Jamison, and Mrs. Lanell Chambers. Sophomores Debra Reihms and Debbie Bemis demon- F, strate the techniques used in patient feeding. 74 ,ie ... PK JE q,,.,A Maas 'Learning by doing is Mrs. Lanell Chambers' molto as she helps a studenf put in a zipper. Typifying the pcxiience and skill of u homemcking sfudenf, freshman Angelica Serczfin works dili- gently io compleie a sewing assignment. ACADEMICS 75 Library pop as reading i Through the efforts of TALA, this year the library has received over fifty new books. As a project the organiza- tion supplies the library with a hard cover edition of every new book sold in their paper-back bookstore. In addition to the many new books, the library has acquired a new copy machine. Librarians Mrs. Lee Firth and Mrs. Elvira Cooper attribute the suc- cess of the new machine to the fact that students are allowed to use it on a do-it-yourself basis. Another addition to the library this year is the presence of teachers' aides. These assistants work in the library when they are not needed elsewhere. The library has proven to be useful for something besides writing term papers. It is also a place to relax and read. Reading improvement is a course- de- signed to stimulate the desire to read. This recently established course stresses the importance of reading and en- courages reading for enioyment. Taught by Mr. John Colburn, students learn the fundamentals of reading, increase their vocabulary, and expand their reading comprehension. 76 ularity intensifies mprovement matures IL I1 . - f.'ff2lQE' ' v r r rara Mr. John Colburn assists sophomore Robert Blakeman with a daily reading improvement exercise T Xml kk EDR ix Library courtesy, Kendall Larson, examines the many interesting books offered by the Teenage Library Association in Eastwood's Library. fully as she assists students in their selection of suitable reading material. ACADEMICS 77 xiswsnsw 1 11 ,,1'n.tHu.w V . - ' L' fs' lm - ,N ' Qaws1wsmz:z:m'M'z1za7awww. efiu f n.xmrffs:smf1:2s:1.,,w,erem ,uw::axaa :sevweYwfee7'em Head librarian Mrs. Lee Firth looks on thought- Engl: h department stresses In essence, English is a universal com- municant. lt is our most useful and important means of expression. The English department stresses this idea through the fundamentals of grammar and the complexities of literature, both American and English. Through the efforts of the depart- ment, supervised by Mrs. Martha Har- rison, students are made aware of the importance of the English language and its usage. The students are en- couraged to express their interpretation of English in writing and orally. Of great importance to the English department is creative writing, taught by Mrs. Bonnie Lesley. Offered only to seniors, this course gives students an opportunity to express themselves through the composition of original poetry and prose styles. Many students enter various essay contests, and all are encouraged to take an active part in the publication of the literary magazine, Reveille. The main obiective of this course is to increase the awareness of those young people who are eager to know their environment and the role they play in it. Perception through the senses is expressed in written work as well as in class discussions. Offered as an elective, Journalism l is taught by Mrs. Daisy Meacham. This course prepares prospective jour- nalists for work on the newspaper and school yearbook staffs. Journalism ll students work on the newspaper Sabre during class and at the print shop every week in order to meet their deadlines. Salute staff members work on Saturdays, in addi- tion to regular class periods, throughout the entire school year. Freshmen Kent Brooks, Beverly Budens, and Tricia Gonzales look over test corrections with English l instructor, Miss Peggy Doko. 78 expression through perception Senior Ted Argeanas discusses the play McicBe1h with English IV insfrucior, Mrs. 'Marfhcz Harrison. Sabre sponsor Mrs. Daisy Meacham helps co-ecliior Julie Francis and editorial -:ssisianf Bill Beard prepare ihe chase for priniing. if' . X W 1 1 I 1 H 4 A N I , - 535 V V .,, . ,1, i,s,,1 if' fm 1 4 fir: p -vw V. . M M ,, ' . fr' A i G ' , 4? . . A ,' V .4 ' , V f f , -iii? ,, 5' W - V , N . fp- r ffneg 1, A er r We if ,U E? , is A I YEL Mrs. Elizabeth Dow und Lofin sfudenfs Mike Allen, ond Kirk Nelson focus ofienfion on o Latin hisiory film. 80 fe Infense concentroiion .N HX is maintained os junior Ken Hari, iff l5ggV1fiff5i5fQff.ii , W1 if if L :if xii iii? lfiiri' i Wl!ill'xi'i1, gflpggygm Zu .w Romsey siudies in the foreign Io 1221 wi W I 'iii 525 +55 fgf 5. f fi f fffik 5 ur - nguoge lab. Field trips, fairs, puppet shows enlighten foreign language buffs With the festive ioy of Christmas, Mr. Colin Flannigan displays the German class decorations. Venturing across the river to Juarez, Spanish lll and IV students took in all the sights. First, they witnessed a cele- bration commemorating the anniversary of the Chamizal settlement. From there the Spanish students explored Pronaf, the glass factory and ended up at the Old Market where they bought flowers, jewelry, and pinatas. Another field trip for Spanish IV stu- dents was one in which boys from the Escuela Preparatoria in Juarez came here for a tour around the school. Two weeks later, twenty Spanish IV students toured their school. ln March, Latin students from dif- ferent schools held a fair at Bassett Center. Articles such as ancient weap- ons, replicas of ancient buildings, and paintings were exhibited. As well as decorating Mr. Colin Flannigan's door with an elf workshop during Christmas, the German classes also put on a puppet show. They wrote the scripts in German as well as con- structed all the puppets. The foreign language department, under the direction of Mrs. Elizabeth Dow, offers four years of French, Latin, German, and Spanish. ACADEMICS ai Nik 1-Vi vi , M' 937 LSESM Q 1. Y 5 , ? Tony Salozar and Glenn Guy help set up croft Mrs. Dolly Picken consults with Mr. John 'Hogan who served os iudge for the first art exhibit at Eastwood. demonslmllons for Mr' Albert Lane for open house' Richard Goglio works diligently of completing stars to be used in the Sun Bowl halftime show. New techniques in modern minds blossom into artistic creativity Creativity is the key to a successful artist and the art department has been blessed with this abundantly. By combining creativity with imagination, style, and lots of hard work resident artists have done many things throughout the year to make the campus more beautiful and to add to Trooper traditions. During the week of Homecoming, the department stayed busy helping all groups with hall decorations of all sorts. The Christmas season saw more of their handiwork with lovely decorations strewn generously throughout the school. The display case in the front hall is constantly exhibiting different examples of the various art forms turned out by the art students. ln keeping with the theme Around the Zodiac, the department was respon- sible for creating a beautiful astrological atmosphere for Eastwood-in-Elegance. Throughout Eastwood's history, the art department has offered outstanding service in helping beautify and decorate the Trooper domain. Paula Chumley grimaces as she glues stars on um- brellas for the Trooperettes' Sun Bowl halftime show. ACADEMICS as Basic concepts emphasize life stud Knowledge, gained through the study of the basic fundamentals of science, is applied to nearly every facet of life in today's modern world. Students begin their study with gen- eral science. From there, they extend to biology, chemistry, physiology, physics, and even aerodynamics. Once these areas are explored, the knowledge gained from them provide a back- ground for further study in medicine and laboratory work. Physiology students, taught by Mr. Fulton Robin- son, toke a test covering the sections of the human body, under the watchful eyes of the class room skeleton, Mr. Bones. 84 Living and non-living organisms begin the general science course. From here, students go on to study cell metabolism and photosynthesis. This section also covers the exploration of minerals and elements of the earth. Biology, the study of life, takes the biologist through microscopic organisms and the human body. The reaction of various chemicals on elements composes another area of science-chemistry. Different compounds gi ,4 2, S, , yi wif' are created, and water, or H2O, is broken down and explored. In addition to the dissection of a heart, physiology takes in the study of all the systems in the human body. Physics teaches the why and how of the nonliving world, while aero- dynamics pursues the study of air as it moves around obiects. Functioning as the head of the science department, Mrs. Julia Daseler teaches chemistry and physical science. wr A51 T. Qu Rh lf Pt V iz, WGA 1512: HD' HQ 5' Mears iii Cf 55 W5 Physics students Bucky Carter, Martin Townsend, Allan Gamble, Craig ,K I 'K Trimble, Lanny Nordell, :warns ANY and Richard Wilson experiment with a pendulum. Attempting to feed a bull snake, Mr. George Wagner demonstrates the techniques to Elaine Bartlett. ACADEMICS 85 Carla Thomas applies the knowledge obta Typing I in her clerical practice proiect. 86 ined M A 0 ,. Cynthia Loya diligently works on the full key adding machine to complete her bookkeeping assignment. rw Embarking on a field trip to the El Paso Natural Gas Company are DE members Ruth Hanna, Robert Hudson, Don Pendley, Grace Nunez, and Richard Narro. Invasion of bu iness world initiated by VCE Linda Seelmeyer answers the phone for her VOE job as a receptionist at Surety Towers. ., .aw Nw . . .. zu. . ., .u Q' Providing essential training for office and business iobs are courses such as bookkeeping, clerical practice, typing and, shorthand. Vocational office edu- cation and distributive education allow students to get on-the-iob training and go to school at the some time. Teaching VOE is Mrs. Jean Hawkins. Students having typing and shorthand experience who wish to work in some type of office gain training in VOE. Machines such as calculators, dupli- cators, dictaphones, adding machines, and electric typewriters are provided for use in the VOE classroom. DE, directed by Mr. Maurice Bartram, is in its fifth year here. First and second periods in the morning are used for classroom training in DE. Typing and shorthand provide out- standing secretarial training for future secretaries. Bookkeeping teaches basic techniques in office record keeping and the use of office machinery is learned in the clerical practice course. ACADEMICS av Xl. Drum before beginning the halffime ceremonies. maior Mike Woods pauses u moment Urging his Cavaliers lo pu? more expression info their voices during an early morning practice, Mr. John Presfwood strives for perfection. 88 Paying special iribuie To assigned fo lower if ihe American flag, ROTC students John Leftault and Lonnie Dresser are afier every school day. Musicians, ROTC Corps practice for perfection Improvement was the mood set by the music department as they started off the year with a noted change. Com- bining their talents, Mr. John Prestwood, choir director, and the band director, Mr. John Faraone, got together to change the key in which the Alma Mater was originally written. Honored once more, the Cavaliers, led by Mr. Prestwood, were invited to sing with the El Paso Symphony Orches- tra. Working toward perfection, they practice every day during fifth period. Mr. Prestwood also teaches and con- ducts a girl's and boy's choir. From entertaining the fans at foot- ball games to marching in various city parades, the varsity band continues to improve under the direction of Mr. Faraone. He is also in charge of the B- band which meets third period. Under the direction of Mrs. June Gingery, the orchestra meets the sec- ond period of the day. They work with area high schools in preparation for contests and competition. Drills and inspections characterize the activities of the ROTC department. Led by Sgt. T.A. Kittilsted and Sgt. Robert Patina the Sponsor Corps in ad- dition to the ROTC Corps prepare for invitational drill meets. William Kettenring diligently practices selections on his violin for second period orchestra class. ACADEMICS so Social studies classes duly resolve to take part in man' modern society i Bringing about an understanding of the world situation today, the social studies department guides students in the exam- ination of maior historical events. Under the direction of Mrs. Nelda McKinney, the social studies depart- ment strives to show the relation between memorable events of the past and present world occurences. Freshmen are introduced to their social studies career through the study of world geography. Offered to sopho- mores, world history deals with the study of international affairs from the discovery of prehistoric man up to the Viet Nam conflict of the l96O's. Juniors concentrate their studies on the history of the American people and nation. American government is a required course for seniors. The purpose of this course is to acquaint the students with the procedures of the nation's government. Two social studies electives are open to seniors. Sociology probes problems prevalent in modern society. Taught by Mrs. McKinney, students are asked to seek logical answers to these prob- lems. Financial problems are studied in economics, taught by Mr. Joe Varro. .f.. iii? fi l ,. illustrating the principles of the democratic process, Mr. Thomas Wesson lectures his American history class on the aims of our society. 90 Nxhtlxkivu NJINNKX NJ 'JON X Fulfilling the aim of government class, Mr. .l.C. Gotcher and Leslie Penley discuss current news. , , ,Y ig -.,,:. , As a part of economics class, Mr. Joe Varro scans ihe siock markei page of a national newspaper with Olon McClendon, Belinda Gafford, and David lucky. Mrs. Nelda McKinney ialks over a daily assignment ' with members of her sociology class Keith Moser, Ricky Smith, and Anita Kushen. Plays and tournaments highlight activities of speech, drama people From pickle sales to one-act play pro- ductions, the speech and drama students are among the most active people at Eastwood. Teahouse of the August Moon was presented as the fall play with the presentation of Spoon River highlighting the month of February. Specialists in duet acting, solo, and dramatic interpretation received many awards for their performances at numer- ous tournaments throughout the year. Eastwood was one of the hosts of the West Texas Invitational Tournament held December 4-5. ln March the thes- pians travelled to Lubbock to participate in the Texas Tech Tournament. Mrs. Cheri Hanson works diligently with drama students in preparing all productions including the senior play. Mrs. Ginger Cross helps students reach perfection for their performances at various speech tournaments. 92 .an Constructing a backdrop for the Homecoming dance are Pat Thomas, Paula Chumbley, Valerie Bracey, and Julie Daniels. Speech and drama students provided the decorations for the dance. mfs. was ' 777' K io r i M 5. Z 'Hn Mrs. Cheri Hanson looks over the script for a play to be presented by her drama students. Mrs. Ginger Cross offers constructive advice to senior Louis Barragan as he prepares for a tournament. Drama students Robbie Farley and Paul Polk enioy rehearsing a scene from the fall play pro- duction Teahouse of the August Moon. ACADEMICS 93 Sights set on broadening scopes x... N Pam McAnincl1 studies the control panel of an airplane that she hostesses for the aerospace class. A f Elias, In her trigonometry class, Mrs. Diane Reed keeps her sense of humor while trying to instruct. Mr. George Garner instructs Joe Pelletier on the basics of using a protractor. 94 rms' qv fi 1 , i-fi I I K . E, ,,, Sufi L. Mr. William J. Anderson sits at his desk correct- ing papers for his Algebra ll class. ' .. .Q-. ,ss ,M srr, sew f9 i 9 ' s :I -cl -5 'Ll' '3 'Z 'l O -v Mr. Roger Arnold uses the overhead projector in his geometry classes to break the everyday monotony. ,MW U ... M ' l l3 I4 l- Learning, that's what it's all about in the math department. The instructors in math department endeavor to broaden the scopes of learning by offering all possible courses to the student body. This year for the first time, a calculus course has been offered, bringing the number of mathematical courses up to eight, including the aerodynamics course. The chairman of the department, Mr. Marshall Nelson, is sponsoring a new Math and Science Club this year for those who are interested. The club's purpose is to broaden interest and appreciation for the fields of math- ematics and science. This year, Eastwood students did well in national standings on the SAT and PSAT tests. Some of the students in the math department showed exceptional ability and three went into city com- petition with other local students for honorary awards for their accomplish- ments. The same students also competed in slide rule contests in the spring. ACADEMICS 95 Mocl bocls and perfect profiles reveal results of physical exercise Exercise! Up, two, three, four, Down, two, three, four. Stretch down, touch the floor Cugh!J, now you're ready for some more. Keep going! Don't stop yet! We've got to keep you physically fit. Stretching, sweating, bending, and panting are a few of the lovely activities that make up the energetic PE classes. Accuracy, as always, plays an impor- tant part in the PE program. Basketball, football, archery, parts of track, and baseball all depend on it. We may never have a Wilt Chamberlin, a Bart Starr, a William Tell, a Randy Matson, or a Sandy Koufax, but we can claim Bill Seale, Tommy Elder, Shelly Nelson, Robert Amparan, and John Henderson, and after all, isn't that what counts? Because of the PE department, Eastwood has made quite a name for itself, and in the future, the name should be even greater. 96 Sternly concentrating on providing superior body condition, Coach Alden George pursues that aim UV! 9'd59 N Members of 2 X E MA .Q- the boys' physical education begin the day with exercises instructed by Coach Alden George. xv. klsixx X X . -NX 1 Y l Janet Olson exhibits her gymnastic skill and coordination as Mary Bombard, Sheila Rogers, and Miss Pam Seitz look on. Coach Todd Ware, head of PE department, takes time out to relax during Homecoming activities. ACADEMICS 97 11 organizations sometimes when it doesn't seem so cold does it seem like you should be getting warmer? are you going tonight? sure, if i clon't they won't let me back in. well, i guess i'll go too. is it worth the hassle? to be in a silly sosch club and feel the satisfactions, the ioyful reactions, and have the pressuring runarounds? in the cold. in the heat. at any time? h i think i'd go anyway . . . g because it's not because of the honor attached to it, it's because of the good feeling. i guess it's worth it. Council enlightens student body with goals of unit and solidarit With their main goal of obtaining unity and spirit throughout the student body, this year's student council kicked off the year by sponsoring a back to school dance. Making full arrangements for all Homecoming activities found the council frantically busy, with the Halloween Carnival and Operation Santa Claus following close behind. ln the spring the council undertook a new project during which they enlisted the students' cooperation in cleaning up the Eastwood area. Another new project was the Generation Gap Confrontation Group. On a voluntary basis, students and their parents met at school and discussed current problems openly. Eastwood-in-Elegance was the final project which rounded out the spring season for student council. Feeling that' the topics of pollution, crime, and drugs were of more rele- vancy to the student body, the council sponsored special assemblies concern- ing these topics throughout the year. Student council members are: Allen Sewell, Ruben Casarez, Lance Murray, Bill Beard, John Hendley, Conferring with Mr. Bob Bradley are student council officers: vice-president, Valerie Phillips, president, John Edmonsan, treasurer, Joel Hendryx, secretary, Janet Persons. John Edmonson, Valerie Phillips, Joel Hendryx, Martin, Davette Juen, Glen Crawford, Ann Haynes Janet Persons, Mitch Henderson, sponsor Mr. Jay Anne Markeson, Julie Francis, and Sheila Rhymes 'Mar . 100 2 l is-nm is naa- ww' Janet Persons and John Edmonson fake iime out to clown around af the Austin Convenfion. Joel Hendryx intently Winches the game wah- Manning the voting polls under ihe new syslem are Valerie Phillips and John Edmonson. ing to lake a good action shot. 4,2 w f f 1? E fs ORGANIZATIONS 101 ' ,W ,, Communication bridged by committee VJ, Faculty members of the coordinating committee consist of: Mrs. Rita Hughes, Mr. J.C. Gotcher, Mr. Fulton Robinson, Mrs. Bonnie Lesley, and Mrs. Dolly Picken. Relevancy hit Eastwood with the crea- tion of the Student-Faculty Coordinating Committee. Beginning at the end of the last school year, the committee was made up of members of both the fac- ulty and the student body. Twenty-four students and eight mem- bers of the faculty have met every two weeks to discuss problems arising on the EHS campus. The committee recommended exten- sion of the lunch hour, liberalization of the dress code, and publicized a resolution in support of student council campus cleaning efforts. Major subjects dealt with by the coordinating committee were the plan system in the counselors' office and censorship in Eastwood's library. The aims of this earnest, spirited committee are to bridge another gap and to elevate EHS educational systems. Mrs. Mary Dennis, Mr. Vic Clark, and Debby Yar- borough listen to comments made by another member. 102 'Nine-ww-t.-GL Mr. Bob Bradley reads over new suggestions made by the committee pertaining to the dress code. 2 1393? L., .-MQ Mrs. Bonnie Lesley, Sharon Crowley, Mrs. Rita Hughes, Carol Lee, Mr. J. C. Gotcher, Dennece Knight, Ed Shugert, and Ann Haynes. sz' f . A 3' ,gf f -- uw nv , as 'f Student council president John Edmonson ques- tions a policy being discussed. Sophomore representative Carol Lee poses a ques- tion on school policy to u 'witness' of the committee. ORGANIZATIONS los Club members are, BOTTOM ROW: A. Savino, J. Mogness, G. Johnson, F. Kolster, D. Clune, P. Freeman, V. Phillips, T. Glardon, S. Jefferson, F. Fitzgerald, M. Bombard, J. Bean, R. King, Club Counci Officers for Club Council are: Terry Shambrook, Ralph King, Ruben Casarez, and Fran Kolster. Club Council, under the leadership of the president Ruben Casarez, reviewed and approved applications for newly formed clubs. The council has approved the Rodeo Club, which was formed for the purpose of promoting horsemanship, and the Chess Club, which was formed for students interested in chess. Made up of representatives from each club, the Club Council is the governing body of all clubs and organizations. They function under their own con- stitution and have regular meetings. Club Council also approves dance petitions which require the signature of two officers and a sponsor. Other officers for the 1970-71 school year are: vice-president, Ralph King, sec- retary, Fran Kolsterg and treasurer, Terry Shambrook. The sponsor for Club Council is Mr. Jay Martin. Barbra Piram and Susan Price discuss the busin to be presented at a Club Council meeting. 104 E55 and Mr. Jay Martin. SECOND ROW: M. Richter T. Shambrook, G. Voelcker, B. Lantis, D. Hoockl D. Kelly, S. Price, M. Jones, J. Lewis, D. Cage B. Piram, C. McManus, S. Banta, S. Salazar: C. Medina, D. Currie, J. Hendley, R. Casarez, and B. Beard. TOP ROW: L. Murray, G. Craw- ford, M. Henderson, D. Lucky, J. Cullers, B. Bean, and J. Hendryx. I approves new club Homemakers promote FHA action Diana Blue demonstrates techniques to visiting mothers. Starting off the year with the election of officers, the Future Homemakers of America began a busy year. FHA sponsored a fashion show where the latest colors, styles, and fashions went on display. Later on in the year they had several guest speakers who emphasized such tasks as caring for the sick and social work. FHA girls took part in Beautify El Paso. This project involved going out and picking up garbage and trash throughout the city. Another FHA program was the family night pot luck dinner. Members partici- pated in this program by performing and helping serve the meal. The main program of FHA is the an- nual FHA week. During this week FHA is emphasized and encouraged. An an- nouncement was read concerning FHA Week that served to promote FHA. FHA is sponsored by Mrs. Billye Free- land, Mrs. Connie Steelhammer, Mrs. Brenda Jamison, and Mrs. Lanell Chambers. The Future Homemakers elected Dennis Oakley as their beau for the 'I970-71 year. FHA members are, FIRST ROW: Gloria Grainery, Yvonne Morales, Bonnie Cram, Kathleen Neely, Mary Beth Strangeways, Susan Buntyn, Karen Tucker, Sheela Hastings, Debbie Rheims, Debbie Bemis, Bunny Chavez, and Mrs. Billye Freeland. SECOND ROW: Sherri Kennan, Vanessa Moore, Sue Cates, Sharon McNeil, Crystal McEIveen, Kathy Baggett, Donna Lawson, Shawnette Lewis, Francie Fitzgerald, Donna Kelly, Sherri Norman, Debbie Strickland, Merala Tomlinson, and Carma McCroy. THIRD ROW: Heidi Baker, Sherri Vaughan, Linda Jones, Danette Rollins, Donna Aaker, Sherri Mitchell, Yvonne Carroll, Patricia Gonzalez, Cheryl Wohlgemuth, Laura Badillo, Sherry McDonald, Laurie Shoppach, Melanie Stenson, Karen Shouse, Martha Williams, Cory Butler. FOURTH ROW: Diana Blue, Marcia Mc- Donald, Linda Price, Lilia Alvarado, Patricia Rivas, Mary Jones, Diane Hoock, Mary O'Beirne, Kathy Frazier, Denise Creek, Valerie Phillips, Nancy Sewell, Debbie Hard, Cathy Varenkamp, and Sheila Hightower. FIFTH ROW: Mary Hol- lebeke, Carolyn Charles, Irma Puffer, Pam Matt- ingly, Sue Highsmith, Ami Smith, Debbie Bryant, Sheila Jefferson, Sharon Ciceri, Debbie Glover, Sallie Moore, Kerry Sneesby, Becky Noel, Marilyn Foltz, Kennie Sue Bowie, and Patricia Petrosky. ORGANIZATIONS ics Lynn Swain attempts to put to work her skills at making a party costume during class. Mrs. Lanell Chambers instructs Joyce Gade on or basic sewing step during class. 'IO6 2 M nun., Lynn Paxson watches as Mrs. Brenda Jamison helps prepare food for Daddy Date Night. FHA continues service projectsg aiding others becomes main goal .s H. , , F siisi ., g c as-F T ,,, crysy , by 1 ' A -- .-. s elif. Louann Gower shows delight while adding the finishing touches to a dress. if if 2 Q! Proiects are what kept FHA busy during the year. Homecoming found FHA busy with hall decorating while participation in the Halloween Carnival followed soon after. Daddy Date Night is a yearly proj- ect where the girls invite their fathers for a cookout and fun and entertainment. Open house had FHA busy showing exhibits of the different fields of home- making. The girls went to pediatrics wards at local hospitals and also visited rest homes to bridge the generation gap. Members had a child development lab where they planned the activities and cared for children of PTA members. They also served for the ELA banquet. Car washes, rummage sales, and service projects were the main goals of FHA during the year. The girls endeav- ored to keep up the traditional goal of FHA by serving the school. FHA officers for the 1970-71 year are: Sheela Hastings, Debbie Rheims, Valerie Phillips, Kathy Neely, Gloria Grainery, Mary Jones, Mary O'Briene, Linda Price, and Diane Hoock. ORGANIZATIONS 107 FTA members attend Ft. Worth convention Using funds earned from the annual presentation of the talent show, FTA members attended the state FTA con- vention at Ft. Worth. There they learned of new directions in teaching. Also contributing to the trip was the Ysleta Teachers Association which donated money to each Ysleta high school chapter of FTA. The talent show gave any Trooper a chance to show his special abilities to his schoolmates-and there was magic, music, and merriment in the gym on the day of the presentation. Susan Candelaria, club secretary, hurriedly takes ..,...--- minutes at an FTA planning session. - 2 . 5 A. . -. . if , , + M ff! r 5 ' - i - Q f f fi rf T ef ' ' s.,Mr7,.sr'z 7 w J,-5'fg,gE' ,, ,,., ll... vrrii- ,f- ,gmt we it.' f- - ,V A A5i?Eiz1'Ia37I9G3b+: L zwwfi b . ' I ,fwLC,i94fLL1ilgil5iisEfs .gif Miss June Carroll, FTA sponsor, confers wit club president Susan Prine about proiects. h FTA members are, BOTTOM ROW: William Ket- tering, James Bradshaw, Shawnette Lewis, Susan Prine, Miss June Carroll, sponsor, and Barbara 108 Prine. TOP ROW: Bill Griffin, Sherry Mitchell, Kevin Bentley, Jo Anne Novak, and SUSGI1 Rebecca Chavez, Theresa Sanderson, Mary Jones, Candelaria. Susan Prine is the president and Dena Thompson, Marie Mitchell, Leslie Dille, vice president is William Kettering. Health Careers aids school's ill Vicki Speck demonstrates her skills acquired in the Health Careers program. Promoting a career in medicine and health, Health Careers prepares students for future medical professions. Sponsored by Mrs. Frances Dixon and Mrs. Susan Funk, the club bought crutches for the nurse's office with money they raked throughoutthe yean Heahh Careem had a monHHy com- munity project of visiting rest homes in hope of learning the bask tech- niques in aiding invalids. Dudngthe HaHoween CarnNaL Heahh Careers sponsored the penny toss The club collected for cerebral palsy and other worthwhile causes. Along with their monthly proiect of visiting rest homes, the club also at- tended program meetings. They learned information concerning medicine and its fields from professional speakers. Members of Health Careers help Mrs. Dixon in the nurse's office in hopes of realizing problems that may arise in the field of medicine and health. Mgr, , Health Careers members are, BOTTOM ROW: Jeff Lawson, Mrs. Susan Funk, and Mrs. Frances Dixon. MIDDLE ROW: Nadine Neavin, Helen as---C. xg. ke.,-f..-'W Niglio, Ted Glazebrock, Patricia Sanchez, Paula Aydelotte, and Mike Purr. TOP ROW: Vicki Speck, Sandra Meinke, Laurie Ciceri, Diane -ss, 'Q we til' is Hoock, .lim Guthrie, Mary O'Briene, and Robert O'Bierne. ORGANIZATIONS 109 Members of TALA Clfei FIRST Row: Margaret Atkins, Mary Beth Strangeways, Marcia McDonald, ROW: Terri Olson Susan Candelaria John Williams, Barbara Prine, Sherri Mitchell, Tamara William Kettenring, James Bergmann. SECOND Leftault, and William Griffin TALA attends district con entions Throughout the year the Teenage Library Association worked on money raising activities along with service projects. The club started off the year with bake sales in the main hall. For Home- coming week, TALA decorated the library which put them in competition for the hall decorating contest. During the year the club attended two conventions. The first one was a district convention in October with a state convention following in February. When the Christmas season came around TALA sold a variety of perfumes in hopes of promoting the Yuletide spirit. They also adopted a needy family for whom they cared for throughout the season. TALA is a service club that works in the library aiding the needs of students and faculty. Mrs. Lee Firth sponsors the club. 110 Richard Jage takes advantage of library facilities offered by TALA Diligently working at Avis Rent-A'Car, Rose Mueller files company papers. , i f .WW ge! 'fs ,W Members of VOE are, SEATED: Nancy Hatch, Jane Scarbrough, Rose Mueller, Robbie Barr, and Sherri Dykes. STANDING: Jeanne Adauto, Joy Stallings, Sandy Carruth, Peggy Chavez, Peggy Porter, Linda Seelmyer, Frank Beard, Debbie Dor- ris, Kay Winters, and sponsor Mrs. Jean Hawkins. Nancy Hatch learns to use the duplicating machine during VOE classroom training. ia GE jobholders get training Under the supervision of Mrs. Jean Hawkins, Vocational Office Education is a work-study program offered to senior students who wish to gain expe- rience in office iobs. During class in the morning, VOE students learn to use different business machines. Another facet of VOE is the Office Education Association which is a national club to which all VOE students belong. Members undertook such activities as adopting a needy family over the Christmas holidays, attending area and state meetings in the spring, selling candy and taking part in the Hal- loween Carnival, Homecoming festivities, and the Clean-up Campaign. rw l X. I J lf' J i J! fe qi- rc ril .i 'N .1 N...- ff i DECA students acquire lou iness appreciation Striving for a better knowledge in the role of business marketing, distributive education students acquire experience both on the job and in the class- room. Under the guidance of Mr. Maurice Bartram they also participated in many school activities. Starting off with a raffle for two Grand Funk Railroad tickets, they then sold candy to raise money to send dele- gates to the state convention in the spring. DE students also took part in the Halloween Carnival and Operation Santa Claus. Over the Christmas holi- days they gave food to a needy family, an annual proiect. Throughout the year they took various field trips to such places as Standard Oil Company and El Paso Natural Gas. Senior DECA member Don Buie unloads stock in the store room of Winns. 112 Paula Smith takes inventory on merchandise T G 8. Y where she works part time. at l ,wean -,, ix xx er iii!! join 1 oc if yah XXX KU ,On ,f Mr. Bartram shows Ronnie Parrish, senior DE student, a plaque won at a district meeting. ,A Q-,W .4 J 'il . .., 3 . ,Si tg 352: .. S J ml fi' is Q -mn... At K-Mart Grocery, Richard Stanford stocks the shelves with Sanka Coffee. JFFSCE DECA members are, BOTTOM ROW: Daryl Jarvis, Terry Davisson, Robert Franco, Don Buie, Richard Stanford, Ward Waits, Gary Breit, and Billy Wright. SECOND ROW: Donene Doss, Linda Greaser, Carla Davis, Phil Qualls, Pam Neilson, Grace Nunez, Ronnie Phillips, Ruth Hanna, Mary Chappell, Linda Lide, and Mr. Maurice Bartram, DE sponsor. THIRD ROW: Mark Paschall, Ronnie Parrish, Roy Williams, Richard Narro, Craig Hays, DeDee Curry, Paula Smith, Don Penley, Mike Merrihew, and Harold Huff. FOURTH ROW: Cynthia Hanson, Ann Hanneke, Lora Widing, Robert Hudson, Lloyd Mabry, Larry Robertson, David Carpenter, Clint Collender, and Phil Zeman. ORGANIZATIONS ns Mrs. Katherine Teel, sponsor of Salta- trix, chooses iudges who rate the dancers on their ability. The girls with high ratings are chosen to be in the modern dance club. Tryouts are held at the end of the year in order for the girls to get their schedules coordinated. The members of Saltatrix perform for the beauty contest. They also appear in the Christmas assembly and dance for the entire student body. A lot of time, patience, and work go into each dance. Once a dance is learned practice is needed for syn- copation and rhythm. Modern dancers begin preparing for their spring recital about two months ahead of time. The girls are responsible for choreographing their individual dance, learning it, and designing and making their own costumes, all of which tie in with the music. Freshmen modern dance students develop routines in preparation for an upcoming production. ,s,iM.csW-ffww-f.::eW 'H' or odern dancers display abilit Modern dancers do the old soft shoe during the night performance of the Christmas program. .--, J:-rc. V ,J .. W- WM. Y, ....... H... ... . e Y, .- H-.. ...,.,. . , , , fs ' , K - 2 -.. 1... L n -1-'5 - ' - 1 mmm: rf , wales , u s -1-fs.sswMt.esf-mugaac, s. Members of the advanced modern dance class perform .Q up F S 3 Q Q Ar. 'N I so ' l Members of Saltatrix, modern dance club, are, BOTTOM ROW: Susan Ferguson, Barbie Dahl. SECOND ROW: Janet Watske, Holly Eurich, Grace Means, Sally Thrasher, Jeralee Dekle, Naomi West, Donene Doss. TOP ROW: Pat Wood, Judy Lewis, Myrth Lotspeich, Donna Kelly, Susan Done, Terry Sanderson, Debbie Bryant, Linda Ehrlich, Sherrie Mitchum. l Roxanne Brooks shows balance and determination while participating in a class exercise. if ff H A, i v-e.,,...v1'.. ,rm -vj 4... ski .3 WK 2:3 Wig' for the beauty contest to the theme of Jewels. Judi Faircloth, Susan Ferguson, and Judy Lewis spread Christmas cheer during the Christmas assembly ORGANIZATIONS 115 i Becky Anagnostou and Marlene Richter prepare for the faculty breakfast in the cafeteria. Coming to school at six o'clock in the morning and working out for basketball games were iust cz few of the activities that filled the year for the Blue Jackets. Work for the club began during August when members assisted at registration. The club ets at the Halloween ushered at open house. also sold tick- Carnival and the traditional Key Club this year. The Klutzes of Key Club came out on top by the score of 38-34. Blue Jackets revived basketball game with club cooking Christmas found the breakfast for the teachers at six o'clock on Friday morning. Blue Jackets also sold cokes at all the home basketball games. Sponsors are Mrs. Julia Daseler and Mrs. Mary Dennis. Blue Jacket officers are Pam McAninch, Martha Thore- son, Theresa Anderson, Debbie Cage, and Marlene Richter. 116 Blue jackets host 'Klutzes' in Cage tilt Sylvia Lopez gives Julie Francis directions during open house as Pam McAninch looks on. dw- i ,-f Q. fm Valerie Phillips dribbles down court as Bob Reese and Julie Francis follow in hot pursuif. h..,. 4 Members of Blue Jackets are, BOTTOM ROW: Lorrie Ciceri, Debby Baldwin, Patty Lane, Valerie loranc, Luann Smith, and linda Texfor. SECOND ROW: Pafricia Pefrosky, Janet Waizke, Lisa Wal- Ien, Robbie Venable, Kaihy Frazier, LoAnn Novak, and Valerie Phillips. THIRD ROW: Barbara Piram, Louise Loiselle, Debbie Tisdale, Carla Thomas, Bussie Hollebeke, Sylvia Lopez, Randi Rutherford, Belinda Gafford, Barbara Towns, Becky Anag- nostou, Carmen Alvidrez, Cecilia Sanchez, Diane mu- ,xl Aufrey, Vicki Walls, Paula Aydelofie, and Mary Powers. TOP ROW: Cathy Nebhan, Mary Hellman, Lucy Luna, Debbie Hurd, Janie Lujan, Mary Zizik, Julie Francis, Robbie Farley, and Sheila Rogers. ORGANIZATIONS 117 Artists' guild erects directional sign Members of Brush and Palette are, FIRST ROW: Susan Walker, Tamara Atkins, Sherry Mitchell, Hollis Henry, Lorie Ciceri, Kathy Fairbanks, Dotti Clune, Anna Rae Bamberg, Diane Schollitt, Karen Dyer. STANDING: Mrs. Marilyn Steele, sponsor, Anne Moreno, Carmela Tarantala, Susan Price, Brush and Palette members Karen Dyer, Patti Eason, and Lorrie Ciceri cut out silver stars for the Troop- erettes to use in the Sun Bowl game. Brush and Palette, the artists' guild, is in its eighth year of existence at Eastwood. During the fall the club members took up their annual Proiect of selling programs at the football games. For the Homecoming game they added decoratively to the field by paint- ing the symbol of the well-known Troop- er on the middle of the field. Another new project was the erecting of a direc- tional sign off the freeway, pointing the way to Eastwood High. Under the direction of Mrs. Marilyn Steele, Brush and Palette decorated for the beauty contest and E-in-E, regis- tered exes, sold Christmas ornaments, and Trooper-grams, all of which are yearly proiects for the club. IIB Terry Chambers, Cathy Torch, Susan Stepanski, Jackie Chambers, Susan Eason, Diantha Scheffler, Robbie Barr, Cindy Strainer, Debbie Fox, Beth Gallagher, Kim Jolly, Julie Kistenmacher, Debbie Tisdale, Anita Kushen, Patti Eason, Kathy Pitt- man, Sharon Wilkinson, Terry Sanderson. TOP ROW: Tony Roscoe, Greg Smythe, Mary Holle- beke, Randi Rutherford, Sheila Jefferson, Tom Bleakly, Jack Smith, Thelma Borrego, Belinda Hoover, Mike Flores. 1-and -1-27 Qsfl Fi - xr we fr' W N., 'K in K v -so 5 it A, -He is -'if' 4' Lv, 1 if xv' ff' , Ai. fx x A my kv 5 if , ,K , It 1' x x 'E ix! 1 L A ,i fs W is Brush and Palehe Key Club cleans stadium weekly 3, Key Club members for the 1970-71 school year are, BOTTOM ROW: Mr. R. Duzan. SECOND ROW: B. Reese, O. Martinez, W. Soza, K. Whitney, C. Gorman, L. Hicks, J. Edmonson, R. Burton, J. Key Club started a new pace for the school year by cleaning the stadium after home football games. With Bill Beard, president, leading the club they had a most successful year. Painting the cheerleaders' megaphones was just one of the many activities of the Key Club. They also decorated the fifth hall for Homecoming week. At the Halloween Carnival, they sponsored the rat race, nail drive, and softball throw. They participated in the litter drive at the end of the year. Officers for the 1970-71 school year are, president, Bill Beard, vice-president, Larry Hicks, secretary, Weston Reese, treasurer, Ricky Smith, and, sponsor, Mr. Robert Duzan. 120 Hendryx, R. Casarez, B. Beard, and R. Smith. Polk, S. Williams, S. Elrod, J. Hendley, R. TOP ROW: J. Garcia, K. Russell, L. Price, J. King, L. Murray, and T. Lyons. Mr. Duzan is Sanchez, J. Gale, D. Severs, R. Bracher, P. the sponsor for the Key Club. Bill Beard, president of Key Club, takes time out from cleaning the stadium. Making sure he tacks the crepe paper in the right place, Larry Price helps decorate Key Club's hall. .5 ,f at As part of a service proiect, Weston Reese helps clean the stadium after a home football game. While decorating the fifth hall for Homecoming activities, Lance Murray draws a poster as Larry Hicks is caught snoozing. ORGANIZATIONS 121 Lettermen sell to give to Troopers Every year the Eastwood Lettermen's Association maintains their tradition of selling spirit ribbons for the football and basketball games. During basket- ball season, ELA sold ball point pens with the Eastwood High basket- ball schedule on them. Halloween found the Lettermen busy with the carnival at their traditional sponge throw. Christmas time was one for the big money raising project as ELA members sold and set up luminarias throughout the area. During the summer the Lettermen reserved their Saturdays for aiding handicapped children by giving them swimming lessons. Upholding an annual tradition, ELA donated S500 from their treasury to the school for a scholarship. They earned the money for this by selling candy. Another gift which ELA gave the school was furnishing the athletic de- partment with new track shoes, sweat suits, baseballs, tennis balls, and basketball shoes. Athletes are eligible for membership if they have received a letter in ony sport. Then they must pass a strict initiation in the fall. Helping the children with swimming are ELA members Van Townsend, Tommy Picken, Rick Coon, and Larry Stead. 122 ELA officers are, BOTTOM ROW: Chris Regan, John Cullers, Bob Bean, Lonnie Nordell, Robert Egge- meyer. Sponsors are, TOP ROW: Mr. Alden George, Mr. J.C. Gotcher, Mr. Doug Littleiohn, Mr. Todd Wore. Ms .-.-wwf . W WI- .' 11 M-1 . vfffvs. Y mm ,. , r ,. M we .RYE I 'ii kk .5 k,.k1.. 2 I K ik Vi kk is Q Y I-g, ..kL .ywit .-.,,k :V ...E isssrs solss Ml' 'Fi 1 TH :-Ifxs5:,..EF::: ::s 'f c.3,.::L:.2:L: 'N V P 1 ' eg K, .. .- ,M k V1-5,,:s:v,gL-Y gk: i..fw,s,., L, .... :,S',L3L, ,,,.,,,,,Km.. ..M.s., .L.,,,,s.s, .. V. ,, . ..M,...,s.., me an - 'vllress ,T , 3 New initiates into ELA are, BOTTOM ROW: Roderic Lee, Mike Hill, and Jim DiAngeIo. STANDING: Randy Eggemeyer, Tom Halleck, Gary Brinker, and Walter McCoy. ABOVE: David Coast, Gary Hedrick, Dennis Koehler, Steve Steele, Scott McGriff, Mike Bertka, Tony Rasco, Lenny Mullins, Oscar Martinez, and Paul Regan. David Coast sets up Iuminarias on Christmas Eve. At the ELA sponge throw Coach Alden George calmly blows a bubble. ORGANIZATIONS 123 ettermen donate weight machine, X X X W sg, , Paul Regan shows endurance as he uses the . . . ' ht h' . Steve Steele, Randy Eggemeyer, David Coast, and Paul Regan listen during a meeting. welg mac me T543 I J 2 Members of ELA ore, BOTTOM ROW: Pat Hender- Regan, Larry Stead, Ricky Smith, Greg Shaffer, Randy Anderson, Dan Warwick, Larry Hicks, son, Bob Bean, Melvin Caraway, David Winholt, Glenn Villarreal, Olon McClendon, and Ted Richard Burton, Tommy Picken, Mike Aanonsen, Glen Crawford, and Gary Hughes. SECOND Olson. TOP ROW: Lannie Nordell, Mike Miller, and Gordon Dunaway. ROW: John Cullers, Robert Eggemeyer, Chris 124 provide Eastwood new equipment Other members of ELA arep BOTTOM ROW: Gorman, Van Townsend, Dennis McElveen, Argeanas, David Crenshaw, and Rick Coon. Dominquez, Ken Lane, Bucky Carter, Jesse Whittenton, and Rick Surratt. Highlighting their year with the ELA Follies, the Lettermen began practice early in the year. For the Follies, ELA presented the beautiful side of the Lettermen, as they posed as everything from ballet dancers to senoritas. ELA bought the school a new weight machine. The machine has over fourteen different muscle-building devices on it. ELA has provided Eastwood with vari- ous other equipment throughout the year. They have kept up this tradition of pro- viding the school with many needed facilities. Sponsors for ELA are, Mr. J.C. Gotcher, Mr. Doug Littleiohn, Mr. Todd Ware, Mr. Joe Varro, and Mr. Alden George. Rick Porter demonstrates curling exercising on the weight machine which ELA bought. ORGANIZATIONS 125 Dorothy Gibson shows expert ability in balancing on the parallel bars while Debbie Fox watches. Elba Gonzalez and Debbie Mizer demonstrate a duet routine used in the district meet. Members of Gymnastics Club are, SEATED: Marcie Cross, Dorothy Gibson, Dawn Natey, Debbie Fox, Rhonda Simmons. KNEELING: Audrey Wilson, Renee Davis, Mary Jones, Patsy Carreon, Janice Pavoggi, Kathy Lynch, Teresa Martinez, Mindy I26 Clark, Tammy Atkins, Jenny Picken, and Donna Aaker. STANDING: Sponsor, Mrs. Pam Pippen, Janet Olson, Brenda Bolton, Barbara Prine, Ingrid August, Mary Bombord, Marilyn Van- Cleave, Denise Steele, Kathy Buckles, and Diane McCurrie. TOP ROW: Debbie Mizer, Cindy Sanetra, Margo Urey, Sheila Rogers, Nancy McCarthy, Mark Moore, Tom Arnold, Tom Cur- rie, Michele Mason, Yvette Collins, Elba Gonzalez, and Patty Cahill. G mnastics develops stamina, co Coming through in their second year with outstanding achievements, the mem- bers of Eastwood High Gymnastics Club displayed their talents in both area and district meets. With the main purpose of encouraging extra-curricular activities, the club also helped develop endurance and coordination in its members. Under the direction of Mrs. Pam Pip- pen, the members practiced three times a ordination week and also during their regular class period. The club also participated in gymnastics clinics held by the YWCA. Helping pay for their gymnastics equipment, the team raised money by holding bake sales, rattles and selling stationery. Highlighting the year was an out-of-town meet in Midland and a demonstration put on for the stu- dent body in April. Rhonda Simmons practices o flip over the paral- lel bars while Debbie Fox spots her below. Showing an excellent display of balance and coordination, Cindy Sanetra works on the balance beam. ORGANIZATIONS 127 Concerts reveal orc:hestra's skill Exemplifying their musical talent, the annual Christmas concert. The orchestra many honors, including the all-state members ofthe EHS orchestra excelled also participated in the area and orchestra award received by Greg in many performances. state music contests. Shaffer. The orchestra conductor is Included in their schedule was the Members of the orchestra claimed Mrs. June Gingery. Mrs. June Gingery conducts the orchestra in play- Officers of the orchestra are, BOTTOM ROW: Myrth Lotspeich, treasurer, Tammy Atkins, secretary. TOP ing a Christmas carol during their concert. ROW: Greg Shaffer, president, Alfred Hiiar, sergeant-at-arms. Orchestra members are, BOTTOM ROW: Greg Kettenring, Tammy Atkins. SECOND ROW: Lacey Hard, Alfred Hiiar, Randy Sellers. TOP ROW, Shaffer, Linda Slater, Butch Villarreal, Ann Mordecai, Sylvia Gonzalez, Martha Navar, Lisa Mrs. June Gingery, 'Don Robb, Keith Pickett. Martinez, Lorraine Baldwin, Myrth Lotspeich, Will Grimes, Laura Pleasants, Karen Tucker, Debbie .NOT SHOWN: Christy Romo. 128 , Wy, :ssl f ff - .5 I ' . QI 0 as . ,ffl 425 I ii I si: :B I 1 I I V gi t K 1 gr - Q A? ta A 5, A -I V ,, 1 it -nf. .gn ... , 155' Tie 'i-se Qt? it 'tv . . - so se. its - rs.- ?i I' . -F 5 1 f- - A we 'sig' li '?' . ' . . , . . , , - -., QI' A . , A .. . ,, i . B . 4 1 . Q . i . X l M , y , B V T: V . 7 , 4 Q S 'Q J 'FJ 4 tg 5 gk . - Ffh. Avg. - A .. 'xg ,O ' Q - . E I .1 3 s if l. 't-Ql7I'f'J '5Q.?I '- . I yi I Eg .5 ugh! K xi! y' ali.,-: A W Q .i , e I . W - ,- g a t - f I i Z. .3 s i t . . H ' , I ? ' '2 Iii. .ie.r. 3 r if I I . 3 4 ft. 'Q I rf' ' f r 1' wiv . Z 2: A Q ' trs I Ve . W . is 5 I L ' l . I..e B l M I. 1 4L A I T I. if . Q J 3' . iill I - M M . I Q 1 P , A E IJ 1 ls, Band members are, BOTTOM ROW: J. McCoy, M. O'NeiIl, B. Johns, R. Jones, B. MacDonald B. Banner, S. Robinson, G. Daseler, L. Baldwin S. Bartram, G. Pendergrass. SECOND ROW: I Cravey, E. TGPP. C. Stuart, C. Stephens, E. Huizar, M. Grafton, M. Cruncleton, K. Swanson, J. Ricks, B Grie. THIRD ROW- M. Pugh D . p . , . Gallegos, G. Fonner, L. Wright, L. Hawks, D. Uroda, E. Thomas, P. Wallace, R. Martinez, B. 1 Belknap, T. Lyons. FOURTH ROW: G. MacDonald, E. Shikiski, R. Booth, A. Armendariz, S. Oswald, B. Wright, C. Donovan, R. Bruce, J. Jackson, S. Hurd, R. Burton. FIFTH ROW: R. Page, A. Luna, A. Armendariz, L. Garcia, C. Hill, D. Wil- liams, R. Venable, S. Wilkerson, D. Hurd. SIXTH ROW: K. Olson, D. Prine, C. Huizar, L. Luna, A. Hendley, R. Meyer, L. Bain, M. Calanche, A. George Pendergrass concentrates on his music while simultaneously thinking about the marching routine. Carmen Alvidrez was selected band sweetheart. Drum major Mike Woods leads the marching band. 1 ,-4sa Mf?Lfff2 Wvf.QffiLmsJmf'.vs-.fails7 Hiiar, J. Dzubinski, C. Alvidrez. SEVENTH ROW: S. Armendariz, B. Hall, D. Bruce, D. Haynes, D. Manning, D. Lamothe, E. Huizar, M. Thoreson, C. Morales, C. Calanche, A. Deckert. EIGHTH ROW: P. Visco, R. Alderete, R. Nash, J. Novak, C. Richards, E. Chavez, J. Huckabee, S. Sampsell, M. Covey, W. Hardy, S. Stuart. TOP ROW: J. Gale, N. Knoppers, G. McNichol, R. Fernandez, D. McBride. Band cop top ratings in contests Under the watchful batons of new bancl director Mr. John Faraone and drum major Mike Woods, members of the Trooper marching brigade proved their ability and exhibited their talents in various marching contests. Working throughout the summer on intricate marching designs, Trooper musicians developed a sound and a marching technique that fascinated ca- pacity crowds during halftime shows at Trooper football games. Other activities of the band in- cluded playing for the Sun Carnival Basketball Tournament and marching in the Sun Carnival Parade. Five members of the band were eligi- ble for all-state band tryouts in Lubbock during January. They were John Dzubin- ski, Ricky Miller, Keith Pickett, Cindy Richards, and Ellen Thomas. ORGANIZATIONS 129 Trooper provide enie Majoreifes Jenny Picken and Sharon Chambliss rfainmenf of fhe Halloween Carnival. K 4 -'Sq gg., -..wf-q.w::f-Q's- L ' ffvifzw-2,-, J so X - ff 1 ,gi 9211 -' ' . : i- ... 'E 52 . I 1 S 1 fr-1 . vegas ,S .am f.s1e?'ff2'. me . , rgasiizmfgai . ,iflifif 5523 J., ? gl f nla a ,, laan ' no .Q43x.fwv A,o lalr ,..vQQ5 rarr 535 , 2 . fQQf-w.., wieiffkdi eQwMg4y11W 531, 1 M, ' S .Wg Q X., Q -all Smilji 5 4? Q 1 X 2 E 5 QQ 5 r if 2 -wx.. ,Q W , S Z ,. 7556.1 .- L 3 1251 is L. iff 1' R yif wil 113.5512 . my spy fl? Q mgfixf S , .I v yr . :- -:rs.,,.,,iiQ12'12isk Q . 1. L.. 1. we-.f5g2fg2 3, . . r-w..U,:xrf-31.33 ii ., , L ye . , . we .13-f..,fff.Q.-,Z . f A-,. V, E, , .Qin-53 1-rqfEESf:jgLEfE'EafG' - apps k ' rg of-7,.a-ff- .5-.5 vm.. .. . ' S 6 -gi ? 15: S w flsiii gizsfi fsfex if , .1-.Q 3' : r , a' xx E xxx 5 :g wx , F.-2' 1:-sf.ms,S .. l end. m53f .sl W ,, ,max 5,- ,'?.v, or if f 2. 59 r Q :'Q , :.-:,.: ,, ..i: :5? 1 File f 52.15 PY:-. - :inie- .v , '15-,,, 'Qi' l l in . .. . me ., q..m.r3af4w-. . . .- gifs 5:-.. N .: :-If-V: 'lr' 'I , .mm .s K .... W' f ' ' giwmwm ' Drum moior Mike Woods looks over the Trooper band. W-J. .V A.g, .. A .H ..., . Q . X. Q we .5 ? , ogg.. lie 3 . E ire iii! band entertains at halftime shows Happy smiles flash from Trooper band members as they finish a halftime show. Mike Woods proudly conducts the Trooper Band as they finish an outstanding halftime show. Showing precision marching cmd pro- viding excellent entertainment, the Trooper marching band showed su- perior marching skills. The Trooper band added to the football games with their halftime shows. Marching along with the band were the maiorettes who practiced daily in order to display their rou- tines at the games. Band members practiced every morn- ing before school during football season. Strict practice is what enabled the band to perform the complicated precision de- signs and marching routines. Leading the band on the field was Mike Woods, drum major. Mr. John Faraone acted as band director. Performing with the Trooper Band are the Eastwood High maiorettes. KNEELING: Sharon Chambliss. STANDING: Jenny Picken, Kim Rampey, and Patsy Hooper. ORGANIZATIONS 131 Cavaliers are, BOTTOM ROW: Bobby Mullins, Steve Nunn, Paul Polk, Eddie Cooper, Melinda Markel, Alice Wasson, Linda Johnson, Alice Lar- son, Vanessa Moore, Robin Johnson, Carolyn Moody, Evelyn Tiffany, Judy Cruce, Krista Knudf son, Andie Richardson, John Nevarez. SECOND ROW: Tom Gale, Bob Banner, Gordon Duna- way, Jerry Griffin, Cindy Combs, Patricia Moore- land, Robbie Venable, Laurie Wilcox, Laura -McNeely, Sara Smith, Janet Watzke, Brenda Nichols, Kathy Kistenmacher, Lisa Stell, Susan Townsend, Lillian Taylor, Richard Sabitini, Mike Jones, Martin Bottier. THIRD ROW: David Craw- ford, Ronnie Bowen, Janey Larson, Renee Davis, Kim Smith, Leticia Vilchis, Ann Clark, Alice Kus- serow, Susan Ferguson, Terrie Clements, Cris Lester, Terry Shambrook, Mary Stanfield, Joel Hendryx, Danny Terrazas, James Murray, Kendall Larson. TOP ROW: Kevin Keith, Mark Crocker, John Edmonson, Von Watson, Debbie Burns, Cathy Hughes, Debbie Larson, Donna Moore, Vicki Speck, Mary Wheeler, Jerri Lee Deckle, Jenny Picken, Ronnie Lange, Chuck Forbes, Jerry McDaniel, Ed Smeltzer, Rick Jage. Symphony enhanced by Cavaliers Captivating audiences with their music, the Cavaliers filled the 1970-71 school year with performances ranging from La Musique to singing with the El Paso Symphony Orchestra. Singing with the El Paso Symphony Orchestra was the highest honor re- ceived by the Cavaliers. They were the first group to be invited to sing twice with the symphony. Other performances by the choir in- cluded the beauty contest, Home- coming, the National Honor Society induction, and La Musique, the an- nual spring concert. ln addition to these performances, the music of the Cavaliers composed a large part of the Christmas assembly. For the first time the band and the choir performed together. The Cav- aliers also sang at the El Paso National Bank during Yuletide. The choir is directed by Mr. John Prestwood. With his usual flair for showmanship, Mr. John Prestwood patiently instructs the choir. l32 'Ss H3 wg, r is E 5 lk . . it . gs ' '1 ifi 5 2 if cssc A A 1 i s is Choir accompanist Bob Banner listens for Mr. John Presfwoodls cue for him fo begin' Under the direciion of Mr. John Presfwood, the choir performs af the annual beauty coniesf. f In preparation for ihe Christmas breakfast, fhe ' Madrigals rehearse their choral reperfory. ffesswg in . 