Crowley High School - Talon Yearbook (Crowley, TX)

Text from Pages 1 - 280 of the 1979 volume:

f. , f! 'rf gigigi' P' .412 Fill' 19 w 4'Y I QV! 0 B I . flf fl d W, Q o +G S-ty . . Q! 8,0 , . . 0669 6,48 If . .. I 6 017 V- Wu Q f ' '6S0Oc 24f I . , 'fo 46 H- ' ' ' I Coq- 9617, , we Oiweqz , S 0 605,745 5 s , Q ICO 6171, 6 , H Q OQOQOS-60, A fe-S'f57E2!'o'0s W 0 , 02106049656 OQSSZISU4 o764,070f- 166 a , , 'A - TOP, Judy Good, Jeaninne Pritchett, SECOND, Tipsey, Dipsy, Bipsyp THIRD, Kenny Green, Nancy Voirin, andy FOURTH, Andrea Axtell and Martha Turner are the same on Twin Day .J 1 1979 TAKEN VOLUME 13 Crowley High School 1005 West Main Crowley, Texas T 76133 xx400i0 00009000 0408 000 M9901 4:40 X000 QN00'x0 0000960040 00006.9i0Q000 006 0i000'00000300006,sx4000 000Kf,0qQ0 006'006x- Q,000xo0x0x040zb0 q00666CA0q60A1' 000 xxl0xCj04Gx06 o0 K04+f5S6 004004900X AQ 009 00S4xc,0'000 i00KCA0.g60A N860 6R0x0 Q00 vWv0i0360'x,? 09 0K o9 'QO06 0K 0000 0000o0c,04000K 0K 'oox 00400'x0K4N o06040x000 oogxyoox QQNXQXE 00 0 5900050 Fb0QQx0 006 400400040, 0. oox '006' 000400 A 00x W '50400 0ox9 4006 00 600 xxx 040 R00 ' 0. x Q0 VO R00 K 0x 'O C30 X00 40 QR 0 ooi 00 40 V00 4400 YA K0 60X 5X 0x0 fb xx 0 0 0 '00 O 06 . Gi 00 Q0 000 06. ' 0 x06 ' 00 6004 '00 400 06 0 6 6 'x0x '0 2 fo P9 ning GV: QQSOQQOG 09060 Q0q000o 00xb060K0 6 000000 006009 040900 b 0506 Q6 -100 00 0 R009 Q54x00N SCJQQW 50 V6 0 R00 KQQO 00 N. Cv ' N06Q00 we 060 QQQVU 6 CSQZOX Q90 Wx 0 000 .65 000 '000 KK00 6 0 06 00 C10 4400, 0 x 40 009 x0K' 402, 'GQ 6500 Q0006 A 400 0K A070 Q 04000 000 0 'O66 '009 ,0 000K 006 . Q30 X60 Q66 00400 000x0 000 00 K6 00 '00 X0 0 0 00 000 o06 '00 0 K0 okx 000 ' Nx0x0 00 006 '66 000K 03460-x 00'0Q00 046+ 0 00x 00 040 0 N0 068000 , 440 K0 00040 00040x, 50400, X001 QTYSOO? 830: fixes: S6 9000000 Q00 0 .K 0 000004 00x400040Xx0xl0i6 00X 60 X50Gfi000xx40xxl0S6o0040x0 oox Kxo0000000 00fQ00'0o0 00 ,300 09 40004 40000040 0x000 96000050 00066049 'LO 0300 400000 o006 K0 66 -Q00oQg0x00000 0000000000090 c,ox00000'00002-002fX6'2f'0'x'2 562 W' Q,N4x,ZS0400004K0x400000. Q? fgxxex Ox05'l0e booi Koi Sxqycfvboxefgb 'XXQJKOO-ZOQF R956 . K9 Q80 0006 Q4 Oo Q BQKSK, NAOQOZQONXQ Qexox qw ima AA EW6 icy' QVGTQU U 3 Q If WMM w ,M 'y . X x K.- I F -SSX ' we iw XV . 1 4'-.K fd 4. I Ne VQQQQQQQ 925 +MfO+ 9065 7,xOOxpQxe6xQNc92NX'0fc9 Qxfbmoe, . 9 QS zqkecw we vbqvzkofe ' 00546. x Q50 Z- Z X Q, xxQ,yQ,qY, g,woo+PQSX'0 Q5q,xpQU5xasjoa,o661e0N0ffv. 4xxlvXe,e7nKVO6Yf00Q0N0Q' VQQOXXQ, Q?NQQQxxwO 'Nfgboceixevqqxek QOSXQY QQ i9e,KoOl9'ZXKQ b6W ' V 'NK Q9 Q QF www 'A+ O Deming f 3 'LO . os .Wg 'een do xero 'COR A gee, bw 'Cixi X546 S1QX9Q2XpNFxa 'bQ0'b12f6'b'X eeaeakkosvdvoqoeofgxembxaolbsx Gees, eswoxxlebcw ,sevewsowb oooeqxeeadoobeowoqqeebfbo Nlqbbav-eeedxdi. fbkxbtl 3:efQQNvvX'5?Q,Q,ON?xexo6e,ox 1616 'beooqizoboeezoo-Seq. xbem od 0 Aesxex 0330 ' edfobo ' ekaek 6 ' ook Croocgeqvqeeeoox was-Q0e, qowixoqooooex voiiegti .igiqexix Q, R '04 wa ,fb-aex Nofaeixoq ooaixeewqe 'ao 'Yds e,KKo6 e-e,e,40e,6 Ko Qeux cox 064 qeoie, o'vQ0e,q0e-eNe,s, Qewfw ' 6 ddfadx e,'Q'bo0, ex sxq, XXQAQB Cjfxexa MX oxxex 066 . S6 e:4- woke, 6600 e,eg0o QOQOQ bezxexe ON bee efo aw .XO Q, do ob Q6 ' Q0 N ce, . Q30 N K0 'X do OK, Q0 o QX6 Q0 'A 00 SX ' ew X 'a srl e, 5 00 . xo be, sexo 60 be, 0 Q 6 x N6 ew 'wi xx 0656 oQe,4xo xebeixexeq, e, fa ago Qofbx ok-Q0eQxK ekobeoxel Sxocemfxe 'ocfo6e, xl1Qfx0'i02, oem vw-'ow eewen-Q0 oox ok QrlQNe,Ro vbNSocyQ4NwXkv1e,Qoxoxeooxo xw1'ae6K'zfO'a6'0e,q9eoxoQ,,'oox Qxozbkoee,e,fQ0eAe,c,oi6xq0QKo4e. XO wie, Y- QQ, Q9 0 fa X- Q ec?- N9 4:0 60 . ' QXO Y- 5000 Q5 AQ game qbexfobo UD Q49 ,Clio-SCWO ' f,Q,3Oe,eI' 92492504 eixiwob Q e,eoQ KQQX-XWXO Q Suk K 9 ease, JA N Ode, wwe-oevd gxwxgvxow 92 wks 'z,0C5x,'bX5xxe,Xoqg'bi0XX'v'N?f9'X0 Qs Q0e,6e,6xox QQQQNDOSQ SOYNYXCXO wg. dw Ofzse We ,VS fi Gum in sri able. was . Nc, ' QNQQQQQ ooyixb xoqikcfxe Qsocxosx Q,qQq6xfb000v- Qwixb DOGBSNZQSW 'ae-ao6i000N0'X Q weaves, 6oQ2'6Qf?XofoNq OQQQSOOSQS Ones oookzbcebfbo KNOQA 'ata QXYOQYQYXG f?fY4V5Y0Q?f QXWXQQXC5 9ixQ,eixe5x40oc f5o6QvYX0OK2 . QSO 6 ' fo QS we. l i O Deming f 5 900 6 X o Pe ning 0OQgQf0VYX0?Yk5X9N0t-0ex,cy.g0 -1000 xqfiikoxq 094.5009 6 606 X00 VN? GOA MN K0006 4 00 Q00 O60 060 0000 0O0'k00K 'OOO 000 02, 506 Q00 ' 0x0 .QA 25 Y- i609 0-i-'00 3600. 06064 , 00-00Q0x0 0980i 00 0090000 0090 Q20 00690 600 eb M Q40 6060. 4250x004 990 X0000Q00f00q0o 'x0g00g0osx4 A O94 Q00 00 ,1 x,, A N0 WW S0'O0Q0000sxl 00000. 000sx4'x0Q00 ' 0000 Qxq0q00K ok Q00 qgoxxlfiix -i00wiQ 000 000000 000000000 00440 000090 'xo -Q00 'xo0q00 7304 '00, 00 0000 -Q00 00x ok OGQXXQKQZQSOKOOQO' oK0000sxX,00xX 0 XX00xfz,000, ' 'Q0000-55 ' by I X06 r H 'X Q' X Xx X X F 'x05bOsxlo 600 4000000 X 0o400,K0x Q000 ox 'i000o4q50Q,000000. xx 'X000 was 2500 x00 Nx00K0 OK Q00 604000 000io400000No0eK00N00g0 QQi0'040NqN050fzb5000Q,0. 00000xo000Q00q0i00x'00000Qa6b 00030000 fA0Q00000k0'060040'b1S0X 00 0q4Sq000'vi00K400Xx'000o4000i0fz?0xxQ X010 'xo 00400 A0050 Y- 0040660 000000 A0 00Qq90x0Xf30 000X00K050 400400 , 00 00x0 4003000 000, 0N000,0000NfX0, 000-Q40 Q9q0000x0q0, 090540 R0 0000-:3,QSi0x0 00060100000 600000000 'xe 0KfQ000Q0000,000004400Q0K0C90'o40NO 0'v5000'x00i dxaxxfxo fivzbie. !f d -M ,KM xg Y 5 x000 000000 00000090 1: - N My xwxg00004Y00,S010404X+v0060OOPWOSQ 0003000000000-xwd faoo40Q00+60f00Ym if' Qc, vc Q93 495 QW K Q96 Q0 1980 recndy or VU! G 36 2,99 090 ,be 'Cb KS opening X 7 4 152 . A 'M OSQVQQSQXBOQ-vvX0?KNAxQ'waN-efda Cyiodixxqiqiixvzixo-Qixzxn Qogbezxe bxfxoqzaoec Know M900 xwNdQ,xec,zaswQma,Qxq,Qoo9w.wQ,54f q0Qx5Q,xeQixox xo-QOQXSOK d'Z755Q0'bQbDOZfg,fi NJ we Xxbzmbvwwl wb Sv, 96 Y-QMS eoxaexqoxoqiedvy 064990 Qfzbb. OS VDC, idleeo 'xfx ooo yV+YXoQ,wxSX SQ x N,Q,5xmpqozQoX9xooQeQ QQSQ,-5 . 5 XQQ,yeQQqeQxxoxQQq9ee fo 5Q,QxC,oocoMKQe,N?Xo-:lox Y-BSZQQXGXX . 0Vx,Oxx4 , OQQQOZ x ww fp-xo SUN We '57 5 f 5 Q rr 9' 'af It L EF fzfvv. 6' if Q, O KE: CSX if MH is K fa fo Qook Nox OQ2, Xx KQQKQ, Noi, Xxoe, -Q6 Q, S ok x efboosxloioe Xolwxoovxooxxl exoow, 6 ON oo o 9941, 6 . W S 44 xox ooixo .N5 40 V6 Q , e-eo qixoxle, fzxoef ,Goo X6 e om oo QW, ow, 6 exooook Xxoqoxoo fo o ooooo. Ne ' eoqbcgfxxoi 'N QOQ, evo oqoookox oo oiookexx oo eos Ne, dx Q,-xoox o wowooxw ' -102, doe-ao ' oe, 'z,oNSQg xeyoo of X96 oxo ixo. Oo Q9 R X .6 0 Z . 'XQAA oxo 'QQ NK dx Z '60 9 W so 0 QQ, KK 4 NCQ, oo Q0 ae, od O40 9 VN ooefo OK '60 flue 'God Q Koo ow, fo QQ xx Q, xo x-qw, was 6 oxox Q, 'K OOk5x Qoexz, ooo. ob so -55900 oo' wmv o 402, Kxoqoe, Soqfxnxe Yqboo fkooql do Wxyoxl QQ, qw, oxefboxxov 'go o oe,feoe,ow ' 9400 'bqlxooooexb oo-mf O66'bKXX60i9 'KQAQ wie, oxoo Novoo oooooooo oo if eyoooexax ooo goooexoqfo oo e,NoK. ooooxboooxx me fz, 'boio-sex Q, xo locffoxlok q0 tengo ie,oQ0e,q0Ko4 oeqfxo QS. N00 oie, ww ooo Noe, xo wx owl 0 X 4400 QP No fbx Y '5Qix xo 6 QF oo fab 'QO Qfb XXx QQ 'YQ 05' NK QAQ, K 00 oo YQ, 62X N06 K QQ 'Vx No xo '56 oookfy o-Q08 QQ, QGOQ, oooova qF'l0'z:KSS0 fo eoe, xiao Q-QQLXQ owe 'ao fgegbfbx K4oq0X?wZXo,x1e, oss jsovoo oox Kfzyxoiike, qoe, fwgx oqoejxqx Q,Yf,9o0,f,ooo seo oooeoo fwooqgfx Q0e,Vof,XeXoX4o bowox ox eocwvoqbx fmloejlle ofbxxqjixoglx o YN Kow5OXe,Y oq0oX'z,vz,e ASQ, xfgbwoo fob X?Nooee,',' Nxlokgxoooxo ooooooxoqeoiqe, xo QM ok ox-zoo Ska -566 ook eoxie ,Ro oefvwo gixoooqo xoxooqpex-QOQ, ixciixx oy eo ale, c, Yoko Qfbi Kok Ne, og SAZNFZYQ1 fb evboqo JO ooogfx ok oooqjo. QOvX0'fOwQQ9 QQ QQ, Qxxixkeboooooexooiooo o-Loon oo'z,g0oeQ'oQ+2fQY Nb one Q,e,x 5 Q' oooofgxoq, oo X6 'xo oo oo 'oo 'oo oo o oo eo eo Q0 qw oo ' w oo oo Ox Sc hoo I . wwe! 9 Old ghosts faded as newcomers arrived After a sleepy summer siesta, the slick, washed halls resounded with voices of return- ing students. Vague new faces floated among the old, and tight clusters of peeping freshmen scurried through the halls, searching frantically for that non-existent class. The nostalgic ghost of last year's seniors still clung to old hangouts, fading reluctantly as the new seniors took command. ln the middle, sophomores and juniors hitched up their old fad- eds, inhaled deeply, and plunged into another year. Over the summer, fashions had taken a wobbling step for- ward into stilt-like heels and skinny jeans. Some bold souls The Student Council members sure were generous to eat 4,000 jars of mustard just so we could have the lids! The Howdy Assem- bly was great! - Sherri Woer- n r dared to wear the latest, others took note of what was being worn for their next shopping trip to Hulen Mall. The three-month gap between last year's scandals and romances and those most cur- rent were meshed with a thick, gooey application of gossip. The roar of humanity ebbed into a gentle overlapping of voices as the last student was fit into the jigsaw puzzle of classes. SPREAD A LITTLE Sunshine was the slogan used by the Student Council, compliments of French's Mustard Company, for the Howdy Day Assembly. DEVAUN DICKSON AND other juniors plan class decorations for homecoming. Heads began to droop toward sympathetic desks as teachers droned on in a relaxing lullaby. The bell startled the student body back to life and the halls were squeezed with the passing bodies. Many stopped to peek into the new auditorium, and a surprise awaited those going I thought the assembly was uni- que and fun, and the pins helped brighten the day. - Mrs. Vicki Glass into the remodeled lunchroom for the first time. The first day finally ended, and all escaped home or to work. So, one day down, and only 179 days left for a little short of a thousand kids to move closer to adulthood. The thought could have been scarey at first, but was soon forgotten with the blasting of a thousand alarm clocks the next morning. beginning school f 11 12 f beginning school ABOVE READING THE rules of the junior magazine sale, Albert Perez stands in the middle of some of the prizes offered to top salesmen. RIGHT, TRYING DESPERATELY to fill his paper in the Student Council scavenger hunt, Delmar Montgomery uses a friend's back to write down the needed replies as Nancy Voirin looks on. its is ,- Y vw YY 5 if Sea venger What will they think of next? They stood at the entrance to the gym, handing out French's mustard lids. Some people, as usual, were reluctant to partici- pate, but most were glad to take part in another Student Council scheme. The same people either threw their buttons under the bleachers, or promptly attached them to their clothing, referring to the popular mustard slogan, Spread a little sunshine. The theme might as well have been We don't fit in here any- more, as people spilled onto the gym floor with nowhere to sit. Corinne Orr introduced a get- hun t, mustard lids - they're at it again! to-know-you game, a scavenger hunt. After a brief period of hesi- tant looks at each other, the stu- dents swung into the fun of the contest, to finish their papers with the names of people who sang, owned, did, or just were what the respective items required. Student Council treasurer, Karla Staily, thought the assem- bly was HGREAT! It really was the best one we ever had. The freshman spirit was surprising, but the seniors really led the assembly. No one was going to get up and do anything in the scavenger hunt until they real- ized it was going to be so much There are two extremes in high school. Seniors and fish bear little resemblance to each other, yet somehow, someday, those freshmen will be seniors. And even more unbelievable, those mature seniors were once in the ninth grade. But don't expect a senior to admit it. Senior Rory Smithee observed, I often find myself thinking why has it taken me so long to become a senior, and that surely there's more to it than this! ln starting off my senior year fun, and we did have fun, we all had a good time. Griff Rambo, the winner of two homecoming dance tickets after being the first to complete his list, explained the technique. I went around to anyone and everyone, and just asked them for all those things 'til they got answered. If they couldn't really do those things, l made them do them anyway . . . Like a fresh- man wiggling his ears. . . Another beginning-school activity was the annual junior magazine sales. Working against the record of the year before the junior class surprised everyone by raising S6,287, two thousand l felt no different than I did when I became a junior. But being a senior is being someone special, because of its being your last year in high school. Crowley High School offers many opportunities for those who'Il take advantage of them. I would like to always be able to look back on this year and every other year and have good memo- ries. These times, once they're gone, we'll never have them back again. Only the memories! Freshman John Hausner recalls his first impressions. The first day of school l was scared. I wanted to stay with my friends, the fish. High school seemed so big! But school is the same as ever, and classes are no different. The teachers are all nice, like in middle school, and they have lots of spirit. They are always at the games. The first pep rally was a lot bigger than those in middle school, and there was more excitement. The first football dollars over any previous school record. They were really good. Lots of enthusiasm, commented Miss Ann Tyler, junior sponsor, about the attitude the class had in selling magazines. Enthusi- asm had slacked off after the first three days of sales, but we had a meeting the next Monday causing sales to pick up dramati- cally. Over-all salesman was Belinda Fliney, who turned in 5374.10 A successful Howdy Assembly started it, and a record prom was anticipated to wind it up. There remained the length of time between them to fill out the year. game felt no different, but we were in AAA, not AA, which meant that the games were bet- ter. Senior, Hsh com pared notes beginning school X 13 ABOVE, ELVIS IMPERSONATOR Rick Presley instructs Rowdy Thomas on how to be a Hound-d . . 09 on Fifties Day. ABOVE, A VARIETY of Halloween creatures sat clapping in the auditorium while waiting the announcement of the best costume. RIGHT, SENIOR TERI Hatfield prances across the stage as the 1978 annual during the yearbook sales assembly. RIGHT, SENIOR PAM Harwell sits back and takes a rest before showing slides at the yearbook sales assembly. SPECIAL KIND CDF FUN We were rewarded throughout the year with a special kind of fun, thanks to the new audito- rium. We could have real live assemblies! Whether the assem- bly lasted only the duration of break or took up the better part of third hour, it established an air of excitement in students which filled the entire day. Did you like it? Wow! Did you see Nathan dance? The stage band is good! Those who did not wish to attend could take advantage of a special study hall, but the audi- torium always seemed to be packed, seniors filling the front rows and underclassmen taking the rest according to rank. Gig- gles, gossip, and horseplay filled the auditorium before most per- formances until the house lights began to dim. Even the rowdiest student soon learned that was the signal for silence and atten- tion to the stage. Then the per- formance began. Yearbook held an assembly to solicit sales. While Shirley Fisher explained how to sign up for a yearbook, old editions walked across the stage and took a bow. The staff also presented a slide show. Halloween brought ghouls and goblins up front as well as the student band Lotsa Love. Santa and his charming rein- deer in the form of Talonettes took over the stage prior to Christmas vacation. Mr. Bob Burger did the honors as Santa and read a list of students' names and gifts they were likely to receive. A multi-media show, Champi- ons, bombarded our senses with sights and sounds, it took most of us an hour or so to recover from that one. Rick Presley, an Elvis imperso- nator, ended Spring Fever Week with a special bang, his polyester jumpsuit and renditions of Elvis' songs caused many female hearts to pitter patter at an unu- sually fast rate. He ended the show by complimenting the stu- dent body on its good behavior. We were finally learning some assembly manners, it seemed. The Student Council was responsible for most assemblies, and most of the student body were grateful for the relaxation and fun they provided. ABOVE, MR. ROBERT Bu r was a joll ol' soul when he mms Santa in Jie Christmas assembly. assemblies f 15 l I Teachers, excuse me for this interruption. Would you please dismiss the band, cheer- leaders varsity football and Talonettes Q for today's,pep rally, were familiar words of Mr. Mike Leach, vice principal, heard every Friday morning during the football season. A few minutes later the same voice would initiate the weekly migration to the gym where everyone crowded into their respective class seating areas. All was confusion on the floor as instruments were warmed up, muscles stretched out, and micro- phones tested. The only calm group seemed to be the football boys who stood in the doorway and observed the crowd with cool detachment. The excitement grew slowly but new cheers like How Funky ls Your Chicken and U-G-L-Y soon had almost everyone on his feet. As class competi- tion for the Spirit Stick grew more and more feverish with band and Talonettes competing for it as well, the noise became deafening. Genuine school pride seemed to emerge in almost everyone as the band struck up the opening notes of the Alma Mater, and students ioined in holding aloft the Number One sign and achieving unbelievable volume with the refrain, Hail to Crowley High! 4 l 55 ROWDY THOMAS, DONALD Wilson, Brian Miller, and Philip Franks show their real enthusiasm at the pep rallies. CROWLEY EAGLES ENTER the gym, showing various levels of excitement toward the upcoming pep rally. i 16 X pep rallies fn-w -M Y 'Nin- if gy... f ..,,i,f. sz, A If Q g .V f ' Q 1 ' I Vg 'fl f Ex.. 2 cf? nl.. . at It 7' ' :LfQ'i1iQ?i44 ' .K ' 1 Q H W . 2 J me Q52 naw.-. V 'I QQ? QS 1 CQ 3 1 Qxxiis MR. RAY SEFCIK, head-coach, unrolls a letter of support from the student body before the Brownwood game. CARL BROWN, KEITH Duvall, Kenny Green, Ernest Moore, and Dwayne Neagle try to be true Crowley Eagle cheerleaders in a skit during a pep rally. CLASS SPONSOR, MR. Danny Stribling wildly swings at balloons with a fly swatter for the sophomore class, during the Cleburne pep rally. 