9: 6 X134 ORGANIZATIONS usa Cadets, Melodettes, and Gleemen ing in annual concert, La Mu ique EE Gleemen for the 1970-71 school year are: BOT- T. Glozebrook, M. Durr, D. Waye. TOP ROW: J. Venoble, T. Villodas, M. Baron, J. Murry. TOM ROW: F. Mullins, T. Milholland, XM. Quimby, J. McDaniel, R. Carbaial, C. Chesbro, M. Farley, Ah .. Am, Gleemen work hard at perfecling numbers for choir clinic and spring concert. 134 Melodetles are: BOTTOM ROW: L. Marsh, C. Flerro, J. Townsend, D. Walker, A. Maslerson, L. Nevarez SECOND ROW: M. Tomlinson, A. Beauford, S. Cannon, C. Nichols, C. Hamlell, S. Rhymes, T. Sieed THIRD ROW: P. Warren, B. Budens, G. Grimes, A. Bandberg, D. Cole, S. Marble, C. Sabin, D. Nelson TOP ROW: V. Wallen, V. Bigler, L. Eurich, C. Cameron, S. Maisfer, B. Doolittle, K. Freeland, D. Blue N. Moreno. 1 3 I 4 1 E 7 'il .. ,il N .- 1' KST . , 4 . Nw Perfecting their talents, Cadets for the 'I970-71 McGrath, M. Williams, D. Stricklin, R. Terrozas, P. Artaleio, D. Frydendall, E. Conroy. school year are: B. Eubanks, C.fStricklin, W. D. Lane, I.. Price, D. Kelly, C. Ricci, L. Bowers, - Q, 5? ' it E E E The Meloclettes do voice warm-ups to loosen up before practicing their songs for the spring choir clinic. Being a member of Eastwood's Cav- aliers is a great honor but singers must work to attain this position. There are three groups of beginning choirs. The Gleemen, composed of boys, and the Cadets and Melodettes, composed of girls. Students must be a member of one of these groups in order to have a chance to belong to Cavaliers. These three groups participated in the annual girls and boys choir clinic sponsored by the Ysleta Independent School District. The annual spring con- cert held in May is presented with the help of these three beginning choirs. Mr. John Prestwood does a iob of dedication in directing these three groups in preparation for their participa- tion Cavaliers. The focal point of their year is Cavalier tryouts. It is here that all they have learned throughout the year must be put to practical usage so that they may thereby attain the honor of being a Cavalier. ORGANIZATIONS 135 Madrigal members are, BOTTOM ROW: Robbie Venable, Laurie Wilcox, Jane Laman, Terry Shambrook, Robbie Farley, Debra Burns, Judy Attentively listening tor his cue, Rick Jage antic- ipates when he should ioin in the chorus. Chosen by audition from the membership of the Cavaliers, the Madrigals and the Sextet sang at the extra-curricular func- tions. Providing entertainment at the Na- tional Honor Homecoming tea was the Sextet, while the Madrigals sang for the Blue Jackets at the Christmas breakfast. 136 Cruce, Melinda Markel. TOP ROW: Ken Larson, Jage, Von Watson, Jerry Griffin, John Edmcn Mark Crocker, Joel Hendryx, Bob Banner, Rick son, Bob Mullins. Madrigals, Sextet sing at breakfast, HS tea L E ,,.. rrr, ,,r,ts Sextet Moore, NHS H Adria omeco members m n R ing are, BOTTOM ROW: Sara Smith, accompanist, Krista Knudson. TOP ROW: Vanessa ichardson, Janet Watzke, Cris Lester, Carla Thomas. These girls performed at the tea, Pom Pon Girls buoy Troop pirit is 1 1 4- 51, 9 s iii ' 1 , , v . A . Halloween Carnival fun finds Robin Hoff and Pom Pon G 'l5 Pefkmg UP enfhuslasm In the Linda BUffl'19f0N, AND Savino, TWCY l-Und, R0bin Andie Richardson working the roulette wheel 57'-'den' bodt' we Cl-OCKWISE Debbie SPUUSY Hoff, Andie RiCl GfdS0nf and Renee 5e9UPell- Beginning the year by attending a train- ing camp in Flagstaff, Arizona, the Pom Pon line danced at all football games and pep rallies throughout the season. The girls took an honorable mention ribbon in the final competition in Flag- staff where they learned their basic routines through a week of instruction in dancing techniques. Assisting in the halftime activities at the Sun Bowl, the Pom Pon dancers participated as piiiata girls. As a reg- ular activity during the Sun Carnival, the girls danced at the nationally tele- vised basketball tournament. Selected by judges last May, the girls are under the direction of Mrs. Barbara Prewitt. Keeping their smiles and beat to the music, Pom Pon Girls Ann Savino, Pam Gagnon, and Renee Segapeli perform during a pep rally. l37 The Troopereifes dance fo fhe music of the Trooper band while performing a kick rouiine ai 'the Andress football game 0 o I rooperettes uphold tradition ' Leader Robbie Farley leads ihe Troopereiies in the New Year's Day parade. Nina Gore 'teaches u basic step during 'tryouts which are held in January. 138 Patty lane takes advantage of her means of communication during the Sun Bowl game. Upholding their annual tradition of performing at halftime during foot- ball games, the Trooperettes once again marched on in splendor. Under the direction of Mrs. Barbara Prewitt, the Trooperettes performed at all of the Eastwood High School foot- ball games throughout the season. The Trooperettes once again per- formed in the Sun Bowl halftime along with other El Pasoans. They portrayed Spanish dancers, Indians, and cowgirls. Performing at the UTEP basketball tournaments was another tradition that the Trooperettes kept up this year. The Trooperettes were very active during the year raising money to pay for props. They sold spaghetti dinner tickets along with the Booster Club. During the Halloween Carnival the girls had the sweet shop and the bean bag toss. Leading the Trooperettes this year was Robbie Farley, captains were Deb- bie Miller, Shireen Baird, Carolyn Moody, and Dolores Pellicano. perform during Sun Bo I halftim 9 1 f 4 .. 5 , I 1 I 4 4 I + . i - The Trooperettes listen during a pep rally. They perform hand routines during pep rallies. M I W ,I . I . 5 V if ei! 4? With a beaming smile, Mary Garza stands at attention before the New Year's Day parade. ORGANIZATIONS 139 Sponsors march with precision ' . W, 1 isf'iIfc 1 assassins- -ffA- ' A 'wwf'- eau ng-ss , ,www ix-W W ,Nuys Mag' ,auunllunidl nnnqyraniiih nmnlnssnbnr .pw--our 1 . A .M Members of 1970-71 Sponsors Corps are, BOT- TOM ROW: Debbie Yarboroughp SECOND ROW: Sue Phillips, Carmen Alvidrez, Diane Alderete, Louise Loiselle, THIRD ROW: Carla Thomas, Barbara Piram, Anita Kushen, Sylvia Lopez, Sponsors concentrate on practice for a drill meet. 140 'W FOURTH ROW: .Ianet Persons, Irene Paz, Toni Glardon, Valerie Watson, FIFTH ROW: Valerie Phillips, Becky Anagnostou, Diane Olson, Su Stuart, SIXTH ROW: Trina Williams, Eydie Gris- wold, Randi Rutherford, Mary Hollebeke: SEVENTH ROW: Kathy Breton, Pam McAninch, Julie Francis, Jocki Magnessp TOP ROW: Georgie Ferguson, Davette Juen, Teresa Anderson, Anne Markeson. Colonel Debby Yarborough leads the Sponsors in last minute practice before a drill meet. w'A eef4 me ., 7 Carla Thomas takes time out from marching to fix a cup of coffee for Sarge Kittilsted. Sponsors practice for meets Under the leadership of Sponsor Colonel Debby Yarborough, the 1970-7'l ROTC Sponsors Corps participated in drill meets throughout the El Paso southwest. The Sponsors Corps started a new tradition by performing their precision routine for the student body at the last pep rally. The twenty-nine member marching unit participated in the Burges Invita- tional Drill Meet January 'I6 in the El Paso Coliseum. Other marching contests that the Sponsors participated in included the annual drill meet held at the Univer- sity of Texas at El Paso on March 6 and the Las Cruces drill meet held during April. The Sponsors also performed for the federal inspectors during the an- nual inspection held March 17. Besides marching in drill meets, the Sponsors roused school spirit by marching down the halls and chanting cheers for pep rallies. Debby Yarborough is attentive at parade practice. Jacki Magness, Julie Francis, and Anne Markeson march at the last pep rally of the football season ORGANIZATIONS um Maneuvers practiced by companies Guiding the military science depart- ment is Sergeant Theodore Kittilsted. This department provides instruction for boys who wish to train for military service. Among the topics which the cadets are taught are discipline, training, and leadership. Discipline and military con- duct are particularly important, as is the ability to carry out orders. Cadets are also instructed in marching, planning maneuvers, and rifling. The Color Guard is a special activ- ity in which ROTC members may par- ticipate if they so desire. The Color Guard members present the flag at football games and at other ap- propriate activities. X x Members of ROTC squint into the sun while waiting for orders during parade Practice. 142 i il 1 .rl. , r ' . of T' lik .pq is .,,,sE Color Guard members are Craig Hays, Jim Agee, Guy Decker, Charley Prine, and Harrell Davis . QSQSTXWEZQMBT l Members of ROTC staff are L. Mullens, T. Halleck, M. Jones, P. Hosey, J. Daws, J. Bass, and K. Blue. RCTC members pass in pections Headquariers Company are, BOTTOM ROW: P. Piifarcl, S. Hvzidak, J. McCoy, O. Diordievic, G. J. Paz, N. Simon, K. Brooks. FOURTH ROW: H. Davis, J. Nevorez, M. Webb, T. Horn. SECOND Delgado. THIRD ROW: T. Gale, K. Jury, M. Zais, K. Cook, D. Swearingin, L. Bohanon, S. ROW: C. Shouse, R. Sabaiini, R. Menser, P. Pynes, Keffer, R. Lane, G. Cooper, H. Ho, T. Small, Williams, J. Scheie, R. Jaquez, M. Curtis. R. Hogue, D. Neavin, D. Cook, R. Gardea, R. ORGANIZATIONS 143 WW s f i:::.:l i I i ' : 3 Members of company A for the 1970-71 school year are, BOTTOM ROW: M. Grisham, R. Leftault, D. Verbeke, J. Jackson. SECOND ROW: R. Prather, L. Smyth, J. Garcia, P. Davis, J. ROTC prepares boys for promi i Daseler, T. Minfer, J. Osburn, M. Baggett, R. Hill, W. Kleinschmidf. TOP ROW: L. Hosmer, L Scoggin, D. Bosselman, J. Bohanon, P. Swear- King, R. Malphurs, J. Agee, J. Ferguson, J ingin. THIRD ROW: B. Sproull, L. Perkins, A. Trower, D. Newman, J. Pierce. Stanulonis, D. Thomsen, P. Holt, G. Grisham, R. I1 Members of company B are: BOTTOM ROW: water, R. Huscroft, C. L. Slaughter, B. Leftault, Beeler, 5- Hvlff D- FIOYGS, -l- Hendl'iCkS0n, D B. Mullins, L. Dresser, M. Oates, iM. Barnett. B. Loving, J. Garcia, J. Fout, R. Malphurs, R. Treadaway, D. Craft. TOP ROW: S. Hrdlicka, D SECOND ROW: J. Lawson, F. Mullins, D. L. Rain- Phaup. TH'lRD ROW: K. Vanzant, R. Smith, M. Olivas, D- Dial, G- OHVUTCS, A- l-Una, G. Decker 144 1 1 j I a LI The companies practice precision as they march in formation during weekly parade practice. The wearing of the honor star by ROTC cadets sets Eastwood's ROTC department above many others in other school dis- tricts. The honor star signifies outstand- ing accomplishments in the Annual Fed- eral Inspection. Preparation for the A. F. I. is made during the weekly parade practice held during the second half of sixth period on Thursdays. ROTC is a preparation for the future. It is meant to develop orderli- ness, precision, patriotism, personal hon- or, and to instill discipline and respect for constitutional authority. Along with all of these qualities, ROTC training also provides a certain amount of military training which has proved val- uable in the future as former ROTC students enter the armed forces. Sergeant Theodore Kittilsted is in charge of the ROTC department and trains the companies for competition in the A. F. I. and all other inspections throughout the year. future with great opportunities Members at company C arep BOTTOM ROW: J. J. Zielsdorf, J. Cullon, E. Beeler, J. Hass, C. Page, J. Daws. FOURTH ROW: M. Walder, L. Behnke, J. Leftault, E. Larson, R. Adams, H. Gardea, J, Bertka. THIRD ROW: J. Smother- Davis, P. McGinnis, P. Davis, L. Reed. TOP ROW: Pickering. SECOND ROW: J. Tiffany, R. Ritter, man, B. Van Matre, M. Silkwood, G. Lane, R. C. Pryor, W. Cude, M. Burris, J. Rutten, H. Davis. ORGANIZATIONS 145 ew Eastwood High School ROTC Rifle Team for the 1970-71 school year includes: T. Halleck, S. Holt, P. Brent, M. Grisham, and L. Mullins- Mark Oates supports o company flag while being inspected by Lonnie Dresser and Steve Smith. Ready, aim, fire! These are the com- mands frequently heard by the members of the Eastwood Rifle Team. The team has competed in meets against Ysleta, Bel Air, Parkland, and Riverside teams this year. They have shown themselves to be quite efficient with their standard .22 caliber rifles by coming out on top in the maiority of these competitions. This year's Drill Team has competed in drill meets at the coliseum, on the UTEP and NMSU campuses, and they hosted a meet at Eastwood in April. The purpose of the Drill Team is to teach precision marching and quick response to orders. The Drill and Rifle Teams are two of the most specialized units in the ROTC Department. They prove that practice and preparation make for perfect performance. Rifle and Drill Teams contend with YISD ROTC units in '70-'71 ' ,,....., ,, V , f. .. .Q , . ,.. - PM M L,,..,..-. mieisw-f+::e.i6'nfs41iiyee'w'2N 1' 'f 4' Ml , ., V , , ,VA , , , ,, ici qfkgqn . fa -3713 .7 ,Q , ,K , LY ,.,ff,,,..ff3-WAQ1 'jfs' 'f ' I K' .a . , 'f Q' ,. x Jr Q, 21 1, Members of the Drill Team are, BOTTOM ROW: L. Dresser and J. Daws. SECOND ROW: R. Stan- ford R. Lefault J. Agee J. Lefault and J Dasler. THIRD how. s. smash, J. Tiffany, Lf ROTC Cadets take a break at a parade practice. Reed, and E. Larson. FOURTH ROW: J. Lawson, H. Ho, J. Bertka, and K. Brown. FIFTH ROW: P. Davis, J. Garcia, R. Sabatini, and R. Prather. SIXTH ROW: B. Leftaulf, D. Zais, R. Gardea, and Toni Glardon selected Drill Team sweetheart. 37 'Q 1,4 ff' J-5' G. Dicker. SEVENTH ROW: D. Rainwater, L- King, S. Hrdlicka, and J. Gardea. TOP ROW: M. Bag- gett. They also are under Sgt. T. A. Kittilsted. 1 Chosen Rifle Team sweetheart is Irene Paz. ORGANIZATIONS 147 Latin Club holds Roman Starting off the year with a reception for interested students, the Latin Club chose its new members. Membership was open to Latin students and any- one interested in the classics. ln October, the initiation took place which was followed by a barbeque in which new acquaintances were met. The club participated in the Halloween Carnival with their record roll. Christmas brought about the selling of gifts from Pandora's Box and the Christmas toy drive. On the ldes of March, the Latin banquet Club had their annual Roman banquet which is the highlight of the year. ln April ci banquet and dance were held which was the last event of the year before the election of new officers. Mrs. Elizabeth Dow and Mrs. Susan Younguist sponsor the Latin Club. Latin Club members ore, BOTTOM ROW: Mrs. Susan Youngquist, Steve Lubecki, John Hogan George Baker, John Tiffany, Bonnie Cram, Jimmy Bean, Karen Dorris, Terry Baldwin, Janet Club officers are, Martha Thoreson, secretary, Kathy Mosher, president, Mark Crocker, historian John Lyons, club council, Debbie Hurd, vice- president, Randy Menser, treasurer. 148 Wolf, Bill Roberts, Suzanne Pfoutz, Desi Overton, Sue Cates, Cindy Stricklin, and Mrs. Elizabeth Dow. TOP ROW: Von Watson, David Candelaria, Mike Jones, Jimmy Thompson, Don Treadway, Karen Dyer, Chuck Carter, Louie Barragon, Jerri Dekle, Shirley Mosher, Jane Engler, Susan Collier, Sherri Vaughn, Cheryl Bartlett, Cathy Donovan, Peggy Meacham, Dennise Prine, Dennise Haynes, and Jacque Menser. es Sans Souci find escargot a tasty treat The development of the French language is studied by French Club member Sylvia Castillo. The French delicacy, escargot Csnails to the un-Frenchj, was tasted by members of the French Club during their yearly banquet. Members reported they were delicious. Members of Les Sans Souci went Christmas caroling at Thomason Gen- eral Hospital. They also collected food and clothing for needy fam- ilies in South El Paso. Aside from their yearly banquet, activities include correspondence with French pen pals. French Club partic- ipated in the Halloween Carnival by selling confetti eggs. Sponsoring French club for the second year is Mrs. Blanca Perez Moss. French Club members include Marlene Richter, Debbie Sikes, Jay Davis, Audrey Henderson, and Leslie Bowers. Sponsor of the club is Cindy Morales, Sylvia Castillo, Christina Ruiz, Cheri Parker, Cecilia Delgado, Cynthia Curtis, Mrs. Blanca Perez Moss. ORGANIZATIONS 149 to speak der Deutsc Der Deutshe Verrein, the German club, is under the guidance of Mr. Colin Flannigan. Under the leadership of pres- ident Mike Woods, the club had a busy and successful year for 1970-71. Members of the German Club are those students who are in third and fourth year German. Also students in second year who maintain a C aver- age may qualify for the club. Officers for the 1970-71 school year are: president, Mike Woods, vice presi- dent, Susan Price, secretary, Robbie Farley, treasurer, Alan Gamble, and sponsor Mr. Colin Flannigan. Discussing the structure of a German airplane, John Lowe exhibits his plane at a meeting. Mr. Colin Flannigan inspires members to learn the best foreign language. 150 Club's goal: Q .Adi Members of Der Deutshe Verrein for the 1970-71 school year are, BOTTOM ROW: P. Hosey, M. Ken- nedy, and J. Lowe. SECOND ROW: A. Gamble, R. Farley, Mr. Colin Flannigan, M. Woods, and S. Price. THIRD ROW: D. Wilcott, C. Medina, L. Luna, and A. Kushen. TOP ROW: S. Meinke, B. Page, S. Hastings, P. Gower, and B. Sproull. in i Q. gi .. 1 A V A A illiiil' ' . A r r P - s.. :..- . A ' 1 ' . .' ff' 1 l 'Rigs lifirg iii! King's Men c eckmate opponents FICTION Chess Club Members arep SEATED: Chris Bartlett, Susan Oswald, Ed Patterson, Ernie Beeler, Steve Winkle. STANDING: Carlos Gardea, Mr. Roger Arnold, Jim Starkey, Ricky Miller, Bob Black, Steve Hvzidak, Billy Sears, David Johnson, Von Watson, Jesse Behnke, Steve Hurd, Don Robb, and John Dzubenski. il s ggygs-0 A I 6.103 T: 1-ssc' - 3 gg. --Q F The King's Men, chess champions in residence, have set high standards as a newly formed club. Sponsored by Mr. Rogers Arnold and Mr. Allan Emert, they hold weekly meetings at which time games between members are held. Besides playing many chess clubs from other schools around El Paso, the King's Men also participated in the Ysleta and Burges Open Tournaments. Rounding out the year the chess club held an Eastwood Open Tournament in the spring which was open to any Club. f X 'I : Bill Griep takes time out to record his game. Chess player Jim Starkey concentrates on his next move while Don Robb moves one of his pawns. ORGANIZATIONS 151 EFL strives for district speech titles Members of the Eastwood Forensic League are, OND ROW: Bill Beard, Louis Barragan, BOTTOM ROW: Debra Behrens, Dennece Knight, Edmonson, Ralph King, Henry Lide. TOP Carmen Medina, Vickie Walls, Susan Price. SEC- Aiming at district championships, the Eastwood Forensic League took on the responsibility of promoting speech ac- tivities in Eastwood. The group is af- filiated with the speech honorary society, the National Forensic League. Major money making proiect for the speech group was that of numerous pickle sales. Testing their own persua- siveness, one could easily find students exercising pickle power. Under the direction of Mrs. Ginger Cross, the club took on the responsibil- ity of saying the morning thought for a day for the entire student body. The purpose was to entertain and enlighten the student body. President of EFL is Mike Woods, vice president, Carmen Medina, secretary, Susan Price, treas- urer, Kerri Lindley. Paul Polk, Ronnie Lucas, and Tommy Davis tend to the needs of the newest actor in Tea- house of the August Moon. John ROW: Tommy Davis, Mike Woods, Jerry Cole, Welcome Edwards. Sponsor is Mrs. Ginger Cross. 'W-nu...,.......mwv -,,,,,.,,,,,.,,,. ,lm 'H I Cappa Delta officers are: Gabrielle Voelcker, Tommy Davis, Marvin Farley, liz Snider, Vickie Walls, lisa Scheffler. Ceremon held for inductees Eastwood's Cappa Delta added to the bright activities of student life by decorating the snack bar for the Homecoming dance. They also assisted in bringing on the Christmas spirit through the selling of candy canes. Cappa Delta was formed last year as a Junior Thespians Society for first year students. Members worked on play productions and the readers choir to earn merits. Those members earning a series of ten or more points are worthy to be inducted into Thespians. This year ten members were accepted into Thespians Honor Society. An in- duction was held in the speech room where each Cappa Delta member recited a selection of prose. They were then sworn in with a reception following. Cappa Delta is under the leadership of Mrs. Cherie Hanson and Mrs. Ginger Cross. Presiding as president this year was iunior Vickie Walls. Members of Cappa Delta are, BOTTOM ROW: Lisa Scheffler, Terry Baldwin, Debby Baldwin, Liz Mark Tanchester, Bill Griffin, Diane Hooke Sheron Crowley, Lisa Grimes, Paula Chumley, Snider, Renee Davis, and Vickie Walls. TOP ROW: Gabrielle Voelcker, Tommy Davis, Marvin Farley ORGANIZATIONS 153 .. .-, .azfa-- ' .s,. 'a:: f , W if Q' 5, 4,12 .-1 ul ,X T7 'N N4 52 Q ,:,,,,-,, +1 X ,E sf Q K el if X, Providing vocal and musical accompaniment for the performance of Spoon River Anthology are Olon McCIendon and Andie Richardson. Robbie Farley undresses Paul Polk during lhe per- formance of The Teahouse of ihe August Moon. 154 499W Vickie Bracher, Paul Polk, and Kim Smith read their parts in Spoon River Anthology. Spoon River Anthology, Teahouse of the August Moon, and an out of town trip to Lubbock marked the 1970- 71 speech and drama year. Competing in tournaments with other schools, the speech and drama department brought home over twenty trophies. Teahouse of the August Moon, the fall play, concerned with the attempt of Americans to civilize postwar Okinawa. A live goat, a jeep on casters, and authentic costuming were part of one of the drama department's best ef- forts. A new project, reader's theater was introduced with the presentation of Spoon River Anthology. The speech team also had a very active year. It took sweepstakes in its first tournament of the year, held at Coronado. lt went on to sweep debate at the Lydia Stark tournament and helped run the first West Texas Invitational Speech Tournament held at Ysleta High School. John Edmonson and Mike Woods carefully handle trophies won at the Lydia Stark tournament. ORGANIZATIONS iss J k ni .x M 5 . T. -L 1... Q ,. , . L. - . Selected as beau for 1970-71 was Ernie Simmons. F' t Rodeo Club whips YHS Rodeo Club, the first of its kind at Eastwood, instituted the new tra- dition of presenting the colors at all pep assemblies. Mounted at opposite ends of the football field, two members of the club galloped to the center of the field with the American and Texas flags. They remained there through the play- ing of the National Anthem. Other activities of the Rodeo Club included participating in an invitation barrel race with the Ysleta High School Rodeo Club. Delinda Dent, Georgianna Fortune, and Linda Lide participated in the race and won the first place trophy from the Ysleta Indian Club. 156 Rodeo Club members are, BOTTOM ROW: T. Sewell, F. Skelton, C. McCray, L. Jones, C. McCroy, L lde ond B. Dahl. SECOND ROW: R. Simmons, K. Freeland, C. Sabin, D. Dent, M. Dahl, and C. Wall TOP ROW: E. Simmons, H. Lide, C. Hays, M. Grisham, l. Walker, and J. Bradshaw, t E Robin Smith, member of Rodeo Club, takes her first run on pole bending as she rides Stor Bar RODEO QI? Y af M 4 ' 1 f' all Q- - www,-aw :anew-1-We' sr wwf Riding her horse Preston, Bonnie Jones contemplates the next move around the pole. Cathie McCray and Ernie Simmons put up a Horsee MR 1 N lm shoe Pitching sign at the Halloween Carnival. P , if gi ., 1 J 'Q E si linda Lide was selected the club sweetheart for the school year. She is secretary of the club. Kim Freeland, member of the Eastwood Rodeo Club, takes Punch around the last barrel. ORGANIZATIONS 157 Reveille awakens hidden talents, discovers tomorrovxfs H mingways 't X' Members of creative writing are, SITTING: Jen- nifer Ruth, Yvette Collins, Barbara Piram, Bill Beard, Laurie Wilcox, Sara Smith, Mrs. Bonnie Lesley, Jay Davis, Dennece Knight, Sheila Rogers, Marlene Richter, Susan Eason. KNEELING: Andie Richardson, Ann Savino, Debbie Cage, Pam McAnich, Cindy Richards, Patty Cahill, Karen McGinnis, Terry Cole, Louise Loiselle, Anne Sparked by the challenge for crea- tive participation, members of the staff of Reveille '71, took the respon- sibility of putting a prize-winning literary magazine together. The purpose of the publication was to present the interests and creativity of EHS students. Manu- scripts represented students from all classifications. Aided by senior creative writing classes, literature from poetry to prose was published. Sponsored by Mrs. Bonnie Lesley, the students not only created the layout for the entire publication, but were in charge of the judging and selection of material to be in- cluded in the magazine. Reveille's editor-in-chief is Bill Beard. He was aided by co-assistants Den- nece Knight and Barbara Piram. Along with the section editors, they were responsible for seeing that Reveille '7'l went to press on time. Another great magazine was published. 158 Markeson, Debbie Hurd, Eydie Griswold. STAND- ING: Karsha Bowers, Lance Murray, Janet Per- sons, Debby Yarbrough, Olon McClendon, Bob Bean, John Cullers, Robert Eggemyer, Sandra Meinke, Kathy Masters, Maralee Gelderloos, Larry Hicks, Norbert Barcena, Valerie Phillips, John Hendley, Rueben Casarez, Klaus Englehardt, John Edmonson, Ralph 'King. S l E 'li Reveille sponsor Mrs. Bonnie Lesley smiles in anticipation of completion of the magazine. Reveille staff member Rueben Casarez diligently records ideas for an ingenious layout design. , c . 'Iz-3 Sta rry-eyed non-fictio Senior Sara Smith ful moment of inspiration preceding the re- cording of a poem. n editor Klaus Englehardt challenges an idea put forth by a fellow student. Creative writing class finds Sheila Rogers and Sandra Meinke relating memorable experiences ,M ,,., 6 experiences a thought- Sabre covers newsbeat to Newly adopted member of the Sabre family is Quack Quack, the duck, hopefully the beginning of a zoo in the publications Striving to keep the student body informed with up to date information is the weekly Sabre. Nineteen staff members, sharp minded and armed with their pens, meet weekly deadlines, amidst a rash and flurry, but always on time. Under the leadership of co-editors Julie Francis, Lance Murray, and associate editor Bill Beard, Sabre sounded out the student body on issues such as amendments to the con- stitution and the student handbook. Sabre also printed a series of editorials and articles on the problems of pol- lution in the air and on the ground. A new addition was made to Sabre this year in the way of a zoo. Quack Quack the duck, who is the begin- ning of the hoped-for zoo, was the rea- son for prompting co-editor Lance Mur- ray to write a column suggesting the zoo. Site of the proposed zoo would be the present residence of Quack Quack, the garden next to the journalism room. 160 department. Quack Quack lives in the garden next to the iournalism room. ....,1-,,, .- Yy tx 1 V1 1' Af- 5413? if . f an s .rss gg X. my Returning after a busy morning selling news- papers, sports writers Ricky Lopez and Bob Black turn in profits collected. 535 'M A MW., .... xwmwef' ..-,IM Publications business manager Norbert Barcena sends statements to Sabre advertisers inform and influence students V 2 Nil Posing before the Sabre morgue, Sabre staffers ore, BOTTOM ROW: Bill Beard, Julie Francis, Lance Murray, Bob Black, Frank Lopez. SECOND ROW: larry Hicks, Cathy Gouch, Norbert M. I Q at K 'x Rushing to meet the demand for a photog- rapher, Joel Hendyrx dashes past Julie Francis and Bill Beard. 125 Barcena, Sylvia lopez, Marlene Richter, linda ningham, Ricky Lopez, Charmaine Chavez Battle, Kathy Masters. TOP ROW: Joel Hendyrx, Rita Chavez. The bulletin board serves as the Ralph King, Dennece Knight, Denny Cun- journalists' catch all and file. . N sn . -L iga?-ir Q, .31-if Keeping sales up, Larry Hicks sells Kent Brooks a copy of the newspaper. ORGANIZATIONS 161 Salute staff survives confusion of deadlines Tweedy Steed, Anne Markeson, and Ann Savino collaborate on layout ideas for 1971 Salute. Cathy Gouch and Norbert Barcena take time out for fun at the NMSU iournalism seminar. Saturday deadlines provide time for knitting and Senior Laura Fairbanks perfects a layout design for Salute staff's deadline. fretting for Salute sponsor, Mrs. Daisy Meacham. EEE J Q. Salute staff isp SITTING: Bonnie Jones, Diane Alderete, Beverlee Bruce, Charmaine Chavez, Pat Henderson, Nancy Hatch, Debbie Baldwin, and Marlene Richter. KNEELING: Sylvia Lopez, Joel Hendryx, Kim Shahan, Tweedy Steed, Laura Fairbanks, Leslie Penley, Brenda Bolton, Kathy Staffers of 1971 Salute worked diligent- ly to make their deadlines. At the last minute before a deadline, room 111 was nothing but chaos as everyone was fight- ing for pictures, hurriedly writing head- lines and copy, and cropping pictures. Many weekends were sacrificed for Eastwood's history book but when the final deadline was met, staffers were asking themselves, What am I going to do on Saturdays? ll The time waiting for Salute to be delivered was spent by the staff spread- ing rumors as to the color and cover so that everyone at Eastwood would be surprised and thoroughly mixed up. When Salute finally came the staff celebrated-and bragged it was the best book yet! I fi gin 5, F Masters, and Pat Petrosky. STANDING: louise Loiselle, Lance Murray, Anne Markeson, Ann Savino, Jacki Magness, Cathy Gouch, Norbert Barcena, Larry Hicks, Jack Ricks, Dennece Knight, and Bill Beard. Aside from work on Salute, the yearbook staff members have made sev- eral trips to other cities for workshops and interscholastic competition. This year workshops have been attended in Las Cruces, Austin, San Antonio, and the University of Texas at El Paso. Participation in the Southwestern Scholastic Press Association also keeps staff members busy. Editor Anne Markeson, assisted by co-editor Ann Savino, worked until late hours, pushing staff members to their limits. Guided by Mrs. Daisy Meacham, the staff made sure that every deadline was met, every picture taken, every word written to make sure that Salute '71 was interesting to its readers now and in the future. ORGANIZATIONS 163 V QV V., -A .-52 Q11 W 55.51-wb X H ,511 ,Qzifyf-.5 Wg.: L,Q'fiifM'xf:bf.:Ql'Vfffy'-vi Qf'5A',j?fQj,CQff,Vy-v 5911-'E'5V Iii 'if.E.,V -QQVQISVVQ, .M ,... W, .V,.V.3, -V, . V. ,V.V.'H -,LQVM fQ1Ncigg1QfqLVE1'.' f','V'f5,,fZS-5 Vvf:V5'VH 5.541 -VVVgQg..- pw'-gf.4VVQV2-V.-. ya '17-V- .'V'VVa 1 --v 'f--'-Vie QVVMJWV '12 '-A.,..V,g Q VV, -I jffj,-'-.'g,v.f'y2f,V3-A , 3, 1,4 -.VV ,Ven-ff. 19.511-'4VfJg..Vz,f.y-jg. - k'A.1,., 1 .VVVYUV :VA-VW-Vi.'V..gfV-VVrVV'.f-g-,- '-mf: fiif .QP--QJVQVMVQQV, K SST! 3: E? fAf'fVV5?2V: i1?-iPfP V- '53+g,fVfffgwa.-5-Q-:251,.v4Q5Qg W ig:-VV-ff:g,Vgi32isQ Vik 1 -g1: Vg:ygMr, 2 V553 5:fV'g-.gay -5 VV.V.m,.5w:-gig:-3.3-. :ffm- V -jg:9.5V,-,.y,:V.y.- V:V:,3:: QV, -955-.1,.-,Y M.-Vw pig , -Vg.-:fagyf-eV e.ge91,:,igVf,.V1Vg-.6 g ,Vi-V'Ef?,.:3y:vL5'yp0 . afdivfvlgwsfygyi .fvvgirw ef. fV:4tqfVcVV-fg-V.-,.V..H1V'A.vf.f'5V , '31 my'-,-wsm5,g,3,1.VV-V,-.1 '3f.VVE,J551?iV3i.s5'jgV:3lV,,frm5x , FV., V-I - ..4,,M.M , V.-5,-VV? Vi-,QF-E5+?.5..k4A5,..fd 5.554.535 T- 2Di3A3gfW?2fk.M.,'f,aMV:,fA5A?4,fQgqgg.fK VV.. ft.: V. gy, V.--L5-, .fitggjg Vg :iff ,gggfl-:fly if 1,-5,15 -gVVV?3ffJ5N2V'-Af'kV5H5fS355 AV.Vf-LVV'-:fmt 'i4-'VV-,', f.,'L'- , -?jJV'fG-JWf5fffQviFV12xgQ52?, A-'fV:g1-7g?Q:3:fgfggl.5fL:5 iffaely-, gyfgzgig m, Y.,-VV .L-V-..,V15:,4.::gf5V5-2.5-ggfw gW 55Vx5gf3gS,V3g,f ggi-5V-75333553 ?1,,,-122'-4Vr93Z,3W iff:-1fVV.L111--jg-f?. gg-,Mf'flVVA5-Wgfgimfgfyj-.VW Vp' J:-VV .Vj1z1.gVV.VA-.':, J'H'V ,.':'fT2:VULg3r ,A falviff'i'5'VV.Q'-'fi H sl- V',w.- FQ F' Yifffjf 43.6 K -- .VV-V-.. .V VA P. ,PV-, QV V.g,,-gs-H,.,3,VV. 93-iV.'.m M -V- . ,Ki ,,- V,.V,V 5,--V V V41 VV5'A:-'QV'-EZVVSVWV-2 'V'-gig-V1gj.,5Vf.s:., 'yf1ff,.V5.Vwj-A'4- 5 -,iffy-an-..1VVQf4V-3 Q.fw.:i-?g33g,+'f.-15,4 Q .5-V 5... .V.,fV'.V :V-1-4jVgV7fxV wgVVQ:x,f,a9,i-gyggw ,gr'ffjg,+gfgjgjVq:,.6-I3A,Vy ,Y.V..5-..,TV-..:...MVE,V,,V..-NV, Wwggffxgf-S'xfff3'f QV-y1::AggV,,..EVw is ...yer r.V--V- ,.-A V.-'V--.V gf- vm -Vkggbgggs +5-U9-:,-4 V 4,Q3g,.g-Vis.-., L.i.V:V5ffV! i,.wVV51fQ7i,V.....,V..V-,.5T,fZ,,,fjjA?jiffVQS2.,Q?l:5 f sri' :VA V !VV'1'-39V-iV:i-Q ffffxm .V ',.,-Vw -V vm. 1V.VfV-v,yV2.V fV,,GZ1X-VQQVVVVEA-V 1259. ggwkz,fVfl5,tQc-Qg:5x1xg,3.Vugf,iV y4,,.g V,.:- g,5-v.:,:..:.V-,V.,V-.uf,W5,-,J535,W3V,31Vei,V-QP, mga g,y35gg,sVg4V m,mV.f5wpV.g5gvg . 'if 'i'fV' -'ffm-,--we'Vf v Z ' riff'-5' -M1535 .V .1 Vi. V.V..ff1V.- ir?VI,x:fffCwiyi.'Vm'-1X-Mx -Vis X Vg- .QM Vg- Vf4,3::53-.V.5,,V5i,, VV.-','x.7-1:-.' -H V .4 :-- A.:-V-.,V-gr:-' fqggwagie-VV -V.'-am'-.V 3Hf1qg'jfVe'f 19-QV Qigiik-,,1SV grg-5 -H-JV, VM- VQQV.-I.: .- V., ,.V, Vu -.V-V nqmiy, ..f,:.,eq,di-J -+'Vrf:.VI,-r...J.w,-V'11,5913 w 923 . fc-l57,5.J'.-951+ +L -,Agp V. Vggzg wr A 3 V-.gif-'gas LV ,VV .fp--V--gp-V-5-,Vase--rwa.4.VQwVfV4V,gy fm---rf-wi: .V I.-MQW -Q-fVVefg5:,. V LL 2-.545 V. ' .fe-w.,JWg,VV.V,-f,v,, V, My '. vi-V .52-fi V-iw, 5 VV-WJ-22,gV-VVV.-3,5-gynflgw . 1F6,'.'-V'Vg.:!-Xia-,'V' Q- V--,-Y?'Vgi:- 'V-ig-11--JVem'-.'5'YVg,g'u . ,MAQQQV A' 3g-,Vgaggwg-jigfib ffm -S52VVV,V'Vw'.VV-WVf.,V3VVV.gVi.VV-fi ,J1.EAj'QigLgILim5J,ibp3gt:,,VwQ V5 gi: -.ffAJ,AVV5--V.,,.-V3V,f V,-. V 'V '-g7.,v Ef.iQ. VV5aVVVfg ,: fggm-4Vg3 V , ,ff -5.55.-Q-V5,fV,,f.V . V' Vw -V .V Vwgf-5gvVQ,:VfV55,. .V -V wg .V h:f,f.agV..,g,E13gfe5-V.. 255,523.4 - 21:1--V-T V.-mf'-,s-:VwV-V,-gf-'-A-fi23'--eww ffwifffif' if :jim 4531.-5q2+ M f'vTi f'l AWf?':' I V, VI'-wa-'59'1.'VI .:2'-'A-rmivfffizsQuai?V-:VHIP-i:.V1-J,-Pm'VgLi3?u..V4V?l-WM. -ef 'JP-.sw jf 3VV2c?V,,frfm.V1fiVM2,Q , VVVV:-'A-VV-'V-.1'A'Vf--V--V. My-,Vv ,Vg ...N piggy. V.. 1, ..VV5V5,.,V-VV1Q',g 5 gi5V.,V:i.yg -V is-V.,-j.1y 475.. , y..VV- ,V ' . ,V -jg... 1: ,- VVVVV-593 5A QVVWQ. , 'VV .3 --Vw .:z:VVV4 --0VQQ-aw-digg.,fgW2'2gfjl,'f-gag. W, 33,2533FfVf.E,f,?2V4'gVEVgf-,-QQVSQVQQM ,AV-a:.V:yf':,.1. V V. VJ VVVV 'QWw.fVVm-Aa'1e,HV:g -1. V-:aa-,f.V -V -H-JV-Vf,qVS4f5jV-wniff-2 Vywev .VV1--V - . 5,3 5.5, Vwgggy '4f4gW,!'VV,Vz.asV., 33,.Q5aQj.,V,,,..V?,ujyL-150,- --.V :VA , . ,4'VV, fV-V' V3,5V::'V,?.VV-A fy- ,:x ,:+v--w..:g?fV,.fzV- y:'Q1-.efv-fy--ffVw-V..-5-m.e-,rf V- V.-4, -,-VVVKVJSWVAVVQ -,pin ..:V'xfgfV. 3,wg'm..5-v,44i ygVV3..,,,.VV .1 G1 .wi-V.i,7g,5V..xg.V,,!,5 f-g4,:vg,,i1dfg A,Qy,bVM5AVS-xg ,VWQVV-,VyaV,p4J3. y:gg,y4,1E,Mf'y.V3 gW. JW -1,-:VV .-13.wgV: .V:,.g,,VVVg,f- Vgsry-'.g,-.a5V ff5TQVfV, gV.1,Vz5yVVV5Q ,gg .Jig mm. wfy.VVj'-V,VyV-V' I V .V : .AV 'jVV ,gflzwi--gg fp -,V,'.Vg-5 V-VV-,:VVV JA! gxn::,a3g.-g5- ., Air?-1751: V-'V4,'V,:.Q V V.--. Q1-,W.2V',p, P 55553 gg FQZ7Ei,VV,Vi5 3,5 VVZQVVL4 ,M WVV,.V9f, V- V. -., :VfA-,-,-gV,JVV,-V.'fv.,g',gw'M3gVV.'3Lg,wcy-,Qf.,1 5VV4,g.A,4gVF.3iVV:VgV ,qw 5VV,V.,g,g5g5iif.3ijQ15,5h,,5,E-,.gymgbyq .'.-I-'.4VgVL, VV.VVj,'f.V,,V .5gs,,53vjggpV': 5V-515,355 ?iriVV4gfni5,5'g3,wzgyY,,:?x:K .1 - .Vg - Q .435-,,g,,,-gg. if -.217 -VV.VV.1VV..i,V 'VV X. ,VV V- V-f-.V-V-,Vg:wA,V....V V -ar ,'frVg.,:V-V,u,,a-WV --VNV Aw., -,gmfgk .VW .q, -5.2 -if. V, 5 kj.-a V ,g,V,-VV.. mfV4,'V.'.Vf:VgIA V:g Vxymavai A'VVa3g,Lgn4fVf:g.r2gf-V 'wif ,?,,f 4.-fVg5:g.VVV3R5gngkjgf.3M1 A V-Sig 1.5V'f,VfVV1:'.,., - ff.,1..,ggV3,.,-9.1 Vf-Vyff,15355-Ag-rg-VVw.3,,ga,5,4, MV- W.-ffwi,,g,.Vi r fs, Lflfafzfxfk. ..5.fVgg?fg,Vy ggV,Vy.5V wf,t,,.,Wfrfz,E-N,W JLVH,if-f.jM5,5!X,ifJiMfg V ? A My T ' gig? Vg fig .gi-ig 5.53. 5734?V55.j:VjVVgVf.1i-3-V, rg'fj3,Vfgq.1gVF33iigi:gNVL45VQQ3j?gVV IQ V'-A'a.'V15p QL. MSE.-5sAV,i:feVVV-uf g.'Lf f' ' Q 'i f V ,QVVVVH 55. ' ' '51-Cv-if-' 5-533 4 '1'ilL':23 : V.-V. V,fVV,:-V .+.-V11VV1.i8f,Vwg.jrgiiwVfV2.V ,-535151 VV,-,QA.5E'fVg,f,21f-,WV wt--Vfffgf-, V QVVWVVKY .5 -QHQVFEVQ, f,,V,. .V-.VV,,.-. .MJ Vg. V 4.-9. ..-.V., -:V.V - .W v ...J Vg'-'1.V.,xV:,,.'e.-..-VV .,,, My V, .ww ,gy 1.-ML M-u-,la . Vaegvgbfgeg rw ,wif . Vg- MVN gum V-,'-..f'xfL.HvV1f'xAi12'1f1f4'-'M' 3VVVwfQ5Vf'-fivjarq.-.- 94 v':'k'm9i2jiilQ ' 'fig 1??'5 fa' WWW y ' .-+.g.q,'-Q-,7'- -V 1 VV- -V J N - - ' V sgggfgff fg-V - V 5 ,-2,1-5.5gwg,-V.g.V.VV.Q,V.: 5341--5.535-'-V1jV,Vg V '.,1eE-.gf-gg.-,,V-g,.gC.Q gf, - 5q:QgGM, V--YVV -.vga VK -,VV-f.1gV.5,V V ,VM-J.. V, -4.--gg-,VV.ywf,1.,-V. .Vr,5.-'.V-f.g,,, -gf.-:,V's,1fl:fxVV.V ,p.j-WV-,Vg-93.3.VV,.,V-,gm 1,35 ,Vg--5Y,,,,,5,--,gx,v VIZ ,VV Vfwz-V-JM .pf Qggazw wig. Vm..o5.-WV - gf ,vi ,,C,.Vf5.,V?M. Sf gf- .3eV..f:V.,VV- 1,wgVV','53g-va 'V ,':l'iV4g,g5-gQ1.VV+.wVQEKVVV. -' ' A1-'VV V. V 5.--MQ, M43-gVVff?.23Vf-VifVVjVV,5ffVq-sq gif-A V.k,f4 V,3'ffa4fz4V+V!Vj,.QQVi5??! -- ' .gf 'Y-Q'Q'a9V.-fV':Al 'yzffw-VV', ff,V-2 if fV1-'IVA'-'-Vqwg-,F-2-V.'gQi? Va 'V-I-5.3 '-.fide-'Val ,jw-V..VV,f-QVV:-'V-MV' V g5gj,s:Vfmi2'.g.V'.g2-J:Eg,QV,5gWV- -ggfggffwig-jyi-fb'j1 . fllj 1 ui? 'ff-VV V- V ' A 'iw-QV.-S,fff.'qfr..V V ' -'VJ f,:V'AVVV'iiA5.i,..3lVVVV :Ti V:fg.,5V.f-gia.a-. 1i--V.--fyVVV,AVi-.liHV-fV1g.fyqfV.:xbxvi,QK .,.,5iV.g335-Vgff swf ,V- ,-4.1 -3,-Ag'fVQ1V-g.53g,gfgi'.f Jgfjfi-'g-..-Vgmgjurf1 -V-1Vg.f5gf'gfg1:g 5.1iz.gffwy:f-g.g'51-5y.V5.5.-i,f'fiV',qQjf?'J4,?,-,f5,g,.J,,!kgs..3 M ffik7E3Q,:ZVa?S:VV.Vg,,aw V- 'fgmqfgigvs V'Ziyi'--'V-5V5-f-ffxf. -nf?..,g, .M,V-JV,gfyrw-VV-fAmf!-4.Ql:22g5QQgggV?EZ2gfg:55,V33i,V.j45-Q ' -5,.fVAw'xA1A-'WVV Vim.J-1wfVVwVQvV'VV'V'21 -QQ-gm.:-1-V3s' V?fI V Varj .-23VVV.Vi-'-,-V 'gg 'VV ':QV,qi,3z3-.4 'QV -V A'VAAVf,VV...V-VV,.VV...V.fAVgtj,-Lf. MA 32'V'..g:',r-,931.2'-V,-V,V.3V1g.fj3ffVVV:.A-Ag-9.5.1 MV-gV,sf',Ve.V5VgVVV-':,fQ.g5V,f'yq.'f?VLigfpf.g,,.,5wg?.s,:,f gig 5 g .mari i., S11-r.j'pgg5fVL51g'VVVV:.rg?V13j,-f-V, -peas-VL,'3,V'r-,AV.XwVgQVa,.Q-4,YVVJM .my13.:aVmR,lg'QV'fm-,,',1,V:,VffVf45gg5..g5? 5555193-V-gi4g53.sfV .J pf:-.VQVL g,fi.5Nf4'5,,3V,j3,f,Vcf3i?gf,,'-Q55-7, V' V fy. 0VV,V1'5F'w.g:V? A.yfVgVg,V-3,,fiV.V,Tm.w .1,.V:,q,,V 3'jg'-.QV.gf.QVV-9.5.-Vg:-g.i Vg.-3 fbi-5-VEVZQV V-Vgg-ggQ.fg'g'igV'V15L44'.?...3.A5giV.pig--V.5. 3 g.,53:,.Vgg.355-g:2,,?-j-53 gg- IV.. . A, - -V-'-Vi, -V V.:1-i.Ve:::g,V'.V-5-isAVVVVH3-'A-V.g..''.'V.-5V-2-3 -V.Av-5.V'y:wz,f.V.VV'A-Vffrfrg 2-.1-,f2f,J'VVV?-f,vg- 4f 'FF'ff,W sf MqlV+,.'rVQVVV'fV.-''fffffiVV,.'VV'A'Y'V -:- f-V-.V- f9V.1V:.f5:,..Q-:,---V-.Q-V,VVVrK.5,-QA.VfVV'Vf:?5:1f- 2.33-.jV,3A.jg.g3i2Vx5QV?1f::VVg Vrggf33V.555A,g.3iAfgQ35SVEQVVVVV.-V fy: .IV V 35vP-j22V.VAV1.,-VV- 1, '-'igf-j Qi'--wa 2' Vifgff .VV9YQV:ff'-V:-.VVVV-.-:V2fVV-- A 5 .5 V 'A 4 1 .gp Q51 ,V5gV.gf,5,f- 4, V U ,V V, M7524 g., .3155 Vg. 5 it A-imfgsik-Qmfmff-VV1 Ai-V??f!SVf'fQ35M'fV.V.APf g-if 'V fx, V2-is-Ai K-'VVVViY.VV ...VA A-V-V- ,.,.VfwVVA1iA-ZAV-V.V:.-:YVVVQV VfAVif?H??fiH'..-S- Swwf-f?-V.A -2-i.2V,d..3,f'AjV-wwf gl:-?A,1VV-'52-,.ig53.ViVV.?VVfV+g,',.V1g'.,-gfw ',VsVVfVVV1fJT'fJ.i':z::S'5fV'.fV.,.'Vmf-VgffV,,,.,3VV.. yigkjy 'A ' '-Q-Vf-11:5-. if ..a,'1j'kF V2y,'-Q-Zwggmrsa j,f'V34'q,:gVV,,V'gfi'VwW.-VVA-1-'3zi- :QV-..:V' 'VEVH-.VV. -1. yLv.'.V.'1,:VVx,VP5iVVf 3-:V-'---gs VVV1.-'Hf'5VV. -may-fVgg5e5.VV-V'-VP-QVMQ wVw:-V.V.q'f- -Vey-V-Vg'-V -V11 3-VV-f,.: -3....fx,.Vf5?-,Vw-S..-.,X V -V 'V Y-gV..-V'VVg-.AV--fvy iw- '-3-g-Viwgff, gqfjzg-3- .V.5fm.g3g,xw.g-lw as- VV A-1-,ljiwgfi-.3g,f-Vf5VVfkm-gilt-,f--gf, if N5 Q.. , 5 V 1-V5 -V Vs--355 qv,Vggly-5s'g.1,.V2.:-VV.Q V15 Af.-,Zf3AfVe?i,-V9-1'-A3 ftfr V-V ' .V V 4:3 V. Vg. fs:-V5 v'r'VVV, iVg:jVV,zVl vg3VeEg,ffgf4Vfgqp.,2,1 gy ,j KL'-.,,,V.ff- ,,qAV,1PH,,A,V-,,:5:,w,gI-,gg'f'1jJ,-,-ig.'LV-jg?-v,:'f.V-'-V32..'.V?'+?Ef-VVAVQXEX'VV J xR'f'5AVVV A'V-'SW-VV , i'5Q:3d fvHJ'QTWVFSI55i'5sV!f11V5f'1,aA1-p 'V6'iiVJ...f?1i Vs, N ...V VV V- V., V,. V V. ,VV.V-rpg.,-,.-..Q--f..,V,-J--.g,m,15 -V V,V. VVgVf..,gQ ,..V..,.g,Lx-a,-,.3J..VVPV,. ,3fVg...V,g,VrgV5?r.5,,L-L3 L..-My V :,, -.a.-,,y,V4V.- :VV5fVffg.g1:fV,V ,4 ,... V, -V -V.-Q ....-r,.45Lt,5gVV QV.-... Vf:..vVV,,,.V ff Jfy, -Vp -.r,,f-e- ,gpg QQ1,-yaw9,V4,Q,,iV 2,.,.fV-,1V,Nq,-,i-,431,J,,,.,, gy., yigjyn-M-31,5 ,gf,,,,,5N 'T-'43 V-'fV'if1-M4'LA-:,fg'ACf',11VA-,VV-A 'Vi1VVV-zifiiwfzl-IVVVFS J: ' VNV,-QV.ji'fV41f3QAqzf .v.3j-VrVi:maJ1f4'1pfcV- 2'-1-VV--Emir'gyg-'VV V ,VV V4 V-V.: .V-,..VVu., ?.VVzgV4QVg3V. fVVV4' ,.g,f'...Qg.Vf,Qrlf,NffV,9Vf,y -5, VI, -V 14, . Vg-V.,.:4,1-gg V: V :Vg 5-,V.Vi+LV,,w,V-,iijg,.,Vsg3,31LgVj,2V -Vaiiggxg. V, .Ve VVMS-V213- ffl?-.ff 4 Yfjai' fwfuiiiiif 5 'f Vs?-'r'A.',:'J,j-'fxiwmf' Tifsifi V5fiifVT '-455 .V .Vwfti .rf V- L :lf Q5--EQ.,-i'f.gjcV-QV.2535 .,f,N3f23 v'f'1-'A?5f'?,-Vi-,,Vf' gi. 'HVWQVQ ,f VV A-.yf-VV'-WV-?z.g'w3g.5NV'V- 5 -5g.,q,V..51-Vp-sfggwjw.-V1g,ZK V.: - A, A I :EV 'A ' -- -AAVYAVRQ -.V'Lf ml -1'-V JVV5.f, 'Vg-'JC L-.VAVf Q4 ,'15V,Vfj 2'-if '. .., .V-41 'VHS if-if ert 5V'ygV: .-,V'g1'Wfl? V-'Q-51' ,V S-1VfV'1q--'Vg 5 ,,Ay'-V4 '2'l'.-1 Qq'VV1f.gg.-,595 ,V A, 'JV .ai 'V jg -'Ava-1:.3f', Q12-::Vjj., 3 Q 5 5-iw V--.111 .5VfVf.f' VV ' Q- -Vwz :-'Qg:35.fA- sv .W V - V4 A Q'.V'.,?fV.g.:i2g:.,gVg:fVa-VV- lj -7: f A- ' -. -f mimi- W. -'L- -V--V, 21,45 '-.V-1 Vf:fV,E-55. 'ff J . if-T 5V, Vff,fVfs ' V Tff 1?-.5214 ' -mg' ',:,13Lq1:z15r5QQ-V .g,fgfvg,V:fVg-35233 V-5 ,.Ve..V.::V , 1-vw V., sVgV:gs:VsffV Vg. V .f,V Z..-.-'LN.52M,Vgjg':fig VV.-Q VV-5.93 5,3 5-Vi'-l4.Vf'--11.1 fV'VVrg'-- Q VV- PV 'Vim-.V.iV: VQVSV2-fg'Vv:.s2 V'V-yff-gif qaVJ':i-u,'2JzWVg-V'-, ,gfigaaz VV fdw4'V'Vwfy.s,'5.,..:V.f V551-VvV,VwVgVsr..V14,ig.'1S-. 45. :-V'gQpg:Vr?:,Vfi,fV4L- J-iV5..2-gVVV?-V-,5::ng'f3,.uin 3-V51-1A.VV-.fggi-5,5 -- ,AZ-SSVQXHAV2: V- '3f2g AM,f3.-VVVA2,4V.,VVVj'fV.,.'-Q-,W ff' V Q..V-..V,-'fe9fe.1f-3:.'f-?V-Q9ifgrmsVgV-5f-V.- -2-1-VQVVVQ,-f V .VViV-:'.fVa1Vff-9111. ,VCi.,vkv5,5,.gV55.yMggFS.xV f1- . g-i'V'g:.fif1-f- -fy''W.,VVV5g5k5g','y- V- : VVV-ge:-.wVV: V.V -VV .VA',f.V' 3-11 A f -gy 'gVfV-VVVGc-1Q:yVVgrVV-- 1--I TV?V.wV','.':-'flgr' .21 ':-f 1-4151 gf? 'V 3-Vw ,--'iffil 'Vu-.VA-iff, ,7:3V,'-Vg'y,.,gV-f'1V5 V555 5 ?j?1:Vg4,f3VVVV-::Vg:'2,QMPVQKVV',y,,W.gg4Vg5V.524QX3-fi-3 .,Q5l,q,V '- g,V4,5fVVVf5gT7335 V-WAPI5. QV,-5 f,VVi3,z!.,,,3LV..LeVN--QQ. :V 5-55.13-VVV.,f.5g!v,gwf.,V-WA N55 ,li- V.VV.f7,.1, V V. , ...V, MJ.. . . .,,.f,1, . V ..,,V,.,,.,,mVy 5 V514 . . V, .V,.V. .. .. ...V ., A. . , . ,A .. .4 ,XV V ...V 1,3 j,7f :wg Z:',,Vxg.Vw-,-V-5.1K-,-AVVVV .51--,,g VV..V .'VVVV.','g :.Vyg.4'f11gVV Vzw-Viggi-. f'Qg5,jr 4193'mfs-',',,ysf-N53-..g.f:p.fr,,-.WN a9Qffff,csf:33AV V, V.'.V'g'-V1-,VQWVJx,Vi-1:2-Vg.wVj!Zfs'V-far2-V .-f .iyf-V-pq if .1355 .xgsAf,f.-.KQV Vrlff,-if :ri-V-,:l.V--7:3 i.,VVV5'aJ4'P'-.gf-V-VJ. -fx-gg' S, V- ,Wifi VVV., .VV ,V .V,VV V, i,VV.- .1f.gj,mq.,,V55e.VfP 9,-,. - ,-,E-31.1.9.4-, ,V,iQV:f-V, Vg ,,. VV f---.,y -,VVf.. ,VA1K..g'-5, VV.5:,m.-.,.J, .. V -,,V...,V. ,VNVVJW VffkQ.,V,i..VVV :VV ,V V17 ,fe 9, ,Vx .,,,V,V,.,.J..V.,V,,: ...VV MV i, .V 1 1, ,.,,-V VEV -,V ,,,y V,,V,V..l. VV, ,-V :ww Vs- :V nfl-VVf:4gVgV--V-V-V. ,VV-V.iV.,-Vi --f1:VVQVLf'-V.wAAV,VQ-Mwg3fk5y,VQ,.' -tm 2-:ws mp.--f7VVgV'VVs V4'f.VV f-l-V-,-62,-':1:VV-:VS-..q VV:.-1'-:AVf.aVf 5.---f--. V-VfMfV'fV'5-'V VV'-WV-'-VYAQ-' V- H 1.35 ' f-1 V-V.A-?g1fV:Vf5V'-VV.SVVffV-wi-.A V'-SQ-f WJ? VV fff5VAfe'iVV1V:-'.V Cfmiifr-VVVQ Qigfg--V A .-.,',,V:V-.Vavmi -31 Vg V 3. 51f5?V1'1'...V,Vf',VQi:V-,.V','p1-If3fsV.,,f .VfVirf3sf,V:V,5 fj3QwagAQ-VV,-'- g,?gg.,,3Vff-, 54-5-, :-.,Vfw1:jQy.- i-giQ2i'gfgVVAVV-15-fVVV-. -V.VV3Q,S'V-VA'A-.fff V-1' 3 V ,,,.VjQV:-Agg'gQV'4V - il 'V 'limi-:Vis :fV'-.im-Spf'-LA-V-F554 www.ff.V'-i213-,rw 1252- J fiff2':i-4Al:i'fi Efliif . H11 V ' 1-f. f'HV:'V-s12.Vf:15fIA- V 'V V V V. ,VV V .Y-A ,qwf . ,. V,5.,,i,,V ..., V,,V,V. . .,. . . -.-,,., ... -V 4V Af'-'V'?,g1V A '- ..Ve-'f-'Jim.,c-:-:Va'.'-'.,-eeV-:V'.x.-- 36:--V ':.H-5111.3-:s2,3...VVQgw-,gbA:EV,gQM!'1Hg-.w.f,5H:!-fszgjq-V5..mf-Vfxfffxf5,.1,:,VMcfy1f-,J.VQ-,VAV,ijf.,, V.QM-gfVwwg.f5V.V,g-,. V-V35 .VV'VJV'Vf'VuV,rVVVV2 1-AH-V..gV ' . f--:pVgVVfVVVV rV, ,,.-V ,VQV-'V L-'uwgwiki-.'g2,-.Vc,-V.'V4'awe4fVf4QNViQV'1?.4VfVV:-5-sg--e 2f,:,2VVVQ,,f f '-VV:--'..1,,y-VMAV' . V y:VA-224 -- .. . J .V YVV,pC3f 5-R1 , .-,fy-V gV: :EvV':Ve:f.'.VVfVFVVZ--VVfv'fQTf.Vll' ..Vfh:Sf5g,ffifg,,,fVVVWVIVV'-9V'QMf,g:,g,VWim ,.ifAP.K1V55f:..+eV'V-3 f,fVVV1g2VQ:V+e,5.5Pi.V5Vf 1. ff.: .VV - . ...W V.. ,, .,. 4 V, , .,-. , .,V,4,, .V., x.,V,V,.V V. .V .. .,,., ., 3..,,, ,. V VVV V-VF ,, ., .,,4, Q.-,....f V.,-,V ww -V,.nV.gV,g51.- .4-,,.,71E 5, -V .. ff V- W.-,,4 .ij .hp-VV... .Wx . ...1VV..:V.. ,, ,QVJMVX V .V ., . V .. .. ,.-1. VV . V-'lf,f-f-VV.----Vw.. V- Q-4,..V,,t.4j5Vf,.fffV1t -wffgifm..-V-'V,'1..J -V 'A fir?-,-Vw'-fi-V VVf.:qV' gj,,'.jfm?:,.?if:VV if :V V'VVig-VgfqviVV.AV.VV5ifg'ggV,1'g,Vj 5 Wwgjhg4paVbKV. - .- .' fig! V3.5 JV-VW..-:fVV,,PV!VfQffVE7Q:V'3, , '::f.t2'V2 ,Bqw?aff,fdyfxg-P13-Ag?-1i65?iW,1,f.i .rjiVg.a'g.V-.V-QQ-a.:I-Q A -WV .A V. 'Ag-jlygr'-iV5VAV1'1'4 1'----,V-.f'ff,'m V1-f.V,V:'-1- ---AVVQVV-if-,3.V.'V 5wA,g.-Q-gap,1gL3V2'.-1,fgVVVVVff-5,'V..V1Hf -Wy-1V..,V2V.. 'V V-ei sg V ff jg 5351-V' A jig V3 , V' -.52 QV-ifgf,-QAAJ'f,'gfV:CV5f..5 jiggf5,rg5Vgf,jg.V-5Q15.Q.V5 gg'ff,Vf5,i5Fffg.,ijsggggV25Vf Vygxikggagg,-LQLW.Wi'fV1i,a.Qggj-fgifgf.-'QV:K,if14Q,.:,1V'V?VZV 37 'Vi' V . A. gl- ,V V. V the x -Ev' H wLVVVf21v?V'-s gi f'4rgf:fjVe3L'5V':f FY? VQ5'f.'Q5i,Jl?iav,ffI.'Q -5Qg2fVVVg.gM.'g,a: gfgrgfmjf 'L'S'I5j'Yhg s5.5,VyVg-4fx.,.. V V X V ' V' V. 5. V f-3. ,.,VgQgV.1-H.'ff.1g.':'f-'sr.agf.4V,A.-VVV-'srV5f:f-f.fg.fV,f'g.'5V'V6,.Q-5f:Vgg-'Vfgig fV,5J-235, A.fVVV:mHf554gV'VV '-',fJAV'51w+'g.g::AjxN.V,'.Vif,Aw-3- 'y'Jw,5:N-1,0-MV--.f,,,.','-isamf.-2s1Vi'1'.:1V.V.:,Mv:gv,A'-'Adm V V 'f 5-11 V.yj.1g1.j'fA 3'hf'1 f6f-9,Xi'g fr K'LqQ4Aw+,4 3L:j45MFywVFe3V5' 25'i'1i,'T.1fV'f'J'fyf?:Xv43 V' 1 'i-5iV1'4Vw:V' 4'V'?5:,g+Q..VA-V'Vi?uV.- ,1'5'fE5V 'hz 2-MV-'VIN- vif yV2 'ViV WGA'Tfiifff'-VEZVIVE 'i ' ' V V V-1-? 'HVz'.,-f-.,V3..fJSVf35, V' -. V- .-- A-1 . V,VWm.A hu? LV wi,.i..,,,..5,y -M. vii :q,j.,v?,,7J,.,4V VV., V, :.,.V45:1,-T ,Vi M54Qf4w,4!,,9,,,,5,,VV':-.VgwrgqV,.3,.,fa?5i! i.'.I.WVVgV,,Vp.,V 3VrVNg,L,.5,3,2i?.b 5,5-W1-,WMlVm.,,.,M-.-VM,:MW,.?q!i,la ,,kJ4,.x-5 Va.. A,,gV5V7.'w,QVg I -V - . ..VsVw,i,gVg,VVg. ,g,.,gg.:3Va,V,f,V:3.-QWQVVQ4-V-y gy: 'N,5fLk,,..',A1,V'V?fjr,j'y,AAkQV,fvg'Ad5f?-,3w4J4EWl1,:g.,j?'H4'F v--5-VV -- 12 VV Vg: 'V-:--gu..,VVV V-'V-V-V-'AVM,?35-V A V VV VV .. V- V VV V531?VfV3f'Jg..sVg1V:i 551. f-'-Aixfiz V5-1-4,-1A?'5-595'-V'5' 9V'VQ:3V.fVg-f5fV.VVQ.wji1ifk51':VV, 5-Vip?-.,f-1,5-IVV. .-if -ff-5 -V+ A .V V V V - Vf VVV4,-aw,V'3f5VVVwV-1,V1,-,eV,4,gV.jVVV-Q-ff -V,V:ffVV-V ,,,.jV-.V'.3---'f,,kVV.V-'VVV-,mini V -my-eiVV'p-:VVf:' -by V , -- A-V'-M-W F,V.fg:1V14'5fV.V 5.'r'V,5f--VAVV'i-VAG '-.Vf':ffxgi2 -csv'-LV3IvMfJV V'-:fl-4'f'.i:l5g!li1.wF1V, -gsfiffV17'525 1,iz'gl.--Imr',g'FVrg-Q-rf5j-55.Vfgnfg5- ,mm Vy'V-15.5,-41-VV53:Mgi.g?g55g.,a5f44k,-151531ww-'..a. M, 'V , - V :gmfL1,?pfgQf5'53EiggJfgB-33 5 V- ig 4 -WU ' J w4W5',,'2gfY ..w5FgVl.N,.i,gQ,r9t'NV.Eff2g,i 'V .'fVV . V . . V 'lift-515 ' .ae-V-Q - V-:ks .-if5fw+d.'y1-jff,..,VVfg Vffivm-s:'QVV1f-Vi.Y'?Vf-V-VV.:1WAf',5Vi'Qff.M94?QV'V?,wifgjVg..ffi5-Vi:3-V' fn-1 - -. V V :VV- 'fiagf Vs V:f5iVgQ1'g-Vj2VVyfg4V,1a V.1Vg-1:52-V':V',ViVggf1'fg.f3VV9ijVVV V' V5 giggiff1f,vf!'f .--Vnfw',,Vg:g:.:5Lfsrf,V,gvV.,'413,My 555.V3MVV..3i:,z5VVgg,VVV5 5Viw-Ev?-VgV,.fMV,w-515 5 1 . lAf.kf?Qi F 1 fVVV1V.gl?-pw- fV ,fnfy'V.V.,f.Qig2VQgVV, 'VVQ,.Vg,,wgs1f5.M'V-.qu V A V- V ' fig Vi .E-gjV,fVf'5-V., .,.k5.?1j,9fWxmV5ppV, grgg., ...ge ,fjyiifwz,jihffwjtjijxxgimk-YQQWQS.S.,4AWVVmiFg?.,2iW,?3f5fvl,1l7mag,.?,f,jSA5' . -V, X A ZAVAAE A .kg??g,,W-2,1,.f,,V.5Vggf5-j5,,V,Q-Qifwfgi5W.. -73h'fQ',1,Lv-f. Vy,,.-,,5,,'-4'ff-:1ZQgjiK1'?7'Vi5'igVKax?1, ,5'E5f'-P 1 V' 'V-f fVHfVpV.V-VV-f'V'1-1 fVv'fiV-V2.1-r--. VV-f5wzA.:f.fV-.g-QVw YV -A W-K-V .-.-f,-- ,V 1,-,:.,..Vr -.VVl-.wg-K u:,VV'w,-Vw, rug-4-, V f,-Vu:-V 14- Vmyk .mf -VM, V V. M, 1, VV .V.,,.MWV.-- ,Xf,EV,y .---fi 4- V 1,f,fN.V-,J-,-,Vg1,VVVVV5,f-1.4.134gVr.w,,4p,,V5. L,VyH-.2-,Q LV. 55319 V3 VV ,,.yV.1V-gm. -,V VV gi,-V-fV,. -5-V..-F VfQ..,.V wr,-V.f:.. 5 -- 395-.vb-X ,VwyV5,V.-,V.Q,-,p--V- V- V. ',,f,V-5.-,V,V:. :V .2,VgV,?q-V,lfjgf.75,....,'V1,,,f --w-,gm V.Vg,-,VV-V-VVVVVV-gV,,VV-...fm -.,-, .VJ 'V 'Vw-,-gr,-.,jfV4.V5VV-.sVi-V17g,qVg.-Vg ,gf--'-V rvR?gfx:rVF1fVr'1,VJ,NV7,5,,gfV5.14,AVVVHF,-,,--.1,,xf5jN,faV.,5Vug.VVf.V3VVvVVVyiVr15Qgg.g-.Exif-.V5V.,,,V-.,V , ...VV-MV VV, ,, , Wg, 1 ,M-2,ff-faq.gm-Z5-5f5VgVV, 5:35-.g .g.5,fcgQgA,.fg,V gg-.V-fxlV-qqifqqt-Q-1.,Azz-y.2eg.g,A5VV..ewcg,,V1--VVgV.y,1V.x.Q,-bj.VaV:-V.-5....z.VgVVgs.g,A1gV,.1V V-yV3Q:,.1V.Vg!V-..f-319,953fgfnfe,,V:Q54.g,1y:.541VM,,jV-V,cv,f.-V3-51,2 H?.,.,g,fH4f. .VVV lwgfq V V..V.f.eV,V,V5.VV ,U p..-4 ,V, f,...1,,,1. ,,g. .VfV.,:A,.6, v' ,J ,Vw ,mf .X -QQ , -V., ,,,i,,r,,,,V E.. V ...f V.f.,4,. 5, ,-.. ,,.gfz,rV,.VV.5J,V,gv.,.,-,.,1 -,VV,-V.,,-in .4 V.. VV? V.-.V .X ..gV.q V-V 5VV,,4. 94951551 ,VVV- VV,-Vg .VV -gym-Vg.. V.V..1,f ..qV.zV V-, 1 -AV., V.-V. V -.,V.V.V V 'fflffwy-VVf'Q1 iff.-1,V-VvV4:-f-ff?-WFQVX gf 1AfhgV'Y-V Vg:-Jg',wVVeWfVffw.f-V' Vw5,:Vs --5'1.:f. -V-1VVV-fp-CVVVVm:r- :-.V--vw -iw ,VffVLmgvfQvV'-'!:-V-.-VzV1'!Jb--ff--VfgfwWV Q :,f:,.iVVV4Q--1:VyrwVV 9VfVJ.AfG:V-1:2'V. 'cf-VVV:-swf 5- rdfifjiga:-7, -V 1-:3.,f1f--gp 'VV V55 1514,-V fidgy Abi. . V.:fg.V,jg-yV-,x.L ,,-.-5,431 ggf.V..A:g,f1-M3-Va,.'-My,.',-,, -. 5rV:.VVf9V.,-V5:V2-v . Q1 W-,V5,g's.V,' Vrfwg-1.fg'V..fg,.---:5-f-fVZVf,,Q23ig-:,ggf,5VVV4g.-V-V,-15,19igl1?w.W:':V. 1 V 5.V:.,.y, Vp., 5-5424,,VVV.,pV1gVf94,f-fi-,L+-VV ,V 555V-F.5fL7VJ.f 144 -V,c.gV+-V-gif--V' V VV,-V-:gm V. -V3 ' QQVQVQ-Q ifg6VV1.:-.fVVz. VW3,1Y4xVVig,g,5,.f'Vp+,V,5gt.33.AVL, 1.AQj,,:,5f-V5V-5f..Vgr5w.qe:..5 VVLVQVV-fp 'Ig ?a2Vj.'53?5'f.A:gj:i?A'r5Vf .V'Q.3,q.V,,,,,.,YEJ3Vr,,,j-,. 1' fV,j:A.fl3y5r-3ffgqmw Vu ffV6Vg.f,Ve5,3V2,V.,Wf+.gV5, ,,'j..'ViWigf..'faQ:i1i'g..- LV'::'YV 5 -V'-2V--FIB. --V-'Vi ' '-VV.:V5f ...sg V--3:5-'VV-V-.g,-.Vw - f,Q.VV:QV:J'-ws-,..fVV'V-VA-fan., ,f-'.1-A' :ip-Vw:fi'.s6gi,5-1 Vgg'-1-f'5S-wwf' V'-f,:'1g5VY-.1V2:fVgA' ,V:VV,V.ffg-Vgy. V -g?,1,-- -V3-4.1, V- 4-.Ugg e,,ViV-l,,f?N1V.Qw ,df,,m,,1,1,-,Vu-V -V., '9gV14.pV-5, ,.- w-VM vgf,-'-,wwf-,.1 4.--Y ,-,..-53-fgb, y-,VV.,.:pffV:1V-VVVg.:-.413-Vgg..V- -gf. -.5-,f,f,Q,:1-',Y,a:' A-rQ1,,Vy'V-.45-. 532 V,,31. 45,15-,-'yp 4 Lx-V4.6 . VVVV.VgVVqVV.q.,dV.g.,,-VfVV-,g.. -.1..: -f Vg 5' -V, -gay-1 z -.L:'Vp:f V84-Q-K pgs. -el-,V-V. VV. --Env ,iff ,, V.!V -f hf'Vf,1-.VE ..+f--V-my My ,ww VV ,f.,i,..5.V.LV.-V'-V:VMV -VJ VJ -52'l'V'-3-'4V'v--P -,ei t,5pV,fVa'g,,f3gV5 fr-f.tV1v-3-xr' Vi'-9,Frg8,w-F+MVMK.,-1,W'WA-V1V-,VSQ-gnVV-urn-,IQ-4-V3-,lg -- ff SVHVVVVVV ' 55- W5 'A 3 V' i':1'YfIA5iif 'mafwf'!iSt3'U '1' 3-'1 :wfKfV1f1:5?1?ff5 'f'35F f fi? A ' -' 73-3 A gwff--QEVVAVSVVV-V1.5-Vfigg-44-fr1V, 'MAVIV-m ?f!f.:V:V1fC5':fV-f-VMVHVVW -if Vg? VVLiv-a4V-.-Wgufi.-Vi-zfivyywfwr -'Aga-V-.'.mVVV-.gif-'fsfA-V.V . VVE55-i5,g,g!ffg1VA-1 QQVVM- cmgsya,-p f,55?iV,,,g5fmefyf5xV-gkyxt-Y ,VV-3i59,qggV4y,,V,fVM!-V-AVVV 4-1V.VV,:gVVf VV- - -5,5 -,.,f6.f:,g- n5VVV1gV,,5.,wg5'- qi, ,,.5Vf,--,VjV,Vff..lrN14.g5VKw.V.gVV. -gi.-,V-f.,g,-yyHfyex 514,-VlVpV.:V1Vg -:wg -g V -V gg, 24 -g2E?g3?s5,V'.A1,,-'-J.-:V -5gff?f-i2Qi,5.,gVV,QV.gQ1: gig ,-5.652 .5 5-,ggfffvg-9VgVjf'.-Vx:-5 V. ' hy fufggg . .V 5255-.Vw-fg1Vy,,gsgg-Vx.-im!! V'3w4f1-ggi-.zgl- rg .wg V , V. 'V QV- -,-V5:V,f,3l.,.V5py'V,1gJ,,g:1 5-5..5,.i.,W2yV5uw-,ig V--V.. gg-55 g,gg,fg,,.V,5g',,,'g.V,L5qVyVg.VV,gf,.ifyypx 15575.-VV,.y55q5-f,5,V,:'ygV.4.VV V-.Vg.aVyV-gf V Qu: ,If,VVfVV5,-1.?fV,Vf.., d.igVf,7pggX3.- fg3j,.-g.ij,:'-5 ,Vf,s,f,,1,g,?,2g,-52,,gfQ,L, ,L V .V-.gg- V QQ,-ag,3fV,f1iAf-QA-,Q x5i1l2fJfwVVJ-r'6NfJv.pef VVal'-NVVVLQWV,-.'VYW--QV.--'fmVg',.r2-551.1 Aw-:gggg.A:q-ygaf,Vff,V,,,!V,irffV,Wij.a,,Vr?fW- 4gg.Vgb3,gk.Q,?,3-4Vg,jf,,VV,5VV:,g-,Vg15,5V3.V,gV:.,,--.-gf,5.,V, 1 VV Ai W Jvfin' 164 Swiss ff- -'WESV wwf 95313214 A'-wil-13-fA'f4J-'?gfV Wi? f ? AH f'W'ff '? V Va-11: W 'igiV'VfVfV' V45 ffi 1114 -1- V IW? eff H' ex' 1 I VVfVfl:vVVf.fV9-we-.VV f'f'vkT?Vg -.V VVVVRVV Vw 5.1 . V We Vfggxggz-. yt., f?,g,g5VVVgQf.f -QVHQVVV SV 1f.'ygS1Vy-ww-,.,z::gg51:55-12:24 EQ my . fy :.', hw g55VVV ,-Q if-,1gV43..,9g.1jgQQV'V,fX.+1.:fl fV - VPVfVg,fv5Q9Qggqa..-V wg-VVV.VVg-V.V: gf.,-V V ' -V--1... V-Vg --V A?2fR,iggI.,five:,.:?, L -iq . 'V' fg5l'i-WSIS'-f.f V VV.f 55.561553 ff-'?'f:'f-kwV3Aif5: FV,i.M-Hffwxf--'YQ AVVi:5V?1!VVZV-1 fif'-512-4- V1VV-V f ffiiici . AAA-',VaV-.-V.,VVVV5V1VsV,iA,.VVwQ 21VV gVi'.- ff' 'U wig? f,EgA5ifffV'95513'-'fs?4.?f5 'PiffAfFf?iiffP5 iifiif' -fri. ZW .ViV?iVffVa-2f,f5JWV'AZVVQ5 Tip'-?Q '4V2?3V? fff ' -V - Cv -.ar-'--ffgrfgx: --gVn-1.1VfV4+,MA.!g,- ,J-N-V,V.V,.YVVi.Lv:-N ,ryg.VV-g.3.,1.1f1,.4-V.K':V,k5tk ,N .- gm-,V-,V+.,Q.iA.V,,m-1VSV- VLVVV45,-7,5 ISVMV f, -V-.V, grjisavgi.-V.. 5515315-gV.-V.,i3 V4 M,-g,.,V A,V.VfV,g-2.Vff.. VVVVVV- V V ., -V,1,?w,,,-AA!Q-5.gM.V,Q5.:Vy.'5Vz:.2'QfAV-1 ,gEV..-QV.ggi-.V.:..gV42f-Vg-Viwyywg.-fg3ig52f3,:z5 QVQHVQ-NJ,'?,,ff, '-V.-f-.gg--wir.. EV? -QVH. kg-fm-Q'd1E7T f.'q'Eg'13ivfgg.gf: WV- 114:-A-rg-gli .VV-ig?,,VwsavV::g,V,..-V'f.'?Vf1:.a5 xmV,sg:VmW,fV?:- V1 4:4-f!f.f,.WgyV,,: j,e,n+W,fVVVUwVfVAw --+2,,VM.V' V, gr K-,J,mLQ.,g,.,',4?s,515, .,2Q?'gQ?fVVVV5,3f'Q.f,5f3::,V glfgg,-,,ggx1VV,2J-fgssgq'pe,Q.. VWVA-V VV:-,V-4WHQZVgk,,i,V.,,-,,.Qq,3..,aVwfy.- V V-V .V -1,1-flew..--QVVVMV V A A LV5.,'3Vf g..VV,..V.,,-'W .-1-eV-.Vg-Vy'VVJ.VV.',fVV ,i -V V 1- gm-js'myrmwg-VVQgJVNmgVV.V.'1V:iVVVg.fV-V4Af.f,gVf-5V- ,.4xQaffdrVp31g.w-NVQ'VVV if- mdwg-.1-f-:,w' A21VAV-'WA -ff! :Li .' 14,1 Z.5VVg:.,V ?..e-.gg-gg1 3V. gl. 'g.iVg,.5-fgyggk :f.gy5.,4 QVVWNWVV g, VigV7gA'Va,.--V.-2 pf.,wgV'5v1qVggi.'VSQ:'-4. :.VV3HA:Vj.gq2 ,V-5-Vg:Q..'.g.Vg1gVf'. 'Vwggffx5f65?x?g5'afflLf3.55-Wwgfye Q Q:--5-'4'iM3'?:'.s55fff'Q-5555 Q5'?f',32jQ Vi?wi3nJ2 123.V'f1'f.A5zs:A f. f V Af VW: ,gg Q,-fVA1V,,M1Ql,5.lVV,R,,W.'EVMP-AX2fiVf'ff'?g:.g . sf..'VC5i-'5?.'.gg2V.f5VffEQf,X-39'-f'-,VV-V,,.h' PEW'-V.VV2-ZA'.Vff I f..ff'Vf3'5f'5..,.5gg2 iv 1-,7.5,fgg.Ve:V 1g3,'mfx,h-kjagqigf-,-,, V:Vu-,,J-M55,gf-A1?VVgg.35ggggm Myfgyg. g5sfg55.g5,MVi.54-M . gVV VV- - . . -5 I 5235?