18 X pep rallies f's1 ' -5 LAURA DUNCAN SHOWS both her talent and spirit at the same time by raising her hand as she plays the school song. EXCITEMENT FlLLS CHEERLEADER Sonja Moore as she and varsity team members respond to the school song fol- lowing the big win over Cleburne. Pep rallies were more exciting than they ever have been before. - Laura Duncan JANA CARROLL, JACKIE Roark, and Stacy Howard get down in the Brownwood pep rally. TALONETTE RENEE REITZER goes through a routine in her health class. Most people never saw the preparation put into a pep rally. Before anyone entered the gym, the band, drill team, and the cheerleaders were getting set up for their own parts in the half hour of entertainment and spirit psyching to come. While waiting for Mr. Layton Keith, the band director, to raise his baton in signal for the first selection, the band rehearsed. Squawks, and squeaks echoed from the empty bleachers as they practiced that morning. Meanwhile, Talonettes filtered back and forth from the dressing room, spraying down and tying back hair, then assembling in small groups on the gym floor to do some warm-up kicks. The cheerleaders were busy taping their list of cheers to the floor in the spots they would stand in, and arranging pom pons and megaphones neatly to one side. A few warm-up exer- cises and kicks later, and they were ready to get the now arriv- ing classes to cheering for the Eagle team. The people in the bleachers may have been at ease, chatting with their buddies, but impati- ence and anxiety ruled the floor. But once the fight song was under way, fears were forgotten and everyone could relax and enjoy the pep rally. pep rallies X 19 Roni Hornell, Cheryl Dinger, Paula , Beauty QQ? Beers Hands reached in back pockets as the rumor spread Boyfriends nodded to their sweethearts as their money situ- ation was determined. Within moments, the glass window in front of the rows of flowers and streamers was smudged from the eager faces pressed against it, peering critically at the selec- tions. The news was out, the mums had arrived. There was a price to fit everyone, from the four dollar job to the eighteen dollar monstrosity, though most orders fell somewhere in the middle. The week advanced and not so surprisingly, many loves emerged in the scramble for dates. The Homecoming Love Bug, a yearly phenomenon, had struck again. Thursday, decorations sprouted from the walls, win- dows, and stairwells throughout the school, as students hung signs, streamers, and other par- aphernalia in designated areas. Sixth hour, distant strains of the school song and the rhyth- mic stomping of feet brought everyone to class doorways to file in behind the band on its way UPPER RIGHT, GIA Harden waits to the pep rally. Once in the gym, seats were found just in time to witness the Talonettes form the victory line and start off the show. Friday night, the crowning of the queen, Stacy Howard, cap- ped the week-long homecoming preparations. Becoming home- coming queen was much more than an honor to me. l feel that I can hold this honor to the best of my ability and try to make this year a meaningful experience to everyone, she stated. After the 12-8 win over the Brewer Bears, students chose from a variety of activities availa- ble, including a Student Council sponsored dance. We didn't go to the dance, but we went to Crystal's and had a good time there, explained Jeff Cole. No matter how it was celebrated, the first homecoming in AAA was considered by many a suc- cess. By the time next homecom- ing would come rolling around, all that would remain of the hope, anticipation, and money invested in this night would be a few crumbling mums put away for memory's sake. in the victory line for the Eagles. MIDDLE, CAGE THE Bears was the theme for the seniors' school decorations. RIGHT, HOMECOMING COURT members are, Tamara Shutter, Swindell, Stacy Howard, Kim Lee, 1 and Sherry Taggart. 20 X homecoming week LEFT, TALONETTES RALLY together as they imitate the football players at the homecoming pep rally. ABOVE, BAND MEMBER George Collins awaits the annual homecoming march through the halls. LEFT, DAN MARTIN senior class president, escorts Queen Stacy Howard from the field. homecoming week f 21 H 22 f homecoming court M 'f' Yi W 3 ??s'uf1r ' - M M.. ki: if-11 fk - A V .- 6 A T'A Q 553' 9 v-N xl 1. W 'V K p at s- . 1 . xl if L,L,h , .. x Z ,XJ A gi -fl K , ,min ,... lk ,- K, I K - x. A, . WL M' . 0' I i l S Qi m+f l, 'B' Y wi x Q, A L W 'Q A if g Xt 53 X x. 455 -:1' . n ,JVL Y W ,wx E tr JK' QQ wr FQ Ziyi? -555 l , 9' 5. gl PF .5 UF.. 5 X' r ,Q 1 , f' , lm ' T X it-fs 16? fN.' J' Lf' 8 Q4 . . xg. xi!- ks sf i ff 4 ,gk W . ,V , :- ., Qg,?',:. i Q .F l x ,,,h,,?i1?,N ax' 51- ' I- I QU -gt- 'i 'Q XX' A Xglf N I x ' x ' g4,LfLN. f Q 1 I g Q , z ' in X i , gs, , ,. E if , Q if 75. .gf Li! f six. Q s 3,2 , l X np A tg R 2 A ' I 5 wa 5 5 X X Sgvyd l N w Q :r3 if 5' M ,W ,fs Ve 'Q if E 1 Q Q iv Q Q X 5 -, Y ' 5 F Q.. L, ' 1 9' , .wk . I , . W : ln :k k . M f H+ Till? 5 1 L ' E ,. f f -'uh 1 1 . Yi. s ' ' ' -f ' 1 T5 K Q . ' A . ' - , W: . if-s+-' L N - , - ' H - ,Q '1 W, ,h V - wal , K' Q F h 185 3 Q-Q,.i.'i+ g. ,KV -. f aw - v v- f 'Q N ' Lf . .QL V, WF wrvgk -WV. 4, -. L X . 'Ay ' 1' , Qual' . - g' I 5 K '1. 1' 'fa rf - , Q ,N .. A AY-9 ,- i' -I 'r', F- Q. C Q 'W Q H xy? P ev13':',.f-N:-' ---,Ne-bl k E xd 'Pg A 3, Bf4Q1f,.,N,w'.'-'fv X 2- .','gyl,, 1 ',a.f , -'Km L n x y M .. QGL- ',-'ui fo N 'x -- - ifka 'idx it - K4 . 1 'Q 5.05, .:. T PR 'YQ if . - of-31..- QQQQJW QQ? Bows 5. 3 1 , mv- ,, ' ' nr, K. V. .. 'fu Mm Not pictured, Angie Jaso, Sophomore Princess homecoming court I 23 QKLAHCDIVIA . .. CK l Some seats, especially in the balcony, had never come in con- tact with a human before that day. Now, as the lights began to dim, and the tall red curtains to draw back, those new seats squeaked as a thousand plus students leaned forward to wit- ness the opening scene of Oklahoma Backstage, in utter darkness, characters bumped blindly into each other as they hurried to their spots, rehearsing lines and wiping sweaty, cold palms before entry. ln the chorus room, the rest of the cast joked nervously sensing the expectant hush of the audience, as they awaited the boy who would call them for their turn on stage. Were all the rehearsals and performances? Yes' replied Linda Peterson who played Ade Annie. The sound of laughter long hours worth the three short 1-P'- wlgv--ws TOP, FRONT ROW: Joseph Riney, Tony Keen, Karen Tritten, Bobby Worrell, Martha Bianchi, Lori Smith, Sherri Stevens, Lynn Richardson, Mary Ann Knight. SECOND ROW: Larry Smith, MarilynAPoynter, Mike Deason, Sheila Lauterbach, Chuck Stevens, Linda Peterson, Philip Franks, Mike Chapman. THIRD ROW: Tim Harper, John Murphy, Art Hornell, Kenny Green, Kim Koterba, Charles Hix, Brenda Bateman, Tim Parks, Terri Hartfield, Lisa Malachi, Billy Knight, Bruce DePriest, Jane Carroll, Kerry Wilson, Mrs. Leann Pyeatt, Mrs. Eugenia French, Mrs. Nancy Pynter. FOURTH ROW: Ranel Pierce, Billie Kelly, Skipper Morris, Joy Wilshire, Glen Tuggle, Becky Johnson, Karen Bailey, Connie Bowie, Gia Harden, Tina Hall. 24 I all school musical from the audience made me for- get about the hard work we put into it. lt wasn't work, it was fun! Among the highlights of the Thursday morning presentation was Mike Deason's sprawling swan dive over a camouflaged microphone cord during a seri- ous exit. He must have been the only member of the cast who took literally the theatrical phrase Break a leg. ABOVELEFT, A DARK stranger is seen in Teri HatfieId's future by Sharon Stevens. ABOVE RIGHT, A fierce Philip Franks defends his lady's honor by giving Mike Deason a thorough shaking. 9 ABOVE, PHILIP FFIANKS gives Linda Peterson a real Oklahoma hello. TOP, JUDD'S DEATH is the topic of discussion between Chuck Stephens and Larry Smith. ,av-Aa-N, , wane, , 1' v ABOVE RIDING IN their yellow- fringed surrey, Chuck Stephens and Sheila Lauterbach leave for their honeymoon, TOP INSET, CURLY'S fate is argued by Marilyn Poynter and Bruce DePriest as Mike Chapman listens. mls CHI' Trans Am favorites I V S1'1OW! IVlork8f Mindy ' - na-DO. up Movie Wa Lady CLittIe River Bandj vorite ABOVE, THE CLOSER fitting, narrow skirt was worn by ABOVE, DEE DEE Faulk, sophomore, Julie Sulak. BELOW, sophomore, poses with a suit MR. MIKE Leach had the popular that was reminiscent of the permanent curls. Forties. 28 f favorites ABOVE, SENIOR TIM Knowles, known for his humor, could also be known for his strange feet. BELOW, JUNIOR KIM Koterba shows the layered and curled hair that was the style for girls. UP T0 D TE ll-is 'Q Wr- ABOVE, HEMLINES WERE lower, and heels higher, as shown by sophomore LeAnne Ellis. BELOW, TENNIS SHOES continued popular, an influence of the jogging fad, perhaps. ABOVE, JUNIOR SHELLIE Tackett wears a tunic top over straight leg pants. BELOW, GIRLS WORE higher heeled shoes with slacks, dresses, and leans. ABOVE, SHERRY LeJEUNE, freshman, wears casual overalls. BELOW, FOR CASUAL wear with blue jeans the basic brown suede shoes were worn. favorites I 29 Student Council provided special doys, speoiol vvoys to lighten our load 'Even the hornrimmed glasses and plastic pen- holder set must admit to having a few hum-drum school days. The average student will admit to more than just a few. That is why Student Council pre- pared special activities and assemblies throughout the year. Ranch Day, Spring Fever Week, and Mr. irresistable were a few of the happenings that brightened some otherwise dull school days. A new addition to the Student Council was the Executive Council. lt consisted of the presidents and sponsors of the major clubs on campus. Being its first year, some members felt that it was disorgan- ized with few people knowing where their responsi- bilities lay. This was only a minor splotch on the Stu- dent Council record, however, overshadowed by the huge success of other events. Scores of Bess Race children were delighted by the antics of Katrina Safety Bug Fitch when the Safety Council took its street safety program to that elementary school. When the end of school came around, students of all sizes had fun times to remember. There may have been some long, stale stretches of school when there seemed no end in sight, But through Student Council effortsgthings went a little easier. RIGHT, EXHAUSTED STUDENT Council members pause for a rest in the action during the Ranch Day I , assembly. if BELOW, SAFETY sue Katrina Fitch F talks to Bess Race Elementary children. SAFETY COUNCIL MEMBERS areg FRONT ROW: Katrina Fitch, Julie Sulak, Linda Peter- son, Kelly Poynor, Lisa Ander- son, Cheryl Clement. BACK ROW: Ls W'lk M' h ll i a i s, ic e e Bray, Karen Bailey, Sonia Moore, John Hausner, Mike McConathy, Corinne Orr, Lauri Smith, Pamela Harwell. 30 I student council E EP, ftfivffr f L f lr ,.zQL A V LEFT, EMCEE KARLA STAILEY, Student Council treasurer, announces the Peanut Push in the Ranch Day Assembly. BELOW, STUDENT COUNCIL PR ESEDENT Corinne Orr Spreads A Little Sunshine in the Howdy Day assembly. ,4- i , , I i l M ' .g L ' ,A T 4 fi? . P 41 5- V, , ,. .., 4 i , 1 i 0 Y 'Y I V ., .A A H 'H , 511 ' ' ff- . W L,,. , ,,Lb A ,W , .vp. ,'f'-:ya-' STUDENT COUNCIL MEMBERS are: FRONT ROW: Cheryl Dinger, Annette Baxter, Julie Sulak, Lauri Smith, Kim Guidry, Michelle Bray, Kelly Poynor. SECOND ROW: Sonja Moore, Karla Stailey, Katrina Fitch, Karen Tritten, Linda Peterson, Lynda Duncan, Lisa Anderson, Cheryl Clement, Cor- inne Orr. BACK ROW: Mrs. Janet Henderson, Lisa Wilks, Tamra Armistead, Mike Sullivan, Gerald Burns, Keith Duvall, Mike Deason, John Hausner, Mike McConathy, Pam Hix, Shirley Fisher, Dan Mar- tin, Pamela Harwell, Mrs. Lee Ann Pyeatt. student council I 31 RAN H DAY Seniors won - riot or wrong lt was an unfortunate position to be in, admit- ted Mrs. Janet Henderson, Student Council spon- sor, of her role as scorekeeper. A few people caught up in the atmosphere did suggest that per- haps l had recorded the wrong scores without an official decision. Her comments concerning Ranch Day were typi- cal of each year's competition. Almost as much a tradition as the Western Dress and competition of that day is the bickering between classes afterward. Which class really won and who should have won each race gave students something to talk about for days. Anytime there is competition between classes, accusations will be made about the scorekeepingf' believed Mrs. Henderson. I felt that the score was kept in the most efficient way possible. Regardless of, or perhaps because of, the Contro- versies regarding the results of different events, a good time was had by all. Students packed the gym- nasium and spilled onto the floor as emotions got the better of them. The Peanut Push, the Root Beer Guzzle, the Pie Eating Contest - all brought on shouts of encouragement or moans of dismay as the results were announced. The Tug-of-War, which was the highlight of the competition, took an unex- pected turn when the junior boys defeated the sen- ior boys. The joy the juniors felt was shortlived, how- ever, as the seniors soon retook their lead and even- tually won the day. Many underclassmen were heard swearing revenge and plotting strategy for next year's show as they left the gymnasium. W Q. -- X Wa, 'nw C' wwf 3 as 9 x l ng. 4? 'gyff-ug i 'Nr W Q ,MQW ranch day I 33 N 34 I ranch day .Nz aw , ,mt , I N.. M Q., - ,wwf few 1 x -I is A Q19 ' .QJE T 7 -f-J 'Q' X1 1 H ' A as 5' '1'f4 Wi,Q5?23:2iQ, , , K ' am, if 5 51 ' -.fx-L, gg.,sZ1 1 f 1' 471. 1 . - -M 3 yi ng, ' Q W, V , f . I' 342, , 23. 32 Y, si ,, f X . ,RA N a 79 iii 3, T344 G-2 Q ew., ,. w 111, A , if ' ranch day I 35 We all had a severe Case of SPRING FEVER We were all at the point of insanity anxiously awaiting a later-than-usual spring break scheduled for late April, when a reprieve came in the form of a Student Council sponsored Spring Fever Week. On Class Day, students donned class t-shirts sold some days before by the Talonettes. The shirts listed the names of all class members. On Twin Day buddies and beaus appeared in a variety of get-ups, all designed to make us think we were seeing dou- ble. On Super Hero Day a few solitary Superman t- shirts appeared. Rags Day was loose, crazy, total fun. Torn t-shirts, baggy overalls, silly hats, and a generally goofy attitude characterized us all. The real event occurred Friday, Fifties Day. Old felt skirts, letter jackets, and penny loafers were dragged out of back closets. Instead of having break, we trooped to the audito- rium for a special treat. A real-live Elvis impersona- tor, Rick Presley, was to perform. He lived up to most expectations, dressed in a white, rhinestone studded, high-collared polyester iumpsuit, he leaped onstage and was in control of the crowd most of the time. One exception occurred when Mr. Den- nis Burke was asked to sing Love Me Tender to Miss Barbara Crowley and almost succeeded in stealing the show with his fine singing voice. After the concert, students reluctantly straggled back to class and the dull routine of the Seventies. man scmux ss. m . 5- 'S' ABOVE, JUNIOR DEBRA Jumper and Traci Auberry are happy to be at school and participate in Twin RIGHT, MELANIE SMITH and Sonja Moore are baseball twins with grins from ear to ear. I , LEFT, SENIOR SPIRIT is displayed - A on Class Day by Dana Caciola, and her t-shirt listing her classmates. Day. 36 X spring fever week S J n s. SENIOR JOHN HINES looks really ragged out while enjoying M8tM candies. Rags Day was a time for having a good time while looking sloppy. LEFT, SENIOR NATHAN Beach has complete confidence in himself as Fifties Day guest Rick Presley explains the use of the wiggle. RIGHT, MR. DENNIS Burk goes through various stages of anticipation when asked to sing and dance. QV C' i si S I have to do what? Well, I guess I could. Yes it like fun, l ei Like this? ,f Look out, Presley fans, here l come! S 'Y spring fever week X 37 X36 :?Q,y9QCv4x924NoxQokQi6 -mega Ilbdvxobeooffoqle go xoxo. QWQXSQBGQ5 ,ve-e,+cae,ef2:f44vx Qfbqoeaaxoceoooxhqzemxekfafgz efzxix. 9Q,x,OiVfy?xQ5C9QfX ,a'4e,k55x0Q,'K0 q,g4Xox,5oeN?wlX4S0sa,0ooKeo Jax cI+XfxQ3kYXfaoeoe,x Wacgwoek-Ne, +6646 em, 6 NXYQQ 05 foviqifxfxxevo QSoss3fogbe,xf,. 90606698 Aeafizoe-fm fax QQKZZQXQQQKG Qefxow. X4-e,e,Qe V90 40050-B OQPSOQTK Q06 . Q3?iO'zF00'bi9vN 'wzqibsefgkgx-5X QQJQXSVQQQS f2wKwxcQQ+ -Q0e,'0fQ'b1l'oxxKko40fz,'5QxxoQjNo Qfwzx , ?XQ5C9QfX SOXXQXQJV-XX,oo'bq10yNe fz52,0Oi0ql xfgbbaxoivzkxzfgkixbo cfxeookoxgo Yyxlx 'Q 6362 ADQX CD2 W2 UWA E, MAKING IT HAPPEN A pleasant surprise awaited those' who skipped a trip to the concession stand during the halftime performances this foot- ball season. Not only had the band expanded in size, but a flag corps had been added, and lead- ing the band out from its forma- tion under the goal posts in six steps to every five yards march- ing were the Talonettes. Both were never-before additions, cre- ating a new facet to the march- ing band. ln order to put on successful shows the band began practice way back in August. From the latter part of the summer until the very day before a perform- ance the marching band was a common sight in the student parking lot where lines and markers had been set up to sim- ulate the football field. Sharp- ness and even lines were the key elements to work toward in prac- tice. Remembering where to start and stop was important, and sometimes a crushed tin can or other piece of trash was the only guideline to locating the right spot. The marching band entered contests, such as the HEB Marching Festival in October where they earned a Division Ill rating. I was not disappointed. l thought we did a good job, commented Mr. Layton Keith, band director, referring to that contest. Whether drum major or alter- nate, lots of hard work was the only way to make it happen, as the band slogan went. The effort that went into making a great marching band could not wholly be judged by contest scores, but by the pride so evi- dent in any Eagle band member who really wanted to be out- standing. DRUM MAJOR AND twirlers are, front to back, Melody McDonald, Pam Hix, and Roger Streater. 40 I marching band Two groups joined marching band MEMBERS OF THE Flag Corps are Tina Flowland, Missy Bentley, LeeAnn Ellis, D'Nette Weiss, Mare Guirey, Sherry LeJeune, Debbie Adams. AT THE FINAL football game drum major Floger Streater presents flowers to Robert , Krueger, elected Band Escort and T l.isa Murphy, elected Band 1 Sweetheart. marching band 1 41 MAKING IT HAPPEN The shells were all that remained constant, the shells being the purple and white uni- forms that unified individuals into a working unit. Underneath the band and Talonette uni- forms, though, pride and disci- pline were the factors that kept these many students together. l'm proud to be part of the band, stated Tim Perez, fresh- man alto sax player. ln spite of the pride and confi- dent appearance of the groups as a whole, no individual could admit to never experiencing some jitters before a perform- ance. A new group ioined the marching band on the field, and their inexperience gave them more excuse for occasional bouts of the jitters than any other group. They were the flag corps, and the marching season was almost half over before they received their uniforms and flags. We could have done bet- ter, explained D'Nette Weiss, flag corps captain. But since it was our first year. . . I just hope we do better next year and get everything together. Next year some of the tempo- rary inhabitants of those shells, the uniforms, will have gone. But before their heel marks can fade from the football field, new indi- viduals would be trying on the uniforms left behind and assum- ing the identity of the unit. 42 X performances ABOVE, WATCHING THE TOP TAMARA SHUTTER performance of the Brewer Band performs at the homecoming pep the Eagle Marching Band stands ra y at attention before marching onto the field School life brightened by performances ABOVE, BELINDA BAKER executes the hat routine Night Train . performanc 3 MAKING IT HAPPEN LEFT, STACY HOWARD and Debi Watkins outyell the opposing drill BELOW, DRILL TEAM! is the cry team in the victory line prior to the homecoming game. for the Talonette group during a pep rally. ABOVE, JACKIE ROARK chooses a pair of Today's Girl the evening before a pep rally. 