-w 2 f2VAf1g V Vg, -2'..,.-WVIQA-ww:--VxAg,.,f2-if'-f1'g.fi1V,V-fi'fkid a1gi:VeyVgVV-eigfkg -If:-Q33-,,,V',0 V-5-.V-2-j1VV 5: V V 'V,e- 'V 51.-gVV3.f.g. 3-diggs -vVggyVf3V...fw:'f.VVVVy5 -f1'f'YQ:gY',V'V'y ' ' Vg.. 3g3,fqfi.--VQVSV-mv. .. wiv V gwqgxgmf, dVf53:'.fVAi'Vg'Eyj.,4fQq2-VL'ef-L-'f U?0!!'fi?f.1?':.VVfft:.TW'aV- 1 1- - V .2 ' , V' 'E--Vfif-V-25'-? W..i' '- ggi. VA ,V.V:V'-ig 1 3,143-Ng.-,-5-3:.j VVVg113ifyVg,Tpf5gV'V g3'3V3g--5 ,V-ifggggg -V Ugffgj'-.irlggfggjg3'3f..'J,V. V75 ..f1JV',-VQ,'pfAg5 EE K, :g5,gV.:!2V?V?V,55.3gg, we 4.,V,.j,g,.fV..f.AEQZVVEVWV-.VV V5 -.pggqgggr f.V.fVVffM,?gg.Vg-gf? if VV 1 A VVVVVVVLQV . Q n V :Q3,.:fmi!,K5Y..,5,.-'.-cELQ,,QLgX-,VMNV VV? my ,-mV.,.:,V ,rg-.5 5,13-ggi.gVLm3,aV,-.1Vgqim-,V:,g V.wV,V.- fVg..fVQig1r-Vffwwg,gfVp55,w-,gr-MVQ, ,V-5. 1V ,QV-g','gV,-5 .-mg., -V - A - ,QQVVI-,-V,V?5gg+,'f,:A..,Vc-gpiw-wig. VVg.Vg3,:.-,..V,-3,5-A -V-f..g--V.f,-wrig- fS EQF'.1iig',AX,jlf?-Ifigi-l!'3g5',f59'2,11 ,.zV.-g,51,.V.V,Vwy. gVVVs-,ig,gg-.-,--g:.7f,'zvV'--55.4.ms-1'-:Q,V--25. Vfv- V yffw 3V -KEf3giw1V,i':fgV2f'2'V1Z,'7'5AjV'f-,5f4f,x:,fC,A5QVp5,?nw-1jf',f ',f155412-Y' -Vf,V.V-WV-LiQ--,VfVV. .V f..v,V.ZX-V55-.-EVVV, V ggrV:ffVg fs-2 g.i,e:2VV-msM,?NV-V-V. . -524.4-eg?k,fw..V,Zw,f, -VVV. ' -H K V -3 V-V Q?-'V ii, cL: f Wi., 5.2351-'E'fj.gg3:L5V2ff7'2iq 151 VV'-5, , 1- ,.'ffj,1f2:V-fag. tj., 5-,gi 3' j'Vg,V f'jy,1Vi fi 'S ,,V,3VVfv0M.351.V-,,ff,.,,,.,? 1' 1 x V -V '-f 5iVVfiff 2'Vz:fV':V'wg':V3375V-'V-Qffflk555'-fw--51-sif fi- fV'1'fifVV-C'-....f V V- ' V-j 'f'-V2. A...f+2TV -' I QM 55 -:Q1554?-:555.,jZ1pVQj55: -4 3 53,435?5559-5,L5gf,iVggf5:ix.3:ggiV,gWYV,E.,'-,'V.-VVEGQVV 1.15-X-g5:,,,43j,L..,m Vl.V1V.!VmL 9mV?Vgv..w,j JMMRQN V V g 4 A2gV?fq.il:gVi??ijV51,24gu5Zg infglihifizggiqigg25333-3,V. Vg gm :Vi 'W g vwfiff -V TVPVV-rVw,'3 W- 'fwflw-52:--f1V:'.'VVVV'Afgfffg 'Fam-ff- 135:61-'fffi-'g, VVei2'.1' FV..-'fra-1: 'V.1':.1V mf 5,35 . 4 ,VV,VV.,Q,-,-!,.,V, 6.-.V.V.-..,,,V5,g,y,M1-,-.k grgqsf .VVVV-V5z:g.,:-,Q .1-V V- .f.V 1V.- ,U .V J VV ,.. -- ,- 4 .W X, ,NJN V . 5, QV -.jg3Kg,:..,, f.p3g,fVv .,f-,A.,.gV,,gq- ' ,,V:I,g,w3,vmwnmk,,V- V.,,'.-,M,f,Q:m.,y, .-V.Q,jVVV-4 9,-, 4:,gVh,,fV, ,s- : 1g,.'1-VVVVV Vw- FVVV V, ily lt.5'27Qgi7,H-.V'f4V,::6qsV4AsfQf- -3 ' V,yyA,J1,-',f,-.F-L:,V?fNiMv,-gym -WQQVV-VVVVVnqgwy 5-QVVVVVM Q Vg-f :Vu gy -V V. V.. ...,3',V.V ,gy 1' Lv V V' '. 1fing5p3T,,'i,siV:-ma ? 'V. :-fy- v V -25 ff.-I 5. vigil -'Q-V,fD'5VV,'-f--ei:-as-'Stf--ff':1:Q Vie -'5.11g'gfV.f--' 1'-tr?-. 'wr f, Vp' A Q QJPFV .VQ535-,sf,4:-jab? WjP,'Q5',. + V Q JV V Vfjsgg 5-1 .1-V. .AV SVIV 9.1, -mm 'V5.5VV?3PwVxV'. :V -V V ',: 'y- :HV V-1' Vg' serif ' F' -51?,Vf:a5' ig '3V?Viif15fVf.A La wr wig,ggw.LVf.S?fyV.::qi'V2-fi-5-wifi Ls-eV'VVff,VfV-f .--'Q-'LV'- Q ffgi -V Y - L L -f.V:fN'VVVVV,.-iw Vfj..V,AzVQi'-VAVVVVVfV,. Vw-.g.RV..R,45VV.g.:wV -.ma V- 13,52 3jV:5?gV5'6Qa5g W gg5ii.gVA5gV W'Vg.Vf3.,V-VR,V,VM.V:,,11-53 L '- ' Fig? fav V 41 VQVVVQVV .V il 'V ,- -S Vrf-fgaw-'f:ifM,,V ,at 'far w'Vi-'g'w'Aqf-,Qf,.. V- V ,S'5.ggp,Vgi?3-3i::r,9z-...QV-V .V gf. v..V3',3.fsg'.afQzQfy,V2-.QV,VV-1V,'V':V'pVVVVPV,-. f VV gr g1,2f.5.gw.fVggf V-kQa.3gf2y1Vig.5fgLy4 A' V - VggVj:g..V,fxVg5,VV-sf-gg 'V-11-VVVVV fe.,-V.fV51w'-zV.V-eg, 'V' 1 ,Q 1,g..3-,frfig-,Vzgm-',V-.yi f ' wi:-1--!y:g Vw: V-Vw -.,.VV.'. V-.-F: I A... Q, Q 5-.5254Lbkafq-313-7-?'iQg.11322156 A5 3 V5i4ggV..V'ff':7,f..-.2p1k-'f- pu VV. , - , V, 4 V. V. v'-- Sggzasygav, a-VQVV-V:-aVV..,VVfV. 1 in X : 'aipgfgg 143 PPfYxfiV124,:iQ3, V My V, ,V VQVVVJVWV-.gf.:,'5,LJ2qVV1.V.'-Sbuf--4.11-' VJM ,.Z'V,gj V. , Vs , 1 a f' -Ig-V-Vf:V-VVV,-.VV-V 3-.V - -V -V1-iV,Vj.Vz,,.VV,,qs?5 g. g,EiVQV::g3gf-,,'VJ-g-A-233534, gf F Vifiii.-V:Afg-fi.-,jf-.W V V- 'V ' V-: VV5 QXLV-3,!24g..35fg V -25-'H ff i- VQVJQQV-Vtw-1-VVffV. gU '4fgf:-V'Li--gfrlf-Qj5iAaV-f ' S f .,51!i,.'Vp,- 'f.'Vu.'-,MSVVF Q .VV-VEEA12-VVI, 11- .,,,g3a,i!,1,,5,4Vs,V'- Vng-1g5Vc:gVgV..Vfg4Vaf V-V.-V, VVV1V.-15-VV.-.j'...V.-4, m x, -iv.. Acid.vm-4l2i'Vgg'5Vf.4V-iff wif? Y- 'vAf'.:z-y.V--V1.,- 1P?.jAVc,,5Vf-,jAff'.f3.f.V-V'-A V ffP2f'JfVfV fV My-FlVfS5jV-I5 -V . gg.g-QVQVVQ V V- .1gg5KfVY-V3'-Ag.25V,-VV,V'L:A.'5.- A fV1:VV'Vf av 5' :fd f5'i'tf4iVm . :fp agJ3'VV'f5'f1If5.2A5f'5l . ,+35ffiV:3V.V55 .. . V -gi,VV.n:.g.V?Vi.j,D ,kt -V: ,J :VVV3l,.' V:V'ff.5?.1 ig:--3-1 ' i. .49V:552?21'iiV1fi-E-, 3. Vw, W ,rVV:4iV'-al 4325 do you eat wheaties? llnoull how do you keep in such good shape? a coach is no less a participant in a sport than a player. he's been there and he has to plan and remember his students. do you think they're up for it? is he hurt bool? how muny points . . .?! a student is hardly an adonis. did you see that guy . . .? he must be the strongest guy . ll why push and punish iust to play? play with a ball? for things worthwhile. ,,-W-smirk f I k ,, K, , . H2is,rx':x,w ,-- K, ms H -L ,W .-vfwfrf., s.,s,. - ss., , A. ww-- sf- - -1 .pgs we .,,, -M,-7 , W K iaakq ' ,su ., L' 1 , ms.-few, Q ' Www' - :ff M h y. , . I W f A- A - V s,.-f I s, ,,,, J ,, . ,4 . 'A ,K . - .n ,gs -Arg I ' Q f K , 'r ' R f f , ' I W' AM - - -4 - -f W, , . .W , I f 4 . M, 4, . . we Varsity eerleaders earn NCA 'Sparkplug' Once again the Eastwood Varsity Cheer- leaders received the highest award given at the NCA camp in Lubbock. Their Sparkplug served as a symbol ot the pep and enthusiasm they dis- played throughout the school year. Under the leadership of head cheer- leader Davette Juen, Rita Chavez, Georgie Ferguson, Toni Glardon, Janet Persons, Valerie Phillips, and Sue Phillips upheld the image which Eastwood l Rita Chavez l I Georgie Ferguson 166 cheerleaders have always had. The B-team and freshmen cheer- leaders took the spirit and optimism of the underclassmen and molded it to help make the pep rallies a success. Each Friday the B-team and freshmen cheerleaders alternated in leading the student body in cheers. They also led their teams by giving them the spirit and desire to win as well as being a symbol of good sportsmanship. Valerie Phillips Davette J uen ngsfgwwfm J ezfii:Qirs,fswssssf 'mam gefffwfffa 2 i .. --i.ffe.,is?sf2are--.assi V Awww sw Hr 1 it ifwif- .mf yr' i i 3, W ' , k fi-, rf'--,iii M, - 43 ' , -..Wm ---., . .. . if ,. N. ,- ... Ar A j yu. it , ' K f V '::-. '. .. we : . ?'. 4 51- ra t.1.- . iz Q 5 1 'rlzffiwr-Slsza : 3 1 vi.. . - - i J H . -' l l i A ,r .X , . -.s.f.si- V -. -1 ,gc . - 'Y ' Uwf:i3 e if , . w . . 3 , 27 N w ilvt Q., . if ff- ,sg 3!21QKrWi'i11Q'55w sc:-.sails efsfi Toni Glurdon Janet Persons Sue Phillips B-team cheerleaders are, BOTTOM ROW: Carolyn Simonetfi, Carol Lee, Charlene Rivera, and Patsy Delgado. TOP ROW: Patsy Hooper, Sheila Jefferson, and Meredith Moegling. Varsity cheerleaders Toni Glardon and Janet Persons show Their wit as well as their spirit. Freshmen Marilyn Catt and Alice Henclley lead class yell during a pep rally. Freshmen cheerleaders are, BOTTOM ROW: Nancy Searcy, and Alice Hendley. SECOND ROW: Martha Navar, Kathy Ramsey, and Tricia Downs. TOP ROW: Lynn Paxson and Marilyn Cuff. CHEERLEADERS 167 pic 7 My L . 95 N-5 ,- , ,, .M ww 75 Q fs John Wimpy snares a pass for a first down. Strong passing attack produces 4-6 record After getting off to a slow start the Troopers matured with the season and hooked up and showed people what they could do. Utilizing a powerful passing offense, the Blue and Gold compiled a 4-6 record for the year. Quarterback Bob Bean spearheaded the aerial attack by throwing to such talented receivers as John Matthews, John Wimpy and David Crenshaw. Leading the ground game were John Eoff, Pat Henderson, and Mike Hill. Leading the vicious Trooper defense were linebackers Rick Surratt, Olon McClendon, John Cullers, and in the trenches were Chris Regan, Ted Argeanas, Tom Picken, and David Crenshaw. The Troop opened the season with a win over Cathedral by a 28-7 margin. Midland handed the Brigade their first loss with a 42-6 trouncing. Las Cruces Mayfield also downed the Troopers 28-6 in Las Cruces. Artesia ran into trouble against the Troopers but got a break in the last quarter and sneaked by the Troop 25-15. Ysleta was surprised by the Brigade during Eastwood's Homecoming with the Brigade soundly stomping the Indians to the tune of 35-12. Opening up in the district play the Troop was downed by the Burges Mus- tangs 41-7. ln the following game the Brigade blasted the Andress Eagles 27-21. Coronado handed the Brigade their second loss in district play 40-19. The Irvin Rockets were belted by the Troop 42-6 in the last home game of the season. In the final game against Austin the Troop lost 43-28. Olon McClendon 1831 turns around after catching a Bean pass and challenges a Cathedral defender. FOOTBALL 169 Troop trounces Cathedral 28-7, Utilizing a strong passing offense, the Troopers walloped the Cathedral lrish 28-7 in the season opener. Quarter- back Bob Bean tossed two touchdown passes to end John Matthews. Halfback John Wimpy also added two pointers for the cause. The lrish could only muster one touchdown pass from the talented quarterback Mike Odell. Doing outstanding defensive work were John Cullers, Rick Surratt, Ted Argeanas, and Tom Picken. The sec- ondary completely shut off the heralded Irish passing attack with three inter- ceptions, one each by Jesse Whit- tenton, Rick Coon, and Pat Henderson. Traveling to Midland, the Brigade was stunned by a speedy and big Bulldog team. Eastwood drew first blood when Bean scored on a six yard sweep around left end. The TD was set up when David Crenshaw snared a Bean pass and romped fifty-one yards before being wrestled down on the six yard line. Midland got two big breaks when they intercepted a pass and returned it fifty-six yards for a TD and they broke a punt return for six points shortly before the half. The Troop came out ready to play in second half but was unable to score again. Midland went on to win 42-6. The Troop suffered its second loss of the season as the Mayfield Trojans downed the Brigade 28-6 in Las Cruces. Trying to platoon their offensive and defensive teams, the young Troopers were out-experienced by the veteran Troians. Playing spectacularly on de- fense were seniors Olon McClendon and Rick Surratt. They led the junior-filled defense in a valiant effort. ln the second half the Troopers fought like madmen but the Trojans had iumped out to an early lead and were not to be caught that night. The Troop had a TD called back when Scott McGriff picked up a fumble and scored after the whistle had supposedly blown. One score however did count for the Brigade when John Wimpy plunged to paydirt on a two yard dive. The try for two points failed by the Troop. McClendon was credited with nineteen tackles while Surratt tallied sixteen. Surratt also intercepted a pass. Jesse Whittenton and Bob Bean also did some hard tackling for the Troopers. The iuniors playing a good game were David Coast, Dennis Koehler, David Crenshaw on the line, while Jesse Whit- tenton, Rick Coon, Glenn Villarreal, and Jim DiAngelo patrolled the secondary. Spirit expressed by the Troopers was outstanding showing-up the Troians who had fewer fans than the visiting Troopers. Linemen for the 1970-7'l varsity football team Koehler, Bill Jacobelli, David Coast, Carlos Silva, Picken, Randy Eggemeyer, Scott Key, Paul Regan, are, BOTTOM ROW: Coley Meyers, Robert Egge- Richard Artelejo, and Steve Steele. TOP ROW: Gary Hedrick, Roderic Lee, and Chris Regan. meyer, Steve Hastings, Rick Surratt, Dennis 170 Ted Argeanas, Ted Olson, John Cullers, Tom strong passing foils opponents Chris RegonC65J brings down an lrvin Rocke? while David Coos? comes in to help on The ploy. SS? A5 L K 1 is Bucks and ends for the 1970-71 varsity foot- Gary HU9l'l6S, -l0l'n Eoff, Mike Hill, RYCIK Bob Bean, Phil C0l'dOVG, BuclcY Caflef, J0l1n bull 'Bam Ure: BOTTOM ROW: .lim DiAngelo, Porfer, John Wimpy, and Glenn Villarreal. Muifhews, Robin Rich, and Felix Loya. Rick Coon, Lonnie Nordell, Jesse Whiifenfon, TOP ROWI PG' l'l9FICl6I'S0H, David Cl'9l1Sl1f-IW, FOOTBALL 17' Rick Coon i221 and Jim DiAngelo i2ll shoot down an Andress Eagle os Rick Surratt C66l, Chris Regan C65l, ond John Eoff 1321 come in to help Speed over Artesia's Bulldogs invaded Eastwood Stadium for what was believed to be a field day for Artesia. Much to the surprise of Artesia, the Troop came ready to play and hit Artesia like they've never been hit before. In the first quarter, the Troop moved up and down the field but were unable to score. At the end of the first period, the score was in favor of Artesia 6-0. The spirit of the fans was so great that it was clear that the Troopers had no intention of rolling up and quitting on the defend- ing New Mexico State Champs. The second half saw Bob Bean score a TD and Pat Henderson kick a field goal to narrow the score down to 'I8-'I5 in favor of Artesia. In the fourth quarter, with the score still l8-l5, Artesia broke a 87 yard touchdown run to give them a 25-T5 advantage. The Troopers were unable to get on the scoreboard again and Artesia eked out a 25-'l5 victory. Playing outstand- ingly for the Brigade were Chris Regan, David Crenshaw, Tommy Picken, John Eoff, and Lannie Nordell. 172 Q Q f T Bob Bean leaps into the end zone for a score behind a big block from John Cullers C641 John Matthews stops a T-Bird iust short of the goal line during the Eastwood-Coronado game. Bouncing back from three consecu- tive setbacks, the Troopers romped over Ysleta at Eastwood's sixth an- nual Homecoming game. The first Trooper score was set up when Tom Picken recovered an Indian fumble at the six yard line. Bob Bean then hit John Wimpy in the end zone for the first score. Bean then kicked the PAT for a 7-0 lead. With a 7-6 score and time run- ning out in the first half, Bean fired a pass to David Crenshaw for a twenty- seven yard TD strike. In the second half, Bean again hit Wimpy with a six yard TD pass. Bean's kick was good for a 20-6 lead. On the following kickoff, Scott Mc- Griff recovered an Indian fumble. Four plays later Bean went over for six points. The Brigade's final score came when back-up quarterback Glenn Vil- larreal found John Matthews all alone in the end zone for a twenty yard toss and six more points. Bean con- verted and the final score was 35-12. During the Artesia game quarterback Bob Bean takes a time out to discuss the next play with coaches J.C. Gotcher, Alden George, and Todd Ware. FOOTBALL 173 Team fails in district Opening district play, the Troopers were downed by the Burges Mustangs 41-7. The Burges offense got several breaks in the first half and cashed in to build up a strong lead at the half. The Troop could only muster one score as Bob Bean hit John Wimpy on a ninety yard scoring click that saved the Troop from a shutout. The conversion was good, giving the Brigade seven points for the night. The Mustang of- fense continued to prevail and they ended up with their first district win. Coming off the defeat by Burges, the Troopers bounced back by sur- prising Andress 27-21 for the Troop- ers' first district win. The Troop wasted no time and they scored the first time they got the ball. Olon McClendon snagged a Bean pass and rambled to the three yard linep two plays later Bean scored on a sneak. Pat Henderson kicked the extra point and the Troop was out in front 7-O. The next Trooper score was set up when Henderson romped fifty yards with a punt return before being knocked out of bounds on the twenty-six yard line. Mike Hill then broke away from three Andress tacklers and scooted twenty-six yards for a TD. Henderson's PAT was good and the Brigade was out in front 14-0. The Troop scored when John Eoff soared seven yards to pay- dirt for the Brigade's third TD. The PAT was good and the Brigade reigned 21-0. Andress scored early in the second half but then was completely shut off by a vicious Trooper defense. Late in the fourth quarter Bob Bean sneaked over from two inches out and put the Troop out in front 27-21. In the last quarter with fifty-three seconds showing on the clock, Andress' Cooper caught a flare pass and started sprinting toward an Andress victory. His plans were foiled when Rick Surratt blasted the Andress runner and forced him to fumble. Eastwood's Jim DiAngleo came up with the pig- skin and the Troop lust ran out the clock for the 27-21 upset. 174 John Wimpy f44l contemplates his future as Bob Bean 1101 wishes him good luck. Coaches Alden George and J.C. Gotcher intensely watch the action during the Homecoming game. The Trooper backfield uncoils as Bob Bean C101 hands off to Rick Porter f31J up the middle. Captains for the year are John Cullers, Rick Surratt, Bob Bean, and Olon McClendon. Traveling to Coronado to play the high- ly touted T-Birds, the Troop played the favored Coronado team to a 19-19 tie throughout the third quarter. Opening in the fourth quarter the roof caved in and Coronado scored twenty-one points to defeat the Brigade 40-19. Mike Hill scored for the Troop on a four yard dive in the first period. David Crenshaw playing a spectacular game, set up the TD on a fifty yard pass reception. Crenshaw scored a TD of his own on a twenty yard pass from Bob Bean. ln the final stanza the Coronado offense set the scoreboard lights blinking by scoring twenty-one points in six minutes. The Eastwood offense was com- pletely shut down cluring the last quarter until Bob Bean finally hit John Wimpy for a score. lt was too late however, since the T-Birds had built up an insurmountable lead. Glen Villarreal came into the game for Bean and the Troop showed a little progress. However, it was all but over and the final score was 41-19. FGOTBALL 175 Troopers blast Andress, lrvm teams Playing the last game of the season, the Brigade was surprised by Austin 43-28. Bob Bean threw two touchdown passes to John Wimpy, who was playing the finest game of his life. Wimpy also ran over for six points from two yards out to give him eighteen points for the night. Despite the fantastic effort of the fleet-footed Wimpy the Austin of- fense was too much for the Troopers. Chris Regan and David Crenshaw, two of the finest defensive ends in town, had their hands full all night with the sweeping backs from Austin. Regan and Crenshaw along with Rick Surratt, John Cullers, Olon McClendon, and Ted Argeanas came up with most of the tackles for the night. The Troop offense could only muster one more touchdown, a one yard plunge by Bean, besides Wimpy's eighteen points. Bean's score was set up when Scott McGriff, a talented end who was used little this year, caught a thirty yard bomb from Bean and was hauled down on the three yard line. McGriff played little but when he did get in the game he came up with some big plays. Playing their last game at Eastwood stadium, the seniors led a fired up Trooper team to a 42-6 stomping of the lrvin Rockets on November 6. Scoring the first time they got their hands on the ball, the Brigade went out in front 3-O on a field goal by Pat Henderson. The very next time the Troop got the ball, John Wimpy snagged a pass from Bean and scooted forty-six yards to paydirt. Bean's PAT was good for a 10-O first quarter lead. Bean scored twice in the second quarter from forty-three and six yards out giving the Troop 23-O advantage at halftime. The second half saw John Matthews score on a touchdown pass from Glenn Villarreal to widen the margin for the Brigade. Villarreal scored into the end zone from five yards out for the next Trooper score. Junior Scott McGriff showed his talent by snagging a Villar- real pass and outsprinting everyone. This ended the scoring for Eastwood. Playing before the home crowd for their last time, the seniors got their victory 42-6. Selected to the 'l-AAAA all-district team were Rick Surratt and Jesse Whittenton. l76 Bob Bean desperately tries to elude Mike Hill sprints for the goal line as an Andress defender takes chase in futile pursuit. Coach J. C. Gotcher took over as head football coach after coach Fred Harvey announced his resignation at the close of the season last year. Assisting coach Gotcher this year were coach Todd Ware and coach Alden George, who returned to Eastwood after he had left his coach- ing position at Andress High School. Working with a small but tough line, Mr. Gotcher possessed perhaps the finest trio of lineloackers in the city. The offensive backfield showed sparks of greatness but since no same back- field was used consistently the runners had no time to iell. The Troop was gifted with a great wealth of talent both on the line and in the backfield. The Brigade's record for the year does not display by any means the capabilities the Blue and Gold possessed. The Troop placed only two members of their squad on the all-district team although many of the Trooper gridders merited the award. The two making the team were Rick Surratt, a linebacker, and Jesse Whittenton, a defensive back. Jesse Whittenton runs into trouble in the form of an Irish tackler after receiving a punt. FOOTBALL 177 Injury proneIV's see1-7 year Members of the 1970-71 B-team are, BOTTOM ROW: B. Belknap, G. McCarthy, S. Johnson, J. Price, E. VanNortwick, L. Whittenton, T. Donovan, and P. Voorheis. SECOND ROW: R. Lange, P. Johnson, R. Lewis, J. Segapeli, H. Lide, N. SEASON RECORD Eastwood 62 El Paso High 6 Eastwood 20 Bel Air 28 Eastwood 24 Riverside 40 Eastwood 6 Burges 14 Eastwood 28 Andress 34 Eastwood 6 Coronado 12 Eastwood 6 Irvin 12 Eastwood 14 Austin 16 Dan Eoff C211 brings down an Austin Panther, while Bud Belknap comes in to help out. The B-team, plagued by injuries to key players, struggled to a 1-7 rec- ord winning only the first game they played. After they stomped El Paso in the season opener they were hit by serious injuries and dropped their 178 Falcon, S. Hanson, and D. Cobb. THIRD ROW: A. Dunlap, coach Art Howard, K. Nelson, H. Hale, F. Heibert, J. Young, R. Parker, S. Thompson, J. Cope, R. Parsons, M. Chazco, M. Diaz, S. Nelson, L. Taylor, E. Cooper, and coach Doug Littleiohn. TOP ROW: D. Eoff, N. Brown, M. Fraga, M. McGinnis, D. Price, D. Cook, G. Craw- ford, D. Rinker, R. Barnes, E. Shugert, and S. Son. next seven games in a row. Possessing good size and speed, the JV will form the backbone of next year's varsity team. If not for the crippling iniuries the B-team would have been a strong contender for the district crown. Never out of a game, the JV's lost four games by one touchdown or less. Coached by Mr. Art Howard and Mr. Doug Littlejohn the B-team dis- played a determined attitude and a never die spirit. The freshmen, guided by coaches Richard Roragen and Joe Varro, sported a 6-2 record, the best record pro- duced by a Trooper grid team during the 1970-71 grid season. The spirited yearlings were instilled with a great deal of pride and determination which drove them on to victory. The secret of the frosh's success was teamwork and unselfish attitude. The frosh sacrificed long hours on the practice field to become the first winning freshman team in the history of Eastwood. According to Coach Roragen there were no stars on the team, rather the whole team pulled together with one main goal in mind . . . victory. The young Troopers jelled early in the year and, displaying a devastating running attack, romped over their opponents in the manner intended for a true team. The pride displayed by the freshmen gridders was an inspiration to all of East- wood and especially the freshmen class. Jack Lemmon C201 hauls down an end from Ross. Eastwood 12 El Paso High 6 Eastwood 24 Andress O Eastwood 24 Irvin 0 Eastwood 0 Ross 30 Eastwood 55 Jesuit 13 Eastwood 26 Burges 14 Eastwood 18 Austin 14 Eastwood 18 Coronado 30 Freshmen are best in history Members of the freshmen football team are: BOTTOM ROW: coach Richard Roragen, Mike Conroy, Victor Goldman, Jim Zeilsdorf, Dennis Harrod, Steve Belknap, Billy McCuaig, Harry Beaver, Peter Perkins, Ricky Kepler, Scott Edwards, John Kays, Jay Arnold, Carl Guerra, and Jimmy Bean. SECOND ROW: Mike Gray, Mick Long, John Chestnutt, Steve Lemmon, Charlie Creek, Ronald Stevens, Ronny Boyd, Greg Heuschkel, Bobby Moeck, Barry Gardner, Mark Inman, Ed Hicks, Mike Townsley, and coach Joe Varro. TOP ROW: Mike Wood, Jack Lemmon, Scott Blair, Mark Urey, George Pendergrass, Fred Spain, Bobby Skaggs, Joe Christopherson, John Ferguson, David Mentor, John McClain, David Williams, Buzzy Murry, and Charlie Myers. FOOTBALL 179 Super-iumper Randy Anderson leaps unbelievably high as he lays in two points against Midland. LaSelle Taylor demonstrates his pin point shoot- ing as he cans a couple against Bowie High. : ii! After winning two early season tourna- ments and compiling a 20-I pre-district record the Troopers entered district play. The first round of district play was a nerve-racking experience for the Troop as they dropped two in a row to Burges and Coronado after trouncing Andress in the opener. Nursing a 'l-2 district record the Brigade nipped Austin 53-51 as David Lucky hit on a last second shot. The Irvin Rockets surprised the Brigade on the Troop's home court and held off the Troop for a five point win. The second round of district play began with Coronado way ahead of the crowd with Austin, Irvin, and Eastwood at least three games behind. The Troop squeaked by Andress by one point and then romped over Burges on Eastwood's home court. Randy Anderson and LaSelle Taylor led a hot shooting club into the Coronado game as the Troop mangled the T-Birds. Although Coronado was once in the lead for the crown they were now out of the running. Austin again fell to the Troop in another close game and the district lead was a two way tie between the Troop and Austin with Irvin close behind. Irvin once more defeated the Troop in the final game of regular district play. Austin also lost and that made it a three way tie between Austin, Eastwood, and Irvin for the district championship. The teams flipped a coin and Irvin was awarded a bye while Austin and the Troopers battled it out in the first game at Memorial gym. The Austin press was too much for the Troop and the Panthers pulled the game out as they beat the Brigade 87-76. The Troop ended the season with a 26-6 overall record. Post man Mike Miller i355 tries a reverse layup against Ysleta and is fouled in the process. Armando Dominguez launches ci high arching shot over the head of his Alamogordo opponent. ,annul ,A if f A . X Jw,,.4'-M' jf ,Q haul' ' f -4' 9331- , ,f Si Q S Q ' k 5 , ,,.. fazgzfl w f , Nu- , 1 4 I 'f ,Q , X S X ,X ,.. V gif, , LQ ::' ai. 1, ,- 5. vii K ug -We mg ,, ,,.,.LL5,,W,, E W.W, V 9 . ,iw 'Qui- , .4 ..,,. wif 'f n .1 -L . 1,, , L f gg f L :w w y sm H Q 'wif 'V Troopers win 1 straight games Coach Bobby Lesley returned for the 1970-71 basketball season with only five returning lettermen, and a few B-teamers, and one freshman up from last year's team. Picked dead last in the city, the Cinderella Troopers calmly stomped Jefferson in the season opener 95-70. Senior Randy Anderson led the onslaught with twenty-nine points aided by sopho- more sensation Mitch Henderson who dumped in twenty. Alamogordo then felt the wrath of the Troop with a 61-59 defeat. Ysleta and Bowie then fell to the roundballers and the Troop caused a few eyes to blink. The Troopers pulled a few upsets in the Eastwood Invitational Basketball Tournament by defeating two of the 'M 182 most highly touted teams in west Texas, Amarillo and Lamesa. The hoopers won the tournament and were sitting on a 7-0 record and were the only unbeaten team in town. LaSelle Taylor, Randy Anderson, and Mitch Henderson were named to the all tournament team. Bowie was the next victim and then Midland Lee fell to the hot shooting Troopers who were led by Randy Anderson's thirty points. LaSelle Taylor and Randy Anderson shot down El Paso High and Jesuit with their fantastic outside shooting and the underrated Troop was sporting a 10-0 record and still remained the only un- beaten team in town. Next came the Ysleta Tournament and in the opener the Troopers got a close shave as they nipped Cathedral by only three points. Alamogordo was the next opponent but their attempt was in vain as the fired-up Troopers bombed out the Tigers. ln the championship game Ysleta was squelched by the Troop and LaSelle Taylor and Randy Anderson were named to the all tournament team. The Troop's win streak was finally broken in the Hobbs Tournament when Plainview downed the Troop in their sec- ond game. The Troopers defeated Abilene Cooper in their first game and Farmington High in the last game. LaSelle Taylor was named to the all tournament team. LaSelle Taylor K2-11 leaps high into the air with a driving layup against the Bowie Bears. Anxiously waiting the rebound for the Troop are Randy Anderson C121 and Mitch Henderson 1301. Mitch Henderson C301 dumps in two more points against Lamesa during the Eastwood Tournament. 'wugae 'WQMN l.aSelle Taylor and Ronnie Phillips present Mike basketball last year. During the Labor Day swimming accident and is now undergoing Jarvis with his letter iacket which he earned in weekend, Jarvis was seriously injured in a treatment in Gonzales, Texas. ffgr if ilfqijgy Q I . 'V I , iivimf Y?-grafts' 7 2'--V M X ,. Viisif i pi,-if A ' i , L ,, . .r. H Vifii yxriixf . X . V .,,. ,fy ' 5 s VT gg ' L s, AEST ? i i ,. W QQ! -- 21, L i'i- ' ' .Q aan 1-A r V W 1. ,W F L 'S ifgigigfl 'X -Lywig A ' he - ' 19, J , , i.,ii,,.. , L2 ,s.L K A 5 E i f Ezkl. g A F ' A . E ' , i5.L5Q' H T Aw. - I 1- . ,- , .N ,fi A , , a sk Ken Ramsey C431 and Mike Jones MU battle an Indian for a rebound during the Ysleta game. David Lucky and Mitch Henderson discuss strategy of an upcoming play following a time out. BASKETBALL 183 n , ,g1,gg555f5ggd, f. ,Q f-,. ww, at gi ,fi 2 5 . W nn A - . W' 5 1' ., VJ- gwfgw 312 if W ahh S' . Q2 i is may me 4 22' 13' A fi O Q49 . sk , .... ..,.. , 3 :QM W, PM mmbmfix Wg ,, I A if .f Q!- 2' Q! 1 . I fg hm Q' .V ' dmviwsvmlyzfisfkimfwf fvzyfm, .x,., .. , nfglwf,-M4355 .,,.,. ..,, 5.1-gyiy,-P,wffih .M -MSQ W M , 14 wil V , , W, M q,,,, ,- l , I 1 - XE 4 il . 5 Q 552 y A , 5 'P ' H ' z . Q X L 0, N K , -3, , 'T - .. .rl ,. 5 5 , as , , ,Av, ,. ,V My M,fw,:?M,.Aw Ay ,f ' at ,A 1 fp, ff' fly, 4 , ,, A, , ,m:, H M my . wgww ,fy 1 vE,,w-swf District play brings injuries to team Coach Bobby Lesley's cagers reached the high point of their season when they edged the Austin Panthers in their in- famous Panther Pit 53-5l. Sophomore Mitch Henderson was the point producer for the Troop as his hot left hand pumped through nineteen points to pace the Brigade in scoring. Senior David Lucky was the hero of the game as he sank a ten foot shot with only two seconds left in the game. Bedlam reigned as Lucky was smothered by players and fans alike, each one wanting to congratulate, hug, kiss, or just touch their heroic player. To Lucky that night was perhaps the greatest night in his basketball career at Eastwood High. SEASON RECORD Eastwood Jefferson Eastwood Bowie Eastwood Ysleta Eastwood Alamogordo Eastwood Lamesa Eastwood Amarillo Eastwood Bel Air Eastwood Bowie Eastwood Midland Lee Eastwood El Paso Eastwood Jesuit Eastwood Cathedral Eastwood Alamogordo Eastwood Ysleta Eastwood Abilene Cooper Eastwood Plainview Eastwood Farmington Eastwood Jefferson Eastwood El Paso Eastwood Andress Eastwood Jesuit Eastwood Burges Eastwood Coronado Eastwood Ysleta Eastwood Austin Eastwood Irvin Eastwood Andress Eastwood Burges Eastwood Coronado Eastwood Austin Eastwood Irvin 186 LaSelle Taylor C241 launches a two pointer against Midland Lee as Randy Anderson watches. A Rebel stares in anguish as Randy Anderson drops in two of the thirty points that he scored Little Terry Denham zeroes in on a two pointer as his Ysleta opponent would rather not look. Lucky defeats Austin with two seconds left ,I is . .Q ..,. , teesifwim. t Eastwoocl's roundballers established yet another record during the l97O-7l cam- paign. Coach Lesley's basketball team this year won more games than any other previous varsity basketball team in the history of Eastwood. This new record along with the team's fifteen game winning streak establishes them as one of the finest if not the finest team ever to step on a basket- ball court at Eastwood. The secret to the fantastic success of the Cinderella Troopers was really quite simple. ln the past, Eastwood's basketball teams would have to rely on one person and one person alone for their success or failure. Doubtless there have been some great players at East- wood but no one man can be the team in basketball. This then was a problem that this year's team solved. Team work was the factor which allowed the Troop- ers to display a balanced scoring at- tack that seldom was seen at Eastwood before. Randy Anderson led the team in scoring followed close behind by LaSelle Taylor. Mitch Henderson, a sophomore, was third high scorer for the Troop. David Lucky, Mike Miller, Armando Dominguez, and Dan Warwick also scored big for the Troop. David Lucky f5lD lets loose with the two points that won the game against Austin High. Armando Dominguez 1241 surprises his Coronado opponent as he lays two up on the board. BASKETBALL 1a7 Ll...l4 Under the direction of coach Joe Varro the B-team compiled a 21-6 overall season record and 6-4 record in district play. Kevin Taylor was the playmaker forthe JV's and, along with Duane Banks and Richard Deba, totaled most of the points for the young Troopers. Deba came through with a fantastic per- formance against Ysleta when he set a new B-team scoring record as he dumped in 42 points. Bank's fantastic jumping ability enabled him to leap high above his opponents to pump in points for the B-team. Milton Barrow at 6'4 and the 6'6 Deba added great strength on the boards as they dominated the caroms for the team. Mark Fraga and Jeff Reinhart dis- played their good ball control as they broke up many full court presses. The JV's combined their speed with their fantastic height to smash most of their opponents during the season. On occasion the big boys, Deba and Barrow, would get in foul trouble, but along with Fraga and Taylor would keep the team on top. Whenever one of the guards got into foul trouble, into the game came Reinhart to keep the momentum going. Such depth al- lowed the B-team to tire out the adver- saries and then put in a fresh player to continue the pace. EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS EHS SEASON RECORD Riverside Bowie Ysleta Bel Air Jefferson Andress Burges Bowie El Paso Jesuit Ysleta Andress Austin Jefferson El Paso Andress Jesuit Burges Coronado Ysleta Austin Irvin Andress Burges Coronado Austin Irvin Mark Fraga C221 lays up two against Andress Height, speed produce for jV's Members of the B-team are, BOTTOM ROW: Bobby Dennis, manager. TOP ROW: couch Joe Righqrd Deba, Milton Barrow, Jon Bertku, Gordon Dunaway, manager, Paul Heinlein, Bill Varro, Duane Banks, David Spindler, Tom Bleakly, Jeff Reinhart, Jeff Smith. Thomas, Mark Fraga, Kevin Taylor, Steve Nelson, l88 Freshmen have brilliant season Coach Richard Roragen produced one of the finest freshmen five ever at Eastwood during the 1970-71 campaign. Putting together a 16-4 record, the freshmen proved a tough team to beat in every contest. Other starters were Jerry Ven- able, Fred Spain, and Mike Ceniceros. The height of the freshmen team was hampered greatly due to the iniury of big Jim Bill Crenshaw early in the season. Although small, the freshmen made up for their lack of height with their aggressiveness. Once more the freshmen have pro- duced a top flight athletic team that Eastwood can really be proud of. The yearling roundballers proved a great as- set to the Trooper basketball teams. DHJX SEASON RECORD EHS Riverside EHS Jefferson EHS El Paso EHS Jefferson EHS Ross EHS Andress EHS Andress EHS Ross EHS lrvin EHS Ysleta EHS Burges EHS Austin EHS Coronado EHS Andress EHS Ross EHS lrvin EHS Ysleta EHS Burges EHS Austin EHS A Coronado Keith Pickett 1221 is fouled by a Ross player Members of the freshmen team are, BOTTOM Mike Ceniceros, Paul Andow, John Parsons, Fred Spain, Bob McNichol, John Chestnutt ROW: Victor Goldman, manager, Mike Conroy, manager. TOP ROW: Mike Grey, student trainer, COClCl'1 RlChard Roragen. Russell Bellamy, Jerry Venable, Oscar Barcena, Keith Pickett, Jim Bill Crenshaw, Karl Stanford, BASKETBALL 189 Junior hurler Scott McGriff fires his fastball to- ward home while he warms up before a game. Three year letterman Bob Eggemeyer grimaces as he smashes a pitch during batting practice. Troopers seek to win second district title V Coach J.C. Gotcher's diamondmen re- turned for the 1970-71 baseball season with only two senior lettermen and a wealth of young iuniors. However, Glen Villarreal, a returning junior, provided an experienced glove in the infield due to his two years of varsity experience. The two seniors, Robert Eggemeyer and Pat Henderson, wielded the big bats as the Troopers fought to uphold the tradi- tion they created by capturing the Dis- trict 1AAAA crown in 1969. Dan Warwick, a talented pitcher, re- turned to lead the moundmen. Other pitchers are Mike Miller, Tom Lyons, and Scott McGriff. Compiling a 4-6 record in district last year, the Troop, developed homerun hitters to better last year's mark. Long ball hitters include David Crenshaw, Robert Eggemeyer, Glen Villarreal, Pat Henderson, and Dan Warwick. District competition gets tougher each year and to meet the demand the Troop worked especially hard on bunting and base stealing. Possessing great athletes, the Brigade trained hard and long for the 1971 campaign. Gotcher's guys started the season with the district crown planted firmly as their goal. I Glenn Hoover gives aid to the outfielders as he hits them balls to improve their fielding. Paul Vaughn scoops up a hot grounder as he strives to improve fielding during practice. Jim DiAngelo puis ihe tag on larry Hicks as he slides info third. The hardballers start working out in February for the 1971 baseball season. Veteran Pa? Henderson snags a line drive as his ieammafe Bob Bean backs him up on the play. Coach J.C. Gofcher hits grounders io his infield in preparation for ihe opening game in March. BASEBALL '91 Hardballers read for new season In 1969, under the direction of coach J.C. Gotcher the Eastwood hardballers won the District Championship in District 1AAAA and then lost in the bi-district title games to Ysleta. From that team all the players are gone except Glen Vil- larreal, Robert Eggemeyer, and Pat Henderson, with Henderson being the only returning starter. These three lead the 1971 Trooper diamondmen in pur- suit of the crown once again. To reach the peak of perfection is the aim of the fighting hardballers from Eastwood. Baseball is composed of many intricate and basic fundamentals alike that require much time and sacrifice to perfect. The Trooper practices last long after school and often until sundown. True devotion and dedication was the theme of the baseballers as they set out in hot pursuit in March after the illu- sive district baseball crown. ,lv Glen Villarreal steps on second base as he begins a double play during pre-game warm-ups. First baseman Allan Johnson receives the throw from a fellow infielder to put out a runner. Clark Larson makes a valiant effort to snag a shoe string catch during fielding drills. 192 Rick lSwee1' Peoh Smith speeds around third base and with o confident look heads for home. E 52 fs sf 'if 3 W Va ae fx? T? 2 Yi E? ya fa 13 H 2 if ,Q Southpaw chucker Tom Lyons shows his good form os he hurls o curve bali towards home plate. Bob Ashworfh swings during batting practice. BASEBALL 19:4 L A is 5523 5 i 1 55323 R sie. es., ss, is yefifffie sys, .message Safely clearing the hurdle, sophomore Steve Baustert practices daily to improve his skill. Junior Van Townsend demonstrates his unique talent as he hurls the discus during practice. wt Q ,ws ss1t5l,,,wmgw: sm.: dressy- efsswr-1'ff: Sig ,gt 5 K 5, ,,,fs,-pu,f,,-3. ,.1svs:q,:w-g, cw.slfsiwfsffwvsz.A-M1111-H11fly. 1 ell:'gfX1.w1T5I:s's5g,gf51I:iie5iss?3sfLf2giEfi s f'ES' Yffi-F:125Q'Lzz1'ftEli5ffwfsislu' ' i A ISA 1 ,tll,etf,,,b. M t,,Q1 i,i lsytsi stt1Q,' 1 -,,.1,1Q-: Q ..1-tt1 ,t.e 11,2-2 -f :say is tr siggemssgtmgssis Q Trackmen strain, strive toward '71 Cinder year Coaches Todd Ware, Art Howard, and Doug Littlejohn returned for the 1970-71 track season after the team was barely edged out of the district crown last year by Burges. John Eoff, Steve Baustert, and Rick Coon lead a strong assault in the hurdling department as these three are considered among the best in town. Walter McCoy, a transfer student from Burges, added speed to the 440 along with Chuck Vogel. The 880 is another strong point for the cindermen as lettermen Steve Spillman and Dennis McElveen lead the way. The sprinters for the tracksters are fleet-footed Glen Crawford and Gary Hughes, two sophomores who will kick up dirt in the faces of many opponents be- fore their careers are over. The weightmen for the Troop include Mike McGinnis in the shot put, and Steve Hastings and Larry Stead in the pole vault. Van Townsend is a strong con- tender for the district title in the discus. After being edged out of the cham- pionship last year, the cindermen have been training harder than ever before for the 1970-71 season. Spring may bring laziness and daydreaming to others but to Eastwood's track team it means a time for hard running in the hot sun and another shot at the district crown. st , , S .,,.,. .. r, new X -lf: ' ,- ' 7 9 .- f 1'I2ff2gsfE?1fii,1f' -W .. K H i f W-seggj' '- f if F Glen Crawford receives the baton from his teammate Gary Hughes during a sprint relay race. ' iii-- wi sg ,,.- 7,1 . k.kk - .kk, : 1 , 1 '.'i , 'ii i is 'riff I 1' 1 Larry Stead shows great concentration and deter- mination as he pole vaults over the bar. K. Members of the varsity track team are, BOTTOM Winholt, R. Alderete, O. Martinez, J. Young, Steud, V. Townsend, N. Falcon, S. Spillman, ROW: K. Sherlin, C. Carter, W. Soza, D. Gentry, T. Rasco, B. Willeford. THIRD ROW: R. Arteleio, E. Janousek, B. Benford. TOP ROW: S. Baustert, W. McCoy, J. Ferguson, E. Olivares, C. Vogel, G. Nakovic, T. Arnold, M. Torres, P. Johnson, G. Hughes, D. McElveen, J. Eoff, R. Cook, Man- G. Mahaffey, G. Cordova. SECOND ROW: D. B. Santiesteban. FOURTH ROW: S. Hastings, L. agers are G. Brinker, A. Sewell, W. Buie. 5 5 l .WV V Glen Cordova, Doug Gentry, Tony Rasco, Dan Janousek, and Kevin Sherlin anxiously await the sound of the gun that -2' wiv-'A .. .. 74 l 14 ffl X ' 1 fa.. 55 '1 45? ' is A F52 WZ? 17' 5, . 'fc 1. gf I I r In gf , A ii.. is 'gif'f1ff iff? ' V , 5,99 '. fx - af' 5 ',.t. 4 y .si,,Q Jivlip .V 11.1 Q F' . . . .fl - .ww ,,. ' .rf W A 'Y V. , V f . 'Ko sry 'V I . ' f'7'A6Q,-, Y i tm, :jf - 1. it ffl V ,uf ffl. ' . I Q4 - , ., . W -,ff 'Y !'ffL. felf' ' if-f, iff f will start their race. TRACK 195 lA S Y 4 W, , K. John Eoff sprinfs ahead of Walfer McCoy, Rick Coon, and John Young as he wins a 100-yard dash. Q, lg 2 1, A 12' lallkwel 2 mb ti. 3 sig, ff- Q -. ' if A + Q K, ll i L i ' or Tx r 'V' 'I .M ' ' -- v- EJ' - .-lg 3 , -.Z 3Q,,g,Ww ,. Miai , is 4 Steve Baustert sails high into the air as he slrefches for a good broad jump in the pit. l96 .E Q V 1-yur x i 3 1 -',,:'1,, A Q Q , Q . - . .. Q. . .. - . .. . ., 4 , QLL 5 - Q - ii . wuuxxx!xai we x ' I iiwu Q Allan Gamble clears the hurdle as he limbers up in preparation for a B-team track meet. McCoy places seventh in Cross Countr meet s l Members of the cross country squad are, BOTTOM ROW: W. McCoy, D. Gentry, W. Soza, S. Spillman, T. Rasco, G. Cordova, D. McElveenp A. Sewell, manager. SECOND ROW: O. Martinez, E. Janousek, D. Winholt, C. Carter, K. Sherlin, B. Santiesteban, C. Vogel. TOP ROW: J. Ferguson, R. Alderete, G. Mahaffey, E. Olivares, G. Nakovic. 5-. 'IM ..- , T-ee.. -M f721.:,,.:.z':,... 1 6 f s,YiE?f' .:? i sEfi,: . i 'iw'-'i ' 5.24. 5 - - - Lemzaefwe.w,m4:s 42, .11 , aff' 1-1... UW .' ft 'W mv .swwsei.-...giifuhrtf weft 59?- K 1. p't2:ra7?' -ff..-t.mw.e+f-:w W- 2? 5 .1 5 .- -,..w.a.-:w::2aeg1g..ai-..-...-xy. .. ...- f-: vwfwwf m mf wife.-S. -27 tx -- 'Bn f. cfm.,'4lt9.'5tlsEVf3EQlV'57f9i7 ti'l5Z,'f2.. 4: ' ., .. H 9,142.50 ,5E.'f4sQ35:.5sel5Qm9 '4:.?.lMQjm...V ,x...:1w::.z4Lf 1-wx.-, . :-'wit sw1wv'f.zfz Mike McGinnis is deep in thought as he prepares to heave the shot to better his last mark. Cross country is a sport that not only takes physical endurance but mental endurance as well. The Eastwood cross country team took part in the Burges, Ysleta, Bel Air, and Irvin Invitational Cross Country Meets during the year. Two miles of running at a fast pace is a task that few can accomplish. This race is perhaps the most strenuous of all track events. Many competi- tors enter this race but only a few gain victorious finishes. Walter McCoy placed seventh in the district meet, which earned him the honor of all-district. The team took fourth place in the district meet. Dennis McEleeven and Steve Spillman along with Bob Santiesteban added strong competition during the two mile run. Youngsters Wayne Soza, Glenn Cor- dova, and Tony Rasco make the future look bright as they return next year. s M, I K i o f ll, , X R i . A 5 - . 'E , lf . ? ' . :sg sy I A si? 1 s e . E fl ' - 53.1 s ffifis r' i iii? ' I - s twig N . 2- 5 . sw - . sg : S 'E li ' S 'L 5-S 5 rs? N 2 . n St . . - f '- 51.2 elim...-..: - 7, , , -,-.g,,,.:g - , :Q . .. -' .E ,L - ' '- V , if in M..',VL. .., .gzgziifg H . . . . . ' 1 I A 1 Q eg -wi ,.. ...,. .. Q ,, N T' f f A M s. -- ...V ze.-. . . V sw- :-- . ,. - . . f 7 - 1. . f f . ' ,L . -7'2 I1 f 51 M- AEK,,13i5.535575-Qiifiifsigfgifi .,..f4.f.a.s:fl AIUMML 'b ' Ti g' ia..-'ic' xlffels-li5ftc:sl+gEi:':cZs.s':.w'Ll - ' Nick Falcon soars over the bar for a good iump. CROSS COUNTRY 197 To achieve perfection on a stag-handstand, Michele Mason gets help from Miss Pamela Seitz. Debbie Fox assists Rhonda Simmons os they use classtime to work on the uneven parallel bars. Hard work, precision create perfectionists The 1970-71 Eastwood gymnastics team this year grew from twenty-three to thirty-five girls and a participating team of boys. Last year several boys worked out, but none performed. This year six boys ioined in with full team activities. The girls events include tumbling, uneven bars, beam, floor exercise, and vaulting. The boys squad is active in side horse vaulting, long horse vaulting, and floor exercises. Both groups are under the instruction and supervision of Miss Pamela Seitz. Miss Seitz helps the gymnasts to learn, perfect, and polish their routines. All participating team members attend daily classes, and they have extra practices after school, at night, and on weekends. Each year the teams participate in about five meets. These included, this year, the Thanksgiving meet, the Mid- land meet, and the all-school Spring Meet. This meet is for all schools and this year Eastwood was the host. ln the Thanksgiving meet Eastwood finished in second place, being beat by the YMCA team. The top 'Y' team won by a margin of only nine points. Also in this meet Eastwood's Mary Bombard received the high honor of all-around girls gymnast. Demonstrating his gymnastic capabilities on the parallel bars, Tommy Currie practices on a kip. During practice Debbie Mizer takes time to show fellow students how to do a walk-over. fi Tommy Arnold shows concenfrafion and skill as he practices an I-hold on the parallel bars. Michelle Mason performs a walk-over while prac- ticing for a gymnasiic meer. ,ww ,N ,M ,,,., f ww W, Z1 I . wiv , mg, in mf I During practice time, Mark Moore sfeadily works wiih The parallel bars on a shoulder stand. GYMNASTiCS 199 ,,1m1e:e:..,. Keith Masters hits an iron shot toward the green as he practices for the next tournament. Jesse Whittenton gets ready to remove the pin as Ken lane concentrates on sinking a putt. .,, . --45 W.: ...,, ,. Southwest golf links X Roy Foltz uses n nine iron as he sends the ball toward the pin for his third shot. John Hendley firmly grips his wood as he tees off on the back nine. Hendley and the other players worked hard to perfect their game in time for the opening tournament in early February. Getting out of the rough proves to be a difficult and trying shot for Jesse Whittentcn. pro ide challenge for golf team Members of the golf team are, BOTTOM ROW: John Hendley, Ken Lane, Robin Todd, and B.J. Overton. Members of the Trooper golf team start early in the year to perfect their game. Local courses provide a challenge to the abilities of all members. During the year the members brave high winds and sandstorms and some- times a little rain to play in tourna- ments. Last year the Brigade finished third in district competition and hope to move up to first this year. Members of the golf team are Ken Lane, Jesse Whittenton, Keith Masters, Rick Bohls, Roy Foltz, Gary Sanders, John Henclley, B. J. Overton, and Robin Todd. ln the number one spot is Keith Masters followed by Ken Lane and Jesse Whittenton. Southwestern golf courses are full of sand traps and lakes to test the strength and temper of each player. TOP ROW: Keith Masters, Gary Sanders, Jesse Whittenton, Roy Foltz, and Rick Bohls, Rick Bohls' shot is ull wet as he slaps his second shot out of a water trap in the fairway. Ken Lane, Jesse Whittenton and Keith Masters take time out for a picture before teeing off. GOLF 201 Senior Weston Reese demonstrates his ability as he slams a hard serve toward his opponent. 3' ' N Q3 Rueben Casarez exhibits the style and form that earned him the top spot on the tennis team. Netters win trophies in Southwestern meets Varsity netter Kathy Kistenmacher returns o powerful serve from an opponent during practice. Darlene Schade slams a return over the net during one of her many practices after school. Sophomore Karen Thoreson puts all of her might into a serve while practicing for a match. -,.. NN I - v Coach Dale Glaze gives a few pointers to Weston Reese and Rueben Casarez before a match. Lead by seniors Rueben Casarez and Weston Reese, the varsity tennis team placed finalists in most every tourna- ment they entered. Trooper netters participated in a tournament sponsored by the Club Campestre in Juarez. The fuzzballers also played in the Eastwood fall tournament. Karen Thoreson, sophomore, captured the 'I6 singles crown in the New Mexico Fall Junior Open. Casarez and Reese won the 18 doubles title in the Burges Thanksgiving tourna- ment, and Karen also won the 16 singles trophy in that tourney. The team captured the second place team trophies in the annual Sun Carnival and the lrvin doubles tournament. Other promising members of the team are Darlene Schade, Kathy Kistenmacher, Mark Gilger, and Terry Gorman. Members of the varsity tennis team are, BOT- Badillo. SECOND ROW: Rueben Casarez, Tina ROW: Coach Dale Glaze, Bruce Donahue, Terry TOM ROW: Susan Strickland, Kathy Kisten- Webb, Vickie Stone, Leslie Mowad, Darlene Gorman, Jonathan Harrell, Mark Gilger, Bob macher, Kim Paxson, Karen Thoreson, and Sylvia Schade, Weston Reese, and Sal Castillo. TOP Reese, and Steve Lyons. TENNIS 203 Enthusias , upport, lo alt ss. CUE. lm 'C Martha Reinhart, varsity football sweetheart, poses wifh Players Ted Argeanas end John WimPY' LaSelle Taylor, Randy Anderson, and Armando Dominguez help Wendy Ehrlich aim for the basket. qv' 2 5 t gf' Q . ll E 1 l l Q , is F Track sweetheart Sue Phillips sits with two Chosen for her enthusiasm for football, Susan Banta was selected as B-team football sweetheart. track members, John Eoff and Van Townsend. 204 haracterize team Sweethearts Eastwood Trooper athletes selected their sweethearts this year on the basis of their support and loyalty to each team. Chosen as varsity football sweetheart was Martha Reinhart. She not only attended each game but participated in the halftimes as an active mem- ber of Trooperettes. Susan Banta, a sophomore, was chosen as B-team sweetheart. She is a member of Corinthians and Entre Nous. Wendy Ehrlich was chosen as varsity basketball sweetheart this year. This was her first year at Eastwood and she proved her desire to become a Trooper by becoming involved in many activities. B-team basketball elected Charlene Rivera as their sweetheart. She is a B-team cheerleader and also a mem- ber af Trooperettes. Sophomore Debbie Jones is baseball sweetheart. She is a member of Trooper- ettes and also represented ELA at E-in-E. Sue Phillips was selected as track sweetheart. She actively participates in all Trooper activities and reigned as the T971 E-in-E queen. Tennis sweetheart is Karen Thoreson. Karen is a member of Venite Fidelis, NJHS, and is an enthusiastic tennis player. Vicki Bracher was chosen as golf sweet- heart and is active in Trooperettes. Christine Rivera tries to throw a pass to Richard Deba while Duane Banks attempts a block. Pat Henderson and Scott McGriff are shown with loyal fan Debbie Jones, baseball sweetheart. Tennis sweetheart is Karen Thoreson Karen is a member of NJHS and is an enthusiastic tennis player Freshman Vicki Bracher was chosen as golf sweet- heart. She is also an active Troaperette. SWEETHEARTS 205 l l l l i l 3 wwf? V572 W Vfwwfd Awww WH 3' L 5 9 MV E ffrwwif 'fd P 'S mf... z,.f12'?f3,f'i.9z:S'v?'VVi.. :A 3 W ww. 3.1 V341 fiSQ12f1S?'i5'E.1xT Him- JW 'W M V nf 15 . v- v , .- f 1 Vw .Nw v N55 V. L... . X HH 1 . nf 1. 4. 1 vw , mx, :Na 3,-,iw x-uf. 4 L. M A. .mx . ,s ,1 qr+ ,A 64, MV ' 1 A V 'U' .V if HM 21051, wvff VVVWVE W fi?f'f'ffi WFS 7 fi. fi Q, V .5 V V' .A f .vw www .1 gh ewg gtg-?5ak!'Q3u. V1 . SVMVVVVQ Q V ww VV M. N V. ,, ,V , . V . ,. A . . , 9- V Vi-2 QV.. V, A V-:VV.,VQ.,.,.j..f.:f ,Vfff?g.g5,xfm., as 1 ... favii-mmf:':::.:,1-.15--.wf5?VVfpVVf V ' N .. VV f V ' - .. V f UM 'wx ffzwf H . W VW sf P A . ,.gmH M Fnwg. ,'-E-im. ..-N ':25V'x-Vusfggfi .wr f kf ' f F!V1g35::? .-'f452.,b'-':Q.--?2ff5g51V.5vq.1 'V 'Q-'fra mfqw' ..-.H ' 4 .V L 'Pi 2, 1 V 3, ig!-i,4'fi:'ii 3-'L fy . af- 4 fifxfix j1 ,.V,A'3f! 23 m12'f?f56,g:Q,j -,V.3f?fHg?.'5?-'-'1f'gif3jS,'fV l...: ,Q gig,-r 1- '- ,f 4s'2fsf5:?'.Wk..-3i-,'ffV f'1fffivfwiii'-4J 1 .. V 3 ' f 1 J - 'V 4 a 4' V 11 W' V 5 , 5 M-16 :Q z .L 4' 'SRP' Yu,-Y'k'3'V4! as V+ H5 . V 4 V.-v-...fad-:..aVV,-,--14.V1Vf'3-V?f-VV1.,..-V..-.V,V., my SV .K , .Vfp.U,,,.,, , , q.,,,,, V.. . J., JV A V.. 4. ., . V+ ,S , 0. QW? -,'r,..., ,AV JZ.. .Q vw, KW. V 'Ria V VVV ,V 43 '. IV. My - ., - V Vim Y4.,-w-V--.. 5951-,V5MzV.qg1VQQ.V-,Vw -J ...Aw V if .f1.