44 I talonettes BELOW, HIGH EVEN kicks are the Talonettes goal. OPPOSITE PAGE, TALONEITES ARE, FRONT ROW: Jana Carroll Clieutenantj, Stacy Howard fcaptainy, Jackie Roark flieutenantb. SECOND ROW: Mel- issa Strickland, Connie Bowie, Shelly Womack, Yvonne Stewart, Kathy Simon, Shelia Lauterbach, Pam Ethetton. THIRD ROW: Linda Coffey, Renee Reitzer, Gia Har- din, Kim Diffee, Teresa Robinson, Karen Van Noy, Belinda Baker, Leslie Parker. BACK ROW Tamara Shutter, Brigitta Simon Julie Sulak, Shermita Billingslea Becky Mabra, Linda Peterson Marvis Conley, Rhonda Van Winf kle, Debi Watkins. 6 It could be said that the Talo- nettes kept Don's 5 81 10 in busi- ness for toast-colored Today's Girl pantyhose during football season. No Friday morning would have been complete with- outa frantic trip to the local dime store for that one agreed- upon shade. The cause for the trip was usually a runner inching down a leg, threatening to spoil a pep rally appearance that day. Appearance was the key to a successful drill team. Just as the girls' kick had to be of the same height, everything else, right down to the color of eyeshadow, Sore muscles paid off had to be consistent. Actually, all the girls were alike from the first day of drill team practice, they were all uncoordi- nated. Fortunately, at no time again would any of the 26-odd girls have it so hard as the first few days. Each morning for two weeks they learned the ten rou- tines they would perform through the year for football, basketball, and eventually drill team contest. Those two weeks might better be remembered as the Battle of BenGay. Happily, the pain of sore mus- cles faded as friendships grew. I didn't mind all the hard work because in the end I had a bunch of new friends, said first year member Julie Sulak. The practice paid off. When the night of the first perform- ance came, the Talonettes were ready. Due to endless practice, they would all dance alike. They would cheer with the same enthusiasm because they would be proud of what they belonged to and the team they supported. The louder they yelled, the more people would know it. N. talonettes I 45 MAKING IT HAPPEN We have to do our job, but we always find time during a game to laugh and enjoy it, said Brenda Bateman, senior cheer- leader. Her description of cheer- leading as a job crumbles the longtime myth of glamor and idolization. People look up to you, said Eagle mascot Teri Hatfield, but they don't realize it's much hard work. Becoming the backbone of school spirit requires more than limber muscles and strong lungs. It requires a week at cheerleading camp, and from there on, three hours weekly of preparation for each cheerleader before a game. 'Seven girls together for five days can be rough, but we got along real well and also got to know each other real well, said one member about camp at SMU. The squad won the spirit stick three nights in a row for displaying the most enthusiasm that day. They took the stick home at the end of the week, an honor only a few squads received. lt was a lot of hard work, but well worth it, Mrs. Peggy Dietz, sponsor, commented. MASCOT TERI HATFIELD adds life and spunk to the mascot role at football games. 46 f cheerleaders s Y Q Q' '-9 Q f District foes discovered that they cou1dn't TAKE US FOR GRANTED En tering AAA com pe ti ti on after successful AA year, district dreams fell to sta te champion MIDLOTHIAN: As Crowley and Midlothian battled each other the spectators saw the Mi lothian Panthers cough up the ball three times and the Crowley Eagles relinquish the ball seven times. On the first drive Crowley quarterback Larry Hausner was intercepted, but the Eagles came back aggin that quarter and scored on a gass play from Hausner to H Tommy Rotenberry that covered 6 Lards. The PAT was good, Crowley led 7-0. A bout of fum le fever took place in the second quarter as the Eagles lost the ball on their second drive. Midlothian recovered on their own 37 and went in to score on a 63 yard pass comple- tion. In this dlluarter Crowley could not mount a drive, fumbling once again. T en Hausner was intercepted once more. Midlothian and Crowley each had a chance to move the ball in the third quarter, but it was not until junior Albert Perez inter- cepted a Panther pass on the Midlothian 49 that the Eagles were able to get together a scoring drive. Mark Walters carried the ball 44 yards for the TD. The extra point was missed, and the score rested at 13-7. Both Midlothian and Crowley fumbled on their next posses- sion. After carrying the ball to the 5 yard line, the Eagles received a 15 yard penalty. A pass from Hausner to Walters ended the sus- pense as the Eagles scored early in the fourth quarter bringing the score to 20-7. The final score of the evening came as 220 pound junior Chris Jennings grabbed an errant Panther pass and went untouched into the end zone. Crowley clinched their season opener 26-7. ALVARADO: Alvarado, previous district foe, met a tenacious Eagle defense and aggressive offense. The one-sided affair was due to three first quarter Eagle touchdowns. I A 40 yard pass from Larry Hausner to Gary Reasons set up the first score. Mark Moncrief took it in from the 4 yard line. The point after was missed. Crowley led 6-0. Moments later Clay Shirley recovered a bobbled punt which resulted in a short journey to gaydirt 3 plays later. Albert Perez scored on a 4 yard dash. he AT was wide, and the score read Crowley 12, Alvarado 0. Thethird score of the quarter came after a drive from the Eagle 25 built on the running of Moncrief, Perez, and Flotenberry. A pass from Hausner to easons for the TD left the score Crowley 19, Alvarado 0. I Alvarado ventured as far as the Crowley 1 1 near the end of the first half, but Robert Loftln intercepted an errant Indian pass to stop the drive. TAKE US FOR GRANTED Homecoming crowd cheered Bear defeat In second half play Crowley moved the pigskin down the field on the running of Moncrief and Rotenberry, but finally had to rely on a pass from Rotenberry to Reasons to contribute to the Eagles' runaway, 25-0. he only other score of the night came when Alvarado punted to the Crowley 1 yard line. Alvarado get on the scoreboard with a safety to its credit, ending the game 5-2. H D BREWER: For 48 minutes the two schools hooked up in a wide- open affair, but it took just 41 seconds to get all they needed on the scoreboard. After a scoreless first hal , the Eagles stormed out like a house afire and perhaps the Brewer Bears blinked and missed the entire bonfire. V It took just two plays from scrimmage on Crowley's first pos- session of the final half to strike the match which set the fire. After taking the ball over on downs at the Brewer 48, Eagle OB Larry Hausner hit split end Robert Loftin in crossing the middle on a hook pattern, and Loftin dodged his way to the end zone through the Bear secondary for a 5 yard touchdown. The kick after was wide. Before the Bears were able to absorb the shock, Eagle Clay Shirley picked off an errant Brewer pass seconds later at the line of scrimmage and returned it for the 6 pointer from the 20. This time the PA was blocked. A fumble recovery later by the Bears set up their only TD of the game. This came with 2:56 left in the third quarter. The PAT was good. The gap was closed with Crowley 12 Brewer 7. With seconds ticking away and the Bears with no apparent hope in signt, a Bear lineman made perhaps the biggest play of his career when he crashed through the Eagle front line in Crow- ley territory to block a punt with 1:29 remaining in the non-dis' trict battle. The Bears had the ball on the Crowley 6, but a stingy Ea le defense held on four occasions. growley earned its third straight win 12-7 before an enthusias- tic homecoming crowd of 3700. MANSFIELD: A gallant effort by the Eagles came up short as the Mansfield Tigers chalked up more points on the scoreboard. The first score of the game came as the Tigers passed their way for the touchdown. Crowley came close to scoring three times in the second quar- ter, but were only able to put points on the board once. After the Tiger score, Eagle Mark Walters returned the kickoff to the 50. Two receptions y Gary Reasons and the running power of Mon- crief, Perez, and George Anders carried the ball to the 8. How- ever, on the fourth and 2 Rotenberry slid down behind the line of scrimmage. The ball belonged to Mansfield, but they didn't keep it long as Ricky Frisbie intercepted and carried it to the Tiger 30. Crowley's only score came on this drive. Hausner gained 17 on a quarterback draw. Moncrief went in on an off tackle play, and Hausner added 2. The score was Crowley 8, Mansfield 7. Crowley threatened again in the second quarter when Nathan Beach intercepted a Mansfield pass and returned it to the Mans- field 28. Hausner and Perez carried the ball to the 17 and Haus- ner passed to the 8, but Mansfield took over the ball on the 6 when Crowley ran short of downs. Mansfield scored again in-the third quarter on a screen pass from the Crowley 49. he kick after was no good. The remainder of the game was mainly a defensive contest for the two teams. No more scoring occurred, and Mansfield slipped by Crowley 13-8. WACO C NNALLY: The Waco Connally Cadets' speed and quickness were just too much for the Eagles. The Cadets held the Eagles in check for most of the game, if not all. There were a few bright spots, though, as safety Robert Loftin intercepted two Cadet passes. Reasons added three second quarter points on a 28 yard field goal. The Cadets scored twice in the first quarter, once in the second, and three times in the fourth. Trailing 21-3 at halftime, a determined Eagle team emerged from the locker 'T stems.. .,,. . . .1 'e',g,,,N 'tie' -tf-1 . . . ..,....m...t....- . .. -. . . -. . , . ,. .. ...... ,. .N -. V.. fs- .,s,ii--,wa . . si, s-.:,.,,,.E.. T. 'If1ilT,g3's.-'Q' I' .' f tsts 1 .... ae-r 'B ' ' ' if sl srre - 1. A 1 , E ..,.,. Q , 495 'W as 1 SU - i K , 1 I X A , S 3 ., Suv-' w x fx KX Qi 5 2 ts. Q 1 ax Q I 'L A ts 5774 T9 Vid U81 Q em - in ,wk wan t . if xg-.,f 'r' 0 in H I ,'C , , ,Q 2 V V 'On The ' , l 2 7 'I ? if .i 11: sg . I f A Y J 'A 1 i A Q -f fax 1.1 I ,, Ji J' ,1'w1PQ51fw?',2i F' WI L? ,,.' 4 r n is 3 ' x A Q , . 5 Ke, rkyr 'hm ' ez' EQ . ' - ' .' 'V .V . ,f I K ,, gig, .. ff Q 4 Q ls , My f K w K' ' .., , I - ,G f V , 5 'm ' Y ' f' . E ., ,,,-, 'A , ,, gf - '.g,,:'j,g5y mf L ' TAKE US FOR GRANTED Freshmen, junior varsity put it together The junior varsity looked their best against Cle- burne. They put everything together, commented Mr. Luis Cunningham, coach. Playing four district games against AAA teams for the first time, player Joel Hawkins stated, We played teams mostly even with us, as far as ability is concerned. Joel went on to attribute their losses to their mental attitude. 'tWe were not mentally pre- pared for a few of our games. Sophomore Mark Johnson was eliminated from play by a broken foot. Ray Baker anticipated contributing to varsity play during the upcoming year. I think that the sopho- more class will help the varsity a lot, and next sea- son we will go all the way. The freshman team boasted a successful season with three district wins. Nlr. Cunningham stated that the team looked good all year. Defensively we were best in the early part of the season. The offense came along toward the end. John Hausner, freshman player, commented, I attribute our wins to teamwork. Also, we had a great quarterback to lead us. Q Q Q i f I , l A . A, - .4 'g-.- .:. ' ...Mn H A -.M ywf A ,L , ,nhl 3, wwf i f l 4 T ff' 1' rv- wits! s , JJ . . A H A .C S. ,. , -M ia., 15- I M, 4 -t I- Y . . A r lf f Y' 'ff' 4 1 ct., Q ig' , LL t -in f ig b Lg A 1, iq . ii f f ,F N- V . L- . Vs- 4 J lv: N A 6' 'ti - ' 'Yr' X . , 0 I A -, , , X . . wa- , 2 -.. 4 f 'lC2 1 , .... - m p ' .. f - ' K A' f ,,, -1.. 1' wiv? ' 1 ' ' '+ .. 1' we VW fx:-iw-.f'-' K. .,-Y. 131 - s., s f',a?2-B? iff' t -is-slffrf.- r .: '--:al 'S-,a-,H --W J -'va ---ff,-',4-we-1-.?3':5ts,4 ' ' , Max mf. .-vig'-If .y ?lz' fi- ' ,fggfv fi I ., - - .sa - at-.fu..t,.-.f .--A-:.f+-1 -fer..-.M -, 11f f,. -- 'gs'5f'3 A.,.f7'f ' 'YRW ifffA5 '.5 f3'x,-' .Q3 '?'4rG ' 3' W 5-.F -.' sl.,lNlC:5? VAFESSTY Tl Aly? i'ref.w1beis are, FRONT ?tOWi Qoug lackett, f3lt3f'f'l lug- gle, Steve Barker, Chappel, ,iohrzny lofflfe, Jeff Cole. juan iiorltferaa. SFC UNI? RCW, Don Newman, Tisomas Cooper, Hay Baker 'lrov Sectihtc, Mike? E.Zllt??OE'l, Randy Hayes, ilaif Httrcla, Mark llc-trnsxvn, Danse? Coker BACK RCW Qaul lwillfashew, Tonzftxy Carrots, joe? Maw k-ni-, Stieff F 'uett, Afwfly Kes? ng, M ke t-ford, Bart Stack, Wayne Sazrtctratilggtf 25 nga x 4x.f4,:44m.,4.: . 4 -4.4?W3 ' '4 'L---fiizfkizsvi' .WET At1k :5f S??55 ?'1feV'fV'?4 M4kf5T73S'i?I5 435 W5'f'gTV 455555 f5m:ff5k?T1L53f?V35M M? 'V5f l1w7:5Wi'7A xilefxlfiimf'-ifif?5:5iW'iN55E7?k5?A:i2Q?fle. f?5if5?55fE. 2-7f 'HV7'l5?'3N---71+-44 Wl??3E?3!?5fE?2T5'7?f .Y53Z91f1E2'!'?3s w 'Z2s4'57'ii' .9'Kf f5 ' Ywnfw W Q 4 - Ka BF X 3 Y 4 -' '-45:34-'.4' x4-f4:gKV4f. -W4 . ' .4ii444sfe-ff' , 4g.,g4,pg4.35-I 4 gzgvg-:Q-'rg 4 '-'4j1455iq5g:gf4Kif--'43 .- K .. -.fgfgqgggggfs 5 4: f4. ' -K 4 4:44 4 4, K-31-4 44 , , if ,.4i.4..z4Ui,'4 . 4'1-1,-g,1K441' 4' Ks'444Q543-A444 -- - - 4,,44i:- 4 S'-4?i44w, 4 ,44 44.3,-4 . . 44,444-44k H4,4,.4 ..4 . 4- ,4gf44K'4-4--'4,. .-,4,4,,-,g,.4 -34,1 4 4K 45,4--4 , ., .4,-.4.'4:f4..4: .4g44zH14,4,-. 4 4.4,'4.f44l4,e44:-.-, 431444-.4-4, . 4 s44 fa?-if ' .4z:,z'iff-'.,- ' zpiiii-42514. '4 fu'?ii4yV4i ' - ,4 V4zi5'z'f ' A 4 Tffffl-:9if IC f4fW55?5?'f33iLi:T I':f'V'4E44fi3gPi?'ze'4l:T f -4-5gT5.'-ifirk-44 ' 4444K5gfQzwxjfg,Q-: - -4 -j -g'g4nQiiQ4.4L T 7 4 '4 545'l4'Y?54f1 ' f'..f4?x7l75'LfV- 4' 3 ffU'kfiUk4f?x:h4:-4 -4 '-74lVZZ4F'SzKt4i- ' i.,'11f7!53Zif VWECT 54'-4i 0755132 'Tlru?l?7f45'fii ,,w -H52 Qmffwx .'f.l4' 9455 -'Z4ii21 V K SFT? 4. 44 -25f21gswz2es2:fgfy:-ws-dh-14:4f'-2,424gg'fs?Uf4Q.-,,-41455444-,S4-14:14.44-L 'S 44 S A W3 -4 J 92 4 '4 '43 TVF?3aE4':?4:l'4'.' 4159424-4f,4', ' 44'f1,3'2lF'SILQ' .. -rg-WUSQQ45 ik '1'5l2i'5:xg,v,5yx. 4 ,qz - 4' .4X5HP5-gfifmbf 51 5uliiE?3?z4i E1ll? 1f13H54w4sgf5fw X .-4544g534zaggszp 4 4- 4 ' '41'4i' ' 'kWiW4 ' -',:.v.s:4-4 -4 4' ' wW44'v-f 4 -4.444w4-44,.44.41- 44-4444444.44--. 4-444444244 ,.4,,..4,.. ,. 4 4-443--g.f,K4, - 4,.'4ff4- ' 4 4, ,, ,..,, 444, .,,, . .4 4 4 ,4 4 4-444-4441, - -4 , - 4, ,,fgr54vi3f:4.z4-- .,,4Q4Q1Qv:444-av, 4 K ...E , :aH?Xf2nf2s4s1: - 5 -4 if- 4 .L,. - .. , e Q 9 44 agggfrg:-g444, -,145 -4 ,,,,,, , ,. , 4,44---,44e,444 4 .434 -- My 4ww4,,.44-.m-ggggggg-744444 44534 4- 4-45, ,4444,4f-,4-44 1 , 4444414 4 , V444,-4,i4- 4, -4 .,..,, 4 4. 4 4 K44 4, , 4 ,4.-44 .4 4 4.14-44 Km ,K VKKA K , 4 ,4, 2445- ' - 4 v M44..41 . , .K. 5.4:44- , -4 4 4 . :,.w44-' - '444444f 2- -.-..1.4,J4,. ,',Kim45AKiHl K 4 :,4KmK.,,5.-.4 . , Q L-4.444 -4 4 .,W4,,4 - .4,4-144,45-,4, ,, ML-44 -4 44 4 . 4-134-44 4 ,.,,. , -4, .,,. ,. M ,Q sg 44 M 1: 4---44f'a494'5,4.e 4 fi-1 , 4 ,. -nM,.44: ,, 44-44.444 - 4 4- Q4m ?51Q4,,sN.y..44,- -,,4y5M,,, . .. 45 V4-44-,gm ,, ,, Z4?F fs .VK . ,2:4,..4144K4 f- 4 -4.44: 44 J-54-L5 M-N f-4' 1:25.-5, , K,, 43. . , .74-, .-K JW 4. 14 44 1- , 4 -k9Ls??fEE!'uLC5E '7-S 41 4,KK4 4 , , W 1 4 X' -,44444w-' . -4-4.5--EK ,.,. 15452444 .4 ,Kg-4 4 ' M544 -, K, , . 4 4.-54,4-44. ffrififi- .4 LfTlQi?f?4 ' 19-5141.- s,444J!214f4'--4.-.- 71v'i544f44 14,f45ix,14',44-k'K.,'5,44Q,-13 - 4--,4.4,m- -4 fm., .44 4 A -4.4 ,W - 4, 4,.-,44.,.. , ,.4,,,4,.. 'f 4-11222-mf 4 5:-4447if45W?Zsf5?7'-f4gf-H:4459642145-E.44'44 - ,, M f V ' fvfsifw '11 4 A 4 442 4?FSfa2,Tifv'v4 ' .4-444.40 5.1, 4452421555211 ' - --Mg ., ., ., .,,. 4 ,,,., .. 4 - ,, 4 ,K .f -4, .494 44,4 x4,, .4 4,-K -,g4i.,.Ul4-I .K ., ,. ,. , fi- 411,44 . . . 4, ,. . KM,-,,,4,, 5 'Q WM4 . 44 , 4454344 4 14, sf ,4 axmam-,-444-4., A, - ,Kumi , ,W .. ui , ..,.. ., 44. my . 4. .,.. 4.-44, mm. 44 4 ,,., 4 4- -44w4m.444.g M .K 4,3344 444444 453,451 L. 4, 744gKJ.sm544. I . 4 4 44 by W f 1-442225-:il 4. L' 4444- . -4 -44..4.4- - , ,, -44 M ,,, K ..,..- ----42-4., ..,, ...,..,,, M4444-,.44,, 44,K,,,.m,,. . A. , , , Qn,.44,, .ww K, , ,5,,.KK4, L Vswiiz 4' 41 .44 mm . 4 ggwywvl 4 4l,4:ff4?f!'4i?YSfi R,K,44.: ,,,, 2,-434Q?54,.4,? :i,4.g-vsfeiw, . -421:12 hw-e -izifgskf-5, HEP, Q-4J5fili?Y?4f'4 4-1 44 - 5-- .444',gifQ:ff,1f'K - 4 ,4g34f, 4 44 ,1 4- 4.4, , ,M-4, 4,,4.,K-,,r,,s. , -4. K,fm,- ,, , V4 4 W1 44ffs2z1'1zHf-444.4-4.4:-4ssQi'Lf-514451:--.-44: ' --. 4 4441--ms-1.4: 4f:am:,44 .4,-a4,:.44ms4f. 4-4::::,fif44z-gif:-,, ,44f1-ef-44s2:.:g:4444944454f'f4?gggg5-gfggvw 4 4- .- r Y 4 ' ' 4.414 If 44 ff 4 ' ' . A f' 'Vi 'flfilw 'iiiz-ii-'E 'Liffffi' ,4,-Lf 44 K 4 iVL2ki6lf?4-' i1-iiQK34i?if'4- - -f, 1211, 4 - l ' 'I?f4?4,.,,- ,4 Z' - ,-45252-4 '- . T' lm , ,,.4,',.,' 4 - wi 414' Wifi ' W- 112, if f..-k..,,,54f -'::f1?i?42f5igi-f'1-1 '4'lW4W:'4'-if '4-my 22344-1 -14v.f241f14W4-44:-4 4 Jsm44..4M-4 a:4i1az:Qs.1S12i- 14-4 -44455154 '94 E:m'i4gy24ff:J3 4Pfsi5i:i-:f44fiU'1? .fWiFif:fgf14f44443ks4WAf4Qff'444w-4-4-zvfmfrif -4 12454. 2 W 4 K ' 1 4' 4' ,-4,44.sJ4Y,4,. , -4 444-542-'iz' 4-4,42 .4w-tif-L2 , ,V 2-,iifkf 'i',,:-Y:?,s?f'---444 4 4444125444 4- 4--4,4:4:4,4444 4- -K ,,:g.wg4.. .4-444145. 5,4542 4 44.4x,44,..K.44g., 4,4g,W.KK4,4-,H .W,,K5,4K,, , ,K,.45Ki,. - f - 4 44 'LL' 4 ' , ' -4 -42,14 44 -'4-:445'4f1i- f:,1:4'541sv41- 4 - 4Q4s21Q4.4. . 4 ' '4 ,4f.,fi4l,4 .4 -'.,:iivgf'zfk'4 4 'Z..4?iii.-, ,'4 4.4,1i,1,'4'4V 421521 4- 4 4 5455-Ft 4 . ,:47ff42-'4- ,.4,i.4444,4. --144443211-,. - 4--5,4gf44Qf,g-4,4 4- .44,'f'sgus444--44,'K . 4,'4-44'fQ4f4f-,VK-5,4 K'-,,14za4s4K 445-52, K K.,4.,4g44445.44,,k--K45 - 4 44vg4424K 44- 44-45-34--agp: 4 A f ES A 4 4 4 4' A 4. 