-'- ,ru A mm. ,.r' ,.,,-V.,y'.,gV-.'.z,,,Vf5, .3-.Vg,,Vh...4.g ,,V..L',,' sy., wg. -,VJQ-'www 4. .-:psp-V ,, nb . 'Nga ,M-.1 . rfygs 1122 .J .W V. , .V ,QV J, Q . 5. A VV A . , V5, . ,-U, H - fV,5,,w,,g.,m.,9 ,,,g,5W,,.,.,,,,,. . Q. 7. ,, ,Vg 1X ,,..,,q. .52 . ..V.W.u,e .i , ,. ,JV pw., ., ,U ..sV,.g, ,,3.,,f5,., ,,.V.,.M ,,W,gg,,p .,WQg5,5,51V V ,,: Q.. fm, .2 V-fn, grzi y, ., ggi? V .VM V-VZr.f.iwg.mg A w,,c,gBL.i,iQl' ff A' V It ,YW ,ffiiiiiv .- 'v'wQ,.fr L?ws?C,,iiZQ:1V 2' 'n'.7W-WLS -'f'f,a'sg Vmf.'v3f'12?1:ffKgtf V47-43 ai. w -- E 255: I ,. M If -V, GTV 1-Tj! .,-V -a- L' Q21 V' ' .pffgf ,'1.',a,ghQ , P225w3Q4'q,x.3.wE...,':i''A fi5,fVg..V1.:f'VV.QVf5'r'.kV rV V.. 5725 3 ,- ' 5-5.35.4 .1-V 1-ffVVJf:'VfE??i''YWyf'f.fT.i'x SVg,!1kfsVQ2'5-l1:f'f3,': .'?'f?'j ':x'N'fViHe4EA539.7?,'f? j'?f 3157137'f1'if' 5.5-SwXff'2Z'2.2:H'.!zg-'Wifi--'V.':'Qa'fS.3wVivH22--51?' -ivrf'-'fEz,g,'9 24:VfV.TQ.V:VVV'm.:fE'x-'15-5 Q f1VQ5,,.f5 1 .M'inf,-VV.g.ixji3,?Vsf-gf.-,2:.fag- .3j2.yrf3.Xvwe.,L,. ,V3Vgf1gg.V:f-VefV.:-.fmffis,VV.VfV,.Z3g.1-221,-QM'.gf V.-,'.5i-,avg VV. 'V xg-.1-'.. ffl' 57. fix 3 ,,. ., -57.4 5 V2:'1g g,,rV3.f,,.5fs,..g.4-ug.,-3 VL' GL -Vv,'!g,.f., 193' ,AQ fbi' f'W'.,.'i:f'g'1-eijiff''FLT...Ll ..'V.- VW- 5.1.1. .iw-.r,..JA: ,' + 1 .1 V ':f.g.,.,, , -,-L V. A L 1:5 ,Q , H MV-if tf g,'gl?V2Vf- JN V1 :WA ,MV-.1xf.:i5Vf-g,iVVC..-V. Q1-3. 0631-.-,kM5.,rV?.. it 1 fwYiE,gV?, A. f , ,YV ZXWSV A V555 ffjv J.-Ur' '?x.sx ,f 'fbi 11' I' 1 1 3 -V w 15:91 U 9 an W F ' '1 Vg' 1 45? 5 49' 5553 V.. V.. V Q .V V V V V ,. V V Aw V hV,.V'H If 'mii.z??W T W ' .V I , :'Ag.v Q . f A V . h. , VV ' . bl va, WN' ., . '12'fa,.,?a VHA? .fgufze MM fav? LM: .gV1.i.m.'.f-VVw,V, V135,!WxV.' .5,,1.m5.,.yC,2.3....., ,V -M,V.,Am.s.,:fwV, W., QV. 4.-wwsk-'JV,VV,.VMV 3,VV.:...ggg4VV VHVV . r + Q ,1 :V Wig- 5' v 4 . Nw. 'V:V-L',Vz.:.'V,'.V',:, V.V'F?...f'-V? N 'f1e?:V.:V4-.,V'k:'V .zVzVv,V1-,.k Vwf'Vf'V 4.11. wtak' ...V ,V--VV. , .c.+.,.'.V. Vw- Vp-.VH ...S VV..,V ,?., . --Fl -V 4. Liz V V' V , . . ,. . ., VV. gtk... -'V 'V6'1VfY-t',':V., 1iV1::,V' .9212 Br' 413.9 waVVVVF:V:LVV'iix3V-VVLVL1W.-'V fu'fsvf:1'.n1f1'Vffwl-wizqsg' V Vg-Q+5fbf'gV1Ven:'V.V .fy -Vai. -9'1Ti+1NV51'ia.aQe -V 19 kg.: , H fs4Vw.ap,f 3 igffzffi? .SMA if .V,V3eVf5.f.V3: 'Qfi-VV.:-'rifgwpiu-'.:e:-,241.,f'i3g..fVga- 9 wg.V.AgV....Q',ff5gqQw.'...,.V,V: ,1gv',sw.5.,:ff,gr..,1.,g.,F,ga'g1f-1.11:E .v1:3V,.qA.Vg Q.:g.igQ VV,3,w:.f2L5qwsiv22.-ffasquz--we 51.3 jsgmwizgcVifggg-..gawV.,VZ.5,t' gmc. 'ff .V V1-nf HVVJYLV fftiif Exif-vm -:':1x5iVa:'1 .2 'f '- .P?Vr1- .f-'VE ' if MVB ': viyffi fff-1 uslff V i.5m2'nZV5f3F2+f1P221IrVfi'ifQ .2151 1-Vgfmfs'J.:'frw-V 1 gay. Q-mr. V m' . I5 , ..v'?:V-fyff-f.f..1f ffpf'.:af.f.Q5.- ,JV-:9252.213:qw-.gVgV.',Vaq,.:fw1.1,gsgfsz:Sgapf,35:,,a.y.v,iV,,252,33:55my.1fu:.,.:5i:V..r.gVw.+,6g,f4.V.,g.V1sgggigrf??:e1-V.RVk'5.w V 3.Vm:Vs. '7w:M'sfqV:gQw?:2'aim-aggdz'' , VV:1 :i4 V: 1... .3 .-.V'Vas- .-VV. ,, - -ff : ws: we :.:-..:.1.f- Vyw- v- , V.-1 ,wig QV.-VV 4- 1:61, . aV4,:4V,ff -. V 1-. -,J ,LfE:04.nQ.-:fall ,5Z?fL,x' -1: 'uve ' .1-fs5x': 4jT Q Q' 4V.v'm '4' VV 3.4-V-:V,.,xf.V V' .- -.sf ,fV,,,,V.p:?V,,, VV V- ,' ,,'s:ya1i4gg-L32T,,,, .V.-1.3!-g:s.VE,fgi.:.V. wg.-,'Vf,, V.,-.?V1f',f - Vs VV-.,'-1,-gV+fprE'f-Viv? -'lu 'X-as -BF-Tr::.u ,WH-x V'!f..9 f:V +:'-2---sf. cw-f..5 !fKSi'?gf Jf1. Wg 35...-Vpf':EV?553.-'VV-:V. '4g4wf4QW,,f' xp W J .wmmf ,.VVm.2f.fQ'i V gif? 6-'Liam' 'f3'2f-K? ..-qw.sV:5ffafl9:T ' ..:V .r 'JT' . :Vw :VV .Va-aa:pVV1-fa1:.Vffw VV'.:V::.-wa -:emu e.a1V..V::.:Vx-fm3.Va1aVv-1gV. ae. Vifm.-VgV?Vpi..aVA.V..5 V:V.f.'Q.afm2,a:ViM.:.:-1.'Fw yzzvsfergw Vgiiw? gjw V fwgmffy- V, V' friwiffll-Qf?1i'f ',.lI.9-ZW7QQFf ?2.VLfr?nfl''EIKV7'-E1?HS'Q,Q3A1:i'l s:-mb1sg.wf1:4'-SAV:V.:Vf.g.V,..Vz,Qa.V.y,gEV2w,ggV-V.-.4.1 l,QffW5V?'X iifha.Na,5Vw:o.:sm'ggfgf.xV.VVV:V.:,wz:g,-w,a1-,v:l-4V1f.Vfwf.?wf1.ifx,sf 1?'wfV:f,zs2xf.Vf'f.1:,fV,'VfQf:gVHX-A0154 ffygw'-'f.' V -Qmgfa-Fgfagpgigm .wfm .f5V?gz'mY 3Aaf3?'u?jf1w.w2S3Vi7hV V uW1Jv-.fra www.'vV.q,yg5g1f-rayV V31Vwifiig.ww14:SMLvi-VV2':: s-E...2V:iiffwfi uw: PPV.--f'1V-V... Vw.VVfVVp .iQ5.:zV:aL:n-f..-VVu::- 'awwfVVV1'V. .mV' 'VV.V:.,w11H5fV- ffl--wpizfc-'V fbx. L'QV-11: f'f?'AV?fV+ PM Vw?'QiVFQVJ-www-fy!!-V-.+ V1.-.VV Vg? -vu MV . -'W'-eM4VfV'12m 7ffm5vVV'ff eg V-Vw' - .V VV .V .V.:V. .. VV V A 'VV1fWVv w.,V,.5,,gV-Vf,,...,,V,,..v,..eW,,e,..f.mg.,V.f.V,3,VV.,zVV..,V.,,1w.,.-:VV .Wm V.V.-wV..VV.,.,, V....VM.f ,W 1. ,Vr-5gxf,V,w.-.f-V.4VqVV1V ,Viv-Vu,V,V,ys5 .V .-.Q ..VVr.fVV+VV.qV,,'V,eV,1. ,fg.,.?V m,,,,e.M... . VV,fvV,V ., , 4. Vg, . s,.V..., ,. in f,...V,.V4 ...gig .s,,:- is,VV.V,. .V '2?95g?'?.i3f'Qwfow1Vf1Vf5'?f4-Wif3fV2f5T+'1VV9 V' :WV'fi5fW?mse1x5 4.ft ,1':'-fa1'nv-11V J54v.?:'31' KSSL Pfn,-aw WV-vw!-'lahVnfzwmffV'V '91'14wfY31 U.-V-WeWewi-f.V'.z!f4gfi '1V'V-GV.w2V'Vn,'Vfd5Mr:.?'WH'V-NQVVMX 'Vwlmifv-Sf f:V-9Q'-hav ffl! fVf1EQfP,-3'V-2V dAx.4 5- 'Wi'-'L-'-'1'9 W3V'Q.?f fiig 5' ' ' 3 md. 43' 'F 5 1?' gjw' VFW? ' rf?iS'V+-P HW J. . .VV - , -:V 1 f9'i'H' W 'W'nlfv5.,:w2...MyWQVHW'-VML-'-'f. L5QrV.1w,2.f'.i:F7?1fSwwqiVw?-Q1Vs'f-yuVV-V:'J.-'iVwr,.fsl3-fhffik www: H'f4.Vuw.w-V.:V'u,V-.'-..mV-Vimwe-M...-V1m?':':QVi 'ww-vi. Q1--'Wi' - q.a'fVV4wgf'VV3VVf.Q.. ffarfgff QSZMWVV M -.Jw V -Ly.. nf v WW V xvi5if1s WJf'A?w''f4xYi 'Mlr1vffV.xV'V'V'-ff'a 'V'-W'1'-9345-V'-Vzu:f 4V-Vi'fQ?'V'kV-.'vV'VVy'W1.f 'fff-wa'-wsa.ffVVf-mw'.:JV:.:wg1'1fL'fw.--S,w'w11w,!91V-'-fxfjiwewf-'V-,g1.x:wffV,V-fx-fgirmf,f.:1.q-4VVL .Wf,l'g2-.1fTQm'-:k,w.'f:yhf. H -EAVV:-fe.-' -1EQy!V'g-.'1g:,.s:4-1J'V 4 :V'.-lfpafih A Y' 'I 'LV JF R ' V ' V.z. V 2'.-'fV'wQg' V -' ,M Y ' XQEVVQ.-a3:x.A,?-uw?V?em-V-:f3g,:Qy:43,aQq3,fw:',,gxf..QVw-VS,-4-'.M.-tfizfiiifiV-Eff,-gfxfgm-u,mfiy'a2:4vww-45'.'V.VH:,H-:iVV'wf+.'1.VVWVV:'3Vffq5,m:aVV-fV1V11','g-VVg.vV'1m.3.y,mem.gv5.mvV.wf.W.m.,,V.,JQgp7--gfypyr-5fg,.qfV,, .1-.,.:Mwvy-yi.Mfm.V,,fp -,,,.fwm. 7,-,, , V Vf, - V Q. -iq, yqf 1 .ivQf'1,411FSisGV -Wh, Qfffi-5915,V4A.:JV::H51E'-415' 'X .4 ?9V51',,g.'f1Qf2f,'q,:fQrV41j5Q2,5L:Vwy-,V Af,'V-1.9.4-.ij-V.Ms'9w' L' fh f3y-fifwiqV.3,1??,.Vf1f'22'wX.g,,gcFQ53'a'.Ef 'gf-.rg nL ,5'E-Gfzij-.'lQ1'2f'5 .'5:W.'7'tgJ3V4-QV il-1'?4f9f'. 15303 f,?'xf',1W'1.G1-5'1'g?5+,,-.xvggffi 33' V' ,QATAR xiii. ' ' 4133 Ja, V :fi ' ' yu ' H' .V V V. .f.fV..1i.w4ff.::.V.V.V:aV,V Ja.-VV-ffV21VvVe.VV.VfmV:-..V5fa4VV:V..:VV :.V:w.wV.w.4..V :V-ff.4.f.1..'?1-M.V-Vw'0Vm'wVffAuf,wV,V'-Vw.-6-V.g,VVpew-.4..f-VVAV1.,.'wV.1r.VV.VVwVwavf-.M-effamzvfiq fave.-'gpg...1'V-Magixff.,-saf,:Lf:s:-AVVQ..NgQiiyV'VfkfV 'VV :ww Jw-,ni . -5- 1 V-fv:..mV5- 1-rV,qVwq:..a+.wV:'Vu',2VVg.,f-312.3-V51.Qg.s fuigmxfg. .--3,-.f..m1'.,!'4,fVa9 1: .gzfV:-V592-',l.---,vm -,1?',.!'gs.1r. H110V-,,-+V9f'x:f-.1f'P.....--'fgn,..w1,1,'z.V.-,1--51.4 H ::V...Vy,,.N,.-V 1.'V.o-,:i,iV?'3V. galil: KV. ::,wVe,':'Vaa yf5,b.'.su-.Eg-pr.-kwqw -: ftqvfiparm aywagf ,g1.gv5iV,x,V.f iv---V-4 -.ef frm- 1-:jeff . --f5:1.gy.V1V-,fV..-: .1,VnQfvas, vq!V1-.awQAx1Vwm,.lf.-,u.g.1-.'5-J.'fVV,::-,Vi-.2.'.,!5,J,vwpx, x g.,a .gVx::2.1fvs'z2::1' +.-'4my.'-.zifffg-Wm..-' -'qz-wfv-.4-Vf.'. 'rim-:w.rf.'f 'f'a'wa3.ih:.11'.w :' '.:H'f1vsC.fy1VV17I-f'v-,.'-.Eff-,-W'.14z?.f'4V'.i,.V.m2 -at-V ,iii-ggcfw-tv ,sw -,W I Tfu', -'V-1.5 . mc. rw . - 953559.-,-.'4.4fV5:,5i5,,,, gf:Vi:.,V!5fgy-wif? Q,-5-v.K25'1Eg-,e.w :--24z'?w5?fAwg'z3,3-.,gf.,.-1-Q vhs-5-Lg.21: jV.5sf'.1,,1e.ga,fa-r141,M. MV- 1,.u,VqVf ,-:11,,Q.a-.:.',V12k2,3, E.5T,3.X,V:.5,V1'.'1?ql',2fm1!g7,3'Q':5fJ5AgfF'f--.1-fd-,g5!Vf''QiV'V'7-Xfxfcj-1.-5-xiggigg,.gfl!f.,w,'J??31:aEg,V..1g ,1VTggyb,V, 'fQ..S,, A3-'f'E'K.,.v-Y.. ,.5:'r,e.,., 'QQV tix? s1ffV?':X,iV'.V -AV.: fy. zigw. -P:,sV:':'?w: Micky..-i.2V r..-H V-.zf .+fVi:f5.?Z5wa QV .,:f'VLV., r fw'32..fVff:ff -.ws 'Vfqw--Q. -IV 9:mVg'g-Vw :V.:.2VVVfV.m:Vw1gzw3 1-VVg.'f:V ?5f55Fb'?'V1V'3' V-A,1:'aQi,i'VfV.Vf.g:,w::Mf3f'.Vyffyfrr -Laffy?-'ffc,5g15.fQf:3Vn.Qifw -715342 wg ' gin, Hi V V gf Vmrzf-iV1'c'g'A-11ef.V.yaV,..VfzVf+,V'v.s1.-Vx1:5.?m-sup-.2:2rgV:'av.'s-VLVV',VVVVff..:V-VM-'FVVVVmsg V., .mf1:L.V'-V: VV ,mnz3,r1V:-Vw-gVV,,VVV, Vw-'VV.V'CV--V.-fa VV'-qu'-:I.-VVwVeVu-1gQg'f:fV1.V.-V,fJV,Vme :-.: VVV'-'gm'rpwxgifsV,V4V'1'i?Ew-isfm wh M- : fx., V-rf V1.V.:V 1. V V.Q...,V f , wp H 'V -V V'..V 1.V.,V'V-V .,- Q.-:, VG, M-. .,.. .V V,-f. .V V. V-.3 V:.ffVw .V .1-w......-. .vw V, -M--VVuV- V- .f '-.iw 1-fun? V.-'VVV-V - -' 5. X - V1-AV V, - wh,-V:a,'.'f , 4' an M.. u .a'5.,,s,75,5.,g,,,,.VMi..fgff2,5,..g,..,af,..gV -,.q,,V7iV,,.,.V.:V,V,V..j,,:.V.,,V...q1V..VVV.,..Vf,,.,,.f1.V.5JV.Vw,.r,VV,,, WV. Vw..V,.VM,,....,.V.,.N,...V,.,,.....mV,.,...,,,.,.,ge .1,.- .,.,,i,..e5,,,,V., ,,,,yVV ,., ,,,,. ..,..e. -,WV m.,2XxVgf.f3ag.VVvf.q,.,V,N. .pm af ai., .. ...M .. ,,.?M,.J. Nz. , 2 .fx-V - 1VV Va- .-ffl' 5- L--'12, , , V , , '..iV.Siv'.:Jw MM, QV--WWEQ,1...VV:V'VqfVVaVwsVSV.,1,V,AV2fV'-1'V'V-M-w-kV:yV2VI:z: Q-VVMVQ--.gr.mm-vpV.V'KQV-V4714 .-12'fwbvVssV' V'w.L.'s w-V2fvFTv V1w'VV5::w.cr-Q5 '4'VM1:f'M1V3 VrP.my.',i' 'fV,M1f V' QP? I - W A E -. f f-'mVV'- Q-W ' VV'VfwrVw?wVWZk'b.l+Vf5M1f'r-3VfgEW1r3??TSJY.sffzniwf'-wi.wwVVMVVY:-w-M44,V-W.Vu:QV-af-rw'm.Vw.f- ..VaV..'.-:mVzVf.,VvViVV,VV..V.n..w,V-...VV-4..ggVVV..w2V'fV.w-.Vw. ,-Vw mmsgnV,,.Vuf'w..f-fV.z'w.Vx,.V L..z.V.5f.-VVfm,-a..,V1f,Vsfr.VgV-eu M QV fmyyfff-.w,M' V V VV VV .4 -ww W. 'elfV2i1.2.'-fifwws51.11fi mf fw.iVf?SifV.Vf . V' J?':iy'f1' f'ff?fW'V g?g,t?f5fA5,yi..M,f.,,giygijimxgfggp..12, - 'J Ka, :MLN Vu X' M, '. fflv.v.,V,?'1V.' V ' MM ' ' 1 -'I V P e V' 55.4 Vw:-. P Hu1',, Rf?f2:,rv,V,U 4.azJv1J'.3,.Qfv'i1,Y'x1 N L .,159g5Rj2f1AV-,JJ .gm.,:q . ug? .MQW V1 1 f L' -' - ' A NH H 2 V VH J if ' Vw V' 4 V WW y V V? if 1' vi- V V '1 '1:ki6'f'fn':i,sm,1 1 Vw: 5 VV if. . L J. .1 .v'f11m'- L e1V,.1V'rM. Y..-'Q-'11 ' Lg. ..AfggL,g1, A.x:f,,,,1 if ,,', A IV, .L ,, Vr.f,,' , mb V-v 1-4: f AW V .L nf. ,:,.Vs. gf., V::1.,Vgg , fy,-.jje'ftkiE,g'1,5vUal71,: uv., ,,,:. g . 53 ,. .. 1 '1.v.,sV:31- .Wig-'f:1 V. -,...tlf,w fm, .. . 4 . 1.4 .Q P 5-.V.,.,V.VV,.' W-Q V 'E1V!s,k-2:':fl5V SW Q5-'Zi af'V1V1afg' HJ Qfg.Q?F:flaE?'?-Q , .':V,Vwx ..41:'j',j,,p V V. fVw.92z4gE7igwaf-V ' U ,. ... .,,V.wp'-4'j.+,Kk,1, 112552 V,-.fi .zqpaw ffrmrvz mmm. V2 . ' ,' 'J 'T'.'E- LFQQQI' 1-'sw-.Q -.. .V-WE 152.-:ag-:Vv ,vga 1... -Af. ,V .f. .x,-.- E.. , rreW'1w.'fW:.:,V Vw- fr--.Jil-1: VV ' .:-fm .1V YV . .qw :.imVVq-',Yf'mi,1f.-'Q WM 5ffsF5fxV Mfr' V1r..1gf5i,L'3'W fl VW:: .Cg5fdJf 1 2- v?u V.VVVu,- ,V . .V x. , . V' 'f'V '3 ?' 1 QV?a3f?.'?V?VF5'fa 2?35??55?3?f511if?V- .. V, V, 21543 'f'7V'f K-3 535423 ,Wig '?E25L.'i?3'f'EVz ?-AV--iv.,-lf .. .. . ..1,4,. 5.413 Q., .gVAlVV,. 1? V-VK:-- .111 V,-'-1S'1!f:if': . ww.-Vfisggq, 753fV!.s2fnfV:, ., f 'Wifi + 'im'5.2'2xs,V1,mrV32g-f. I-,fl HA fax fe fi-aV-15 Va .., V, ,B ,N ,W .V. :.,V4,.,, .E x V ,VV . ,,,g.VV5 ,Jr L' . fk,.V.,. 43w4,,..VxV-VV, .V -V , 5,054 :5 V,...,f,.V,.,,. . 'Ffa 51.2 LV, . VJ' .Q-Vg' VV V W I pg V ' . a , . , W. .N ' . V V.. I VV :.f1Efii-in-V' 9 Yffpr-ilu: V-V ff ,Vw:4pV:.VV:.-- ., .-' V V V, ,Wi -, V-, .4-v,...f,.V V V ..VV,,w'V, .V-,ff-f . g-'2 -.V,-z.x,V,L ' V, Vai ,4q,,VVffrf..V.. .J5.L.V','VVt1:1 .1'V,ViV.g. V' 5. 'Jfl' y'.ff.'V 'C Wx . 4: EE-Vw .-41:.QVVgWWVV52: ,Q ,3'5'G',1:' 1 'V V-Qgj,ta??f fam gV,.s1jV.gV -I,5 2v r ff..,p-zVJ.'.4.w V.V2f 31'v'V 1?f.'w . 4.1 9.49, V' YV .'::.VV!' :.'-'..-'Fuiy g,--ii, .,.Q.w:..:i:.-.., .,-qw. W.: , L. vw: .TV -:J gp 7 fu nl,'Ef.fV'.. 55,-V, 335391 .If 5V-wfwxxf. ,5gAg.:.xggVV1 V-if-5, Q. -:Q 3, -5, - .e?Q?af.f..VgVg.V : 'l5E:r5T?1VQ Vis. Ve- H aw Je 1- 1' is ff 1351-V V-9: .Vw ' ,ff-Vs'.M:VV-1-.ff ?ff1'f-f,3?1fffV'V'V:. 41VV,3'fr.1' 5 .- ..,..V.1c:..V ,. .V.,..., .V . V'2Lefmg.4,'fVQ.'. f+V,vV f. ,-1,2-.1.-2'-4? - 1.-,MQAV gm-'V'.VVV.,V..u '--,H .I fiii-f:G'fiVf:f1VV'f 'ff' L, 12 fzfjiliifg-1-,1,3. fjV',,'V. I ,mg Ztf FQ AQ'.',Z-fr: Ji' V- 12, V. ia5?Z5iT43L.Q?fJ. 1, 1' V ggf?r,i11?,iff jg-ses-c-QQ-5, Va 1:V'-,f'f:f'.f5,Qa .fd ' .,:-dw-31.34. .:,.V 5.13, ,,.15T5,m,,,,-,, ug, .V.f.a.V,, .,,,, .VV . V . wi:f2..fVV:f V-ffm 'f V. 1'!1'Q -Kg: 'fi fy.5if1g.Q sQZV?g:g.fYii'f'1,:1 , 'fi 1.1.2-fgT4,:.vL -XV -'1H.3jx1Z1v3',Vf.V '-'. '. Vi 2-V. -uf: .Vez- zf13,ff5?gE1'5V'.pf Jifwfft k2 ta1?1T'7 i1'A1?i+?i5f '1'V ffai' MAT-I NV ,. ..fm.Vn.V .xl ..,.,.., ma Vs ha' V ,1,.. .,V - .-.fa V , ,-iii. x ,Ll 1 V- in gf-A-Q :rm sfQ?Xf'?QfVV'V- ,H,f. ' :1V7V.Ik:Qf Qawiwlw 35: ..q,.,,.,u,,:, 3 ,VW 'f VV.-.V QW VV V , -:u::'::fVg.VV1V , .L Lm.-.251 QP:-Vg:,fV,, . ,.m'.VfV.f.4V-Y: .QV fliffg 11f1fg5lf'IV 1 fl lv. Qi'z'?fg 1 2 n . S- . -. Xu V f'1'f'2'1kf:,.V' 1 '1w11'Q12 - V 1. -V.-'iffi . Nl , '.' 591, , ,, 3311: LF,- 7' 37' -'7 V' 'l.il'-if if-':3'f -vw-M. .,V,,N ., ,,.., ,. ,. .L Vi- .LQ 31741 15 'V 72 ' V V wi is 5 .g.nV 2.19.51 Vi Q'I,g1g5V,11L.1.V'-XXV: ,W V f- FT fV'aF'.:v.'f.' C i3-'IT' P KW Vw 'QW 17' V-,gg pn..-V .,-,.--fic., ,VP g,.,.f 1 'VA -' ' V ,ff .-.fr gl: v an v if! 2'-rf'V'3,V5:?i:.i,zfi-' r :iii-12 1. 13' .V ' 2:5-'3 Wi Q 1. f :fbi .1 flyjfmz-.Vl'-H-rm',',Wf5 5Q'mVf..V,-VJ V'xffV':?Zd.fkV f X. A 4, 4 x vw-ew f . A-.-.'-,-my ., KVSQQV .VVfr,1fV 5553, Iii ' ' -'glkifhii' g ' . ,. ,, V, -. ,.,. -. 15'-1-.YW W V.:fV.,,-V. '!VfV-:,Vf- ' A ' 5 , ff:'H. sfr,nVVV.'--mV,--.V'!:v-nf-..V' If 4,-V..:vu-,,.'Jf,.g.4-V-V gf. V . a13..f.r,,cs ,!vV!'2.w ,lf Hs qv-f.,V.Z5a.:' iv 1 V1, 2,V1f.1f'2V--...Nr ff..'..CvV-1 5'-z'iQ1f'f-f'f-f fif'f. 'E1?.ji'5Eglgfiif-:v'.'E.i'FV k V -1' AFV-2215!-t'E'-.:,fV'Q1'S: 4.13: . HV' ZL'fV:fJw-2 VV nf V g5:,'p.4mV4,,.VxgvsgirQM wg,-.V .V. .. , .Vw .. 1. V Va V 1 V-'a1,...,,,V., 1 4.2, .:.V.V, ,w,,..,V. ,.,, V 4fV1,.EVV,2 A . eV ,-V'i,J.':lWf:232'Yi5:'r- 1 .1,4,..Af. Q H 3' 444.1 SJWFQT' 5:1 'WVV ff E. f!V:f1fx'i5 ' -V FQfflfVV'f fff .F VV .f '1 f L..,,Aq.3.. . ,V i 135-ff z45?:1?cI f:V If .nw.'+iziV..q,-vf 'EVM ,VM 'mgfga' 'mi ' i'pf?1i? gi, 25,91 gal: V-I 21.21 ' . , ...V,.H.. . TFL ' .'.42'?1 55:f.5N:'i '- 'V 'V fur 1.3.-5191... J' .f:.1'-I rr. -2.52: I'-'rf:.'233'J:'-E'?'5T:Qv: - V -.Q '. QVEQVVV, V 2 L54 jg?127r'55igf5S? 1 QQ X Q Q V ' f f V . V - V VV XfE5E?Vf?V'.P-3'.fL.i1.3?f9.17 .5-P T-igg-GQF'-'if-' if vs my 51.-..eVVg., few-.Vw gy: gg- -fu 1- 55 g.11,,nV-ig-,,..,.-fl, V- ,'r,.:-,tv 214,-,V-. Q.-4 gc!Q,,.5 ,.,., ,.V.,,,V:,,.,. 1--.,'g!,-VV,-aff.,.X-:Ax-V, . - mf. ff ,V . 11...-V. -, , ., an e V: ifVQ.,Tm-'i .Fiflf 4 WaLi?LffViQQfi:- gfwyfm ,'ffg3ff H : ff'iVf'f54V..fg4,.f1ifi'-Qi' .,'f:f'V', likEi':'1 :F :V?.-ESF? .V .VaVfiV45+VsV-31Q2,V:pe 3s' viwsxsknia .HV VV:2:.V.xiM.ff:f':wifi 1 4.-Y-VQPIV 'F'V'2.'.f ,E ., V, ,V.-2 7, V:wx,,:.... M ff . ,.f14e'fV , yzm. ff wi M. Q? .fhVl15fV11V3- - A-4w'.'f igjf fii'Q2l'wVVg5f:IV12195.?f3Pf333f?4?5?ff' .v,2HiQvfS W1i.Jsff2.g5f'i2 f 'M Q:s'B5vVfVf-ag, f iw. 51'-3' Viv V-'V,,-.4.:Vgw,'gVV 5-pw n, X2 .V ' ,ai :V ,VV.., ' V '92, 1'9i.1f: .,wf1.iwVq.VV., ?:?f5PHff:gwfgg??5-.EZQF-'aj ?,fi?f'.fi3.:! KE: W ' is' 'uffifli yyffkft 'K' ' .S 2551- .I ..f- -n1mVVVfi?.+siV.fQ::f-' XV Q r . I.. ,- ,1?,,.j.gggiPwF51st4g:ix HA 1:- VV .J -r' VV. an fV 3 'CwQ!JPWv' V-' ' nik, ' .V.V.4:,,,z.?affngP. 5 . . V 91.-f.?1-W.-9-M'-V ,,,.V1zlff.ffV.1 3V5'-i. -VV V- . . ... V ...JV 11 in-'yfilvf-s1:f: V' M -., !..fjjif- .gigsZQQ.- kErf.,1tg:t3 'rfljrl ,L 1. ,.,. 'xg..sAf+2?'.14 ,.V,.--u.VV2,511'V 'Vmfgl-fV1.,V,, J.,-v,xV ' PP-1VV:'f.-f1.1Vff .,--,'V'ff,.:gV.. i'x751V13V'V,.'4L .-f., V.-y.VmyV.V U, . ,V-.VV , ...VV ..-fV'+,ggww31-V+ .f V 9 3 1. ,.,. V 1 .5 wgllisizi. .xg .,VV.VV,.,- ,. . 1g54.wV..aw..VrV M -:V,.w'lw vk S-L,y,.L -.LP 1 .VM y' fy 1 Jfuf. 'J ,Hulk U . . '. '.1111V4F'Vs My., ...A ,,,.,g .x.rVVV.,J.'V 1'3'iEl5f5ff':w'QF'.' ?.weVv.f1-?3'Sf :F'.: .4f7.1'5J'iVfJ'2 ' -f?ifc2?:f.'5Vh'-ff X'Lf1L'f'i..+'.- Y-V'-V:5Y'f27V VJ- 3 .5 1935 Jmgx, 5-.V4'..,-M Vg, 253343 V '-VQV, VwH ' 251. -wwlwfu 119135. U.: ,,l-WVUWLVQV ' ,,3'.-,3 K V.g4'. fp, , wr .. ,,,. 9. ,..,. ,y w .Lg .,.,:m.. ...V. 33, V... VV. ,V.1g. , VW. Vi., fm.. 4.,..V., JU, ,. . V.VA..,.. ,..V..r.,V.L. Yxg,..,f .,1, ,,.f,,,,x-+A. 1, .W M, f'x,L.x41..,n. . Vg .VM -VV... .V Tfpgf 1fI'5.,1 is H21-?,1?:ffg'iff54! 'ji 535.1 .e:i3fT:Ef.9SF4 IM . wQ 5Lf.14W,fi.'? fL?4?4E.,3j ',,!'1ff'5 vVjkKgf52f:!1fiQ'i . ,, V6 V4-.VM w.f.Vff-mr. Qu.-.w-,71V, Q-N -s . V-Vw iffffff f. .fiif--:.1 '- we I 23' .. --fzf-V34-. 'V aff is -5 JT !fV Qdz.Vwf.V.-v'.,.1:.f Af.-:,.a 1 .X mx-45.5 ww. . ff .L .f , VV V.. .,.1 ,gh ., V.k,,,,. Hi'VPV32'1'.VVg1'all-ifVEi2f2Sii?V3f1: ' 'if-:Elf fl'- .1 3 . .npr ,S.5.,'f,7 Zi V. V ,V -,3.-.-.V1..g,Va ,, M Q 2. .fx 'V 'Ia'!'frl.1V , . :Zfpf VVJq23'f,,E15'V1'f3 j...-I-. 14:2 f4fP1ZVLx44..:V, W., p3g:Jzumfw ,154 A A U I X K 3 VW L' J' .v.-,Vaf-1f..!fVV 3 . V451.2VaQ5Q1jf2:K'V. 5 gg.V44..:? ik g2f:f,V?.55'mf:, ,VW-,+ -., V . Vi.-,,,x., l,5VZ'5'5'w,'Va'.fVfi-:'i.1JiVvEf21P5f.f -S VVH4QM.VVw:3..VVM-iffwxife- V f Ti + 'Q II .5255 V. V- M51 f??45i.'5fg,gVV Sami-t -,.aq 'M wmv ' N' 41 W 'K 13 -:QM 1H5Tif'95ii'i3?VX5if my ,- 11V?.gm 1,e:wwW V. :,ax.1:fXHKV-sew '4' ' V K ,rw .iyggiy M.. VuW..g?,,3 ,V W ,.u4,...,wf5wk,g ,,WV:r, 3 Vw-VV Va- 2.'wV.Qf'P1f1:'+VVuV ni .- am, .V J ww?gag32f.p:u,QVff id whM:5!ffn-ak, 133.1 Wt? +V 'V M 5 c Q V. .4 . , ,. ,x :A 7, gg. ' 571- 5 54V.4.gfgr-.',,.M , -N- W .m,3f!1,.V55qQ5Ef.VV-V W WMV +'- -! :-P -,v fiE'5W? ,L WV D -xiii' gV1g.MVx is f ,Q-K5 1-IEW my .1-. if .5--, yy. g'Vg..,g5-, V . ,. V 5.11:-6: 2-w.r',? VVV e.:1'ym .4sf 'ES' ' ffa-2:12,-'J'1'T.'f'54i3?f, '-'TIF ALM . 'Z' 'f 1:3-MV'-. . V ww .V.-., ,, , , 'sgvty-W .,.SH.,.,,4,3,.-l?.w-7,.,w-Vafs-'xkfsgfrwwV V, Vf,,g1K,V4-.gg fWgggyV:..V1g-V E,.VVqvfw.V V fl L 7 ' ' V VUE, as Vgzcffffrwg ttV,V.4..5 i.. gf V.. V. V V- VVVV,Qf. . ,V Q ':':?rQ'Q1nff!'K5T5'?iif:19i?'fI1'4f12'11'gf .Vfgf,:V5' f-F3555 .V,.V V ..,, fn 1 s ig 7 Vp V1.V,Wg.:z,V,,,, ?gf,,fV1,'-gf. :.fgr1?b1:.-E-- 5'VV-.-,VV-V,V'f'.-.-vwfwir-g4Vn' fu Am .1 WKVVV' Vw 1- 1,VQ'SM5'w-f'v? 5 M.xVV 'vf.2Vfu-VV 1 :Q V1.1 - EV f5A:f53.w'ix:ggfE- ,WE . Fx. Vf V. ,. J fV?f'f767 fl 751::2ffV.17 Fiji' 'E VV 'f?x11r...,i',V .gf 1 UWM 'iv .fgfafg fgiS5'W5gffV1. I iV .WV-2 4f4'E?fVff f?iQfT:'VfV f'f.Ve21f'-.'l9f'Vff95'Vf' f W 'Q ' Q L- :W V J V 'V 1Vfw .- HV. -TW V2LV.vfVVl -H VV2 145idV,yY3J W- 5 .V K' 1- A,p'fy: A-1 9 -2 wi: ,- , hui: LZVV Q V. ix,-.VM ,,,f,V,.5i.:..-.fVf?qVx jug, mv2EVggf,zY+?. V, fm 1 5: f, ,, ,H -, X f V 'fi N 2. J .fw- I 5' fw A, 1 my ,464 W H .. , ,gweL,g,, .gig wif X f U M ., V , VU ,J A ,WI y F4 qs We? 1 alggffsfzfiw 543, , , . , V I .V-.Ng F l I4 w J., VV w P 15. V5 Nd QV 1. f .C wg V if 'nz V' I IJ! 'V V 1 yy , vw. Q V .xx 24 1. . QV J ff ,sf f . -we ,QM Aff M. MJ X Mrgu v V' My gg: TJ' 5 1 w.: ag,- .ff . + 1 x , 5vV,iU 417' 'SEM , V . J ww.. I af i V VD ,r ,Vx ff. .Aw xr' 19. fwfi., V f .w ,V+ m 1, Vw V x 5 1 9 I sw ,- -911,3 V V' . 4 hifi -1 73 f1'1f-1 f-' N,-1, - qVf.V .,ffl!.iVVVV ,.,, V4 .Q4.i'..-A .. ,, .. V V V.- ... .. 'un ,Vi , ' x' ' ' :fi ,V H5 ' K S Q , ., ,,. . ., fu V 4 ,,.,,1 WV.. .. ,-, M ,. W. WV 7 4 b i 'fi-ff? 'N Hx? if G yn X 45? W, 4 .. :TV 9 J V' I'-fi i':'Vfl??l'1'.f-'r if Va3:?Vf'L,5'.i Q Y J My gwbfcf- uY'JW ,V'f. i.f,1A ' NU? if 'f u,J , I Kfrg, 'Q 53 -Law NJN V ,. ..., .. .. 1 , .Vf'-K:w:V:V'f'i V, Vg. ., v-Vs nw: 4 C57 5: X1 J.Vf'1VFw.VJV?5' rw 44-ff,-a,,'L::g.':-f V ,:, . VqeVaai.,g1-f-: Vf.v.-zafxwsgfi-W... 4 J QJL.-ng ' 'uf ' . M , V' f' .fn- . ,- ,J V .V-L2 'E-lf'-'N. nu- 'I .ff- 3 ' ffr' 15!:I : ., T '- Ti, lf' P - Ji ,fix - 'if' V L I 'Q we if 1.3-fr-fi .1 . , VU. 'rV'P.V3zg W ,. ., .VV .'.:f--:Vx -M.-11:Vf.V'sig VV'.i.V.- ,ggnxn-f -'.:V::-. V--. fs kg y.g rVnf,zy.EV A .,.,V ,-,,,V,-,, .PM -.Q-uf N S, - .V4,1-',eVqA.,V.-I - Sf-1. .ff - --V,,. - .uw . 1,y?2',iEfVY5e?iiri .f Ei.:,V'gfg, l V'-z':w+.': .V ..Vg:i35f'wx3v-g'pQ'V,V5wVii'3N5 3 Q X31 'Fi 2, . 'Vif:1'f-::':fJ:.:'-,Cz1f1f:Vw.V--if VV Lmifi'f.if?VK'1t 'g'-:VVQ' 2.VQaVf,V g,y? 5'5iV'4'Vsf , V ' ' ' . .. V... -.1 f.V VVV1-av.rpw.V.,a:' .-af X wi. Q ,. ...img 3,2 I . .. - - - 1- -z.: --.V .VV 'V ..b.af'm.-fwws , ,. ,. V, . V- Vina., ,-.'V5.-3.5 V'4.-gff91V?--1f5:- we .-17,312 fna,ai.,.g,Vq,Vix- riff? 'X '- V H A .31 v5t5f1E'2?xfi1 1 --'vi' . VV J-2.V':f:V1V :Ja : V: V.-V' V V5 1-+ by Q .vJr-VV---2.Q..E:V.f f L' ?:2v.'1:V . . wha. , M' ww: Q' V.. ,WM , .IVf.. . ., , V ., , ' :Vw ' 'V 14Vf5V,-'.-'View vw VVJV'-V..-'e.. V V1 V- , 255.5 .535-V.'1':,1.qf n-.,rV...f?e.9 .- V,w.V,- g,fCx i lm. .,,f.1,,:df7, . . A' Y ,. .vgsfzv 3-'VZ..J ,:i,: 3f,iQ3Li37:'7:':'S'f53' FQ?fzlvw-NA'.f5'?r'Cx:mfw 'Bai-.:'fyv-V'f'S.,gu., . . V. I.. .5..,-zu.,,'-rm,-V-wi. ., ,. , ,,:,gfE-?gi'g,V:ff5f'Fp 2.5.-,,,vQvfQ.:Eif?'5'Ev'f .-,yzf ..w,v,-M?:Eg:Vtyq-.,v!44V'm5VLmf. -V.1m,'ja3V3Qg.,?:Q,?72gq?Ljj?f5gF4g'i-g??:QE6g,f , , . .V . gf. ,Q ...JY , 55355 , . 4? Y rg., M 1 Y-4.fFr'V1 QP-Nii? .x,. .., ,V my .W .gVg3.,V WV- 5V..,f.g?gVfy QA fp., MV .zu EM Mr., VV VV., ,r 'ivgyvgw Q15-f sawlfsih QM lui? gQ'fwgar.zf.4Q fm If gQ1.3FigeWf 1 WLV- V 6f.b:z5Qa.1 -. ' 'Vq ' 5,5-wg-:gy ff- .5g,,5,,Q-qi,5?.g ,Q i,:1::fg,nZq 55353 J U' vs as Wqabxffm 7 33Y5f-fd ':5E:-+?3?1WfPf44'FIw.'ff? i4'fff W4 W -of bf? ' fV51Sf4w2gS4f'Waiifffkafw'fvVai:f?erw-,Vf3 ,537 1 f+w:'2'p.f5: 7' gi? 1,2 YU 5123 A if fxsmu' My-g?5Vg4w1g'3,1'm?VV'puff.,mggyggg-V.g'.q,sV-..5,f',e.-.5 , tw N 4 My ff 1,1556 V, Vfl f,,i,1K::,g,,yg,vnqL1.VV,f5N-1... .gv.f1'Vg ,v..,z,mgs5,V- mf 'ff , wr UM w Ft? 'ufVVVfSa??-W-sgw,.,iVfW..V .qi wfxwmqf. ,.JFV.i2QVVVq V VV 7 - V . KV V.. V.,'1- f X' ff A I l J2!'fffVf',0f'-is-rv . :if Ysftff ..3.'V+rf 'A-55516- k?V'3'L?5'? . V 513.5-..gVV,.-Vim f,V?.,,....gg...V+Vf...VV9 nN.f.kfe V . uw.--4 . . . ,.,. 1- . ff 1 1. M wi.,-.,-.gf':1.,,V, -. ?fQV.,,V..- .l,.'21 .. .. ,.... . J gi ' nv '. 5'F-5'mffcl-.,1f'3,.131-53,.:'3Yg-.-,'g:f2- s'2..i::'.5ff'::24,'i 1 p YP .if M . ,.ffgvfNz'5 mia:VV-Va MV.V?f,NV..,f.:'4fii,w.gg- wiyv Q fs f ffv f 5: .ef-yiiqgf pi-5 We 2 f V V .V IWW W Q., fi -, ffm, , Mqmx 5gVVV,W5,,43Kw ,QW 4V3w5Vg,ui5..:,i,s,,i51?'lfi'Q',f?,-V-Lryftgfiqel . V .V V V .,, ,Mm Mu. uVm,5V,W .V -,,g5.3V,V,., r.,,V,,....., 3 xi Y ...ff A .5 ,,,.,-.1-ifphimmf-' QV.-M eyaygff -.VV.'Pw'g...,..w.l-av5,f 6 Y 4 wr . f.'a'A 5,130-F3 M.-W,'?+V' Y-SV 4 1 1- :fm 1, 1 xg x ' 1 Q341s-iefn?:jzfq52ffg5,fi'.,JV.-E-3333522432 fffg-M' V ,-V ' ' V. r'.'5f'Fi rf 'i 3 ff ' ',.r.,hE1rf3fbf1e.12:J!.,! '55.'!f'fi'f:'wSf5n2EV?5 ., - ,w Q-'QV Mil- 9' .YW-HVM5' 1- skfmifis . fm! Vi .-1.761 fsgiffiifirfek-'g 1'?2'Pf1-'liiv Vkffsqfjvf R, ,F , A -'Z- S V335mfjivx-I-s:'g?4Pjg52i-1:2-W f.gyilififyggf .W X I f ,M 3,1 1 Q V ,W mg' ff :z:,,Lfyf!-V.'il wzfgiggw,-a4..rMV:f.VV-aim, gfxg.,-rf-g5.,gg.,+W1,x4 fQ,f5 f ,, 4 -V,,g,aV.,:y ,,m.V.V-..V., .1ymQ,?,.. .mg-,VV.V :W .vgsw Vw .1 , . Vw- Magma:wwfVsefvmfm-w:V:yV..V.wffsai fy, rg W ,:'gg.a'2gV.'V1V41ff.-gmV5295?VV'Q,Qwwgki5q:dVWqwf5VVA:V-VM fn, im 1 ' . MV- 9 :Q-'fLV.f.'Mfraff ai '.fg.VQ3V1.-.-'gisfsggzfgifgjyjff .W 4 M, I ig,-c,..,fV.f3V,.,gV:g2.? M53 .IVV5 .XV 0.31.54 f - :J .1 1 V u V Q-sf' wi- k fi-' JW' ., fi-,fZXl'a i' 2:13 4 f .VM , fue 125,111 .-2591rfrg-.':L:V:-.sV25,VyfV'V,+:wh-i-V,gVvIV 7141 7313111 fr r ,M f :VVg'..q. -' .Q ,-aff - . V' 'V 'S Vw W6 22 .V. J . W 4:'V'+.,V'.ffVVw-ew '-Hz. -an-M. Raef Q, .4-VV 'fag V. 'pa .Eg 4 ., -af ?i ..,bMwq , 4v:!.,,1VV'33yggx-15.5 ' 'iff Q .frm .W ,z ...H Lflifiyvfalw Ja' -Qfwifl .fVVv.:z,4.Jq:,2 . , . V. 11: Mm M ip' -'XQ.,-g .7':gf1gr5g.w:ly'y:V5f,V'1 'Rx 7'J:f rV V fVff5V':'57f V fi? s'5:f'ii?i3i?Hiaf:f1f ifi?f9'eF51 JV. .Mya ,. v VVV.L-'a,f.1Ri3,,..V, Vw., ., A,,1'5,-V gy' ,1-gm?-fi.--'z-j.g.gfJ5-V'i M 1 ww r ,A ,f -:W '3.1g:VwffVMV5 Vw:,gigss.kg.:.V:a,'gyqiv.3,..Q4gVVg,V,f-,pi Q VV:,.f 7 1x.igi':V .VV m1 l,gAVgg2f2Vag .Vw 1r:-uV.,- c, J . '- ..w11.,,.,f1.f4f .V Vinh' wx My .Ve 52,11 Qs'KHs-.-g,w'.ffVw'.,wf14'g5vJgfwVVqw J. :4..1f,Vfb.-- 5.1 .5 ,. ,Ve r, P. . ffm ,..:., 31.1, , ,H3.V.' .V.-. VV ,...,.. ..... , ....Va,. V ,ff-zVx,a5:'f ff -:'ws3 V-iq?-:HQXV 14'Vf'L'ifL-.,,.f51?'Y Vwiff-Q fm?-... Q U EX, .,g P? f573'd'?53'?i , ,V 1141-ipmm my V'f2:1 5VV: fawgiggixfsggggnflggk f . . .,,,.V.VW Ji f Hy F5213 Q.. .Qu ,, ,ww W QV , VV f J? 'if X1 V' 2-za f . f . 2' K al.,-w, V WM le VW v ' 1' 95NrQf'1N3,h'4v x'f 24? ,jg wif:-1 m. if 1 tai mfiwvwggkxy r .V ,,VVm, .A-,,.f...,V ,. 'v?V .V ..,.f.,,...V?z,3,,.Qggfnz.,V.k . we Pj' . ,afar-2' .. .2 'R Y?ffFf2 'a-V ' MV'-'hw' ' J ,ww Vw QM M bf .,. 5 ig. V4 A12--Vw K ew 543 V ,KZSIAQ1 fd-if fig'-Q lgfisxn'-fag Y.:-5? .VV . 4 fp. Hg flea 5' km i 1, tihigzkxgil' 'L ',,havfr:lL2'f,: M5 dd N315 Q.w.1-:Jw r giisqkjgqlfgg 4 gggmgv ax, KQJ 3 ,V ,V VW, ., Mm M ..-, bl, ,dv xgiuiqf zfkm wwyg g.jV..Q51g.Vig,,.ms:.fVfVVg2215.3 si Q V J? N pwemw ,. gf'-,!fV.,1..L s... ,Vt-..8:f.'Wmwh1 A PV Va.. VV V ff.. VVw..VVVfVVV.2...V.V2 , .V ,Lai Ws'g4f'i'-3 1-s:'gfkfmj fggji V--.M-2W'we-Vf:1fai1wwV.wV'5?5ff'VVQff1-wg V .Vfniviffgvgiii .r-EF' f1vsf'g.-jx' HS' 'H mc . mfg' f'-iq V ' +55 V5?w'7r yy V A rg ml. X Q jf'- yY',j V. V529-Mr 11. w m V- ,ww fu V V V V HW! 'LHB M3-. -eS3.,.V: .yrxigx 'S' nrt 1' if it LV --aff! V-' -,lgfw mi'-wifxfj-X QM aww ks ef ' fAV,,f :Tf,w :Iggy 2 ,uf K .33 VH EQ WV ide ' V 1 ff. '1 HQ, .43 M A? W V V11 .. . F62 f wg irii Q., ,f,,M1.. 5 'LAX' px., ,JL Q .5 , M , wr. ' M 3o5A,Qigf?'lVE'f Q V V uf .2 V Nw Q . V 4 'Kuff' 1:4 vi 1 V , ,, 11 fx . , , ' 3254 1 VV RLQIM W 1 . . . X ik ' if W'fZWVf'xffr45 .:eVV'wV:,V':.3:2-:tVV5VvQ.3q . ,, 1 ' .VFV J WV .zfwlg . ., V V r fxWggzwg--:.'-z?'3f5'vL,waV51gfY1Q5f5w'?MVfVg?f3 ..V?5'Y3'?, V f 3243 'Hiifi , 5 sm... . JW 'L N5 ff fl 23' ,P W1!V5165i'v.f2QXV'H3531.?5Vfff7QFffZ5aVf5?i??E2 Q :Vv4?',.' ' ' , .- . . V. . .fi-:se -V 1 :cf -.zVf .V ,mfg V- V. ,V my-..V,.1s-1a'VQ:,,g -:- 55V-LV.-3 : V.-Vff.V..,V,,gV,5.V,r. M' ,.V,'fV2-mjVAw-i,:- .-Vw...-.QLVV ,.fVV3VL..l.g:,3x '! 1zi'Y'-w3i'lf. -. - y AV. , A V. .- .- V, . r Q .,: ,,Vf:V:-V.. 11... mga - .V 1' g 53. 'Vf:1.f.,Vy.g.z..+,2-1.-Q.. 1 . gif,nz1-1:3uff4fii1gV9ffV:i H.. .3lj: :f-125556'515f1iQ:',5'i1L g.ip'fl'12z5Q5'a.', ' ' X341 M y ' WV VW V V 'V f :V- V..V 1,mV:.w:gV,,PAMf .,fwi,2ffzf:'.:1?m ' V'-aV,nV,jm,,..qvV:-ug:f-qw....1-V 'a'uV,4A.1f-fe.4' . 1.2 . Vmwfgf A . Vs .V '14 :t51Vx'f1V,.-'wi 'v JT V 1 V229 '-'V1::J?fJ kV- fa ' 4:13-.1v.2.9Qw5 V' J. . .. Q . L JW, .4 114.-s.y,V..V. . K.. V ..4 f . TWV 3.-f VF? H Y-251: 'ff -xifV.'.V VL, 1'i17g,1, f5Q QV.. -mf , .. QM' :Miff- ,,,,,L3 A:,V,,,, ,N .y ,. V- .. . I' , .V 4 2 :Jr -f V..-A -,' '-ff--fb I-1-fr,IV-'ff-'V g':,:w,,.V l1?..'g,,'.fV-. f,Lff.' .ali-.fi-'hpVmfVfpfl.,vm'c'?igaf.-1?-'za if Img' , T 3, SQ gg V: V. :ff ff-:E V1 '1' .- .S .+.'f'f- :'VfzJS'H1' R . V :i w:w'wf'f1 S Zlg1+1.+. -Vw-VV' mf 4f.S1.Vv4VM V' V-, .V :Vw V Vw-g -rr 5.3.5. f .f S., . V1 V-w,'4..'-V' v' -mg 'Vw .'.-.1595 mgmgs--'Vfxffy V:V f'.1V1'Q,L wwf?fF'V,fVw,yVgp,fV-Ay?-f Qmjg V H. V -Vw 'wxfV.4V.afgi:wygxf .mg .V. J'V',.-,.,,-fV,.,A.V-qt-:,::g,V , VV,f,.f::xpqgfi-clkfg .a:f,,3g3- Vf4f,rg3g9EfriiVlW1,,p2:f5,l2!fs A w, afi 'ff, .L ' '.5ff:l'X'V I ,Mfsiv X' -V' 'Zii 5N?2 .1V:VH:J f'Zw:p VTVi .V-.11 21114: rgfmiA'i..V,:1?'?.:x-'wirf- VZ I'-V114-rf .fwfr V' A-w:.V-fVeV..V...,.. 'V V,m.,a.4-,-,f5jgaV.gVV..L,.-jgV-Vg. ,l.a1,V1VpV35:M.,g,:.Ve-,12,5.,.V7 -V Q 5- VV--5,1 . ' R, V 'V V . 1f13V'V:g1w','saVxrE5'erV5VV,'i,'VVf'f.g.1f,f-3,23155f VU VP X, 1, .fi ,M ' w ,.5,:fV1fw?4S,:5gg.sfygmfyqf,-'A-V,'ffVV.AVff.V-w'.YL 3 2 , if X , Y. .Vw A V5 Nth, ,jf 5. .fr x , qu My ,4 V , . . M f .. . :V V. kk :mul . fV '-V Vw' 'iw-1Vz'Q' Fef'wW'fVVc21i W V Qi wifli. :gm 5.13550 ggwa.'g.zV' f ' ,.,V!-.a,4,VA,-V4K'.f'V,,VVo,V.V?,VV:i..j1mb',wg5.4,,.-ff.,,. w,aV.VV...V rv ' H ' V: J - , -VQV' Vr,::f-v,VVge4V'-VN.V,wVy'-ff: a,, . 1'99V'eg 15, vii. ur,-1.g:l 1 ...H . 1 91:1 Vg.. . 1 V., ..V ...A V,,,.,.k..,.f.., urn., V .,..,vV4.,.. ,Egg ,,. .,.,.fyNM9,.:f 2:5 A -Vf?w?'W- VL .V V .V.,wg,,,.W,,.5,n H,-Q-V 1. . V.,fC,.f5., . Y- x ,Q . V f1x.....f. -Vx. Q f2'H52V131V4 V.afWf.f, . .Pg V, af. - . V 'f'5fg'Zi'?5' '2,.'1qf'g? y:W Swkfljigiug Q 1 Vmw I V 3.4-fm' '2V:,fV ..'L . eww -tv K :.V , , f, W.. V'-QV, 79 ' 7582.93 Ji 352 ., - .,J,,v,VVfV. iv , . xg? .,-Q fl V V15 fy Q ' 5? A 9? V QV ff. f QV.. 49... A. 'rsV.5fwgg,V.'1b.v qu. .aQffVg WQfy-,igrgggg51.35332.253QV., fdeqi 25.3 34, - . 53' ff- ifU w1f'3fVV Ya 359, 3: 5.4 5, A +255-V -31, V V. , 1 1 . --Q ,,. V 4 .vias M 5: V' .2 . 2f1ffiV,g'VV .Jg,y5V:ma9fLS+j.?i me fy ' .1'-viii? P I' 5 v .1 A -w fr f' ' J . 1,59-E - 'far VV q u a M',q'9i?1?754V,f.5x1,,:, .isa - V ' ' VV V 5 wifi X ,fggggqqp V if f . Mfr. ...Kwik Q. if ...f i ,x wi' 4 ' J wifi' W fyvggxgw ff Wifi., E f , F, M . QA I .ix it a a I I 4? w V, . ,.V.fs,fl ... . .. , ,,.,V V. V. . ,V -5, 5 .. . , ,,V,,.. .,,.,,. . VvLf.,4,V. , ,,. ,,, ,wg .WV -.x,,., -V . a,V. -, .Vw--.N N ,,V,,,V V -.V ,VV ,V ,. J ,V , . . W 1V,- -4---V . -Vg- gfy, 3:0 .V'fw.,,,5 -an .V 'ing V.: -.31 5. gi- QVV.,. jV.. .1 'QC-f.V. .,,5,w V 52 me 3 ,1w,,. '- 'VV-,Vs f. '3-M f V91 'V,w,3V-..-, Vp- 4.15 1 xg.---1. ,.jf..'- V-,f -i,V:.,m ,g.gp,5.1,ziy+ .,, gk, VV aw: 35,:'4,,.gf:.fEfVi.,V.,, ,VV .,,.ff..2V:.f.,1...,,-, 2-35.,fV...14V '..e fw5?ii.gV-3,-43.4. 59:9 4.1.3 VV iffgfggig,,k,e,,.11q-HVV 1-?fxg1'fV..:f,fV:ee my Ui-iffy, V-51.54-V-a'V :gm V. QV,5jlg.,.3-,:1g..:1-:f- .:.zfV:11.,f5 gf'A21lVf,.--if u,,Ir9.Vv .5-2-fg'1VQf.' .51 QI: .,:'g1v:-?:fg3'.c,5-11 -V ,,. ff.--c, Nu-,' VI .,y'vV.-1'VV.'V'S,1Vfiv'fi,Z1.fzfV2fgif53f, 1--if.-,. ,,.,3'j 3.-,f.if .,.,. 41-VPTYV.,-' 'Q-.?4,ff.1... ,1.-1L'.u: :. fl P12 .V :HV ',3.'- 1- ,V'.':wfa?1x V.,'1Z : ,..3:?VVV .,-:.- 3,45 ,af-1y',:j' 1 ,.'.-sf, ,':,':eV,. .1 V:- , -..L.,.g 1.,.,-,..g.:h.--Vu f'-.nh .fgVV-,VL ,::,I-.,V,L..1,-,'Vq 1' .,.--.1 dvfw-,V '..' -rdf ns- ,L-'gf .51 y-.,w-fgfagjg V'5,..4. .-Vj...g,-f V V VV' ,. 'fVV',:7F',gi5g5f?:v:iQi'?.i'fVf.f'.'ViVE'Ti'12fiF i:5n ::'x5i NV-4V,?5',V-'IfV.L:V' J',bi3154fi'i-2i??'..fg,''5'373iS:,F1-2, e'Vf '1'Vg1:f?f3'lflfi51.-3'fal.ks1'f?is,?-Q,-fi,-,iff V '1J:'f +V3-'5V .Vq -fVf1'.,.VV1W1:'f'g- f. 'm1VwV.V.-:V-1,'-Vg., any Q VV f-:wg 'gVf--1-5121- 4 rv ..V.gV:p.1g,,,-u:1:,f..,V-Q. ffl: V4V51,V'Vff:-V-.nsfag V , V: 1,3 --:aVV:.4v. :gn rp.. VV -rw 3 511,- V V .11 WiV'1VVi 'vX' vm 1 - :V 27'5',fV135'f2'f5ff53f5gyij4 65:13 IEW' 117. i'..Vcpif'Z:sifEfVTILGMU,-'.ii 70fZif!24J.?f'1E:TY'l'!:Y,1?T ?l 'fff '9ffFf1?',E'V '1 V7 '2i'L53 :,VZf:'ff1iV :if1i 2.i -? ?:V.L7 A.ffimifv .1f.i 2W?Vi7:V'-tl QQ If' fw,SVfQ.f-'iufllffilfa'- WQV 'f7fKN:ff'l fif ' hi . gg'fi,Hff5VV'.,,'.,g,,QV-,V...mp V1,g,'iu'g2gV.'ar5-V.- 'Lr.'l',?-V.1s:.Vf3f gf,-,Vf-::j.Vsi.:f,V.'1..zV55'?em,':wf':.V1V .,,-V,-?,'5f i-S fQvi'r,,I',, ff'1Kf?,1QL1,'fV,,g 5121:-2Vfy.VwV-f.g!61!34.g1.'g.,gQgg'VfVg'5'..,V'-exif5',f-'W-V'-2 .115 234-++,V 'i,V?'j'y2fV:,V.'-V, Hg! . ',dfg..4:1:, , .':f.,QV'VHfAf'L2 ,z1gy,gV'f9w.V2',i I.,fwigqwx0.V.VVwVVfav:V4is'.iV,'f,V:E.fmif 1:1?-'VVLVkgm-f,g:gVie22V'jim'V'V,.w.Vg.aa2Vgiq,m52.9a4.4.,z':s:z,1Vf2Vfiflwmf'-,rz1Jf:1f:Vr-1i7 f.:.VV.,i A V75 VA., V ,V 4,4 V fy. .X ,u V' Vwimp., ,..:,V:, fx ': 5.51Vs, n5:-.Vy:1V,VfV- wp aw .., V uw' ,. r ,Vzu'.-fvzff' Q .. s -.4 ., 1 4-' V' , E'ff!'wf.' 2fe?1'-f4i 5X TTY '..f,3i5f'1f,'2w yVW 'f 25.51.35V',f.-P,2'1frf.f:zMViviifi,2-f'ffw?'fVff'1V1fVMAe!..V,Vn:f-V':V1qVVV.Qwnq2m.wrQ:wmif2f..f.'1L11'Vw?-f4L.fiV ,Vw,ffVz eV4f'gff'V ,M .1 . .2 K . ',:'g ,j,.3 37 'g 1.g'f -.V QL-V3fv.1Q.2111.' :wgVf:V.ef5w'2V1' 'afici 5TV'.jV,1' 4- .gf :.V5f:gw2-V:.a:.I,V:1fMI.5'01fVqf'ffV.2wV2 2f'VZVZFMLVQS' gy:-x h ., ka, ''?'f '1L'I,lfi.7Q-55'ffm!V','fxE',3- fff.?P: bIl:5s'Q!f':1' '..' f ' ,ff 4,-'Hg' ff .fp-if'.E-' 'f 'lflfkf--7-fi.ki .v1 S273-QM 'fI'V,I'gf,j'g.g:-SQ 9235-:15Z'.-j, IQ.fhfVl',-j1f'if.'L: inf1.73 rx, 31gfityfbfxg.L1i t.,3f7,3 lf+-5 . 732 a'1.Vhx4 j'ZV '4f. 11 V' th f -- .':.'.'ZV ' QV 'L,.1.f .132-Q fri? 1' 1 -'f'V'V ' . ?.V.2'Ei 1'-.'-'N il: ' it -f - :J-'fi'-:f:.i...' 1--'g1,.,'VV..'55g'V'CQ5V'Af,LVc.5:2g'V iff: V, 2-,'.,7-if1'5, -1.3. .fiflmgj IT- 'j ..::'-,f4Q'1.t, I-'JU - ' V1 ' ', 3- f fgf',,. ,K 1- V:g,V....', I., lfx xg.. ,:,,,.:g' V:-'Lf K fy 2313. I3VV..V21,1f ':..f 'ara Q3--.115-x : 'mf-.ff.V1Hg. 'VM V in f V. !L- 'qQv 1sYgz' ,V,.1C'2J5f V',f,V,f4g, iV,1'2V :2'.ff5?. 1': 6.1 1-' ,V VV ff : 1 1V',V:zf- 4:7 ,:'?,.'i: ,.-QQ' VV.-'C .V'f?.1'fwV1.,2- 1'-'frV f 'L2VL 231-2-fVf g:l1.'4, aHfF I-sz: I1 4' '?52VQZ5fw.'1i.e'Jff.'?Vf' 'HV. f'5.ifV-. ni Fit wiifieV .1 fix-5 -KV: V '41-Vw Va . 5ftV'ii f4'. - . . -me 2' ' qV..V'V ' : Q. 13. 11 53f' :Vain 'V V1V'1 if 'riff . Vi' 'YQ-A -vf'Vs'VZ.Za,:'g5.VJ? .2243 Viv Va,:VwiV', :?J??VV4?21V'Hf?fV 'V' Gif 92, :QQ Xi L57 E2 ' , M , :ffKm?':1flff ,'f3:e,!Pj-'3L!?i'Y'i,f 'W?'Qf',gff':'?1'.35',3i'j V3 4V VK-Vi 1511 lfg xf'L'V'V!-2 :1V'A:4F frV,2igg.ViSV'q..YGV?-'QV5'Vfiii:f,Vf'V:,2'V3f.VVtMq'fsfm 'iVix', 3f:.4'1V-'fitmfwfv VR,-12 'A ,ff'Fz.1-M122-Qff-'iff We .gs 1 25 V.,HJ.:..5g,2.s,is5V.Q,5417235:.'V3V.fVga'V'gg:Ef',VL'Vg,gV,,T3',3.V,f5-1':4:Vf','-17.2Vi-VQ'V.VB.VVH ,VVL-iVwgi,rwgX.Vg,gfVVi2,L,. wjgmflc...:VgV.f4V.:i ..g.Q:aV.ixH34?,4,f65x.q.W?. Iv, Y., pg-2 31,531 ,124 35 ,V,.vj. QeV.Lg-1,l:g,f.g?pi ,fg,.,fVVV.Vf,'s5i +Y,,.VV.V.1q1H'eVA-1.frw.:r15'11,H:5.JVjr.V.,Vrpgwfg.-H L,-um .5Vv,f '.'g , .:, L,-gr'VLV,,V:-.:1sgV:f'Vyf,V1y, lfljfi 259-1,q2fg5,1-pfg,Hf'4,,gV'V,gQV11i2 !5'i1 gpgVwtf:-.,.w.M,.fVgg,jgf,f ,,wl,,,gVf.-17, ,L ,QM 95... ,W N QS, .'4fgwV1.VV5e--V.'fix,zA.Lmf,'3Z:.tfn:g:gEV'iVg:V:, 5V.,'23,,aViVv12m,p .,:f'.L-:'K3..,.3V..tm1V...'.--r::VV?V5q if-wi 53'-ff. j'!2?,i,.-,QV 535.1,.27z.V1V5.V.'V,e.gag.,-'.1,g 17g,vVv-VV1.gg-32.g.,VV'VxguVWVki5 f f ...'..V'..,s5'1'.1,'11':f1T ur :ws,.Va11f.VC.V21.-WV2:VVf1:.E':igm,ViV'-.1 f-.fVLV'.'iQV'V' V 'HVL'f'?1-'ffVTi f l'f'i'5'f 59-,-32f.V.:'fZ1V'11'w'fV'?'..H1wx.133-::'XxlVV.fm.'VWFVV-ZHJIsm.-:fV-TiVi2'h ff':ifQ9fsVa.:wiv V ,J fir' i 'Y ffl-,e MV-,-f-- i-:3,,2 V rj-,VrfV,f33if'V?5-,Q '2V?ff4,ig9.1L:3,g'Z'5f'Q-igVa ':V:11V:1VrffVf Q Q 3:1-' f 5Vi-.'W1fS':f4fi'551VWfY'-'54--mfgi?3gLEiffifi-V2.1EV N, ,.,VV,-,Q ,Vg - ,,V-.,-A.-. ,X .ff ,-,. . V,.: . .,g,gV3'.,-f.,,.g,: J, , ,,. . 3V,.:. Ah, ,, ',..,. ,'V. I jf ,V,St'f:f,.-vm1.5.5. Hg-eg.. u.,-V-.4 -.3 -gg QV. .VVV.-3.4.1, V, :Vu V4. 9' f K. T'Z,5V'3'f3'i5:fi1.,- :-Y,-Yi.,-I'iLff-rfljf'-Viffl' Z , ., F' . WMV.ff--12'... '1:i-FIV? S i : 1E.'7':1w '.f2,V..- IZ ,Q 1 ffiiffw-,f.-iV:VV'.'-IV KVI V'-17 V f:.'f'fV'VVV.f'.i:ZVr -sSVv,g2f'-Vi:zg.:' :Qin uf: 'VV--155:-,-isaf'1ri2'5V,fV+,1f4-ew..-,aft 2 ' W K 5 ' X ' f ' ix ' ' f' W 'fi-,rn-'V:k5r' 2 v,:fe.i,v,VV, L::'z'L?--1'Vf'V1V':5 E372-PVig'xiii?.w.'b,:a.,5:2f:f:fVV:-'E',Vf-'VVfVfVV?a.fsi,g41':f1922? VJf i-.'fz:,G.-129365VV355 . V YS ' 15 ,VU Nj . ' ' 5 V N 9' wif i'f,Vr'Qz'Vi:' f.?V.V.g.Vg. V 31yVgV:,f::eV':'yiV-V.Vg.gV'c'::',V-fwfg, gV3315.wizN VV .1VVgV15,VyV2Xs.,igV.waifzg-wVV.g,V-V',?..ffSf1 ':,gw f1v,V,V,i,pi-f3V.2':g,,'2-,'+ . .V V I. ,Z VH -X 4 94. X' J . M , ., VgVgV,3.XVVyVV.gV,-QV .Ag.vL.VfV'fV3g,'--12:53vi51,32 ,V'g.',Y 1,-jf,-g.fgn.f I.efV,gQVV V,5V,-p.75i5s5:5.5g.fix,V'53152..,?g5'f:4V4c,i5Lg Q V,:QzV.j,:zgV,: ,agkg'Viffggw,f3fffi,V.,Qy1 M V WV -LJ. mv '- V13 -uw V'f.x,V'1 :VV-vw.-,'Vr2'f iVV'V'Vg- 1'-VV, gf ' ' ,VJ:V,:.ff-. 4' MVB' -V V. V.:'f 21:1 ,V--'rv' : L'V- -V: Mm.: X 'X 1 V jf' RW , 'N 1 V ?X5fV.,w-fi--Q:my'wr.'V,VVV'w'afV-1-:ff ,n,V..mV',1rz:V-I-V'f::r2V,1VVraV:wfJ4g:.f4f't3H'Gf1'J.-w2VV'52Hf+?Q1-'q5.Vf:Vg,VVVV'VVV.-Vafvam-.VYf?a:'Vvim'Vx..w:Vg.Sf..XV.,.,V,V5Ve? ??a..V'f. 'W'W,-2 .ik , v QV . , , +4 ,V .V..ye,:f..V,.Vy.-,Q..,v..VV,. ,I .aaV4.f.n7..'..,, .,,-,,fV 5,3-.V I-,:.frV..Vf:j'M'-15.1, -3555,-Vg-V--V Vw '...Q.Vb'V,' ,g.f'VV :V4,V.-Vy..:f',,.Y:wV 1A.w-gfV-Agn, wg' 1 :- 11 if r, ,V 15 5 , 1 S , , J V VV V V.'-,a.'1w'-'..':1 ww' fw 'V' QV. V'V4f-2 Ysmwl-:V'V1V+vV-V1.:j.ff.I5'L'fE1:Vv:wf.Y,-V'-W--44 xV?'V, '2V3f'5fV.g.aL-Vqwraf-V-yffugsl' 1f,,-V.-QJDVQQVQ 4 . J .. 521 V. . Q .V :V-,-,r-'V-1-11-4.1 2' ' ' .,gV.V-if.gf'.-fcv.V,Vm,- VV al, e V Q V , , 3. :qw-' .. .2 . - , V, 4, .f vi' -VLH-x,,'.'f1-Vf:.4m.3f .V,V-1. g-1.2,'VwV,5Aw1,-V,-.ff.1N,.n1r3:.g:.4v-3w.- H -4 ' Af f -.1 - '1:'VVV'v-f-:fm f'e Y--' -'-X L' ':V ' Vf Vf' 1'V.-'JV '-WF:Vf...V.1i.-.'f'v55:'-ff'-3Q5:f1'li- TAI-,'V'V'22,..'5fx1ZL5.2 ':'LIX -f5f'?i'f'W'5 R5 V, ' J F . V - . Y :Ja 'ix-.Q --1.L an V,-sc ,-w,.'.- .V-,Af ,Vi 'K V .s ff.:-V '- 1'-1. I ,af 'V-':.V:':.VVsfa'f--:UmVf:V.S.51w.x 3v4V?sgfQV,-V? V L A , - . gl.. Z S- ., -- .V,-.-.V f. V, ,V 3 . K . ., V wr- 1.---.f P' V.. .-V,-VVVV.::'.cvu1 ,1..V .-'tV.fjf-4 wx..-'V 1 -...' Vue 'V Vzkznq. wk w , . 14 f 9 V X ,N g'Vpg.v':'f'V:.,,. .,:,-ag'.vJ.,Vg':,'.- ,',.,,1,g','V,, , 5V5'LrfV:5'gV:V2e,1 ,, 1 ,324:Vicffjgg-4.f,f:g.'ri.f41j.?13,-ggiVJVV.4S'VV.f'Qx5??l:V.a3V, , ff' H. '. ,Vy-ag.. ,,.- .V V- AV? V': W, ,ja fy. Vg.,-:V+-V V. ,g --VV VV .1 '57 1,' J V V' 'fi , , V, Q X L lm VV..Vviw:.f' c.-mf:.'-i3fl N.gVw:gSw.z.TQ-fiVVf4.,..VV15'wV.V'feVfCfiw4:-.:VtgVg,. iles EV in 54. ' L PM A V . V ' .QV V . fi':iQfiif'E'V.Y..,fV'V1,wV'i f:f'fV'sV v 14:21VfflVVVVi'V3:ifzVmQVZi!wV'Vf'f3V21-Wkii-S5321fi ..1:VV.Vi.1x.E1,V1iSk3WG1j?i?3f'i17f5'FVg5xiEMIS-l5G s,lmYVV ' 2? M5 faq . V 'V , , L W.. 'Vw f 5 W, W ' 1, W Q' I-':VVf,f,iVQ:5a-Vi ' 'VQ97Vfw7i'.-fVvfg 'V gvzajlfsw::',v.:ggVV1':wf,iig5 Mf:kfre1H5rV4VgQ5jV'f55V,f,VV??ff'j,.,barExgV, 1,-. FV ii . V -V 'V VV -.i,VVasV5 :-Vf 'V:Vff-.ws 'afta+.:.:VV1:.,VVV:-.affV JTQVW ' V Q K H , , A ' . 2 V'.'f1V:L ' :V '.:f.1.Vf-.-'.fVff,:4V1VgV-fgrfxqg1:feV:?fi.:,f.-frf 'Vgif.V-V:VgrVafg..?zg,V.aVV-fV.rVVfs:-11,2 Q, gfj Ei, L , , v-V. 'xV,,5j., 1'-,., A , '.-W .wht ' .',7.'1 N .1 If 'L'-D-,ZQKQ-2'f f'.V-U1'u'!'V ,f R' ,?.V.g'lg2'5:g1, if 'ggi , fl-Fif,3n3 I-xx: U- V' 743:f7i T K V 4 - 1 V' --A Vc V . : '.. V .VV -V - . . - fm -fV.,c4. .-:Vf.V'..xif V V-1--'sa'-f -f1gfV:V-HnVV-.-1 -9.3 .war rfb- X 1 v 5 ' w I ,V1. - g. -f-Vey V-V.xV.1- , Vt K-Vw.-.,.q -ve , 2'-,VVV:..',f,,F ,V-,3--4.-4 ,fV.VV fb..f,,11-V.gR:1.,q1,ff--1, V,.VV1,f1 uv,-.:. . . V ' ' X ' ' l gV'f , V.f .51 'f:Vy,'.iF'3? L. 1,-Zh' V. p.aV, ',-:'1'x ' 3 -C'gf2i:'gk.'1V.'V?.'in2 -g U1gy4s','JVQ'11Siifff-'.5:e51V'flf'. ,VV?Sv 'gg-i'?Tf 1 'AB K V . 'K V., A f , 1 Q ' ' ' x ' ' . -,VL -VE'-Vr . W fVf,V,..-i'VV,i-, e:.V',1v.:g'4 yu'if-Q.....,1:-fV'fTfQVfs.Uf: lla--11:.,1'. L I 'jf y SV., 'W V fc ..q :V.-.11 V Vg... ,. ,- V, .F.,gf.f',XJV'1?'..'., wx.. P11515-'f1,f-nfl V..-,xr J ' ,I'4fH.L AV vi' Q:-'2 T ' ' r W , 'E Z , X , if ' K K H , ,M , J ,.z,gy:, Vf,.Vl,j.-,,,,::VV2,+2.3V--.JLVVVTg,g,,y2z.gfg.V'1Q.?fi,-,w.'.V'Q,',k1,j43131V,:.Vf,4f.,,,.'-weighs,IaVgffig'-VV:wf:..,3.psE.,i5SiVQfwfiwf. fig 25' 1 W ' ' 5 Y A V in M H f V 1 V Y 1 S i5-2, 1 VVgQ.Z2 F,'.'2Q'f:'5Vif:i2'?'A?VV4.V9fv.V:V:'44-'HENYPVV!iVVV'Lv'V.,s.V-Er13V'ii1iKiVV1r-nL'V-K fm wifi '-l- 51.7-V? V Y W 1 V V ff V X , f'1'Vj!' ' Q 7 H f , ,N , 'V V ' H f .V V'1.-Vfiff.VVfyVsVfw,f..f15. Q y V , H+ Vg' WT .V V+ .ff V A V V A . , Vx? ,.+-:.V11V-Vx-ffVf.i,,f . f, ., , 3 . A .W 4 W ,V A, C U m. VV f . f . my.. V.:Vf1ffff,V:3V51-Vgl-:,5':5VV.,axVV,'IV?1gQf-zwVg,?..'V.'g:Q.giisfVV5'v3L,:?g'Vf.x,.fir...'512'Vg5-gm?f Y ,gg 1 Q 5 wa I V X, Q ! .I 4V 2 I 1 ', , V, f 5 W... .2 .:g.,,.5.5gVQQV-,:3g,5.. ,':iE3?iVk1V:35!i5i,e, 1? if f ygiff Lf. 5, ms. 1 S K ' X , N ' x 1 . x --ws'-Afsw 241' ,,,V-.-.emu-a,VsVL,-1.,q.-9.54 -w.:zfVgL'Fl9N'fJr ' 5 U K .H , f' , ' V f :Vw VV V . Va H V V . 1 V , V Qlf- W f 'VM ni Q ' K f 1 w A V f . f, . Q V x .1 ,H . ' M '.'.3jfV.-V-.-:- -1.Vw-gr'VJSVV-g'f,.f,sq,,1L,-q ' ., . J, 12' 7 J if 'if . M V' ,V 1 ' V f V1 V , V+ V' V VV V V 'WTM 'ifgwf' 5 H V1 VV Vw. 2- n 4 a . r 1 V , .. r f V 9 , Vy.,.f'i'..,Vf,'.5-5gV,V:-V.V-w.4-:.V.:2 ' VV... . . , .3 by . 1 1 V Q 5 V 1 1 V f 5 H x A g . v V 1 1 .1 Q., 1 JJ mgqgz-.Vgw--V, :f'y'1fVi1VV'aV ,f . ,,-. J? p 1 15 13 , , f .3 ,. Y Mf, V, V 1 Q , f V1 1 A ' 'V 'VH ,X V591 HQ .',.' M ,Y fy f, ,,-V-jy9.j'Vk L.VZE,V,,Vf:wK--V.fQy.,gV, -ffm 'V 1: Wf,f,.554Qn ,gk 1,5 ', 4 f f . V 1 V . 4 s f, iv 1 W QVVVVV. ... My, raw.. , . , VA, 1 45 V VW ,LW M' 5,5 '15 1 J H P P3 'V J Q '41 in ,V D Q ,S W ' 51,3 1 1 1 51 X, ft, n vw, ,, my -Via,-4. V.WVV-V-V.V...',t-Viiymg Z., 11.6 V X 'Q ,V HL. V V V. V 1 V . , f V 1.1 R 1 V.s-wzwifiin.:4af.:,'L'WgVi: A U 2 V VV 5 1 e f M11 1 tu. 'is .L ', V X Ii ' A L' 'lx f NH W 1 sf' A Sep, 5 5 ,iw If M W 'Wff-:QVi.'55Ci2iV:',A?5,if,. VXyVV..5jmgVg,? if vyyx S Q' ' ni F4 avg-sf I K 2 Vw. L an-fG'VVfV?- -21-.IV.f1 .'-:Q-V14 fl ,, K 4 g -1 4. 1 wus 'K 1 Qs ',leLX li gnu' , X G X f up .1 S r .3160 ' A 1 Y 1- V,?f'-5,535-gin?.:7w.??,,5LVQg54i'.jgi L 1 YJ I ggi M ight' 4 L. ' f S Q ' f' 141 r. , 1 .ffl ' , ' .l's,'w 1,1 fqyiz' lf flfafwff .55 J . :V .70 I Q w K .4 V , 5 N LR? Q iq . tes jr s 'fig K. Q 1,11 QI ,, 4 K , . Nl K f, .A If . ,M P, 1 5 M il it r-7-V V. JgJ.V.3n1:: N7 if r ,M -45 i 4 , ,,,, ,V .v-.1 ,gp 55' M' U, r -1 V ...fa 'VNV ,g H- f . V14 -9 1' 2' 'wg . , gf, ,, V. 1. , V 1 I .- Vs, V, K 4 .V,, , .fwtfc YYY .V V .1 iff V 'fx f' 'I 1-5 -K dl ' 'K 'Uri if U' fi' fig' V. fig? 51 '5 Vj-'W f fq 'F fm? sf' Q 4 3 fuva PEA.-X,.f ff V,,V,xr45 , HV I ff f nf HV.. .., .Wu efVfHiQ :gwf,gfVV 'Tvfy 93 K -Sf fy, Q' :il xi fijg- Q 'A in Yfywd, I ' 1. 5-Kg' 11,3 HN! 1 fatjl? mt gf' VHQJY X'x3Xzi21 ,Hx Vg Qi,5w,,R ,rsh ff: A5lV',,g,.fbjf,.,e, 1 ig V'!7 2t.,f5?S.a ,Jin 1 .,gq 4 V :,1U-.4 v -,. 2 ,v ,J J ,av 1:41 14, x,1v..1 w -'-V uf. lq, 1.4 4. 2 Y 55 f- fx 1' w .1 . V , Rv 59,4 ..r4H5J,.+-rf 3 I J -,Va jg 54 M ,f5,,X V 4. . 1 11 ,.X r . 3, ,Q ,,.S wg .AW , 5 , 019, N, 1 ,yfxq 2 M, M V 1 A V S H . 1,1 Lg if my ,Y Qs, ,2.,V.,.,,w,, I1 fwn .Vg is li Vw V1 .fn ,',, s .M ,iff ' , ry., V VX V ,,VV 5 f X. 'pf max td X! ,V5fai',g1 f .Ln M Hf 4.251 F Uvjm ' J at? 'K ,gig ,A ' Y' , Vs ' K 21,4 gfh ' V, Q, 3. 1' HQ, Jfiw 1, f'4.35-gf' w..,fY,Mr' fffrifg- f A.: f X nv gfr ,fax , 1 4 'VR 1 ,V Y' 'LK V -IQ -.', 715 1.: , ,., ity funlgqiiff M X Jvzgggigl, R- 4 VVxV .si 5 f 330 ,V 'Q-1 , f'?1a,Lu',q V, fg--V 'Hy 'CEA . ,APL N ,xx Av x'3'f'352F5'ffJi'H? :S YZge'w .',f 4-4,,g9,1 4 'W pf' 5- 1. ...uw v. 'Vw , .M .g,Vm 7,4 VV .qfwww AV...VV..:g..4' V., 453' . nv' 4,v .1jw,.v p,.,1 f H421 V.,s BIIJ., -5 .Age . .MQW o ,R 2 fha .?,3,.5.., Qiuf, Vligitfi my 7 . V Q 1 , fV 4 11 'A , ' .Vf fu if VfV.V.2.:Vf Vw. Q. NV. fi V .V V :Vf VV. . VVfV-Vw V V5 .VH ..VV..V.V.Vw'V? ,QV VV V :Q V , VV VV fAg,.,,eyX .www f. Lf1'Y'2 wwf, mf., g.fwVw.-.,V,..f Vu L ,MJ 1,9 ' ,Q .. ' A vxvkgre ,ff ru X gy 11 sv . xygc MJ y 1 . gc. Ay 1 L . A , g V 14. -1 ...V u, . 5 2 V . ...A , , ' 'Vx aff VVWV Vf mi PMN? 2 52525 V if 'YXQV-VVVfiQfw,c-f ff HVVVW ...QV V V. . . . . . V V. V .x .. 4. . 4 ig? Z ,xv P, 4, 'bg if Q., 'Xa I7 1 yf i 5' A Fw ff .T 'wr xl jfsrfu 12 ffl! in Fm Q. d,kVVxg2,1 Y. kai if- ,egglw HQ 1 4 s 1 vs V V H X . f Q 'H H f 5 ' 1 '3 V ' 1 x . wx m7Slx., , .. .V R1,yxI ., r,x? xx :bln It ,ti jrwfx J L- ,VVS-3?.ggN.ffV-Yi 3'f7,. igfg4Y V A 35? vw3afIafi'fT?H2?X5i 'E M f, ' V , V MV N ! VV f w?+VF'fV V M Q 'Egg' ,l ik dlggffku 58 I ' ' V ,V W . K ,I . -..., v.,, V, W VA 55 Xfnfg 51 gf v 91vii5g,1 ,,g, . , . 3,3 1 .K L' .. . , - f , ,'R'LV,r . W65'Sf'FZW'?S'f'.-'t'V'..M , is--vw-f-5' V, -J V.V V.. 4r4v.T.w'V'. :p-iw. .1 .J ,' :Q VV 1. V. D VJiV'Q y.Ef 1 V W3 'WV M HVILW A , V V .V -VM Qi...Q5.?i3.Q2:?f,fV, 5.iy 131 1fQgsi5'gz F525 55.44 Q - j x . 1 3 'Rf,mhi-.VQV-V--mV L zswixf u 'V V - V. 1 1.. Va -V ' A '- V ff . . Vw V 1 ,V muzsigfffflw-f',VlV,1.' U.VQf1,l143,V U., 1,3,,.f.M,123.-.55 V35,QV..-.,V-W5-v,:x.-,..0.39.15 ,Ly-,V.1z.V s 7Vy.,g.g1.5g.,, VV, 1' :,..w,J.3 V- .5-'L .151-Z:V5.w HgVifff.j !s5V,E,.5.1-jf. .L .v5,5g,lwr.L.a,YgiL:f55,.r.g 1... fy 3.5, 1 'V . H . .f . V -., ,Diff EV7ei14a:V.?1sifff-13?-2112QifmifHim?': L.Y.:5H?5fSEfi?' ii'f-V1f2'xf.1iF?21vJikVzVVwwf'fezfiifsexwwgffiiwgf-WVif:2V2Lf'SV A:.s..Pg5.24s.g,2k325-f-env..ibm-?zVi?aIaV:ff.-fv'15P'lff,1.f V2if1'.f1if2fVf::fSWVim. VV?Q f5'M'3254w-f.3VLw!f-gf.V6.5 We ,-rf V 9 ,, 5 eg ' ,Q S - ngsf.1Vf:aQ.f11,:yfVx::a5 rf.zsmigVVf+4f'f,-2-Lkzigwgii,'ggs'Vf6.,.V4,5f.:gf.-5111-SwfjwspffgpVwff...V-3:-M5521Sgqw- v155g'Kx4-N,wa:4yg5i.N:Vgf2q1fe34VJae .i,'!'w+.'V2-.V,,V .54 -? izfvfiii-rfL1zfVhfV1:4fW:?2zkr.ffv2iVmi.'2+aVVV11,.Vr53.-Vadimfm-VV.1g'.:fVfi.VffV-nw,f,:H.'W'V.,.wgfzwf ',-VVVV'VV1VV'fsfV2Vr-s.:f.5':VHZf3VfV-:VV:V:.VVmHrL V ff' 'M ags 5, LV Qi' Vx . 4fH:i' Vqqgf. V.-um may 441 'ZS'f-Q37fq'!gf's-151149,-:W:VIiJ7k xVU, 3'RiV'ikyrfUa'vA: 1rQ-D'1.'V'--1'Cb,YV- wif .his--fJ1V,, 4VV-r,e1-'21-1 Mfhbf-1-.V-,l'.i,VrV..f29V1V-55 :..Vf,w' VP ,.p.argg5rfV4b1.fg741fVV .Vfvb-.JVM-,V:,v,f.'.'.2',VV'-'ug 4. .uhf Unk, ish- 1.,V..,,r,,V , .g f 4' .V F ., my 155 4. gf, . . Q . V vi'ff.,mwmf-VVRfiuwggf-:5VVV.ViQ.f bXW X YfFvS'95?55V':fIf.,'Q5MI-HU'WW?W?fxA'Wi?'.3 1J'71G1!?f-'li-'?v?051-F3911wx. .lVV55Vf7'5Q76'R!Q5'x?AM WCS-.U555f.?f.,4?'Q5f3fP'1A2ff', 17-'kfnfqfVvffTf'ef5'Q'GlK'5f,f'l4'9Ri'fKff-53 'w'35F e iff . wg,31.,. 'gy Vg A Vw . mf. ,132 s?,g'Vs'1 Vwrigfw V,w h,r,w3V.fw w.,,. S9 WGf'j1,5f5M':ifiqAviv-:,Yr'4 'g1f'wY?:Y'i!5QTw?QQT5V1 feW1VSVVV-ffaWVV'sVVf'L' nrff.vVVQ:V1:wfVwve-'6VVVxV1f-QVWVVV'w1VVVzf..VvV1'-.-.VeV.Vu.s'1,Vv.JVH.VyxV..Vf.wV?S.w:V:v.12-V: wifmfs Vwfwm-VVif:VzV-. V . VM, , in A li' wN.fVsnfdMV mv vw. .fV . uv' .AV .. . .AV 1 V-Q-v.V'iWv:: VV.gqV-...V-,rf.VVPVV1V1.V Vg.VVf,Vff?Q.,rV,.V,f.4,.VVV-ff.VfwaV VV -,Vgl,fvV.,.VV,VV.,,,f..,,.fmfx-MV.,M..j9Vga.f-fn.,.f??M,-2.5.5.Gwugw -LB . VV '-,,,.i'lN, ,4f..-kgr'V.Vef'V Q - 2231, QV mg- .Vw Vw :ey . .V . mn Wim?WVfr?V.u4':VweVwVwuzixVSV,Ilm3'.:g?Vf?9:VVf .Vi-'fVf.:VV.-2.3..VVw,VVm..Vr9,,.V..mVVmfV..:,-Vw2f,?V1VV...a.VVf1VV+.r...JVfmVHg1ggV.gVsq..-.,pV- -.-5.mfQqgg, p5.m,.:m..gVg:V.m,.5..q.yV.VVQ,V1,r.-,V.g1Vmw.,..-,gV.,QVh1,V,Mw,,,Qfggfiguy.yVWV , 3.,.V5ff, yvV,,q- , , V fr ,V 'V , fm- ug., Vw-VfWV.w5wife3fwVMVrmgiv-V.V'VfVVmVV..VfVfVmVVwV'ffVV,+:V'x2:V1:AsV'MwV.V-gi W...cvV-Vw:1:zfvyVw-QV1agffzswq-Q14-V:wiV.amV'1r--.U,sVws'VV.f-13 VVi'f-1.Vs'Viw4 way! ww QV 1. -. V V' 9 , 1- gap-4 yff::,fa::'3-.,,..fzQ..V,.-ff.-VfwA,V:5aw'ML-n 4fg2f.1iL+Vggi +i:,J 5lV.'.u1-,:.1,fg.Vif Ve' +5.21 V.3.11-,1g4,Vge,gH-.. .f.fgV.'u,V3...5.f ,VwVf'Q,,'.,99.-,gVmi.gg:,19,Qfqg gg.:-2.J,.1.,Qf1g.,,wg.f,,w,wwg.i'f5F?,mmq9I-m'.5W'8g35.7x3Lf55vC.131.V. e,,2W1? ff, yfqfwi win w x V - . -4 www :gk V f fri?-, .VZRw.3g.f'Qu+4'j.'V,fC'2-gSi..V:--TSW.-5f3'.s'.4Lu'-54'-:j1ff21yf.?.m:'g'i,943'Sg'V2f1'vfV,wf.'VV'g-.'.f.e'w-3i-riV-g.g1.V'z'.VVV'QW?-1,'j?af'V '.3, g'f'f':'Vj.','1'.-,V'-.gjwi:':1-,V1V3.u-Vfgfi-V'V.T4g.i51ffm'r1:g-Vzfw'11.555,-:e,g4:2V'1'.51p'1,iVV1eggVV .JK 'fiibggu 4 -' 4693171-5, vgggw, ,, 'K V' ' 59 V:V+?2V1-Ve:a1f5.-'-f...- gf.,V,f',S-Vvgifrz--75V-X VV.'2xV21g4'fiIf'V22:V'g','gV1?-,Hf :qV?He?1r?g:V:V'-'My V.V',w:.zV+.e..mVi'1-f'Vkfgmiiif .Vdvsfml-uv' sf.-gs?i'.g.f45f.514Vg:,.i2:?f :V V- ,.f-ff , :WR 'f 'V V ,g....y+,fV' 4wifffvfv'z'f.AfP?f4?afVfgV..HVV.'Vw1rf1 1 fV?3r:5F.g:qVV-ggy:Viaw:.m. V'3g.Z.g3f535+i?5ifVF55Q Jir f fli ,-15. V. V asxgga F V ' if-V V?-'-mv. .FP :Vw1.34.?Hi--3iVVS1.is?f.m-5.afe,.+:'V,VV:f?.3,Vf2.iwas .sm-1 VwQ'.--1ff1':gVz.-fm-lggfli V2igP4.f'4'fVV-fsbwq i Vppmff W' .f W3 Q -1i:V1,3?3i4 38125835-Vff.fpgmw'mg's.Vd,qgp'a.V1fQf..fVhffwiV4f.5VfV1-,VVM'wf.a,gvVfV,fm4VVVwV.iVfg.'w.:'4aQ,f-V.zifgngzpvrggr Q,f2,vV.gV:J,s,:.q.z1,-V521mfVf'V.3qqg:.V,gKgV.rf1V4,....r.9,1191-155..ffeg5y,x,-,pfgV.n.Vugi:V15,g.uJZf4Z'Q,g..fg,V.Psa my-Vxgf 14. ,fg1 .y5f V 1vw.S.,3K 5-'g,g VV gf: 433516-I5i,.13j?.:1,g.w J5kS'125V'ff4f4. .1191-Viawf.. ww:w44':c,+.f1'Vff-WVs':1s-ww: ff:wiM'f 'Qf'Ms!...'VfF.wmEw.eV:.',::g.Vf,q,-:Vwmf..-V'V1w.f.Vff1 QVV:Jf:ywa.mV.VV..mV':.fmrs....VV1,.5..g-Amp, VSV-Vfuwwafifagx .?x5..wsQgk'.'m1VVf+sV5v fEf Y I .iw-r .,s, Fi? if F w qq..VVwmVg'f..:1-w- -v Miyfffw- VV-V-gtiqqzg-pV. Vi e!V.f:fifyQ3?n-Wmwzig. mfgw V.'-,-weaVeVc.wifLf'r:.fem'x2-1-,gm VV''41'w.1V..wsgI,,'ETf.V5vVtVfwVM-.VKVgw5F1VV'.,V.ff,V'.i 'MV 4-wfr:gf5,f..:W.V12 Wwgfvwr .34 V11 N5 Mfg.. Sw fgax,y,+Vrl4w1.f55h :V .VV fm 'gg' .f v.:V'f 5, W V g. '2 www' . J' V V, V,V'55-V1- rr?-' - 3L.:5h2,pgM.. 1-WV Aiywsg gi fLV'f'15-1HEf3'Je95- 'W?'fVl'5V tw-v'.mVf 41 V wwwfv+waxVfV-...V'1V'MW-'.SN:,V:,Vgg1.:f. w,JVVwV.s.gV4 ng. VmaVV-gV.Vfi,VpVV-Vwwlmhim f4x..y5,,g.gz4M A, EQQWIQCVV!S1,wx3f55w.m. .:.2ew,n5-Vms 2 V, ffm-Ci VV., 51,155 1 my iywrwfiefmvq W .iezE.M.gi1.W?.vcn Vwia-s' . , ,.. ., V, new g1WVwvV-Nf3i.1VV.:ffV.n6w4'1.w?wQZ12hs'5Qg2,VfV'Vsr1V..,.1VWV1fy.V1...Q1V,mV,VVV5xy.xx...JvV.QV'VV-V1-aww, pl - fV2i'f-,swf-wmv.-p.VrVVr'V..w...5w-M,w,..Q.,..5QV, ww myVV...-QVr.-VmVww.wfQ,:,iVwV-my ,fqgyc ,QV--.Vf.f?.1. 1. ,.,: 5..V,QV V V V .V ..V,1g'Vv 1 V--Vw .W 4'v'g'6fW'Y'Wvf'q. HMVVVV ViAQ.zVfz..:sw1kfxgV4wf5ffQ2:f.,vV,g,gVr,sw,VfJr.mgV:?,.Vff.V,3raf5V..aef3:-mfts.-5. .:4,gV2.V 1.'V:-.W:'g.zV..VVV,f'Vf4,wAgffw,..V+VwVi1.-,:.,.,qVVVq,y.Qm..wmwgwf,.:VVq,,w.V-.,.wfaqvpgiVw..,3. 1- V .'Viff?f.yg,iv. ,V, N., ,Qe9'1,'jgx:.EjY s..--. wg, .Vmf4iqJ.m:' 'SQ'nf?'elm'bvvv--V4gf.V,amszV:-.ME-1ff1M.fV:ifVWa.--V'VaLV:-WahZzmyzw-VZ'.vfV:-ms---11:54.2i.Vef?.',aCV.-arf'r.VVV a V?iefmivmvf....'a.--VQXQQQQVQ-:iV-:wiLeVV:tVV'V1'fVVs-a: fViMQ'V,:faY:fPr,k.iVv-4N ixffifff 3-af Lg. 1' 1 .' . ? . if Vw' ffVVffLV 2' ,F- f-1 ,'4ff'W-VfVE '2E,'?f- ,LAWg-'VgkfVmv'5M2R2fQ:-lfsrw'1-2.-,iv-.j5wZQ:.fVf,'1,ia,.iVV'1wfYa1v-249213 -: gVVV:'f,5a.Vi.VVs1f'f 'vjbiiwi '.2.5iwV'+'cKi'wL 1hQw,V,f'+z:Ki :.?.l'f4i34:fifsf11.:-'f'553fW1EeWf4:5Q'fvf '321 fi: 'f -ffv 1 ' V- V R ' Vg VF 1 'K -v' 2'wV- 'gfffgs wV'f1f 1if3fi' ' ' V le.. f N 4 , V- ' V U45 ..,.. -, , ,. -.-5,kV.,.,.- -V-4g.:.,z1 5 -,a',f:f,-.f.y-,fins-. ,,VVfV,A J fx :i,VV,,gj ,':giV.,,,,Vi .,,.,nj, ..gsggf1,..f7.Q,f,g,V,- V' ,1gi,,.:4w' fe-,QQ-', nh Vf,5,1,,.,,5,-fVf- g g.:w3g,, V., s,. V VV , ,, 4.3 j , , .,.., L. 15 - 551 -V V V ' ,V , 1 Z V 1 '.,,-5 vas. 'i V, V ,JZ .. .,. H.. pgmf. n,1,,i,ITTm,.. .... My ,..,V..,,f:, ,, u,,,x,-.M V., .gpg 51,,.,g,,,..L,vV,,, V ...WM V ...,.k,1,,W.xVl,. ,VV VV tVV.,.VVV1,-V4,V,, Vi: , Q-my rv.: wV'.ff'Vh1M -21 :Vg ...fm V. mm .4 V-'iff ,W V5 VM-. .V rrxmf. 11 , Vw - I RAS- i - ,4 wif fvw-51 -V fliV,AE,,.V3f2.4.g,vgj1Vwx41,-,133i,.',-V.,1.f:3V,4 y,-1:-w-k?,.:w:V.V,:V1. 1 -Vw.,-,'fjn... ff.wr,--jL'V1-',-L..V:-w.,v5V:'nf'i4gs1-'W,-',.il .,7,J'.fQ.-,r5zyV',.V5,: V VV ',qVV3,f1X'4.isyaiwiaff-1iVfVW+'ugQN .1,.fV'f-.-,Vp .ifswfmQ-V1:Q:'V-VfC 'fn22i,fz'r wxw i i ff!! 'ffd V-13 f -V V V .4 Vg. 1ggS'+ka-- 'fp ' 14? 1 -WQKS-If. '. ,V .. ,.'V.1f.- ,. 21:1 '.v.fV:sim-V wx ..f:1i?lr:'V'V :VV:' 2' -:V'Ubi-V2m2vgZVvwmfV4 f'1'F ii .-1.QV.!5VVf.mm 'Riff' ' Q Aww - : V - 345. .'.f.:....V. ' I+ .' 'tiki ' 'HSL' Vw.-VVJ ?f'F5'-Fw , V , .VV H 4 . 'VV llJ'?f??V f1' -'2' Q2-V-'.515-fvw'Vwwwfiifizn. QVMQV292211.L2:ifn:v11wiWmmifi1.g.V:fYVVf:aVnV'fV'2f-aw-awwV'w,V'::Vfwa FM- '5Gw V AV - -' f ?Sl5 Mff:Vg - Vw Vffx-fxffieeeflwfm-Vwee: 1: pf .M?'Vr..V fwff. f.wA-lr'Q-.mxgffffw-L-Vea-7ff:V..vw wnwg ,.,V,,w.-may-+,..V.-. 'm.w,.f,z 1.v.VV..1..m..fn -Vv:'VVf34...M,3?1fA'..- . Wg' - , V 5 QVVAAVA, V W4-V-,an-1Vg,V V' ,. VVVV.-V VVUVV9 ...psig--g.P -V ., fV.:,.,.. .. Wu.. .. ..,V5fV.V.4 -af.-Mx' ,s4E.2f-z,m.--V'Vgf.g!- :Q-, ,V,wg,j.+1.w5.FV1k2'V.-ii wi, 5,1w4gL1+f.?.f-1'u.ViVfi.'2:-,-gwfxg .r'.Vhjgvfp.:,.Q.--fy 2.xx.qjf:1'E5.H,Q-im- fra-:51Q' ' - Q- ,Q ,gyggg-MV., ,V.gg,..VE1m-uw.:.E wJ . 'wr 3V7v1'sgLW,r-3353 ,-VV... I+ 74.1 ff-Va, -.411 EM' -:VFVV 'wgfpsz -V -,pswHgA?5?h- m 431xf'?'f'5Y4R,'1-,911.,'gy.5.Vg:.J,5v,?3QT.-.wa 1: vV1f:VV,f-.VV4 fx-.gV'w12vnVSaf14, .Q-4.-Swag!-VM-.H'fp11, ,-,.e'-iffraig,-1V w+fVG'V. My J M np, fu. ...lm-.., f..nffVVg'v5-,gg4.4.- wi' V.sm'r af?5,gsj .,-uf---.A-we. yas-Q fp .,-f atm ..V,-- Vu. .-gf mf:-r aqmqf.-V... . --f--X fs' fhffS.::-V'VQf,N1ie 4. nw-:V-vf f-ff f .h.sifVEV4L'5fff'f V 'ff-Mm.-.'5'?: Q .73-df.. f21? -4CV.x.fVzf-Rf' hSf?2i:f?J'f1-V F 'Ev-V.. ,Q- , Jw,-1-Vfeiwxgi -ww-f.wQf.,v-. -1-W: 'W' - -6V4J': s5 f4i-s,- .ww J- .':- MM- XM '-' ff. if mf- .2-wxaa-VV . fVv:+:,4-fm- ' VH. fV5fV-.-L:.iuh'f-L-fafisfzwjfg-fkg-VV-.L-:Y .,Afg,f:A-V'ss1vv ..ffm'V.nS-'fQ,f- .V.f,.':3 .ww-,--.. Mr. V .v w-Q. -kdm few.-.frf--,A 442.3 ,n m V 'wi-rx 591 X73-9 V-:wr VV: mwqgs sn-3 Vw: V-M - -.H vw na..-41-wf. 'V-.1 H?-vQ.fn:g':'i!agwyv'L.gV.9AMF-.l.?f.zf,,rV.....,-nf..m,wV.l,Vf p,V vgz,.,fJV.yffw..em.:.,,V.,.-g.,f3f?feg..,...fV ,511--f:V:w11g,s.fV vm F.-S V+- in i Sw A Q. eJfQ5 'z.g1-V3.2 L--HV. fr. aww-V-V v. 'vw :wf..'!+r?:V-,im an dgilvnm-we -V qw V EVM.-pg,,1V5 i.wJq,V,Q m,.,lyw.fV Qi,-, .4w'V. -7:,,.-2.2-.i 5, 51. :' 'Sn i2.w.4aff KSSMS- xjggl g, ' a .uw W, V4-yV,-'SV-gypz-5,-. Q3 5 . V. 3-:'.,.e?3?af.Q3q,33 5- .f .34 , n...-GQ-V .wg V ...- Vu., Pg A-,VU-f.5'P,,, ifa5Qg5ap!jj'giaGwepHf?fw' Wrs!'P Aw5VvdfWff 'yg.ae.1uifVl?E,+-fV.-w1'E..Awf5'Qf1pVQ'Smg-V d'aff'f'F-Lsp?V,x.-qwgff mf.-1. A w-.e. V,2 my ff fffffh-K1VQ's.'VsV 1-M,-.S'V V-Q?-i5VS23f,VV-f-f V , -, 5 ' ..a..-2.8 ,, 5eff:.f- ,Vw Q ,ww new ..,f+:?gm.1s-11' J - ' -V V, - 'V M V , V. V X .1 V . Vx' , -fm. .1 V .4 H V' V- v -:'ti'5f A-L .V V .-W4 ,.'-19'-QNHJA .wifibf Hg',g?WV-3V' Mr we VVw.zw.,VVw61'51..?-lV4VVw.:.-WV V ...V V.c.'.nr-'r..:Vw-lv..-II tru- www-V .2 .W drill VMQSSGV- ?'AyLV7f'Qg6 .L mf ,wi VVVJw ,..'LV!-Vfli-5s4V y,,v,-S,f51.f'f ,'Zi'?wv.,l ,,mv::.::f,!'qQRgV, Afrwjh, sz5?1wVg2.m1-5.x, V V: fi ,-. , .Q . , 59 ,, pmxw ,. Q-ya-,VK-,, Y 5, ,yuh V., ,L W W., .:,,.y--Vwgf.,LA.-hmi V..V...V..5,5V,..,fV,gQ,qV.,,,W 41 ,5g4,.,..f,.v Q V 4h.ff1x,y,V.55. ,M rg. ., AWMVV V .Hg ff... ..,VV1v!..V3M-fV4iwMV.-r.VE.VV VM.-VW W-ww V -V .e5?3Vw 'Mm-.V.AwfQQ,eyf+V4rff,75'9'qf 2 Vfgn?- nik . . Vu -' V.,5MVwVV 'SV s .fV.w.,,4 Q- -Qpwyv V. f--if in wsuV..vh'aVVVg..t'15Zww..ff1Vg.. P'-fvp' Vrp31x.VV?..n1 m'-V-fVP75'f-Elyiff 4::VV. ra MVA' aaV1V.V?if,2:'M '2.wa,a.w.,gvfgwwwffwiifgwlsiwww .3wg.VQ'5Vsw+Va,.fVaVVr.1,wS'fa25 ' ' VVVQQVQEVK-www ,,.,,gq:'g1:.Vi,, ww ,Vw V 'V f NJN'-wwf. wr f :....w,xgw?.?H'efrfV.':. 4155,wirgfws-QV3wsqvf-mVV.r1w2Q..VV sl- .., V. VV - .Q . -VvHf5'f54?e:fW'ffm-4.1-1'v2V+2V ' Qg,3?:1VV'V.a3'fg112wzx42.a:ff,?fxQ Vw .v Vwx1M:s6'ggm.Ve,gm5. M T2 F.J2'943' V- 'fi-V fwiwmfggfgbf 1 H 'afs5.5VigVg3,qgWgf5.,,f4g3g,:+q.,am322ra.5iijEW5AVa-,m:ygggQ,wffV25.2agfXp,YV.,,,,i'fwVQyg1, eff3:s..Mffz:-mfs-...ggvw,we-'2Vf,sVff:w..'1f?1.mmf-, fa V , mg Vw Va .':,:f,35-. .W-' ,V 'iw .xV.25.'w'f V6.a.eYf.Vfwase::.5gsVMffifw-as'MaliaVV mwtV'1a- -Vxae'1wwV.V.+V1V2w 'mage-C .,1.,H-.,y:af3VfQ'f'gr2VwsV5'...agVwwt V Q V M -, . . .mfr .mm V f3ifghQQ',:-q'. ?Ji:V of V-vV: -cwzfs-1531...3:v.?w.mV' f.1.V'.'s'-f.--V--,wffV.,nVM,-.-:ai-V,gV.5VV.:Vfww.:-fVMs'V-.V-1.521 1 fV.Qw-hwlmffgg--VV1fJif-!V:V,fmy Q 1223: 54:45 -.f.f'?1:V4ff-.fvggggf-V..Kamp 4 .V --43. -V Vwsw Ze! -is .-Qf,.V15g, ,Ig- sig-1.3Q'V?b,,,f' 3ix.5'V 4333! QV k5es5.fps-'fg,ff4K?f,1296.gifsljggq4-szfftgmtf1S1V.'i3JjfV:5ca.a1g54a?a2e2ex.w,:VeV:2ff-QVALFVV'.1w-Vw-.2gaViV??kMfg'5fVwZL?mx:.i2rggg:xgi,f.Qg3h,.2' . --,fffgmgi ' zwiwgxqgjgxgq . smffa-sy f21.?2i.,Ag?1:??3m.y:VX3.w .M ---f5is..1f.QwVk5-if',twt4et. .-1:42441my.2fffQffff:g.f,- w.a,V:x5'va:,2'NV2VfVm1fVVe2:2 by -.VL .gan .A V4k1v.,Sff?gwfSfvg fkwggjawcg'-.if 'V +53f?4Vm.s1v.g1g.:.wq5fVg..:y2azQ,:Gf.4ms2a4VV5v'r.,yVmw3,3.r.13HsgqrVwth--zwfziang?X'V1....s2c:V-VV.-MV' 'L Vw-r. MVVV fi, :Q wVaV4N.Af ww 432. Vw Qwrfm 0 Vff-1? ag-ma-'zgvipf -ww1.f4..hg-wmv 1VV-s2M':1'2 V, ., ... , ., ,, . V, ,, 1 . V. -ww.. -,..-,mm 14, V-..,V m.,V.,,1...,Vm,,VV...,,,w54,V .M V. AMVQ. Mg, M. .3 4 V, page ag ifgfw . -M.-4 m:QVv.V.V 1fV.fVV..:+'4:.., mwgfe-5' f.fWhjy.'7-fiV.i'i'71lf2FfgfW-vV!?z4, .yffam ' VVf3ff.5:?5F:xffV1f4a?iV42-'2w? .V.w...V.,iq.Vux,.s.fv:m .VVVh.,.- 'Vw-wwffee4.1fi-Vw? -1 . w '- 'gf -19 5' ' -VVQ43 'Vfzr Vg' 'V Y if F 1.-lf-gg3i?VVi'5m . ., .erin-w1Va'w'q:aA.'r'19'f fi-1 'fwfM155'1' VV:w-1.21-f.iw-.Vw...