4 ,, - K 1 T-fi 4 '1 'K K , Si 4,540 - ' -41444-Q 0 4 4-,if I,1z'-W - 1 7ii4i4is,ii44-'4 4- 4l'if?4'Q4 if 544f:44i?iPi-1- 4- : 4124-2:E'r'4 ' 4E4?59?'5f -Y 4 1J':Y'4U1--45 4 --44-'iff-CEN 4,ZTi4715T4fk ' - HWHEIPQ4, 4-4471f4??42i55:f44', 4 .i:9TG C5iTfN94- 4- - ' 'MW 4424-54 ',.f44-1'i:3VEE'i'B.lf,' ,,,.. f4,T45iifff.?'44?- 4- ' :ii4fi?Q45iiS1!4!'--4 '44ii1-?i9iQsQz-f,, 4--My 43442-1 4 t,., . - -- -ffiazisfk. ,Lf fy' 94--f4'4-24- 4. 4 -4- Ka.4,g444.f4- K wffiiwlivlf' 44- - 4W55'4w14-- 44 ' -444KK,g.544235-4.4454?-4.-Q4,yQgjQz64Us54f44- 'uw 444g2p1qM-M1115-4rHX41f A W if F' 4 5 Wi? '4'5'?f3::1f-K4 -- -.,4-sv,5s14-47-4-4 ' 1 ?fL4vi1E24'f7,,,- 444..4. W 21ffzP?f'5'!' 4 4'.iiff4?51,f1k14Y1f'- K4 K- 215554526-4 4. -444545.46411 K. , 4.4444 4.KV,,4..4..A,.I 474443444 . ,V,.,4,g43 A .A44'il,C, , 4 ., 7.4-iw ,-444,ff5slQ14fk'. ,- 2f42Qef4:ix'.' -. f-4554324515 . Uf44513tx4-411- '4 - .-4Wf44?- 4 - '.,fs,,,4f43.14i44.- 5 K K .Iwi ,awi 4 g4K.,4KgygK,,44,,,44-,Kj 4K4- ,'5Kgg:4m,Qg-,,-- K- 4w,y5QX4r5LQ1,,K 45 4-44,454g4e15gifjKj5KKK -jlzsmsfwg ,K KK,g,g::TQgfsfg:4g -- 4, . K , Kffakmg zone. wasfhe varsity team s. glial, but they.-,K4 4,rawi,, -eaK44ne64 4 ,4KK-,44-Kp 4 -r mes., 4, 1. xfissmf--,,K4,Ks ,.,-- lass k V . ., .Y . zw.1mf!.x -4. 1 4-.M .,-- f .. - , 4 ., . 4--W 4-4 444 4 4-rf-4:54-4,4-4 14444.44 4 ff-4:,c:-4-4 4 -- 4 4-444-4.44-4 4 444:-4414. 4- 5 ,-K- wmv 34.4, A 4 K my . - - 4-41. 4 A -54,-1,, K.-4.43 ,.-,4 .,,, -'Fi---14-' - ff--QQ'-T55 K . gs . , KKKK-,,.44,.w4,-, - 4-4-4.-1545.4 sv-4 41.4,-f-444..,-, -. , - 4- 4--4,--454.4.----4,-.- K 3, ,,44, ,.,- . 4g,,K4K, 4'-444:-4 ' 44 ' Kxwz, .4 K, if , - ---- l-g- 4 - . . 4-- - ,-4,- . 44-44Qvfnw?Hbefed41 fhe 1 ,Qfeaf5-94 Height swf defense?-i4-,5 4 44 . 'diS?4i -E . . 4 4 Ca 4 4 -,.. - ,fail 206294 and NHUCY Voizih wefif Outstanding- ' 4--l- ----44 fihgsefrefs- i 4 44. - l .4 4 . , .4 , 4 '- ' ' 4--4-- 5 'f 4 4 4 4 4 4- lii ' . 4 -4,-iffih s . ,444 42 B 444,e,fsxx.rsQ, ..4,4-44-,4,,., . .-4.,.4, . , ws x 2 541 4 4 -?-3'?,3,- f -m4m4,4f,,K .- K,-4,.44,K. 44 4 - , 44414144 4,. . 1- .51 whiff -4, K -- 4- sg: '41, 1.4.4 1 4 - .4--4 '51e'l5ff11::- 14-af43.2E4-442-.Q 1 :fi 4 44-- 4 .4 -.K,.-4,--4 - - K4 44-Q.-44. I . .. , ,. .K .- 44-K44. qw --'..zzs4'4mf:f-f-, 44- . 4 4, ., E '4 -144114-rn - -44s.s 4 -I .,y-.,.4- 4 I - K. ,VK.Kgv,4.,-4K- 4 .. .. E444 4 . 44-. ..4--,-4--44-. . 44,5 . 4.,.4 ..,... ,. 4 - ,kk- -,MK 9 1 K4-K 44 f - i 4. sisgkfve' fin f-4:5544 We--me-QXIF-J - EZ-ww 44.-wk-4352-if-545 44- ,-4' 'siixi .S214w4..ff W fm????99f32i if?? 4. ,-4.-., - . 4,. Sf ,,4 44 ,4- W4 44-fl? -4--4-2fQk42ix1i,.i4.- -we 44.-W 4 ,,,,,.,, . Q .Q Z. 4,iXi.444 4 V9HeYba4n4 , ,-4m -KKKK4 .. ,, . ..,.4,,,. 4-.4 .- -444f4.w,,-. - .,,, si-4. -.4 Si ' ':'i-.isfifiif 1 I dwg an rf ilk ,ma 4 ll crcimped our style Our record cannot reflect all the hard work and determination T displayed on the court. -M it Ms. Susan Waitson T a T., Junior varsity volleyball team exemplified hard work, although the season record was not a suc- cesstul one, Miss Susan Watson, coach, stated, 'jAt the ends ot the season we were playing together, and had much to be proud off' Lack ot confidence, inconsistent spikes, weak serves and bumps hind- ered the team considerably. Physically small, the team was strong on sets and net, play, The girls reached a low in the middle of the season, but after winning third place in the tough Crowley Tourna- ment, were ready tor district play and their high point. Outstandingysetters were Kelei Setcik, Patri- cia Haskell, and Vaierie Whitley. T Teamwork was the strong point ot the hardwork' ing, fast-learning freshman volleyball team. The girls displayed few soft spots. Weak serves and a generallack ot experience were allllthat thwarted a perfect season. The giris acquired a well-earned first place trophy at the Crowley Tournarnent.'The only district toe to defeat the girls was Everrnan, Outstanding setter was sherryltaggari. Outstanding 587 volleyball spikers were Karen Hall and Kelly Rice. y . 15 f. , - - - ABOVE, FRESHMAN USA Reese concentrates on i bumpirigthe bali. LEFT, SUPER SERVER Monica Zuizila, iunior varsity, prepares in to smash the ball over the net. Q x WWW 8 Q Q aan lm' .T99 43 V3 2 0 u . fly? s ' wx. 'E' 1 L A .X .sv A f if V',' j 15 i K , A Q A - , f' 1 Q 3 i f I l , L xy Q 5 1 Q X Y .L -AN t . a ' Q' ff I JW I 4s mf' 4 . V - V A' - V vi' ww Vi K . f ln - an -W .Q lw' j:-.gx?7' V I y . L ---' , 1' 4' W' V l ' S L,' V V . RQ A 7 'A-Aw wi. ,1, ' .qv f , --l A K a.. 3 ' . 52- 4 n 5 g I , 5' f 7 lg V 'SW zzi EA? r O ff I I 7 K .,,, q if L, ? I H K I 15 l 1 L11 A , VI Is , is ' avbn 9 Girls' varsity basketball team had little experience in five man play, but not in the essentials of basketball. Five man inexperi- ence and free throws were the only weaknesses the team bat- tled against. Over all experience and playing together as a team were strengths. The most important strong point was the girls' deadly press. When working to its fullest potential, high scoring oppo- nents were held down to a mini- mal number of points. The high point was reached during district play as every sen- ior wanted the district and zone titles for her own. The most con- sistent high scorers were all zone players Sonja Moore, soph- omore, and Lynn Duncan, sen- ior, with Roni Hornell, senior, leading as the top rebounder. Ms. Susan Watson, coach, stated, lf there was something to change, I would have asked for fewer injuries and for us to have played five man last year. We never stopped trying! Roni I-Iornell summarized the attitude of a never-say-die team Senior Laurie Ingram expressed her view of the sea- son, From the bench, my opin- ion is that we had a great team and a very good season. Even though I didn't play that much, the season was a lot of fun. The biggest asset of the team was the closeness of the players which sometimes decided the outcome of a game. I feel this was one of our strongest sea- sons, not only in our playing abil- ity but in our team spirit, explained Roni Hornell. The toughest game of the year is usually different for each player. For Lynn Duncan the toughest game was against Ste- phenville because winning the game was essential to making the playoffs. We didn't win, but we never stopped trying. I feel that the season was a success as it was our first year in AAA play. We really came a long way as a team due to the team together- ness. 60 f girls' basketball ll ABOVE, POST KRIS Snapp fights for the shot against Fort Worth Christian. VARSITY TEAM MEMBERS are, FRONT ROW: Annette Baxter Cmanagerj, Kris Snapp, Sonja Moore, Nancy Voirin, Laurie Ingram, Karla Stailey, Roni Hornell, Becky Latshaw fmanagerj. BACK ROW: Miss Susan Watson Ccoachj, Kim Guidry, Kim Lee, Katrina Fitch, Lynn Duncan, Pam Endsley, Darla Blakely, Karen Tritten, Karen Fraisier fmanagerj. LEFT, SENIOR NANCY Voirin stretches to win the jump ball against Fort Worth Christian. ABOVE, KIM GUIDREY shows good form on her freethrows during the game with Everrnan. girls' basketball f 61 We never stopped tryi g ' ABOVE SONJA MOORE is successful in going up for a shot against Graribury. ABOVE, NANCY VOIRIN uses ABOVE, SENIOR KARLA STAILEY height and skill to get a shot off jumps high to tip the ball to a very against Fort Worth Christian. anxious Darla Blakeley. Q, Xl 3' n ' T . Y 62 I girls' basketball Weatherford Alvarado Fort Worth Christian Cleburne Red Oak Alvarado Brewer Weatherford Nolan Aledo Grand Prairie VARSITY Red Oak Mansfield Fort Worth Christian Brewer Everman Brownwood Stephenville Granbury Cleburne Everman Stephenville BELOW, SENIOR PAM Endsley takes it to the rack for another score against a steady Alvarado team. 33 53 40 33 55 37 ' 28 36 60 19 80 38 52 34 43 35 45 47 57 42 Manshdd 25 34 Cmburne 51 46 47 34 66 54 45 39 ' 36 50 22 29 23 79 31 29 73 51 60 30 57 47 41 63 A 41 48 ABOVE, FORM AND concentration occupy Lynn Duncan as she shoots freethrows at Cleburne. 1 RIGHT, HEIGHT PREVAILS as Kris Snapp gets the tip against a Fort Worth Christian player. girls' basketball 7 63 We never stopped trY I 9' Junior varsity girls had a tough year against some really rough opposition, but managed to pull second place in two tour- neys and keep an l 1-11 record. The outstanding forward was Gwen Smith, who also shared the title of top rebounder with Mel Reese. Junior Kathy Ken- nedy stated, 'flf l could make a change in our season it would be in the self-confidence of our entire team. l think our strength was our sportsmanship and our major weakness was turnovers. The high points of our year were our tournaments. We had a suc- cessful season because we worked so well as a team. Freshman girls had an overall good record, finishing 13-7. Freshman coach, Mrs. Karen Crow, stated, More height and self confidence in shooting would have boosted our season, but our season was pretty good. The outstanding forward was Fledonda Capshaw and top rebounder was Yolanda Conley. Kristi Bagley explained, lf there was something l could change about our season, it would prob- ably be the games we played badly. The high point of the year was our game against Eastern Hills. Our major strength was our defense, out biggest weak- ness was shooting. RIGHT, SOPHOMORE KELEI Sefcik goes up for a jump shot to add to the Eagles score against Cleburne. 64 X girls' basketball JUNIOR VARSITY FRESHMEN Weatherford Western Hills Alvarado Alvarado Grapevine Western Hills Brewer Everman Burleson Cleburne Brownwood Stephenville Grandbury Everman Cleburne Stephenville Granbury Weatherford 36 78 Alvarado 31 19 Western Hills 40 6 Burleson 20 38 O.D. Wyatt 26 28 Grapevine 56 25 GrandPrairie 33 38 Azle 38 20 Keller 46 32 Western Hills Brewer Everman Cleburne Brownwood Stephenville Granbury Everman Cleburne Stephenville JUNIOR VARSITY TEAM members are FRONT ROW: Becky Latshaw Cmanagerj, Tammy Cox, Colleen Fette, Sherry Brad- ford. SECOND ROW: Sheri Osmun, Karen Steenbergen, Kim Guidrey, Sherry Woer- ner, Kelei Sefcik, Mrs. Karen Crow fcoachj. BACK ROW: Sharon Porter, Gwen Smith, Michelle Bray, Mel Reese, Teri Eller, Kathy Kennedy. FRESHMAN TEAM MEMBERS are, FRONT ROW: Shelley Donahue, Sharon Stephens, Cheryl Clement. SECOND ROW: Tracy Ellis Cmanagerj, Lynn Hughes, Lisa Reese, Sherry Taggart, Karen Hall, Kerri Clement, Cmanagerj. BACK ROW: Kristi Bagley, JoAnn Domi- ney, Redonda Capshaw, Kim Hudson, Yolanda Conley, Kelly Rice, Mrs. Karen Crow Qcoachb. girls' basketball X 65 2 K 2 3 3 2 F 2 2 X K 3, S J -1QJQ5i' K S 1 2 2 1 fvfs?m,w , - 2 it 3 'C s K 3 Ax 2 Q 2 A 3 5 W W Q Q Q1 Q 2 2 3 5 K 3 2 S P S 4 2 Q Q X , , 1 p 2 2 xx .,k. i ,L..9.,f,,, e 3 2 fs :Q-fwfr-2 Ji: Y S fvzgiwz' A K f X K . 52 K S 3 - 'few ff 2 My wg Q P , . J W A I -4 QZL 2 1 'lm 3 xv' J , C ACM 33 .K Zig N N7 'R 1 'fx 'nn -we G PTS. 21 263 25 313 25 155 25 142 23 89 15 73 25 80 8 4 16 6 BELOW SHOWING BALL- Neagle advances towards the iron. I HANDLlNG agility, junior Dwayne LEFT SCHOOL RECORD- HOLDING high jumper junior David Beck leaps for an additional two. FAR LEFT, LOCKER ROOM DISCUSSION captivates the attention ofthe entire team. I v- x. I j 1 REBOUNDS FG FT AVERAGE FOULS OFF. DEF. TOTAL ATTEIVIPTS MADE PCT ATTEMPTS MADE PCT 12.7 Frisbie 60-79 139 241 105 43.6 85-51 60.0 12.5 Reasons 106-107 213 300-129 43.0 110-53 48.2 6.2 Anderson 28-56 84 177 55 31.1 90-45 50.0 5.7 Neagle 21-23 44 124- 53 42.7 69-36 52.2 3.9 Farley 32-31 63 89 30 33,7 41-27 66.6 4.9 Montgomery 33-34 67 88 33 37.5 15- 3 20.0 3.2 Beck 29-54 83 93 24 25.8 31-12 38.7 0.5 Fritz 1-1 2 4- 1 25.0 3- 2 66.6 0.4 Bowie 4-6 10 13 3 23.1 3- 0 00.0 G 2 Gamesg OFF : Offense: DEF : Defenseg FG 2 Field Goalsg FT : Free Throwsg PCT : Percentageg PTS : Points. boys' basketball 7 67 10' g, .H..W,:,..-f.iW...,.,M-,.,. ,.,.,.MM.s-- ,.,,,,..W,W,,,d.,,. ,,...W.,W ..,dW,t,,,,,-.,,,.,..,. .wr Wwfff ,.,,,E F, F .gfmm .wi W-.. ,cg -fe-a n iii il ggi? Sig? Q Q 5 li . 5? i igii, LEFT, RISING TO the occasion, g 3 V5 sophomore Delmar Montgomery l 4 il .-f. WVh sw! Q, -. 93, If N F 5' U7 O 'O 'U O 3 FD I1 ,. U1 E - J' T: 3 12, 3 CD was Km, ' , W MTE Wm, s sl uf ,t 1 LIGHTING UP THE scoreboard once more junior Gary Reasons adds two to his team leading point production 5 :., ,.., 2 5 5 , TEAM MEMBERS ARE, FRONT ROW: Jeff Pohorske Cmanagerj, Dwayne Neagle, Delmar Montgomery, Gary Bowie, Brad Anderson. BACK ROW: Mr. Mike Cook Ccoachj, Kyle Farley, Gary Reasons, Ricky Frisbie, David Beck, Mike Raulerson Qmanagerb. boys' basketball f 69 DESTI I-leigh tlsldisadvan tage threw teams l t in no other game inlthefsports world can clomifff nance he determined easily, but in basketball there is such a factor. lfbiayers are taillerlltharfl' others they eeee shoerlrd xggin rnorerbasisetbaeil games than smaller teams. When this is combinedwith quickness the result is sorraethirtg sgseclat, Junior varsity and freshman basketball teams met this priiblerii halfwaij butflcanl dirt the small end otttheestncls. The jurqtroregarslegy no starter over 6', but this did not darnpentlthellighlf that thefteasm showed. Afiessrrtitansillaverrfageeglr-12 record didn't tell the whole story. Three of the 12 losses Werellllby lflto points, and were 3320 12? poients. ENo starter axgeraged Qyer M30 points, brit Marshall Green led with 106 points for the year. Freshman- ooetpetiltions was- unusuaihf tough, and the freshman's record proved it. Freshmen tried everything ltrorn thelstall againsl:fClelaurne to the half-courtktrapthe larterparteot the season, The more experienced sitlhools used alruni amzlrgun style tetesoffset this efiort.,Theelresgmarg team's big man Steve Bates led the scoring chargesfwithfl56fpoints. This season for the junior varsity andefreshmen teamslcoulol only be teriinedl llls a lelarnlng eilperil ence- AS most players have oonertrsrisvvasandsleveo three years of varsity competition leftj being its the toughest districtsin AAA or even irsglthegtstatet has taught meaningful lessons to 'these rounclbal- 70 I boys' b85k9'lb35l FRESHIVIAN CHRIS GRAY drives past a Granhury opponent. MIDDLE, FRESHMAN LEO Merino moves the ball past a Granhury opponent. FUGHT, DOUG TACKFTT heads a last break, 'E s.a . -1 , ' '2 ' -',' ,, Q:, V2,.,, -lzv 1 -': Ill! - T - k smash-T QW., if A , iii 2, .. .. f' 1 . i ' ', 'r N n ' , L. K wifi' . - n FAR LEFT, FRESHMAN team members are, FRONT ROW: - ' . so ' i QP T Leo Moreno, Alan Laserna, Gary Campbell, Bobby Booker, T IU , 1 X 25 34 55 f J Pat Brownfield. SECOND ROW: Bret Perhorske, Jimmy , , ' y y EJ f . 3- J , Q -J Maynis, Jeff Lee, Pat Fotteni, Terry Castro. BACK ROW: 1 my sf . -- V . ' 'B -Tw' y-fm--'i7Qf.,--3 F' 1 Mike Mocanathy, David Loftquist, Tim Parks, Steve Bates, V -. i L 1 T51 ' , Randy Beiker, Dale Woodby, Mr. Louis Cunningham 53 , - K , coachj. - 44 , fs 1 zz 45 f ,14 ,. , 11 If 5 V' if LEFTSJUNIOR VARSITY team members are, FRONT ROW N ,' Q - .. i n , K ie g 1 Troy ecchio, Roger Douglas, Jeff Cole, Doug Meyers, T -. V ' E fu , 5 ' Juan Contreras, Doug Tackett. BACK ROW: Marshall ' ' lk X y , k 4 - , I M- ' Green, Keith Duvall, Scott Pruitt, Mark Hohnson, Jimmy t mg- V ,H Q' . f y 5 Vx Peacock, Joel Hawkins. ' 1 H ' -.4 f boys' basketball f 71 SHERI OSMUN I feel the most important event is not the relays, but each indi- vidual event. Each person partic- ipates in her own event and does it to the best of her ability. This does not only give her confi- dence but also gives her a sense of accomplishment. LYNN DUNCAN There were only two reasons that I even ran track this year. First, because I enjoy running on the mile relay, and second, because track is good condition- ing. Our team did pretty well this year. I feel we improved with every track meet, and we placed as a team in a few meets. 72 1 track Eight special girls gave all they had to a special sport KIM GUIDRY GirIs' track is a sport of dedica- tion. It is very challenging, espe- cially in the AAA division. But I personally enjoy team sports more. - . KATHY KENNEDY The only way in which I did reach my goal in track was that of making it to district. However, I didn't quite reach my most wanted goal, which was to increase my throwing distance. I was pleased in going to district and placing because the compe- tition was stronger. SHARON PORTER I felt the competition was a lot tougher in AAA than in AA because there were twice as many contestants to compete against, and a lot faster times to try to beat. SHERRI WOERNER I'm wild about track! I am nerv- ous all day before a track meet, but when I get out there and do my best, it makes me feel happy. It's hard to explain. ,, .f . th. , p 'A?:'lnSntSl13ll?er 'ng SONJA MOORE High jump is a mental event as well as a physical event. A per- son can't let himself by psyched out in this event because it is a hindrance. I didn't reach great heights this year in high jump because I had a mental block about it. BRENDA PURDY Now that Crowley is AAA, it is a real accomplishment to reach district. But every athlete should aim for something bigger such as regionals or state. Each indi- vidual should be higher than what they were in the past or what they will probably accom- plish. Advancing to the district meet used to be a mandatory thing for an athlete. But now a competitor has to place in the top four in his zone to even think about taking the trip to Waco. All other track meets lead up to this event, as this is the ulti- mate goal for a sprinter, hurdler, field event specialist, or long dis- tance runner. With the two zones an individual, has to go through his specialty at the same pace for two consecutive weeks to be a district champ or even place. So just placing is an honor in itself. The girls' varsity track team qualified nine for district compe- tition with four placing. Leading these individuals was junior Sherri Woerner. In sprints, Woer- ner listed jaunts of 11.5 in the 100 Cfourthb, and 26.7 in the 220 Cfifthj. In hurdles, sopho- mores Sonja Moore and Brenda Purdy finished the 80 yard course with fourth and fifth places respectively. ln field events, only one managed to place, junior Kathy Kennedy pulled in third in the shot put with a throw of 35'9 . Other qualifying for district were Kim Guidry, Lynn Duncan, Sharon Porter, and Sheri Osmun. The team's overall point production ranked them eighth of the twelve teams entered. GIRLS VARSITY TRACK members are FRONT ROW Sharon Ste phens Sheri Osmun Sherry Brad ford Darla Blakeley Brenda Purdy Cheryl Clement SECOND ROW Karen Tritten Michelle Bray Sherri Woerner Kathy Ken nedy Mona Diffee Sonja Moore BACK ROW Kim Guidry Lynn Duncan Sharon Porter Gwen Smith Teri Eller . , ' f f ' 1 1 , . 1 1 1 1 ' 1 1 - I r I 1 track X 3 DAVID BECK I set my goal at 6'6 before the season even began, I did that twice this year. My ultimate goals was 6'6 until I did it, and then I set my goal at 6'8 but couldn't get it this year. I think l'm going to set my goal around 7' next year. GARY REASONS My throws this year weren't consistent, however, my better throws could possibly have placed higher in AA. ' e GARY DICK I suffered two broken toes one week before zone, and I had to break in a new pole in one week's time. I feel I can do better next year if the weather permits. The other pole vaulters will be disappointed when I take state. My goal next year is 15'. CLAY SHIRLEY The challenging part about the 440 yard dash is guts and stamina. To run a quarter of a mile at full speed is a real physical test. The 440 relay is a race that not only requires speed, but great coordination between other runners. Track is a sport in which you are able to mentally and physically test your body. WES ATCHISON Varsity track was all right. The coaches expected a lot more out of us than they did anyone else. I am not real sure why I run. Really, all I do is lay out and get a sun tan. 74 X track N . A.-. wr Q.. -..E V i .ff I 1 x - .t .- A - - Q-.Q-:li t ,J ... ., .yy s. J. . .- . A ut., .Q , ff ,X Q f ni. g-1 f fx tiff H .f . . pggqngnig eerhmg' Seven made d15tr1Ct, two reg1onal5 KEITH DUVALL Durlng track season I ran distance work In the mornlng before school and then I went through track workout wlth the team after school The competltlon IS really a lot tougher In AAA than It was In AA The times are better plus there are more mllers that keep up wlth the lead runner In AA where there was maybe one or two fast guys In each race In AAA I put In a lot of work thus year but I don t feel that l put In enough or at least as much as I should have I was looking forward to runnmg a good race at dtstrlct The ram hurt me but I thunk It had the same effect on everyone F' Q.. :FQ 'Qin W-ll all Boys track competltlon labored under the same clrcumstances as the gurls track team tough competutlon and hav mg to place hrgh to qualify The varsity team made trups to Stephenvllle and Waco for two weeks of performances They endured the zone meet at Stephen vllle with five mdlvlduals and both relay teams quallfymg for the trap to Waco for dustrlct Fleld events at the zone level was where the varslty hut the jackpot as three of the flve competitors were In this cate gory School record holdnng hugh jumper tumor Davld Beck who weeks earlter set the record of 66 placed thlrd with a leap of 6 Gary Reasons captured the dlscus wath an effort of 145 4 and Gary Duck tsed his standard of 13 6 by placlng furst an the pole vault Zone sprunts were captured mostly by Everman but In the mule lunlor Kelth Duvall placed third wlth a time of 4 57 47 The only sensor who mdlvldually qualified for dlstrlct was hurdler Phlllp Franks who covered the 120 yards In 15 54 placlng fourth The 440 relay team of Albert Perez Wes Atchlson Del mar Montgomery and Clay Shirley placed fourth with a ledger of 44 2 The same quartet ran on the mule relay team and also placed fourth wuth a 3 30 49 The team s 66 points placed It fourth In the fleld of sux teams At dlstrlct competltlon two quallfled for reglonals Beck and Reasons Reasons throw of 150 placed hum second Also Beck galned second wuth a lump 016 4 The ram halted Keith Duvall from placing hugher as he placed flfth with a time of 4 55 78 More musses cost Gary Deck a spot nn reglonals as he placed third at 136 once more In the 120 hurdles Phlllp Franks placed flfth with a career best ol 14 9 The sprint and mlle relay team dld not qualify for reglonals BOYS VARSITY TRACK members are FRONT ROW Gary Duck Albert Perez Mark Moncrnef Phllnp Franks Make Moncrlef George Anders SECOND ROW Keith Duvall Mlke Sullvan Wes Atchison Chrus Terry Greg John son Brad Anderson BACK ROW Mark Ledyard Andy Kesllng Gary Reasons Davld Beck Robert Teague track X 75 RIGHT, WHILE ATTEMPTING to jump at the district meet, Sherry Taggart knocks off the bar. FAR RIGHT, IN hurdles competition Ray Baker clears the first hurdle. GIRLS' JUNIOR VARSITY team mem- bers are, FRONT ROW: Kim Hudson, Renee Perkins, Kristi Bagley, Joanne Dominey, Shelly Donahue. SECOND ROW, Sherry Taggart, Karen Hall, Colleen Fefte, Miley Bassett, Susan Beck, Jackie Lynn Moore, Joy Wil- shire, Belinda Riney, Sharon Slack, Laura Steele. BACK ROW: Lisa Reese, Kelly Rice, Katherine Myers, Sharon Ellsworth. 76 X track ,A ei, ' SI'5'3lLE'2,?.2P.?.!P '9 Up-and-Comers came on strong I BOYS' JUNIOR VARSITY track team members were, FRONT ROW: Rico Chazaretta, Dale Woodbee, Scott Goodwin, Ken Guidry, Tim Frasier, David Med- ford, Billy Griffith. SECOND ROW: Scott Pruitt, Marshall Green, Willie Lindsey, Wayne Sandridge, Rudy Good, Brad Petty, Allan Lagerna. THIRD ROW: Steve Bates, Steve Barker, Tommy Pedigo, Mike Yar- ger, Gary Tidwell, Don Yarger, David Lofquist. BACK ROW: Doug Moore, Joel Hawkins, Ray Baker, Scott Murphy, Troy Secchio, Randy Hayes, George Medina, Bart Slack. track f 77 78 I baseball i Having entered AAA with hope ot the same domi nance they enjoyed in AA, the varsity baseball team was handed hardship at this higher level Second year coach, Mr. Larry Pillars, who cap tured the district and bi-district championships the previous campaign, had to cope with an inexperi enced team as only five seniors returned. As Cle burne crashed its way to the district crown, the Eagles could only manage third place with a dismal 3-8 record DISTRICT 2 5 O 14 Cleburne Everman 3 10 8 1 Stephenville Granbury W LOT 8 VARSITY BASEBALL Dwayne Neagle Centerfield Larry Hausner Third Base Tommy Rotenberry Leftfield Jimmy Lott Shortstop Gary Reasons Catcher Bryan Miller Second Base junior senior iunior senior iunior senior 0 'YVC Years Varsity Competition As most seasons have their ups and downs, Mr Pillars stated, Our team batting average was far below what we needed and the fielding was incon sistent. But he added, Every year has its satisfy ing points for a coach. The younger players showed a great deal of improvement through the season to make us stronger next year He showered praise on two exceptional players Consistent play by Larry Hausner and Dwayne Neagle proved to be our strength , He set aside Neagle by saying, Dwayne Neagle was the most consistent hitter with a .333 average A conclusion was reached on theiseason by Mr Pillars when he stated, The pitching was sufficient in most games this year, but a lack of support often sively proved to be our downfall. He added, I do not feel this team reached its full potential. The bad weather prevented us from developing any continu ity in workouts I'l l'l I' I' ABOVE THE UMPIRE waits to make a call as senior Jon Hargrave makes one last effort RIGHT AN EVERMAN third baseman watches as senior Jimmy Lott adds to his production 3 - 5 - 51-11 5-155 1-85 4-8 . I - 5 - 51-O ' - O-75 3-2 TOP SIX STARTERS BATTING AVERAGE POSITION GRADE A VE RAGE YVC ' , ' ' ' .333 2 d , ' ' .266 4th , ' ' ' .25 2 d ' , ' .225 3 d , ' ' .222 3 d ' , ' .185 4th Previous AA power handcuffed by AAA pitching as or lock of support ended former dominance VARSITY TEAM MEMBERS ARE, FRONT ROW: John Hausner, Doug Myers, Ernest Moore, Bryan Miller, Jimmy Lott, Artie Hornell, Bobby Booker. BACK ROW, Victor Guajardo, Juan Contreras, Tommg Rotenberry, Jon Har- grave, anny Tidwell, Larry Haus- ner, Lowry Hunt, Dwayne Neagle, Jeff Pohorske fmanagerj. 2 - baseball f 79 0 ICICK Of Support T Season ended onashutout Q'----. ...MMI --1. ...., -40--V -fA---- ..,r.l.l . ....,.,., ..,..-,. V' A 'F- wff rg. g ww of hvfy.a::f: . , ,ye ,rx vf' . . . W ,,,,..,.gfn,,3u-. . -, i 'T 13 ' , jfs.: . . 316'a4': 'J ,Q A : 1. 'if.'.:i4?W W4 L , AM' , 1 ' in .' v ' i 'ggi 5: .. ' - Mg? , mr 'bf' it v-.. .avi-we , ..,,,, - .w - y f 44 -af . ,. ,. M Y , , ,pdf J, ., .J ,W 'T' Y, 6 .. , 9 K .L ,f .e... The averages were lower, the run production was down, the earned run averages were up, and the lack of consistency in the field hurt 'this inexperi- enced nine. T T T The starters were junior Gary Reasons behind the plate, junior-Victor Guajardo at firstg senior Bryan Miller at second, seniorLarry Hausner at third, and senior Jimmy Lott at shortstop. Theoutfield had iunior Tommy Fiotenberry in left, iuniorrDwayne Neagie in center, and senior .lon Hargrave in right. The pitching staff was Larry HausnerfDwayne Nea- gle,eBobbyi Booker, Jon Hargravefand Lowry Hunt. The best played game was the last one against Ste- phenville as Dwayne Neagle and Bobby Bookericorn- binecl forthelshutoutfwiththis1-Orvictoryq T , T aofoasebaiir . s 1 h 'sl 1' . f 4 'K TOP, LARRY HAUSNER leaps into ABOVE, A CLEBURNE the air, and the ball is his. Yellowjacket tries to beat the ball home against catcher Gary Reasons. it A ' fin l 'Q-. Photos by Pete Kendall, Clebume Times-Review baseball f 81 NEW GAME PLAN: an 2 ' TOP, TENNIS TEAM members are, FRONT ROW: Gary Campbell, Johnny Loftin. BACK ROW: John Herweg, Jimmy Manous. ABOVE, TENNIS TEAM members are Mike Deason and Jonathon Lee. 82 X tennis his TOP, TENNIS TEAM member is Lisa Wilks. ABOVE, TENNIS TEAM members are Marty Bianchi, Karen Bailey, and Kelly Chapman. Vwwmfmmwf Q 1 1: ,1.f,,.,..g..,e,,:, ,. :Wwnmff I ' ,,f-, f A-. kr, ,y V 'Q V .N 7 3 r MV , --:g',f.f H ' ' ,nb ' A ,VJ ' fr . if 1 .7 1 -f' 1, x- v . 5? J 'iw- W ' A EM'- like M? tif 2 f 1 V wg .L . V Y ,,. J ti, 4 1 1 V' wr f f F t if H! ,I ff ff ' SW' fc! ' , ,gf ,Q J f 4 . I f 1 'E . gQ,? 5?,1 it ffl ...,, Van . 'TX Q 4 Improvements in tennis program Since Crowley High School is AAA, we need to triple our practice because the competition is rougher. We also need a program that includes drill, weight, and exercise. More and better courts would help, too. In that way, Jonathon Lee, named best tennis player at the Athletic Awards banquet summarized the frus- trations and hopes of a team which did not win a match. The planned construction of twelve new tennis courts would solve one problem he narned. Team members hoped that the others would also be resolved. 121' . x X 'W-. '1 yfgfyiif . Hit-,Q iV ,ffizg VV k..V V 1 In I '- ,.,V.,. . g,,V. V, V , V .. Y f '--' H L . W . 4 ...,.,, , ...,.., ,m,,, - i::xz..a'f-war ff ,.,..,. V - L L it L -f. f .rv Vg Q, . Nga M V LEFT, JIMMY MANOUS serves the ball. ABOVE, JONATHON LEE volleys the ball back over the net. tennis f 83 84 X golf DIFFERENT STRDKESI lf ,hnisf r Awe I-W , Q X, 'Jai' iff'-if -,f If TOP, JUNIOR MARK Ledyard leans into a practice drive, ABOVE, JUNIOR BARRY Featherston uses good form by keeping his head down. Wy! L, ,, N -E, g, fvumw- vw., H- I ., 111,43 ' 8, ,, .f-1 ,M f fi ' I ' MP1 TOP, DIGGING HIS way out oi the dirt is Barry Featherston. ABOVE, MARK LEDYARD concentrates on hitting the ball. 9 A' 3' ' I .a.,,. J f Il' I f I 1 Only route to team 1ITlpI'OVE1Tl8I1f Though their season was not a successful one, the golf team attended four tournaments. t l's When asked what the team needed to James Ivy, coach, stated, We need a to practice on because I feel that their skills and their momentum to Every Tuesday and yyss hursday the to Pecan qfgood eighteen Ivy statesyigthatihe considered himself more of eipylained that a pro Val- ley, igave the on me aria f?Q Ulefions Of QQLEI i On and week the playefgif. ldi..be,eeseqn t3ghindfthe field house practicing olnlyfreygard being the satisfaction of knowing that thiayffadlworked hard at acquiring skills and building the self-discipline which enables an athlete to compete out of the lime- light. ABOVE, SENIOR KYLE Farley shows how to drive a golf ball down the fairway. LEFT, KYLE FAFILEY, using the perfect stroke, slings his way out of the sand trap. golf X 85 86 X athletic award: fe. S WITH avg CW' xv' 'iw- .., X in 3, -Aa 1 TOP, AWARD WINNERS are, FRONT ROW: Lynne Duncan fbasketball, outstanding torwardj, Roni Hornell fbasketball, outstanding guardj, Kim Guidry Cbasketball, most improvedj. BACK ROW: Pam Endsley Cvolleyball, outstanding playerj, Sonia Moore Cbasketball, outstanding forwardj, Karen Tritten fvolleyball, outstanding . playery. 'ffk 'Q if-'lt' 1 - f is A4 U9 45 H 5' 335 ABOVE, AWARD WINNERS are, FRONT ROW: Larry Hausner Ctootball, Fighting Eaglel, Nathan Beach Cfootball, Fighting Eagleb, Grift Rambo Cfootball, outstanding Iinesmanj. BACK ROW: George Anders Cfootball, most improved, Albert Perez Cfootball, outstanding backj. A TCDUCH CDF CLASS With a Touch of Class - the Crowley Eagles was the theme of the much anticipated Athletic Awards banquet. Tables were decorated with ivy and paper eagles. The banquet was catered by Vance Godbey with filet mig- non as the main course. Mr. Bill Hix, newsman from Channel 5 was the master of ceremonies. Mrs. Eldon Bean, wife of school board member Mr. Eldon Bean but known by coaches, players, and other Crowley sports enthusiasts as Mama Bean, surprised the coaches with some special gifts which she presented at the podium. Following the banquet, every- one moved to the auditorium for the awards presentations. Lining the stage were small ceramic eagles painted and glazed by students in Mrs. Diane Muller's and Mrs. Sue Martin's classes. Each senior athlete was given one as a special surprise. The outstanding athletes in football, volleyball, basketball, track, tennis, golf and baseball were called forward and given a plaque by the respective coach. i. if' ABOVE, OUTSTANDING BACK Albert Perez accepts his award from Mr. Ray Sefcik, athletic director. LEFT, ALL DISTRICT athletes are FRONT ROW: Pam Endsley, Clay Shirley, Lynn Duncan, Griff Rambo. BACK ROW: Larry Hausner, Gary Reasons, Sonia Moore, Dwayne Neagle. athletic awards I 87 88 f athletic awards firm, , RIGHT, AWARD WINNERS are, FRONT ROW: Larry Hausner loutstanding baseball playerj, Sherri Woemer ftrack, outstanding performerj, Jonathon Lee Qoutstandinztennis playerj. BACK R W: Kyle Farley Qoutstanding golferj, Dwayne Neagle foutstanding base II playerj, David Beck ftrack, outstanding performerl. www A TQUCH ,CDF CLASS LEF'I', AWARD WINNERS are, FRONT ROW: Dwayne Neale fbasketball, most improv j, Brad Anderson fbasketbal , outstaning defensej. BACK ROW: Gary Reasons gaasketball, outstanding offensej, ick Frisbie fbasketbal , outstanding oftensej. BELOW, MRS. ELDON Bean, a longtime supporter of the high school athletic program, presents each coach with a special present. .I .K I 4, , vw, it S, V -A ,iv -1- 'f'4.g,. i.:',:'5' .1 -g411,1,,, WAP v.,-f Cheerleaders and Talonettes were also recognized for the part they played in supporting the athletic program. The first year in AAA had been a rough one, but after a year of sizing up their opponents in larger schools, Crowley athletes vowed to be tough competitors in the coming year. MR. RAY SEFCIK, athletic director, addressed the audience before presenting awards. athletic awards ! 89 ademics c X a 90 9 a 1 '000'0P0o60O06f06.nsj 6f76'f'O6 1'Gf002S'C'l16'SGl7'v6l6056 -Yf00604r6,+sO005'b9o60 46 4909606006009 64309 60605051063 Of 0688- foo05 lvoffg 6096000006 060 0260060 610009 '25 660'6f00f0004!?560066f0f096496060060 0' 0498668 lvo01'60 QFVGOZ, x0 ,of61000s0f 00041 661-60 0665, 0600 60 hfof4y09 H705 0490 600 05109 4-610060 10 056 0564 609000 81005018 16600 0561 f6 WGS 6423601600005 115605 10 1110009 60010 001: 1601 606 of106 43090698 6610911 01906010 101 06006060 Q90-6000 00 6 069107 056 o'Z06 of 6 'Z of?-0 0616006060 So00o05of6s lvofi-600610166 10960561 6 165601666 609 0040000 60049161 o 6696 601016605 0500949 of CGQQ VOC-60006f 610 S049 H0460 IO 01666106 'bf 0,6009 0o016sf19 600 61f6f6fof05605,o60600f90 167 0561060660 of0o05o6- 0000 600005601 f0 056 0490 s00oof 00661660 05f0 1156 06+1 0116 10 061160 1,6616 O47 if 0o1 0560 f60o9066 05612 66,6 0500 10606 066 05611 66 046 06 fo6033 056 6+1600f 117066 00 041000605 000 1 66 4966 '?,Z,056066'16000o -95073 040000 6:5004 0 8000 9060061 056161: W P6000 O0 6096060 1 11 6060 0fof6060 60600 0 , 606006206 4469 fbeqak '?:7'776O 96 0 4, 63006s'Z,oo0,oe0:bq 1004, 'dt 66400 eafyboivoq GS 6000 006061-60 MOQ 600056 IO 66 601 00,66- 6070.9 H7066 6501156 W3 ati A f GPO'94s6a,Qe6a000O'7Cf Z Geo' 0OxQZZ11f5.9fo'a105e robe: We Mase frwvohf' 'k5Ioe46'Z.6c6sspf0o'Z-booof 07 WesfO'ofOe 4vC'6ef6 6 Mug? Q ,QS 7 si 4104709 000 1 SGC lOl7 CW sssb 'TS' 20,01 ob! 606 sf? 560 4, 'bww QT vas W ,Qolfe W 6 1 1f0lf-SW? fofbeorcdasses fZ5'77 f 600441 we eofeapos 047059 6 l'4943:yo' e at fo Y 6001 JC? Practice made perfect for musical groups Yes, the performances were exciting. A stage band perform' ance for the student body was fun to be a part ot because the student audience was so suppor- tive. Singing in the spring con- cert was fun, too, and something that choir members were proud of being a part of. But behind each performance lay nothing but hours of hard work. Each song had its begin- ning in a classroom, whether it was the band hall or the choir -...-..-,.,..s ..-....- PRACTICE trombone. concert too 92 1 music department THIRD HOUR EVERY day meant learning new material and going over it again and again. room. i Every day students worked hard for at least an hour at school. Many then took their music home for more hours of tedious repetition. lt usually had its rewards, though. When asked what he had gotten from being in the band senior Mike Chapman explained, l've gained experi- ence in working with people, staying positive, spraining ankles, wearing holes in my THE spring' k choir members to the auditorium. shoes, and pulling up socks. The best times l've had in high schoolwere spent on the march- ing field, in the band hall, or rid- ing the bus with the Crowley Eagle Band and the best director in Texas. Choir members experienced similar positive feelings. lt was good to work hard for some- thing, to really discipline oneself to achieve the best performance possible. o S , a .fn .fi rs E 2 W fm- ' rs y- yu. E .Qs 'HE I , .L E, Y N , -or -nv , we .. iw Q Hr Q ' LEFT, EXCELLENCE ON the saxophone came after hours of practice for senior Kerry Wilson, auow, cnom MEMBERS practice ,X forthe spring concert, .., 4 Q f.: . , W K R .gmusixg deganment L93 UDEVOTED TO YOU was the song which the chorus opened their part ol the Spring Concert Spring Concert drew nigh time audience Being in chorus gives me a chance to express my feelings through music. It is also a class where l can be free from classroom work, explained Becky Johnson. Chorus members spent a lot ot hours in practice, preparing for contests and programs. A first was the production of a spring concert held at night in the auditorium. Chorus members were freed from the restraints of the ris- ers. lnstead, they formed special groupings around the stage. Some songs were choreographed. The middle school chorus ioined them in the program. Chorus members participated in UIL contests, and several placed high. One was Marilyn Poynter who explained music's fascination for her. Music is an art. lt involves cre- ativity, self-expression and great concentration. The main thing about singing is the self-discipline and satisfaction of doing some- thing that you and other people enjoy. 