+A 1V325164'fr5A f,M3 yg.11-a,5.1,a3f-L --N, 1V n'.,,,V, ,,f.xK.m VfqVq,::M.+-J 5 ,L ,wgwggf 4,5:Vg-gm..g..W..vg:,g,,3gV2ny,V,f,,,,g:aVH,V,g-,AM Hwy .wg 5' .Vr , . V W. fcgrfijg 45, AV-1, .fypxmgygi .r ,f,1.A.,tggV,,95f1yLsvp,g1f,gi',:3w1Vfw,,-Wg1,-miggfsaQV-VQ,,f55gp,fg.4.14fVQlw,-, aww .. f.W'V .V 1y5zV:VE VVq.4V.y,..-.VA f VEf5GfVEf.fVVw ALM. qf4f,q.r:,q,f5f'1? gfVV VVQ?wr':'52vmwL81f:ipNvaawV+fV.EV5m'f.V1VV'qw,Qg5bV.w13,U .W ffl vff W .-Vw, 'A xftfbguk w ggg.2+e35,wV ,.my-Vmfg.-f,fs+.4sVM:VVz.W, 'ffymw -zw3...5',,,gQ.fg':..,wyug.f4.V-.fix-aw ,. wg-, 3. -QW 5 .551 a5.V5gagg1,mf,,VV.fV W . FLW ' VV 5152 -- U 2 0 - wg-,V c LV VHV V .41-gf. pi W. ...VJQQVVQQV ,'P :?gi 5Y A m., 2. Vvw,.Vf4?'.EE Ali 'f?4fi., 'ffU'E'1 Q9kAf'?.5':fv. . ,.f,.VV9Z'.,g. V y w mfv up .f fm g..V V -Vvbizyffriil' 'V iw ' 'aff-VV' HV H2?f:VV.V6f'VV?iVf-Vf.w +-- '1fV'flg1K'W! F4l -'16-'f5m'3 ..f !:-- - V -gn , . ,. ,, , , .V ,.V.,, . V, - . .ff.5,.em JL, .Mu .4 --QQ 4. 1 ., ., -..Q .,.. , . VV, . sr... . V V..V. ,, nz, ., .- V WV. 44, -...,VV4..fQ,,fgV VwfVAw..,4V1...:.e. ,M . V. V V-5-365 11 'I K1 1' V 4 V VV '1 f' I: 15536. ' V ' 'QL-: kv--' V. G . . V .V '- V 1 ' VW J -if 5 'A ' 1 1 1' H.'x?: EVf,n.if'iv'V 2.- fgfig--mm-.'fi1'-ag,:'xdf.V.V.w 'It-X v:-W f.w- In-k'f : 'L-1m5'f:V:VH'?5V'i-Nga1 Q.:-Y M. .N-4i':1r W here we are . . . another good year of our lives down the drain. what a waste. you said it, man! aw, come on now, fellas, school is a wholesome atmosphere of togetherness, helping to build decency and mold you into a useful, functioning island. what'd he say? dig that dude. boo. he's gone. ugoodyl hey, what are you doing? uh, nothing. he's reading! well, what of it . . ll x if 4? Co- orkers honor Dr. l. M. Hanks Service was the key word at the annual Public Relations Banquet held by the teachers of the Ysleta Independent School District. Dr. J.M. Hanks, super- intendent, was proudly saluted by his teachers, co-workers, and many former students for his forty years of serv- ice to the YISD. Service pins were also awarded to other members of the district showing the continuity of effort .needed to keep the Ysleta schools successful in meeting the challenges of today's education. Anticipation and excitement greeted the groundbreaking activities at EHS when work finally began on the addi- tions to the school. Bond issues were approved last year for the addition which, when finished, will mean a whole new look for Trooperland. Basketball fans especially approved the new gym that will seat more than two thousand and will host the scoreboard donated by the senior class of 1970. New classrooms, needed to accommo- date the ever-growing Eastwood student body, will change the appearance of the school when they are erected across the front of the building. And so, ten years of Trooper progress. Dr. J. M. Hanks Superintendent Dr. J. M. Hanks and his wife enjoy themselves at the Yslera Teachers Public Relations Banquet. 208 I -mf V ,,. 9 B R f'-f I 1 45, N H, ,.,. T. , l . ,ig-Q ' 45 Mr. Clyde Wafer Mr. Earl E. Best, Jr. Mr. Ross Barrett Mr. Jim Bowden Assistant Superintendent . - 5 fi- 1 K .Q W I na- Jug! - f 4 s 1. it' f :fu ei? 1 5 A 1 5- Q a it 5' 5 Mrs. Alicia Chacon Mr. E. L. Hurt Mr. J. Stoney Porcher DY- Kenneth l.. Rice -qs 5 1 ta. i, ,, vc Mr. Bob Bradley displays an address book presented to him by the student council. -as 'N-., w 7f0i Til Mr Bob Bradley principal Administrators supply gu ?,.e-S+ if gk dk x iw, . ff . V .wx -- ti!-.3 .1 x at . .gee , Q3 ,, . fa ' A 2 1'-f 55724 i Q ' , JA' 1 ...if . Mrs. Mary Dennis Mrs. Frances Dixon Mrs. Sammie Mrs. Mona Gaither Mrs. Elaine White Registrar nurse Fourmy office qssigtqi-if attendance office secretary ' it v V. 'ii' ' ,ff WI' . M 'Lu K 'D I 1 'ff 1 f ' I 1 i Mr. .lay Martin Mr. Robert Duzan Mr. John Lynch Mrs. Nancy Morris MVS. Paula Turner student activities counselor counselor counselor counselor Mr. Vic Clark Mr. Lee Dodson assistant principal assistant principal idance During the past ten years Eastwood's stu- dent population has more than doubled -and doubled the responsibilities of the administration. Leading the faculty and students, Mr. Bob Bradley has put much time, effort, and talent into guarantee- ing a superior school. Mr. Vic Clark and Mr. Lee Dodson are in charge of enforcing school regulations and policies. Mrs. Elaine White and Mrs. Mona Gaither supervise the attendance office with help from student courtesies. Mrs. Sammie Fourmy and Mrs. Mary Dennis take care of such iobs as reg- istering students and depositing money. Mrs. Frances Dixon, school nurse, spends her days at Eastwood applying her nursing skills in various ways. Mr. Robert Duzan, Mr. John Lynch, Mrs. Nancy Morris, and Mrs. Paula Turner, school counselors, guide students in the selection of school courses and aid in the selection of college campuses. ADMINISTRATION 209 Coaches join in fun of carnival MR. WILLIAM ANDERSON-BSE, MS, Alge- bra II, physics. MR. ROGERS ARNOLD- BSE, geometry, sponsor of Chess Club. MRS. LOUISE BAIRD-BS, Typing I. MR. MAURICE BARTRAM-BS, distributive edu- cation, sponsor of DECA. MRS. PEGGIE BIRKHEAD-BS, PE I, II, health, sponsor of senior class, GAA. MRS. JAN BOWEN-BS, MA, world history. COL. JOHN BRACEY-Ysleta Inspector of ROTC. MRS. JANE BRAINARD-BS, English III, sponsor of junior class, Copiae Auriae. MRS. WINIFRED BROOKS-BS, Algebra I, geometry. MRS. THELMA CANTRELL-BA, Algebra I, sponsor of freshman class. MRS. LANELL CHAMBERS-BS, homemaking. MR. SALVADOR CHAVEZ-BA, biology. MR. JOHN COLBURN-BS, English II, read- ing improvement. MRS. ELVERA COOPER- BS, library science. MRS. CHERYL COTH- ROLL-BA, Spanish I, II, sponsor of Detinu, sophomore class. Sponsoring the sponge throw at the Halloween Carnival is ELA, with Coach Todd Ware as target. 210 I ...,.. . ,, ,,,,......,.. : sw-.5-,,..s,5g F-- .. rs. . -, .ss f-fe s. E-2 . IW? y FGM. -, w:,.ey,s, , n w.. .- -- - as ff M W -. .--PM '-. . we .7 ,. -Q .. Q, .s M -s s W 'sy as -Q . sum. ti U .. Q . -, .,., M a-,. -.::,,g,,. - ., 1- gg,-gg::w.s5K1k:::,s,'.ff,,--.-95 ? I 8 I my . s 'E was -,L-ses. J ,feffszfrrsfsisfgtfiffw rf.?15P:zS?s?51 R - ..,.lQI5953i5:FI 'ES' '7fEE'1I5':: I f 5 i11,'iiEi 7 f :f :-fIQ::.I'F:.,.. frisifc.-, ' A A 'T I, ' sit -' ii' Z: . .,.., - 3 ' . ' I 5P1T151f15fs'1i - i Rst . ' . . if '? H fafs. i . ,ss .W Mrs. Julia Daseler, Mr. Vic Clark, and teacher's aide Mrs. Yvonne McCoy enioy posing as cheerleaders for o skit at the pep rally for the Burges game. ws, , I f 'W I Y kink, K T' 2 L X 1 Egg Q if.. 4 1 S S '! s if. as 1 t 'I 4 si f I mwgsggggf ' .J ,Il . it' s M4 2 at . wists 25 3535? . x af .J ',.' , 5 , -' , lf! .gn E 'ij 1 . 'few 'CE 5:1 rkw,-X i 'm' Pedagogues stage show at pep rally MRS. DELLA CROMEANS-BS, Typing I, Bookkeeping I, II. MRS. VIRGINIA CROSS -BS, Speech I-IV, English I. MRS. JULIA DASELER-BS, chemistry, sponsor of Blue Jackets. MRS. HARRIETT DORGAN-BA, ME, American history, sponsor of iunior class. MRS. ELIZABETH DOW-BA, Spanish, Latin, sponsor of Latin Club. MR. EDWARD ERICKSON-BS, general shop. MR. JOHN FARAONE-BM, band. MRS. LEE FIRTH-MA, library science, sponsor of TALA. MR. COLIN FLANNIGAN-BA, Ger- man I-IV, sponsor of Der Deutsche Verrein. MRS. BILLYE FREELAND-BS, Homemaking I, Ill, sponsor of FHA. MRS. SUSAN FUNK-BA, chemistry, ad- vanced science, sponsor of Health Careers. MR. GEORGE GARNER-BS, Related Math I, Algebra I. MR. ALDEN GEORGE, JR.- BBA, gen. bus., PE, football, baseball, spon- sor of ELA. MR. DALE GLAZE-BS, tennis, sponsor ot Racquet Club. MR. JOEL GOTCHER-BS, government, sponsor of ELA. MR. CHARLES GUTHRIE-BS, Arch. I, II, pre-engineering, gen. drafting. MISS JUANITA GUTIERREZ-BBA, Shorthand I, typing. MRS. CHERIE HANSON-BA, Drama I-Ill, sponsor of Cappa Delta, International Thespian Honor Society. MRS. CHARLOTTE HARRIS-BS, English I, ll, sponsor of iun- ior class. MRS. MARTHA HARRISON-BA, English IV, sponsor of senior class. MRS. JEAN HAWKINS-BBA, ME, VOE, clerical practice, sponsor of OEA. MRS. JANIS HOLMES-BBA, Typing I, ll, sales- manship, bus. math., sponsor of freshman cheerleaders. MR. ART HOWARD-BA, foot- ball, track, physical science, sponsor of freshman class. MRS. RITA HUGHES-BA, English I, Il, sponsor of Detinu, B-team cheerleaders. MRS. ELAINE HUPFER-BS, world geography, biology. FACULTY 211 Exes return to greet alma mater MR. MARK HUTMAN-BS, government, world history, sponsor of senior class. MRS. BRENDA JAMISON-BS, homemaking. MRS. LU ETTA JOHNSON-BA, Spanish II, III, sponsor of Copiae Auriae. MRS. HELEN JONES-BS, physical science, spon- sor of junior class. MRS. GLENDA KATT- BS, MAp Algebra I, geometry. SGT. TED KITTILSTED-ROTC I-IV, sponsor of Sponsors Corps, Drill Team. MRS. GAY KLOSSNER-BS, Algebra I, geometryp sponsor of Corinthians. MRS. KYLEEN LAMAN-BS, English ll. MR. ALBERT LANE ll-BA, crafts. MR. JOE LASALANDRA -BS, English II. MR. BOB LESLEY-BS, world history, basket- ball, golf, MRS. BONNIE LESLEY-MA, English III, creative writing, sponsor of NHS, Reveille. MISS DORIS ANN LEWIS- MA, world history. MR. DOUG LITTLEJOHN -BS, health, PE I, football, track, sponsor of ELA, freshman class. MRS. BERTHA LUERA-BS, Related Math ll, Algebra l. M i aww 9 5 K fi. af' I During the Homecoming assembly, serious faces of the Eastwood exes observe the activities while Mrs. Daisy Meacham expresses . . . 212 English IV teacher Mrs. Martha Harrison acts as head cheerleader at the pep rally preceding the Burges football game. Faculty boosts football players MRS. BETTY MCALPINE-BBA, typing. MRS. LINDA MCCARTY-BS, algebra, geometry, sponsor of freshman class, Saltatrix. MRS. CATHERINE MCGARRITY-BA, Spanish I, ll, sponsor of Sokeyatas. MRS. NELDA MCKINNEY-BA, American history, soci- ology. MRS. JO SUE MATTHEWS-BS, English I, sponsor of Doowtsae, NJHS, sophomore class. MRS. DAISY MEACHAM-BA, Journalism I, sponsor of Sabre and Salute, Quill and Scroll. MRS. DIANNE MOODY-BA, MA, English. MR. RICHARD MOORMAN-BS, MS, Related Math I. MR. MARSHALL NELSON-BSE, trigonometry, geometry, Algebra Il, aerospace. MR. ROBERTO PATINO-ROTC, sponsor of Rifle Team. MRS. JEAN PAYNE-BA, world history, government. MISS BLANCA PEREZ-BA, French I-IV, Spanish I, sponsor of French Club. MRS. DOLLY PICKEN-BS, Art I, crafts, sponsor of sophomore class. MR. JOHN PRESTWOOD-BME, music theory, choir director, sponsor of Cavaliers, Mad- rigals. MRS. BARBARA PREWITT-BA, Trooperettes, Pom Pon Girls. MRS. DIANE REED-BA, advanced math, Trigonometry, geometry, Algebra ll, spon- sor of senior class. MR. CECIL ROARK- BA, MA, world history. MR. FULTON ROBINSON-BA, biology, physiology, spon- sor of Ekappa, Rodeo Club, sophomore class. MR. RICHARD RORAGEN-BS: physical science, health. MRS. PAM PIP- PEN-BS, PE I, health, gymnastics, sponsor of Yahna Phi, Gymnastics Club. FACULTY 213 Coaches take time out for fun Coach J. C. Gotcher plays triangle football with ELA members at lunchtime. MRS. AUBREY E. SHELLEY-BS, govern- ment. MRS. RUBY JO SHERWOOD-BA, English I, sponsor of NJHS. MRS. MARILYN STEELE-BS, art, sponsor of Brush and Palette. MRS. CONNIE STEELHAMMER- BS, Homemaking I, II, sponsor of FHA. MRS. KAY STOVALL-BA. MRS. REBECCA SUAREZ-BA, Spanish. MRS. KATHERINE TEEL-BS, moclern dance, health, sponsor of Saltatrix. MRS. DIXIE TROLLINGER-BA, Algebra I, geometry. MR. JOSEPH VARRO-MA, economics, gov- ernment. MR. ERLWOOD VON CLAUSE- WITZ-BA, English IV. MR. GEORGE WAGNER-BS, biology. MR. TODD WARE-BA, PE, football, track, spon- sor of ELA. MR. THOMAS WESSON-BA, American history. MRS. CAROLYN WOLTER- STORFF-BA, English I, sponsor of freshman class. MRS. SUSAN YOUNGQUIST-BA, MA, Latin II, German I, Spanish I, sponsor of Latin Club. 2I4 X . Y, iw. QQ m .X 'L M Q 'Sr wg . .. X I Q 'WWW F 3 V3 6 gl f 3 , A K Q sk. .r , ? ii 1 ,. 5 VV . Z f A f C, K 5, Ax si QR . 43 5. ' Y-3 , sf 15 Hi ' l , M f . A N one s 'W .qi . 1 1 Q . rg 1 2 1 sgsliir .. 2 ' ,. , ' H .... tif-if ' it H 7 .K ,N ' ' - A-'W lsrle A . Cafeteria workers are: Florence Pfiester, Delia Del Hierro, lrma Tovar, Jean Willis, Clara Alvarez, Socorro Pagliaro, Betty Bower, Romelia Contreras, Mary Gonzales, Bernice Ranson, Mary Stout, and Alicia Florez. School kept in top shape y staffs Serving nutritious meals for the stu- dents and faculty and keeping the school in the best condition kept the cafeteria anal ianitorial staffs busy throughout the year. Under the direction of Mrs. Esther Wilsey, the cafeteria staff provided lunches every school day and prepared meals for other school functions. Mr. Wiley Welsh supervised the corps of ianitors in the care and main- tenance of the school. Mrs. Esther Wilsey is cafeteria director. FACULTY 215 3 i f Sponsors for the senior class are: Mr. Mark Huimon, Mrs. Peggie Birkhead, Mr. Erlwood Von Clausewitz, and Mr. John Lynch. Not shown are Mrs. Marfha Harrison and Mr. J. C. Gofcher. While in one of his less serious moods, senior Lance Murray is seen putting up a ladder. 216 Senior class officers are: John Hendley, represeniaiivep Tracy Lund, secreiaryg John Cullers, president, Trina Williams, vice presidenig Ann Savino, Ireasurer, and Bill Beard, representative. is l I l Q it Chosen as favorites for the senior class are Irene Paz and Bob Bean. Students frolic: during senior pla as the enjo last times together This year's senior class will graduate with many unforgettable memories. One of the most enjoyable proiects of the T971 graduates was the senior play. Vaude- ville was the setting for the production called Infancy. The enthusiasm was ap- parent among the cast and audience. The seniors also sponsored the spook house at the Halloween Carnival. This project was used to help raise money for the festive annual prom. Another money raising proiect for the seniors was the senior follies. Many hid- den talents were revealed at this time. Other activities carried out by the seniors were collecting for the Canned Goods Drive and sponsoring numerous dances. Favorites for this year's senior class are Irene Paz and Bob Bean. Irene Paz is a member of Yahna Phi and Doowtsae. She is also a mem- ber of ROTC Sponsors. Bob Bean is a member of the varsity football team and ELA. He is also a member of National Honor Society. Sponsors for the senior class are Mrs. Peggie Birkhead, Mrs. Martha Harrison, Mr. Mark Hutman, Mr. Erl- wood Von Clausewitz, Mr. John Lynch, and Mr. J.C. Gotcher. This class has been one of the most active classes. Through their determination and that of their spon- sors many precedents were set and many traditions begun. SENIORS 217 'l9'l WAYNE ADAMS, JEANETTE ADAUTO- OEA, LARRY ADDIS, DIANE ALDERETE- Yahna Phi, Club Council, Quill 84 Scroll, Salute staff, ROTC Sponsors, MIKE ALLEN FERNANDO ALVARADO-basketball, PE Who's Who, CARMEN ALVIDREZ-NHS, Band Sweetheart, Blue Jackets, ROTC Sponsors, BECKY ANAGNOSTOU-ROTC Sponsors, EGAA, Blue Jackets, Copiae Auriae, RANDY ANDERSON-basketball, ELA, TERESA ANDERSON-NHS, Troop- erettes, Blue Jackets TED ARGEANAS-B-team football, varsity track, varsity football, ELA, ARMANDO ARMENDARIZ-band, TOMMY ARNOLD, JOAN ASCHERL, DAVID ATKINSON-Na- tional Merit semifinalist Senior Johnny Eoff hopefully gazes from the window of the Trooper bus, thinking and wondering about the game to be played that night. 218 seniors begin final year, ' - - . v xss fisazmf-isis Lgfzfew- V . .,., , . ' 'ar-f 3 C k .,:?,,q?2Nf'LE':ll.il , , , if ,m?es14gfs2,ss,1v',Mf- nj? -,,f'E1,,:55:,,,' .,-2, E -pw ' lfaiiiisiiiiiiiffSfr' v5i,Z 5-'-.5 fH::.Z:':::- H: fb' . ' . ,hifi ,. , , . 1se':2enSf- 1-'icv i iiki If L ' :li-3 fha! - , 5?i?5?is?iS3i5iEl5 . ' - SF , - iff' 15, ,Lg - 1? .: -Q L , f r -f?s5f'f 'lg: ei' I I m-IWmmwmewswusuwnemmfsywevfmcfmsfffwmmwfwmfaememrumsmmwmf-m,mww,wum,wi v-,i- A X -- 'f-1wf-wnu -:evfwf-wwW-w-wwf' bright future attracts graduates it H51 John Wimpy, Rick Surratt, Bob Bean, Pat Henderson, J h CII a cl T Pik h irit b hold on uers, n om censowsp y ing the senior class banner during a pep rally. SHIREEN BAIRD-Pom Pon Girl, B-team cheerleader, Trooperettes, royal visitor, BOB BANNER-Cavaliers, band, Madrigalsp NORBERT BARCENA-Sabre staff, Salute staff, Reveille staff, B-team basketball, Quill 81 Scroll, MIKE BARON, LOUIS BAR- RAGAN-SNHS, THESPIANS, EFL ROBBIE BARR-Doowtsae, Brush and Palette, OEA, gymnastic team, JOEL BASS-ROTC Drill Team, DIANE BATSON, LINDA BATTLE -Quill 81 Scroll, Reveille, Sabre staff, DEBRA BEAN-Chess Club, German Club BOB BEAN-ELA, Club Council, football, Reveillep BILL BEARD-NHS, Quill 81 Scroll, Key Club, Sabre associate editor, Reveille editor, Salute staff, Student Council, FRANK BEARD-ROTC band, bancl, VOEp DAVID BERGMANNp JAMES BERGMANN-TALA ROBERT BERROTERANp GLENDA BEIN- FHA, Trooperettesp WALLACE BILLS, JESSIE BLANCAS, DIANA BLUE SENIORS 219 KEN BLUE, RAINER BOEHME, RICKY BOHLS -golf team, MARTIN BOTTJER-Cavaliers, V-, I. .X Lu , -I L1-,,-gif - , ts, NINA BOURNE -' at ff ' X ' C A h sm, I Hgfgfn F 'W'-M I ,L I f Wg: . ,QQ M f --A I x s J x I M Q lx JIM BOYLE, RONNIE BOWEN-B-team foot- ball, Cavaliers, ROGER BOWER-football, .A ,IAQ ff . basketball, KARSHA BOWERS-Reveille staff, ,II Copie Auriae, PAUL BRENT-Rifle Team, ,,,.: 'I A Chess Club I .-J ,,. ,1- I. .I:-, I Ill if ft ll in lf lit 2 l ll it. KATHY BRETON-Yahna Phi, Pom Pon Girl, military princess, iutnior class secretary, DEBBIE BRILHART, MARK BRODIE, DQRIS BROWN-Gymnastics Team, FHA, RICHARD BROWN KJ -'-.,,1 Seniors pursue new advancements TIM BROWN, BEVERLEE BRUCE-freshman, B-team, varsity cheerleader, Yahna Phi, Student Council, Salute staff, DAVID BUFF- INGTON, MARVIN BURKHOLDER-freshman, B-team football, DEBBIE BURNS-Cavaliers, Madrigals, Epsilon RICHARD BURTON-ELA, band, Key Club, varsity manager, SUSAN BUTTON-Yahna Phi, DEBBIE CAGE-SNHS, Copiae Auriae, Reveille staff, Club Council, Blue Jackets, PATTY CAHILL--FHA, GAA, Gymnastics Team, Reveille staff, DAVID CANDELARIA -Latin Club ADRIANNE CANFIELD, SANDRA CARRUTH, BUCKY CARTER-football, ELA, JUDY CARVER-Trooperettes, Doowtsae, Blue Jack- ets, RUEBEN CASAREZ-NHS, Club Council president, Reveille staff, Key Club, Racquet Club, NMSQT semi-finalist KIM CASS, STEPHEN CATALDI-cross- country track, JACKIE CHAMBERS-Brush 8. Palette, Health Careers, ROSANNE CHAPARRO-Doowtsae, Saltatrix, Copiae Auriae, MARTHA CHAVARRIA-VOE, SNHS 220 Troopers keep high expectations 'M '17,- Q ,.,.-,1:, ,f1,,,,1 - I ,::.E, I ..-:-,,.,,, - ' W ' 'Q .Puff sf . -fn' . v 'EER iff' 1 ' -:, ' '. 'EEZ L:fz5:I..i:',.: 3352 ff ., f lr: -1. . ' ' E i5i1.xii:aaEl:3-' ' 2, in ' , -' sp ..'- is-1 I v - v,...e Q , :gs -- 1 ss , is Y' f ' Y ' sis , It A s I L CHARMAINE CHAVEZ-Salute staff, Sabre staff, Trooperettes, FHA, Quill 81 Scroll, PEGGY CHAVEZ-VOE, OEA, Epsilon, Copiae Auriae, NICK CHRISTENSEN, ANN CLARK-Cavaliers, Copiae Auriae, FHA, GAA, JEANNIE CLEMENT-FHA, Cadets, Cavaliers TERRY CLEMENTS, STEVE COCHRAN- DECA, JERRY COLE-Republican Club, TERRY COLE-Reveille staff, EFL, Republican Club: PAT COLLARD-ROTC, band JACKIE COLLETT-Pom Pon Girl, Club Council, YVETTE COLLINS-Trooperettes, Gymnastics Team, ELLEN CONROY-FHA, Copiae Auriae, NEAL CRAVEYp MARK CROCKER-Latin Club, Cavaliers, Madrigals, band WILLIAM CROUCHQ SHERON CROWLEY- Cappa Delta, Student Council, Student- Faculty Coordinating Committee, band, JUDY CRUCE-FTA, FHA, Cavaliers, all-city choir, JOHN CULLERS-varsity, B-team foot- ball, ELA, freshman class president, senior class president, freshman favorite, DEDEE CURRY Senior Debby Yarborough points an accusing finger at herself when questioned about an answer. SEN IORS 221 JULIE DANIEL-Trooperettes, Cappa Delta, JAY DAVIS-French club, Reveille staff, CARLA DAVIS, TERRY DAVISSON, JOHN DAWS-ROTC Drill Team commander, B- team Rifle Team DELINDA DENT-Copiae Auriae, Rodeo Club, BOBBY DILLDINE, CATHY DONOVAN -varsity band, Latin Club, DEBBIE DORRIS -Melodettes, FTA, Sigma Chi, VOE, NANCY DRAPER SHARON DUDLEY-Sigma Chi, FHA, SHER- RI DYKES-Doowtsae, VOE, SUSAN EASON -Reveille art editor, band, Club Council, Brush and Palette, PHIL EDGAR-B-team football, JOHN EDMONSON-Student Coun- cil president, Cavaliers, NHS, Key Club, Youth Appreciation winner ROBERT EGGEMEYER-NHS, ELA, varsity football, varsity baseball, WENDY EHRLICH -basketball sweetheart, KIRBY ELLIOT-Jun- ior Achievement, KLAUS ENGELHARDT- NHS, varsity band, French Club, Reveille staff, science contest winner, JANE ENGLER -varsity band, Latin Club JOHNNY EOFF-varsity football, varsity track, all-district track, JACK EVANS, LAURA FAIRBANKS-Salute staff, E-in-E duch- ess, Doowtsae, ROBBIE FARLEY-NHS, Troop- erettes, Blue Jackets, Cavaliers, International Thespian Society, Der Deutsche Verrein, GEORGIE FERGUSON-varsity cheerleader, ROTC Sponsors, Doowtsae, maiorette JIM FERGUSON-ELA, varsity track, Key Club, cross-country track, Racquet Club, tennis, FRANCIE FITZGERALD, ROY FOLTZ- freshman football, B-team football, Student- Faculty Coordinating Committee, CHARLES FORBES, STELLA FOURNIER-Doowtsae, Copiae Auriae CHARLES FRAGA-Cappa Delta, JULIE FRANCIS-NHS, Sabre co-editor, Blue Jackets, ROTC Sponsors, varsity tennis, SNHS, ROBERT FRANCO-ROTC, JOYCELYN FURTNEY, BELINDA GAFFORD-royal visitor, Doowtsae 222 Spirit seen in seniors, ., sp, 3 Fc Q d 3 Qesismslsii s est Q G, it wwe N, Q-S, gsm, st tm Q Q2 H 'wggggg X is 5, M it S M A 1 S ig,--sis. S K I ' 1 ' ' 5:ar?fi2-li1ifffi5'- f- -ssifv ff Q, L K zisiiwzisv 1 ?k'.fs:.-Iif.551-L:liiisLQsig1e1:..i.::ff,--:Q-if 1- M as V sc, gn ,3,,,,.t.,,.s -. . we 1 f A ' B 5 1 ,-',::,-A-.-,,',.,,,- -, ns. . . :Usa .t:,:5jg,,V::-:.-E:1-- - . V 3.5 11 -, f 1 ,. sg:s,1:g,:.2'-frt vrfi g , fffiiiiif iffiff -if , J ww fxitifi. 5211 3Ysaf'f?.ff5,?SfILf1lE?l3:7k7sEN3, 55355157i97z?is:'s1i5bs,, :. YV,..-0555 students enjo pep rallys 5 A . ,A,,. -, pl psy, t ,Y Ni, me -, e f .... .. S 4,11 az.-1,:2i,?f::5.j:.-jim' wir wif 12? -A ,sw-, :q..,w,:,.f. Y- , Aff f- , if ge K .fi x was K A 1, X ized' X2 me 4 in 2 ' if S ia, ix, viii iiii it if ' - ' ,V 1 ' 1, - . f - - f, . f f f ..:. ,, ,f ' ' L-, GY, 'K 'f Q 1' ' . f ' fe f ,-K, ' .12,.::f5,f?s 'H,m1S1f1 'qyfiQ'a5 f' 4- Qg ' 'i?i5QZ:,2,if,gf1 , , ' a, f:g,q,s,,g,, wgssiji ifs,, ' ' :,,,-UML l',,2sQ2,?f,i5i U .- 'liggingffzgfigz , ' f ffm. '2Si,5Z,fi,1', fem, sez, fs',r: vazw- 555331 . . ,,,. 'gmfff muff M WNW , 1 W I, , mggqai ., if pbbpvf ,fwfw ,wfiew -1 ff .M--E 1 ,www mmf!! ,aw rv- View?-2 s,,,4w, .. ,WW .L-,,,, , w ig-M ,Wm ' ww . Y 1' , f',,,H ,- -1 S' W so 1, 'r,g:w,,i, . w ' .:-r.:,,,::,v, M: .: -. Y ggiirigg . . if . , il , M Q? , f ' s z .. C ' A f i' sf'-T1 ,virref ' ii f' - if ' s K - , F ,Sim i ,V me R , I Z 4 T- ' 7 if 1, 12ffQii w - W. L X f. iff ails, ilu.--. ' .W , Y .i ,?,s.fsJu' -u efijigfli is i f A ,- gy Showing her enthusiastic spirit, head varsity cheer- leader Davette Juen leads the seniors in a cheer. PAM GAGNON-Pom Pon Girl, Doowtsae, ALLAN GAMBLE-Der Deutsche Verrein, track, JOHNNY GARCIA-freshman, B-team football, CARLOS GARDEA, DONNIE GARDNER-B-team football, baseball MARY GARZA-Trooperettes, French Club, Copiae Auriae, MARALEE GELDERLOOS- Reveille staff, TONY GLARDON-B-team, varsity cheerleader, Yahna Phi, Student Council, ROTC Sponsors, iunior class officer, ELBA GONZALEZ-GAA, Gymnastics Team, VIOLET GANZALEZ-Copiae Auriae KRISTI GOTCHER-Yahna Phi, Doowtsae, E-in-E duchess, LINDA GREASER, PAM GREASER, EYDIE GRISWOLD-Yahna Phi, Reveille staff, Trooperettes, ROTC Sponsors, beauty contest, military princess, CAROL GRUBER-German club, TALA, Brush and Palette ANDY GUERRA-SNHS, Club Council, GLENN GUY-ELA, Doowtsae beau, varsity football, TOM HALLECK-Latin Club, Rifle Team, ROTC staff, JOHN HAMILTON-var- sity football, ELA, B-team baseball, TERRY HANDEY SENIORS 223 Troopers continue to prosper RUTH HANNA, ANN HANNEKE-Brush and Palette, Popular High Fashion Board, DECA, CYNTHIA HANSEN, STEPHANIE HARMAN, GAIL HARRIS-Salute staff, Trooperettes, beauty representative, royal visitor NANCY HATCH-Salute staff, Quill 8s Scroll, VOE, CRAIG HAYS-ROTC, Rifle Team, Color Guard, DECA, Rodeo Club, JERRY HELTON, PAT HENDERSON-most popular, most handsome, varsity football, iunior class president, varsity baseball, Salute staff, JOHN HENDLEY-Student Council, Key Club, golf team, Reveille staff, Club Council JOEL HENDRYX-Student Council, Salute staff, Club Council, Sabre staff, Key Club, Cavaliers, ANGIE HICKS, LARRY HICKS- sophomore class president, ELA, Quill 81 Scroll, varsity tennis, Reveille staff, Sabre staff, JANET HIGDON, ALFRED HIZAR BENDY HO, MARY HOLLEBEKE-Trooper- ettes, ROTC Sponsors, Doowtsae president, E-in-E duchess, Blue Jackets, Brush and Palette, JENNYE HONEA-E-in-E princess, Yahna Phi, YVETTE HOOVER, PETE HOSEY -German Club, Drill Team, Cappa Delta CYNDI HUDGINS-Junior Achievement, KATHY HUGHES-Trooperettes, Cavaliers, beauty contest finalist, Copiae Auriae, Ger- man Club, HOPE HUIZAR-Sigma Chi, band, DEBBIE HURD-NHS, Latin Club, Reveille, band, Blue Jackets, RICK JAGE-Cavaliers, freshman basketball, Cavaliers, Madrigals DONNA JARVIS, SHERMAN JEFFERSON, DAVID JOHNSON-Cappa Delta, ROTC band, MIKE JONES-Latin Club, ROTC battalion commander, DAVETTE JUEN- Homecoming queen, most beautiful, varsity cheerleader, sophomore favorite, iunior princess, baseball sweetheart VALERIE KAAKE-Copiae Auriae, E-in-E duchess, MIKE KENNEDY-German Club, MARTHA KING-Rodeo Club, RALPH KING -Key Club, Sabre staff, Reveille staff, Club Council, Quill 81 Scroll, debate, DENNECE KNIGHT-Sabre staff, Reveille editorial as- sistant, EFL, Doowtsae 224 Seniors relax during last 'f , rirrifrthei 'F 'W ,gh , - 3' 4 ,gf ' B14 U s Ni ML, M-M,,,.....of NICK KNOPPERS-varsity band, KRISTA KNUDSEN-Saltatrix, Cavaliers, Rodeo Club, FHA, FRANCINE KOLSTER-Blue Jack- ets, Doowtsae, Club Council, GLENN KUHN, ANITA KUSHEN-Trooperettes, ROTC Spon- sors, Doowtsae, Brush and Palette, German Club, beauty representative CLARK LARSON--freshman football, B-team manager, EDWIN LARSON-ROTC, Drill Team, PHYLLIS LEE, JOHN LEFTAULT- ROTC, Officers Club, Rifle Team, Drill Team, German Club, TALA, PAM LEHMAN- Trooperettes, freshman cheerleader, FHA LOUISE LOISELLE-Salute staff, Quill 84 Scroll, Epsilon, Sponsors, Blue Jackets, royal visitor, SYLVIA LOPEZ-royal visitor, ROTC Sponsors, Quill and Scroll, Salute staff, Sabre staff, Blue Jackets, JOHN LOWE-German Club, SUZETTE LOWTHER -Copiae Auriae, CYNTHIA LOYA-FHA, Copiae Auriae, FTA year MARTHA LOYA-Copiae Auriae, SNHS, DAVID LUCKY-freshman basketball, B- team basketball, varsity basketball, ELA, Rodeo Club, LUCY LUNA-band, Blue Jack- ets, FTA, German Club, beauty representa- tive, TRACY LUND-class officer, Yahna Phi, Pom Pon Girl, TOM LYONS-NHS, band, Key Club, Latin Club, varsity base- ball PAM MCANINCH-Blue Jackets, ROTC Sponsors, French Club, Reveille staff, NANCY McCARTHY-Doowtsae, E-in-E duchess, Gymnastic Club, OLON McCLEN- DON-varsity football, ELA, Reveille staff, CATHIE McCRAY-Doowtsae, Rodeo Club, MARCIA MCDONALD Student Council president John Edmonson seems to enioy his ride to a Trooper football game. SENIORS 225 'I970-7'I seniors meet one more time before graduation for their annual senior picture Seniors prepare for graduation DENNIS MCELVEEN-ELA, varsity cross country, varsity track, all-district cross country, JIM MCGILLIVRAY-Latin Club, TALA, varsity band, ROTC band, KAREN MCGINNIS-Reveille staff, LLOYD MABREY- DECA, PAT MacDONALD-Der Deutsche Verrein JACKI MAGNESS--ROTC Sponsors, royal visitor, Yahna Phi, Salute staff, Club Coun- cil, Brush and Palette, JILL MALOUF-FTA, Brush and Palette, ANNE MARKESON- Salute editor, Homecoming princess, tennis sweetheart, NHS, ROTC Sponsors, Student Council, royal visitor, BECKY MARTIN, OSCAR MARTINEZ-Key club, varsity cross country, varsity track team, ROTC Drill Team PAM MARTINEZ--Trooperettes, MICHELE MASON-Trooperettes, Doowtsae, Blue Jackets, Gymnastics Club, SNHS, E-in-E duchess, KATHY MASTERS-Salute staff, GAA, Sabre staff, Quill 81 Scroll, Reveille staff, JOHN MATTHEWS-varsity football, JOHN MAYTON-freshman football, Key Club BURNEY MEEK-freshman football, B-team football, SANDRA MEINKE-Blue Jackets, Der Deutsch Verrein, Health Careers, Reveille staff, Who's Who, DEBBIE MER- RIHEW-Copiae Auriae, BRUCE MEYERSON, DEBBIE MILLER-Yahna Phi, E-in-E lady-in- waiting, Trooperettes, Epsilon, Doowtsae, beauty contestant 226 I as they welcome future plans -mf' M, 'Q' 3 ' N 'x 'fi' V7., ' 6 it 'ffl ' awe 'ill I A I-3215, ? I it I Y DIANA MILLER, GARY MILLER-Chess Club, PEGGY MILLER, EDDIE MIRELES-freshman, B-team football, SHERRY MITCHELL DEBBIE MIZER, CAROLYN MOODY-fresh- man cheerleader, Trooperettes, Doowtsae, sophomore class treasurer, Cavaliers, LYNN MORAN-Yahna Phi, maiorette, Gymnastics Club, Rodeo Club, DAWANA MORDECAI -NJHS, SYLVIA MORENO SUZI MOREY-Trooperettes, Yahna Phi, Doowtsae, FHA, Brush and Palette, SHARLA MORGAN, TOMMY MORGAN, KEITH MOSER-B-team football, Thespians, varsity track, KATHLEEN MOSHER-varsity band, Latin Club, FHA ROSE MUELLER-Yclhncl Phi, OEA, GEORGE MUNOZ, LANCE MURRAY-Sabre co-editor, Salute staff, Reveille staff, Key club, Quill 81 Scroll, Student Council, GARY NAKOVIC -track team, cross country team, RICHARD NARRO SENIORS 227 DEBBIE NELSON, BERTHA NEVAREZ, JOHN NEVAREZ-Key Club, Drill Team, JOBETH NICHOLS-Yahna Phi, Doowtsae, EMELIO NIGLIO-Key Club, Brush and Palette, Cavaliers LEONARD NORDELL-Key club, ELA, B- team, varsity football, BOBBY OLIVARES- varsity baseball, SNHS, Key Club, B-team baseball, B-team basketball, freshman foot- ball, TED OLSON-freshman football, B- team football, varsity football, ELA, DIANNE OLSON-ROTC Sponsors, royal visitor, varsity tennis, RICHARD OLSON TERRI OLSON-TALA, EDWARD ORONA, STEVE PARKER-basketball, Madrigals, RONNIE PARRISH: MARK PASCHALL- DECA, B-team football Seniors IRENE PAZ-Yahna Phi, Doowtsae, senior favorite, ROTC Sponsors, JOE PELLETIER, DOLORES PELLICANO-Doowtsae, Trooper- ettes, LESLIE PENLEY-Doowtsae, Salute staff, FHA, JANET PERSONS-varsity cheer- leader, royal visitor, Student Council, Epsilon, NHS, ROTC Sponsors SUE PHILLIPS-varsity cheerleader, E-in-E queen, Yahna Phi, Epsilon, ROTC Sponsors, Homecoming duchess, VALERIE PHILLIPS- Yahna Phi, varsity cheerleader, most popu- lar, NHS, Homecoming duchess, Blue Jack- ets, TOMMY PICKEN-ELA, B-team and varsity football, varsity track, HILDEN PICKERING-ROTC officer, Latin club, TOM- MY PIERCE BARBARA PIRAM-NHS, Copiae Auriae, Blue Jackets, ROTC Sponsors, Club Coun- cil, Reveille editorial assistant, ARTURO PORRAS-freshman and B-team football, B- team track, PEGGY PORTER, ROBERT PORTER, JERRY PRENTICE CHARLEY PRINE-ROTC Color Guard, Rifle Team, Officers Club, MATT PULLEN, PHILLIP QUALLS, PAUL RASMUS-band, DEBBIE REED 228 ...gi I I t I l s establish new traditions l I Excitement mounts for graduates WESTON REESE-tennis team, Key Club, ELA, CHRIS REGAN-B-team, varsity foot- ball, B-team, varsity baseball, ELA, MARTHA REINHART-FHA, football sweet- heart, Doowtsae, Epsilon, Yahna Phi, Troop- erettes, ROBIN RICH-B-team, varsity foot- ball, ANN RICHARDS CYNTHIA RICHARDS, ANDIE RICHARDSON -Pom Pon Girls, Cavaliers, Sextet, all city choir, Thespians, Sigma Chi, MARLENE RICHTER-Student Council, Blue Jackets, Salute staff, E-in-E duchess, Reveille staff, Quill 8g Scroll, GARY ROBERTSON, SHEILA ROGERS-FHA, Blue Jackets, Doowtsae, French club, Gymnastics Club, Reveille staff RICHARD ROMANO, KAREN ROSEBOR- ROUGH-Copiae Auriae, FHA, JOHN ROSPRIM-freshman, B-team basketball, football, freshman track, KEITH RUSSELL- Key Club, SNHS, JENNY RUTH-Reveille staff RANDI RUTHERFORD-ROTC Sponsors, Ep- silon, Blue Jackets, Trooperettes, Doowtsae, Brush and Palette, SUSIE SALAZAR-Copiae Auriae, French club, Club Council, FHA, MARK SALCEDO, CINDI SANETRA-Gym- nastics Club, ANN SAVINO-Yahna Phi, Salute co-assistant editor, royal visitor, Pom Pon Girls, E-in-E duchess, senior class treasurer BRENDA SAWYER-Copiae Auriae, Doowt- sae, JAYNE SCARBROUGH-Trooperettes, VOE, Doowtsae, CARMEN SCHAFER-FHA, advanced girls choir, JAY SCHEIE, DIANE SCHOLLITT LESLIE SCHURTZ-Saltatrix, BILL SEARS- Cavaliers, ROTC, Chess club, TALA, LINDA SEELMEYER-Yahna Phi, FHA, VOE, GREG SHAFFER-ELA, varsity tennis, orchestra, KIM SHAHAN-Yahna Phi, Salute staff, E-in-E duchess, royal visitor, Trooperettes, Epsilon TERRY SHAMBROOK-Cavaliers, Thespians, Blue Jackets, Doowtsae, Club Council, E-in-E duchess, CRAIG SHERLIN, DEBBIE SIKES- French Club, FHA, ERNEST SIMMONS- Rodeo Club president, MARY SKERKOWSKI -Saltatrix, French Club, SNHS, Doowtsae SENIORS 229 Senior Follies cause laughter, NANCY SLATER, ED SMELTZER-Cavaliers, PAULA SMITH-Brush and Palette, DECA, RICKY SMITH-varsity football manager, ELA, Key Club, B-team baseball, speech, SARA SMITH-Cavaliers, Reveille staff, Sex- tet, advanced girls choir SUSAN SMITH-Copiae Auriae, FHA, KERRY SNEESBY-FHA, VICKI SPECK-Cavaliers, Health Careers, BILL SPROULL-German Club, JOY STALLINGS-NHS, VOE MARY STANFIELD-Cavaliers, FHA, band, RICHARD STANFORD-ROTC Officers Club, DECA, German Club, ROTC Drill Team, LARRY STEAD-ELA, freshman, B-team, var- sity track, TWEEDY STEED-Salute co- assistant editor, Quill 81 Scroll, Trooperettes, beauty contestant, Doowtsae, FHA, MARY STEPANSKI-Brush and Palette, Copiae Auriae, TALA GARY STITES-Reveille staff, CARR STRONG -Chess Club, Trans-Pecos Science Fair, SU STUART-Yahna Phi, ROTC Sponsors, Doowtsae, Saltatrix, REDA SUTTON, RICK SURRATT-varsity football, ELA, sophomore favorite, B-team football JULIE SWAIN, ANAMAE TARWATER-FHA, NHS, SNHS, DEBBIE TAYLOR, DEBBIE TEXTOR-Doowtsae, CARLA THOMAS-Cav- aliers, ROTC Sponsors, SNHS, NHS, Blue Jackets, Sextet PATRICIA THOMAS, MARTHA THORESON -Latin Club, band, NHS, Blue Jackets, Optimist Appreciation Award, DANE TOM- LINSON, BARBARA TOWNS-SNHS, Blue Jackets, FHA, CRAIG TRIMBLE MARGO UREY-Doowtsae, SUE VANDER- ROEST-DECA, APRIL VAUGHN-Yahna Phi, varsity band, gymnastics, E-in-E duchess, ANDRES VILLODAS, LISA VINSON-Yahna Phi, band, Trooperettes 230 students exhibit hidden talents NFL BILLY WRIGHT DECA ZEMAN-ROTC, DECA JANET ZIELSDORF-GAA, MARY ZIZIK- Blue Jackets, Trooperettes, FHA, NHS, TALA, Copiae Auriae MIKE WOODS drum malor NHS EFL German Club Pres idential Classroom LYNNA WRIGHT band Sigma Chl DEBBY YARBOROUGH-Yahna Phi, Trooperettes, military queen, NHS, SNHS, RAY YOST, PHILIP LESLIE WAGNER-Saltatrix, FHA, Trooper- ettes, WARD WAITS, CINDY WALL-Copiae Auriae, FHA, Rodeo Club, MIKE WALL, DONNA WASSON-FHA VALERIE WATSON-Doowtsae, ROTC Spon- sors, IRVINA WHITE, KIM WHITNEY-Key Club, B-team basketball, B-team baseball, LORA WIDING-Doowtsae, ALICE WIGHT- Doowtsae, Yahna Phi LAURIE WILCOX-Cavaliers, Madrigals, Copiae Auriae, Reveille staff, BOBBY WIL- LEFORD-freshman basketball, varsity track, cross country track, ROY WILLIAMS, DIANE WILLIAMS-Latin Club, band, FHA, TRINA WILLIAMS-Yahna Phi, ROTC Sponsors, E-in-E princess, military princess WALTER WILLIAMS-freshman football, GINA WILLIAMSON-FHA, Doowtsae, JOHN WIMPY-B-team baseball, varsity football, DAVID WINHOLT-Key Club, ELA, freshman track, varsity track, KAY WINTERS Debby Yarborough finishes her breakfast while lead ing the Sponsors, Valerie Watson awaits orders. , -f Dwight Jefferson seems to be enioying his fav- orite pastime which is pitching pennies. 232 I . Junior class sponsors are: Mrs. Charlotte Harris, Mrs. Jane Brainard, Mr. Robert Duzan, Mrs. Har- riett Dorgan, and Mrs. Helen Jones. X 4 5 Oki 3 3 . Officers of the iunior class ure: Steve Hastings, president. BACK ROW: Cris Lester, secretcryp Patty Lane, treasurer: Jenny Picken, representativep Allan Sewell, representative. 2 gs- 'lim Junior class favorites are David Crenshaw and Jenny Picken. juniors sponsor country store sales, attain money for yearl spring prom To start the year off right, the junior class began the football season by sponsoring several victory dances. The Halloween Carnival saw a revival of tradition with the old favorite the country store. This year, as every year, the junior class is given the privilege of sponsor- ing the Junior-Senior Prom. The proceeds from the dances and the money made from booths at the carnival go toward financing this annual event. The junior class favorites this year have proved worthy of their honor. David Crenshaw and Jenny Picken have worked hard for their class projects all three years they have been at Eastwood. Jenny has been majorette as a fresh- man, sophomore, and junior. She was E-in-E princess for the sophomore class, a member of Junior National Honor so- ciety, girls choir, Cavaliers, and the gym- nastic team. Crenshaw has made his most worthwhile contributions to the school through his outstanding contribu- tions and performance on the football field. He has also played basketball and been on the track team. This is Cren- shaw's second year to be class favorite for he was chosen sophomore favorite. The junior class, all in all, enjoyed a productive year and showed great leadership ability. Their aim is to prove to be one of the best classes in Eastwood's history. JUNIORS 233 The vending machines provide a good place for iunior Cathy Gouch to take a quick snooze after working hard on Homecoming decorations. juniors spark Homecoming spirit Donna Aaker, Mike Aanonsen, Doug Achim, Dan Adams, Kelly Adams, Bob Albrecht Robert Alderete, Ron Amato, Toni Andrews, Coy Ardoin, Danny Arnold, Richard Artalejo Diane Autrey, Paula Aydelotte, Debby Baldwin, Buddy Ballard, Abbott Banuelos, Rod Barnes Mike Barnett, Jacque Bates, Debra Behrens, Bobby Belknap, James Bell, Mark Bell Jesse Behnke, Cynthia Bennett, Mary Berg- mann, Bob Black, Barbara Bleakly, Kim Blomerth 234 .- .tvs , ,. ,W . .eww T ' 4' up - ,--- ,..... . N -- : -t g erm wfszggiieiissi .-,,.g,,s- . , - - - o , h o, .Ii ,::. , - L , Q f'f':'f :. ' A 'Q is . ,. W ' Qs is E 72. . . 'ii ' ' .. fgifii-Yfii ftr ? fi if ax.sssfiif'f T-': - ,t . l i55' W ' l1, f W, ,os,ooo,,,..o,.o,r. -. oso, ,o.o U H uuklyuzblg gg in L Z I V: 5 , K1 ,,.. ,, ff' If B 1. B' --ff -ws, ,,. ,,,,:ssf - , . ..., - .... . figs? W ,m t :- t- -.4-, ..w,, rmmfw -2ft:S,-swf .,, ,tn .- . - - -- M ::-ik. - I-Tiiil 2:2365 55 5Tff5,'i' V. 155:54 iiziiibii' V . ssH5:,g - if . , Q ' ew' f V, 9 -we 2 , . 1 gfiisff' . - f 22 'M' in ' 'ri' , wwf 9, -Wy - , ' '- - ,,.. R A - , ttst .v-:: I , tz, V . ,, o,,. ,,,,. .s,, , . o. , , fl U 'iiaffiff , - ' : ' ., , ,f F f Y. xx A i 12: . gy ' A ' 'f tie W 3 it f '9W ' . W i 'Y H Activities in pire junior ego ali! -from we av V- awww Y .12 7 si-malvf' V E! sl, , .:.,,,A,, V W.. V , 45' if L fm 2 2 or ., flfe, f . . 1 'rizrsr ,rr lik i t ' Q V A A fggwzg A ef: 1' faire, ' ' ' ' 1 ik, V,,, 5,5 4 , frggxee ,Q X Q ' H, S W X M nf c 6 225 R 4 Q : E,'159 ie' 'if V 'F .W are -ff 1 Q ,S .... so 1 Q2 . sf fn.: VE 523355 ' ,. L wi ,N K ' 1 17 i ' f' - , 52113, yi ,, if 1 f ' nz 'A ' QS. 1, 71 Allis f. ,V ' in S1 t tif 2 ' . ' f f es G.. - .. 1 x Philip Boden, Andy Bohren, Thelma Bor- rego, Brenda Bolton, Susan Botts, Greg Bowers Leslie Bowers, Jamie Bowie, Rudy Bracher, Dianne Bratton, Gary Breit, Jerry Brooks Karen Brooks, Curtis Brown, Darrell Brown, Wayne Brown, David Browne, Jack Brunson Linda Buffington, Don Buie, John Cage, Mary Ann Calanche, Cindi Camacho, .Ianene Cannon Barbara Caraway, Melvyn Caraway, Paula Cardon, Mike Cardona, Richard Carothers, David Carpenter Pat Cates, Beverly Catt, Ken Chamberlin, Kim Chambers, Sharon Chambliss, Diana Chaparro Mary Chappell, David Chavez, Eddie Chavez, Rosalyn Chavez, Rita Chavez, Tony Chavez Lorrie Ciceri, Bob Clark, Debbie Clemmons, Dottie Clune, David Coast, Terry Coast Larry Comey, Colleen Comstock, Dennis Cook, Rick Coon, Philip Cordova, Mike Covey JUNIORS 235 juniors participate in ports Russell Cowart, Denise Creek, David Crenshaw, Marci Cross, Betty Crouch, Pam Crowe John Cruncleton, Denny Cunningham, Gerald Currie, Cynthia Curtis, Margaret Dahl, Jerry Daseler John Daseler, Richard Deba, DeWeerd Harrel Davis, Philip Davis, Terry Denham, David Lois Doebele, Susan Doss, Craig Dow, Ed Jim DiAngelo, Done, Donene Downs Lonnie Dresser, Laurie Dugan, Paul Duran, Karen Dyer, Shelline Earley, Patti Eason Randy Eggemeyer, Steve Elliott, Steve Evans, Kathy Fairbanks, Judi Faircloth, Paul Ferguson Junior Mike Aanonsen, manager of the varsity foot- ball team, enjoys explaining one of the techniques of football to seniors Ted Argeanas and Tom Picken. 236 s I -. - -- V - -- - 3 f V . .4,..,- H- 1133. 513 s.Ef' 7225554 .V . 'iIf5.?' .ff -- .-:W we W .t 1- ff w, is XE,-e if 521511 VX' A f:,:2 z f 7 2- v. 'V ' 'V'st:T13,.s z:: . . - .2 .J , 51 75555954 X ,. V gl , K M, A mt - ,. --ti ,A :,. P. ,,t X , -, Q . le, ,,.. . , ,. , v.,5 , Aww- .v f f-gi' 1.7, gt f ',,., W, it f , , ,kkk , s sf trz I t X W L L J 2 X X , iw it ., . -55, W e .iff-. D .. 95 2, ..j K' 19 6 of gg 2 , .- ,.m,w ,.w:1f-4 ' M - W S , J 2 wx- .. ts l. 5 wx S will S fx as S S 2 Y is an .. , sf.: .,,, . . -.3 V s in . Lsaifiglff' Y ' ':fif:fl'.l L S 2 , F 33 nf M 7 ' Y ' WV U3 YQEM' ,... . H---M .. YEL: mam. L' 5551-i x.:.'::..:' if fgJ2E5?s75ii3iiig' :'::'1i- - ' iiiiiifi:-ifisiif 2 x sviil-J SE, 315 5 5 mg K v gel ' t - V 'V rf T - mu I I . ..-1 L Q 'X .ff w L2 .. 1ifF'x.fQ,,.,- is - 2. 51 ., V.t, ,. 15' jg' ' I -s '1 5 .. r fag- -Q - ,Q ' ' . t if 5? ' -- L ,. ,H-is 2 'sQ1sw.s,i,zL, .i,w JW' . fs -- L. ,. , -- v.: Nu I gisgiiinf 1 ' :fi1gg:f53gjg5fi1 .- Ekiiigiffi-':'f .W -. .. 1 M.. - 'J . - ' i f i f jg y 1' ' D , . . ,.,m. -fs if is is R fr- M gi , is. - ' i 'if' - ' ' L ', . s J: 'W'-' s-If V ' . K weygfffli .V .fs K .Q ' , .11-.. ' . Q- , -war , f' , a. st Y' at gg gg j -' ' ff' ,.., - ,Rum 'fiiwha -, ,M X g V um: :E .A We L f --f- K.: K - I ' Q'-N ' i K TH V' iii fiffif' ' .. ' 52.575 . . 3 139- ' .. - - lf NE' i ' 23.5. ' ' 'ff' 7' . W .Qi . , . ., .,,, .,..,, . . , .,. , , K-xg i X 1, 9 R S f. Y - ,f:1r1'1,,..tW1, emm wmwt,-7-ss W Y r rs f Nr f if :L Z 3-Q .3 K u A A I l el Q lf' f M f,,,,e-w mN E' s V www W' s Y 5 3 L Q P le fi T: fix Anxiously anticipating a Trooper iouchdown luniors Richard Artalelo Felix Loya Gary Hendrick and Steve Hastings boost spirii on the sidelines. Debbie Fields, Sydney Flaming, Mark Fout, Debbie Fox, Kathy Frazier, Denise Frydendall Pam Fryman, Bea Furtney, Karen Gagli- ano, Jim Gale, Beth Gallagher, Ruben Gardea Bart Gardner, Melanie Gauthier, Joan Gehrer, Rick Gelsthorpe, Douglas Gentry, Dana Gibbs Sue Girard, Tom Glass, Donya Gonzalez, Nina Gore, Chris Gorman, Paul Gower Cathy Gouch, Ruth Gould, Mary Grafton, Mary Lee Grafton, Al Grall, Gary Greenlee .lUNlORS 237 juniors await future anxiously Jerry Griffin, Bill Griffin, Marty Grisham, George Guerra, Jim Guthrie, David Hafer Cheryl Hale, Denise Hall, Lance Hall- berg, Ivan Hamilton, Wendy Hardy, Steve Hastings Gary Hedrick, Mary Hellman, Hollis Henry, Jerry Herolcl, Trinidad Herrera, Debbie Hicks Kathy Higdon, Mike Hill, Terry Hoff, Steve Holt, Diane Hoock, Marcia Hooper Glen Hoover, Tommy Horn, Dave Houston, Belinda Hover, Bob Hudson, Alex Huizar Carol Huizar, Matilda Inman, Arthur Jack- son, Bill Jacobelli, Eddie Janousek Daryl Jarvis, Sheila Jefferson, Carol Jenness, Paul Johns, Allan Johnson, Edward Johnson Linda Johnson, Linda Johnson, Randy Johnson, Bonnie Jones, Mike Jones, Mike Jones Maralee Jordan, Roger Jordan, Jeff Kaake, Kevin Keith, Nancy Kennan, Pat Kennedy 238 - .... , mr, sis, , s 'iff fgiielf Rm R? ies, , ik si ' -- , Hs. . . . 3. fs. - uf T7 m11g5vs10P-.life as . fwsgcw- ' -. s- iffrfgx . FEE? ' - ' I - ,s,.'- ,,,. - ' ,A gzssm-s' 'Q ' fi I 2 N? - f r asf., H- :W- ref' r A .s as ' af ,Q 2 X K , X s H ,w . .. X M . ,s::,--,rw V --Qef asi, e NC if fi H N3 i f Q if ST sz Q 1, H up gr if 1 tm ., , ,,,, ...W 1 ji' ' i ,ggi ,N ---' iii : 1 ' - . Ig l J - , f V '- . rr :Zh A' K ' ' 'l l-5 5 .si J , f W . R4 ? if larsl J H 5552 fw.: F l M? -ww 'K r '- ' :gg , -1- fs, vi' m e zu, ssv--mf: if N , Q? - il' 'f r r 3 - , - ' N 2' f x . ssgssgg es: 1,2 - vu rr - if - -' - -5 , r V rw. f. fr ' , , 'fl r , i ,. ,, jr -ji A 4 ' ' . ' . , sum? A . M fig f '2is2svr:?ilziE .' ff ' ' -' J G' 1 if 1 , -- my-A f ' 5 wsf- -:M-sg f 1 4. Q, W .sf s Z f, - 1 , V . - H -, ,V s IH. I r is ks., , fr, -, as rs, ,. -. pages... 5 1- M, g,.:.,21 ,. . : , -- af girzm ss : 1 gig .. H gg V sw ., ,- V s J LE, , x v- ,. sr ---- . -,V w s, .-,E W21. e,,M,,,s,3, r R- Z We 3, -' 51- sais? m g. fe k ,, .. , , , . , . r ., 2 1 g g ' I f 2' ,ga ' I' . fi 3 fs - , - 5 , 53 , - V5 4 ,MQW . M -y ,- ,,v f:.,E,- y f f Junior Kathy Buckles hopefully gazes upon the field as she anticipates a Trooper touchdown. nthuslasm shown for Troopers Pam Kessel, Scott Key, Jeff King, Gordon Klunott, Karen Kmetzsch, Valerie Knight Dennis Koehler, Robert Kolster, Jackie Kostielney, Kevin Kuenzli, Harry Lally, Jane Laman Ken Lane, Patty Lane, Ron Langford, Barbara Lantis, Debbie Larson, Kendall Larson Jeff Lawson, Roderic Lee, Murray Letters, Robert Leftault, Barbara Leitch, Heidi Lemmon Chris Lester, Judy Lewis, Shawnette Lewis, Barry Leverett, Linda Lide, Kerri Lindley Marsha Lindsey, Valerie Loranc, Ricky Lopez, Bill Loving, Felix Loya, Ronny Lucas JUNIORS 239 Debbie 'Larson and Linda Johnson practice many long hours for the Cavaliers' Christmas concert. Tom Luebke, Janie Luian, Leanne Lund- berg, Kathie Lynch, Bruce MacDonald, Rosalie McCall Kathy McCarty, Walter McCoy, Bob Mc- Cutcheon, Michael McGinnis, Scott McGriff, Gary McLaughlin Jon McManus, Greg McNicol, Ray McNiece, George Maldonado, Francie Marsh, Alby Martin Mary Martinez, Richard Martinez, Debbie Mason, Randy Masters, Carmen Medina, Michael Merrihew Angela Michael, Wayne Miller, Mike Miller, Mary Jo Minellono, Tom Minter, Marie Mitchell 240 Students display many talents Meredith Moegling, Donna Moore, Mark Moore, Sallie Moore, Vanessa Moore, Bernie Mora Alan Morris, Mike Mosby, Melody Morton, Bobby Mullins, Lynn Mullins, Frank Muniz Coley Myers, Bernadette Nabhan, Robert Nash, Carmen Navar, Don Neavin, Cathy Nebhan David Norris, Jo Anne Novak, Kathy Novak, Grace Nunez, Elizabeth Nutter, Steve Nutter Dennis Oakley, Bob O'Beirne, Virginia O'Beirne, Ricky Olivas, Irene Orona, Don Orr Junior Debbie Behrens helps decorate cars and floats for the many contests during Homecoming. JUNIORS 241 B. J. Overton, Billy Page, Cheri Parker, Ron Parker, Janice Pavoggi, Gloria Payne 1 4.6. in x vi fx 5 4 Don Pendley, Gary Pero, Harry Peterson, i cw' Q if Pat Petrosky, Linda Pfeifle, Bob Phaup John Pierce, Marty Phillips, Jenny Picken, Kathy Pittman, Paul Polk, Rick Porter ' 'fi 5 fm Q2 -it A 'fl 2 J X., M'-' Z la' RX Q 'Z' 'P 7 'Q is Bill Possiclente, Mary Powers, Carol Price, ' Q WWNMW Susan Prine, George Putnam, Ken Ramsey K 5 ' ,, x X, i . ' 5- an-'Y Bob Rasmus, Paul Regan, Carol Ricci, Jack ..1:., ,..,,,...,, , ..., .,,, 1 1 i :'tivf:, 'fii - - .- JA .. , K, Junior girls dressed as Troopers and Indians compete in contest during the burning of the E pep rally held during Homecoming week. Ricks, Steve Robinson, Ed Russell 1 Ai juniors find varied pastimes as students enjoy participation Henry Saaveclra, Mark Sackett, Lillian Sainz, Cecilia Sanchez, Cathy Sanetra, Bobby Santiesteban Darlene Schade, Sandie Schwartz, Renee Segapeli, Allen Sewell, Dorena Shanley, Kevin Sherlin Brenda Shoemaker, Carlos Silva, Faith Skelton, Debbie Smith, Jim Smith, Kim Smith Varsity cheerleader Rita Chavez is concentrating on a cheer taught to her during summer camp. Lu Ann Smith, Steve Smith, Russ Snider, Rudy Soto, Debbie Spougy, Teri Spidle Steve Spillman, Carla Spindler, Jean Sprague, Jim Starkey, Steve Steele, Susan Stepanski JUNIORS 243 Junior Cris Lester helps change letters for the mar- quee as a proiect for a girls' service club. A7q'Mu sr- . ,. Students strive for top honors Mike Stephens, Gloria Stevens, Debbie Stricklin, Mike Summers, Carmelo Taran- tola, Linda Taylor Lloyd Taylor, Barbara Terry, Kathy Teutsch, Linda Textor, Monica Thompson, Roger Thompson Stuart Thompson, Evelyn Tiffany, Debbie Tisdale, Diane Tinguely, Monica Todd, Van Townsend Susan Townsend, Dean Travis, Earl Turner, Jackie Turner, Bobbi Van Kleef, Rogelio Vargas Ann Varley, Debbee Vasey, Helen Vaughan, Paul Vaughan, Tom Vaughan, Robbie Venable Richard Vieira, Leticia Vilchis, Glen Vil- larreal, Lisa Wallen, Vicki Walls, Larry Warner 244 V Competition encourages juniors q i c sckwrsem , I' 4 it wi Q ,N Dave Warren, Dan Warwick, Alice Was- son, Von Watson, Jan Watzke, Susan Waugh Susan Waye, Naomi West, Steve West, Leticia Westhoff, Teri Wheatley, Vicki Whitecotton Jesse Whittenton, Darlene Wilcott, Nancy Wilcox, Joan Wilkins, Sharon Wilkinson, Charles Williams Thad Williamson, Audrey Wilson, Jeannie Wilson, Jim Wilson, Richard Wilson, Patricia Wood John Young, Mike Young, Mark Zaharko, Tom Zeman Carla Spindler, a finalist in the beauty contest, looks into the crowd during competition. JUNIORS 245 Sophomore beauty Sally Thrasher awaits the deci- sion of the judges during the beauty contest. 246 E s 1 X Sponsors for the sophomore class are: Mrs. LuEtta Johnson, Mr. Roger Arnold, Mrs. Dolly Picken, and Mr. Fulton Robinson. Not shown is Mrs. Jo Sue Matthews. Sophomore class officers are, SEATED: Carol McManus, vice president, Carol Lee, secretary. STANDING: Mark Fraga, president, Mitch Henderson, representative, Glenn Crawford, representative. 5 . ,,,.., il .524 k7:A. , ' A ' .-2v . 5 gi f 5 ffffi . M ,Q . is 5 .5 l 1 1 Favorites chosen by the sophomore class are Steve Nelson and Debbie Bowden. est .1 'rf Sophomore class captures honors as they win canned goods drive The class of '73 made an outstanding showing around Christmas time by winning the annual canned goods drive with first place. The sophomore service clubs, Entre Nous, Ekappa, Corinthians, and Venite Fidelis have accomplished quite a bit this year. They have clone such things as cleaning the parking lot, giving bake sales, and boosting spirit to new heights. Steve Nelson and Debbie Bowden school were chosen class favorites this year. Debbie is a Trooperette, president of Entre Nous, a member of Corinthians, and served on the student council last year. This is Nelson's second year to be chosen favorite, having been selected as freshman favorite also. He is a member of National Junior Honor So- ciety and served as treasurer of his class as a freshman. Mrs. LuEtta Johnson, Mr. Roger Arnold, Mrs. Dolly Picken, Mr. Fulton Robinson, and Mrs. Jo Sue Matthews are serving as this year's sopho- more class sponsors. The sophomores sponsored several booths at the Halloween Carnival this year. Serving as class officers this year are Carol McManus, Carol Lee, Mark Fraga, Mitch Henderson, and Glenn Crawford. They have done their home- work in providing leadership for mem- bers of their class and the school. SOPHOMORES 247 Cindy Adams, Kathy Adams, Pat Adauto, James Agee, Josephine Alvarado, Vickie Amato, Barbara Anderson, Pam Anderson Mike Appleby, Tom Ascherl, Tamara Atkins, Ingrid August, Sylvia Badillo, Kathy Baggett, Dixie Bailey, Greg Bailey Terry Baldwin, Jeff Bale, Duane Banks, Susan Banta, Rob Barnes, Martha Barragan, Donna Barron, Nicki Barron Ernie Beeler, David Behlen, Zandra Bell, Debi Bemis, William Benford, Denise Bennett, Joe Bennett, Tod Bennett Anne Berger, Butch Bernier, Jon Bertka, Debbie Betts, John Bien, Angela Biiole, Tom Bleakly, Linda Blizzard Sophomores actively contribute Ricky Page joins the band in entertaining the stu dent body at the pep rally for the Eastwood vs Burges game. Page is one of approximately ninety band members that play during all pep rallies 248 The enthusiasm of the football team is highly boosted when sophs ioin competition for spirit stick. to weekly pep rally activities Mary Bombard, Ana Bonilla, Debbie Bowden, Rick Bowen, Kennie Bowie, Valarie Bracey, David Bradshaw, Sharon Bratton Larry Breit, Gary Brinker, Roxanne Brooks, Allan Brown, David Brown, Noel Brown, Debbie Bryant, Donna Bryant Gary Bubb, Hal Buie, Harold Burk- holder, Pam Burns, Michael Burris, David Burt, Chrisy Butler, Carol Caldwell Benell Canavan, Susan Candelaria, Alex Carothers, Ronnie Carpenter, Patsy Carreon, Chuck Carter, Sal Castillo, John Cataldi Terry Chambers, Roy Chaney, Daniel Chaparro, Carol Ann Charles, Mike Chasco, Eva Chavarria, Cindy Chavez, Rebecca Chavez Mike Chesak, Mindy Clark, Teresa Clements, William Clonts, Drew Cloud, David Cobb, Colleen Collard, Judy Collett SOPHOMORES 249 Halloween provides enterprise Mary Strangeways, Alison Ware, Sylvia Badillo and Renee Davis construct puppets for the carnival Cindy Combs, Eddie Cooper, Jacob Cope, Frank Cordova, Janet Correll, Jonna Cozby, David Craft, Bonnie Cram David Crawford, Glenn Crawford, Barbara Creecy, Deborah Crowe, Linda Cunnington, Cheri Currie, Barbara Dahl, Mercedes Darancou Patrick Davis, Paul Davis, Renee Davis, Thomas Davis, Patsy Deba, Guy Decker, Arthur Deckert, Mark Defee Jerralee Dekle, Bobby Dennis, Patsy Delgado, James Dennis, Larry Diaz, Mickey Diaz, Ramon Diaz, Lynda Doebele Bruce Donohue, Mike Donovan, Tim Donovan, Kirk Draper, Sybil Dum- brique, Gordon Dunaway, Alfred Dunlap, Michael Durr JoLynn Duscha, Suzy Duvall, Bayne Dyer, John Dzubinski, Lyn Edens, Merri Jane Eades, Welcome Edwards, Jackie Efaw Linda Ehrlich, Scott Elrod, Christian Engelhardt, Danny Eoff, Molly Erspan, Jesse Esparza, Patricia Estrada, Barbara Eubanks Holly Ann Eurich, Maurice Evans, Debbie Eytcheson, Mark Eytcheson, Mark Fairbanks, Nick Falcon, Richard Fernandez, Richard Flato 250 Tradition is built b people Linda Fleischman, Sandy Fletcher, David Flores, Emma Flores, Michael Flores, Marilyn Foltz, Georga Fonner, Georgianna Fortune Mark Fraga, Sam Frey, Stanley Fulkerson, Bill Gainey, Thomas Gale, Dale Gamble, Guadalupe Garcia, Jerry Garcia. Joe Garcia, Joe Gardea, Andy Garza, Mike Gaucin, Ricky Gee, Mark Gelderloos, Terri Gerdes, Robert Gholson Dorothy Gibson, Mark Gilger, Jeff Girard, Patricia Gonzalez, Robin Gonzalez, Sylvia Gonzalez, Tony Gonzalez, Terrance Gorman Karmel Goughnour, Louanne Gower, Valerie Green, Billy Griep, Georgi- anna Grimes, Cindy Gross, Debbie Gross, Martin Gunaca Juan Guzman, Barbara Haas, Jerry Hahn, Hal Hale, Mary Hall, Greg Hammond, Pam Hansel, Steven Hanson Rebecca Hard, Jonathan Harrell, Karrol Harris, Pat Harris, Marilyn Harwood, Sheela Hastings, James Hass, James Hazel Paul Heinlein, Audrey Henderson, Mitch Henderson, Paula Hendley, John Hendrickson, Javier Hernandez, Linda Hernandez, Mary Hernandez Trooperette Cheryl Tibbs pauses for a moment of reflection following a dance routine. SOPHOMORES 251 Sophomores seize fleeting time Jan Hiatt, Cindy Hicking, Debbie Hicking, Steve Hickman, Fred Hiebert, Nora Highsmith, Gloria Hiiar, Carol Hill Henry Ho, Kerry Hodge, Michael Hodson, Terry Hoff, Robin Hoff, Patrick Holt, Patsy Hooper, Leslie Hosmer Franklin Houston, Steve Hrdlicka, Jeff Huckabee, Robin Hudson, Jeanene Huff, Gary Hughes, Steve Huizdak, Tricia Hunt Gary Son and Robert Barnes enjoy spare lunch moments with one of their many favorite pastimes. Charlie Huntsinger, Stephen Hurd, Kathryn Inman, Cynthia Jabalie, Margaret Jackson, Danny Janis, Joyce Jarvis, Dwight Jefferson Pat Johnson, Robin Johnson, Steve Johnson, Terry Johnson, Kim Jolly, Debbie Jones, Mary Jones, Rachel Jones Randy Jordan, Ken Jury, Linda Kaufman, Arthur Kerns, Donna Kelly, William Kettering, James Kilgore, Kathy Kistenmacher Phillip Kittel, Cloyd Knight, Ellen Krenzer, Estella Kun, Alice Kusserow, Joe Laduca, Durenda Lane, Ron Lange 252 5 ? l s ' ii were ..,,...,. ..i.,....?s , ....,,......x.... ,,,, 1 LW, . . MMM ui 'G 2 to escape from each routine da 2-5 f f 'hu-ww 6 s ,ifx s 2 so Judy Lantis, Robert Lantis, Alice Larson, Janey Larson, Donna Lawson, Carol Lee, Ronny Lewis, Henry Licle Elaine Loiselle, Penny Looman, Frank Lopez, Linda Lopez, Myrth Lotspeich, Carol Lowe, Frank Loya, David Lubecki Abel Luna, John Lyons, Steven Lyons, Nancy Lynch, Gary McCarthy, Mike McCoy, Hugh McCuaig, Diane McCurry Joe McCutcheon, Jack McElveen, Phil McGinnis, Wendy McGrath, Terri McGuire, Ronnie McKnight, Carol McManus, Cathy McManus Gary Mahaffey, Frank Malone, Andy Malphurs, Debbie Manning, David Marble, Melinda Markel, Theresa Martinez, Steve Masters Grace Means, Randy Menser, Richard Meyer, Jack Michaud, Glenn Miller, Shari Miller, Terry Miller, Glenn Mireles Barbara Dahl supports National Honor Society by purchasing o Garrison with her SA card. SOPHOMORES 253 While demonstrating home nursing in homemaking, Debbie Reihms patiently feeds Debi Bemis. Hom nursing insures the future Sherry Mitchum, Danny Mizer, Patricia Moilan, Joe Monticone, Cindy Morales, Yvonne Morales, Lacey Mordecai, Norma Moreno Dennis Morgan, Burke Morris, Pat Morris, Danielle Morrison, Leslie Mowad, Diana Mueller, Karen Muel- ler, Dwight Mullens David Myers, Gayle Myre, Dawn Nafey, Toni Nakovic, Robert Narro, Nadine Neavin, Kirk Nelson, Steve Nelson Brady Neuville, Pam Nevarez, Pam Newkirk, Brenda Nichols, Otto Nie- man, Helen Niglio, Becky Noel, Ter- rence Nolan Stephen Novak, Mary O'Beirne, Eddie Olivares, George Olivares, Jesse Olivares, Eric Olson, Janet Olson, Kay Olsen Kenneth O'Neal, Yvonne Orona, Bob Osborne, James Osburn, Susan Oswald, Paula Owens, Ricky Page, Jimmy Palmer 254 is 'Sqn sf X it ,. ,.,,, .. 3 95 oi A Y -A A E il ws v W 1- s .V . .,,. 4. il. .r it r A594 ft X K if ve r g. ,-1 uw X Yu . .- 1 M .., L '-if , r vs 19 al 5 7' 9- ijf ' . V .. fs V ,mv an 5 5 - iw its ,, f if 4 QE . J M rg g. 1 ' as we nf? 1 W A L ' . :-' 'WW B , - ' , rrrrt f f 4 ' ,,,, H ii A me r Q, J , E33 N I 6 V,:f ,, KM . , I hiv' Z 5.6 ,Iv .i in V ,,,-, ' - . ig , - r.. to te L i may K qi' if Q5 inf ':f.f.,,2:: '::. 5 zzl -,sE11:-L: , ,E ' ..-:, H 'vw in it H i3'2ffiZ We iff .tw at 'xiii-'K 5 33 Y S 4-vi it we nwtwww x Q -1, 3 .Ar Robby Parsons, Phoebeio Patero, Edward Patterson, Sheri Paulk, Rita Payne, Kim Paxson, Raleigh Peace, Denise Pero Tom Peterson, Donna Phillips, Alecia Pier, Michael Pike, Chris Pittard, Sylvia Polanco, Cheryl Prather, Ronald Prather David Price, Jack Price, Larry Price, Linda Price, Barbara Prine, Chuck Pryor, Mary Pugh, Mike Pummill Cindy Pyle, Humberto Ramirez, Tony Rasco, Larry Reed, Bob Reese, Debbie Reihms, Jeff Reinhart, Cyndy Rhodes Charles Rice, Dennis Rinker, Ronald Ritter, Charline Rivera, Christine Rivera, Mark Rollins, Anne Romano, Cynthia Roscoe Donna Rusch, Denny Russell, Cecili- ann Rutter, Richard Sabatini, Scott Sampsell, Harry Samuels, Gary Sanders, Joe Sanchez Patricia Sanchez, Terry Sanderson, Roger Santee, Diantha Scheffler, Joseph Segapeli, Dan Severs, Twilight Sewell, Helene Sikorski Exes create bustling activity me meimnm-EWR Wayne Soza and Joe Sanchez decorate an assigned hall for the welcoming of exes during Homecoming week. SOPHOMORES 255 Dail schedules demand haste Mark Silkwood, LaNell Simpson, Carolyn Simonetti, Rhonda Simmons, Nick Simon, Winston Simon, Jenny Simons, Corby Shahan Vernon Sharpe, Mike Shannon, Terri Sheehan, Martha Sherlin, Carl Shouse, Edward Shugert, Ellyn Skerkowski, Linda Slater Tommy Small, Ami Smith, Deborah Smith, Diana Smith, Joe Smith, Karen Smith, Greg Smyth, Bill Snow Thomas Sookiasian, Gary Son, Wayne Soza, David Spindler, Brian Sproull, Russell Staats, Frank Stains, Jack Starns Denise Steele, Lisa Stell, Chirley Stephens, Cindy Sterner, Janet Stewart, Debbie Stiles, Richard Still, Ronnie Stone Vicki Stone, Wayne Strachan, Mary Strangeways, Susan Strickland, Cyn- thia Stricklin, Carson Stuart, Debbie Stuver, Cheryl Summers Jane Swasey, Philip Swearingin, Elizabeth TGPPI Mark Tate, Cheryl Taylor, Kevin Taylor, Lane Taylor, Lillian Taylor Fred Tellez, Danny Terrazas, Bill Thomas, Ellen Thomas, Dennis Thomsen, Dena Thompson, Sean Thompson, Sheila Thompson Javier Hernandez keeps pace with Melanie Becker while conversing about future school activities. 256 S A 1.1 sg: f . jk, 1 , f. ' 'f 1 -- I ,.-. ff V '- In . - A 1 4 Q as 1 Q-.Q .IQ fg A , f' - T , Y, T 1 E Tl A 1 - J J - .ii-w A , ,QL tt Y ' as-f S 'fig T :kr , 52,3 J M , - .I KK V A sw, L , rr ' LL me ' - if A ,V if '5 , , y- P i A W rw . ' cy L I 1. ., , f- Q u' 4 . Q 1 Q M ss H 'Q 'ff is - gc, we , f - s ff ' n 'K ' - - ez:- ' . 75, J , r . Q - jf! 4 :.VEE:b: ::l . .., H V... ,ws X ,, l 5 Qi, ,Gu ,QQ an Cszvjf it, , A 5 at i X in it -r .4 t it K 1 .-,af . 'i C T , fi 5 152: .. , 5,,, Q, hy J it E-Ti , - 5 Q-:im I:-E: 1. s y , gf sf Q z ,,,, Q F W t 5 2 had 3' Ju, K ,X f f Y 5 sn Y ' 1 L Q SVC? , Q T ,B W V , S - A 5 F ' H 5 , T, W.. . J ' RQ r , ,. -. e , C: .. I if W Sf, I ,gp A C is t sal, 'J 32 S ' ' if 'rf' . f is . ,f ' ' 'K ' i X . J . '-. . me -,M J , AM we-Me. :aware W5 4 ff-fh 1 fs A Q1 4' . new meaty Ki E I as 1 SQ 1 S' J ui, Q lg ll 4 ,,.. E1 Q Q. ,jb- -'WS' 2? g:.i'.,. L- I' jda:f',E2I:gf::2 ,V 1, ,TV NV.: V, ., L .e l l R: is I ,V , M -r . .3 - 2, 1 , -,,.,:,,.,,- :A H S, 9935555 W, .H--.,,,H,,g---Freazaaagggym.:5:.:':-,eliw -:s',i:2-:u nease A ' , S 'ff 1 1' 2 ' 52 -- 1 1 no K 'ze f i -L of ' 1 Y MLN f - f -se I J 1 'S .K-if Q 'll 5 ' ,, I ,gl 2 . J '.- 51,5 ,, s it 'T' Q- is B I so me 2 it v f , L 5, 3,45 1 4 - 1 Q ff 1 if J' e Q K r- T f 3 11? ES 5 L A aw L ,, 11 i I 5 f it at g gi t if W' X If ' -, -wi X l 3 fr, f , . i . .4 , , if 1 -i'f1 t M my S, . ,,mmW,A.W,,A 32, m,., , , ,,., ,, Wag A 1 , ,f 5 , er , , 3 ,, we f . , Q , X M is A Q Q -new fi Z f to sr 5 F ' N 3 ' 'Q f f 1 i fr 2 f Q55 ii i 1, wr' me , it-Q , Q ,, ,am M I2 ? i zifisrf' i L A M fr' ' ,Q gf ' ,,-.,, 1 'T A M., , - ,LL : ' , ' A . K -. ' ' - fa, tiff , 2, -1 ' ' ,- A L, , t, , We -f f if -k,' ,H ,V z, W' g uy S E '- if , , , ' . A i 5, ': -f 4 W' L, -X 1 - . X -. 4 i r its V T ' -'f A : f - L it g .e .4 - I f ' tw - ,. ' Q ' W 7 V ' f-:.If t li ' 5, J H ' ' - f . ' sf A ,, V, - ti: I. ' V L- x , gi rs,-2 f,fs-vw, Stan, f.,, me-f ha , ---,,,t- fn M- me 'hh Q, -wf,,, -,w,1f,L -f 3 .. ff- , ie if f ' - ,, 5 L ' 1 1 L 2 irrr Z ii .- . Q - ,. - ' at , , 1 L ,.,., , V ,Q 1 V, I 2 I -1? i . 'Q Aj-I k y' 2 , f 2' g .. V . ,V - A HSM, ' V' L ,.,k If ' ' 3 if I 1, I I I i, ' , f ' Kr H ,S V Rte: 2:-j,,,i! ,, - ' 'H.,,, ,f Ay L , f-,.a:.,, I I ,1 , v 3 I x , if 15, ,i'si1l',, , if if -' '- - H . .: IW' ' ' Y- V a ' . '::af5:Ze- 212' rf' V fi-: J' L 5' if ,fi 4931's , ' ,. Ti - ,, ' , .. 'm ,. ' 4 i .L Wt ,... fi i' 'A 2 ' z '- ' it ' 'L .1 L 'i 513719, ' I ..,ff ' 5 fi W, 1 1. www' V YQ z: if W., Av H ' W . W' , , ,, A 2- , - -we L,'A-' l - H , , M 125' L Q W' V ' ' -BICWQX : ,ty ' ' ' u ::.s:5.: .A 'fs ', ,,,, M' ' ' ' ' g u m.. ' , we H -- . mh' J ' L , , .,. ,. ,, , ,, ,,, A t M, , , . i ,I T J Q as, YV, n,- fs, ,we I I - V, ,fy . , I ,V ,f ,fi fx fwf- ' ' ff ? . f ' - fsifez, . ,. - 3 iff, , L f f- P A , 1 ' ' ft' A A 1 , if Y .f ' i . K v 'Sei 1 l it A ,g ,L MH if , ,V ,, , f TV' '- ' 1 E V ,.,' .,,, A ., ,. , i' , 1, -:5 V f'- V Karen Thoreson, Sally Thrasher, Sherry Thurmond, Terry Thurmoncl, Cheryl Tibbs, John Tiffany, Carmen Tinaiero, Tom Tinguely Teresa Torres, Richard Townsley, Elizabeth Tufts, Marilyn VanCleave, Eric VanNortwick, Keith Vanzant, Joe Vinson, Gabriele Voelcker Charles Vogel, John Waggoner, Donald Walker, Greg Walker, Ladd Walker, Patrick Wallace, Alison Ware, Susan Warren Soph examine art of sport Dan Severs, Robert Narro, and Joe Smith survey a basketball game held during athletics class. Robert Watson, Donald Wayne, Tina Webb, Chad Weber, Darlene Wende, Jim West, Sharon West, Peggy Lea Wheeler Lee Whittenton, James Wilcott, Karen Williams, Stephen Williams, Steven Williams, Margaret Williams, Richard Wilmot, Rachael Wilson George Winkle, Stephen Winkle, Linda Wood, Lisa Wright, Robert Wright, Danny Young, Dolores Young, Jacie Yonkees Richard Yost, Thelma Zamora, Paul Zeitz, Nancy Zentz, Colleen Zizik, Robert Zukevich SOPHOMORES 257 g i X r W2 Q- ,Mil -f A,,A ri '03, .1 ' if Freshman cheerleaders Lynn Paxson and Nancy Searcy upprehensively watch a freshman game. 258 Freshman class sponsors arey SEATED: Mrs. Carolyn Woltersforff, Mrs. Linda McCarty, and Mrs. Thelma Cantrell. STANDING: Mr. Art Howard and Mr. Albert Lane. Officers of the freshman class are: Lynn Paxson, treasurerg Sherri Sfeele, secretaryg Joel Williams, president, Sheila Rhymes, representativey Kathy Ramsey, vice president, and Ann Haynes, representative. is GW W mggm S Ml-img wr will LB Freshman class favorites are Steve Belknap and Sheila Rhymes. swim Frosh class enjoys first trooper year as freshmen compete in spirit race Highlighting the activities of the year for the freshman class was the outstanding performance of their foot- ball team setting a new school record with a 5-3 season, the first winning season ever for the frosh. The class also took an active part in backing school functions by sponsor- ing an after game dance and having the tekita booth at the Halloween carnival. They worked hard on the canned food drive coming in second to the sophomores. Selected favorites f'or the year were Sheila Rhymes and Steve Belknap. Sheila is a member of National Junior Honor Society, a little sister of Copiae Auriae and a student council representative. Belknap played on the frosh football team and is als,o a member of the track team. During pep rallies being the largest class had its definite advantages. lt enabled the frosh to win the spirit stick and be recognized for most school colors more than any other class. Faculty members sponsoring the fresh- man class this year are Mr. Art Howard, Mr. Albert Lane, Mrs. Carolyn Wolter- storff, Mrs. Linda McCarty, and Mrs. Thelma Cantrell. They have worked hard in advising officers in the various activities this year. The class of '74 has gotten off to a real good start, and expect even greater things in the future. FRESHMEN 259 Freshmen's spirit upholds teams Ronald Adams, Lilia Alvarado, Ricky Andis, Paul Andow, Don Arbogast, Anthony Archuleta, Nancy Ardoin, Becky Arellano Gus Argeanas, Sandra Armendariz, Jay Arnold, Sally Arnold, Cheryl Aydelotte, Bob Arver, Elsa Baca, Laura Badillo Mike Baggett, Cimanda Bailey, Laurie Bain, Lorraine Baldwin, Anna Rae Bamberg, Oscar Barcena, Catherine Barnes, Elaine Bartlett Steve Bartram, Bill Bassett, Drexel Batson, Jeanie Barton, Jimmy Bean, Lorene Beard, Harry Beaver, Melanie Becker Mike Beeler, Steve Belknap, Russell Bellamy, Marla Bennett, Stephanie Benson, Kevin Bentley, Pat Ber- roteran, Vicky Bigler Bruce Bird, Mike Blair, Scott Blair, Bill Blenkinsop, John Bohanon, Leighton Bohanon, Zachory Bohn, Joe Booth Awaiting the arrival of the teams, Ruben sits in the sun during the first freshman if 1 Olivas game. gl J 1 Er V, l I Q, is 260 throughout all assemblies, games W J' 323, ' T' K 2, -is r was vial. sei sw. ,Shir s 'G F N, . .. -W. lg ss Y 1... xiii X 553583 ll 5IS'fiiI??l M725-:.1v:::.::,. , , . , .- , - V V'2f'-fix' I5P.1':Q.:5:: 'l'k' ' 1-5 ::i':: - .,, : ,'-::51:.,55:'- smgww ,, - ii.'ssfv,ws::w25??s1w eii-Eisig-QQPMWM :-..:g-g,gaag,,':g:Eqlime M5 V 1 ,sisffssfiezfesseirmsf-mfs W-s,,,fig,ffQ,fssg5g,n, g,.- ,is---Q ::-,-- W, as xxl-f-weffsfssewfsefiw1:?fe?1fv'f'ifff?gKis,1fsmg,5Sg:mgg A m imi? ' 'ZTifiiifif2?fsf?fs?fSff425g?is4fsxseiiffffgsiifyisifsszfsfezervgieiiup Zgsiurfigsgg-sqi3,i,Pie - me-'isrg21,2sffsz:i2,-,sfs,,gs,w,rf., 2If,'4si1Hvie?is1sg2ey1aQM,ewes1s,MMe f, 1' K 1. - 1 David Bosselman, Ron Boyd, Kim Bracco, Vickie Bracher, Jim Bradshaw, Barbara Branham, Mike Bratton, Dee Brodie Marilyn Brooks, Sandra Brooks, Carlton Brown, Mike Brown, Susan Brown, Curtis Browne, Dianne Bruce, Richard Bruce Ronald Buckles, Beverly Budens, Alicia Buford, Mike Bukowski, Susan Burtyn, Jerry Burkholder, Fred Burns, Cory Butler Billy Byous, Mike Cadena, John Cain, Catherine Calanche, Carole Cameron, Cathy Canavan, Shawn Cannon, Robert Carbaial Jimmy Cardona, Colleen Carrick, Yvonne Carroll, Sharlene Casper, Sylvia Castillo, Sue Cates, Marilyn Catt, Mike Ceniceros Mike Williams, lisa Johnson, and Steve Lucas support their team and class during games and assemblies. FRESHMEN 261 Frosh support school projects Kathy Ramsey gets her SA card punched as she purchases her Garrison from Mrs. Bonnie Lesley. Gary Chambliss, Pat Chandler, Bun- ny Chavez, John Chesak, Chuck Chesbro, Jon Chesnutt, Joe Chris- topherson, Steve Christy Mike Chumlea, Sharon Ciceri, Cilyn Clark, Mike Clark, Sam Clark, Edward Clement, Matthew Clune, Ann Cochran wwe Dale Cole, Susan Collier, Brian Collins, Walter Collins, Caren Col- lom, Mike Corroy, Kevin Cook, Janeese Corbit Jeanette Cordova, Christine Corral, Tim Cottingham, Janet Cowart, Mary Irene Cravey, Charlie Creek, Jim Crenshaw, Susan Crossmon 262 Mark Cruncleton, John Cullon, Mike Curtis, Christy Daggy, Jan Davis, Larry Davis, Mike Davisson, Gilbert Delgado Mike Dennis, James Dethrow, Donald Deweerd, David Diamati, Becky Diaz, Danny Diaz, Leslie Dille, Obren Diordjevic Beverly Doolittle, Richard Doss, Max- well Dow, Tricia Downs, Richard DuBose, Robert Duckworth, Shellie Echols, Scott Edwards Ricky Eggemeyer, Deanna Ellis, Elizabeth Estrada, Jerilyn Eurich, Kerry Eytcheson, John Fairbanks, Ande Fargason, Lisa Fargason Student number grows steadily Marvin Farley, Greg Farrier, Stephanie Feind, Danny Ferguson, George Fer- rara, Linda Fields, Cynthia Fierro, Phillip Flato Richard Fortune, John Fout, Kathryn Francis, Tommy Franklin, Kim Free- land, Randy Friedman, Frank Gade, Joyce Gade Steve Gaenzle, Denis Gaglio, Nancy Gallahan, Debbie Gallegos, Josie Garcia, Barry Gardner, lda Garza, Denise Gauthier Sue Gergas, Teddy Glazebrook, Deb- bie Glover, Patricia Gonzalez, Sandy Gonzales, Sylvia Gonzales, Cathy Graham, Gloria Grainery Harold Grall, Mike Gray, Bobby Griffin, Debra Griffin, Lisa Grimes, Grady Grisham, Mallory Gross, Carl Guerra Mark Guidry, Mike Gunaca, Terrie Hale, Barbara Hall, Carmen Halle, Carol Hamel, Debbie Hard, John Harding Dennis Harrold, Richard Harvey, Tim Haseltine, Wayne Haverstock, Linda Hawks, Ann Haynes, Cheryl Haynes, Denise Haynes 263 Carnival brings forth freshmen's Sharian Haywood, Mary Helton, Wil- liam Helton, Alice Hendley, Tony l Henson, Norma Hernandez, Greg Heusckel, Robert Hicks Dennis Hill, Macual Hill, Randy Hill, Marta Hodnett, John Hogan, Robert Hogue, Larry Holguin, Karen Holt Bill Hooper, April Hosley, Jim Hover, Rhona Hoy, Ronald Hoy, Karen Hughes, Patricia Hughes, Edwin Huizar Alice Hendley, performing with the band, portrays a stripteaser during the Halloween Carnival. 264 effort to prepare for big night Christy Hunter, Norman Humphreys, Bobby Huscroft, Mark Inman, Robert Jacquez, Bill Johns, Georgianna John- son, Lisa Johnson Lindo Jones, Ross Jones, Cecilia Koss, John Kays, Sherri Kennan, Ricky Kepler, Mark Kilmer, Lee Kilstrom Arleen Kimbrell, Gay King, Louis King, Julie Kistenmacher, Bill Klein- schmidt, Joe Knight, Karen Knudson, Paula Kurns Donna Lamothe, William Landsheft, Deborah Lane, Debra Lane, Randal Lane, Gary Lane, Cynthia Latura, Bernie Lechuga Bernard Leftault, Scott Lehman, Jack Lemmon, Steve Lemmon, Cecilia Levy, Walter Licon, Robert Long, Denise Lopez FRESHMEN 265 Eric Lopez, Fernie Lopez, Pat Lopez, Joe Lord, David Lovelady, Steve Lubecki, Stephen Lucas, Greg Lund Lon Lundberg, Wayne Luther, Mike Lynch, Donald McBride, Robert Mc- Carthy, Karen McCarthy, John Mc- Clain, David McClendon Frank McCloskey, Jason McCoy, Carma McCray, Billy McCuaig, Nancy McCurry, Jerry McDaniel, Scott Mc- Donald, Sherry McDonald Cris McElveen, Keith McFarland, Shari McGillivray, Debora McGrane, Norman McMaster, Robert McNicol, Russell McNiece, Vickie McPherson Richard Mabrey, George McDonald, Sonia Malone, Kay Malout, Roy Malphurs, Susan Marble, Susie Mar- grave, Lani Marsh Ann Martinez, Susan Martinez, Anne Masterson, Pamela Mattingly, Peggy Meacham, Michelle Meister, Diana Mendez, Leticia Mendez QL EEE? he . -gig, fuzs X 2 . 1 3 ' LL L ! ef X . M . -v ,.-, L , .x. Democratic processes observed Ann Haynes portrays her interest in student activities as she casts her vote for class favorites. 266 B Buzz Murry reveals his responsibility as a prospective voter by casting his vote in the freshmen elections. as frosh exercise poll- power Jacque Menser, Kathy Merrell, Rhonda Merrihew, Glenn Michael, Thomas Milholland, Cheryl Miller, Jerry Miller, David Minter Robert Moeck, Alan Montellione, Frank Moreno, Mando Moreno, Vic- toria Moreno, Glenda Morris, Shirley Mosher, Doreen Mueller Freddie Mullins, Maria Munoz, Larry Murrell, Buzz Murry, Donna Mus- shorn, Charles Myers, Ruben Narro, Martha Navar Kathleen Neely, Damie Nelson, Diana Nelson, Patricia Nesloney, Elizabeth Nevarez, Deborah Newton, David Newman, Colleen Nichols Mike Northcutf, Mark Oates, Martha Oaxaca, Edward O'Leary, Patrick O'Leary, Danny Olivas, Ruben Olivas, Velvie O'Neill FRESHMEN 267 Sylvia Orona, Joe Osborne, Desi Overton, Sally Palmer, Thomas Palmer, Robert Parrish, Angel Par- rott, John Parsons Debra Patton, Donna Pavoggi, Lynn Paxson, Larry Payte, Jesus Paz, Rosanne Pelletier, George Pender- grass, LaVonne Pendley Cynthia Perkins, Leon Perkins, Elizabeth Peterson, Suzanne Pfoutz, Debby Phillips, Keith Pickett, Marsha Pickle, Debra Pittman Laura Pleasants, Ida Porras, Pamela Powell, Charlene Price, Denise Prine, Irma Jean Puffer, Steve Pummill Patrick Pynes, Mike Quimby, Connie Quisenberry, Dominick Rainwater, Sandra Ramos, Kim Rampy, Kathy Ramsey, Steve Rancich Rocky Rasco, Lynn Rasmus, Karen Rathbun, Robert Redus, Jim Reid, Peggy Reynolds, Sheila Rhymes, Adrian Rivas f-'FA E tt., i tt, AY.: K :, vsxfsgszggee L, W r X S 1 M 3' 2. - 3'fS.fs:.J '.: ,21t ,Y ,iIf5Vf'35i?72'f'A'm ?'f - - fiwffgfi .sive ---f L xii - .- Q - L. ,, H , wgg W EMM Q N , , 4 r ie- f VXM ,x - 5 43 ' 41, Q Q w xl . asf Frosh decked in blue and gold Johnny Cain, Peggy Meacham, and Marc Tan- chester applaud as they once again are worded with the spirit stick. 268 Spirit stick: award for vigor y at ie' i V .i r ,,, s , is 'E A S rf frrr 3 A' E eff? S Q' l . V Q T S K , , :', V ' 'X M is iiii rri rl . .,'- A . .. J' ' J --:-- ii' v ir' 'J R f . ,Al H 3 4' V, ,, , . ft V ' E ir ,A In , 2, Cv 'I A sg. ll P 5, Q, . ,greek is ,W J we 5 WM fn J , f i I if ' - ,Q ' 'f fr E J J - .,,.. I U 'SM ,, V P2442 ,'f,'f I .,,,,hEL,wi, ig: flaw V . ..::. r , , . m f . , i iiiif 1 . S Q .V '11 we , We H ' ' W ' I, 5 I ' t , 'I . :. ' ' 5' - i .. ' 'P , . J A. f A H ' -, . . ' V I ,X ps-s . , ., f Q- ' 1- ' I- , r. it J A -r , lln , Z , ,Q , is 55? V V1 l , , ' I W ,UL Alf i l i i l- ,A I ziszi , ,,, 7 5, I in g -rv I ,. , W VV M ' QQ, .151 '22, Q 2,21 1 . 2 H3 is - Upholding the freshmen's enthusiasm, Sherri Kennan and Cris McElveen display their signs of spirit. Patricia Rivas, David Roach, John Roach, Don Robb, Bill Roberts, Jackie Robinson, Nancy Robinson, Dana Rogers James Rogers, Danette Rollins, Pat Romo, Linda Roseborrough, Christine Ruiz, Rueben Ruiz, Debbie Rusch, Jack Rutten Phil Santangelo, Dan Sawyer, Ronnie Schade, Alvin Schatte, Lisa Scheffler, Deborah Schick, Diana Schick, Robert Scoggin Nancy Searcy, Kandy Sellers, Angie Serafin, Janet Severs, Jean Severs, Nancy Sewell, Edward Shikoski, Jeffry Shirk FRESHMEN 269 Student concern exists wherever Robin Smith enioys relaxing and conversing friends during the lengthened lunch period. Lori Shoppach, Stevie Shouppe, Frank Shouse, Karen Shouse, Donna Shum- way, Margaret Singleton, Chuck Slaughter, April Smith Ava Smith, Catherine Smith, Jack Smith, Kathy Smith, Robin Smith, Ronny Smith, John Smotherman, Liz Snider Dawn Snow, Patricia Soto, Raymond Spain, Joe Spence, Karl Stanford, Anthony Stanulonis, Sherri Steele, Gloria Stepanski 270 with R-. W wav' . -vlgr -Q A Q Q 5 , 1' ww: rir, it f.r' K -1 h. 5, 5 ,,,' E ,ki' ' N' 451 ,EE . xi oy Z LVVV M A fv.. N J we an X66 , fl , Qi Ji A K-if tgff ,sg if .War .A ..,.. xi A My 1 I 51- ,W ' '- ' , IX 197 li ,L , :HN Q, H? 4 1 ' 1' 3 NK .1 lx 7 f I 7 'i ' M 4 L,-f . Q l , l l 'xl' I 1' I V' fi 5 Hi 3 ll llrz nzl ,.., In , v,,. ,.f, A My ,S r, P . .. ,k,,, I- My E , ' A I K I 1? .gr . - fff v ' f ' ' ' ,E ,,,, Q ,B , ,, it - , ,L , M ., - , Q'-'f' 21' H3 A: 6- K ':1 U A , M , . L . 'Z ,A ' 'ft' ' ' I . V Y S ' 'xx A ix , 14 L l , people gather to convey notions James Stephens, Ronald Stevens, Wade Stiles, Stephanie Stillwell, Melanie Stinson, Kenneth Stone, Sidney Stuart, Mary Swain Karen Swanson, David Swearingin, Deborah Sweet, Marc Tanchester, Angela Tarantola, Kim Taylor, Pricil- la Tennison, Eddie Teran Norman Teran, Rebecca Terrazas, Anna Terry, Roy Textor, Edward Thomas, Beverly Thompson, Jimmy Thompson, Laura Tiierina Doris Timmons, Robert Timmons, Clif- ford Todd, Robert Todd, Mekala Tomlinson, Marta Torres, Judy Town- send, Mike Townsley Leslie Traylor, David Treadway, Donald Treadway, Violeta Trevino, Jeffrey Trower, Joni True, Karen Tucker, Mark Urey Smith, Robin Wilson, and Vicki McPherson discuss their nominations for Eastwood-in-Elegance. FRESHMEN 271 Debbie Uroda, Belcla Valdez, Bernard Van Matre, Elaine VanNortwick, Cathy Varenkamp, Jerry Venable, Don Verbeke, Douglas Verbeke Anna Vilchis, Manny Villarreal, Jose Villodas, Frances Visco, Christie Vogel, Lori Vugteveen, Steve Wadleigh, Debbie Walker Jerry Walker, John Walker, Vicki Wallen, Sharon Ward, Scott Ward, Paula Warren, Clifford Weatherly, Mike Webb Kathleen Weich, Leah White, Parker White, Wendy White, Bart White- cotton, Terry Whittenton, Rosemarie Wiebusch, Kathie Willey 3 5 i-new f 5 rt im is ez.. v fg. .r , at i ., SL Se g a l gwwgggf? qw 3, eg, my Q X 3 1 ,, -' ze' i A ' 5 39. Q fl Hag l l TEV , V ':--1'-' - l Msiiil ?7:?E if'I' ' ' ' 1 'iggf-iz 'lil , 'Ig ' it s f . K .V Teamwork works at Young Life Frosh ioin uppperclassmen in u songfest at the Janu- ary Young Life meeting held in the snack bar. 272 H ,, ,yah Fresh anticipate comi 1,4 A 4 1, ., t ,. K f- m 35 K - f ,g Y ' D p ' ' Ms E Q ,753 ,. ,SL ,, ' ' iz' --fy -be , g H If V L ' l i .. Q 31 W- 4 'X ' i V' . I J H e w , - , 2 g . ',-' g , aw A 2 , ,sg A , . , f, us- A -fl ,- Q I I 'A ew. l lf' ' , . --'Q ,Q ef , t -- - y V' ' , X . I , -Q, aim , .ai rl 0 , N W , - . , I K , , 'w+ 'w, V2 tt' if - ' g El' 5 X . ,-,, I. J, ..ff, .V ,,, ,fp +A! 3 4 dl H H l fllw - E I ' W '- Lg ' ' 1' , X f g f K itz ? ii 1 11 55' 'L' I V all X - Q J L - iz sr 4- -, E U - , . ' . 1 s ' , ' ' ' , ., - 1 l , ,M M , we-ef f 'K1 15-.. V i . ' , ' , ' K , J, . I. , Q a. l 1 Freshmen Nina Williams and Marc Tanchesfer discuss ii' their chances of becoming seniors in the future. ng years Hugh Williams, Janet Williams, Joel Williams, Lee Williams, Martha Wil- liams, Michael Williams, Mike Wil- liams, Mike Williams Nina Williams, Ranea Williams, Tony Williamson, Robin Wilson, Sharon Wofford, Cheryl Wohlgemuth, Janet Wolf, Jack Wonner Mike Wood, Bill Wooldridge, Jane Wordsworth, Betsy Wright, Charlene Yeatman, Charita Young, Steve Young, Henry Zais Rosa Zamora, Michael Zeitz, Nana Zeitz, Earl Zentz, James Zielsdorf, John Zielsdorf, Don Ziemski FRESHMEN 273 J ,M , if -fagLriqLE?:3f A IQ .-TfiifiiklqiFC-WE312i'T5,i',-SF' Si,ffiflipfiifliiif-2YL1'1'i2f' QQZXSWEQT LE QE??E3ffE'm fX '7'Tqf'?i ': 55 , f , V3 - - JZ X' ff-f fi at 'f' Q 3 'L' -iff' Dilifg J3gf?3 Ze?2.1 35'-1' ?f'Tfffa'f1'1 1 . eixfffi- 5 '2 E-Q - L, ' - --A g-. w,-',-Wg, irq--,Ml f g,..Lsffy'g:fs2f J.i.,Ld,' .yu A-,, 2E.1-35.14s-urygg15-fufi-55,1.2kiJ,?,gz'igiPeg-ig-555:44 ,A1A5gw334re-iggfgigfy-.awe-555 f ' f , - ., 5,4-'.' X- ' ,-j.'v F u AQVZJ ' ', VR Z' ' ,' gg' vj 'fe f'Q.viCJ? 2- 'f ng,-W uf. '-if 3479-J' if GYM 7?-,L-ill-1'.t' if-1i1f. v'-'-,3',k X ',,l,' Ya '72 ,dl ,fQv, i1,'-Qi Li: 1' 529' tu.-Qkj1'fQiH: ifkfj ?E5'f4w-'3i'L4'lTXQ3 ' in-HF'-ig f5LK' i'32'31'f, 'wg K-7jP,-YQ-1-wfwfil' fJ'?Lf 'K' uf, w': fe3i-52N'fEN XMI' QE Cf! A ,- ,. A ., V, 5. , ,,- ,,,,.5:L ,,, - ,5 .5-1.X,,7,-fi--f1,, ., .- - . 5 A , , ,, ,aw-,,5,,,,,. . ,U ,q,,Q.g,,A x,...,-wig MQ-f,-,-, -Q-, -My .-:.f:.,x Y,,-hm WEE.--,g,H,i'fgw::f,,,.,,,b51fw'g1-Y --.-A,,g.f--1,-gfqxg -,i-.45,-.--,haf-.1-,1r,,f..-1,an kv.,-,,5.Q,---,ff mu. I - -1 . M, ,f -mm ugh- fm- f,,f,:-1. -iw 1, ,. v--.-.wg-, wf-5192.1-f. -1 Q, ww - -1314-we-11 f'x51f-K!-fff--1'g,w'S .,f'f-sfa.f-eilf-3.5,!m,?-eff--fig1-Lw1f,-5w-e1-fg:f-,-m.,-9ye-if,-wyzafggsffffefmigya--,fflsw-H211wpiwfgegmaywzsmfr'- aw A . 1 4,2 - - . , - v-.em W -- .pw in- a,1.Jx1.-,--2-rf f:,-J--J M,-1 , ff'.fYX-.aww-r.f1'f-5...-,J 1.,-:.y-.6-5, W'-4. '-,f.4-w,-e-:-f,'-- :3'.A':-L-:pig -:,g:g-2 g ,sz -- 'fp .y,,--,-, .1,fg1.--fVay,,,-- -Aa,-J -f.,-,-,,,,y 54,- J , 'A f , if . . A -fag ' --f-12552 xi-f..'-X gf1':':,JfZ?-if pc:wr-f-5-'qfz .,'upf'f-X'f,f-S-124'-AQQQfif2g3'+1QG-vqffgaw,:gm-wifiH-E22'--,J ,2fw1W.4-iii? -- . . f , v - wg- -- - ,-Q. v- wi fm- .A n - My - 'M-'f.:1Qf,.. m.w..-fJg,f,-- f--,w s-'w,-:-:.1fig -.U wp, .-,,,,-,g .,.f,,w,,g,--gg-3.1kg--Gffgg-a.,,iww-,,-f-yf+fMxE,,-f-fgQ:- - ,g,--gnfw--1 w ifi., -ff-.gffsft -11 QN-9i'14Q-,l,,:f'g,1,yg.Q,f'Q,'f'f'k'Q, 42p:'V15-'iw -5-Sym,-fvf-' was--1-fd' ' , .. - .fnrflf ,,: - M1 ,nu V f 'raw' 1- .fm-f1v'a f1 f-'-wtf-1 1. f:fn, 5-5-.ww -Tfv-1,-M.-rim-,ms1,1-hw f1,qf'1'-42,15-, wa,ff-elswgswaw-yt9wx,--rvfvuf.nwf.1gz,gww---, as-.5-Qmg-xv. -sswyqvgfw Yiwu -91r,!3rz2fw.-1-?:4g-Wm 'f-:re RMA M 'fkffffw X -,Q-.gr , , . HJ, ,,. .53-X, xx -gg .1-2543 M. Mg- ,-gy,..zy-,g.-be-. -,Q ..,h.y.,-:f,L,f, xw,,l?.y--2w.y-,mv,.-H, 'A fggmgquw.:-5- wg plI--Wfgg,-.1-Q:-Qvf-wwfmy 1-Milf 'lygvx-.vK,5,fw'71,:w-gg-fb' 1--,f,'i,4'-'WM-,N-2iafpwg-?i?mi5f'4'm,A,w33v'-141my:lifeaf?f,,d'waif-V,Ms-fn.f-fwgelm-gg-,amrr'?-Jw?A1fnQf?'f1gfA?-gxmKTfg,vf-rfwisl- 5 f of 11,-: ' -5 -5 ' - -f. A-.3-, -,-511- -:'1,, -35-' . ,.- ,gg Nj' 4 :J -km ,Q L-xg-lf,-'1 -lg'--,- S-,gfffggg-'ff--:.ff.,Q---1-, -V g,4,,:..f5!,.q.,,.: ..,g,3.wr,iA-,'g,4 R,-J-,45Qgijf,QKk,ku.5f-my.fw,Mm-,4434,l5sjl?qLg,,,:gW.,,qMg,gk,Qgw-lgfg.,if?,,4L,,i,-,55,,l-, 55,335-BW, -4.!L:,Mf:,X-L-WMQELQH.-My-, ,- -'sa-15,41 ,. , 1, , ,, .,- 1.- -u ,uw V- q-- ,-1-, ,.,-,---,,. ,, -1 k --A ., , V, ,,,-, .,, 1--u ,,--,-,,,,.f,g,m f :,L-.- L-1-.-.-,1f,:w,.-wg-,4 ff, r , . 9-,Q-,w : ,U .-4, 1-H -,Q,..,.q4 -,, A , -,A-. -,QW ,gf-r. ,J -,Q f ,. - 1-.3y.m-ZA-1Q,,i,U,b-ug,, ,. ,--,-,f-,-Y,IUp-ra,4J,p.- ,,., f--,-ww,-Q-.' ---,P -X ' --1-:M-A., -,, y,4-A Ig, ,A ,,-W-1, nf.--.., ,..-,-mv.-,ffw-, Q hr- -- f..-Agif-,,-,.1,9--Aff-gg, Ml.:-5-,f,Gush'.11,15fZfpff-4,,,'sZf.f-.sf,----,--,f-.1--fwfr,,-,-1.52-ww-4-. mf-1..fgfbQ?-vim,-4--wi.-v.-,Q affmfp-JEME1mbps-1g?:iW-MQW ,,--4 nfmf'f',-wggfpm-.:..if-f.,--533. ', f z K'---fn H .iy-ziv. f ,'-f-:UW-1:-',,,--,'MQrv,dflg,K- ':,-glsfv,-ml--3'f-xl 6' W7 1.-:QI-S,14:3-5'.1ff5q'L-'-1-:-g2'.r-Wi'Amiz5-'im-f,f'f:,--ata-,:f. ',!f 11531-A--L--,-fuw1-,fwat:f.fm-03,4 A-bl-.g'Qgfpf4aP: if-simfcmwfs-www-sg9--3'-giff-'ggi-uf-:Q f'fQy '42 ' ' ' Fffixw- 731 W- M ff'-ft-Ha UW-ff?-'. --in 2'fW9-f f 1- fsffi'Wit fl-'9f'1'+vf1'5 -''f'i'E'f'Fi f',-M9fl'J-f'-x:'f'f-V194-'Nflf'2'1'f'-W- -V'L'-Qiffikrf.-54215-,ariizfxnyW155911 P-flglwfQ?fPf'Q-'--iG1m-q1w,f:u-93,5-:,Lc19.f?s,'ggY-212--xxx'-Yf,gy.v1q'3,11y 1 'EEWNQEE-zfftfiwi1-fiplfvgfg,-ykgyifykgqtiwiff ag31f1i:al'.:Q1a-fawain-:Z Qhigsiw, ,,3,w1 -L-g -,Q W ww, A '.e-,g,,Q,,,-,,3-5-gl-,L 3251---,. ,,.,,,rf,g,p,1f,,::',-W-1',-dx-,-f----,Qgfgikkyr,-'Q-,,- xgquqw itizsytpfy,V-,-Q'-'12-we--5,014-mf:4 iff,g-xfw:-3-'.-sm.-Q-1-f-fri v,-m-Qz-sw:we,-fif--,1,fp.:f5fefQn-H2, 39,8-mf-qw:-L-ffuf 5,11-nf -M--,5mv-Mfg-e-x-em-Q19,QQ-:W2'-U-:XWIA-y,w?: :,vHf1: , , Xk,. ,Q ,, ,. ,,,, , ,.., L.,,.v . '-,, A .1 . - ., . :,, I I ' .P .Q , A 3 1, f , 'X Q. ,, ,,:', :ig ' :yu fJ rv, ,.f111,,z:v '.1ASz1Q1- m. .,f , 1.-'W -. g ' 'J 45-1 QQ-'fi'- ' ' I .sb ,wx-an-'g'L2frT-f' -:W-X.-' We .mi Q W',..av, wc 125. 'im 4 K1 fP'Q-'JVM- -fi - 'Y' W ASCE' AS, ' '-fivfffi 'fix -f-,Fi'S'mgs'Qc- Wi-W' '9?153f'M ff? 1' 11- 'fi'- w f 1 4 ' ffl H ,,,--1 -- ..1,-'Vw nh- ,sz'H-Vw-rx--3.213.-'-' ww, .,:w-.4-,.,' -4 -.4'MM-af-.1-w,4-'S-we X115 ,iv-'W- H-B3 p'fxxww.f,v-5-X4-mwHmm-fmwws-fm'frAJi?:3wm'5,,2wwMr14-':1KlwlxqwM,f?5b'.15S'a','-N'-,rc-2,--ww-M 1Sfmzaiwiwav.-ffzx-1-fx-,253M W-af'-'H-:www 5,-:wiv-4' 1- w- ,, , f ,,--w A, ,H f, gg. 35,5 , -v,'.gf4ag.,5:Q-',.v I- eg 3,1':.5'q',,1'. yf114,,, 5'f:,i3I:,f,.- iiif,'Q1.1.Zg?5j'l'-945-1 f1f,L,'f-S--Q? in 51-,..v51 'f 'Luiw ww -T.-M11--,mi,igfwxgg5fff.-'Q,,y'-Wf'f5t9fm7'Q--sqw,-SQz'mgw-515:-Wvffffmlffwgyff--1fawrwfsugzgzsmgi -s'-,zggmif-g.mW?-giqyw.Q5,fw,g:5g1eig5,g2:ffgQ.-QQqgpf- iifiifff' V- - .,fgxf '5 ',-' ,--w'-'wad-, P3 -N 'K 1- f ,J'?-ff'w- l f f1 1'-PWA2'-HW'ew-:V-'f wiWZ-,fa4au5'l1 '-M2'gif-:,'S'Ff4':HfifYfff4-'J'iZv?4.rJiQ'a,f'-fm-I591'-?2 I-a'f-Ngfa-.K-7165?,1i4iW:e,5'?w9Jflvi-fr--iv?-X355LZGM'ZQ5f?'fZc,cgafi'h1.9'f w'ff'f'sP'i'253i5g?f?5Kg-vi?1i5?Q'5fb2,:Ql9Jwiwvfgfii'.fir-1'-'?f3:S-ffMu,-Df1a9f'?.4-fwj:-655-ww5-fN?yE':'.4 fff I Q qu: 'N-XL - .. 2,-',1,',ws1 xv kf'7'.2,X:1',.Y-47,eff' .- W Nz- 'fx X2,-vw3,-l,w'.-'1 ff 1f-Vi.--kizwl-9Qa'WM52!f.2':?. ':'Iufw-M1P1-':AH5g,:w,':g!iv'.qw-9.1VrfLf.'Q.ti..'g--3-Avywfmr-Qaiqgrw-Mxvff'21-gmcgwwg-151wmv431'--,p'?-93,3-gg.M-.gfwr-5-Sw -Frw -rjywli,uf3,,z.-f,gHiE:Qif-f--36,3-59.v qxfzpgigg-gga,ff.2,q5F+n wwf'-fs'g::,'L-rw,-g,q19'Qgzv ,W-z,:f ug ,fa-1 - 1.. -,Jw .1 w ,x f, f '5ftPJ- 'f H'-X.,w:m,w.v-.-'-wfeivg-iw-.Miw 1'--, m-gX,ff'v-its-N9' W-Wx'za,Imp-wxef.1,-.-'Qff-.z.-W'-1152.f21?.x-.ww-sbuvgffxfw.-'Qgyv-ff-:fly-,w1g,-any-Q,www.-A f+f,ve-Wi-Qqm-v.-ff wr -5'-'ww--riff.My--vyggf1if3'ewe-Wbg-w-Qgfqfi f - 4 fu' -J'-1, -- ws JA J :,'-ff ww-.-wpffc'--f,Q -, H-1 .f-:M---1 ..f -ww5- ww-fr.-f'Jf:',u 1-.-wk-J-.Mir---',qu--.-af-1--fflXa-V.--Eg-1 ,u-na.m5f-gary'fnma--gm-1-Wrm,-,wfn-vc-Eggfn,-.f7ws,,Qfy wg., W1w5y4,9w-,fyg-H'-, 9.-,f-w'S1Z,:.:s:-vwgfm-'1.41-?,'S'i1,..,-117-V g1.,m:g,J,15nqIi'fv1, vqignffzkffqva f.,w,x,g-w,fm.4',,v-rin-1-Q I2 I5 :1 'V '-K'-9 ff 221'-1h-v--' W' .' iff. ff:-1 'ff-'1' XMI- fx :rm-A-':z.-' .' xg,',-W1-L'-fe-'La uw-14- 2-S'kf 1 .1 www .+.-wr-'fy?2L'14A',:513: -595515:-K-fe-:T-1:2lie-4 '-'1'f.-.'-e'0LwS.fcwfffwQvfxff fir-fEh iWfwTfMv5.H3Q-.:'c-1,v4flw:L2s'Q'fsaff-vi:-''fszimflw - lf.-few ff 'A-efgyi-wlzw-:f.i gilwikn.QCiwwQtj'f'v,129g:,miJfWa:-e,v5g:sr'dim1' f .-.Ma 7. r,,,w-U .3 3, ' 1 - , 15-g 1,3 Q-1,'-pw, r,-f ?,f-, in gn, --f fy ww-24fflgg,3.4.,,fw5,1,5j.-f2- H?L:x,x-nz'-15..1:--,3,74ygf'15?:,-9g:3,,.y ',1,f,n, 531mf-,9ziig1.vf.'g.,1fg!gfg.w,M4'1w-:Z.vyiigsgq-pw.:-'Si?Wf :W-23 Q' wgff:f4gQA+'I'?g'461f5qm -4f4vJ1J'3?,fggf---465-7355-'Hiz,:-1,4 rig-gffrwr-5-1 -1 -A 31' f+efG9u.,3?M54g?,.-gp:-Mg.-1- ,yW.5f,3vi t. , , ,M 1- . ,, , - ,w . f, .4 ,, .AQ f : mmf-,,-.,fqf.1,x,.-'41-W 1 -4-.9-My-..-4---,uf--li v 395,-ep,.-Q--Wi-,um.,,f3--,J tx--555,5 mx-M,a,,-.3141 .-,f,,-upf-,.q-,y.-,,mmg.4,-m,-neg,3mJ5x5--c,fxp,--4. ww- 3r,vg,.f,,b.x,u --I -5 -- 3- ' -13 4 1- - ' H- 1.-1. 'P-'f'l Y- f -wp-.-N' wix-www-aw'- wr: '99 4,1 1-'-Rr. Swim- -fri-'ig'-1'-w 'HZ--1,-fx.,--rw::',fr-fiwfwif-gm .m-f,-,7:-f-v-- KM-Q,f.'Sg.4fs-rqfzppiu-.EM -fm,-W-.fg,,'-2-. :W we-.-2-ws' -533, 4--iw, - - - f-fmnsfqefw .--:Q -.,-mn,,.w5-aw-,yr ,KN .eu:--w- -W Sf-fy-L,-,W jvfw- aff-MWWiqf2g,f,f3 .Q,f11,Az g V -. ,N L -,yy ,- .-5, - 1-yy f-Q.,-':,x,'.-K .-cf -5,-gp,,--A-my-,fq 3, p,.g-5--53,113 -M-'.:w.,z:, 7,-',.,I,f:f .1-fq.L..'w Ly. --mt ,r-px'-fg -5.3-15,fe,:,w.wE2L4w5,111-pf, my-,V-fu-B-' -af-ff-Mflfx-f-Q,w:f'5w?1'2mW.:e1N i'2wggQw2fgf'?'+-MJ?-Qm,.2.5,-432.f.:,q,Q?5w-f3, Qbg, 541 ,-,P--is-2-1,ffgv' gif-,we'Ms5g,:,:2-4 wif, --5.'Mw:',fi: ' 1 '- -, f J:5Qf'f3'. ,f':wf'gr:::f:'.-1 9Ff14Ww-.ff'W'Wfwlgimdml'-wir--isW1f4vim-2,11-4f1-'51,11-f+2ifgw2.-fivfffmw-w'-,-3fAgaLMfm-5-'fixwg3x+.Q:ps--Q.',H.,5--wi'1fe?v Q1--25151-s-'fyigxcwlfgwfm-LL-53251233 bgpffkfmvflygfwzliiqfrQyqbff-xfizqmffzkmff'wi pw 1- M- --1i',W.'g: W - av- uf'-f'fY'Z'-swlf-Mr-'fw.-nw.-1,-w-.w 1''lf-W.-1,-.-'-1-'fa,w1H'-N, Vfw:---5-vw,W5--ffma-Q44411-'ff-1.yu-,Q. -4-,'f1,V,m:--2--ffi.-Wf-ffwfawpmffJH.ffM-.x'r1.1vf-f-:yn-1:-'ww.-f--wvfg2s.:r'me1mw.,:w -kfwg:mqYw-w--awfxmp-5w,s'fTf,fqv-vwf-1-1Qffp,Q.,gvf, wg--,-iwif,-11:-H,-'J-v 'f7?f1-f,6v I.-, .-mf if-1-f mv- -. 1,-,vf ' uf W-' ' W. 3-1-'fl'wf.'f 'Z' w'm.'x--.' '---'ww-'vi'-1-, WN 2 f 31' W -wi -.fi1f,1- -I ef-wif' ,g-'wmv--Q,-ff--: z3 V 14 fy- fp.: -l-54--4'vfj2f,., 'ww q'.'wfw.1,ge'!g fi: ?gfM,wrjf.- f?f9g-'13,-wwf.--5 gg:-15,m-:ggi-, ,yM.v4'f.? w,,aygs-f'4g9'M-L 5swgge-','.:-wgzgxwlgw-w.5,,m r1,.f,glev wxg9f,':fv:,n3wIfdmyzw' I 4 1- -ff-,U My-Q HX- .,,e 'f wff'f',.f- X- -M-1 11, I-.-f-M' 1' ,-. , ,- -A .4--LM f .- f-4,,,4-,n fy ,--,mf-., - ,-.G V - 3 -.1 -W-, My -,4-- wk wa, -gflqma-1, flaw-.,a--www--mf yy- f f,-gl I-f --iw .4 - --s, -fm ,- - . 1--.. , ,f f, - .--. 1 Mn. -, Q-' ff -- -,v----,-.,y,fn,Xe--- ',.U-f-,QM ,, -., r.-,, -.vu ,.---Jaw'-.1-, ff,-ww -.-:Mhz--'-, .M5.i43,,1-.U ,,.f'--,ref-, X-1'f1a,n-Q,b-,vu--W4-Af HUA my Kwwvwwfvzwsx-vf,rwff ,-9v-1fy,- H?:,w1,,,Q'f- m 24-1. V'Q-mf,--itww.,-fwn-..,---45m-,Q12 . f 1 I- ff ,n-,.'-'AM N .f 'X 'i7'.T:T 'l.',u.. 9 ff, +I. 'vi-lf.VITU-'j'f'f f !,J I'L-fjl+i1 '-f,-'-1fY'iirli-w1.vfQ'ff'z-9:51iixiff''MFY-3 51f1'W'.'3 fHTF-if -,1-svffwilga-,H -i f-r- 1-1-w,,f-:-J '-G9-.H '-11 -'ifl fzw iwfwfwi -.Qui gg--?'i'w-fifdffi 'I '3,- WWA- 6P-w?'1 mils Jxwiwif ffL5..7,--Swpfnfl-H5iLgH2-'wqffffW-H4 1 - , wx 9 , -1 -'gf ,wg -I -1 J ,-4,-qv'.f:A.-'ws ,sf-3, ff: z-f:fA:wwi,f--1.1-X,z:.-mf -Q 4 -ww1,-1-.mf',,.,1ffm,,'1fzvg.f5ga,g-1 fi-1: m-ze-fw-mv,-f,.1 fri:-,-L'-1'Qs-Wew-2fvf.5f:1ma,- wir, Wit-511' 1-Haw 'Q fl-MP' -2-.2-IS?-fffwzmivw ' , , -A - ff- , . wg,--f 'rf ff fi- f 4,-ff?-, 2,-:QQ -1 .ry ffm 5--ff was --1-f -5?L-P?-iffg-sfs.:f5'v-11,w I-ff-Q2 figfaifcflfgef-iifl 'fv.1ffnz-e-Qf:s,- ff zakhgf ,- A X- Ms,-,:.?., -, 1 +--e-fb.. -ww:-f, .-.mp-2 151.3 ff--:g 19-. ,yg,-ff-,,f,, .mfg--W1 g-,2--gfQ5-,yf1z,mge:,325.1-7.52,-L:s21f.,v55q:.:fQ-swf..-wffV?v --tfqghfg-,f-vggfn,xfgw:mm4-ifff,fx',m?i?ff'?5:n-.zxfgg-513-9-fagirwswX-vruw-..:w-,,--fri zf,'35mi?E,:c!gf'f2,,pgm?rf5-,ffwffv-m+5ff I-.Ui - lf :..,-j- 'ga---,a'g 1 lj-,X-,'5'.,,3 5 4 -5 gt.. 3. ,'j,f--,fy 11.2 - ,. -1.5--q '1'.H2-1'-,pig-g3'1,:iu 'Hgh212,:Hi-H.pie-will-r532,-Mg-Y. .71-,J Q-mid'-.f.gQy:+if - A-ifmg-,'?3-9',gqfgwpfim Jfv-'off'-' Vg.-w53?,Ik3i?w,2: !f,'f,iSiigS3,Q,x:wgzffjl-A ,'Qu,Q51-SJZJQQM-SfNxyfgvgtf'15:-,i?f?eigg.izQqs ww-Lyv'5f:1 ,- XWQX-5-5','gx,47,yga -- . - -- as - ' --1 J nf- :, 'swf-4' :'w --Q-1 'Y -,ff-,'l'm :'-.'..--f-:- .ww,,f.f:,--Afkcfiw-' -f,H-,P--:f.L -azw'-1m --.'.fi'v-4,-43-1 '--.9--Lawn''-'v-mmf' :f'f-'L'---1-.vii e - sliiffzy-wwfmPW1-ivffffz-M-ivM2211-,f-ffwr-6'95lk-+P--sv-K?--'maffw 29 EJ1E?'4Q'HVi wi .f--um 2 ' ' 3 ' I-'-31 - 4514- 1 , M f '- I-1 ' -J' ' ie- QW 119---+ '--Tif-ui f11,Z-'ml +'::3J -1-S-' 22 z-Wffffi-'f4.'u---fflf-'.:fHf-Vff,-f:'11+1xx-1':ff-4.11'i:4 -Flew:iw iwifv-iq5S'4iv'faciLQf ww :Q-HQ'-iff-w r1'i-vu,-J-gif' wg-v---4--5 f.wk:?wi!.fZ1'--.- 4,15,2e.- :ff1'51'f-'fwv ieff-HQ:6A-122723-zyfw aw '.g-M-gw-J .ig-mt'--w - X v' ul pw -' f xgfQ'lfmlw-ff'1:F-'masf:-'tin:,1f-:1 'fw--u-:l:su---ffff'--vwlffY::r.:-nfiffifrrwif--fs13w4Q'f1i5's -WW-,m':.s:6fLw3amif:4:wef.ii2-ff--mm:1Qf.f?ff2-121'rvfrfwwfwwfe? gf-'SM4 m v .f '-51 '. - 'fx 4 if - n++'-211 A-'- - mf-1 -N ' lg-f - 1 in: 'f fin.,--1 s - X .-,wi vT:?H1'gf!.f1.':?wg'-mm-,31-M-za'-'1-mime -ei-Mm:isa-:V--fx' r-.Q-'.zw-gf:-L6'Qfwgifra--1Q'fw5Mwf'mgyf?mef! ' 1. X ' ' 1? 'f1 3. f YW ' 7 f K -if - Y57'-A' IETF'51231574'2f2?3L- ws?1?-Y:'f.5-If-1!l3?Zfi:31'-'f'l'2 i4f? ?? f ' . ,, ' - 1- ' ,X -'yi -f --551 , L , ., j inf.-' .x'i?i'1V:H,5i,l,fg-:frgi ff:-1,:,s,g.-abr?-g.L?wg:9 f M -+A 4. ' - -A wr J 1. 2' If 4 of 45'L':4QC- J-wiv '- ,1ff.y,m.1LA'1m 'T-,fw1w:'2 , '-s'.1f'-:view W. www'--'ffl fn 'g-.nw -. -wr-ws-51--w ' - A -f e..- 1 11,4 L -,- wb fy.. - fda - -' . .,.fX.,'X -Q , -u .v,-- fffzr. 'f W , .f ,,-f-.Nw 'rf ...1 .nk-.f wt f.,w'-'fl-1-2 - .-:J I-nb-a1,wg..'k mn-,qw eww. Q 1 KM 3-W-'Y1'.,e,:4f3? -5ily-c-?'eiv-.wvfggp,q.1q: :Ma fiNi',.a-,2--fA A ',f,'4u',s:,-: f, nzv,g,y,-'.wf'.-fn '--gn .mf 2-.x' -. ,- ,aw - ,,- K. Q.: --L H J- ,yy ' ff- uf.,f..w,a' Q' ' 7-4 r., lg ,u,:Aw'.,2,., :-1f,'-'fQ:.'X:.' ,+- ,y.,, ,-J, v1.41-if'5.2uwzvfLfi .41 M if-..4,1f 'sLr-w', ,:r:f,'g'r.- 'Fw W' if-4-13,W-Qlfw-aw'a,2'1P-L4 'wv:s-2114-1',fwfffw'Y.:r,m1'fn-:swf-:Nur 1 ' X 1 ' - - 01 ' ' I-:tif 'H' ff,-5--1.-A 1.3 MH: -Liiwf-V51's'A'ff-'rv-Wi-if -'H-'11-A-1':-'W-+'f?-Wf' 1 'HH-'ff1fs1?9f.wJ ''.:3a.,w'2-111ffflffi--Efd:,131,gi-rkw-ff?-rf?f!'V?1134i'Wf?1f19W'-Y' liw'2f.qa-!f-9?1g- f53-35,116 if wi1,vr1'-ilaff-wi,-9zufflff-41'-fvxPwr-wi., s- ml -, gp - 3-1-in1-1':Lf-Sf.'Y3,5-r.Eff fly-fpT3f ?f?41Ef1ir-ir?1' fp M x .- mum 3 -' -f V 'sf 'H - ,A V I 'iff -,.m, '1'fj'fi:- rigliiiafg, if-'i -.K'-.:f,31x.'2A'i, 'ig-9.-2 'i1'y4:93i-.,.w1y:r5, f Q -Q-f3'gfg2.,,'f7:i.fw1v s igsf:-f-'--srl mpg- -, mlm, -ffa1'Q 5-f-5-12-'Sf :H-.zryfzHxfigwix2'-11'?gw1.Q2,f-gwgjgrg-fm im'-Y-5 4fg'7? f 51' us' p-1-7 -. L .': k'1,?f.'-x ,, 1i1,wf:f:-- 1ivnpgzl-,Qa11-:fmg1::-g.- V ' 1 :K , ,Q v ,-4,-2 .f 'LL-:iff z'1'g1i1f.'ff 2-'mfr n-ffU',fl -1f':Qy-..-fL,:s.fgff-13-59,if-4-feas,,5gggf,f , -f-125, gi-tg-ffm'eg-.f2,w-2-ngwugiqz-1:5411745--Qmv-ifxgfggg.was-M53-Qg5Hg3sQf-fyegg.3isx5gxw5'?w5g-gcggiivfgiigig?,5Qz2iHgf?QQ5qfQ:y:gg1J1-'gi'fH-3252525gftzgzmwiblq-Fegfiwg' 1, -' ,, , V -' ,i Nw' V 5-LT: , F Q-1 : 1, 1-f -Q nal--15 ziifq-,.--.-295'-11, Q:-1: fi'AX2f,.f V EP-v-f:L,f,1,'-'xiii -55:5 Fb,n',1W5,iR-'i.? AFV-'ai?5l.:L,if55731151fntffwfsw-,L-1LSfS wifbyvfgf' --1-fi-6':Lag,fWeE,fZg,P'kWsy3lQGeEwa f'2lIH-3515-5 WW-11'-flfkf-1'm11f,Li'Zr'?,.?:mg wi- 3 ,,- ' M-Z -1,6--' A --,uf-f. u, ', 4 f ., f-'-- .- ff Cr- w Q - f B. '1,U1'm. ffgx V',Jfi4?i,'-A295 '1 i-in-ew. f,1:,f,.g' gf-EX A- Qgpyfif -ff1fF-1,-cm-519-u-9'wgfbwPM'ffm-wr'-11,14-iffwi-gs'miie:igqp, 5-ww-91Mwfiwffiefifkavr- -swf!W-,w-vsgi,-3 -X15-51.13-YVWA-1'9 nl-mfg-wigffiqfffyg- :iv-4-.ge-fm igg - e f' 7. , . -, ' . ,M , ,lf -f.- -Q - , --Q - --vw ., .-.. I-f.-,.,x W., -,-A-1.1f,,:.i,vvf .,d':w-sf f-ww.-.--I4--M--f,--s-g,.wH-gym,1--g,r3L,if,M,,:,1,,w,,vw-.,gf-KJFA,-m1uf.a,QM-?x,,g.gg..-1 --,li--.-U,.ww-,,,i.qf,-,-,4.-,.,-iw,.g-11,5-,M-,.q,,,-.f,,Ag,1.4',i in-.ew w. , -,,.g ' -1 fr--In fx 'W V .. ff' . ww: . 4 -, gf, '-'ff-,ax .,:g:,xx 'A'gg,,f,f-:,gfX'Y2Ci'T---Mei, ,Q wmv?-r 3 -5-, fm,-A-,ffy-- ggg Lqi5ri47,f 3112-gf1P151ff'QU,i':2iigg wi-wigmy'A52rwaf--N, :?gf--QW-11'wzfmgwu--,,-Amr-Mkfbfiwzfufm2'ig.f'4fg-f--'1whiz 1'-:1fwh'f+il2Ifv'X :v,giw1fQwEw:?f'm A gym ' -J. -- , if ff-wisp . -if A-:J fin -Q 1--A-ii'-M'fiw vii-u +f-,iff-'We-----'14'-eg-2f'.f-'Zwff iefwf M-121vsv w5zf1vff14'flZff5'-Sfv,-G'-:gh.zwlimisgfgsmwzfQW'-Q-P,, 1,-5,324f-Swk-Www-'Iikv-'i1:n,x1-Q--M'-5,5-'mi ' 'f -. f .p- -, 1.1 , .s-14: N A 5-rv 9425.--r--m,I:.3,ge4-:Mia ww-'Z' ,':-mae,-'52 T'J ,-z-Q'-Eh-,Qw'v--':'2 Fil?-ffm1':-rf-,M4f.:5f'f25qf-?4mIf.:-4- ff.lwfi--Y'xf'1-WSWfffl'rf -vfkzii-V54-LffF'f1 HQ :J -Kamiaigpf.AY5:'.'g--mm 3, - Qi-5. A , gf . ,pf W ' A .- g,g-I,-f,,-Wg- g,-1,5-1 f3,wqW,,,,,fQ,-gi5fQ,gmq'- J -V Y ' . v ' 1-I ,- +.- -'L 'Aw -, V r- fa- 'Q-wlaff'fs-V1-sz fwiffwv L' . ' 5 ww .fv Y-2: Q. -, .-11125-,i-. 2 P2-ff-wi--w g::f?f V 1, , ww ' . ' , X -, r 1' M: 1' -- 141- -1 ,. 1 -glza Q mt- ug-5-af-gg:-f-fi',l-.ig,,-f,Qg'f,:-ggi--1.r-g V N , ' 5 .-'Ural 'A M- ff: ' r- WH-12.1 vi-?? '?f'f1Ti.'-32i1ff'V:-5155?1E,3f f F7395-.f Tian:-'-'Jkffiii'SHS--3:ii4 1f3 '5.VWW-2?-ifi-3-i'fL1A7 1 Q- 3 'ii -X - '- A 'lf-5 P .iw ,, ., fi- V Q lkff-ff? WI i3?a1f1m-WMfr?-M1132 f ' - '. Mai A --ff A f, - ' f f mix. , V 1 fsi-ij:-:QQ 21-5e5452.55 f13i.isL121,i-mi-ii 13 ' 3 M1f' A13 -1 , . 1?Q'f,'f1l'fQf' 5 ' fiif-5:f- f:,1g.i-I fi i?-f.-:W - --fiflxf9-5?e?'-555542 ffviiiif 11 ' - - . 'ffw ' .' V' A 4''wfvs-f'fif? -25-45Q? -in-'l-5z3?.f '-'-A -1ff: rf1:2y51i'+Pxf5.'A2-11?4YmF1 -'?i5?ff'ifEY-1'fif-Ifsff? xiii! X , , X -, ' Q 4 ' -S.. ' 511' ,--K ' M9151-ygzfJ..a-:Ag-1 'lAf,'-Ziffmy s f-gzw .-'-537'--3:1-'JFX-'3'vs:-M-.':3.wfxst,--inf-5-,.-z-1,wa.'fqvffte' T!s:g5:,-:yr ----,fgfbsfiqsf-yi!-9, f - , ,- ' my , ' 15: A fi'--wi-,-2 -wi-iff-v,g-Wg?PT,u-Ss v.l'f'?L21.a:-,,-ggi: ?k,,gfr.,:m+,,.1n,?1f5HLV'x-ei-,1,f,gf--if ,A lp-vgpgkl, A : f ' , L , ,- 3,1323 aff-L -'lp Zvi-N C 1,-,gg -feii 2'f-pr,,f,3e,jg-- -3,5 -Qsfiivff1-.25's-ijfwiji-,'1?g.':if'N''5vi:'y-155 ',A1 'f:-rv .,,f1fif-::'gy.,w 'H': '-Wi:-5 9. - , , '-Qui f, iii.:-1'3f '-'w'-,rig-11-g'1 ,N-.f.,r-A-iiff! ,f.L13v :i'5'-'ff1 -?f24f:',ifv-AJ-Sf-Tia 18?fl5.-E-Wf-f1f'fr:'WH,f-F.T-ww' Uv-'fzfw 2,4-,f'SLmx ' 1 L--f, J V ' . V ' J f -3 f- ' fnfff. Ta fy:-. --.M'3.'. Q, srla-1--.ffvw Tfvf-1n's'i--1' '15 -fvfigfg-115wWT- 53-:5 '1.11w5.-fi ' ,H ', 7 f , V ' .J ',,,-E-,- V- --.R 5,1 uc Q-fp,-, ,Z -1,1 Z '6'u.1, V 'a'-'.-3--.13-'Q' 5 f:'.1.v, '- wil .',f. ' 7,2151 EE' H 'Sw' ,J-,iv my- ,fx '1 :'-vi. L -'2.1'S7,f'w'H11 '-, . 'H V- '- -, ' ' ' V ,. f -.n ,- ma- f., H- ,,-f,f.f.-KM .1 1-' -'Q--.,--X-.X,,.1 4 -fr-.1 1,:-.M -.f -.s-f---11s:,11f.-Ly mfs- -,1-'prl-f-'-1: mf i -f HV- . , .x A . .- A..-,gr ., ,- ,L .--, s -. -,-vm,--, ,ff--, Jw- 1 ,--.--N.-Q-, MV- - i 1 f - ' ff V N ' 1, W. f ly ,iay-11- -:A!x,?.w'X mfg-Qafw 111 :3,L--.Ce1iC'zi-Z,:' fm 4,51-5. 'jggx-S11555'-'g'fLyg:'2 -gg,-.f-'Jizz-11 1i4ff?':l:.5-'5e,.fwi wfpi-- --fMf'f21W. .f.i,g1x 1 1 ' .Af '. , -' , W N- f ' Q-:Jr-11. v-1--11 S1141-,-'1?Q92fff,-rf.iw:i'--ff:.Aii'-,r-is,v'.11le's,l-A-'Swv5'-'fgw,-H3lg,.-A3za-'Mfg-4-eQ-1.',A1-,if-uuffff'3pfxf?gf:'pg-1ffq-,:zff,,'5ff y'Ef1:.Yjf' .1 ni . - 'r , f n - A -gt, ,W iff-wie!-14'-,-x TJ- 11- uf '-111'-,...x3-1-V--,w-ffm-.gjw:11.ff,- ff'v':':'m1.i-MW'-',-4:--.w-sl:-agef,x,-4-Wmy xvfre.'-,mf,-xg:-5-,,:.,-N-. ' 1-:wg ,fry-v,,gn5.gS.11-'Q 'gf J H 1 -- - --,ff ,,f.... V ff V -:M-.-. . V A-,-2'--.f,,g-'r-. -. -Y.,ek,-.,,,-1,,,.f-.-':,.v.m-Acm, -111,2-9-weA-,,L,...f ww z-,f f.,-.---,f-.- ',--f--,-ff--,f,-L ,Q-ry--uf-,--,-M ...5-,,1-v 1 V - I - , V . ' gf, f -f fy 'Vw --v1,-L.ff.1--X-,iff 'Q 4v,f'-:wi--'.f-Tl ,--yf,: ' -1,-sf-,',---q-,.'.1fwfy-.e ,1--1-:img 'me-5-.f-.-ff:-A tff-:fy - :1- M X-1,.,'4:' aww -1 wg-1 -g, - - f K fu ' a 'V '- 13 4- ,iff fc,-1-k'g,,-, -5,1114-: V, 5-gf 1,-1.-5-f Mfqwqzaifhqi 'f -z, 'i.1we,,129L.fg2'i-' 'ffef QYJ.-1? f Y' -' r-JY-iw ' Q - f-vcd 'f QL- - , 1, Mvvv--me' 5-'T -,--1-11-'g.ggn-' -.-iw sf' ,,'- Of 'f-Fqffg-1fin.2wfi-'-vfrr.i'-fssmsgv mgggfx' -Q H- , rw:- Q g ,lf k V g , .xg ,-.--1-fifs.':v:.'1c' 1,3-.g'v'L '--1.-3,5 5,1 +:,,,.-'-imp-1 g-ig 35 f' -' 57f Lfm,,9:ai-.1-z ,:?:wg,:3,-f'3',1rfam,-v ' ll -ggi? -, L U 3 ,A L- ,. ,y 1 , ,A-sv.-.Q im-fy,,L,-Lxiqxw-,gf 2-,W fy, 1 ,-w.ng'.:0-f gff-gl-.gg,:,,y-3wg,-gifyw-X'MQ:--Qs hyQu,., ,::Q,Q g-9.5-,-A , f' .Q -gf ,g,,,:1g-,sry --gf-N , SH W wx ' ' ,-L .' 1 1'fM'1-ww , ff-fm. 14 J -M.,-L 'px 'M-www?,if-'.,,-:M---.-:'a..,.-up: an 3 p, ,ww-5-:,.1 fl , ' :ez '- f ff' 'f ' S ft' f ' Y -fr'.'-:-rQi-ff' f fzf 1- J-,L-5? Q-vias'--vw:-21 --WEL-f 'k's,J21iin',f'f'f1-,1.1af1?:f5G-infgif?5?4i:f1'f-ffm-aff,1,-.Q:'!'1f v'vx'.-4'as M-,ffl-. in-,fe '+L-'? -W A 3 ' X' 1- -- p, 5-4-'- uf,f1fg5v:qwjfff-rg-f 'U-.gg1'v-'ilk i,4'5'a-ifff. F524 ,-Qyfy-.'f::,,m , - A ' ' X ' m 4-11.1. -Aww1-,WMClvlfz-.lfS,vf :-w'f'.':f-H2--flWai,-ffff-V, nzfza:---5 fqnfm, L-'i11x1 z-in '- ,awNz -'s! :T'QHf4v--vi'2,--1-A-wf Z-as-, :wif-f ,ff 'fu -S1 Tv- ,, -1'-X W -L , ' ,- ' z , K ' ' 1 Ev 2 4'12'.-L 14t'Fxfiwi'J-'S-E4E'i:'gf3'-: '- ,zJ:'-W5::'?Jfe'1 'ffj .zi5 s-- 42--53-ndfif.---3-f1C:':f Yxilc'-5 f2, 'i'Qj.1'Qllfir-CW:'f'yJ?+5+-2152f',1wyGPi?n:iw-5,sS,,,y,','fA.gffrr--Sm. 'wg-'J1'4 -11-19. f' ij-'? f '5 R '31-3 . .3 5. '-3: kfff' 2.12 51.2-93- 7f Qif'!i'5'.-C '53-ff X i'f',ti ,Cz-Jvjiff 1 53113251-f1.TISHF fi Xi-,FEI52f y'QV31ff4i:,?.QEEQI'-'Qififf-4- l40l 5. Sm--' kttn 1- - ,, f J .1 Qi S . , 3-K-,vw , 1 M g vzif-JMiggg-fffi'wil-?f:X5g.Q,g.1,2pffgmf-1--ys,'iL'fiIs-:La-:gg-gii-QQ,-:1,,'q 51343,-:1Lsg: 1p'g:.-W-F,1f:1fg.igH:fg5zgg'J'QQ-if-1 fr A-H1,' - 'A ' ' f Q '- - ' ' -1-up s fx' , ,iff , J. , , , -.1-QL-.-C 1 :'J'-'S-'nut Siu-.ifri '1:U,fIfwf5'-LT2291:-'42i--4-.wiifkwi-'H -ffin.ESME?-iml.----Q-ifwifi-'.:'.H3.-R141,Qf'TEAily:-iffiiiis-'fif-'Q X ':f.7i1'f',zk v V 3.1 , M. ' f , M x , ,y f. , , - ,g , Q.-'V v A ,4. mf- W 9-32-'ffgxv-114 5-,,14.g3g1 y,3f.m':6'-,dui-1,:..w wr,ii-92:Mi2-gr,z2a5-gYf5-P'-- '.w-:'f.q-P.-H3551-K Qi.:fLcyfi-1'f..,ff31g4':jN'-f1.-Sm!-,-FJ-1'-F'-1 xy'-W , . X w 'rw' . ww,-r -1-1 -K 1g,.- 1 0 'Q-s'-?f1fH'iXNi' i,'P--WL 'w-f1z'f'ifff?Mwi?lffH'-XELW-h.''. ffiimjv'-ew3 Wd-1:eymxff-.wage-s-.E--' as,':Hg--'P':g,-1X-+r:.t,f iff?-Pxzfm Q?1':':--ff 'f V - M 151.3 f' iff- f , .Q-H, ,.--A, , . -11-11-,--e-1-5.-ip'V+- ,fi- -, ,VMI,y7'1k':3?Wf'.5x-i'15-NDN-vAF'1-A 'w5 Q-:f'1g',gfF-P:'1-iii-f-ij-3512,ew-.mg-XYmfif-ifipivg-pf-if-fix'7:.f'M.1-?l,1-:fix5ggysggfqfw-gf?54:44-Sz,if-ixwfff,-a.',-,-93.5 -3-:-pg-z.qf-ii-,- -, ff 5 ' 1 - . - A V -: . f V . ,:1g.-.fu-.gf 1 fi!-'-, 1 -fx-sw:-:,s . f. 2-1--,f1:v---H fm ' fa'ffffw-L-af-vars'-1rf-:war-if-ifxr-5mp'f4'f -ulfff1-:mmisJfiwliiew'eff-zfwnfak-HHS ff- -- - ,H - Y 5 A., '. - -rw --' 'QM 'c -i' -N- AM 1:1-u-45 f -K :-1g,f,:- avi, ik .-.-f-1.f','2 'V - mxf--adm:,-'-W.:r'-nav ir--.-:ff-was wrfgx.,,-f5Q1.H.-'mm-, ff :fav f,f-.',5gw:f1-Lvsgyqfeiif'-,'5-'--'fR.g:axk,f.m,-.7-f,1A1:1gLL :35?1Qgf.iQ'1+.113255:-my-gfQ'gsgg,w-X-Q5-'wif-H,-1-4:is-ypqm.+,'w1-ag X rj-'uf - 111 -9,1-.12'.fY'ffr3:'f+f' 'I+' M'f':1'.-t SI?g -'f-fr,---Sd-TL--In 'f f.ffi-i.,:-AM w g-kfvgqq1-,vggijsfg::w:5,?,5:2,J,yg,:'f222,23-Q5f:x21y3Q-Qggiffggg-2,-46.3ggqiifagggxguklg-fig-51-3Q-,xjflik-112-QWsjgfgQg,,gr3,qVeqgfaiggigyfgii-zgvfzyffizgg-5,kg:5gEfm4?-Rayy2iE:2:3si25P,'f'4.eQamiifi-dllii -- 4- Q . 1 ' bfi, :JH ffl N : Y!+ r',m1'Q-sw-.1f:1W 1-LM-,wi-2ffe':f-L'+,z1x'.f-' mv'f--'l-21-'fx-11:fImf:21 1, , ' ' ' -, A -3- f a-wx: 4 4- ' 12-:f:.-fw-f2- .'- -gg--A--21-fm ff' - , f. V zu - wr, - ffm' 'ft .1 :main -as ' P-.--1-'gff-wig:w5fwi,1f:'1f3:-f-21.ff1'gQ.'Jf5Zf:gA214224-23531psig?'fgggl-1rf:S?f-ifgaNig5f-rim.-5'-Q wi-,f:':x1fgL'3ff':wah rj V 'f ',C 'm'-1' 4 -19.1, - '- -, -pw -J-L.,--Q-.eLfyr 1'-g.,,:1i.1.,X--fi4533-'G,S51 :Q,rif.??,-5,2-vm.:2-irirnzfejw9.Lq.-M211-:QQ a2:1-ff,,.,'-wf1:-1g,--'-:aaa-if .fir-.if,..eia5'v-gm-,Qfifw-35'-Whl5 1.f-1-ww' up -,, 'x -1 f i:-H X 11 , -W2 'g-'gf -fyirwz ' up-1: 5- wgm-,gfgigfg-jg iwW,-ggQ--5-3f,zpg'5fgi1-:gf-,mfswf.-'m.k,' 54.5, ,M-,ui '-,fS?:YL-22fA:xg.,3'-L51FW.-fig vi Q-3?--iw:-X 1-,.9?f.:a,,mir''H'wil'-w5'9 f-R'f?1'6i1'fiffiff' ' , ,, , - 5- , 5 - A g. . , r -- ,::, L ,y V -5 ,M .-:5-,1-,gn mf - L-wg,-.,j.3 ,, -,.. -, ,J 2 37519-5ff.2:1,gL.4.g5:g,,,ugfig,-HJrf -1ft.,-5-.i5,:,-1,5-Kr '14-'L:3fg'gy,-1 ,, ff: a, --,,g-- f1-.-,1-,n- fm- s3,-.vJf:,,-,- fy-,B ,xvgfm - L- -, W- Wg, 2,5 sv 7 fi-I ' - X -iffzgf-'gff-iHf1j-Liz!Q-ig?-, as-., v ,. --,Q-,ffcf-,e,'j'l,:f.ff -MN'-11 -iriffwzx qfgrigif 'Q' ' 'K '21 - ' xf V .'- ' '-1 'MV 'f ',wfl f '-fy .5 Slip ' 1' - wif ' ' 'L.ff7f4'x -55' -' f '-'f'u'f-3 1 Q f fIL-'L:'LJ.,f,C -EGM' fu: 'NNI 2 L-47111 UE -nulx.df:-L3'1-'7?'. ,'- I 'w-3':z 35g' ,k,1-Wir!--i54fx144f Y-Zi! U 'Leif' 'U' IW' ,-.flue ' 3494225 -51 -'vii-if-f1'W9ai'fAQ +4.'Q'6'-f 'W5ff-Z- M ' -- -J: f' -- Q., 54 J L. ' 'X fn , -V V 'Q ,, if- 21. V Wu' --.5 -:' f'1'l1J 1 ':1-' , iff!-' -1- wr -'ft 4-'f 7f'.f fliiff-e -,':1::n: ,ggw,fEQf1:- Mp-g--,-,,-'z' '-vfnfvzfibff--Sw'13-by-.-gw'f,Q'.MMffm'-,1..w-'.'vi,' Qagpyvgf-Y-pg:-5'Q5'fT3-f H:1affL-f.w-g5.11,- A if x , 1 fl f, ff- ip- :Q A - 'f21,--gg-z2f 1 yu' ' N, 375, 5' ---ff.. 7.9-i.-pw . -,-fx.--wg 5qw'age'rf-FL-f,f,f:w1'w4fzLQw13542,-,--vagffsfmmgfmy 'L ,5 , K 1 'Ti nf-4 .- mmf Ziyi -4 -, ,ifaf-I 25239 fagxfigr- ' 2LJ2fL'?Jy?'i'77hi?5Xfffi'f 41'-2.5.5,-fgi-1?4 lgfrli 5-g1Qf?i1iMff1:'B1-2?Wf21'Mf'M,551-ii?QKl1i?1'?-F251'2y54'LE?--Mfiiiiiii'Jiriff 5. 'Q' ' UV'-,ex 1 221: n-f,2:-tm.-,ria 'r-'1-5 6 f-. .i'r2f2-fe--:ff-fum-f,:2s:f.f3-W Sw' f v,-,-.w '. 'X 111- .wp'4.11,,-,--1--,g-.mff-.Spa H mf,'1n'f.mg---,wns-,-L--0 -.1-1'?5--as-agvg fwwfy-meggQw.zw:.'ig-1-1:8254av-33255-sQ,f-xvff-,QQ-.mfgnwfasif-W13541112-twicp'f?1e,sfwiz-3f, ffAv?'-':gf,4f3--es,fmf:Lf-Q23-fr'2fei2:'j's'--1-jf-' L ' , V , .2 .V f.-zu 1, f ,X -1 V .e-.rv 1 -2- ' -N ,vifag--,v4 , ' , ww :1 4 .,.,', . 1.1fnw-:f:,-1g'z- -:: ,-:px 1, 1-fy'yfrq'-':,3gr'J5-if 'L-4g'1i,:f1: 4-,'.g,e.,fkr1-3 k 3-fl-WFHL wif, 13 wg 1 HF H ' ' ' -5 ?g-f-pg y,.'gjpf 7 1 5, ,, 5i'.f1b:,-xi-jik-1.-lg Q ' i- 'V 2 :ifff:.1'SQ'fefq--g,ef, .- ' EWQ5Tijfzn-Iii -HE:ffl-1-if A ' u '1 ff 1-1 :ff-'J If if Qffhf-'J-'14 '1.+-e11'ffQL-.f-ppfff'22.5w-f?'fFr -rT'N1g1-'-'-f.iQas -5f,bX2'i-Qwi-9: '9:zQf34P',lifm f x1 +'-pf?-' 1 f - Jf' ff' f ,225 ,. -- --E-'sa am-xv -fm: ' we?-1ag, f,e.f:,fs:fggf5:25Qw 12155 'ff' x --'fsy'-,J 'fy f ,--1-ffiw jan -Di' gf::5,,i--Lp, .1 5125?-?:2g-Q z?23??F?MiS 'f2g H ' 'Y -La P:1eg3'T' zf - 'f-5112 36 , ' ' 1 'L f fx:-'1g-li- ' '.s.'g1i-fg.: q , , L -. 31'-1 :'1-15135-1,.'j.,fl':-,': z M, -,gfs -:- f.,'1,q-:ui--,-,.g,q., iQ.y,':g .2gA' ,lf 1gy,g5m:,g:34-e1g,3g,- S2-.1, -,?.:.yzf.zffg,zg-A-fy .'yrig:---Ya',fy.,a1i3n4 -5 QL- :fa-gr. wrvw- i , . -nf f ,f-,ff Lf- f A . .. 5 f,-4 13.-f--,-1 f, V --,,,,,,----.-v--'- .,,-.4igf,g.,..if-,Q-LM cn:-,Q-.., ffn,-Q-me,-.1,,,-f-.-.-.,,.V4,f,,-vq.,f-Q.,-,fi-f.,a,f2:+,7-,gi f,-,M,1,f51,,A-.i -l,:-,,-,-Q.--.,.q.Egm gwm aww , - . ., I .xw,-ev- 1 WM' - ,:' :fa-'fr'-m-,L-, -,Ln-!4,w :QA -gms-A-1-ff1zf:'1 -dm-ewlfml---,-1-uH-Qy?,-,pw-igmfyw---M,J-mix?-,ssl-f11--ff--Qfw'-6:65111-11'm-'4Xw'm--f,:,fx-,is-fs,-1-z:fgfmik-www.:,f-2-y-f1-'-,'fw-zsqwcf ,n . - ' , : ,f -5' -' ' 2 'fi-:1.u f'-4-A H .w,-:,f- fd ,B 1- ,v fr.-r--if.,-N '-mm,--. A fzf.mf-1.af:+2-'W-wefwfw:fw:ri'ffvtH:s::-':-wg-wi'f?'f-:f,':W9-1 , 4 w - f, M , . ,, f .4 ,.w ,.f- Q 1,f-inf---,1 f' ,, . ,H-. -N1-ka,,-vgws ,. -Q--Q ,5 ,,x.f, wi--:,1,--J ,.fq.2-.wuz-,,-11,f:.w-f-1'f.L-.-wwaiwlW-: X1f,brewwfffl-Wfrm 33-rw-.i-.4 'f's-1-frf:ff'A,,.,1-, --f-,sgflie-,yew , . 1 - '4 -' V f-- , + -My x I, 5 A --,1.f. -fnfxmx I-'qw 4, 1. fm af, --A mga-flyy, l-if 5, '-ryfgpufmf,.ffgrlf:,,1w-3-ff-x4--fa-,If2'Q'-'Wlwl-f 2--wf':f2'.-5-4 -jew-gfggx'-1 Q-vgfgv-iygfjza .fyw.-2:,a5-,.,y-rl-.WA -,mg-4 f. 'f ' .'-- ,-..-H' ,, ,a --If-,s'-,m - .1 --19, fu- jk,-f,.,p kf,p',:fp-ev ,---,-3, ,y 'kin-15 ffm.:-QL, -1'-'.'7,,,fg L-v 411 -f,---1-1S9 f,i2j1,s'f.2-3qw-fg1,'Q:?f: e4f'g':f:f:r.'-if my-3 rf-ff ws mf'-w-V33-v2.'i-,11.-Ain1-1 ' Q ' , f 'fi-,, , Iii' Q5 A .ff-Elffi -- fu-1':2f'. in f if--,,.14f,1 -f' 1 -J. -af , ,Q :fri-fm -- ,!w1n--2--- -A-21.1-g:,f -, 91124 LS-- awp: .:,s,f4i.f,-f,- gy X - , 1 f 1, , , f,'--.-rf,iL7nQfQ-fgwv.-me--CrmiHrf'3ax2:-NYJ-:R-ff--5 f -ww,-4 A . 1 ,'1?-mf-4:4 , g1-gf:-V33 ,?f f.E-11 5- ig'2'sHJ 32,,g .. . -vw. ,-,Quia Li.y1--- - -1 -ar-1--il uyrzr'-fw-y'2f1.41--a -if,-wif-'-q Qi,5--2-,Q--M-5'-awM,aJwfwvvzmza-m-a!:w?2ff,,fix-en'-c,,fsfH1n-Q,--fix'--QSu1w:,':-www5?fqv.:'m--as'gHJi2af4m,-,1-wwf'fm-'we 1 -. . 'f,L'--:,r':1.'- V1 I ff'-1-'civ -',l,':' F ,52F':',4f!A'.'z-2-Diff-Y'NQ?Yf2fYLlg9scf1'. -:f:,i'ff-JM Qiffflirlfiv-PligjiliffZ5??fv5w?i?'GYS5557-H.lv'iii-w3f'I-f:5f1J,fi2Yinfm-fb fi i-WzeiLQBTZZWiff?4lZ71'vPi:if3la'H'5'3 E: vii . . .f , , if ,- ,. , 1 .,--,.-,Q .-, ,, 1 ,n 1 , 1 cms,-f,.-. , ., mf,-W,-,,--i,., ,pg ,W -, -mf ,-'sh-,-f,--1,A--.--A,MMfi .,Q-M.,-bk,-4. ,-M Q. W.- '1, I-f' ,' W A - 'ww .wi-2.f1:X,'x-1 u-f..w'-fx fm 'igfff -.YM-:f',ffwe,Q,wf-w-Q,gJ'fh.:-.iwgs:-fszffwsilgcwmfzb-f--gm-aQ2,f'fwwwwg -1 ., ' we ,, 5- 11 lv ' 1, H - , L -f'f ,5 . 5: 1, Xi:-iw-!L:.5-13,,f-p fy- mfg, -Q. fi,s.'?y2,w-4:3-41 : If f':.- -,zgfs,5.H'-5?Ls,fe:ii?-,'.v-wg. Q'Mgiiieui.,7ff5'f.v5.g53 if ,-3155-f,2,1.gggf,-rg,dgxgzy ,9-:g,34M5,M,x4,gg5 5335135-1--3535-a1f5,,y'g:LxV . 1 MV .ww Sv ff ', fx- 9'-'i!1'.f,:'h ' 19 brwiit,- , wx f '-'3'k,f.,,.,fl-ff:-T4-',g1f5ggsi,g:',,- 6--X 1'Ej'f4'U:-Eiqziq z'-T5-:,?1ft,.f.,g-gb,-,li E rsW'fiQQ?.-,rm 555536-figg4'ya?nXgJ5f.,1,zgJ,-14Ky 3p1fg'Q-2f..xSze2- 3fF1xgfry5'f-uma ,,fig5p1gi1?w'f!fE?'E55c-2,5164-'29q5ggj,J.aa -e.30,fgQq'ri2fgg, :V-tu15,4JT.?g Y wt' -1'-f ' .w1,x.,m f ' Q -gg Q-.5-gf U 5: VH:gf,.-pw0514rfyyg?KQ.-js,-Hfi,-f-. LSi.fx-,3,,:4zx?f'fff,V 3151,gy:,'4--Q,qwiw-fa--fi,'-'if7251? ?wfQf':fw-fm,-5641235,1-Af-ifirfff-255 xi--ff1f'?vm-max.-.M1g1cgAjggw:Q,,ijfmgf--,-3-34--,1,'w:',11e:-iii? , , - ,N K , , '-ww, ,en - - M Y, :Q , A M . ,J , - . A -V, Q ,. f..7 1 Bw is-, ,f-M-.,,A L--:f,fgM.E,- -in wi- f,-1ff4.m,e. fs-4,,'fw,g-M-1-b.-.max--21im.'nf-,ai.ww-ggik.-'gZ.3,'fQ-lib,-awvfz-.QF12-'- qz':4:f,?wQG mw-'-iw5'sFfi,2'1-- 51-JW -rfiw '?5S1:v?1-Af-rffgkiwe -' , --, , ,-' Q :WY -,A , mf --,q-xyf'.3,1.f.--'-N 3-i '-ri-Spf.,-,q'y,yewi.1,,.Q,a,,,r-mir, Mei,-Q,Lv-,-vygugy-:vw-mgzq.v-,fffgwgfkgm:LZ-,Q-'59, A-g,,:1fJv-1 -,w,mg,.--esas .-fm-.V-,,1,f-,fs3Lf5w,.p1,-f,2g'x-,,g-,wggw54 Q-mfg-wvgf-gfqff. -fsfqg:-mg,--Er f. f . f -ww wmv' fin., -,: x 21 -1 'x v mf.:-, 1-'N 'f1,a -IMI'-A'5fm'Q 1' my'f'ifs'2-ff'-WSI?+2-e J1-i'.-wi-lviwf,1'-fd?-fxww' 33 -im-'sffi-- SW ss 'F '-:WJWSN-i1'4L 4 -i'Q--.-'ww-1, f?-x'M '-2 f'-vt K . U- ' air, -N f - -f . - - 2 K A Q--',-ga?-11ff'. riff bl'--f if:f'?2'f.:.-fy iz-izi -31:33 53:24 5Hs:ww',4,,,5l' ,sv 2im,aXi,.,,-gym? -g: i1-,1-fr: M 'www ,H 5 px ' 5:21 -11-Q . .- . 152- ., i-w.'fs'::xf-- f-pix 'S z'-if-,Liv :sw-5,,eggz-W-Q: gz5fe'fm::Q?'-Lai:v3f:w2,z-A,,-p QVFQQ3-if-g,M'gf1 if . , - x A , Q 3 .q:251'.,::,,- -4 Lcwg.-wgzpf -,1,:::m gud--1'w,,w.-1l1',-,Q-5,2s,:.f,x-,fwff----mm-'VJ MY:-as-I-21..swvp-Hi'-1-,fini-f1s2f:'ef???'1f:,F-5127.firkwaf'76-ffwiigwvw,':f3W,1?fehFfifiN1LM'f2kw-452 -15i:-S1w,:-.::g1--:- Q ., , K- J . ', 1. , --' V, -f -,,nK,-,ff-3,--1:37. -:u -,L X . - .- ., . ,,-7-f,,.,,Lw K1--pq L,-gk-:-,YL gmqgwg.M-1-,nywg-g--.if,. .,wy:.g,v,1r- ,qwg-A-,gfygk -Q-33,1-gA,35!11,,n,39i:,4.-1, -, gmc, 3,,1yw-,-,'.,g,.:X-,,- 9 gi,-?,,.v-rfsgg-1 11gy,-3m,fu-fffr-,,f.--, - 2-.Urn-ff ,- ,- ,1 -f-, S - 5 ,ag--Wx, -ff H ,X 2. ., y J-kf.M91?i- ff .,q1,Qf-'1sf.wgm-,- 1' gif:-' ' if' mf:-A-,p-g,':g25,i--f 3.445-:twffrwakgg m:-,2zmw:I55f-gg-ffzrqlwm-Mg5:,,g.f,g5fSqgyffiw ,fire 5- ya, f-N-5.ww-mmyf-. 