33.0 iiifei' ' i 94 chorus DURING A BREAK from Spring Concert rehearsal drummer Mike Raines beats out the rhythm of one of the songs. lfr 3,3 J f wav i , Q 'Six ' If 'V 5 h 53 i '1 gs V gg f Q I L , , .,xw l ik xy chorus I 95 Band earned revenge at Carlsbad Festival 'Ira Revenge was sweet for band members. After losing out in the marching season to some local rivals, Crowley musicians were eager to settle the score. They had that opportunity when the band traveled to the Carlsbad Music Festival in Carls- bad, New Nlexico. The long bus trip was made worth it when the results of the competition were learned. The band finished in DRUMMEFI RANDALL MITCHELL looks at his music. first division in concert and was named the outstanding AAA band in the festival. There were nine other AAA bands entered. The stage band received a ll rat' ing in that festival. The band did not fare as well in UIL competition. The sym- phonic band traveled to Azle and earned a Il rating there. The con- cert band did not compete. THIS TUBA PLAYER prepares for competition. 96 I band sQys, 11 an Nw f' , m 5'-l,,, 1 XX 1 kvx .. Q' ,rw .N li .xx --wr Q-9' 'Qinu .Auv- MARC JONES EASES the tedium of the long bus trap to Carlsbad, New Mexuco. f ' ' Q q x , Q x , Q , Q ,Q I band I 97 v . UIL competi tion yielded II rating STAGE BAND PIANIST Tirol Ba DY r f bead 'WQIE U , K Q 4 KELLY HARRIS IMPATIENTLY awaits his meal. Ma. ANDZMRS. Richard Kincaid smile in gratitude for the gifts from the band students. , X Q. X x .Q 1, -...Q X 0 -0- Follow The limes LISA MALACHI PRACTICES being a sun for the production Aesop's FallibIes. l02 102 1 drama department -noni, Three major productions came from one small room The accomplishments of the Drama Department did not hint at its size. It was, in fact, a depart- ment of one, Mrs. Nancy Poynter. That seemed to be enough, how- ever, for students continued to bring to life scores of delightful characters to entertain the student body and do Crowley High School well in UIL competition. 0klahoma! , the all-school musical, was the first major under- taking. It was performed in the new CHRIS RINEY WORKS carefully on props. auditorium. Work immediately began on one act, and by February it had come together nicely. Before going on to UIL competition Robin Goodfel- low was presented to the student body. The last proiect done in late spring was the charming Aesop's Fallibles which contained hilarious scenes using ingenious props and costumes. I ' 5 . I :Ser 1' 'gn i , . 7 , n K iir, ' 1 W 'fl ies --i- it fr i f' . Mfr X1 'V ,,.. KIM KOTERBA TAKES a rest during a rehearsal. LEFT, CHRIS RINEY and classmate raise a cluster of Trabres to be used in Aesop's Fa Il es. K .ak 5 V t ,lZ, Mk,,.L.,2,,, if -affx, B A E .5 ,. - 4, .if -lf 3, ' ,gk f ff Hut? X many , .. .,, ABOVE, CHUCK STEPHENS speaks up for wolves ln Aesop's Fallibles. drama department 1 103 IQNQW The Innes Five seconds less might have meant victory Actors competing against themselves, was the way Chuck Stephens described the experi- ence of One Act. The One Act troup took its production of Robin Goodfel- low all the way to regional com- petition before losing out in that competition against themselves. ' There, for various technical rea- sons, the performance ran five seconds over the allotted forty minute time limit eliminating the troup from further competition. Nevertheless, the actors and crew delighted the high scbool audience with its performance of this Shakespearean comedy. A stately fairy king and winsome fairy queen played by Mike Chap- , ' man and Marilyn Poynter led a Q - band of sprites dresses in soft gg ,fa green and yellow gauzes. Gary ff A A O 4 y Smith confgunded Griff Rambo ir' , ,J if A 2 and Chuck tephens with a vari- j R f ety of tricks and pranks so skill- ' f -f iiii . fully rendered that the high V l S - school audience soon fell into ' x as - li, the playful mood of the produc- I i i 52 ,1 S tion, not sgeming to mindEthe T jg A unfami iar hakespearean ng- K ebisl , y ' ,,,,, 'ish' -1 -515 HW: TOP, CAST AND CREW members are, GRIFF RAMBO AND chuck MARILYN POYNTER FEELS a surprising SEATED, Gary Smith, Lori Smith, Marti Stephens are separated by love's infatuation. Bianchi, Kim Koterba. SECOND ROW, wall. GSW Smith- Marilyn Poynter, Griff Rambo, Chuck Stephens, Kevin Fouts, Connie Bowie, Mrs. Nancy Pognter. BACK ROW, John Murphy, Mike hapman, Joseph Riney, Skipper Morris, Ricky Walter, Tina Parks, Tina Hall, Mike Deason. 104 I one art if ,, I V, 7 x Q -5 3. 'V al 5 -9 Q ! E 'S 7 4 I I RAAA f :' I twig, f ., ,g M. V e ! ' A 557 I TOP, GARY SMITH tickles Griff Rambo with a feather attached to his sword. ABOVE, WAKING UP, Chuck Stephens discovers he is an ass. EFT, GARY SMITH and Mike Chapman girdled the earth in forty blinks with the flower by magic power. one act I 105 1 QHQW THQ Hr lQrs Favorite fables found 1 in A e5op's Fa11ib1es Instead of the combined cho- rus and drama production of the past, drama students produced a colorful, hilarious Aesop's Falli- bIes, parodies of well-known fables. The central character making sense of it all was the jack-in- the-box played by Paul Saint. Griff Rambo and Gary Smith re-enacted the race between the tortoise and the hare, only this time it was better. Gary was an obnoxious, bragging hare in jog- ging attire, and Griff, wearing a green back pack, was the slow- est, dumbest turtle anyone had ever seen. Two other charmers were a wolf played by Chuck Stephens and an eagle played by Michella Karsk. Chuck complained of dis- crimination against wolves, and Michella zoomed through the skies with a variety of passen- gers. TH ESPIAN MEMBERS ARE, FRONT ROW: Teri Hatfield, Tina Hall, Kim Koterba, Brenda Bateman, Sonia Hall. BACK ROW: Paul Saint, Mike Deason, Bruce DePriest, Philip Franks, Larry Smith, Chuck Stephens, Mrs. Nancy Poynter. 106 f drama production rw W,- -. gl. ..., ww 'ff- K V, , vw, . gd We 1 1. f' 'sf Qu' - -.1 ul L an i x I s .1 Q E 'E H Q megggwkfaix' . . . E, Sv it s 1 W ,M -an af gf 1 W QV... ,, 4 r F . LEFT, GARY SMITH and Griff Rambo are on their mark and ready to win. I , We Q' S, f Vmiz V t f '+P - 1 P :P i Y tw, I .' X I 3 .xx JI . Q f irst, , 3 gl E at 2 ' li! f a' .X . . X ', K TOP, MICHELLA IQARSK, the eagle, TOP, NEW BABIES are exclaimed over by pauses between flights. NRL: Koterba, Ranel Pierce, and Jane 13. ABOVE, PAUL SAINT, the jack-in-the box, explains the title of the production. ABOVE, CHUCK STEPHENS says he's fed up with maltreatment of wolves. drama production I 107 uv -W 1 a 1 . ef Y 0 Q00 6 Oo O4 CQQO .uw X a X 4 A T x .: - I n . '- 'I fb S 9 Jw-. 1 1 ii' H r W wf .Jn M J' , 5' J, ':I: '.,-f' E 5 K 2 ' 'Q '4 . 3' fu , WA y fa . .N 1 , Q' . xref. I W- gf'- ' 'v'n ,O'..L- ' v Q, ' ': ':. '4 ..o,'q.., '.,, nw 'ls ,q,ef,fku,,'Ls w n ru . v ' W, ' . x .Q W' ,,. ,.,4. ui Y'Ro. 1 . 4, 1. W fx..-.dw ,nic nv s, 0, ' '. ,, , , ,,,-. fm. ,fry . u'n ., .'-,.. 4.4-41 Q, , , -1 'Q Y , K ,.,. lv X '2 'iff f if?r GF' l f 5fg4f'f'rzfVsea 5222if-1?E5?f2SzgfswM122555752 - - ,,.. -VV ,ir , ' 21' 'MT - -' 1533 -fggipffiffi' Qifif ffff' -zrffE7,rE,5af:f ,55 j Q L f,,rs'? ffPEr,ffN,Zxn-'i'f4T.,Y?fi wjfifffnifi-gs',vgjfrgjiiigj-VQVWTJTQ,W 1 :ef K K Q,,:.,4Eifi A K 1 rd..s'?f.L M112 ,E 'f1..,.Ezizg 7 ,,jus1,,l,3 skjrjggku kg2frQ'f-,ggfiz .1 ,M ,,f-2511, 145,j5g,5,,I5'1ff.igg,,,,gf5Qfv.1,fgf5,g,7gk,k,:f.,5irggfyiji I - f Z , - ,- M , 2 42 fy I I -f 'V .:s'rr - ' ' we, H M r,.,,-5545,-ffV,,xx, .r,A5,ygygf, ,gpg Mg ,, 'Miyg ,Li .,-'gf-ms, , Nw ,:'-Jiili i-: 13---HSS ',,5'?, IEW- f Iwi. far 'iw iwll 'Lex ':,grs:r r ,370 jjj- r--5.-15':L!f': ,.., K, , .sg -Jig, ggi A 5 TE, lf xg W Ralf' 1 .5 ,sf yfvlvy, E, fig.. Zak. 4 pri, Wild, f :mf A W --Wfvwg , L.,, ,. , ,,LL, LL,,. L. B kg- is K K fs, -2521: .,, P 'if . V ,,. , fm, .,2?i,fW :fl -4 Q wr, 'J L, , -ya., ffjkg lik ' A y rm, J, fer, 4 ,, . .sw A . ey ,J X2 A.., F9 X -aw- fi rf- ..., ,, .. ein- . , .,,A i,4fg:g,s,1r71ii six ,w1,,,+rls 5 fs, X - vf--'f-' ,ag is --VA -sw W 7 f rggr.. sys- mv 1111, Ari, .,, 121,55 2 5 'Sig rp A ' ,Y '49, my fs me-W 721 ',ggM:frLQ:siL,1-:EK , 3522? Q52 i. gf- - T5-W if-, ,, , ,, I -,,1Ls..I.w, N K he ,elif ff K , gl- als- jgf, ir S P 4, 1 .5-fl 2 .if f I .,f:i-- , La, , ,ig Eligf ef, ' .-ills , iff: K K K K EY! . 2 1 , X , ' . Y X iff , W? ' K ..,. S ,Q N N., - A Vi S K H 1,54 , fa, , -ss W ,ii We .. ' f .M K if? ..,,.., 'Zi-1-'rx' -. T , 2 f ff 3 A we -wi. 1 Ji XS' 2 . f -N: six or -E77 I-friirrff-piwfff 5 KA LEF , PAU LA WILSON and Lusa Worrell, freshmen, present . . , 5,3 -,11 W fr, , V9DI'Ca5 Of 3 Vemnan UTY- 2- 'jldfigf , ,.QagvfQw'Q?QfQTTftz5 5,2 fist ABOVE LEFT, JUNIOR Tammy 'N' ' viii, ,11i'i,,fKrf5's-fe Cox, funds reading duffucult an her r Z English class following lunch. , ABOVE, GLOBE THEATER K iw A - jx K sa ,S ' reproductions dotted the Englush I A wg classrooms. j , r we 5 , K5 5. L x , -,.,.. ,,, , ,A fi .ies W 4 5 2 , , r, , 1 452' ,. x 3 iii N K , gg, 5 3, K K is 7 2 S :,, 22 Q , X X 5 1-H5151 5 2 F 3 Q X , if 9 21 fr sf, ., 4 W s H 2 r 2 ,.,. us., rr H ','e211,-'Sr,:. fir 2 K o f K K .sg , , Eg!-, 5: ,, - , , 5 .. , ' X 2 2:21. W lee? mf, A 'I-5 5 .'-.- xg.. sq e3?f2guws7M:-iiiiszimii., K-:assume-sn:ssa:sfsaswf:ffeeia4ma:z.w:eiwfzsfzwva'41:simianwanewvwfakaaiaiwsw-fwsasfmw A . 0355 9- Mw TOP, STAFF MEMBERS who went to the l.L.P.C. convention in Austin were John Hines, Mike Raulerson, Teri Hatfield, Lisa Renfro, Jana Carroll, Shirley Fisher, Dan Martin, and Doug Myers. .... ,.. 5iil1uI.-g., ...., ln.,- ABOVE RIGHT, JUNIOR Doug Myers ABOVE, USING RUB-off letters, Vicki crops a picture for a track spread. Chavelier completes her speech spread. f 'wg .N A , E , QQ g ,H ? is gb angf ...pa-asv S-.....,. .,- , x 'Q in vi. . 4 -, 115 . -af ,- L: 'fixt- r ix -y YQ 1 n .nf Ui' ..., if 5533 . 1, , . 'IMQEKS ,. Q, .i f rr W sw K Y I S I S21 V sa, NW . qwq 'Mg , X 5 113195 FANG r r ER ECTING ' 'VIANISM , CAD . e err I .il 3 X -L. B BRA BARNETT, A h L member of Fang Finders, hplds a close friend of hers, a - L bull snake. MRS. Duana Clark's'l observe preliminary by a X If ' if XXWXX 'fiflrfflfi f'fXXXX XX'f?fll'1 f' - .I'X?5Zl?T-E. -X '225s?HX?7XQ,.., , ESIXXXYSXXMX -fffiwfi -'--f- fXi2EiXl5r31Z2f.2QXXflsf'l??Tfv1F5ia1 . X X fr -- X? '. ' I QS' A 'W 'gg XX 'KX L? If if , Y L L' Y W-L' 1 I I X Q , s slssX It X ',.. ,, al X m X 2 X Tfjfff' 7121 K ' rr l.l, I .. I X24 I X X X 2 X Xl, ,, f X12 A ' X ff, I F X ,.,gtgggfggfXt.,gf.: ABOVE LEFT, DAVID Lofquist 'f demonstrates sound waves with the X cymbals In physlcal science. ' N ni r' LEFT, FRESHMAN KAREN Hall looks , X SX, X 7, , on for a qulck answer an physlcal Science- .fg BELOW LEFT, IN a sophomore I buology assembly Mr. Tommy Pyeatt, X X I X medtcal technologlst at I-larrus I f Hospltal, speaks to students about B scuence careers. I BELOW, JULIE SULAK and Charussa 2 XXX, Anderson work cautuously to dussect a I frog In Buology I, , 3 I f I2 -lf? 51 55? Xt st, XXXXX XX, XXXEEQ , X X X -XX-XX-X X 3 ..,Xt.w,vtXX ,.--,. X,,tXXXXXnXsX..W X .t ,N tfX,fX.,,.:,,XXw S XX. HXXX W X WN? X af? X K X YX KX - . XXITJE I K ' XS 3 1, X'X2,.,, F7s:bf?jgQi5ffWg 2 es Y. , sz ..,,X,x,,.,,,. ISSSQEELIXX X .X - XXX ,. L.. XXX- JMX--X. AXXXXS .f,faXKf9'g,,XXXXXXX- SMX ,wwf -WX--X Xwlftw --'A 'Q X ,X .mm- X -I X, X ,. ,.K,,, . Jmifisi - . XXXXWIQX' X- XX-.XXXXXgXx.:, -X X .X,XXX -., X X,XXsX X X . , 'sifrsaz X-fXXg53QZXgisQ1sa X2fZXaXX5gfs ss ,.XXgftX'XXv,,f' . XSXXXSQXK ', X -XXXXXXXX 'XefPffX?f5?5si .1'5??2?tE5?X.1ff Q , -5 J '- -111 X- Xf7a?teX,'sgv KSXXXXX is XX X -G XXXX 'A :X1fXX91Ivr'W rieriluiliiz -HX.fXX,,,XXX,,.. XX , ,.XXXsjgts1X1f ffsrswg--X -XX-:XXX?iXXXX,Xs, .Xu f--, -XfXX,1XX,.,,. !laXfEq ,g, ,E 'ZT?F'flf- 3 4 as X X X X X 4 I2 ,XXX2 . ,trfwr if7i5L5X. ff? f g 1 . XXXXXX- XX XX jf ?jfifl'l' , Wziiii. .1:Xsggzg5X,gX 3 X A mgffffri: 5 3 1 X24 X-X ,L . ,-L, U1 1, ,fm :XX-XXg ilf'lX X - X , ilu. 1 ' X,ii:E -A ' 'SX I -lf' ., :X'X,. ,X.z,'?hf'X X X I, X- ,VX X.:, , - gb,-IX' 's,.1r., ., X -XXV, , ,Ugg .X, lzs, .,., , james.. ,,li1J,,l: . .1gj,j5X r.,,wX-,IL , XX X XX,,XX,.tfX XXQXXXX-XXX 'f:swX1s2XsXX,ftfaffwzeisttX-:ff-f,XXXY? Htfw, XX:,f,XXXe'X.:Xf XX,,XXXx:XaX XX.'XXX5IXXLi4Xiil'9i21H,4'XXl5WX.'xsiimg XXXXX-X:-:XXX-XXXXXX XXXFXXQX WX X,,tX. X-XXXM -X.,-tX,.XX,X ,- X.XXiXX,,X ,,,XX,X,X ,XXMXXXX ,,XX,t,,.X X. .XXiSgX,X.- yX,,,,..X-X,,,X,5,,L,X ,XX ,-XXX,-X.-,XX,M,XX,, ,Q-51' HX,4X1:s1 X 'rs'ezgzX,X, 'X '2,,tgifX.i'X.gfs,fXXfXpg,gg1'r,.-r,gX5X,y,XXg,,X-1,MXXXXfXX5g,'XXv v.rXg,,,tg'ggk,g 5gX.XXXXX,1 -XfXg3XQXfXy1'X2f1X.us455QiiXX:XX:LX?XsXX'2ggX.:2z,QMogg . SX: X-XXkf22ifX:1XX XiXXere:eX:a,XXsfr Sr wffvggifzfst X,zsXXXfXXsXefgXXsfg.e:fXff2. Ui X 2 'K . N Q 4 WL, Liz au' Yu: Z -Q wg, , .- L--,Nl k,,M,.,,,vwzfazA 1wzfuffmmwmfM,fwg2Wgw,,,Em--,fm,g,, ffwwf ,.,f,A.ww1.. Wm H f, ,WNW , ,W .V 5, ., ,, 1 w EN- V - ..,..., - W 1,1515 ww- 1- ,,.., -M-.,.,M1. --vu-z,w1,, W -:swm1,-.1 --H 1-11.M W YM ,W WWW - --,,,.,.p. 't .,.,,.,f.- W'ff M' S4Tf'3l?a : fbi- ,DQJFN 1 it - 'T?'M A A -, , fimifw f 35'Z?i5'r,x'79 M A9577 W :fTEvI'af mTQ '1 'wJf?1g1 H a - ',-, A,-- ..11 2 1 A 'h L KV., mhhy .K m'-k' l s 'L,' ff?2f'l1ffff1Qff ,liirr,1 ,,' mixigge Ptylw111,1f1,,lg-Shggfswugy ,'-, H iss-,'f1e1' l fl'?ff11f' 1122 43. ty:-'L ipwsstff. :rr pi?ifl1w111'i' xt 1 .,'f fv2.11'?11'frf1f. 'X '-,' 1.1ffU'si'1tf. llrs 7 .- l l .1 -,-,' '.-,-, r 'L L' ','-w' L ,, ' .4 P LL l J W-11e t 1,3tll11t1..1 V1 111..m1 911111 3 ffsziyifilfrf -,- Nitrates '-L' ' 'L,' t . .1 -1 ,, -, i , - ..11.r Shop students were tucked away In a corner of 1 ' c the school, and few were aware of just what went on f , . 1 ' Irl that VOOFU. I The truth us, a lot went on. Four areas of work orer tatt ottae occupsed shop students. ln woodworking they made planters and gun racks. ln metals, garden tools and . rsrt 1 tool boxes were produced. Candy trays came from f.--,, L ,-,,, fl ' ' ' the plastlcs segment of the course, and un drafting f h h I me students drew treeband sketches o t e sc oo building and the floor plans for a ca bi n. r ' rl You can let yourself go, express your feelangs, g jf r'-., K1 b ' h' f ytlt srttr e proud of yourself for makung somet ang out o 7 , - - nothungf' sand one art student. ttsst Q rlsltt - ' ' l Mme than WW pfolecfs We'e1Q'Ve to Students to choose from. They were as varled as the students . 1 ' ylts f themselves. Some projects were pen and lnk draw- s nng, charcoal rubblngs, prlntmaknng, paper mache, abstract deslgn derived from tools, archltectu ral r'k ' ' deS'9 .and enamehng' . . t 1- -fri? K .sr, 1 ssr. A unuq ue atmosphere fllled thus classroom. As l llss l ' l one student sand, Art lsn't somethlng you learn, lt's something you experlencef' a . ..'rr. 1 ' EF if t Q1 ..t. 1 . 1 51,1 5 K 11155 gs. . ..-,..:-, Q 1 1111-5 1ff.m:s,:. 1 +1511--, ,g15f,f2ffezgs1tftgs,gs'511gi'st:1g,3, . ge:1lsigahg:fJ51g-fjS1asWkef1af fwaf11': 1.11.1321 Ziff' f 1?il5H'11Y1 -51k1ggg43s1,t,'gl L11 .. 1 .gl 1k-Amswf 11w1, k+fgql1awr.1.1,, qi? ,H ..,, wgility- 21sfiEf!5111fv:1 f11w1- . 1 ff tffiwffiweli zsmttfif K . .,fL55'V I ' 'i9i?3zA f 92':si1 I ' .qgzgE.f1gl131 gg,:typ111--,f11 sz,fistL3s1z- : P21 Lefty?'fx-1:1105 51113 .-, f. S15g1fyg215zf5i'svs1?rf ' ,335 s ,,.-, , ..... ,... - 1 I w 2. u elsrtmia 1 1 wsez '?fwQQ1:s11 M as ' f11:,svw.Qf111. ffffiifii i1?'sMi5ir1'z-,'. 1 galil' Lili '1:QL !1KfllYf21l?'.'1: 'l' 9ff15S,f' 4 me: 11s1'wc5s?5f1.11 ,Q A,A.,. ..fftrgi,tr11t1 -1 'f1fts5fflf:1t f1 11 1 11.1-tart ng' we 1155112111- r15g,55f1V55,71?tg 151575. ,5,31,l,Lf zfisgffli fixflffifdsfs't3'.2t54iz':i:E11 112551 'tw 1. tm-1 1 ..11.1'-,w11 lgi?Jf111ftz1-11411lff+.m.1qg11Q1'-1fs1,g,m :- tQiagfffg5.we5i5fs?g5feisrgimsag-' U 91511 s1?il1fiQ+5l!Q 1554f,'l?'? 5.7 ttf-.5227 izgjfgj'g'Qgl1,f5ji?E,2??1'5V Kmfr, Y' 35:11- 931?,syg1f::1tQHM1:1s1'L 1 at ,y ...... 'exit 1.-wr ? 2 Q l f l 1 X41 3. E Q Piiweisf W W3 l gl 1 t 1 A f 7 1 1. .1 1 I. 1 2 g5fg2eeSsJy?gqg,5f12vszevf,Qt?ams1A5r3lmiI aw .1.5'fsSsi,3Qtz's'-7gfswp155,iMs11.1rwsgf H11-11111g35rg,gsv111 1111ggiKrga4w1Ag1f11's1?fge1tls5f-f.,f fsgrtmrfyt- ff- fa11ezfg1g11f ' : l'2 A:n1' g51fi15vj,4 55 1'fif5xi,t5ZfliL11fgaT '?1'5175e11,ftiQ1lf T - 5'1jiQg',fi9?1S,1'5'5'5'1Q5Xr-1?5f4f,'1W'1Ifl15T?J?5L5g4Qf5'if5f''3lfy!l??,fitl5'5,'1 Ji Qxififf'-' cE?j15?fli51 ' 1 1 ?Tf2555?i1'f2 ' 5fEf5f5?l4S11filZ'.1i :3a5rfQti'i-,, Zi' 7 3fg1,5,,1W1 fel, u p W.M,-A1i1,1f1.,ttt,g.1,.,1.1al5,m.,,., ,1.,,,t1-A, .vt,1.,11,W H.-,.1f,tl1t,,, f1s1,11f,,l1 1tt1..,t.w1.1t1,,.f.,,ra.1-M-,.f-,1.1wwf11.,.1-.Jw f..- 1 1 rf.-1t,,fl1111.f .11fw1-,1f111tt1-1t-l1111tt 1. man new .-' I Ae - lk,1.,wwf1 V.g1f1,,fs,,g1f.r11t.v..11.f1s,f1..11lsx5f,.. 1,1.11:rt1fg..m-.ff.-mtr.11,1,111,ffffty1t1t1..1 ,Ls1,15:' wt.1.1,gs1.1mAmfgff,.M5t VM1t.-,s-1t11lg1l1e2.11-.1--11t51ffStf1f1- 1 .1o.p'-, ,,,ftl.1. 111, t,1.yw.-.1,.11fy 1. ...W . 'S Pt wes t 2 ' My M A W ,,.,. W ..,., , ' sm ,M XM -om sg W . -W . .-'zwzzlz-f eg.. 21. me 1:24-1-1-'aa' 1 - an--If K- 1 - t'r- ?wta1-fm w 1 1s1gffaaf eit'f1111,1 tatf.-QSW 1 1M1ss1l. .srs1fy,t1 tlrgsafys-'51 51.113.1..t4x5g-tt-mesa., 93111 f--f ..31s1s5t 1y.Wf.,-at .1 1-111,13--f sews1l,5y,R,a,,11.,,1,,c.I s rrm'i13-9ee-x-l-ff-:!f- 'fltrv . -. Shaw 11.414-1 1 Witt: fs. vw1,ws1lew nf - 1tfJt , u.s11l-ifrf-f -Q5 13mm-n ' 1s,111Mx. rw-A ww t-Lfzfcsf1151,r sr 11'felyf-sm 14.11 LWS1 withs,11wtr1m1 .t1txzl1w1-ff wg.: l -11.1-wt fe111tQ1 f9'1-1111!-ffs11-...wr-1.2ff11w -at-rf Luaaeftalflr . , -I. . . - -! M111 Y me I M 1151-W1 1 if tr 11--,sa lmf11ft11r1, .l1. X - . tw. .1 wfstr.-A 1A 11 Q1 sffwfl .NA .f ff 4, 11.s,Q.1ef1fr1 FQ .. . :V V, -3 --LAW -:H H-we , NH-aff:-Eraswaurw-W'-E'--1 -- , ,f--fl-'g,,:, ' il' u . N r E Small department yielded large returns Though the department was relatively small, hav- ing only two instructors, Mrs. Mary Harris and Mrs. Barbara Hall, it was a popular and useful one. Freshmen wrestled with typewriters, forcing their stiff fingers to adhere to the demands of the drills, reaching for that yor stretching for the z. Some stu- dents chose to stay with typing for another year, perfecting their basic skills and going on to more complicated jobs. Business law was a popular course with students because problems pertaining to their lives could be pursued there. The class took a field trip to court, one of several sprinkled throughout the year. Accounting students were those who were most serious about entering the business world upon graduation. r... fNf2HSQN?? S375-Sf1 ?iH2FEMS?if ki 5 NQ9AL:YKii?SWM7fQBHFR'fZ5:2KiGN' TOP BELINDA BAKER carefully spaces a line in typing class ABOVE ACCOUNTING STUDENT Kathy Tritten quietly works 'c'7 LEFT DEBRA JUMPER displays the shorthand speed which took her to regional UlL competition Business ,,,,,1 5, MWA ' ,.,l f,,'Lf-:: .41 l- BELOW, TYPING I teaches basic skills to freshmen like Jeff Lee. bs. K .. . D Us -L ABOVE, MIKE RAULERSON works to finish a term paper. LEFT, KAREN VRBA works through an accounting problem. business f 127 f RM, at Home and family living staged two weddings gl They covered everything from muffins to mother- hood, from redecorating to re-plumbing, from trailer houses to teacups. They were an indomitable group of people - those who taught and those who 1 learned in that loose assortment of classes referred to as vocational. Home and family living and home economics 1 were two popular classes in that broad category. One big project for home and family living stu- dents was to plan and execute a wedding and recep- Y l i S tion complete with bridal gown, corsage, music, and ,X if punch Two couples were joined in educational mat i TOP BRIDE AND groom Shirley -ig Fisher and Charles Secchio pause -E in the reception after their home 'QI and family living wedding. ' ABOVE, BRYAN MILLER jokes . with the bridesmaids in the 3 reception line. .f RIGHT, GAY LYNN BOONE scans a magazine looking forthe right ' picture. rlmony. Q l '21 fI A, Ill 'W .l T Yin! Y ' M' mi - Bl -..ihif ff. T kgs., 'l m ,.... .N ff,,,,j,.1 .gait f. fm -tfff- . 128 I vocations Voooliondl Clclsses LEFT A THOUGHTFUL Tammy Auberry rests during the reception following the home and famlly luvlng wedding BELOW DRESSED AS a fisherman on All Hallow s Eve Mrs Duane Muller undertakes some mending on the floor ABOVE MRS GAlL BUMPUS demonstrates makung muffms for her class , - , ff: ,. - I . ' 1 ' , . ' , v ' Vw Q- E Q Q 1 X , gt ,X ., , N J. 1 .gi ,el 1 - V I vocations X 129 MRS. SUE MARTlN'S aide Clay Shirley was drafted to help work on the trailer. Vandals destroyed renova ted trailer Another mammoth undertaking which was cruelly sabatoged halfway through was the refurbishing of a house trailer. A local mobile home dealer loaned the home and family living classes a damaged trailer and 1500 dollars to repair and redecorate. Students worked long, hard hours, often in freezing weather, to repair what turned out to be extensive damage, replacing the flooring in one spot and redoing the plumbing. Just when it was time to do the fun stuff - paint and upholster and wallpaper, the trailer was vandalized and the inside totally destroyed. A few thoughtless vandals ended a pro- ject which many were proudly lnvolved in. ABOVE, THE RECEIVING line enjoys comments from guests during the wedding reception. RIGHT, DUNCAN HINES and Kyle 130 X vocations Million make a cake. , f' ' 'Xe-X X i 'f N gg i 'MZ W es- M-Vocoiionol Ciosses BELOW, BADLY IN need of repair, the home and family house trailer arrives at its new home. 1 ff . W? ,, -f f ,Q ' f t ff : f V 1 A U F 1 . , w I 5 I , i V B wmv., in n. Hr- i i 1 i . i i i i i LEFT, BELINDA RINEY serves f punch during the wedding , reception. ABOVE, MRS. LEEANN Pyeatt, ' Mrs. Diane Muller, and Mrs. , Barbara Gregory are incredulous ij q 5 at the sight of the house trailer. tx-.. , , 3 gr? '::... .... Z' ..,.,,,r . .,.,...,... ' ..M....W... WW' 'Www 'Q zzlil' ' -v ...W 'iw '-'- ffwv E 1 :1 -' - '- -- if ,' 1 -'1. at i. .'::-,,-..f- : .. t : . V. , .INV I vocations X 131 E Q 5 BELOW, BEFORE REUPHOLSTERING, the chair was N a wreck. 'E if I I TE ye s i K T Q L gi ii 5, i E T T J 5 5 5 ...H ' ET 'III' E 1 'n' TT' WW 5 'W' m l - i f- 1 V Y TOP, AFTER REUPHOLSTERING, by Tommy Teague, Walter Jones, and Ed Petty, the chair has a new look somewhat hidden by Mr. Larry Westmoreland. ABOVE, STUDENTS HOLD certificates earned in class. 132 f pre-vocational Pre Voc X Woo Students active in Crea tive projects Fifteen students were involved in the pre-voca- tional class. There they worked to acquire salable vocational skills while increasing proficiency in math, reading, and day-to-day living skills. Students worked on communication skills, basic math and consumer math skills, social and job skills, and craft or leisure time skills. ln the latter capacity pre-voc students completed some lovely projects - a tole- painted trunk and a reupholstered chair among them. Vocational adjustment class helped students become self-sustaining workers. They also devel- oped their own social programs holding a Christmas dinner and a spring social. They helped test all pre-school students prior to their entering school in the fall. Vocational adjust- ment students worked as elementary, athletic, and custodial aides. They were a working and achieving part of the school. Q55 NOX Z' 1901 VIKJIU S, - ' ' W NXNT'-ff' ' 3 TOP, CHARLES POWELL punches in at his job. ABOVE, LIZ WOOLEY, Ed Petty, and Walter Jones work diligently in their vocational adjustment class. LEFT, TOMMY TEAGUE works on a rug in the pre-vocational class while Mrs, Cecelia Rollins looks on. WWMSWWNHMQWEW-wQ'Wk'WRHSMHfwwwWFPEGRSK s'2wnM wkv'TPWWm,., , ..... - wmmmwmwmw-W-W---V M-N Adj l l s l l l l t l ll l All 8 , l l l s l vocational adjustment X 133 BELOW, FHAVHERO members are, FRONT ROW: Sarah New, Dana Caciola, Renee Davis, Tammy Biggers, Chrys Orr, Kathy Wells. BACK ROW: Chris Snapp, Denelle Green, Dennis Baughman, Doyle Lindsey, Larry Smith, Todd Mitchell, Mrs. Sue Martin. 134! FHA ABOVE, STATE SECRETARY Melissa Strickland works in a home economics lab. .... .. ... .... F BELOW, FHAASPONSORED Twin DayduHngSpHngFeverWeek broughtoutsuangecoupmshke RoniHonmHandAnneheBaneL In the classroom FHA members engaged in pro- jects which took them into the community. They vis- T ited a nursing home in the Wedgewood section of f Fort Worth where they sang and took flowers to X 1 those confined there. At Thanksgiving they held a . T . food drive the products of which went into homes in R T , C the community. FHA also contributed to school life. The club sponsored T-shirt Day during Spring Fever Week. During FHA Week they sponsored a clean-up drive , 1 giving prizes to students who picked up trash in the -A4 'jr M A school. ' ' A fr, . On the state and area levels they attended meet- l ings: Melissa Strickland ran for and was elected SX state FHA secretary. I ,,,w-ig., . :f Q fa . O O -I 3- :ai Q K V Q - 4, 2' 7 f Q - 't . tcir ' ' . 2 E I 7' st' A . A H S., . I an Q A .. 'R , A 4- ef Ffh 5 igiigliil 'E? . ,t A . V U1 -N my 7 1 L tg... . A A . L L . h . :. -'t l ABOVE, FHA MEMBERS are, LEFT, TRACI Auggfrqgy FRONT ROW: Karen Bailey, Vickie and She-11,9 Tackett aye Vrba, Chris Waldrop, Beth twins on Twin Day- Trenner, Missy Harvey, Kerri OemenLDebmeHuH.SECOND ROVV:KeHiStncHand,Karen it f' TnUen,SheHyRowmnd,Lsa ' Tamboni, Diane Alvarez, Melissa if Strickland, Paula Wilson, Sherry LeJeune. THIRD ROW: Mrs. Gail .Qi BumpusCmdyMonB,Kmen H Cain, Debbie Mikeska, Sharon Curtis, Jeannie Huff, Rochelle Sweet, Angie Graves, Kim Huckabee, Trncia Terry, Marci Smith. BACK ROW: Mrs. Amanda Goodson, Mrs. Ronna White, 33 YdandaConmy,SusanBecK Karen Vrba, Jim Crowley, Toni I , Warren, Betty Spaeth, Lisa Clark, Melody McDonald, Synthia Cook. FHA 135 F TA made a dnfference FTA was a small club but actlve at Important tlmes Dunng Open House members were on hand to greet parents and other vlsltors to the school with a ready smlle and dlrectlons around the bulldmg Valentine s Day they sold telegrams typed them up and delivered them to the lucky reclpnents nn class many tlmes In the form of a song ln the sprung they sponsored the selection of the Teacher of the Year by the student body Mrs Janet Henderson English teacher was surprised with a plaque and a corsage during the Awards Day assembly They were Involved ln other projects and actlvl tles Members met In the home of Pamela Harwell for a Thanksglvlng dinner As a Christmas project they donated a glft to the state home for gurls Dur mg Sprung Fever Week they sponsored Super Hero at the Tarrant County Conventuon Center Year ABOVE PAMELA HARWELL buslly types up Valentine telegrams Day. ln February they attended the state convention 136 X FTA TOP FTA PRESIDENT Kathy ABOVE TYPING UP telegrams Earl puns a corsage on Mrs Tammy Sladnovlk and Becky Janet Henderson who was lust Latshaw stall have tame for announced Teacher of the glggles wTTZTli9Z'.ffL7LiL,L ' wz',..XIS.'.Z',Tl2-A JKGZERExQ54s-f9.+iZ mf'v'?7Z'TSZIQQSZEQSZBEQZH.ViZ-f2R7Gw'imE'5'12?SSi8iEfY'61?TiE1nM.ZBZm'iF5F'SI4llLI.'E?mziiagiuwl? I , W4f5'A'QyEHb5.WHffK?L'RM' H .TSE EmQX3B,HIdli XSQW6i Yi i Awards Day assembly. X lik Mit 'i. LEFT, FTA MEMBERS are, FRONT A ROW: Shelly Womack, Tammy Sladnovik, Kathy Earl Cpresidentj, Pamela Harwell fsecretaryj. BACK ROW: Becky Latshaw, Nancy wifi Doyle, Karen Bailey, Brigetta 5 Simon, Valerie Newman, Becky Mabra Ctreasurerj. LEFT, MRS. JANET HENDERSON hurries onstage to accept her award as Teacher of the Year during the E 5 i ci S ff is li l 2 i 1 s 5 l i i i ii ,Q ig. 52 52 ii is is ii 2 fs ai ll 2 2 it 1 2 E if , I S X 5 gi si Q E ii 251 iii il! Sl 53 Q 2 5 S E -3 E ii 5 E 2 52 E S FTAXT37 ,E I 0 't-,ammi'afnh f'l':'1N L' iI Q.,,.,.'k'W55s'??tu4S'?rE2veeroSf.Id'n'fl ' JZ?e7f??I I 2 1 'I I ES 3? l E I E 1 TWEQPQE, , HJHWMZMW was 1331392 if it I I , I I I 5 2 it I It II 3? it 22 RIGHT, IN VOE Linda Peterson finishes one of many packets to be done throughout the year. ABOVE, KIM LEE types up part of the National Honor Society program, RIGHT, TAMFIA ARMISTEAD and Brenda NIcMiIIan work together in c ass. 'X , AQ' I-l'l I,, 138!OEA ,QW .M Q1QGi53T'i13-'5?.TF'm1iL,fF,1 JIlL?5AW7NlIM4wSkEti? f:9Q?JQ,f?5LlJ, m ,t.,.kfI' . Wm'-3 ff-Mn' ' M-T' 'I H r- Q --V - ,QQ 'A , E MIDDLE, BRENDA BAKER files and listens to one of Donna Van Noy's business letters. ABOVE, JACKIE ROARK looks at an advertising magazine in VOE. CEA Eigh t mem bers earn ed area finalist a wards OEA was an organization which affected its mem- bers' lives on several different levels. Under a special program which involved class work as well as on-the-job training many members found themselves on the way to a career upon grad- uation from high school. ln addition to classroom or lab work members were treated to such guest speakers as the manager of Cullum and Boren and spokesmen from IBM and Bell Telephone. Outside activities included a Thanksgiving drive, the purchase of a clock radio for a mentally handi- capped girl for Christmas, and an officer workshop with four Arlington high schools. ln contests eight students received area finalist awards: Kim Talley, Tamara Shutter, Sharna Love, Tamra Armistead, Randy Parker, Kathy Simon, Kathy Tritten, and Paula Swindell. They competed in such areas as job interviews, extemporaneous ver- bal communication, shorthand and accounting. TOP, OEA MEMBERS are, FRONT ROW: Shanna Love Csecretaryj, Paula Swindell fhistorianj, Jackie Roark Cparliamentariani, Tamra Armistead tlab presidentj, Anita Garcia Cco-op presidentj, Kim Lee Ctreasureri. SECOND ROW: Mrs. Peggy Duvall, Sheila Turner, Car- lene Ruckhardt, Diane Herrera, Stacy Howard, Linda Peterson, Brenda McMillan, Donna VanNoy, Cheryl Rentzell. BACK ROW: Rhonda Wright, Tina Goodwin, Brenda Baker, Debi Watkins, Kim Talley, Shelly Womack, Kathy Simon, Kay Blalock. OEA! 139 if re a w wwmw- Cook, Ba yse ranked in area com petition The twenty-four members of VICA-ICT were active competitors. Three students who went to the L. D. Bell High School contest in Irving, Texas, were Ricky Cook, Steve Bayse, and Tony Bargsley. Ricky, Steve, and Tony took the first three slots respectively in that contest. Ricky and Steve went to Houston for further competition. Tony explained the club's appeal. lt's helped me decide what kind of career I want to go into after high school. Two members of the appliance repair class went to contest at Hurst and Houston. David Mills placed second and Victor Mann first. A new class, appliance repair was housed in a room full of equipment and appliances awaiting a new life at the hands of the students TOP APPLIANCE REPAIR members are FRONT ROW Jeff Woerner RickyAlderly Mark Mullen BACK ROW Danny Ditmore Victor Mann William Braudaway Mr Herman Bresciani ABOVE APPLIANCE REPAIR members are FRONT ROW Rory Smithee Mike Greenhill Allen Woodworth Terry Heald BACK ROW Mike Castro Randy Ulrich George Barker, Victor Guaiardo Mike Bray Mr. Herman Bresciani. . . - ABOVE, AWARD-WINNING Ricky Cook shows the skill and technique at meat cutting at Haley's Meat Market. W? X... ,. M il KW.. 140 X VICA W appliance repair il ta. WCA LEFT, BEFORE WORKING on a washing machine in appliance repair Rory Smithee prepares the torch to be used on the project. Y 236 TOP, VICA-lCT MEMBERS are, FRONT ROW: William Braudaway James Walker, Don Lang, David Mills. SECOND ROW: Mark Kamp Ctreasurerj, Gerald Burns, Ricky Cook fvice presidentj, Joe Torrez, Philip Olson, Robin Smith fparliamentarianj, Barry Waldrip, BACK ROW: Darrell lrwin, Bill Brittain, Victor Mann, Bobby Hastings, Tony Bargsley, Tyler Gore, Mark Webb, Mike Dunn, John Bailey, Steve Bayse, Mr, Charles Johnson. ABOVE, HARD AT work, Randy Ulrich tries to fix a broken part. 'lien , , RlGHT TROY BEAIRD Tim Knowles and Jim Crowley paint the eagles that were given to the senior athletes at the Athletic Awards banquet ABOVE TAMMY DAVIS secures the rabbit s nose before putting ,P him in the DECA show window for Easter. big Q' if N EN N-...J M TS. ABOVE, DECA MEMBERS are, FRONT ROW: Tammie Davis Ctreasurerj, Esther Garcia Qhistorianj, Shelly Green, Donna Walters, Lynette Weaver. SECOND ROW: Beverly Saylors, Deanne Parks, Annette Baster, Kelei Sefcik, Alicia Contreras, Tammy Borden fsecretaryj. BACK ROW: Troy Beaird, Kelly Grimes, Jim Crowley Tony Nix fpresidentl, Tim Knowles, Nathan Beach Cvice presidentj, Delmar Montgomery, Ricky Mixon, Mrs. Diane Muller. ' I W M 5 W' ..,.' ff - fflla .if ...ir . A! A ' I 'V NT ' J 1 ',.1. li Ralfi Q . f f , R i A .2 'QJ I 1 2, 47 3 I ' 5' N. Y 142 f DECA , . .... .. f - - A l4 w m Mlj-H W-new-WRN5 -4-1.1 ABOVE, KIRK PARKS, named best DECA student at the Awards DECA Six mem bers attended sta te meet Marketing and distribution were the realms of DECA. This was outwardly evident in the colorful displays arranged by the students in their show win- dow. Perhaps tbeir largest display was a giant Easter Bunny which heralded the arrival of spring. Six students attended the area contest in Waco, Texas. They were Tony Nix, Tammy Davis, Esther Garcia, Alicia Contreras, Kirk Parks, and Kelly Grimes. Kirk placed in petroleum marketing and Kelly in advertising and display. They went on to compete on the state level in Fort Worth. Mrs. Diane Muller, instructor, explained that the fields of business and financial services, fashion merchandising, property and home related goods and services, services for personal needs, food mar- keting and service, and transportation services were the business of DECA. 1. .. Q ' Assembly, helps Alicia Contreras move part of the Easter display. ABOVE, DECA STUDENTS scan newspapers for merchandising ideas. DECA X 143 DePriest, Van Noy placed in Con test Fourteen areas of contest occupied CVAE-VOCT students. Those contests involved job interviews, applications, display, and photo panel. Bruce DePriest and Edward Van Noy placed in the photo panel competition. CVAE-VOCCT students worked toward state con- test. They held several off-campus socials. Mr. Har- vey Caviness, instructor, stated, The leadership and creativity of the club members largely deter- mine the success or failure of the members as well as the club itself. TOP, BRUCE DEPRIEST kneels by a display he arranged. ABOVE RIGHT, U-HAUL Inc. received a boost in Edward Van Noy's prize-winning photo panel. RIGHT, CVAE-VOCT members are, FRONT ROW1 Sherri Waldrip, Karen Steenburgen, Tammy Murphy. BACK ROW: Mrs. Karen Banker, Bobby Bentley, Richard Holcomb, Scott Randolph, Fred Ramos, Bruce DePriest, Wayne Bishop, Chuck Holden, Edward Van Noy. 144 X CVAE-VOCT .J it , X VJ, V ..,... .,,.. in ' , ...,- 5 M iq v 2 ,I rr W .,,. hw A L... l l ' 1 ..N..,. M 4- sf..- in Q h sk-J Kr T 4 19 I l from the ditto. ABOVE, CVAE-VOCT MEMBERS are, FRONT ROW: Rodney Coble freporterj, Vincent Davis fparliamentarianj, Jeff Poheske Cvice presidentb, Sandra Duckett Cpresidentj, Elizabeth Miller Qsecretaryj. BACK ROW: Mr. Harvey Caviness, Mark Heisey, Jerry Hicklen ftreasurerj, Mike Yarger fsergeant at armsj, Walter Jones, Linda Cappers, Chris Lacy LEFT, JEFF POHOESKE and classmate make the necessary settings on the ditto machine. LEFT, MR. HARVEY Cavlness and Johnny Biggers examine a copy SONJA MOORE STEPS forward to accept a medal. wif 146 f academic awards X Seven fy-one took medals One of the most pleasurable events for bothistudents and teachers was the Academic Awards assembly. Teachers had the opportunity to recognize people who had worked hard in class. ,Students who had achieved realy success by going the extra mile ine rthelclassroom instead of on the athletic field were given their day ihitheisunivi Combined with the National Honor Society the event was one ofzsoiemnity and decorum with everyone decked out in his Sumiaylbestv, Av TOQAWARDS ASSEMBLY a ,., ,VICA STUDENT RICKY Cook accepts his award. 