'A ,- -, ',, -5 fk '14 f f - -mf 'X . . wmr'.Sf---':,fW'-1mwjgG-,iff '-2-12-'fwxi 55.mf'w- qgwf-fsliw w1'2v'7e,11-Xcwqw-L bf-1 f 2-M1-rfafdisi .1,?1ai5,-ww 1-v-'4r4'n,1,ffga'a'flw., -ww-azL'1' f'W:rmf-:MQ-29's-,qgawf, rein' sm 5 -1 -- .1 -A Am..-1. W .- N- -fv Hi- 1--E. .. -Q H1 -f -,-A l-,, -ng. L+- ,-,fa-Mk, lm- lf ., r--4,--.--,w- .W -vg,-Q,f,f-vgw 4: sm. -,,-.-fSw:mfQ,gsM.x1e.-,- ,Q W Xgwaf--,www--Q-5ff--QM G vw:--.,-,Ffs1,Ga--W ww-za -sw -.Mus-.M-wi.mf-.1-A--MQ- -wg- ' ' -1, -fx - ' 'ld 1 f fu H- ff 11. f1..iQ+-C-:L - -v,:., Ew.aw!-wg -, W-,L W , ff-I -1,1-:ff 1-.'aw- -nffgasrli'Qpdewspf-2'fL.-M15 'D m4yfm.3t:-1rw:fg.:Q'H wbkakww- -if 4-'af 1Y5f:w12L ,liinylwvp.gfsg2s,y-l,W's5:v1-im:.D':A- 'ffm zfwwvnl-F-W Tzwv,-sv H- .K X ,- ' ' '- wr f- vw , 1 .fff -- A -, 7 - A ' Q A W -iz'--.1 -:L '--af f ,-3 ,Mfr-af v-H,-Q-'ff-rr---,1'. MtfTQ:'aA,1.+1f?f1-vf- 42-U-isp,-df H-----1-4f,.:v'f?E-QE:-ff vw-fr'-X 'v'1fZw:,' :agv7fS'vf2g'QffwM, ff,Q '-'w.LrQ,'1-1-5--v,r-,ffl W2 --' 11 ukfj 5w?IQ.-an-w'5L'vww -,L ., 1 s - -, . --- f Q-. X - , ,t , 4- fp. A 1- A1 t ,-, .r-fu f .,m.--W.-Y qw,-,xx.--f--M11 -, ffm-M -,Mg4J-,w-,y-mr- q,,-a1f-new-..-4-KH -4gEX.,g,rfg..5+5g,f, ww .-,Q-M-E-f,,,Qg4A?w-YL -Qx,-gway-64? ,gfmsz mag ,w,Qf,,,J,,i-.-gg -,W , ,- 9 X uw ' K gg -- 4 u --7 wr gi-.-:g1,aw, wx-,x:f..LY .,1--Q wifi frf Hs 1-'.,w-wr Iwtri-w.'.+1W55.-'im fMQf Q:-,-,ffm-3-My-,qsma-eyffqng-gfQ, 5 ,mi5i'ag,a3f.fv54,mip-zxam, aw-fHz'1f:r,-aff,-y Y M.:-g,g'v,Q-.QV-5-5.5Q---'fgqv.-e,-gyfxffwfM12--f,,i -x f . ' -, ' A Q-PV 'wt'2--aff - ff:-ff --4fggiiafynwfgg1g,Jrg-vgfwm -aQggw,g- W., 5 -- 'f n- , 1 5 if Y. - , -- Q ' u ' , - ' .-ig- -1 , 1 L fe. I,-J. nf, 'ffnfdl13-'-,.'1.'f,ff -ff -kuwi.As1, 1-.f-.ew,f2-1--'g-,'-g-:fungiV-was -a3,7,vQwiPsf-.2?-fm-iw-ww:!Q-Srwftywf -uf' H- w, .rr 1 Aff' -H: Pfw-ffhwviw v-lk-1,w fXfr:-fs' -ik-w5'fQfi2pH2Wiz-1iuxmgwerf1:aywef'y1fzQif-'-gf-wfffmaafwz'-'ff 'wimsgfwhsfw'-'WBt'3f?655?5Q:'4MfSewfmwfwf-TLrHf'1Q3w fv'-Ref: 'e+sf'z?i1 ,,..-,1 , 4,,-,-L-sy J AY- -- s- f . m-,'+5L.,,g',- gfefig-.-2--14,-, W-, Q'-4-1, .ff--.-1,-im ,X 4-45,1g,Qf,-f---M,-2-1-w,gi-ms-,,f1-E4-Am1:-,,-.fiw sw -1'Qgi41x,,ffm -Q-'-fm-:3gf:,3,-mm5v53 2 -,f'igN'fwwif :i?1Q2,m.p-59? f wvwfi'-Mgr. --12'?a.'H,ww' tw , . X iw X ' --wf'-f --fm V -4 -Y.--iw.--Q.-.-P'-f-1'-'-fm-f4..f--,nf-wx 'ft--::,.1,,yv'M X ,--'ww fe-W-2- 1-1--f,:',:-Sw f- ,:m5'5:--..-fv'wff.-akvfm -- , 'Rm W' hw f- A :ww f, ,-Mg, K,-ff, - ,W mf ff-ww --f5y,:1-,'-sip.-'Q A e- - ,- , ,Q , J- 1 --1 Q 1, ,, W, , , I- -F, xv 2f.f,4,,-,,-W-QQ ,W-,-.,,,f aff-,M--.,.Q,,1+----ff,Qff-1,--w.Q--alcmd,-Q---1--1-g.f :ri-ne'-.-vw-1.-,ffwas-v --'ff-,mslffggfggfglf-fff4:5-we-meg nm?-mgkfxgi mime-fit Q3-fsmfv-f1ff.' -, V: ' ,- 5: , X f ' ff ':----f,1AU, t-,ff-!,7f,p::,,-mg:img, yz-pf-Qgfzkam swf- ,i',y,g'fm -.71-g--,figx ,wwgf:1,.ff5--,z,w,'--.eg :,,-fw.41.gmtKgiwiivwvgiiwmgrsiyx ,feff?--a.,'LggxaffmyfgL:'4:p-f-fQg1'L-wuwwg - A52:15e:gmQ,Ni4xz1?-fE:.+9 3-,gry K-fgraffk---Q.,-fgE.S5 awe,-,f,9e??fL:fxr,-.-51 w + XXXXX 1- X - X -, -f X -,af--Xz n -sm.: k fs - .- ,--T--ww 'H 'W 1.-Wa f -- :-,e.Qm.:- mf,-f'r.,w- -' ,4 --,awzwx 1--' 3-Q-,f,---J. 217- iq ,L vm , W ,f,Qp,.,f, ,--?-,W ., 2 - x ' -' -f, was -. -12 f ,- ,1 , , . . .R-4.,.,,.,-le, K-WU. ,- ,-,f H ,M ,H-2- ,, N , wp,,w,..-,,:-,--Am 1.3,-g -,gQ,4j,'. .51-,de --,em Jgw yvf'-.1 Mynf. ,VJ--f,-MM:-vf-:-,':-A,..m-y-3- wg? vw,yr-ff.-,-..-if-K.-J,-ey,W.,.4lya,i4-,yi-5-fin,-,Q yi.1...z,-..W,, J.-.,p,ff-5,g..f.,y.--,f.4,g,,,,,.g , . f XX . Y , . I ,: . : ,g ,A f.. 1: K 1: swan, xgw, 4,-,x ,gg k,5w,:,,,, -M-W--. -N f:-,1Wr,5. ',,,,-Q-L-,I-Le,-.gf--, Q- u-gx,-,m.w,,-LA,.:g,s35,u,,5,1g5d QL?-,,,-,,-.N-,mv 5.-4M,,,,JH If,f,,3ip,5,M,5,:,5W,?J,N,M-fW,,t,,x5q,-4,g3W5.Ly.,:gpk,g1.U,M3f,gg.,.,:,-,wgg ,. X, -5 f .. A, , -1--, ww li- '-'54 fy- .M -- --W -1f-1 af X 1 - W f ,ff-4, M- .Q Q-,,.,..,-.-Wgyda,-1' -2-.fm---rf--1.mx-'Q-:' sa- www-um:,frf'1-E1,---L-fawff-1'-K-Q:-ff:-f -we 1?--fr-f.-LH--,L'bA1eg-' mf-?m':w'-WA-4 Jw.,ffx5,-Hgar-N,.aY--ffm-+1f---cl-vww-'a--'-ff.-amy' . -f, Q 2 . . - ' ., -1 X- ' 1 -fm., 1 . -'c -- ' f' 1. .vw-1 m'wGm-- ,f ----,-,N y54,.,,-ML-,,,,4 U,-b,.m.1.-A fmiwgk,--' .xfygj-fgfvsfw ,Q,:-urn, ,W-.,..,-.f--,-2Q.,-A-,.:1,,,-MMM W.- .' N ', . 4 r' -- ::w,:--wwffi -lm -. ': fs 'f WJ. -1-: 5 'f gf- 2,.-Saw--'-f'?vf':mvwgfft1-lin,-wr'-:'5,'2w.f-Sa.ff,p-ri-Lmiu .-1.n-w:w:-whim:',-m7rg:y.a 1x-'- Asia-efyak. .v ikg5Qvfg:1rfwx 'g' -afafifm-1', gf?-af. grsmfif gfifvf-:X-'x4hf2+ f'wifeXpa,-fx-iiiWTG1 -w1f'iI f L , 5, rv. ,A ..-I-:-1'.y, P .1 ,-Y,.1-ey-.,,:-'-'sw.gag, ,,px-1,1-5',.y,:,tfg..:gg,x',1-X,rjy,L5h,g,.-,-M,.V-.3,4,f-,.1-gig,-,f-Lfgqgggmxig:,'a,f4.,gjfpg5i1,1164-'55-4-5-553'-ifgg'gmkggfjpgrfwgg-gzggirg13 yy?2,gg,,1?nf-5:.w.3?g,g55,H',n?15,,-iffgggnggf-ge5?Q,YTg3 .- - ., V X -- X - , --,L -- A - f- -f ,.-f-,--wA.,W-,f, , -.Q-ska,-J,, 'N-wa: L,-,M W-mf-,xr -,. K- -A ,T sm.m-,- -1-mn zf Tw .- fem -,Jr---3.1 MMA . 4 - ws- ' - ? . X ' ., f . 'f jf ff -- ,,':f1S A 'f X if-4 f' -W' gi-,-My-3 nf 'gk-viazffwgMs? w1-'-1-J-'wff-1 -Qmy-vfvxg-f191:3g5,fQgN:1'aevjlmyffaixg-S2-5 ,5:i'aq:5:+iwvf':!5iPrjYi?:i avA:1f112ei?,gkQ21g11m'S:4Q5wg5Q in-6 '-fv,w.' v -. -.f J 1 .-a-.-,1,-fr'-.iw--g'g',:11, f2f1g M r.v',f-mvw 1,-nag ,f-.,4 1. -:af,-hav,-g.Sz,f,,ff.1f, : r:'ffx'.fg4iQ-w1f,w'w'a 1,-q3-:g,,- :sg-4,,,r,:-fe.-.gf,fp-,-' ' 'Sag-if-L ws' -,u--ff-w 1ff1: HM xl 2,-yff fi A ,mv . ,- XX f 4 . X , fu xv f f M1 ff'-fy.: 4 fX',f'7a--' Q., 1. , .nl rf.-sw. . -Q fw--115 1--A-7'- 1'f-2- ,-5-iw-Wx-wa -1- - 41-:'-..-sf? ef-A: v-'9a'in, Mf'Ziir,.-Q'.wf7: MSW,-, 'ax-fav.-ffQ-Qzwm ,-AA, W? 1' 1'-Tw ' ' ' - ' ,s - 1 -A Fr'-ffwai if-3'jg2bX' ifwzlfs- Q- l-.'-1-Me,-fz,-zQQfi:,f-Stall-1 vi X ,J-ww ly' , 1-' A+ :z-fi-W1 .' :if ,s f fwm211:w-f-'-f,- rf- 111 1-'meter -Q--me-1'iff.1,,mi nm---w: a-vw 1-:sw M ev-4 Ve v4fvx-M3 Q11--fQ...12 we wr fm-4f2Q?wfp1-u I . L. 1 ., 41 -w,,1.,-v-s,,,,-,- --Ah -, f -.,,- -f,,f-fig., -,.-ww -,ca--uf win, gm, ,y- -ij.,-,-,,-.Q W, ,..,,g k,,,,-- .tg ,.xpf,+,,Hf.- gwewhm-s-4-1 if , ,,fQ,,MI.r,,-. 5, QL.,-.-k,!.,,L,, my 1, V,-W, ,-M, . 1 , f , - X L, , ,-,f , 1 ,,,,, , , -,-', 1, A --Q.-5. ,p,:,,,vg,,,f-.--,q,k,,1, -V'-,kimx Q-:WA .W bu, ,:S,'-N-,JSM 1,?'-W-M M-,.L5,-9,345-..w,,,?r,4,-e,,,,gM-,,-Q , f -:wwf fi,.,.-W-ffw-W---M34 .yfjyv-wg.-fqxx wfkhfffgg- w.wy,1w-f- ,SE- : X w ' , -' - ' f A 4-ft . A --I pa-. - -., -gi :Wff-1-Ka'-f',+L5N,:-i-.:',?11-f- w911.fm'ff:-wr-animnlfiliw,An-H,-'v ',Q-fm'f A?-4:-1:3.,y'--.-ssfwfgl-!,y,,--my -9,351-.tgffskzwmgf iw. F-fi,15f1yivMgf: :E:1f?34,L:1..,yf?-z'Xmiff'if?f.-M-1'i'g2h,2Q3f 5f-fwzqif-i?,x,'Wsfv?,ffiW5Xf7:s'4-migiiri,''mf pf s ,rff X, A -fr ,ff 1' We up 1 im'fi3 f- -rv - '-'-h'Vi'Qn',FEu , zi.e.p:.:,e,,-f-,J-'.-'A-'gif-In35412,-5-11' -fizfm-5-,N:,231-f -ggf.:f:w345,,.4433,a:f,-.--5:53Q:Lm,Zfwq4'L-J+:Q2fgif -2 Y-gi-ZG4ggivYiMywlfYw,,52-R::ir,,f LQ?-4f f'5-2'-gin -Pitiwiv f-quwgfgm-glfif' 1 X - ,. ,A ,. ,-1 5,54 , ,, six- gi,-gw-,1:f.,b2f3,gf'r,X-5-1,-,-g2,f-f 'Qgzgg'-:4pMf.:w-'fm5--Sq.-fiwgvgfgy :swimfvm-sqfgcqff-2-lswfgiqsg-5212-9X'gj.5,gwm9js1--ix,a-gqq-y,Q4ig5'emf,d-Zl? 5-- f- kiwi.-21-asm-ram, , , .. 1.w,f,'..',Q,., f .41-if ,J Qugc- --ff5'-Yfwwf'xc-mi- -'i1ea',5.'f''M:iv-.-:QQZS-fa's,wq-5:5 --QQ-iw-vQg,wQ5-fgwagi,-sa?w4f:iw'f-f-ffkifeff-'rfsw-fax: 425, ' :wi ' . WN- ' -era:-1v1e3wEff'1g?S2:-,W-'19-frm, ,w4ff'w?qsf g.gv'-wi-afwwl va . X . X. W- 1 V-1':'-:,--.emu H1--H -Lffl Q n-:af fmfffl W, .mf -nv: nw' ws'--.-2. 4, -' X . W --:wxr99:.-,:fx4wfw:-az-'z-'fmwnbg-M wiwg-mf?-fn--f-fx-mg 'qv ,,-Ma, ,y-AgMMfE7n5,m1,f X .1ffg,ew5.-,'-2-'7q5,,,aS1..N2Qw +-,Emp N l ,, , J. , -V ml.,-, 5 ,,,4,--,m,,,.,- f,,,,,.,-,,,-- A ,Q x.-gf.,,,Q--fJ,w,1?-5,'.-t.,--,Mir-ffl?-44,.e.g-Ag-Wy?-p+,mf.f,-qg,,g.+g:i ,,f,-1,y-,if.L,-,gg mm--L-,fm M.-v,fwwz3.fm-F35 -4-, -ff, ,. ,mf 1 ,, Q-w,Q-asm-vw-2. Ll ,MQ-1-qgf,,,-,W. X ',. --.Q K f - -A ', 1 1 f' Q - 1 mf- , 1,,.. .Q--fe--Gg.,..c'f, px, -A+ --.-J--. wx-mf'w-:Q-'.'w1w-. mv -avi M 'J -211'-U 54.1, mrsiif Wm- :M-F , 14Qf'54 ' 'MM' mm' 3'11:2QZ2-.--ff' ,ffl . 'f HQ-, A A-'+ ' .. -k '- A A H ' --' 4' fffbly'V-f4 : f 'x:'.L 'TY Y.. wVm.k'Tl-'!C- V '-'i ?'1 11 .TG-V'?5'-',1 M55 iw' A' -2 3 kg, 'f7'kik'.-if--'.Q3W' f,,'-'l'1'l75LJ Y ,'3'1 F'b - H4 'SH f'l3w?TF.fT'.'z'7Z-'M 47 'J A 'Ml M' 1,1 : ' li? , T' I J i' Z fb -'YT L 9' x ffv' W' ' Y , f S - Q pin , wifflff-, Q ' 5 1-WfaCr1,:f.f-an2,f 51 EM-x!w-.fw,,!'ri,v-ff-45,was-V-2'ua'3-X'-,.W,-wwf-Hf'-I-Bw'If2r?'wifl-'-ffl'-Aw UH? ff'-5 -YW? -':f1 1f 91:1 .X 'wwzspf 'W-W. 'fv'-wwl 1'M'Z1K3f, wzffn-wc He?-I-' 4-P X Ysf , -' wf ,, gf 3115- ,r': 's' my : --,iff 1,1-W.,-215-ggi-my -J-2,z:'g:g'-in.-,SY-r1v'ffJF'ff-J.-giqfgg-f-:fQ,gy.wg q,:,fs:v,',-70f'4g'.:: mfs,1'.w'1-,fT 5- , mf? f-Q -wif'-'sk-. f f 5 fi?'W'-lg --3554-15. m-S+-56-1ef,d-wfJ'w Mas- 9? .X '-MY' f f , ' - ' - - . r .- A 9 ,f . f-:uwff1:1165af-wflrfmffzwiwrx-2,,.-szzauf-w-www-.rr---rw-W-2W:-1-was-.5-af ff-1:-2-3 .J 52 -f -fi-'aw' S q-1 K V W wwf rvwyx - - -, - - - X ' 1, pn A mx--.fy Q f 4 m,:-,,w,-'fff..f-W '. 1. g,',f1.i-fu, Vm.q1aL-fe,1,,1:9-M,-fx,,,,-:,4gw-L,-K .v,1w,m-X 1.5-4 ,1?k.,.gN- -wg X ,. -. W. , - ..-WSL x ,Q - my f,,,,Qz3- AQ, -M--, -H - yi- X, Y I . -Tg W if-1 -If .4 -v-mf -f-,ma ,115--'JW-L 11' 217 ---56:-'ff--,f-mv'-,S?'-,'hE' Jw,HM-fSf:?v- -W1':- w2,0'k'-ffwv-.w Wgfxtxghwr,-1,3:-'f'fx3if:'x'-,xv-1-M-W-,asifgg-. fudifngzglf- v.g'mk4 -, -g W rv '- G 1 M .g- ' .5 '-n 2 -.-A f 2-EEL. mx IQ qt I FTW! -'M' - ' 'U-15,5 + f,-fbf-ffw-fmQL: v-'fPff'ww2w2-fw-f-f':4ff'M.-m:.4--We.42 f m f' 42: ' TV 3'-1 Pls '- M-Q -iii 'A' w . WWW ,-N . g f Q gwnxfw v - ff'ff-P ,'.Hi1Jfr A ,.---Hilv-.-'11-.-'vf:fLf'f--mi:-2 -Mm-rflzrfiq 1:5212 3 ' ,--, - ----' f.'irf5 Mn Y' -3 1:1 3-f 'wwf' EPR .F- --AQ 1-,M -.1 ---.'41-....w-.MA-Q----14:4v'fm4-,ma-If-sf--axQE--L-+:.,V--1-w.:.w -f-542.-.ww .-ya-zmaxwf :v.q,g---.-www -- uf,-852394-. fn! is:-,yin -QQM -.1 Zin-' -W - 1 'N--fi - F? 41- fa my X 1' -vvwfvrwl na- 91- if -if -1 f . N f 3-,-M f-JA' 'M w an --C A Q ,rf Q1-Ak-1-if 1- , , f .M--,,g.4,,,5-.gg-,,,:rw-FV-Q,,f-ifik,-527.-,,,ff1-A-Q26-g,f6515 X 1L,i--W-A ,QV Cfuvfn.ffV--,x.'-.'5f4 ',1:-1-fqfwaw . -4:-.QA.-,,-v-MQW --wr fwf , - Qi. 'sb' s mn g f Mig- my -2 -JH Www f ' ' WU- Wm .R by , 5-wwf, . :W .. -, ' , .. ,. - .- ,,, ,,,,,x-:M-f ---,.,,,.m-:,f,.------..-. iq. ., E .. N',f,,.,-QB-wig1,3-.,Q.Hfl-5Qwa.Yv,..a.-.9 '..f,qf wwf-wfwizqgq-5515-1 wg-Sfiw f 521, Q, .. 'r if,-V -. Mr' fgfxf. -Q, K -ww 1-1 -fail P 1 qw , ,. v X mf. 69335 X- af- f -f i1.1f--'r f-L :ff.'v?::,?1?-22vw-1'fw, :i7ff' fab--ks-pgl--.x.ggae,-yy,ig-1i'5m9F' 'aww-ryigg:iw15giw,+wa fggs3Qfg55w?Qr+L,-.Q'r-,' 195552 gn, w g.-S, 4,.. -f-,jf-pw WF-K if ,,-g, H 4, vi '-'H-. J- 3 - 153- -,1,B3ggj5y5nf32gYgg,,g. .- ' ,' ,Q -If-M 1 - f V - fqbiyggg ,5w, ' i, j1i 4 .yffgwl-.ff,-- .fx- am f-,1,2.1:,Lv,-mgffigw -ffpjw-'-may-vvp,,wLvA y fQ,fq.1fg-Wim 1.1-i1a1Le:,1wK.11w--.3,.-Awliz'-J1-gm --M11Qfw'z,J,,21 A-ztfmwx' Q .-4,5-g'.',t.f -, .. M- 5 I ' A , yy -,.:- w o. , '- . IM?-'sf , , :-.w g 5 '- nag- k, ,,,.. X k -, Lf, . g , - ' -2, -4 4 -'u - N- 1:'?.q-1-- ' f J ,. -,-'R , 4., wr:-,-,g-:,,-:-,fwg.,---Wap1,1 ,,,..,f,-.L--w.v--4.Qx,,Q. ,4:--b..-.3--.-Q- --,-Mg-3---, 45-,-'fi 7. .-A-w,v-3-A-' new-Jw ,--wa--vxiwgggy f.. ff? FQ- Ei,-, Q A v - . .H v . -, f - 0 ' - ,s 4 gg -Q rf ':, - -Y A. 5 , , R ,X . 1 1- q w ,gm-kez , MJ , wwf, if-'w.ws'r-'11-n.c.'.A'f,i .f'-wr.--GX?-, Wnfaf--:- fav:-- S-,-fm ,ww !'l-,--gm ww--'--, - -- 1' .-A-Kzms.-.fs-JY .,xff-ww fl, A 2 4 ' A' ' - Q2 1 5' 'Q W qs'f-i,?ff- A -1 in .-1's1,iV-M f we I- fwpu- , v-,f--,,gf,,- , -,U,---zu.f.--'---:1--:w-a-z3--ti'4 -7m,.,,f1f-Ja.-:Ziw.---yafzzv,-1-1+ 'gf ..f.--cwmflksy-'-w-,-i,m,w,:- 3.1-wi'-4'ww,-fx-w5fv-.xL'.--fxwwwrwf W. P -2 :wa -A ' -mph -3 . 1 fv xz--' www?-Msf -- E 3492. Wzfufmf-Q0--aw-' my 'vffff-: :,':y1,1-.- - 1 - ' 2-r -Y 'v-,,--1--' ':':w:AGv1e-1 feiffm-a'.f--Q-mlrQfH3'wf .f2aiM5e.w'i-'5ri:-'APM-iwQ1-ww -wif1524wwx-Vivefhgfwe:mfSfwiqgff-isEmf.fQ'fS,--iw-.fffgwv fywwggi-5 A 9, ' 'wh-,'We-ia 1, mf asf' i Q -5? 2215 W' Q' v-59212535551 W2f'?A?gfw1'i I,-, -3-,-Q.-. g, -r-ev 1, 1-f.'-,,,1:15-eg,-1.-':,,.eWflL,-ig-,M -f-,wrfa'-q2,Qz1-Q-:yfe1-2-vw:.'-.Lf-ff-WA.--fa-:,gx1,gkf,fv.sn-mf:fry- ics'-gem wiq-wG5j-- -.a-'in--wwqg---Huff.-ff fR-Qymu ga 'lZfv?yE-.- ,s neg? -we 'f - f .af-Wei ix.-sg .. H ah- ,'tF1w .-if-1,-f gf' 23 I 'Fl.L!-'-.'- -.Y--wrwge H-1M:1'.iiff,'-liGf Y1 f1fEi:L 11!---tg..-Wil-?Sf55.:2aZ':29Zi.kgL.--1-1-fM5if'1?'Ei542'f-'U-d'gv-fiflaw-:wwwfT'i5q3,iQgQ'f:,f22Y2'fR7,f'?d3?fW3f5k 5i'fT?5'if'?J5?3'6,f1'15'-f'?Yg'W 2: 'Fl' 'H y' fi 'Yr - W1 MQ ff -41'-ff-'ff52-W5 'G 1 ,M , fm v ,,Qfg1'r. 5 r f,g-s.,-..--,gC,.-1-'pg wfcfgfzfyi-,rh-:fe-'im.nf,-gypg,-.1f-rye.-1i,,7-:1w,gggafQ.--,A?-'Efs1Q,,feEz-x4g:-9,,ffgh,1ig1',w.--:P-3-3-AligngfQ'w.g-1?-w'rf-,M .xg-1 Kmiif- 2, .- Zig?-.wv 92:1 Wxfxgfaspx P -fi' A E 1 .-Q 9 Wy. ' -xg,-. 'mf +:mqrv'g-:W glifxexgisg' : 1 -f mf..--, f V fy-..,..-A ,- Wm- f: .-,QQ-.:,-f 4 W -I 1- 1 -,w fr-t-:lit-wlfsfzvs.iwfw-my 2-yu-v!y,ff'ffy!m,,f'a-'sf-hs MY- K'-S - f, 'qs N 352'-WY -ff -'U J ff - , . A ' 1-,ggi 'm Q myialllizf ,QW A Q,-W 3, , xx ,, X-.-, .Aix -1 ,,-- '.m,V-w..,4',4 f,f,ii,.,,.,, 'Q,-,.f-Q,-1515-g -,,k.-u.e3-u..y,,-A, 1,-5--eg ,F-,,,.im,-t,-,Mg-,fn,-gn iQ,'Ssg5g1,1 ,,,,-g,wn.- J,-.W-mf, -gg--MW , - .,-,ww Pam . Q Q 1- QU 1:-,fzfyf QW ew new ,, . ,.5,5w- J ,p .343 ,.-,,,,!,5g,,? ,Q,-W-3.-, W -- w 'Nr --U '- '-4 4- w:1'1 w- '- 4'3, v'.?. -,211 - - w-'af.:,-fy f'-.aw 3.-v ':-.52 9 :Y me wa.-sf--rw wiv:-1 MH?-,ru1'fA?v wiiilffw silk-'mf 'm M '12.vS,f'f,-1 -'kgff T' -w -, ,Q-Kr. :ii-f ff 'w x QL:-in - A- 'A Af f 245 5. ---231 w'L'9'53glUf, M- N--wzmf ' '-:.f-me Iefzp- V' Q1- We' ,w -1 . ,-- Jw- We- - f' fwmme- W-,Q--bwwwi,-,-.--,--2-gf 1------ww .4.-Q-5,fik-W---n-.-Q,-q-.--2,,v-f.- WF:-wgw-yffgq-. n wa- -IIMVQ 1-me -. -- -455' -fx -'fa uwfqf- --f M-Q-..,-f,-, 1-fg--g-,Mf-'-:,L-,Wme-,-PM'fm,W,Qe,-.fm,f-.-gfwm-pw-1,:az'-y-Q---A--sf: .ww-,ag's.-f-1--wsfwf M132-1:-':wEw.LLf.-'vg2s'-cx3,- Y ww-,-.M ri W. - , 4?afv-, fp - ww Q 5.5v 71if 4555-,,-,Nw L -133-mme-xi' -Qg,,w,-gi4fasr1- - 1' - nw -2 4.-an .-7, -,P--' ,f xl-5:-'ffwww-gs-:f1MK-,gR-.-f-f,--uf'-Q:-gamma,M,--wfwR.w-415:-91 -, --43.2-,.W--am:-,,4-sink A--wh.--'H mmf- . w w - M , ,Q .fish wen ' V M- ffrwwv L5 ,,w-.ugh - 1,1 W,,-- W . -. 1-ml'-Q 1 -.,f,,,'1 ,my nf-W,-.1W.-fJ..gb.-Q,-,,-.,,:-,W1-I4-J,,r4,.-ra-.neva-gg-.-mfg'-.qw'V--mgmxf,w-ff--+4-lfi,-Q'-fr-.Q-afgm-51'.---ew- ,mm -if-ei 5, 3156 Qmfy .. Q-'tw - - f -fx A- -f -5-4.55, - f . -15 is :E-ciif -A - L, .,,-,,, - -, ,-,1-- -LM --f ,,n-A-,U ,,.., , .,,f,,M.m-H, 11 , Q,-1-ffsigfe,.f1.A-1,1-am M5--,Q g-?gX,.x5,g.qy, -fu Q-cm mgngk-E,, s,mm,.,- , M. 9 , 55 ,QR N fp,- ,, M, hz? , 1 WW, qw . . Q,-Lmysggygg, Mfg, -, -Q 1,-V-,E-,,, 11- -,-'.-0,-,,..' - fic,-.5-,,, -2.-.4.,,s,K-H-. .,-my, ,W 91,4-.L,7w'ef-:LW,ff7 -wfrE5f7i-'4,'.Sp-an x.-f-M-gy,y:f5.--fyftffizfs -.ff--,v,-w-'w9-f2?- Y . , - ,.-3,-.A mf ff,-sq.,-gg, . '-. '- z : 4 Q , -,1:.--- . f , -v .Hamm 'U - ' ,fy-.'gA, -,.-. af , ,rw-qv .3-.--wg.,--,f--Kf5f,1:w:,:1.-1-ing,f'g:,1,,m5- 1-'gm:f'.ws,-za -p :,,az,-Wav-Q-9-ggf -.,gw-,ggpg-.- x,-ss:e-ff-w-J,ax:e'2'5f W -1,-rf:-, -,,5Svrf.g-.y. --+vzfSzx.- -, ,Ip 13. 1 . H - A yin, f NM 1. - rw-sg, .4--. --, ,-1 g,-.Q ,fn , 1 W- +f..f,-- , X. ff- --,-, .- -4 . ..f as My-'--my 1 .-.-'L ,-,-f. If fzm'--qi f.,-x,.,Q-.-,.-ff-f.f,w-V -E-mf-W-A-,-1---J!,w,g-'W Aw- wil- an-rw - .mw.--N - ., ,, , -im. .X-,4 , -wp, ,- -Q , - -.4-fm.-5, .QS wr- V , .4.,ef.,-, fn Q, + W f , 1,--. JW. ,- -,V-L.:-,' 1- .f,.,w, z 1-,,, K, H W,-,.f. ,,.5,A.f-,J--, tw!-',fz-,'2.z2 .-,H P--W Q -ay -mf. mg- A-jf-, -1: ':,.,,-.Vp aw-gy,--w W--rw mm,-A. mm., -. -F.-.mifwq , S , - -. A, of -nm. L ,y-M Mm- v, .-Q-,M fy- .N 4 .gm-,K ., g W.-1'-,en -. , f,-. . .M f - ,-:sw -L - -g , --,. fx. ,H Y. X- f.--,aw--,,.,, -.1 --fm wwf W---'f ww Yshfw- f-,---'m,:w-f---1w- -W--1---W, '+-,sf-if Km--,ww ,rw-Qi Ji f frff f-my f--ww., ff-3,1-y-H--f,,f 4 ,f Xi, fag,-gg-Qgrrf--,9, ..,, ., , Ig--,.,,. - :ia --, -- -v.c4',-yyffvf-,Q-,y5, f- - , V55-.,f,'.fff y .'g.,a,,p,.: V -J. :if 1 W ,,.,f:-w.-w.,f,.- , me-.-1.,w'.a-::g,r2n-,QMQQQQQA.4-,vwQwJw,',f---Lfqr..x----5-1-1, -gs,-1,1 v'91'7J'-g,w,- -M3--sw-X-S q,Q5.-11-min , A-,-1-' - 1 .. mf Mei - ff .. 1, -f., -rw, . ,Wa-.-Q,, ,rf-,,4-,?f,, NEW?----g 9-gf .N , 1. -A f- -wv-, ,wp-, ,w.,f-Q-fwff---0 ,----,-.-,W .---.nw ,- -,, M --ffm mef--Qrf.----wa'---f.K1 'HQ-X-V---2 ff -J+1-Sibw .., -we-, f Jwmeaw mb, Q - PM --, . fx . gm , -A. g .:4.- if 2- A .,- sf - v , H W 1 -. - - ,.--fs'-.f ,- Lt, ,-1 19'-:rw-f+,,,,-1--1..f1--.f frm''ei'J'fN'4i5,.,f1.fn1-1'-M251-13-f'-.'f'-mx4'gfr 594' - 'famigrwbi' vw:--f..-fswbwV2i5g,3wf3f1i'lgg,fx,.,-1fsf5-f- - -'ww f M as. i w,QQfi51S1- w -,um WE ,,-'hy -f,w 1w-. - -F . M. , . ,- ga wk ' 1 --sw 0, M- A-'rw ,Q-'-'mf -,. 'wg -,vf,,g:,y -.3-,mf fin. Q-,os--u4,+v,::f:,2,.-1?--.M G- s,',,,,,-W -1 yiw-fi:f3.HEJ:m 14- ?'ifY5?,c.:. :Wg -.,,f- 'Mgr-x,M5'A wp ' - W' , - 1 4' 1+ :-2-w -wg H ' Y- jf- .Pe -A - - I A 5 ,- -- - - Mi A v ..,f.!f'i-wth nf -if-. 1 I-glfif.-f--il: may--asilwarfkix-SY?lraiflaidifsfm -ks.f32':fE'5ff-:s45x.1v35-+zz:4E'-+e's.-liQL-i-3cmw,Jfb5p ,fi -f- 231 3, - ' - - W2- 153221 ,. .mm ., ,+. m rg - 'Q i' advertising the sum of cooperative effort. the substance of existence for many of us. many of these ads are quite expensive. i know. it's good that merchants have the freedom to show to us to sell to us these things that are produced by us. for ads that are large and for the many more that are small there is within that vast orb of merchandise a tremendous quantity of goods, that so many of us purchase and certainly these are things worthwhile. w',x 1? ' Two Locations For Your Convenience The Best Designs In Flowers TIGUA FLORIST Y A- 2 K Q L if 4 qi-s.:.,pya:p,Q5, ,gas-' 'Wx N Q-.A - f i .5 ' sis Wi? AR' r I ,X ra 5, , VV?-it xv! 'i Xi, 'se X A 'Q 3 Q 'ful' 3 7720-A North Loop Road 772-5503 LEO'S FLORIST 607-A N. Stanton Street Downtown 532-6037 El Paso, Texas 79915 Scotsdale Realty Sales-Renta l-Property Management 3412 Orkney Road Corner Wedgewood 8g Orkney El Paso, Texas E.L. CSpudJ Hurt 81 Joe E. Petty Off. 591-9486 mm. 532-5575 DIAL 532-5575 pfdga Smpne S4475 G I F T s - RADIOS - TV - PHONOS - TRANSISTORS 'L v Rv D 'Q ni D I A Q Q - MILLS 81 OREGON EL PASO, TEXAS Texas Motors Machine Shop and Auto Supplies Phones: 532-6325 81 532-5529 2200 Texas Ave. El Paso, Texas :iii 335 'M lit iffy l s hi? I FIREARMS, INC. Guns Ammunition Scopes Reloading Gunsmithing 623 S. EL PASO 532-4601 3100 PERSHING 565-6313 5 315 i ii' l 76 N b t Barcena gives Jim Boyle ci lift to check the goings on inside o room. Joe Jarvis says Have Your Car Serviced By AVIS TEXACO Super Texaco 6801 Montana Phone: 772-2074 We Use Inland Radiator Equipment Complete Automotive Service Bassett Employment Service SSTZJZIEZQLTLZZTZ, Oregon Cleaners 84 712-2107 Tailors Bassett Beauty Salon 70 Bassett Center Phone 772-1217 EI Paso, Texas 79925 Two Locations K-Mart Center McRae Blvd. 500 N. Oregon St. Our business is built on Service and Quality ADVERTISING 277 Newly found tradition started Debby Yarborough Eydie Griswold Lieutenant Colonel Maior I ,. :-f!'E ' -.1 , , ' y yrlfm ifgigiiwir .is V- SJR J ,Q 'r may :Q if ' -Q 1 Trina Williams Georgia Ferguson Major Captain Anne Markeson Su Stuart Captain Captain a sag?-a.:ewgfm1w . g?3g2w2g4Q35mfi2 ,,Q1,,.,,if,,.i , - f shziwsw sfw:4fasf1f:, ' rig,-5L3,gi,efg 'I is af gi5,.L,lEfg,59.',ir.g4' K -iwrzfg y ugsssf5ggf.jgg -U WM 9 Hsiliz' I , I 'w,e'1rZ Diane Olson Janet Persons First Lieutenant First Lieutenant 278 F ff I K N, Qi: Mi-,IH ky 6 ,-1. Q S ,,,, Q ilii ip . Carmen Alvidrez Bussie Hollebeke Irene Paz Maior Maior Maior :::',,:E'i':Ei..E53fii. imwi MW f5V:5'3l7i!??l??'-xiii E gm? , 2,1Wfs11s.s,w,sifs, ,.,. W, . M V' K N nw- QS' 2 3 is x 4 E W .Q ' S U i 'Qs ii new , 4 Q ef ix as is Julie Francis Davette Juen Sylvia Lopez Captain Captain Captain 05127 Teresa Anderson Louise Loiselle Jacki Magness First Lieutenant First Lieutenant First lieutenant Sue Phillips Diane Alderete Becky Anagnostou First Lieutenant Second Lieutenant Second lieutenant at pep rallies by ROTC Sponsors Kathy Breton Second Lieutenant Toni Glardon Second Lieutenant Anita Kushen Second Lieutenant Pam McAninch Second Lieutenant -45 f.-4 Valerie Phillips Second Lieutenant In i Q l A . WW if - . E- i Barbara Piram W. Second Lieutenant Randi Rutherford Second Lieutenant bbx , 'E , , .K 7 Li ,: 5 Valerie Watson To achieve perfection in drill meets, Sponsors practice regularly. Carle Thomas Freshmen, freshmen, don't you fret, the nurse will change you when you're wet, was just one of the rhymes recited at pep rallies by the ROTC Sponsor Corps. Another activity of the girls to pro- mote spirit during the pep rallies included marching down the main hall and shouting cheers to the accom- paniment of the drum corps. The Spon- sors also stood up during the pep Second Lieutenant assemblies until a victory for the team was recognized by one of the coaches. Twenty-nine out of sixty-eight hopeful girls were chosen and trained by Sergeant Theodore Kittilsted. These girls were selected on the basis of how well they proved their march- ing ability during tryouts which lasted a period of two weeks. These twenty-nine officers of the Second lieutenant Sponsor Corps marched in drill meets for competition under the command of Lieutenant Colonel Debby Yarborough. The Sponsors exhibited their sup- port for the school by attending the Las Cruces football game and the band meet held at Bel Air. The Corps also formed a new tradition by march- ing for the student body at the last pep rally of the football season. ADVERTISING 279 Faq 99000 06864 ZALES IEWELERS Order Your Beautiful John Roberts Class Ring Student Accounts DUNE BUGC-Y CENTER .R eff Home of f ltv ffiwilfwl WHEELS FOR FUN lily' .,.u QS-dl li 5 ll!'Q21.'U Dealer for Meyer Manx, Meyers Tow'd, Meyers SR Sports Car, Fiera, Paisano, 8K Mini-T Fiberglass Bodies Cathy Gouch takes a savory bite of an advertiser's product-its good. 4404 Monlona 566-1238 It's the real thing. Cglge. O0 Bottled under the authority of the Coca-Cola Company by Magnolia Coca-Cola Bottling Co., El Paso, Texas. ADVERTISING 281 Yahna Phi has active last year Trina Williams merrily conducts a meeting. Beverlee Bruce prepares the E for burning. Yahna Phi little sisters are selected to continue the club. BOTTOM ROW: Janet Severs, Dee Ann Brodie Sherrie Steele, Jan Davis, Margaret Singleton, Jean Severs. SECOND ROW: Trisha Downs, Sherri Ken nan, Ida Garza, Lisa Johnson, Vickie Bracher, Leah White, Connie Quisenberry. TOP ROW: Susan Collier, Kathy Ramsey, Nina Williams, Ann Haynes, Karen McCarty, Nancy Sewell, Bunny Chavez, Janet Cowert. Eydie Griswold, Beverlee Bruce, Debbie Miller, and little sister Dee Ann Brodie prepare the E frame. chooses little sisters Club members view the name of Yahna Phi newly engraved on the Operation Santa Claus plaque. Mrs. Pam Pippen opens a wedding present from the club at a shower given by Yahna Phi. l Kim Shahan studies a picture for the scrapbook. Yahna Phi included activities of all types to make their last year the best. School activities were topmost on the list. As a senior club, the girls prepared the E for the burning, which proved to be an eventful occurrence. The club entered the float contest, and were named as winners of the hall decorating contest. After the rally all club members scattered to decorate the members of the football team's houses. Signs and toilet paper were proof that the club supported the team. Yahna Phi sponsored a schoolwide drive to raise money for the purchase of sabres to be used at the Military Ball. The girls helped the gymnastics team sponsor a meet at the school. Club members filled in to do the many odd jobs needed to be done. Two activities were done to help raise money for school activities. A room dance was held at the Halloween Carnival, and a basketball game was played by the club, the proceeds of which were given to the Junior- Senior Prom Fund. Community projects comprised a great deal of the proiects done by the club. Operation Santa Claus, a drive backed by the school with a contest, was won by Yahna Phi. The name of the club was engraved on a traveling plaque. Yahna Phi also helped the senior class collect for the canned foods drive. Members of the club answered the telephone to take pledges for the Muscular Dystrophy telethon. Yahna Phi was the sole club given the priv- ilege of collecting contributions for the March of Dimes. The club members enjoyed baking Christmas cookies to take to a local rest home. The girls spent much time visiting with the elderly residents of the home. A wedding shower was given for the club sponsor, Mrs. Pam Seitz Pip- pen, whose wedding was an exciting event for the club. Yahna Phi proved to be a well-united group working for the best for the school and the community. Yahna Phi big sisters bequeath Trina Williams Debby Yorborough Suzi Morey Jo Beth Nichols president vice president corresponding secretary recording secretary Kathy Breton Beverlee Bruce Susan Button Tom Glardon Anne Murkeson Debbie Miller Rose Mueller ,.. 'J QsS?iEs6,,f.4' ,k We-fx so V 'W ' -m, S r H Kgs Q Q Q J, We -1 'fm f .am S K , A , ,... if SS 'Liste fi Ml-IM ef wg N5 Q S F sa li.. S ,S 2 we is fi N516 Wie K J, 5 3, 3 Y lik S' se is gi 3 , ,gf s S c 5 J, six J? sl 5 el 3 S M-W S 3 is 3 K' i 2 was ll s ff Ei' I xi sg? 3 my A .silver fe fa .N Qi:-':f1., ' U X 1. x Q 4 1 if - eiwsaw ' A ' M ee, ,, 5,,ggs?,.s,., .M ,. wks, fgrgge ,V mfg A isexefesmv J new V it -, T r:ef3i'QeSr - :L se, if 9' my X 9? r3+:,X X LW? :- i W r f wg ' ii -' saf- sv seam 5 5 1 sa: L 0535915 f-mf.. ,-f.f - . ,, g V ., 7 , -we Q f - K -is A ',-' f or 1i'i Valerie Phillips Su Stuart -121 5,1521 Q z az-s,:s15.,,1se ,Wg April Vaughn traditions to third generation Ann Savino Lisa Vinson Kim Shahan Jacki Magness treasurer parliamentarian historian Club Council representative Kristi Gotcher Eydie Griswold .lennye Honea Tracy Lund 1. lrene Paz Martha Reinhart Sue Phillips Yahna Phi members and a little Mrs. Gary Pippen Chris Regan sister decorate a room for the Halloween Carnival. ADVERTISING 285 H -Fashion Board member Elaine Loisell e displays a coming trend in fashion. HARRISQN BUSINESS EQUIPMENT Two Locations 1409 Texas Ave. Phone 533-9824 321 Mills Ave. Phone 532-4479 El Paso, Texas Complete Line Art Supplies Office Furniture Engineering Supplies GENE HUGGINS CUSTGM HOMES 3616 Derick 6 C 3 J, we Af 49' 90' 1 -aff- ofiv 4 M ,Y 34 gum HOMES Phone 566-1626 4431 Montana El Paso, Texas charcqater DRIVE IN RESTAURANTS 4024 NORTH MESA 9315 MONTANA Custom Care-Not Just A Slogan But A Process To Restore That Store-New Look CUSTOM CLEANERS 2107 Wedgewood E1 Paso, Texas Tel. 598-6933 Ruben Oxner ADVERTISING 287 Congratulations and Sincere Best Wishes To The Seniors From TI-IE v ALLE Y BANK of EL PASO i Hunt Building Marts, Inc. Brandt-Cullers Homes Builders of Homes and Apartments lOl05 Montwood Drive 591-9403 B 591 1250 R 591 1389 vounlfvqma hsuvmre jAo:N'r -.gf-...--f STINSON Sc SON INSURANCE AGENCY MICKY DILS WHEEL ALICNMENT Insure Today, Bc Sure Tomorrow K-Mart Center on McRae, El P T 7992 AN D CARAC- E COMPLETE AUTOMOTIVE SERVICE 6992 Alameda El Paso, Texas Roman and Russell Builders, Inc. 3616 McRae Blvd. Louie Giallanza Patrick Russell Quality Home Builders 3616 McRae 591-330l Best wishes to the graduates from ..... i . ll ' .!,c'f '.T ,,T:. V Ia BRING YOUR FRIEND 4232 Alameda 533-0975 ll Serving El Paso For Over T6 Years 5205 Montana Phone 565-6048 El Paso, Texas ADVERTISING 289 Doowtsae members adopt family W , Bussie Hollebeke Nancy McCarthy Randi Rutherford Laura Fairbanks 'Leslie Penley president vice-presidenl secretary fredsl-Irer parliameniarian Alice Wight Sheila Rogers Judy Carver Belinda Gafford Fran Kolsier historian chaplain l ,,,,, ,MMV Anifa KUSHGI1 Michele Mason Debbie Miller Carolyn Moody Marlha Reinharl Ann Savino Brenda Sawyer Kim Shahan Dolores Pellicano -5 ir' E l Q Lififir i arse, Margo Urey g serve teachers mid-term luncheon f 21 ,C-...sv Valerie Watson Lora Widing Gina Williamson John Cullers Mrs. Jo Matthews beau sponsor Members Laura Fairbanks, Kim Shahan, Ann Savino, and Leslie Penley show their support for the football team by hanging up a spirit poster. As a Doowtsae service proiect, Alice Wight pulls weeds while cleaning the Senior Patio. sa . , -u 1 ,. 4-45.71, 1 . A 'w,f ff. s 'lf my-, ' X . c had V Q4 Much time was spent on projects for the coming year by YWCA affiliated Doowtsae. Service proiects included decorating the goal posts for each home football game and serving refresh- ments to the men in the press box. The girls spent their Saturday mornings in picking up and sweeping the park- ing lot and Senior Patio. Doowtsae decorated a hall for Home- coming and received honorable mention. Teachers were served a luncheon and a Thanksgiving Day tea. The girls participated in the Hallo- ween Carnival by operating the fish pond and the Mexican food booth. Another service project undertaken by Doowtsae was providing a needy family with food and clothing. Sponsoring the club are Mrs. Anne Aliaga and Mrs. Jo Matthews. Selected as beau is John Cullers. ADVERTISING 291 Sue Phillips Valerie Phillips Kim Shahan Janet Persons president vice president corresponding secretary l'eC0l'dln9 SeCrelGry Epsilon hold back-to-school tea Murcia Hooper Cecily Appleby Shireen Baird Jacque Bates treasurer Sharon ClW0ml3llSS Pe99Y Ch'-We! Rita Chavez Palsy Hooper Epsilon began the year's activities with an all member back-to-school tea. A girls service club, Epsilon entertained the local orphanage on Halloween. Community work dominated the club's year. The girls worked with the children 292 in the pediatrics ward and the oldsters staying in Providence Memorial Hospital. Money was given to the Oldster's Christ- mas Fund. They followed their own tra- dition of helping with the neighborhood March-of-Dimes drive. Pure fun and profit were reason enough to hold a contest for guess- ing the names to match the varsity football players' legs. Epsilon polished oft the year by playing ball games with other school clubs. Patty Lane Louise Loiselle Anne Markeson Debbie Miller 'T' Sheri Miller Cindy Murry Irene Paz Donna Phillips Martha Reinhart rv ur': '3 Corby Shahan During an Epsilon meeting Ann Savino, Kristi Gotcher, and Kim Shahan seem to be concentrating on what their next project will be. fl fl '14, Randi Rutherford Debbee Vasey ADVERTlSlNG 293 29 1' f il f Congratulations to Graduating Seniors from BURGER CHEF NITA JAN SHOPPE, INC 3029 McRae Blvd. EI Paso, Texas Misses-Juniors-Petites Dresses-Sportswear Accessories Congratulations and Best Wishes To the Graduates Hovious Associates Realtors 800-810 East Yandeil Drive COMPLIMENTS of TIGUA CHEVRON BOB8.JAMES 4 Sharp Royal Typewriters Electronic Calculators OFFICE MACHINES CO. 2330 Wyoming St. TRAC EY'S LORETTO BEAUTY SALON 4830 Montana 565-3128 Open Six Days A Week Bassett Center 210 Mills Ave. 532-5655 On the Mall Downtown 772-1491 532-2461 Sales-Service-Rental REED'S PHOTO MART, INC. Camera Specialists P. O. Box 930 El Paso, Texas Caravelle Starcraft Mercury and Mercruiser Motors RAY' S SPORTLAN D 6820 Alameda El Paso, Texas Rebuild and Finish All Types of Boat Hulls New Ownership: Bill Moeck 84 Douglas Stubblefield Ph. 778-4179 Best Wishes From KIIRLAND 1 - M u l fg- Your Complete Department Stores of Music Records-Tapes-Sheet Music Pianos-Band Instruments-Car Stereos Phonographs-Guitars-Amplifiers Sunrise Center-751-1219 Chelmont Center-778-6345 Senior Larry Hicks operates a spotlight for the Beauty Pageant ADVERTISING 295 Wfwv Nancy Kennan Sharon Chambliss Patty Lane Debbie Spaugy Cindy Murry President vice presiden? secretory treasurer parliamentarian Hollis Henry Kathy McCarty Judy Lewis Cecily Appleby Debra Behrens l1lSl0 lUn chaplain represenfofive l-ind'-1 BUffln9l0n Rita Chavez Caihy Gouch Nina Gore Cheryl Hale 445 Kyiv' f O M... -new 6 Marsha Hooper Belinda Hover Pam Kessel Chris Lester Linda Pfeifle junior class Sparking the spirit of the junior class is the girls club Anehta Sesea, marking a long list of service projects. Starting the year with a bake sale, this girls club took on the awesome duty of caring for Eastwood's marquee. Included within this respon- sibility was the making of new letters for the sign in front of Eastwood. boosted b Anehta Sesea The football season brought about a great deal of activity for the club. Anehta Sesea made locker tags for the boys on the team, received first runner up in the Homecoming car deco- rating contest, drew caricatures of the football team and coaches, and put up a gigantic poster in the front of the school: Home of the Troopers. The club's community project for the year consisted of making the table decorations for the Ysleta Teachers Public Relations Banquet. While participating in the canned goods drive and their Halloween tea for the faculty, Anehta Sesea pursued the idea of boosting the junior class and overall school spirit. 'US ,vs Jenny Picken Brenda Shoemaker Debbee Vasey Joan Wilkins K isls . . wwf Zim Q. we ia vm I 'I-'F' f A Anehta Sesea members Cindy Murray and Joan Wilkins step on a bus to congratulate the basketball team on their win over Jesuit. 5799 HUSHUQS Mrs. Dolly Picken beClU sponsor ADVERTISING 297 HARMONY SHOP Musical Instruments Rental-Purchase Plan-Repairs dist, y r ushn IOI 05 Palmetto 598-0222 Guitars by Amplifiers by Fender Guild Guild Ovation Ovation Fender U H I Alvarez Harmony ' GU Bond Instruments Truck 81 Trailer-Rentals-Local 8. One Way cqu532-2681 BOB'S FINA State Inspection Bob Bagdon Mechanic on duty 6060 Alameda Phone 772-0586 Brushing up on tennis techniques are Julie Francis and Lance Murray. FABENS ICE COMPANY Party Ice-Block Ice Dry Ice-Beverages 8920 Gateway East 859-9050 298 WHITE STORES INC. Three Locations: Fox Plaza Center Northgate Center and 3920 Morehead Fine Home Furnishings Catalina Brand TV and Appliances Automobile Parts, Service, and Accessories White Magic 50 Tires and Batteries STATE FARM INSURANCE Manny C. Morales 6005 Alameda Auto-Fire-Life?Health Phone 772-6028 HEI NS RESTAURANT An Old Name for Good Food Keg Room PROSITI Good Food and Drink At Chelmont-5400 Montana HERFF JONES Creative Excellence in School Jewelry, Awards, Fine Paper, and Publishing Herff Jones Company Ken Marlow P.O. Box 26369 El Paso, Texas 79925 ADVERTISING 299 A-1 ASCARATE RENTALS San-O-Can John H. Deweerd Phone No. 772-5251 6295 Alameda---El Paso, Texas Air Compressors Backhoes Chemical Toilets Forklift Trenching Machines Heavy Construction Cement Tools Carpenter Tools Sanding Machines Power Tools Painter's Equip. Plumber's Tools Mechanic's Tools Loading Tools Household Equip. Garden and Yard tools Donald M. Love AIRVISTA TEXACO Realtor 24-Hour Service 3616 Derifk Ban comer 591-0250 9026 Montana 598-3441 - l img' ,Q -- 6. rv -'Aix 151. if sasllluh leg, QSXJ' -I 54 456 Tlx - y View ii 'Ii its x MAKES DIRT CHEAP I f This dirt bike is great for camping, hunting, trailing, you name it. The CTI 175 Enduro is economical, lightweight, and a proven per- former. It's ready for the roughest terrain. The CTI 175 comes delivered with a 5-port power engine, 5-speed transmission, autolube oil iniection. Special Enduro suspension, the best. And a dirt cheap price. RATH BU N'S YAMAHA 5509 E. Paisano Dr. 772-1215 778-9781 YAMAHA I LYNX L i ' I ltgs V Mrs. Martha Harrison takes a breather after a long hard workout. 300 MISSION GARAGE 417 Mills St. EI Paso, Texas 7990I Good Luck, Graduates of Eastwood High FREEWAY BOWLING AND BILLIARDS 6926 Gateway East EI Paso, Texas Phone: 778-3358 3 v. AT I , ff' . M 5 5 ., , f Q7 H, I, I fc- 3 , ' 2' A-' 1,5325 , Y I fi'- - 3,1 nl. K ' iii? , Fifi - 52'ff:'ff f , . f, rf A , I if I- iq 2- C - '- Y My 5 . 'E:.i'. -tw , , if .qi .,.. ' X-an 1 - I -45-, II' . na X -1.1.2-. 1 Q.xQ,,,,:, ' '- .h N 24, .,.,,v,,- ,QR ' ,Yin A.: 1 -- .. pfsjbji X f ' V ,,.-'fab .rt - f-ni-A Y ' --' ' g.,,, -- .-112535 f A ,. C'----A-mr, , I B uttsr Church, EIPf1so,T:xcis M SCOTSDALE BAPTIST CHURCH 3001 Dublin EI Paso, Texas Bro. A. H. Skognes, Pastor Paul Goodwin, Minister of Education A friendly Southern Baptist Church AIRPORT BARBER SHOP 6213 Airport Road TUPPERWARE Best Wishes is sold onthe popular party plan from B 5 MARC-o's BEAUTY SALON Avffwffled I I Dfisffffwfof 911 Huckleberry f t SA 1 , , C 5662374 CHAPAR SA ES, INC. ADVERTISING aol Girls take float prize Boosting school spirit and serving the com- munity were Copiae Auriae's goals this year. The club boasted a second place finish in the float contest during Home- coming Weelc. Members collected for Op- Martha Loya Valerie Kaake eration Santa Claus and collected nylons , , , president vice president for the Shriner's Burned Children's hospitals. Peggy Porter Mary Zizik Ellen Conroy Delinda Dent SeCrefUt'Y treasurer parliamentarian chaplain Bdrbvrv Plmm Kathy Buckles Roseanne Chaparro Peggy Chavez representative Stella FU'-Wnle Julie F 0f1ClS Mary Garza Violet Gonzalez 302 fi, f - -:E-u ffzffs Ji an -s .qfefzg - me i X 3+ -up 5' i IA jc' JL, 4 .1 g I .. . girl Lynda Greaser Debbie Merrihew in Susan Smith Joel Hendryx beau , sf wvsgif? .qu-v kv '1s..i-'X Vfvvv- Pam Greaser Donna Jarvis Cindy loya Debbie Mizer Susie Salazar Brenda SawYef , 'N v 1 f 'V 'R I, Mary Stepanski Mrs. Jane Brainard Mrs. LuEHa Johnson sponsor sponsor Joel Hendryx receives congratulations from Mrs. Jane Brainard and Julie Francis as 1970-71 beau of Copiae J W ff 1 n '-.zafil Auriae J POPULAR Mattress Factory Complete Selection Inner Spring Box Spring King Size Queen Size Long Boys Latex Antique Beds Odd Sizes Campers Bedroom Furniture Headboards Bunkbeds Bedspreads and Linen We Specialize in Renovating 4114 Montana 163 S. Clark 566-4961 772-6566 GENE HORN OLDSMOBILE 6330 Montana 778-771 1 Wimhlfwllfffma Mechanical Contractors Air Conditioning-Plumbing 2101 Missouri 533-3774 El Paso, Texas 79926 H MOCK sporting goods for all outdoors Cook Sporting Goods Specialist in Athletic Equipment 778-9581 304 I if hen you want 11 fine portrait... to record forever with charm and dignity the important events of your life,come to the Photograph Studio of your Official Photographer . . . Photograph Studio-Second Fl ..PEE.?!E5. ADVERTISING sos 06 Participation during Homecoming 'V . 1 -V MM,N,f.,, ,A K ., i - V . Q iwisfl- - -- - Dorena Shanley Sheila Jefferson Linda Taylor presideni vice president gegreiqry Toni Andrews Kathy Fairbanks Debbie Fields treasurer parliameniarian higiorian CUTICI Spindler Donna Aaker Thelma Borrego Dianne Bration represenfative Ki: fs Doifie Chine Judi Faircloth Donna Haas Bonnie Jones maintains Detinu group ..nwi5 3 wd Kathy Fairbanks, Dorena Shanley, and Linda Taylor discuss plans for initiation of new members. plrlt Highlighting festive activities with school spirit, Detinu, a junior girls club, participated in many service projects during the year. As Homecoming activities began, the girls entered both the car decora- ting and hall decorating contests. Also in the category of services were their teas given for the faculty. During both Thanksgiving and Christ- mas holidays, parties were given for the children of the San Juan Mis- sion. Maintaining the group spirit, the club went Christmas caroling. As money-making proiects, Detinu participated in a bottle drive and sold valentines to the student body. This organization managed two booths at the Halloween carnival. Shapely legs spelled the success of the garter toss. Imaginative predic- tions proved beneficial to the group in the fortune telling booth. Sponsoring the girls service club are Mrs. Louise Baird and Miss Juanita Gutierrez. Elected beau by Detinu was Dennis Koehler. Q f w, Pat Kennedy Kerri Lindley Bernadette Nebhan Susan Prine Lillian Sainz Ceci Sanchez Robbie Venable Dennis Koehler beau ADVERTISING 307 Yfammeaz llidiuf Y' 52420 at : . , 0 024' TOYS BY ROY Toys-Hobbies Arts-Crafts Birthday Party Goods , 83 Bassett Center 778-0971 Eastwood Phillips 66 2100 Wedgewood Phone 598-9949 EL PASO !V!lfl0lVAlL 54 NK EUXZOXXVG EZ ,Paso rfxAS 79901 H151 533-6274 Finest f0b lCS GT 11. .:11,.' 5 V.... :Q .1'-2 ii 22'2' :1,,,' 2, .:.,.-'- :JEIQ 1' f QUALITY FABRICS or LA BARATA 'fir .--f 7?'2F'f--Q-1g::7 Elf ' llltlll B r T L ations Q W - lll S. Mesa 32 Bassett Center LABLE A QUOFIZE - ' - BUIL INGS - Low cost BARTEE'S DRAPERY BLAIR l'lAl.l. C0. 84 I N T E O ras: esTuMATEs SEE ,.,. Li 7724493 Beauti-Pleat Drapes A COMMERCIAL CANOPIES- STEEL Roof SYSTEMS Cnot like the ordinary drapej , 206 RAYNOLDS El' PASO' TEXAS 308 We Hi-Fashion wigs ...the amily store 6 Locations to serve You 702 North Pieclras 7044 Alameda 8586 Dyer Bassett Center 7750 North Loop 425 East Paisano TEUETONE WIZAR D Tlfesfem l'7y2' 566- 1 689 778-3369 755-2359 778-5365 778-4482 544-4663 84 Boutique Featuring Various Styles of Wigs Also a Full Line of Holiday Magic Cosmetics fm- For special wig styling visit the Hi-Fashion Boutique. 6215 Airport Phone: 778-9569 ADVERTISING 309 Ekappa provides food for neglected homes Jane Eades vice president lisa Wright secretary Debbie Gross treasurer Cindy Gross parliamentarian Diane McCurry representative Cindy Morales social chairman Josephine Alvarado Tamara Atkins Dixie Bailey Pct Gonzalez president Pat Estrada Mr. Fulton Robinson sponsor Lee Williams beau Ekappa, a sophomore service club, has done many worthwhile things this year. The year was begun by win- ning honorable mention in the Home- coming hall contest. The Thanksgiving season saw more of their hard work. In keeping with the season, they gave a tea for the Teachers using a Thanksgiving setting as a center- piece. Thanksgiving Day dinner was taken to a needy family. On Christmas two families were gifted with a lovely dinner. This action was repeated at Easter time. Ekappa was given much praise for their part in providing a happier holi- day season for these families who would otherwise have spent a .bleak day. Their experience of giving was rewarding. Tamara Atkins, Diane McCurry, and Pat Gonzalez make preparations for the Thanksgiving teachers' tea by preparing cookies to be served ADVERTISINC an Eva Chavarria Theresa Martinez Rhonda Simmons Mary Beth Strangeways Jacie Yonkees Sigma Chi ai Christmas saw members taking a group of orphans to the museum and then entertaining them at a Christmas Party. Highlighting the social activities of the club was the Mother-Daughter Tea, an annual affair. Selling candy bars was their primary fund-raising activity. ds in drive Considering Muscular Dystrophy one of the foremost US medical problems, members of Sigma Chi worked in col- lecting funds for the MD Drive. Sponsored by the YWCA, the girls sent two representatives to the Youth and Government Program in Austin. Hope Elaine Hulzar president Sharon Dudley vice president Susan Stepanski secretary Maralee Jordan treasurer Debbie Dorris reporter Sharon Wilkinson chaplain Thelma Borrego historian Sheila Marie Jefferson parliamentarion Francie Fitzgerald representative Dottie Clune 312 x l' . if 2 if 3 , , ,ft Pi 4 fl if Debbie Fields Paula Hendley Carol Huizar Bonnie Jones Kerri Lindley Rosalie McCall Lillian Sainz Monica Thompson Sheila Thompson Jacie Yonlcees Mrs. Linda McGovern sponsor Billy wfighi beau ADVERTISING Debbie Bowden Mary Bombard president vice president 51'-'HY Thfosher Jo Lynn Duscha l iS70 '0'1 represeniaiive Janet Correll Lynn Edeng Paisy Hooper .leanene Huff Denise Sieele Carol Lee secretary ireasurer Susan Bania Roxanne Brooks Jan Hiatt Robin 'Hoff Robin Johnson Pam Nevarez Entre Nous bolsters jV-team Exhibiting their constant spirit, Entre Nous began their second year of activities. Projects for the sophomore girls club centered around boosting the spirit of the iunior varsity foot- ball and basketball teams. Entre Nous members participated in such activities as serving iced tea to the B-team gridders, making signs for the locker room for each foot- ball player, and decorating the lockers of the B-team cagers. The club also helped the sopho- more class win the canned goods drive and raffled off tickets to the Steppenwolf concert. Entre Nous also participated in the sophomore class Halloween Carnival proiect and sent a telegram to the var- sity football players in Midland. Members of the club participated in President Debbie Bowden expounds while club members seemingly carry on a more IDTEYESTIHQ discussion the Homecoming decorating comes?- Vickl Stone Carolyn Simoneth Mrs Sammie Fourmy Danny Eoff sponsor beau ADVERTISING 315 Diane Mueller Cindy Adams Corby Shahan -l0r1f1d COZby president vice president secretary treasurer Debbie Bryant Debbie Bowden Susan Banta l-ee Wlllllenlon historian parliamentarian representative beau MVS- GUY Kl'-'JSSFIBV Benell Curwvdn Janet Correll Jackie Efaw sponsor 316 Debbie Espinoza Holly Eurich PUTSY H90Pe Cindy Jqbqlie Corinthians visit Viet Nam vets to bring greetings at Christmas Viet Nam veterans' holidays were brightened by the visit of Corinthians to Beaumont during the holidays. Mem- bers brought along cookies, punch, and homemade pastries to make the visit a real Christmas party. lt made us feel like we had done something for our country, commented one of the members after the visit. And the fact that we had gone made my holidays quite a bit happier. Car washes and bake sales added to the bank account of the club while expenditures went toward boosting the Homecoming activities. The second hall went really blue and gold during the busy week under the sponsorship of the girls in Corinthians. Halloween found members working diligently in the snack bar trying tekitas for the ghosts and goblins who visited Eastwood that night. Debbie Jones Carol Lee Linda Lopez Shari Miller Sheri Paulk Rita Payne Denise Pero K. Cindy Rhodes Charline Rivera Christine Rivera Colleen Zllik ADVERTISING 317 5 Sl? wif ae ll 'Xl Complete Printing ABC BUG SHGP a n d Complete V.W. Repair Lette r S e l'Vl ce Phone-598-8790 1oo75 Carnegie sf. 6114 Trowbridge El Paso, Texas Dial 778-4478 51359695 bX1X11Z1XbFXDXsXbkXi4XPE1Xggxi,q G FOR wx' it AN Y REASON 96 ,.i, all zil 1322 i,.:::1 2 . , lzz ZI: ,,,. ,.,: . I , il, Z ,:,5,EEE:,:,,.,.. ae 15 EEE :1,... -2222521 11 2 3252211 ....1-1: 2 ii- i2 5f52i2i5s:f:-., Call them what you lilce . . . A bg Promise rings, friendship rings, date mates . . . X or just because. . She'll love her first sparkling ,Xl diamond . . . set in yellow or white gold. ae Priced right, too! gl 519.95 E Ssxbaxmqxbxaxbmxbkzzbzxvixbxxasilq Ben Williams jewelers McRae at Wedgewood Beside the A8.W El Paso, Texas An unfriendly creature lurks in the crevice of our halls awaiting unwclry victim. JoNr-:s HATTERS s. WESTERN STORE GD T ,E J H JIM JONES 5001 Montana Tel. 565-9502 E1 Paso, Texas V 4 9 l l l i' --H! TWENTY-ONE THIRTY TEXAS AVENUE ixx THE HALLMARK OF EXCELLENCE HE Elillil .Q.-0 O I I O Through its 22,000-mile pipeline sys- tem El Paso Natural brings depend- able, low-cost energy to Arizona, California, Colorado, Idaho, Nevada, New Mexico, Oregon, west Texas, Utah, Washington and Wyoming. EL PASO NATURAL GAS COMPANY The resourceful one ADVERTISING 319 Chrisy Butler presidenf Carol McManus rep reseniative 20 Kathy Adams Venite Fidelis visits elderly 1 . - QQ 'X p - f 'E if .ff it H A Q 2 51 s R is NE x ' 335 2 , R A I - if M2 .liiiiixxzl -'P Sibiiisjsaugw- .1115 Egu dxi r u -7 - 1 -- swQ51s2h?Ls?Q2!2i? wfsfl iff y 1 , . f i-wzsffzgs-ssagsfy, ' A 7 we i f V . H fu ,MU '- : w1gSxsa.seQfs1'2aQH5g Qg5A! 5,:sz:?gfs Patsy Delgado Terri Sheehan Terrie Clements vice president secreiary Treasurer MUYY Hilll Marilyn Foliz Cheryl Tibbs l1lSiOl'iGn chaplain parliamentarian Debbie Belts Patsy Carreon Mindy Clark rf, raises money with bake sales Dorothy Gibson Joyce Jarvis Nancy Lynch Cathy McManus Pam Nevorez Sherry Paulk Ellyn Skerkowski Marilyn Van Cleave Colleen Zizik Ro be rt Watson beau Q , A R, - , K LL. m f . A295- QL K -w b y Karen Thoreson Venite Fidelis filled the year with activi- ties ranging from money-making bake sales to entertaining young children at an orphans' home during Easter vacation. Club members also visited senior citizens at a convalescent home. Other activities for club members in- cluded traditional hall decorating and spirit boosting schemes during Home- coming festivities. Members also held candy sales for the student body during lunch shifts and made signs for the halls during football season to boost team spirits. ADVERTISING 321 LEAVELL DEVELOPMENT COMPANY Land Development Texas Homes Division lOl 20 Montwood Drive EI Paso, Texas 79925 Telephone 915-598-3465 Harry W. Buckley Vice President H. CARROLL LEE Construction Co., Inc 5 ll 'Ari llllgi gx .,' or .A egis General Construction-Dirt Work Railroad Construction Rental Equipment Lease Equipment With or Without Operators 6999 Commerce 778 6477 JCHNNY GCDCJDWIN ENCO SERVICE Q 5 f-wwf H Home of the friendly Tiger! 6240 Montana ADVERTISING MOE'S DRIVE-INN Moises Dominguez-Owner Mexican Food Food To Take Out Phoned Orders Ready When Called For Plenty Ot Free Parking Complete real estate service Raymond R. Bissell 772-0654 6298 Alameda 3 ...l- all'1,: REAL ESTATE PROPERTY ENDURES 10120 Montwood Drive Phone 598 5404 Jaafari Maiwfw. LONG DlS1ANCE MOVING Buy-Sell-Trade Fast We will buy your home or sell it fast. Our clients have money to buy. Don't wait. Call now. 10120 Montwood 598-5404 EMPIRE MOVING 84 STORAGE CO. 9201 Empire Ave. El Paso, Texas Jack Conner 591-1427 Res. 772-6578 Henderson, Larry totem pole. Hicks, and Jimbo Boyle provide a t p y EL PASO AUTO AUCTICN Used Cars-Wholesale Prices Open To The Public 81 Dealers Also Top Prices Paid For Used Cars 4908 Alameda 772-3245 ADVERTISING 325 Greg Ray's Music Studio Guitar 81 Voice Drum Lessons Instruments Loaned to Beginners Call For Apitude Test -At No Obligation 3391 Wedgewood 591-6183 Weston Reese shows off by displaying one of his athletic capabilit ACHILLES 1 Two Locations 105 E. San Antonio 532-8082 1330 Montana 532-1311 Student Rates On Graduation Pictures -n 6 Congrotulotions, Seniors! E. H. BAEZA Builders ond Sellers of Quality Homes E. H. Boezo Norbert Bolrceno 9615 Sims ADVERTISING 327 Eosfwood Church of DEAR SENIORS: IAM STILL NOT ALL THAT I SHOULD BE BUT I AM BRINGING ALL MY ENERGIES TO BEAR ON THIS ONE THING: FORGETTING THE PAST AND LOOKING FORWARD TO WHAT LIES A- HEAD, I STRAIN TO REACH THE END OF THE RACE AND RECEIVE THE PRIZE FOR WHICH GOD IS CALLING US UP TO HEAVEN BECAUSE OF WHAT CHRIST JESUS DID FOR US. Compliments of - JERRY woLFE's Chmf RESTAURANTS U-Houl Truck 81 TroiIer-Rentols-Locol 81 One Woy BOB'S FINA Bob Bogdon IN CHRISTIAN LOVE, PAUL, APOSTLE OF ouR LORD KPHIL. 3:13-14, 6060 Alameda Phone 772-0586 CompIimenTs of MEAD'S FINE BREAD .I. O. WoII 328 RALPH'S TEXACO At Maryland and Alameda Tune-Ups, Brake Jobs and BOB MEAC HAM 81 Am Repairs O I N C . Fast and Good Service I 6000 Alameda El Paso's Largest Custom Home Builder 10120 Montwood 1 598-5417 128 Thunderbird 584-3421 Trooperette Shireen Baird takes a momentary time out to strike a pretty pose. Support Your School Publications Sa bre-Sa l ute-Revei lle ADVERTISING 329 Student Aa ke r, -A- Donna-105,126,234,306 Aanonsen, Michael-124,234,237 Achim, Douglas-234 Adams, Cynthia--248,316 Adams, Daniel-234 Adams, Kathy-248,320 Adams, Kelly-234 Adams, Ronald-260 ADAMS, WAYNE-218 ADAUTO, JEANETTE-111,218 Adauto, Patricia-248 ADDIS, LARRY-218 Agee, .lames-142,144,147,248 Albrecht, Robert-234 ALDERETE, DIANE-140,162,218,278 Alderete, Robert-195,197,234 Alexander, Janice ALLEN, MICHEIL-80,218 ALVARADO, FERNANDO-218 Alvarado, Josephine-248,310 Alvarado, Lilia-43,105,185,26O ALVIDREZ, CARMEN-37,40,117, 129,218,278 Amato, Ronald-234 Amato, Vickie-248 ANAGNOSTOU, REBECCA-40,67, I 16,140,218,278 ANEHTA SESEA-296-297 Anderson, Barbara--248 ANDERSON, RANDALL-124,180, 182,184,186,204,218 Anderson, Pamela-248 ANDERSON, TERESA-38,41,116, 140,218,278 Andis, Richard-260 Andow, Paul-189,260 Andrews, Toni-56,65,234,306 Appleby, Cecily-292,296 Appleby, Michael-248 Arbogast, Don-260 Archuleta, Anthony-260 Ardoin, Coy-234 Ardoin, Nancy-260 Arellano, Rebecca-260 Argeanas, Gus-260 Argeanas, Kosta-260 ARGEANAS, TED-80, 79, 125, 170, 204,218,237 ARMENDARIZ, ARMANDO-129, 218 Armendariz, Sandra-129,260 Arnold, Daniel-234 Arnold, Joy-179,260 Arnold, Sally-260 ARNOLD, THOMAS-126,145,198, 218 Artaleio, Pauline-135 Artaleio, Richard--170,195,234,237 Arver, Robert-260 ASHERL, JOAN--218 Ascherl, Tom-248 Atkins, Tamara-42,61,110,118,126, 128,248,310 ATKINSON, DAVID-34,218 August, Ingrid-126,248 Autrey, Diane-40,44,117,234 Aydelotte, Cheryl-260 Aydelotte, Paula-40,109,117 Ayres, Debra Baca, Elsa-260 Badillo, Laura-43,105,260 Badillo, Sylvia-43,203,248,250 Baggett, Kathy-105,248 Baggett, Michael J.-144,147,260 Bailey, Amanda-43,260 Bailey, Dixie-248,310 Bailey, Gregory-248 Bailey, Jeanne-320 330 Index Bain, Laurie-43,129,260 BAIRD, SHIREEN-68,219,292,323 Baker, George-148 Baker, Heidi-105 Baldwin, Deborah-45,46,117,153, 162,234 BALDWIN, DOUGLAS-232 Baldwin, Lorraine-128,129,260 Baldwin, Theresa-42,46,148,248, 153 Bale, Jeff-38,248 Ballard, Buddy-234 Bamberg, Anna-118,134,260 BAND-130-131 Banks, Duane-188,205,248 BANNER, ROBERT-36,129,132,136, 219 Banta, Susan-104,204,248,314,316 Banuelas, Abad-234 BARCENA, NORBERT-45,158,160, 161,218,277 Barcena, Oscar-43,189,260 Barnes, Cathy-42,260 Barnes, Robert-178,248,252 Barnes, Rodney-234 Barnett, Michael-144,234 BARON, MICHAEL-134,219 BARR, ROBBIE--111,118,219 Barragan, Carmen-44,46,93,148, 152 BARRAGAN, LOUIS-248 Barragan, Martha-42,248 Barron, Nicole-248 Barrow, Milton-188 Bartlett, Cheryl-54,148 Bartlett, Chris-151 Bartlett, Elaine-43,85,260 Barton, Lela-260 Bartram, Steve-129 BASEBALL-190-193 BASKETBALL-180-189 BASS, JOEL-62,143,219 Bassett, Bill-260 Bates, Jackie-59,234,292 BATSON, CHERYL-219 Batson, Drevel-260 BATTLE, LINDA-45,161,219 Baustert, Steve-194,196 BEAN, DEBRA-45,219 Bean, James-42,104,148,179,260 BEAN, ROBERT-40,104,122,124, 158,168,171,173,174,175,176,190, 216,219 BEARD, BILL--33,38,4O,41,47,79, 100,103,104,120,134,152,158, Berger, Anne-248 BERGMANN, DAVID-219 BERGMANN, JAMES-110,219 Bergman, Mary-234 Bernier, Oscar-248 Berroteran, Patricia-260 BERROTERAN, ROBERT-219 Bertka, Jon-145,147,188,248 Bertka, Mike-123 Betts, Debbie-248,320 BIEN, GLENDA-219 Bien, John-248 Bigler, Vicky-134,260 Biiole, Angela-248 BILLS, WALLACE-219 Bird, Bruce-260 Black, Robert-35,45,47,125,151, 160,161,234 Blair, Mike-260 Blair, Scott-75 Blakeman, Robert-76 BLANCAS, JESSIE-219 Blankenship, David-317 Bleakly, Barbara-40,44,234 Bleakly, Thomas-118,188,248 Blenkinsop, Bill-260 Blizzard, Linda-248 Blomerth, Kim-38,110,234 Blue, Diane-66,105,134 BLUE JACKETS-116-117 BLUE, KENNETH-62,143,219,220 Boden, Philip-235 BOEHME, RAINER-220 Bohanon, John-43,144,260 Bohannon, Robert BOHLS, RICKY-201,220 Bohn, Zachory-260 Bohren, Andy-235 Bolton, Brenda-45,126,162,235 Bombard, Mary-43,47,97,104,126, 249,314 Booth, Joe-129,260 Bonilla, Ana-249 Borrego, Thelma-118,235,306,312 Bosselman, David-144,261 Boswell, Dennis-330 Boswell, Melinda-330 BOTTJER, MARTIN-132,220 Botts, Susan-235 BOURNE, NENA-220 Bowden, Deborah-247,249,314,315 316 Bowen, Rick-249 BOWEN, RONALD-132,220 BOWER, ROGER-220 Bowers, Greg-235 BOWERS, KARSHA-158,220 Bowers, Leslie-135,149,235 Bowie, Jamie-235 Bowie, Kennie-74,105,249 Boyd, Ronald-179,261 BOYLE, JIM-277,336 Bracco, Kim-261 Bracey, Valerie-92,249 Bracher, Rudy-120,235 Bracher, Vickie-154,205,261,282 Bradshaw, David-249 Bradshaw, James-108,261 Branham, Barbara-261 Bratton, Dianne-235,306 Bratton, Mike-261 Bratton, Sharon-249 Breit, Gary-113,235 Breit, Larry-249 BRENT, PAUL-226 BRETON, KATHLEEN-62,140,220, 279,284 Cutest couple, Debbie Miller and Glenn Guy, are happy almost anywhere as long as they have each other's company. 161 ,1 BEARD, 62,216,219,332 FRANK-111,219 Beard, Lorene-260 BEAUTY CONTEST-56-57 Beauford, Alfred-134 Beaver, Becker, Beeler, Beeler, Harry-179,260 Melanie-256,260 Ernest-151,248 Mike-144,260 Behlen, David--248 Behnke, Jesse-151,144,234 Behrens, Debra-152,241,234,296 Belknap, Robert-129,178,234 Belknap, Steve-179,259,260 Bell, James-234 Bell, Mark-234 Bell, Zandra-248 Bellamy, Russell-189,260 Bemis, Deborah-74,105,248,254 Benford, William-195,248 Bennett, Cynthia-234 Bennett, Denise-248 Bennett, Joseph-248 Bennett, Maria-260 Bennett, Tod-248 Benson, Stephanie-260 BENTLEY, GARY-220 Bentley, Kevin-43,108,260 BRILHART, DEBRA-220 Brinker, Gary-123,195,149 Brodie, Brodie, Brooks, Brooks, Brooks, Dee-261,282 Mark-220 Jerry-235 Karen-235 Kent-78,143,161 Roxanne-115,249,314 Brooks, Marilyn-261 Brooks, Brooks, Sandra-261 Brown, Allan-249 Brown, Carlton-261 Brown, Curtis-235 Carpenter, Ronnie-249 Carreon, Patsy-126,249,320 Carrick, Colleen-261 Carroll, Yvonne-105,261 CARRUTH, SANDRA-111,220 Carther, Charles-78 195,197,220,249 Carther, Charles CARVER, .IUDITH-40,220,290 cAsAREz, RUEBEN-34,4o,1oo,1o4, I20,158,202,220,339 Casper, Sharlene-261 CASS, KIMBERLY-220 Brown, Darrell-235 Brown, David-249 BROWN, DORIS-220 BROWN, KENNETH-147 Brown, Michael-261 Brown, Noel-249 BROWN, RICHARD-220 Brown, Susan-261 BROWN, TIM-226 Brown, Wayne-235 Browne, Curtis-261 Browne, David-235 BRUCE, BEVERLEE-45,162,220,282, 284 Bruce, Dianne-43,129 Bruce, Richard-43,129,261 Brunson, Jack-235 BRUSH AND PALETTE-118 Bryant, Debra-105,115,249,316 Bryant, Donna-249 Bubb, Gary-249 Buckles, Kathy-126,239,302 Buckles, Ronald-261 Budens, Beverly-78,134,261 BUFFINGTON, DAVID-220 Buffington, Linda-137,235,296 Buford, Alicia-261 Buie, Don-112,235 Buie, Hal-249 Bukowski, Michael-261 Buntyn, Susan-105,261 BURDENS, ROBERT-232 Burkholder, Harold-249 Burkholder, Jerry-261 BURKHOLDER, MARVIN-220 BURNS, DEBRA-132,136,220 Burns, Fred-261 Burns, Pamela-249 Burris, Mike-145,249, Burt, David-249 BURTON, RICHARD-120,124,I29, 220 Butler, Christine--249,320 Butler, Corrine-105,261 BUTTON, SUSAN-16,220,284 Byous, Billy-261 -C- Cadena, Mike-261 CAGE, DEBRA-33,44,104,1I6,158, 220 Cage, John-235 Castillo, Salvador-203,249 Castillo, Sylvia-149,261 Cotaldi, John-249 CATALDI, STEPHEN-220 Cates, Pat-235 Cates, Sue-105,148,261 Catt, Beverly-235 Catt, Marilyn-43,167,261 CAVALIERS-132-133 Ceniceros, Mike-200 Chamberlin, Ken-235 CHAMBERS, JACKIE-118,220 Chambers, Kim-235 Chambers, Sheryl Chambers, Terry-118,249 Chambliss, Gary-262 Chambliss, Sharon-130,235,292, 296 Chandler, Patricia-262 Chaney, Roy-249 Chaparro, Daniel-249 Chaparro, Diana-235 CHAPARRO, ROSANNE-202,220 Chappel, Mary-113,235 Charles, Carolyn-105,249 Chasco, Michael-178,249 Chavarria, Eva-249,311 CHAVARRIA, MARTHA-44,220 Chavez, Bunny-105,262,282 CHAVEZ, CHARMAINE-45,161,162 220 Chavez, Cindy-249 gags Valerie Phillips goes down with a smile as Bill Beard snickers with pleasure. This earned them the title of best personality? CAHILI., PATRICIA-126,153,220 Cain, John-261,269 Calanche, Catherine-129,261 Calanche, Mary-129,235 Caldwell, Carol-249 Callender, Clint-I13 Camacho, Cynthia-235 Cameron, Carole-134,261 Canavan, Benell-43,249,316 Canovan, Cathy-261 CANDELARIA, DAVID-148,220 Candelaria, Susan-108,110,249 CANFIELD, ADRIANNE-220 Cannon, Janene-235 Cannon, Shawn-134,261 Caraway, Barbara-38,119,235 Caraway, Melvyn-235 Carbaial, Robert-134 Cardona, James-261 Cardona, Michael-235 Cardon, Paula-235 Carothers, Alexander-249 Carothers, Richard-235 Carpender, David-113,235 Chavez, David-235 Chavez, Edward-129 CHAVEZ, PEGGY-37,1 I 1,220,292, 302 Chavez, Rebecca-108,249 Chavez, Rita-19,35,45,51,66,161, I66,235,243,292 Chavez, Rosalyn-235 Chavez, Tony-235 Chesak, John-262 Chesak, Michael-249 Chesbro, Charles-103,134,262 Chesnutt, Jon-179,189,262 CHESS CLUB-151 CHRISTENSEN, NICK-220 CHRISTMAS-60 Christopherson, Joe-179,262 Christy, Stephen-262 Chumlea, Mike-262 CHUMLEA, PAULA-83,92,153 Church, Susan-278 Ciceri, Lorraine--109,1 17,1 18,235 Ciceri, Sharon-105,262 CLARK, ANN-132,220 Clark, Cilyn-43,262 Clark, Mike-262 Clark, Miriam--126,249,320 Clark, Robert-331 Clark, Samuel-262 Clemmons, Daborah-44,235 Clemont, Edward-262 CLEMENT, JEANNIE-220 Clements, Teresa-249,320 CLEMENTS, TERRY-220 Clonts, William-249 Cloud, Richard-249 CLUB COUNCIL-I04 Clune, Dorothy-104,11B,235,306, 312 Clune, Matthew-262 Coast, David-123,129,170,I71,235 Cobb, David-178,249 Cochran, Anna-43,262 Cochran, Steve-48 Cole, Dale-134,262 COLE, JERRY-152,220 COLE, TERRY-158,220 Collard, Colleen-249 COLLARD, PATRICK-220 COLLETT, JACKIE-220 Collett, Judith-249 Collie, Susan-43,148,262,282 Collins, Brian-262 Collins, Walter-262 COLLINS, YVETTE-126,158,220 Collom, Caren-262 Comstock, Colleen-235 Combs, Cynthia-132,250 Comey, Robert-235 CONROY, ELLEN-135,220,302 Conroy, Michael-178,189 Cook, Dennis-143,178,235 Cook, Kevin-43,143,262 Coon, Rick-53,1 22,171,172,196,235 Cooper, Eddie-132,178,250 Cope, Jacob-178,250 Corbit, .Ianeese-262 Cordova, Frank-250 CROCKER, MARK-36,40,132,136, 148,220 Cross, Marci-126,235 Crossman, Susan-262 Crouch, Betty-235 CROUCH, WILLIAM-220 Crowe, Deborah-250 Crowe, Pamela-235 CROWLEY, SHERON-103,153,220 CRUCE, JUDY-33,132,136,220 Cruncleton, John-235 Cruncleton, Mark-263 cude, Billy-145 CULLERS, JOHN-50,104,122,124, 158,I70,173,175,2I6,2I9,221,291 Cullon, John-263,144 Cunningham, Dennis-45,161,235 CUNNINGHAM, RUTH-233 Cunnington, linda-250 Currie, Cheri-250 Currie, Gerald-255 Currie, Tom-126,198 CURRY, DEDEE-113,221 Curtis, Cynthia-149,236 Curtis, Michael-143,263 Cordova, Jeanette-262 Cordova, Phillip-61,171,235 CORINTHIANS-316,317 Corral, Christine-262 Correll, Janet-18,250,314,316 Cottingham, Tim-262 -D- Covey, Mike-235 Cowart, Janet-43,66,262,282 Cowart, Russell-235 Cozby, .Ionna-250,316 Daggy, Christy-42,263 Dahl, Barbara-115,250,253 Dahl, Margaret-236,264 Craft, David-144,250 Cram, Bonnie-43,105,148,250 CRANFORD, LYNDA-234 CRAVEY, NEAL-185,220 Cravey, Ma ry-262 Crawford, David-132,178,250 Crawford, Glenn-100,104,I24,194, 246,250 Creecy, Barbara-250 DANIELS, .IUI.IE-92,222 Darancou, Mercedes-250 DARLEY, SHERRY-222 Daseler, Jerry-129,236 Daseler, John-40,62,144,147,236 Davis, Harrel-142,144,236 Davis, Janice-263,282 DAVIS, .IAY-149,158,222 DAVIS, KARLA-113,222 Creek, Charles-179,262 Dqyigl Lg,-fy-144,263 Creek, DGNISS-74,105,235 Davis, Patrick-143,250 Crenshaw, David-124,168,171,233, Davis, Paul-144,250 235 Davis, Philip-143,144,236 Crenshaw, James--189,262 Davis, Renee-126,132,153,250 INDEX 331 GLEEMAN-135 From jitter-bugging to tangos Rose Mueller and Joel Hendryx wear out the soles of their shoes earning them the title of best dancers. Davis, Thomas-42,43,46,152,250 Dayisson, Mike-263 DAVISSON, TERRY-113,222 DAWS, JOHN-37,40,62,143,144, 147,222 Deba, Patricia-250 Debra, Richard-5,20,188,236 DECA-112 Decker, Guv-142,144,147,250 Deckert, Allen-129,250 Defee, Mark--250 Dekle, Jerralee-115,148,250 Delgado, Cecilia-149 Delgado, Gilbert-143,263 Delgado, Patsy-167,250,320 Denham, Terry-187,236 Dennis, James-250 Dennis, Michael-263 Dennis, Robert-188,250 DENT, BELINDA-222,302 Dethrow, James-263 DETINU-306 DeWeerd, David-185,236 DeWeerd, Donnal-263 DiAngelo, James--122,171 236 Diamanti, Davis W.-263 Diaz, Daniel-144,263 DIAZ, JESUS-222 Diaz, Larry-250 Diaz, Michael-178,250 Diaz, Diaz Ramon-250 Rebecca-263 DILLDINE, BOBBY-222 Dille, Leslie-108,263 D-iordievic, Obren-143,263 Doebele, Lois-236 Doebele, Lynda-256 DOMINGUEZ, ARMANDO-125,180, 181,185,187,204 Donahue, Bruce-42,203,250 DONAVAN, CATHERINE-37,129 148,222 Donavan, Michael-250 Done, Susan-115,236 Donovan, Tim-250 Doolittle, Beverly-134,263 DOOWTSAE-288 Doris, Karen-42,148 DORRIS, DEBORAH-111,222,312 Doss, Donene-113,115,236 Doss, Richard-263 Dow, Craig-236 Dow Max-263 1 ,172,190, Downs, Edward-44,236 Downs, Patricia-167,263,282 Draper, Kirk-250 DRAPER, NANCY-46,222 Dresser, Lonnie-88,144,146,147,236 332 DuBose, Richard-263 Duckworth, Robert--263 DUDLEY, SHARON-222,312 Dugan, Laurie-236 Dumbrique, Sybil-250 Dwwway, Gordon-124,132,1as,25o Dunlap, Alfred-178,250 Duran, Paul-236 Durr, Michael-42,43,134,250 Duscha, Jo Lynn-250,314 Duvall, Suzy-250 Dyer, Karen-118,148,236 Dyer, Martin-250 DYKES, SHARON-111,222 Dzubinski, John-4-2,129,151,250 -E- Eades, .lane-250,310 Earley, Shelline-236 Eason, Patricia-67,118,236 EASON, SUSAN-118,158,222 EASTWOOD IN ELEGANCE-64 Echols, Shellie-263 Edens, Lyn-250,314 EDGAR, PHIL-222 EDMONSON, JOHN-24,33,34,40, 53,100,103,120,132,136,152,154, 158,225 Edward, Welcome-152,250 Edwards, Scott-179,263 Efaw, Jackie-250,316 Eggemeyer, Randy-123,124,170, 236 Eggemeyer, Richard-263 EGGEMEYER, ROBERT-40,122,158, 1 68,1 70,1 90,2 22,235 Ehrlich, Linda-115,250 EHRLICH, WENDY-204,222,335 EKAPPA-310 ELA-122-125 Elliott, Stephan-236 Ellis, 'Deanna-263 Elrod, Scott-120,250 Engelhardt, Christian-250 ENGELHARDT, KLAUS-34,35,39,40, 158,159,222,337 ENGLER, JANE-148,222 Eoff, Danny-178,250,315 EOFF, JOHN-171,172,195,196,204, 218,222,338 EPSILON-292 Erspan, Molly-250 Esparza, Jesse-250 Espinoza, Debbie-316 Estrada, Elizabeth-263 Estrada, Patricia-250,311 Eubanks, Barbara-135,250 Eurich, Holly-115,250,316 Eurich, Jerilyn-134,263 EVANS, JACK-222 EVANS, JOHN-222 Evans, Maurice-250 Evans, Stephan-236 Eytcheson, Debbie-250 Eytcheson, Kerry--263 Eytcheson, Mark--250 -F- Fairbanks, John-263 Fairbanks, Kathy-118,236,306,307 FAIRBANKS, LAURA-45,162,222, 290 Fairbanks, Mark-250 Faircloth, Judy-115,236,306 Falcon, Nicolas-178,195,250 Fargason, Alicia-138,263 Fargason, Andrea-138,263 Farley, Marvin-134,153,263 FARLEY, ROBBIE-40,46,58,93,136, 154,222 Farrier, Greg-263 Feind, Stephanie-263 Ferguson, Danny-263 FERGUSON, GEORGIE-69,140,166, 222,278,338 FERGUSON, JAMES-125,195,197, 222 Ferguson, John-144,179 Ferguson, Paul-236 Ferguson, Susan-115,132 Fernandez, Richard-129,250 Ferrara, George-263 FHA-105-107 Fields, Deborah-237,306,313 Fields, Linda-263 Fierro, Cynthia-134,263 FIERRO, MONA-222 FITZGERALD, FRANCES-l04,105, 222,312 Flaming, Syndey-237 Flato, Philip-263 Flato, Richard-250 FLEET, MIKE-222 Fleischman, Linda-251 Fletcher, Sandy-251 Flores, David-144,251 Flores, Emma-251 Flores, Michael-118,251 Foltz, Marilyn-105,251,320 FOLTZ, ROY-102,103,200,222 Fonner, Georga-129,251 FOOTBALL-168-179 FORBES, CHARLES-33,222 FORTI, STEVE-222 Fortune, Georgianna-251 Fortune, Richard-263 FOURNIER, STELLA-222,302 Fout, John-144,263 Fout, Mark-237 Fox, Deborah-118,126,198,237 FRAGA, CHARLES-222 Fraga, Mark-178,188,246,251 FRANCIS, DON-222 FRANCIS, JULIE-36,40,44,45,66,68 79,100,116,141,161,222,302,339 Francis, Kathryn-263 FRANCO, ROBERT-113,222 Franklin, Tamara-263 Frazier, Kathy-105,1 17,236 Freeland, Kim-134,157,263,264 FRENCH CLUB-149 Frey, Sam-251 Friedman, Randy-263 Frydendall, Denise-135,237 Fryman, Pamela-237 FTA-108 Fulkerson, Stanley-251 Furtney, Beatrice-237 FURTNEY, JOCELYN-222 ..G- Gade, Frank--263 Gade, Joyce-105,263 Gaenzle, Steve-263 GAFFORD, BELINDA-44,68,91,117, 290 Gagliano, Karen-237 Gaglio, 'Denis-263 Gaglio, Richard-82 GAGNON, PAM--137,223 GAINEY, BILL-251 Gale, James-120,129,237 Gale, Thomas-132,143,251 I1 - Gallag er, Beth 40,118,237 Gallegos, Deb ra-1 29,263 GAMBLE, ALLAN-40,B5,150,196, 223 Gamble, Dale-251 Garcia, Guadalupe-251 Garcia, Jerry-144,251 Garcia, Joe-120,144,251 Garcia, Josephina-263 GARCIA, JUAN-144,147,223 GARDE A, CARLOS-144,151,223 Gardea, Joe-147 Gardea, Ruben-143,147,237 Gardner, Barry-179,237,263 GARDNER, DONNIE-54,223,333 Garza, Garza, An dy-251 Ida-263,282 GARZA, MARY-66,185,223,302 Gaucin, Michael-251 Gauthier, Denise-263 Gee, Richard-251 GELDERLOOS, MARALEE-158,223 Gelder oos, Mark-45,251 I Gelsthorpe, Rick-237 Gentry, Doug las-1 95,1 97,237 Gergas, Sue-263 Gerdes, Teresa-251 GERMAN CLUB-150 Gholson, Robert-251 Gibbs, Diana-237 Gibson, Dorothy-126,251,321 Gilge r, Ma rk-43,203,251 Girard, Jeff-251 Girard, Susan-237 GIRLS CHOIR-134 O GLARD N, ANTOINETTE-104,140, 147,166,167,223,279,284 Glass, Thomas-237 Glazeb rook, Teddy-109,134,263 Glover, Deborah-105,263 Goldman, Victor-179,189 GOL F-200-201 Gonzal ez, Donya-237 GONZALEZ, ELBA-38,126,223 Gonzal ez, Patricia-251 Gonzalez, Patricia-105,263,310 Gonzal ez, Robin-251 Gonzalez, Sandy-263 Gonzalez, Sylvia-128,251,263 Gonzalez, Tony-251 Gonzal ez, Tricia-78 GONZALEZ, VIOLET-52,223,302 Gore, Nina-185,237,296 n Gorma 125,237 Christopher-18,40,120, Gorman, Terry-203,251 Gorrell, Billy-173 GOTCHER, KRISTI-14,16,67,223, 285,293,337 Gouch, Cathy-18,45,57,66,161,162 234,237,281 ,296 Goughnour, Ka rmel-251 Gould, Ruth-237 Gower, Lovanne-107,251 Gower, Paul--150,237 Grafton, Mary L.-129,237 Graham, Cathy-263 Graine y, Gloria-105,107,263 r Grall, AI-237 Grall, Harold-263 Gray, Michael-179,263 GREAS R, LINDA-113,223,303 E GREASER, PAMELA-223,303 Green, Valerie Lee-251 Greenlee, Gary-237 Grey, Mike-189 Griep, William-129,151,251 Griffin, Deb ra--263 Griffin, Jerry-33,132,136,238 Griffin, Robert-263 Griffin, William-108,110,153,238 Grimes, Georgianna-134,251 Grimes, Lisa-128,153,263 Grisham, Grady-144,238,263 Grisham, Marvin-144 csmswow, EYDIE-62,140,158,278, 282,285 Gross, Cynthia-67,251,310 Gross, Debbie-251,310 Gross, Mallory-263 GRUBER, CAROL-223 GUERRA, ANTHONY-44,223 Guerra, Carlos-179,263 Guerra, George-238 Guidry, Mark-263 Gunace, Martin'-251 Gunace, Michael-263 Guthrie, Jim-238 Guthrie, William-109 GUY, GLENN-82,223,330 Guzman, Juan-251 GYMNASTICS-198-199 -H- Haas, Barbara-25,306 Haas, John-144 Hafer, David-238 Hahn, Jerry-251 Hale, Cheryl-238,251,296 Hale, Hal-178 Hale, Jerrie-263 Hall, Barbara-129,263 Hall, Denise-238 Hall, Mary-67,251,320 Hallberg, Lance-238 Halle, Carmen-263 HALLECK, TOM--122,143,223 HALLOWEEN-54,55 Hamilton, Ivan-238 HAMILTON, JOHN-223 Hamel, Carol-263 HAMLETT, NANCY-225 Hammond, Greg-251 HANDEY, TERRENCE-223 HANNA, RUTH-86,113,224 HANNEKE, ANN-113,224 Hansel, Pamela-251 HANSEN, CYNTHIA-113,224 Hanson, Steven-42,178,251 Hard, Debra-105,128,263 Hard, Rebecca-251 Harding, John-263 Hardy, Wendy-67,129,238 HARMAN, STEPHANIE-46,224 Harrell, Jonathan-203,251 HARRIS, DONNA-231 HARRIS, GAIL-14,68,224 Harris, Karrol Sue-251 Harris, Patrick-251 Harris, Yolanda-179,263 Harrold, D-ennis-263 Harwood, Marilyn-42,251 Haseltine, Timothy-263 Haas, James-42,251 Hastings, Sheela--105,251 Hastings, Steve-170,195,232,237, 238,297 HATCH, NANCEE-111,162,224 Haverstock, Wayne-263 Hawks, Linda-43,129,263 Haynes, Ann-100,103,258,263,267, 282 Haynes, Cheryl-263 Haynes, Denise--263 HAYS, CRAIG-113,142,224 Haywood, Sharian-264 Hazel, Jim-251 Hedrick, Gary-123,170,237,238 Heinlein, Paul-188,251 Hellman, -Mary-238 HEALTH CAREERS-109 HELTON, JERRY-224 Helton, Mary-264 Helton, William-264 Henderson, Audrey-251 Henderson, Mitch-100,104f131f182, 183,185,246,251 HENDERSON, PAT-17,32,56,124, 162,168,171,190,20-4,219,224,325 Hendley, Alice-43,129,167,264 HENDLEY, JOHN-100,104,120,158, 216,220,224 Hendley, Paula-251,313 Hendrickson, John-42,251 HENDRYX, JOEL-100,104,120,132, 136,161,162,224,303,331 Henry, Hollis-11B,119,238,296 Henson, Tony Calvin-264 Hernandez, Javier-251,256 Hernandez, Linda-251 Hernandez, Mary-251 Hernandez, Norma-264 Hernandez, RlCl'1dI'Cl-15 Herold, Jerry-238 Herrera, Trinidad-238 Heuschkel, Greg-179,264 HEWES, DAN-230 Hiatt, Jan-252,314 Hicking, Cynthia-66,252 Hicking, Deborah--252 Hickman, Stephen-252 HICKS, ANGELIQUE-224 Hicks, Deborah-238 Ann Savino strolls with a baby carriage in the senior production. HICKS, LARRY-45,61,120,121,124, 158,161,162,224,295,190 'Hicks, Robert-264 Hielaert, Fred-252 HIGDON, JANET-224 Higdon, Kathy-238 Highsmith, Nora-252 Highsmith, Sue-105 Hightower, Sheila-105 HIJAR, ALFRED-128,129,224 Hiiar, Gloria-252 Hill Carol--42,252 Hill Charles-129 Hill, Dennis-264 Hill, Mike-123,171,177,238,264 Hill Randy-144,264 BENDY-224 HO, Ho, Henry-143,252 Hodge, Kerry-252 Hodnett, Marta-264 'Hodson, Michael-252 Hoff, Robin-137,252,314 Hoff, Terry-238,252 Huizar, Carol-129,238,313 Huizor, Edwin-129,264 HUIZAR, HOPE-40,224,312 Huizdak, Stephen-252 Humphreys, Norma-265 Hunt, Patricia-252 Hunter, Christy-265 Huntsinger, Charles-252 HURD, DEBRA-40,45,117,129,148, 158,224 Hurd, Stephen-42,129,151,252 Huscroft, Robert-144,265 Hvzidak, Steve-143,151 -1- Inman, Kathryn-252 Inman, Mark-179,265 Inman, Matilda--238 Hogan, John-148,264 Hogue, Robert-143,264 Holguin, Larry-264 HOLLEBEKE, MARY-66,105,117,118, 14O,224,278,290 Holt, Karen-264 Holt, Patrick-252,144 Holt, Stephen-238,144 HOMECOMING-50-53 HONEA, JENNYE-224,285 Hoock, Diane-46,67,104,105,107, 109,153,238 Hooper, Bill-264 Hooper, Marcia-238,292,296 Hooper, Patsy-13O,167,252,293, 314,316 HOOVEK, YVETTE-224 Hoover, Belinda-118 Hoover, Glenn-190,238 Horn, Tommy-143,238 HOSEY, PETER-62,143,15O,224 Hosley, April-43,264 Hosmer, Leslie-144,252 Houston, Dave Lee-238 Houston, Franklyn-252 Hover, Belinda-238,296 Hover, Jim-264 Hoy, Ronald-265 Hrdlicka, Steve-144,147,252 Huckabee, Jeff-129,252 HUDGINS, CYNTHIA-224 Hudson, Robert-86,113,238 Hudson, Robin-252 HUFF, HAROLD-113 Huff, .leanene-252,314 HUGGINS, MARY-234 'Hughes, Gary-124,171,194,252 Hughes, Karen-132 HUGHES, KATHY-224 Hughes, Patricia-42,264 Most school spirit was awarded t EHS the most support. .J- Jabalie, Cynthia-252,316 Jacquez, Robert-143,265 Jackson, Arthur-238 Jackson, John-144,238 Jackson, Margaret-252 Jacobelli, William-170,238 JAGE, RICHARD-110,132,136,224 Janis, Dane-252 Janousek, Eddie-195,197,238 Jarvis, Daryl-238 JARVIS, DONNA-224,303 J arvis, Joyce-252,321 JARVIS, MIKE-183 Jefferson, Dwight-232,252 Jefferson, Sheila-104,105,118,167 238,306,312 JEFFERSON, SHERMAN-224 Jenness, Johns, P Carol-238 aul-238 Johns, William-129,265 Johnson, Allen-46,103,193,238 Johnson, David-151,224 Johnson, Edward-238 Johnson, Georgiann-43,104,265 Johnson Linda-238,241 Johnson, Linda-238 Johnson, Lisa-261,265,282 Johnson Patrick-178,195,252 Johnson, Randal-238 Johnson, Robin-42,252,314 Johnson, Steve-178,252 Johnson, Terry Lynn-252 Jolly, Kim-118,252 JONES, ALAN-234 Jones, Bonnie-105,162,238,306,313 Jones, D Jones, Li ebra-67,204,252,316 nda-105,265 Jones, Mary-105,107,108,126,252 Jones, D. Michael-148,183,185,238 Jones, Mike-143,224,238 o Davette J uen and Don Gardner for getting INDEX 333 161 ,1 62,225,278,326 Jones, Paul-238 Jones, Rachel-252 Jones, Ross-129,265 Jordon, Maralee-238,312 Jordon, Roger-238 Jordon, Randall-103,252 .lUEN, DAVETTE-17,50,56,67,69, 100,140,166,222,224,278,333 Jury, Kenneth-143,252 -K- Kaake, .left-238 KAAKE, VALERIE-224,302 Kalmbacher, Paul-302 KAPPA DELTA--153 Kass, Cecilia-265 Kaufman, Linda-252 Kays, John-179,265 Keffer, Michael-143 Keith, Kevin-132,238 Kelly, Donna-42,66,104,105,1 15, 134,252 Kennan, Nancy-238,296 Kennan, Sherri-105,265,269,282 KENNEDY, MICHAEL-150,224 Kennedy, Pat-38,238,307 Kepler, Rickey-179,265 Kerns, Arthur-252 Kessel, Pamela-239,296 Kettenring, William-42,89,108,110, 128,252 Key, Scott-54,170,239 KEY CLUB-120 Kilgore, James-44,55,252 Kilmer, Mark-265 Kilstrom, Lee-265 Kimbrell, Arleen-265 King, Gay-265 King, Jeff-239 King, Louis-144,265 KING, MARTHA-265 KING, RALPH-104,'l20,'l45,l52, 158,161,265 Kistenmacher, Julie-43,118,202, 265 Kistenmacher, Katherine-43,132,252 KITCHEN, CLAUDE-127 Kittel, Phillip-252 Kleinschmidt, William-144,265 Klundt, Gordon-239 Laziest Chris Shelton and April Vaughn are caught stopping for a quick snooze between classes. Kmetzsch, Karen-239 Knight, Cloyd-252 KNIGHT, DENNECE-45,68,103,152, 158,161,162,224 Knight, Joe-265 Knight, Valerie-239 KNOPPERS, N'lCK-129,224 KNUDSEN, KRISTA-132,136,225 Koehler, Dennis-13,123,170,239, 307 KOLSTER, FRAN-40,104,239,290 Kostielney, .Iacquelyn-239 Krenzer, Ellen-252 Kuenzli, Kevin-239 KUHN, GLENN-225 Kun, Estella-252 Kurns, Paula-43,265 KUSHEN, ANITA-66,91,118,119, 140,150,225,279,290 Kusserow, Alice C.-43,132,252 -L- Lacluca, Joseph-252 Lally, Harry-239 Laman, Jane-33,136,239 Lamothe, Donna-43,129,265 Lanclsheet, Brian-265 Lane, Lane, Debbie--265 Deborah-135,265 Lane, Durenda-145,252 Lane, Gary-265 Lane, Randall-143,265 Lane, Kenneth-61,125,200,239 Lane Patricia-59,117,185,232,239, 293,296 Lange, Ronald-33,132,178,252 Langford, Ronald-239 Lantis, Barbara-104,239 Lantis, Judy-252 Lantis, Robert-252 Larson, Alice-42,132,252 LARSON, CLARK-192,225 Larson, Debbie-132,239,241 LARSON, EDWIN-225,252 Larson, Janey-132 Larson, Kendall--33,77,132,136,239 Latura, Cynthia-265 LATIN CLUB-148 LAWRENCE, RONALD- Lawson, Donna-105,252 Lawson, Jeffery-109,144,147,239 Lechuga, Bernardine-265 Lee, Carol-'l03,167,246,252,314,316 LEE, PHYLLIS--225 Lee, Roderic-123,170,239 Leffers, Murray-239 Leftault, Bill-144,147,265 LEFTAULT, JOHN-88,110,145,147, 225 Leftault, Robert-144,147,239 LEHMAN, PAMELA-225 Lehman, Scott-265 Leincl, Stephan-225 Leitch, Barbara-239 Lemmon, Heidi-239 Lemmon, .lack-47,179,265 Lemmon, Steve-179,265 LeRoy, Rodney Dean-177 Lester, Chris-103,132,136,232,239, 244,296 Leverett, Barry--239 Levy, Cecilia-265 Lewis, Judy-104,1 18,239,296 Lewis, Ronny-178,252 Lewis, Shawnette-105,108,239 Licon, Walter-265 Lide, Linda-66,113,157,239 Lide, Henry--152,178 Lindley, Kerri-239,307,313 Lindsey, Marsha-239 Loiselle, Elaine-42,43,252,286 LolsELLE, LOUISE-45,68,117,140, 158,162,225,278,293 Long, Robert-265 Looman, Peggy-253 Lopez, Eric-266 Lopez, Fernando-266 Lopez, Frank-161,252 Lopez, Denise-253,265,316 Louis Barragan recounts his daily routine Lopez, Linda Lopez, Patrick-266 Lopez, Ricky-45,160,161,239 LOPEZ, SYLVIA-45,69,116,1 17,140, Loranc, Valerie-239 Lord, Joe-266 Lotspeich, Myrth-115,128,253 Lovelady, David-266 Loving, Bill-239 Lowe, Carol J.-253 LOWE, JOHN-150 LOWTHER, APRIL-225 LOYA, CYNTHIA--86,225,303 Loya, Felix-40,171,239 Loya, Frank--237,253 LOYA, MARTHA-44,67,225,302 Lubecki, David-253,266 Lubecki, Stephen-148 Lucas, Ronny-152,239 Lucas, Stephen-261,266 LUCKY, DAVID-91,104,125,181, 183,185,187,225 Luebke, Tom-239 Luian, Jeanette-117,239 Luna, Abel-144,129,253 Luna, Greg--266 LUNA, LUCY-117,129,150,225 LUND, TRACY-20,38,68,137,216, 225,282,285 Lundburg, Leanne-239 Lundburg, Lon-266 LUNSFORD, PEGGY SUE Luther, Mike-266 Lynch, Daniel Lynch, Kathleen126,239 LYONS, TOMMY-40,120,129,148, 193,225 -QMC.. MCANINCH, PAM-40,94,1 16,140, 158,225,279 McBride, Donald-43,129,266 McCall, Rosalie-239,313 McCarthy, Gary-42,253 McCARTHY, NANCY-126,225,290 McCarthy, Robert-266 McCarty, Karen-266,282 McCarty, Kathy-67,240,296 McClain, .loan-43,179 McClain, John-266 McClendon, David-266 McCLENDON, OLON-91,124,154, 158,169,225 McCloskey, Frank-266 McCoy, Jason-129,143,266 McCoy, Michael-25 in the senior play, lnfancy. McCoy, Walter-123,195,196,240 McCray, Carma-105,266 McCRAY, CATHERINE-67,157,225 McCuaig, Billy-179,266 McCuaig, Finley-253 MCC urry, McCu rry, Diane-126,253,310 Nancy-266 McCutcheon, Joe-253 McCutcheon, Robert-240 McDaniel, Jerry-132,134,266 McDonald, Bruce-240 McDONALD, MARCIA-105,1 10,225 McDONALD, PAT-226 McDonald, Scott-266 McDonald, Sherry--43,105,266 McElveen, Crystal-105,266,269 MCELVEEN, DENNIS-195,197,226 McElveen, Jack-253 McFarland, Keith-266 MCGILLIVRAY, JAMES-226 McGillivray, Sharon-266 MCGlNNlS, KAREN-158,266 McGinnis, McGinnis, McGrane, McGrath, Michael-178,240 Philip-253 Deborah-266 Wendy S.-135,253 McGrifl, Scott-123,168,190,205,240 McGuire, Terrie-253 McKnight, Ronald-253 5 .. McLaughl McManus, McManus, McMan us, n, Gary 240 Carol-103,246,253,320 Cathy--104,253,321 Jonathan-240 McMaster, Norman-266 McNeil, Sharon-105 McNicol, Gregory-129,240 McNicol, Robert-189,266 McNiece, Ray-240 McNiece, Russell-266 McPherson, Vicki-266,271 -M- MABREY, LLOYD-1 13,226 Mabrey, Richard-266 MacDonald, George-266 MAGNES5, JACKI-12,69,104,141, 226,278,284 Mahaffey, Gary--195,197,253 Maldonado, George-240 Malone, Sonia-266 MALOU F, JILL-226 Malouf, Kay-266 Malphurs, Ralph-42,144 Malphurs, Roy-266 Manning, Debbie-129,253 Marble, David-253 Marble, Susan-134 Moreno, Anne-118 Markel, Melinda-132,136,253 MARKESON, ANNE-36,40,45,62, 66,68,100,141,158,226,178,282, 285,293 Margrave, Susan-266 Marsh, Francie-240 Marsh, Lani-134,266 Martin, Albert-240 MARTIN, REBECCA-226 Martinez, Ann-43,128,266 Martinez, Mary-240 MARTINEZ, OSCAR-120,123,195, 197,226 MARTINEZ, PAM-226 Martinez, Richard-129 Martinez, Susan-266 Martinez, Theresa-126,253,311 Mason, Debra-240 MASON, MICHELE-40,67,198,226, 290 Masters, Steven-253 MASTERS, KATHY-45,158,161,226 Masters, Keith-125,220,240 Masterson, Anne-134,266 Mathews, Amanda-43 MATTHEWS, JOHN-171,173,226 Mattingly, Pamela-105,266 MAYTON, JOHN-226 Meacham, Peggy-148,266,268 Means, Grace-115,253 Medina, Carmen-35,40,41,47,103, 104,150,152,24O MEEK, BURNEY-226 MEINKE, SANDRA-109,150,158, 159,226 Meister, Michelle--266 Mendez, Diana-266 Mendez, Leticia-266 Menser.. Jacquelyne-148,267 Menser, Jacquelyne-148,267 Menter, Tommy-144 Merrell, Kathy-42,267 MERRIHEW, DEBBIE-226,303 Merrihew, Michael-113,240 Merrihew, Rhonda-267 Meyer, Richard-253 MEYERSON, BRUCE-226 Michael, Angela-240 Michael, Glenn-267 Michaud, John-253 Milholland, Tom-134,267 Miller, Cheryl-267 MILLER, DEBRA-64,65,226,282,285, 290,293,330 MILLER, DIANA-227 MILLER, GARY-227 Miller, Glenn-253 MILLER, JERRY-267 Miller, Michael-180,184 Miller, Michael-124,180,184 MILLER, PEGGY-227 Miller, Ricky-151 Miller, Sharon-253,293,316 Miller, Terry--253 Minellono, Mary Jo-240 Minter, David-267 Minter, Thomas-240 MIRELESS, EDWARD-227 Mireles, Glenn-253 Mitchell, Marie--67,108,240 MITCHELL, SHERRY-37,105,108, 110,118,227 Mitchum, Sherry-115,254 Mizer, Daniel-254 MIZER, DEBORAH-126,198,227,303 Moeck, Robert-179,267 Moegling, Meredith-167,241 Moilan, Patricia-254 Monticone, Joe-254 Montilione, Alan-267 MOODY, CAROLYN-40,59,66,132, 227,290 Moore, Donna-132,241 Moore, Mark-126,198 Moore, Sallie-37,105 More, Vanessa-105,132,136 Moreland, Patricia-132 Mora, Bernard-241 Morales, Cynthia-129,149,254,310 Morales, Yvonne-105,254 MORAN, LYNN-227 MORDECAI, DAWANA-227 Mordecai, Lacey-128,254 Norman, Sherri-105 Norris, David-241 Northcutt, Mike-267 Moreno, Armando-267 Moreno, Frank-267 Moreno, Norma-134,254 MOREN O, SYLVIA-227 Moreno, Vickie-267 MOREY, SUZI-227,284 Morgan, Dennis-254 Novak, Jo Anne-108,117,129,241 MORGAN, SHARLA-227 MORGAN, TOMMY-227 Morris, Alan-241 Morris, Burke-254 Morris, Glenda-267 Morris, Patrick-254 Morrison, Danielle-254 Morton, Melody-241 Mosby, Mike-241 MOSER, KEITH-46,91,227 Mosher, Shirley-148,267 MOSHER, KATHLEEN-66,148,227 Mowad, Leslie-203,254 Mueller, Doreen-267 Mueller, Diane-43,254,316 Mueller, Karen--254 MUELLE Mullins, Mullins, R, ROSE-111,227,285,331 Dwight-254 Bobby-132,136,144,241 Mullins, Freddie-134,144,267 Mullins, Lynn-123,143,241 Muniz, Frank-241 MUNOZ, JORGE-227 Munoz, Maria-267 MURRAY, LANCE-36,39,45,100, 104,120,121,158,161,216,227 Murrell, Larry-267,293,296 Murry, Cindy-139,179 Murry, James-132,267 Musshorn, Donna-267 Myre, Gayle-254 Myers, Charles-241,267 Myers, David-254 -N- Nabhan, Bernadette-241 Naiey, Dawn-126,254 NAKOVIC, GARY-195,197,227 Nakovic, Toni-254 NARRO, RICHARD-86,113,227 Narra, Robert-254,257 Narro, Ruben-267 Nash, Robert-129,241 NATIONAL 'HONOR SOCIETY-40- 41 NATIONAL JUNIOR HONOR SOCIETY-42,43 Navar, Carmen-241 Navar, Martha-103,128,167,267 Neavin, Donald-143,241 Neavin, Nadine-109,254 Nebhan, Catherine-241 Neely, Kathleen-105,107,1 17,267 Neilson, Pam-113 Novak, Kathleen-241 Novak, Stephan-254 Nunez, Grace-86,113,241 Nutter, Elizabeth-241 Nutter, Steve-241 -Q.. Oakley, Dennis-102 Oates, Mark-144,147,267 Oaxoca, Martha-267 O'Beirne, Mary-43,105,107,109, 254 O'Beirne, Robert-109,241 O'Beirne, Virginia-241 O'Leary, Eclward-267 O'Leary, Pat-267 Olivares, Eddie-195,197,254 Olivares, George-144,254 Olivares, Jesus-254 OLIVARES, ROBERT-37,44,228 Olivas, Daniel-267 Olivas, Ricardo-241 Olivas, Ruben-260,267 Olsen, Janet-97,254 OLSON, DYIANNE-68,140,228,278 Olson, Eric-254 Olson, Janet-43,126,254 OLSON, RICHARD-228 OLSON, TED-170,228 OLSON, TERRI-110,228 O'Neil, Kenneth-254 O'Neill, Velvie-267 ORONA, EDWARD-228 Orona, Irene-241 Orona, Sylvia-268 Orona, Yvonne-254 Orr, Donald-241 Osburn, James-144,254 Osborne, Joseph-268 Osborne, Robert-254 Oswald, Susan-67,129,151,254 Overton, Desiree-148,268 Overton, B. J.-201,242 Owens, Paula-254 -p- Page, Billy-150 Page, Richard-129,145,249,254 Palmer, Jimmy-254 Palmer, Sally-268 Palmer, Thomas-268 Parker, Charlene-242 Parker, Cheri-149 Parker, Ronald-80,242 Parrish, Robert-268 PARKER, STEVE-112,228 PARRISH, RONALD-189,228 Parrott, Angel-268 Parsons, Jonathan-268 Nelson, Damie-267 Nelson, Debbie-228 Nelson, Diana-134,267 Nelson, Kirk-42,47,80,178,254 Nelson, Stephen-178,188,247,254 Nesloney, Patricia-267 Nevarez, Bertha-228 Nevarez, Elizabeth-267 NEVAREZ, JOHN-132,143,228 Nevarez, Pamela-67,254,313, 321 Neuville, Brady-254 Newkir k, Pamela-254 Newman, David-144,267 Newton, Deborah-267 Nichols, Brenda-254 Nichols, Colleen-24,134,267 LS, JO BETH-228,284,336 NICHO Nieman, Otto-254 Niglio, Emelio-228 Niglio, Helen-109,254 Noel, Rebecca-105,254 Nolan, NORDE Te rre nce-254 LL, LEONARD-87,122,124, 171,228 Parsons, Robert-178,255 PASCHALL, MARK-113,228 Patero, Phoebe-255 Patterson, Edward-151,255 Patton, Debra-268 Paulk, Sheri-255,317,321 Pavoggi, Donna-268 Pavoggi, Janice-126,242 Paxson, Kim-43,203,255 Paxson, Lynn-43,105,167,258,259, 268 Payne, Dee Gloria--242 Payne, Rita-255,317 Payte, Larry-268 PAZ, IRENE-140,147,216,22S,27B, 285,293 Paz, Jesus-143,268 Peace, Raleigh-255 PELLETIER, JOSEPH-94,228 Pelletier, Rosanne-268 PELLICANO, DOLORES-228,290 Pendley, La Vonne-268 Pendergrass, George-129,179,268 Pendley, Don-113,242 PENLEY, LESLIE-37,45,90,228,290 Perkins, Cynthia-268 Perkins, Leon-144,268 Pero, Denise-255,317 Pero, Gary-242 PERSONS, JANET-45,67,69,100, 140,158,166,167,228,278,292 Peterson, Elizabeth-268 Peterson, Harry-242 Peterson, Thomas-255 Petrosky, Patricia-105,1 17,242 Pfeifle, Linda-242,296 Pfoutz, Susanne-43,148,268 Phaup, Robert-144,242 Phillips, Deborah-268 Phillips, Donna-51,253,293,315 PHILLIPS, RONNIE-183 PHILLIPS, SUE-21,50,53,60,64,140, 166,204,228,273,285,292 PHILLIPS, VALERIE-14,32,40,44,50, 68,100,104,105,107,117,140,158, 166,228,279,285,292,332 Picken, Jenny-13,35,59,103,126, 130,132,242,297, PICKEN, TOMMY-122,124,168,171, 219,228,237 Pickett, Keith-43,128,189,268 PICKERING, HILDEN-145,228 Pickle, Marsha-268 Pier, Alicia-46,255 Pierce, John-144,242 PIERCE, TOMMY-228 Pike, Michael-255 PIRAM, BARBARA-40,104,140,158, 228,279,302 Pittard, Robert-255 Pittman, Debra-268 Pittman, Kathleen-118,242 Pleasants, Laura--128,268 Polanco, Sylvia-255,315 Polk, Paul-33,35,40,46,93,120,132, 154,242 PORRAS, ARTURO-228 Porras, Ida-268 PORTER, PEGGY-111,228,302 Porter, Ricky-125,171,242 PORTER, ROBERT-228 Possiclente, William-242 Powell, Pam-268 Powers, Mary-40,1 17,242 Prather, Cheryl-255 A chance encounter brings shyest Wendy Ehrlich and Robert Egge- meyer together. Ra ncich, Steve n-268 Sewell Prather, Ronald-144,147,255 PRENTICE, JERRY-228 Price, Carol-242 Price, Charlene-268 Price, David-178,255 Rasmus, Robert-242 Rathbun, Karen-43,268 REGAN, CHRIS-17,170,171,285 Regan, Paul-170,171,242 Redus, Robert-268 Price, .lack-178,255 REED' DEBORAH-228 Price, Larry-120,121,255 Reed' La,.,.y-145,147,255 Reese, Robert-120,203,255 REESE, WESTON-120,121,202,229 Price, Linda-42,105,107,135,255 PRICE, SUSAN-40,47,66,104,118, 1501152 Regan, Chris-17,124,170,171,229, Prine, Barbara-108,110,126, 285 255 Regan, Paul-124,170,171,241 PRINE, CHARLEY-142,228 Reid, ,,m-268 Prine, Denise-268 Prine, Susan-108,242,307 Provost, William-233 Pryor, Carl-145,255 Puffer, 'Irma-105,268 Pugh, Mary-129,255 PULLEN, MATT-228 Pummill, Mike-255 Pummill, Stephen-268 Purr, Mike-109 Putnam, George-242 Pyle, Cindy--255 Pynes, Patrick-143,268 Reihms, D-ebra-74,105,254,255 Reinhart, Jeff-188,255 REINHART, MARTHA-204,229,285, 290,293 REVEILLE--158-159 Reynolds, Margaret-268 Rhodes, Cyndy-255,317 Rhymes, Sheila-43,100,134,258,268 Ricci, Carol-135,242 Rice, Charles-255 RICH, ROBIN-171,229 RICHARDS, CELIA ANN-229 RICHARDS, CINDY-129,158,229 RICHARDSON, ANDIE-33,132,136, -Q- 137,154,15a,229 Richter, Heidi RICHTER, MARLENE-35,40,45,104, 1A16,149,158,161,229 Ricks, Jack-129,242 Rinker, Dennis-179,255 Ritter, Ronald-145,255 Qualls, Lynn-228 QUALLS, PHILLIP-113 Quimby, Michael-134,268 Quisenberry, Connie-282,268 -R- Rivas, Adrian-268 Rivas, Patricia-105,269 Rivera, Charline-65,167,255,315, Rainwater, Dominick-144,147,268 317 Ramirez' lHUmbeff0-255 Rivera, Christine-59,204,255,315, Ramos, Sandra-268 317 Rampy, Kim--130,268 Ramsey, Kathy-51,167,258,262, 268,282 Ramsey, Kenneth-35,40,80,183,185, 242 Roach, David-269 Roach, John-269 Robb, Don-42,128,151,269 Roberts, William-148,269 ROBERTSON, GARY-229 ROBERTSON, LARRY-1 13 Robinson, Jacqueline-269 Robinson, Stephan-129,242 Robison, Nancy-269 RODEO CLUB-156-157 Rogers, Dana-269 RASCO, BOBBY-232 Rasco, Rocky-268 Rasco, Tony-123,195,197,255 Rasmus, Lynn-268 RASMUS, PAUL-228 .lo Beth Nichols tries to persuade Jim Boyle that there is really nothing funny about being chosen wittiest in the class. Q11 M ff wwf- swf' wfvf--s.4f f'u s.-.vvuu - .mes-W . L sf Joel Bass, Pete 'Hosey, and David Candelaria plaster Nancy McCarthy with pie Rogers, James-269 ROGERS, SHEILA-45,66,97,117, 126,158,159,229,29O Rollins, Danette-65,105,269 Rollins, Mark-255 Romano, Anne-255 ROMANO, RICHARD-229 Romo, Pat-269 Roscoe, Cynthia-255 Roscoe, Tony-118 ROSEBORROUGH, KAREN-229 Roseborrough, Linda-269 ROSPRIM, JOHN-229 ROTC--142,143,144,145,146, 147 ROYAL VISITORS-68,69 SCARBROUGH, JANE-111,229 Schade, Darlene-202,203,243 Schade, Ronald-269 SCHAFER, CARMEN-229 Schatte, Alvin-269 Scheffler, Diantha-118,255 Scheftler, Lisa-46,153,269 SCHEIE, JAY-143,229 Schick, Deborah-269 Schick, Diana-269 SCHOLLITT, DIANE-118,229 SCHOOL BOARD-208,209 SCHURTZ, LESLIE-229 Schwartz, Jane-344 Schwartz, Sandra-243 Scoggin, Robert-42,144,269 Searcy, Nancy-167,258,269 Ruiz, Christina-149,269 Ruiz, Rueben-269 Rusch, Debbie-269 Rusch, Donna-255 Russell, Denny-255 Russell, Edward-242 RUSSELI., KEITH-4O,44,120,229 RUTH, JENNIFER-4O,41,45,158, 229 RUTHERFORD, RAN-DI-66,73,1 18, 140,229,279,290,293 Rutter, Ceciliann-255 SEARS, WILLIAM-151,229 SEELMEYER, LINDA-66,86,111,229 Segapeli, Joseph-42,178,255 Segapeli, Renee-137,243 Sellers, Earnestine-269 Serafin, Angelica-75,269 Severs, Dan-120,255,257 Severs, Janet-269,282 Severs, Jean-269,282 Sewell, Allan-100,195,197,232,243 , Nancy-102,103,105,269,282 Rutten, Jack-145,269 ..5.. Saavedra, 'Henry-243 Sabatini, Richard-132,143,147,255 Sabin, Carolyn-134 SABRE-160,161 Sewell, Twilight-255 SHAFFER, GREG-34,124,128,229 Shahan, Corby-66,256,293,316 SHAHAN, KIM-45,67,69,195,218, 229,282,284,285,290,292 SHAMBROOK, TERRY-38,46,66,132, 1 36,229 Shan Iey, Do rena-243,306,307 Sackett, Mark-243 Sainz, Lillian-243,307,313 SALAZAR, SUSAN-104,229,303 Salazar, Tony-82 SALCEDO, MARK-229 SALTATRIX-144,115 SALUTE-162,163 Sampsell, Scott-129,255 Samuels, Sanchez Sanchez Sanchez, Sanders, I Harry-42,255 Cecilia-40,1 17,243,307 Jose-42,120,255 Patricia-109,255 Ga ry-201 ,255 Sanderson, Barbara--344 Sanderson, Theresa-43,108,1 15, 118,255 Sanetra, Catherine-243 SANETRA, CYNTHIA-126,229 Santangelo, Philip-269 Santee, Roger-255 Santiesteban, Bobby-73,195,197,243 SAVINO, ANN-15,45,66,68,104, 137,158,216,229,284,290,293,300 SAWYER, BRENDA-229,290,303 Sawyer, Daniel-269 Shannon, Mike-256 Sharpe, Vernon-256 Sheehan, Terri-42,256,320 SHELTON, CHRIS-334 SHERLIN, CRAIG-229 Sherlin, Kevin-195,197,243 Sherlin, Missy-43,256 Shikoski, Edward-129,269 Shoemaker, Brenda-243,297 Shouppe, Stephanie-270 Shoppach, Laurie-105,270 Shouse, Carl-143,256 Shouse, Frank-270 Shouse, Karen-105,270 Shugert, Edward-103,256 Shumway, Donna-270 SIGMA CHI-312-313 SIKES, DEBRA-149,229 Sikorski, Helene-255 Silkwood, Mark-256 Silva, Carlos-170,243 SIMMONS, ERNEST-156,157,229 Simmons, Rhonda-98,126,258,311 Simon, Nicholas-143,256 Simon, Winston-256 Simons, Jenny-256 Simonetti, Carolyn-167,256,315 Simpson, Lanell-256 Singleton, Margaret-270,282 Skelton, Darlene-243 Ske rko wski, Ellyn-256,321 SKERKOWSKI, MARY-44,229 Slater, Linda-128,256 SLATER, NANCY-230 Slaughter, Chuck-144,270 Small, Tammy-143,256 SMELTZER, CHARLES-132,230 Smith, Ami-105,256 Smith, April-270 Smith, Ava-270 Smith, Catherine-270 Smith, Deborah-256 Smith, Debra-243 Smith, Diane-256 Smith, Jack-118,270 Smith, James-243 Smith, Jeff-188 Smith, .loseph-256,257 Smith, Karen-256 Smith, Kathryn-270 Smith, Smith Kimberly-46,132,154,243 Lu Ann-116,243 SMITH, PAULA-112,230 SMITH, RICKY-91,120,124,192,230 Smith, Smith, Robin-156,270 Ronald-144 SMITH, SARA-132,136,158,159,23O Smith, Smith, Stephan-243 Steven-140,147 SMITH, SUSAN-230,303 Smotherman, John-144,270 Smyth, Greg-118,256 SNEESBY, KERRY-105,230 Snider, Frank Russell-243 Snider, Liz-46,153,270 Snider, Susan-43 Snow, Dawn-270 Snow, William-256 Sookiasian, Thomas-256 Son, Gary-252,256 Soto, Patricia-270 Soto, Rudy-243 Soza, Wayne-42,120,195,197,255, 256 Spain, Raymond-189,270 Spaugy, Debra-137,243,296 SPEECH-92-93,154-155 SPECK, VlCKl-66,109,132,230 Spence, Joseph-46,270 Spidle, Teri-243 Spillman, Stephen-125,195,197,243 Spindler, Carla-243,245,306 Spindler, David-188,256 SPONSORS-140-141,278-279 Sprague, Jean-243 Sproull, Brian-144,150,256 SPROULL, WILLIAM-230 Staats, Russell-256 Stains, Frank-256 STAl.l.lNGS, MILDRED-111,230 STANFIELD, MARY-132,230 Stanford, Karl-189,270 STANFORD, RICHARD-113,147,230 Stanulonis, Anthony-144,270 Starkey, James-151,243 Starns, Jack-256 STEAD, LARRY-122,124,194,230 steep, CAROLYN-45,134,230 Steele, Denise-126,256,314 Steele, Sherri-258,270,282 Steele, Steve-123,124,170,243 Stell, Lisa-132,256 Stenson, Melanie-105 Stepanski, Gloria-270 STEPANSKI, MARY-230,303 Stepanski, Susan-67,118,243,312 Stephens, James-271 Stephens, Chirley-42,129,256 Stephens, Michael-244 Sterner, Lucinda-256 Stevens, Gloria-244 Steven s, Ronald-43,270 Stewart, Janet-256 Stewart, Sha ron-256 Stiles, Debra-256 STILES, GARY-230 4 Thompson Thompson Thompson Thompson Thompson Thompson, Thompson, Taylor, Lloyd-185,244 Tellez, Fred T.-256 TENNIS-202-203 Tennison, Pricilla-271 Teran, Eddie-271 Teran, Norma-43,271 Terrazas, Daniel-132,256 Terrazas, Rebecca-135,271 Terry, Anna-271 Terry, Barbara-244 TEXTOR, DEBBIE-230 Textor, Linda-117,244 Textor, Roy-271 THESPIANS-46-47 Thomas, Betty THOMAS, CARLA-40,44,62,66,86, 136,141,230,279 Thomas, Edward-271 Thomas, Ellen-42,129,256 THOMAS, PATRICIA-92,230 Thomas, William-188,256 Beverly-271 Dena-108,256 ' Thompson, , James-43,148,271 Monica-244,313 Roge r-244 Sean-103,256 Sheila-256,313 Stuart-244 Thomsen, Dennis-144,256 Thoreson, Karen-43,202,205,256, 321 ri-ioResoN, MARTHA-34,aa,a9,4o 116,129,148,230 As the odd couple of the senior class, Kristi Gotcher and Klaus Engelhardt show that it is possible for opposites to attract. Stiles, Jerry-271 Still, Richard-256 Stilwell, Stephanie-42,271 Stinson, Melanie-271 Stone, Kenneth-271 Stone, Ronnie-256 Stone, Vicki-203,256,315 Strachan, Wayne-256 Strainer, Cindy-118 Strangeways, Mary-105,1 10,250, 256,311 Strickland, Susan-43,203,256 Stricklin, Cynthia-135,148,256 Stricklin, Deborah-105,135,244 STRONG, CARR--39,40,230 Stuart, Carson-129,256 STUART, LESLIE SU-14O,230,278, 285 Stuart, Sidney-129,271 STUDENT COUNCIL--100-101 Stover, Debra-256 Summers, Cheryl-256 Summers, Michael-244 SUN BOWL SUN CARNIVAL-58-59 SUTTON, REDA-230 SURRATT, RICK-125,170,172,175, 176,219,230 SWAIN, JULIE-230 Swain, Lynn-106 Swain, Margaret-271 Swanson, Karen-129,271 Swasey, Jane F.-256 Swearingin, David-143,271 Swearingin, Philip-144,256 Sweet, Deborah-271 -1'.. TALA-110 Tanchester, Marc-46,153,269,271 Tarantola, Angela-271 Tarantola, Carmella-118,244 Tarvis, Daryl TARWATER, ANNA MAE-40,44,230 Tapp, Elizabeth-129,256 Tate, Mark-256 Taylor, Cheryl-256 TAYLOR, DEBORAH-230 Taylor, Kevin-188,256 Taylor, Kim-271 TAYLOR, LA SELLE-125,180,182, 183,1 84,1 86,204 Taylor, Layne-178,256 Taylor, Lillian-132,256 Taylor, Linda-67,244,306,307 Th rash er, Sal ly-42,56,1 15,246,256, 314 Thurmond, Sherry-256 Thurmond, Terry-256 Tibbs, Cheryl-251,256,320 Tiffany, Evelyn-33,4O,132,244 Tiffany, John-42,147,148,256 Tiierina, Laura-271 Timmons, Doris-271 Timmons, Robert-271 Tinaiero, Carmen-42,256 Tinguely, Diane-244 ' Tinguely, Thomas-256 Tisdale, Debra-117,118,119,244 Todd, Clifford-271 Todd, Monica-244 Todd, Robert-201,271 TOMLINSON, 'DANE-230 Tomlinson, Merala-105,134,271 Torres, Marta-271 Torres, Michael-195 Torres, Teresa-256 TOWNS, BARBARA-44,67,1 17,230 Townsend, Judy-134,271 TOWNSEND, MARTIN-35 Townsend, Susan-132,244 Joel Hendryx does his thing in the senior play production, infancy, INDEX 337 Townsend, Van-122,125,194,204, 244 Townsley, Michael-179,271 Townsley, Richard-256 TRACK-194-197 Travis, Dean-244 Traylor, Leslie-271 Treadaway, David--144,271 Treadaway, Donald-148,271 TRIMBLE, CRAIG-85,230 Trevino, Violeta-271 TROOPERETTES-138-139 Trower, Jeff-144,271 True, Joni-42,271 Tucker, Karen-43,105,128,271 Tufts, Elizabeth-256 Turner, Earl-244 Turner, Jackie A.-244 -U.. UREY, MARGO-126,230,290 Urey, Mark-179,271 Uroda, Debbie-43,47,129,272 ..V- Valdez, Belda-272 Van Cleave, Marilyn-43,126,256,321 VANDERROEST, SUSAN-230 Van Kleef, Bobbi-244 VanMatbe, Bernard-144,272 Van Nortwick, Elaine-272 Van Nortwick, Eric-178,256 Vanzant, Keith-144,256 Varenkamp, Cathy-105,272 Vargas, Rogelio-244 Varley, Ann-244 Vasey, Debbie-35,244,293,297 Vaughan, Helen-244 Vaughan, Paul-190,244 Vaughan, Tom-244 Vaughan, Sheri-105,148 Vaughan, Warren VAUGHN, APRIL-230,285,334 Venable, Jerry-134,189,272 Venable, Robbie-40,117,129,132, 136,244,307 VENITE FIDELIS-320 Verbeke, Donald-144,272 Verbeke, Doug-272 Viera, Richard-244 Vilchis, Ann-272 Vilchis, Leticia-132,244 Villarreal, Glenn-124,171,192,244 Villarreal, Manuel-272 VILLODAS, ANDRES-230 Villodas, Jose-134,272 Vinson, Joe-185,256 VINSON, LISA-230,284 Visco, Francis-272 VOE-1 'I 1 Voelcker, Gabriele-37,46,104,153, 256 Vogel, Charles-195,197,256 Vogel, Christine-272 Voorheis, Philip-178 Vugteveen, Lori-272 -W- Wadleigh, Steve-272 Waggoner, John-257 WAGNER, LESLIE-231 WAITS, WARD-113,231 Walder, Mike-144 Walker, 'Debbie-134,272 Walker, Donald-257 Walker, Greg-257 Walker, Jerral-272 Walker, John-272 Walker, Ladd-257 WALKER, SIDNEY Walker, Susan-118 WALL, CINDIA-231 WALL, MICHAEL-231 Wallace, Patrick-129,257 Wallen, Lisa-40,1 17,244 Wallen, Vicki-43,134,272 338 Walls, Vicki-46,117,152,244 Ward, Sharon-272 Ward, Scott-272 Ware, Alison-250,257 Warner, Larry--244 Warren, David-244 Warren, Paula-134,272 Warren, Susan-42,257 Warwick, Dan-124,181,l85,244 Wasson, Alice-244 WASSON, DONNA-231 Watson, Robert-257,321 WATSON, VALERIE-73,140,279,291 WGTSOFM VON-33,40,51,132,136,148, 244 wmke, Janet-1 15,117,132,136, 245 Waugh, Susan-245 Waye, Donald-42,134 Waye, Susan-245 Wayne, Donald-257 Weatherly, Clifford-272 Webb, Mikel-143,272 Webb, Tina-203,257 Weber, Chad-257 Weich, Kathleen-272 Wende, Sharon D.-42,257 West, James C.-257 West, Naomi-115,245 West, Sharon-42,257 West, Stephen L.-245 WESTERN DAY-61 Westhoff, Leticia-245 Wheatley, Teri-245 Wheeler, Mary-132 Wheeler, Peggy-257 WHITE, IRVINA-231 White, Leah-272,282 White, Parker-272 White, Wendy-42,272 Whitecomb, Vicki-245 Whitecotton, Barton C.-272 WHITNEY, KIM-120,231 Whittenton, James Lee-257 Whittenton, Jesse-125,171,176,177, 178,200,245,316 W Donnie Gardner, Sylvia Lopez, and Joel Bass play peeping Toms. Whittenton, Teresa-272 WIDING, LORA-113,219,231 Wiebusch, Rosemarie-272 WIGHT, ALICE-66,231,290 Wilcott, Darlene-150,245 Wilcott, James-257 WILCOX, LAURIE-35,132,136,158, 231 Wilkins, Joan-297 Q Biggest flirts Johnnie Eoff and Georgie Ferguson were caught! Wilkerson, Sharon-118,312 WILLEFORD, ROBERT-195,231 Williams, Charles-245 Williams, Diane-231 Williams, Douglas-129 Williams, 'Hugh-273 Williams, Janet-43,273 Williams, Joel-258,273 Williams, Karen-257 waney, Kathie-272 Williams, Lee-273,311 Williams, Margaret-110,257 Williams, 'Martha-105,273 Williams, Michael-261,273 Williams, Micheal-273 Williams, Nina-273,282 Williams, Ranea-273 WILLIAMS, ROY-113,231 Williams, Stephen-120,143,257 Williams, Steven-257 WILLIAMS, SUSAN-233 WILLIAMS, TRINA-62,65,140,216 231 ,278,282,284 WILLIAMS, WALTER-231 Williamson, Anthony-273 WILLIAMSON, REGINA-231, 291 Williamson, Thaddeus-245 Wilmot, Richard-257 Wilson, Audrey-126,245 Wilson, James-245 Wilson, Jeannie-245 Wilson, Rachael-257 Wilson, Richard-85,245 Wilson, Robin--271,273 WIMPY, JOHN-169,171,174,204, 219,231 WINHOLT, DAVID-124,195,197, 231 Winkle, George-257 Winkle, Steve-151,257 WINTERS, KAY--111,231 WINTERS, MARY-234 Wofford, Sharon-273 Wohlgemuth, Cheryl-105,273 Wonner, Jack-273 Wood, Linda-257 Wood, Mike-152,179,273 Wood, Patricia-115,245 WOODS, MIKE-33,36,37,88,130, 150,154,231 Wordsworth, Jane-273 wfighv, Betsy-43,273 WRIGHT, BILLY-113 Zaharko, Mark-245 Wright, Lisa-42,257,310 WRIGHT, LYNNA-129,231 Wright, Robert-231,257,313 ABC Bug Shop-318 .Y- YAHNI PHI-382-385 YARBOROUGH, DEBRA-21,4o,44, 62,102,103,140,158,231,273,284 Yeatman, Charlene-273 Yonkees, Jacelyn-257,311,313 YOST, RAYMOND-231 Yost, Richard-257 Young, Charita-273 Young Daniel-257 Young, Dolores-257 Young, John-178,195,196,245 Young, Michael-245 Young, Steven-273 -Z- Zais, Henry-143,147,273 Zamora, Rosemary-43,273 Zamora, Thelma-257 Zeitz, Michael-273 Zeitz, Nona-273 Zeith, Paul-275 ZEMAN, PHILIP-113,231 Zeman, Thomas-245 Zentz, Nancy-257 Zielsdorf, James-179,273 ZIELSDORFF, JANET-231 Zielsdorf, John-273 Ziemski, Donald-43,273 Zizik, Colleen-257,317,321 zezik, Mary-40,117,231,302 Zukevich, Robert-257 Faculty Anderson, Willian-94,210 Arnold, Roger-95,151,210,246 Baird, Louise-210 Bartram, Maurice-210 Brikhead, Peggie-210,216 Bowen, Jan-210 Bracey, John-210 Bradley, Bob-17,51,73,100,102,209 Brainard, Jane-210,232,303 Brooks, Winifred-210 Cantrell, Thelma-210,258 Carroll, June-108 Chambers, Lanell-75,106,210 Chavez, Salvador-210 Clark, Vic-73,102,209 Colburn, John-76,210 Cooper, Elvira-210 Cothrall, Cheryl-210 Cromeans, Della-211 Cross, Ginger-93,211 Daseler, Julia-211 Davenport, Linda-44 Dennis, Mary-72,102,209 Dixon, Frances-109,209 Dodson, Lee-209 Doka, Peggy-78 Dorgan, Harriett-54,211,232 Dow, Elizabeth-35,80,I48,211 Duzan, Robert-209,232 Erickson, Edward-211 Faraone, John-15,211 Firth, Lee-77,211 Flannigan, Colin-81,150,211 Fourmy, Sammie-209,315 Freeland, Billye-105,211 Funk, Susan-109,211 Gaither, Mona-209 Garner, George-211 George, Alden-96,97,122,123,173, 174 Gingery, June-128 Glaze, Dale-203,211 Gotcher, Joel C.-35,90,102,103, I22,173,174,19I,211,214, Guthrie, Charles-211 Gutierrez, Juanita-211 Hanson, Cherie-93 Harris, Charlotte-211,232 Harrison, Martha-19,79,211,300 Hawkins, Jean-211 Hogan, John-83 Holmes, Janis-211 Howard, Art-211,178,258 Hughes, Rita-102,103,211 Hupfer, Elaine-211 Hutman, Mark-212,216 Jamison, Brenda-106,212 Johnson, LuEtta-212,246 Jones, Helen-212,232 Katt, Glenda-212 Kittilsted, T.E.-147,212 Klossner, Gay-212 Loman, Kyleen-212 Lane, Albert-82,212,258 LaSaIandra, Joe-185,212 Lesley, Bob-73,184,212 Lesley, Bonnie-40,41,78,102,103, 158,212,262 Lewis, Doris Ann-212 Littleiohn, Doug-54,122,178,212 Luera, Bertha-212 Lynch, John-209,216 McAlpine, Betty-213 McCarty, Linda-213,258 McGarrity, Catherine-213 McGovern, Linda-213 McKinney, Nelda-91,213 Martin, Jay-100,209,213 Matthews, Jo Sue-42,43,213,291 Meacham, Daisy-79,213 Moody, Dionne-213 Moorman, Richard-213 Nelson, Marshall-213 Patina, Roberto-213 Payne, Jean-213 Perez, Blanca-213 Picken, Dolly-82,102,103,213,246, 297 Pippen, Pam Seitz-97,126,198,213, 282,285 Prestwood, John-41,56,60,88,132, 213 Prewitt, Barbara-213 Reed, Diane-213 Roark, Cecil-213 Robinson, Fulton-84,102,103,213, 246,311 Roargen, Richard-179,189,213 SCHOOL BOARD-208 Shelley, Aubrey-214 Sherwood, Ruby Jo-43,214 Steele, Marilyn-118,119,214 Steelhammer, Connie-214 Stovall, Kay-214 Suarez, Rebecca-214 Teel, Katherine-214 Trollinger, Dixie--214 Turner, Paula-19,140,209 Varro, Joe-91,179,188,214 Von Clausewitz, Erlwood-211,214, 216 Wagner, George-85,214 Ware, Todd-97,122,173,210,214 Welsh, Wiley-215 Wesson, Thomas-90,214 White, Elaine-72,209 Wilsey, Esther-215 Wolterstorff, Carolyn-214, 258 Youngquist, Susan-148,214 Navi Rueben Casarez and Julie Francis, most likely to succeed, study a novel Advertisers Achilles-326 Airport Barber Shop-301 Airvista-300 Anehta Sesea-296 Ascarate Rentals-300 Avis Texaco-277 Bartee Drapery 81 Interiors-308 Bassett Beauty Salon-277 Bassett Employment Service-277 Ben Williams Jewelers-318 Bissell-324 Blair Hall-308 Bob Bagdon-328 Bab's Fina-298 Bob Meacham-329 Brandt-Cullers Homes-288 Burger Chef-294 Chaparral Sales-301 Charcoaler-287 Chico's Tacos-289 Church of Christ-328 Coca-Cola-281 Complete Printing and Letter Service-318 Cook Sporting Goods-304 Copie Auriae-302 Corinthians-316 Custom Cleaners-287 Detinu-306 Donald M. Love-300 Doowtsae-290 Dune Buggy Center-281 E. H. Baeza-326 Ekappa-310 EI Paso Auto Auction-325 El Paso Natural Gas Company-319 Empire Moving 81 Storage Company -324 Epsilon-292,293 Entre Nous-314 Fabens Ice Company-298 Farah-280 Fashion Furniture-319 Firearms, Inc.-277 Freeway Bowling and Billiards-301 Gene Horn Oldsmobile-304 Gene Huggins Custom Homes-286 Gilchrest Jewelers-308 Greg Ray's Music Studio-326 Harmony Shop-298 Harrison Business Equipment-286 H. Carroll Lee-322 Herff Jones-299 Heins Restaurant-299 Hi-fashion Wigs 81 Boutique-309 Hovious Associates-294 Hunt Building Marts, Inc.-288 Jay Zatovich-298 Johnny Goodwin Enco Service-323 Jones Hatters-318 Kurland-Salzman-295 Lamplighter 'Homes-287 Leavell Development Company-322 Margo's Beauty Salon-301 Mead's Fine Bread-328 Mickey Dills Wheels Alignment and Garage-289 Mission Garage-301 Moe's Drive-In-324 Nita Jan Shoppe, Inc.-294 Office Machines Co.-295 Oregon Cleaners 81 Tailors-277 Plaza Empire Shop-276 Popular-305 Popular Mattress Factory-304 Quality Fabrics-308 Ralph's Texaco-329 Rathbun's Yamaha-300 Ray's Sportland-295 Reed's Photo Mart-295 Rodeway Inn-328 Roman and Russell Builders-289 Scotsdale Baptist Church-301 Scotsdale Realty-276 Shelton, D. H. and Associates-304 Sigma Chi-312 Sponsors-278 State Farm Insurance-299 Stinson and Son-289 Texas Motors Machine Shop and Auto Supplies-276 Tigua Chevron-294 Tigua Florist-276 Toys by Roy-308 Tracey's Loretto Beauty Salon-295 Valley Bank Venite Fidelis-320 Western Auto-309 White Stores Inc. Yahna Phi-282 Zales Jewelers-281 ADVERTISING INDEX 339 340 the mountain that rises near in the west is a mythical barrier of men of old, for streams of thought flow around and hearts soar above and no longer can we be stayed in one spot. laughter and tears erode sir mountain as iobs and joys erode still further and when only a memory remains it's found that most everything was worthwhile. mn. 'lk 3:1 4 fW'nh inevi- E mst? K s K- E KE, Hz, W ,, , 555: , 3 Wm X 1 Q H 2 if ,g xub.. 8 ,N 5 5525316 as 5 i 5 2 xs m . , 352 15 . 82 X, ia-,iw Wi me f-H ,f f 5 5 Ji Ei ga g ag if , Q 5 Z 1 H5 4 11319 ' Q93 X -aria 'H A gi 2 em W xg, 1 it Y i 4 W' Ng, jf .QW 4 1 a 3 ?iff'5 ,QSQW if. if . bw mf, Q fm 3 v:.:?..n ,., 5:3 :: 'miie' greviyfw we f., 341 how long is the wind? and time refuses to let you run and hide . . . twelve years is how many years of peppermint haircurls and dandy new clothes? the sunshine day explodes into an enigmatic envelope, addressed to you and the letter reads: enioy this day, give of yourself, and make things worthwhile. 342 ik 9 . ff 0 Xa ww, wr-- Q, a 'AI 'www A wfzfsygh wif i A, QW 4 jf' by 'K M A 4 ay fl 1 fbi Fling is 'W iff w ha sat rvmg i, THINGS WORTHWHILE 343 It never really occurs to you until after you're right in the middle of putting out the book what a truly big job it is. If someone asked me to do it over again, I don't know what I'd say. But it has been an experience I will always remember. There are so many people that I need to thank, unfortunately there is not enough room to thank them all here. There is one person that I will never be able to thank enough-Mrs. Daisy Meacham. Her assistance, patience, and eternal optimism were vital in the production of the book. Blood, sweat, and tears characterized the work of my two assistant editors, Ann Savino and Tweedy Steed. We all managed to pull through despite some near catastrophes. I would also like to thank Melissa Boody and Jay Zatovich, two exes who gave up their time to help us. I would like to thank the Popular for their fine studio portraits, Mr. Bill Moore for all the free time he spent up here taking pictures for us, and Mr. Ken Marlow and Mrs. Hannah Gouch, our Paragon representatives. Finally I want to thank the people who made up the core of the book itself-the staff. They were a determined and optimistic group who gave up their Saturdays and their other free time to help put out the book. I sincerely hope you enioy Salute 1971, its production has certainly been worthwhile to us. 4016 !7k4Cf!JmL. Ann Savino and Anne Markeson show smiles of satisfaction upon meeting the final deadline of Salute. Editor Assistant editors Copy editors Academics Organizations Sports People Advertising Index Photographers Anne Markeson Ann Savino Tweedy Steed Bill Beard Dennis Cunningham Julie Francis Brenda Bolton Sylvia Lopez Leslie Penley Marlene Richter Diane Alderete Beverlee Bruce Charmaine Chavez Bonnie Jones Louise Loiselle Gail Harris Pat Henderson Kathy Masters Jack Ricks Debby Baldwin Nancy Hatch Pat Petrosky s Norbert Barcena Laura Fairbanks Jacki Magness Sylvia Lopez Jack Ricks Cathy Gouch Joel Hendryx Lance Murray Exemplifying her ever present good humor, Mrs Daisy Meacham looks back at the good times!
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today!
Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly!
Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.