148 1 academic awards I f NHS members played host Since it was Dress Upi Dey everyone iooked his best, iust in i case his name wasiiisccailileci, National Honor Society dentg Jusrin'Landesg the medals ,as ,each neimegaywais called. Stugents the stage and took fhe as their friends ' audience. It was recognition would' enizouifage. others to try foriia the coming WN! 6 X149 people O f 1 5 C50 061 PS6 046,45 hf 606 10 of s060of,o10s061000 010610 0 000606 151 05051061 1000060 QO0010 66106 06 fb 111606 1111100 o '5P00b0ffS' 1000600 02536601 601' 5900001 hfeysj 010650 016456 65061f1ofss X 00 00141116 6040 16 440000 35 6566 61017561600 05660 05,9 061 151 661 00060506011 00110000 SOVA 606445060051 Q,s-1501060600601 6W 10 , 60160 1191 9649 f67 Cy 06101 'C44960 6 MSO 60 06 65 0+0f66k0 fo0Q,01 0566, 10 6 '60 of 67650050 00 06 soo 0 of 0006 4 5 3504190105 00 006 60 ,061 fo 06 610.00049 650 606005 96 .s'0600f lv if G SSCOf70'f' 0-S 605011 00' 010 5560 6406 05001006665 0190110 05010 00' 00 01101 4 606663 '6 Q16 056531 006001020 000050 of 55611 Q 251600 06' 1' 650 001000 sh 650 11565 60 006160 0 0054160 606'6k6 05660 0002501 C46 0065100 '75GOgf9 16 010110 6501 0400756 661S'fOO'75c7xS'lI1G4 1060 4-6010900091 ' 00606004 051116 10 601 1606 45101 152 0901006501 -966505 ' 11,0143 9100100 10 25 06056 00200 G90 6 S0 6' G G 4 Oemiifiiiiiiiifllflii as 40'5g004vfx'0'fi 1110 0049156 15100100650 , 6011 0 0 0.9 6 '79 I 6 f 4 1 0072320695 S 6500 06000 46 00 '90 67' fvN96sfS'4z,flff7 Gfes 49617961059 Q92 sqm, f 001015 10 4 f f o+6f203Ziiif0 'k fS0996?S6f f 0 e'Zofaf05e'5f,4h21,,-E,'giff57?2Z,8 '9-S'0O4f 790476NOZ006GGZ,aOgf fbeoewooosfobevofbeefsafeoeo 1-QQ I bog OG 0 KSV00 sooi' at 64' S017 Gif' 7'4f9f47 GP Q 66'43'!77 CM 5 05-iso f4w9f'9gb7e6fda4e-s azigeisiifvvvoevevf-M i 152 X administration DR. SIDNEY POYNTER, superintendent, was first employed by the district in 1959 as a teacher and a coach. At that time Crowley ISD was a nine grade school system with one building. The district began construction on a high school in 1965, and since that time three addi- tions have been made to the school. A middle school, two elementaries, and an administration building have been con- structed. The original ele- mentary school was remod- eled and enlarged. A bus storage area and two tracts of land were purchased to expand both the high school and Sycamore Ele- mentary campuses. ln 1959 enrollment in nine grades totaled 215 stu- dents. Enrollment for 12 grades is currently 2901. Dr. Poynter managed not only to stay abreast of developments but to lead his school district to earn a reputation as one of the finest in the area. MR. WILLARD MURREY has served the district as a teacher, a principal, and as assistant superintendent, his present position. The expansion of the athletic, music, and vocational edu- cation programs, as well as the general curriculum, were the areas in which he noticed change and improvement. What Mr. Murrey did each day had a profound effect on the day- to-day efficiency of the school. POYNY SCHOOL BOARD MEMBERS are, FRONT ROW: Mr. Eldon Bean fvice presidentj, Mr. Gene Frittz fpresidentj, Dr. Sidney Poynter fsuperintendentj, Mr. Dallas Park Csecretaryj. BACK ROW: Mr. Kenneth Hopkins, Mrs. Sue Crouch, and Dr. Jim Hargrave. Closeupg Gene Frittz School Board President Possibly the most easily reached member of the school board was its president, Mr. Gene Frittz. One student agreed, He comes up to the schooi a lot. You see him walking around the halls during break and lunch. He gets acquainted with the kids. y g t . O As a person, a single member of the board, my goal is to know the students and faculty in the personal situations that they have, explained Mr. Frittz. C C C . . C C Mr. ,Frittz served on the schoolboard torynine years, and as president for two. He made himself available to students, but liked to know that they wouldscome to him to talk. f'Somerof the beststug dents will come ,to me and ask questions. .That shows that some care enough to do, something abouttheir problemsfi' he stated. Caring was what worriedsMr:iFrittzi. The hardest part of his .job was 'fexpelling a student when the parents won't come before the board because. of a lack ot concern. y Fortunately, the majority of parents he came in contact with did not generate such a negative pic- ture. ln general, parents give their response and support for most school activities, ,accord- ing to Mr. Frittz. There were lasting rewards for being a mernberof the school board. The most joyful part of it was to seerkidssleave andsachieve their goals, and know that it is possible through this school to do that. y y y y administration 1 153 154 X office staff fff f Close up: Betty Horn Counselor M .5 BELOW, MRS. DELORES Cole, office secretary, presents an ever- present smile. ii Aeovs, Mns. NANCY Massengale, worked as attendance clerk. Visible through the glass front of her office working individually with students' problems, Mrs. Betty Horn is a common sight to those pass- ing bythe office. Never a dull moment was her description of s her job as a high school counselor. - l . That is quitea statement considering the length of time she has held the position - 21 yearsgi When Mrs. Horn started as Counselor the r high school did not evenlexist. Studentsrtrom first i grades to the eighth attended Bess Race, Stu- dents frorn the ninth grade up wereisent into Fon i Worth to Paschal High Schooi. Since that time lit- r tlehas changed involving counseling, 'fexcepting in numbers of students, but students them- slveshavej W ' if W W W W e s 'l'heyeseemito be more open than ever before, Mrs. Horn said. g p r . f What would she change if presented the oppor- tif? 'W ' tunity? Change? ishei mused. Only toioffer more opportunities for education. l'm happy tg- .xx A fs here. NN Dm Dania PPQmQ1p0N fix-ll E. MMAMQ LQQCM VQQQ Fekmclpsb l 156 X community education Q .K f .151 Lkk. I , Belly dancing, horse training drew largest Crowds Community Education director, lVlr. Ray Brough- ton, paused tor a moment to comment on the range ot the community education program. Community education is a concept which involves the whole community, that is, preschool to senior citizens. I would hope that more students would be interested in getting involved in Commu- nity Education activities and voice their wants for classes and activities. One way in which students may voice their opin' ions was through the student advisers, juniors Glen Tuggle and Darla Blakeley, pictured to the lett. a I PLAN A DISTRICT supervisor, Mrs. Mary Stewart, is in charge of the twenty- six district staff members, six of whom work at the high school. Sixty high school students are enrolled in Plan A receiving extra help in English and math classes, Fifteen students are in the Pre-Voc pro- gram where they are prepared to work in the VAC program. In VAC the students work the entire day receiving school credit. The Plan A program aides stu- dents from early childhood, to the VAC all-day work program. Ms. Noella Coker Plan A Secretary -'Q M,,.,.ff ,f ,Z ,ew l X Mrs. Ann Porter Plan A Aide Miss Barbara Lilly Speech Pathologist Ms. Sheen King Counselor I xl plana f 157 llord workers? You betl Ask any student what his favorite period of the day is and the answer most often received is Lunch! But ask the student about the food in the 5183 ' cafeteria and the reaction will usually be as if God- zilla has asked him for a date. The long-standing joke about the quality of cafete- ria food did little justice to the hardworking women who prepared it. The good is clean and wholesome, commented Mrs. Vivia Ditmore, manager of the cafeteria, for what we have to work with and the amount we have to prepare. The biggest obstacle, according to the general opinion of the women, seemed to be the small size of the kitchen and the outdated equip- ment. Despite the ribbing they got, the women enjoyed working with the students they served each day. It's a joy to watch students grow up from year to year. They are a real joy! said Mrs. Ditmore. Sometimes working so hard to please student and faculty tastebuds was not so joyous. Mrs. Jane Graves felt the least rewarding part of her job was when we work hard on a special meat dish and the students choose a hamburger. Another fear was running out of food before the end of the line was T I . served. . . . I Closeup: janet Graves n f cafeteria Worker If Mrs. Janet Graves' first year to work in the s school cafeteria was one that she would remem- T ber. She recalled an incident in which she served , Griff Rambo a strip of plastic bag on his bar-b- que, and other times when she forgot to put pat- ties onthe hamburger buns. The most rewarding . part of her job, was when the students andjfaculty 4 ' T enjoyed a meal that they had worked hard to pre- vi. Q f 4 'A L . fe. . Q . . .V -' ' pa 158 X support personnel OPPOSITE PAGE LEFT, George Clark peels apples for lunch room meals. OPPOSITE PAGE, BELOW left, Pat Taylor serves students lunch. s.. 3 HEAD JANITOR, MR. Harry Baker, takes a breather in the library after a long morning's work. MRS. PAT CARR, school nurse, wetghs a student. CAFETERIA WORKERS, ARF FRONT ROW, Pat Taylor, Lavava New, Ruth Llghtner. BACK ROW: Vivia Ditmore, Isabell Flint, Janet Grgves, Barbra Whelen. Not Pictured is Georga Clark. support personnel X 159 160 1 faculty 55. ni. -X I.. Miss Karen Banker: CVAE instructor, VOCT Club sponsor, cheerleader sponsor, freshmen class sponsor Mrs. Gail Bumpas: Homemaking l instructor, F.H.A. sponsor, junior class sponsor Mrs. Hortensia Baudin: biology, physical science instructor, sophomore class sponsor Mr. Robert Burger: economics, government, American history instructor, senior class sponsor Miss Amanda Brandenberg: home furnishings, Home Economics l, li instructor, F.l-l.A. sponsor, senior class sponsor , A Mr. Dennis Burk: physical science, health instructor, athletics, senior class sponsor Mrs. Becky Bray: geometry, Algebra l instructor, sophomore class sponsor Mr. Harvey cavmessi CVAE-ODP i, n , s c i , instructor Mr. Herman Bresciani: appliance i repair lab instructor, V.l.C.A. club sponsor l r r Mrs. Diana Clark: Biology l, ll, M chemistry instructor, junior class sponsor, FTA sponsor 'ht . ' JWIN, K ' , if--s ri 1. r- 'x 'Sa-5,,rr . , - . .I . If Qx ii: ' 'W .H 9 U UN 1 Z' saw me Mr. Mike Cook: American history instructor, athletics, freshmen class sponsor Mrs. Peggy Dietz: Algebra ll, lntroduction Algebra l, trigonometry instructor, cheerleader sponsor, freshmen class sponsor Mr. Vernon Cornish: Shop l, ll, woods instructor, iunlor class sponsor fl .fo , Mrs. Peggy Duvall: V.O.E. Coop, V.O.E. lab instructor, OEA club sponsor, senior ciass sponsor Mrs. Karen Crow: physical education l i instructor, athletics, sophomore class, sponsor . Mr. velden Fothergiii: vocational , V, y , Director Miss Barbara Crowley: government, - y economics, world history instructor 'Falonette sponsor. senior class s e sponsor , y c Mrs. Alice Frasier: resource. 4, L freshmen class sponsor Mr. Louis Cunningham: world history, American historyisinstructorg athleticsj 4 sophomore class sponsor y 1 s Mrs, vscka Glass: librarian 3p ps .3 ' faculty! 161 I62 X faculty Mrs. BarbarelGregory: world history, y economics, governmentinstructor, National Honor Society sponsor, s junior glass sponsor y q Mr. James Ivy: physical education instructor, athletics, senior class sponsor ws. Sammi maui Typing i, is I I l instructor, freshmen class sponsor I .yy. Mr. Charlie Johnson: l.C.T. I, ll , , instructor,,VlCA club sponsor, , I sophomore class- sponsor Mrs. Nlery Herris:eccou'nting,' ' shorthand, business law instructor, I Felonette sponsor, senior class I sponsor Mr. Layton Keith: marching, concert, symphonic, stage bands instructor Mrs. Janet Henderson: English l, ll instructor, Student Council sponsor, junior class sponsor jmf, Richard Kinceid: marching, y concert, symphonic, stage bands I I I instructor Mrs. Judy Ingram: English I, it instructor, Talonette sponsor, junior ctass sponsor I , si Mr. Larry Lanier: English I instructor, athletics, freshmen class sponsor . .mr 'S' , A ' 'N Wi X li Mrs. Joan Leonard: creative writing, U.D. English, English ll instructor, senior class sponsor Mrs. Nancy Poynter: U.D. English, drama instructor, Thespians sponsor, senior class sponsor Mrs. Sylvia Lucas: Biology I instructor, junior class sponsor Mrs. LeeAnn Pyeatt: Speech l, ll, Ill, U.D. English instructor, Student Council sponsor, senior class sponsor Mrs. Sue Martin: home management, HECE l, ll instructor, HERO-FHA sponsor, senior class sponsor Mrs. Cecilia Rollins: pre-vocational instructor, sophomore class sponsor Mr. Jim Mitchell: Art I, ll, lll, FOM ll instructor, junior class sponsor Mr. Ray Sefcik: health instructor, athletics, athletic director Mrs. Diana Muller: DECA instructor, senior class sponsor Mrs. Debbie Shackelford: Algebra l, geometry instructor, cheerleader sponsor, freshmen class sponsor M war :fs 164 X faculty 4. 1 .. ,r 1 'It -Nmx Cheryl Smith: Plan A instructor Mr. Harold Test: physical science. physics instructor, freshmen class , sponsor Mrs. Aileen Solomon: Algebra l, ll instructor, sophomore class sponsor M Miss Ann Tyler: Spanish I, ll, lll, UD. S English instructor, iunior class sponsor Mrs. Judy Soriano: English ll, U,D. English, journalisminstructor, iunior class sponsor Miss Susan Watson: physical education instructor, athletics, sophomore class sponsor Mr. Robert Steele: special assignments class instructor Mr. Larry Westmoreland: VAC l, ll, senior class sponsor Mr. Danny Striblingz health 7 ' e instructor, athletics, sophomore class ,sponsor y Mrs. Flonna Whlte:yHome Economics I, iunlor class sponsor 1' , Z3 s 'N if t 4 1. I A X , -ks it Mrs Jo Ann Wsitrams physucai science instructor, F.T.A. sponsor RIGHT CAUGHT BY the camera is Mrs. Jo Ann Williams dressed as a pumpkin on AN Haiiows Eve. ABOVE Mr. Robert Buroer keeps in touch with his students uurinr? f unc . faculty f 165 W X y K r l ,X 1 --r,,m?ff, irfgfw, A l2fh1,, ., H MEM.,,mfinygfp w,5pn?ffxlx,..,,-,gms P gf f, 'f fm' K, . 'f 17 uzsfrw fveegmgfif nz :,:f22fs?faz1fAw .f regwwsfg r ,gqrwsggig -xafifga 5? 0 5 'N ,llf ' ' , lffzf' i71Ef7 .7'1'.iQf5Q , 5735552 7-fig: 925 rl . . .. ww, ,, r Z. il 1,. , ,mf ,ir ,. , H V 5, ,Q Z I : , Q51 ,QrS?i..,r2 . S1 2?7Qr'3,-'N 233' I w,f ,wifisk 'f.5fif! h'f'f 'f fo ff' 1 ?f5'7'i55l 5 - 7-5'7f6A W? flixlfx f , fffm - kgs me all ff! fmw rm zz, mfrswlfwre ww -ffm M2955 sw YDS? Q ra , :fiom .if 5 WE, . 515: f, f Sfgfhilff f iffaziv lzf,Q5fg, A ' M ,nfl 'f'Pff'l3g Ziff! ' 4 E7 t f, ,gg-fx rezgrzu .Wwe , WF, 4.-We .ff . Bl 5' A jx if A 5 .23 'E 3 N 'D 'Sr 'F Q 'lf N l 7 I 1 A 1 iw Z l ' Ki we b if Nh A.. s 1 .Q-gn. .. it 37 I X QLi 3 X is l ., X Q fff A 166 f freshmen John Brooks Pat Brownfield Darla Broyles Joe Bueno Frankie Bush Karen Cain Stacey Caldwell Gary Campbell Linda Cappers Fledonda Capshaw E: iffh ', 'Sis I X F 1 ff' f' v e or lool . f fooo Q3 l l Y il X o.,,. X mi if w e L' 3 EQ L Qiflrfi , - we no I, . K 14-swan -.-isgzyg.-iw, -,.,,,5P,f,,,,-f,ggw,,-.few- .L.i,A..,53g5- .-,M-1'.- -'f:,gg5fgf, I ,,s3ff,- ' - f.-, -' -f.' wig- :,-- -'11 A ,gy , hfk- U, . i. Conley Cummins Davenport Davenport Davis ,E so A Rx b il D ail E ., if 7 3 E i Andy Donaldson Shelley Donohue John Douglas Sandra Ducket1 James Dyess Anita Elkins Tracy Ellis Sharon Ellsworth Don Farnik Pat Fotenot freshmen X 167 Dan Fowler Frank Fox Tim Frazier John Gaines Garrett Gathings George Good s N Q. 9' X N X . ,fi , , .sail 5-.UB , VKJQ' i 'vi- l68 X freshmen Denise Hill Debbie Hinchliffe Charles Hix Amy Holcomb Kelli Holmes JoLynn Holt Mark Hopkins Kim Huckabee Kim Hudson l K Wm. .J K4 fi A 53PJn... feelin. ' mf x A L- srl- KE Gif i S sf-. ' x F 4 K iis Q F f v Jeanie Huff .X T 1 .35 A 'fr f x f Q X J.. X . s. it X L 'W' Q , 5. .ig 1 i 'E LV' gi , N n N i YP' 1 , L Q. we ' sag. Q. an E - iiyigisfiimberiind Kincaid ,5iPaige King fjvlary Knight iw, ,L Kratochvil L DURING THE E ' YEARBOOK saies assempiy, ' L as y ry Lane 'degides to res LLAT. db . , L ' iiu siir H 0 . 1 lil .. ...- - ki ,i 'Axe 'L X ,N Alan Laserna Judy Laserna Jeff Lee Jonathan Lee Sherry Leieune Katrina Lenamon Willie Lindsey David Lofquist Diane Lyons Mistie Mabra LQ. . . . - 1 ,rims slsggfy.. . an ,. freshmen f 169 'Egg V , f -it li, Da Pam vid . R: it . Q I K, .JZ M 03 170 X freshmen 'mlwmf LaDonna Parker Mike Peacock Tommy Pedigo Tim Perez Renee Perkins Douglas Pervere Ed Petty Ray Pierce Brett Pohoreske Keith Pounds Morris Morris A N than Neal ' Q san Nix Diane Olson Zane Orr Jeff OMSTWUU ii'nm14? rift 1 bv nf' t 5 b 54 3 af' is -fv if . A X X 5' .-.,, x X '- ' ff. i,i'liVx'n X , 5' . Q-Lfxg. atuil 1 'A tg - jxx , nt N x yr Q 545 35 is C Q H X i iii wt i 'Y sm .- sl. ,. ,yn -V . -fr - rw, f, - . U,v,S,, . ,- - on-,ri-wf,,3 z ,yi ,,iw.y3,:l.V,k3 jE,.kV,Wi51i.l Q . , il, T 6 Kelli Poynoi' Marilyn Poynter Alberto Prado Norma Presley or f f ,T Q 1 vu . A Q T . yi Q J- 5-x -:Q . i 'if 4 f Gregory Stephens Q, Q - 'i 'cf' T lsl Sharon Stephens Mike Stoker James Stone Donna Stofts Kelly Strickland Sherry Taggart Kenny Taylor Tommy Teague Tricia Terry freshmen 1 171 1 - ' 4 1 wi V' 'f a ' , .. . , ,,... .. .. A, YQPQVSVKWQQS 2533? 'HSMFV' w f S 4 - ,ahgw 75, k,m,1,f yn. - rg, , LN, - Lf, ,, J , Hwang!-5 5iv'bnff?1frw.5'?,fPvuf:H'f-M1-asz2z'ffmcm11N -mi! ft: - L- f, 7 -- I g?i 3fqg4a, ,ff 5 , I ,si , W, gf. 'az gfzisfwgiv -WeSawwA-,wfi?WNuw,i.-wzwf mff,ff13W9?if'iwWvt V Th mas m aa .1 Thdmas Thqmas TWSY .fiillilkfr X l. -,Nw X iw Q N I A if XV H LW W' Y aff! me wt ,.- in H , . -45' - 1' 4. 172 ! freshmen f. x X N Wallace Waller M Jimmy Wayland 3' a ir' I f xi 3' 4 1 17 i - LarrY West 5 -: - ,+ 5 ' W as 'Cb , av t 'Z Q 'X 4 A. tt rl, yt S4 if 6 'xg 1 3 r Q f 3 elel' Ralph Wheeler Cindy Whitbeck Gary Wilson Paula Wilson Kevin Wingo Dale Woodby Christi Woodworth Lisa Worrell Scott Wright Lynette Wyatt Don Yarger Mike Yarger Lisa Zamboni Alex Zubia freshmen I 173 . - ,. ag 12,1 :sf 174 f sophomores Barbara Adams Rick Adderley Debbie Allen Debbie Allinder Diane Alvarez Derek Alderman Charissa Anderson Tommy Angton L Sherry Bradford i - Wanda Brannon I William Braudaway Ar1'r' Michelle Bray Kathy Bowser gi' y y 5 ,ty N X X Leesa Burden Randy Broyles Jeff Bullock D QQ Clifton Burch ' rrsi' y Sherrie Bueno ,ki j B I 'x A x C-3 .sw an .46 H i rr- ' Tx - TQ are 5, Z' Q EY .. on W A f .wff1w1mQ . -,fgzgzvfgf ,N if' -,ifiwf?xS5+P5l,if.vme, 1525 . iffy-rf fr'-'f :,, f1'75 ' 1-'dswffyf Sf f?fQ11e5Q5,55'?l'5f I fwmiliffiilsgqfs .. A, ,ww fm' gr -, L,,f. W -,,, 3 lei: f , ff-,:W, . f.-, 4 Q ,L lp, , gm.: ..i,,.w 1 'if Q- A, ,,-5:52, uk., firlilfff ' .-'fs ssl.-in :ffl uf wif' -iw .zz fl Q -g ifmazlmfe, -v fmwfl-:Q . Q 'W s'.w.:-'fm3ms,im 2,'s5esfg,'1f. 3 gl f .e:w,sllf,:g,' -f Y. wi Saegwilflffilf,kszy.f,:ifliE?g5g5'fs 65 P2153 .fqwsffszb - - 2. . Y - A, Qi 1 it ., 'k l aw Mfr W ,rl , -'ff . A 1 , ,mirage Q ff? WM-,,i. K Q ,, -fm, R, H r f 1 Y 'ww-,lm 3 l gf? Al f gxyiil,-i. ig? e .,A-. sg 9 1 , 1, ki . ,. W .s gg -R 1' 1 f. if 'I 5 ,5 A. -, .i , MyAw,--9,Lg,X5fL5yqxf,,3ev' iw' .V imggg 5--pggiffli ia M - im -N ew wr N ei sr ' : - I i wi -. ll-ylirwgsm w , Q f AHB ,. W 'l M 1 ..,, gi. 53 Q f - ' 2 BENQ M W ,2 2 ' M6 HM . is X1 Fr r -nif- S X r X x. Vx.. X- V iv ' J .- . l 21.5-Q . 'Y-.U 5 xii ,-- ' ' 1, 5f:2q, . . 1 - Lx -- YE::. .. ' I ' ' an Bryce DePriest Charles Dobbins Derek Dowdy Nancy Doyle Robbyn Duplissey Robert Durko Mellissa Dwyer Elkins Carol LeeAnn Ellis Susie Escalante sophomores X 175 ' 355, -max ,sg , -. 1 ' as M- V '+.?f:Q' 'M-wiiig' H Q 'fjiffli ',' fi.??3,z', Q, W is w ray J , Vi. W Mi Q hi 2 V Q, 4. WW N, V -.':,::.:1,k f 12,,,..., , ,.,,,, ,NW DeeDee Falk Sieve gen gi ri Lo bs. , qv. x . V' ls 1 fe i' wg, Kerry Alecna W Y, E P' M ' NJ li -s w., W as Ev SAY GARY and Randy Broyles as they dissect a worm in biology. 176 1 sophomores Wir H M k F ek Q1 N 5' 9 in A ml . 4 1 1 - -' K! -ii W, viii QA x e N W wi 1 xi ei S: ii as eff 3 Randy Hayes Mark Heisey Irene Herrera Linda Hernandez Eric Hendsley John Herweg Chris Hines Mickie Hudson Victor Hughes Leslie Jacobs ee , , .wx - ,gee ,. ..,.i- m ' w y 5 1. -. r 4' f r if x A i .1 'X ' I xi! M F 5 fixes N 'N V N if L 5264, .1 Tigoki 1-v,1gQ:sm,,, L1 1. i, 1,,gs,,g , J, v,Qf5ww11,.f:wz,1,a5,sf .HW 1.,g-.K - , Q , v,,,g,,l,f,i,, a 1 meh 1,sifgsgqwf-,f15zg,i11qy,14.a7,,5 we 2 ny, ,M n'f'11 if B555 112119552651 larfHgffijQlQ'7ii?iQ9l kV,f5f5Ti55 'f?,,5'l2Y571 , Ailflfcf, lfglif ' V w f J iff! 5p1w1 Q5 ' 1 l v1sf,5l1gpip?g1qfl51fif:gfq,i.fmq,5,f1:+,:1'llsz1w:ifl1ww-W,wgfflffxwf1, .azlm-,,1vf111of:s,3lff- Q M oral? 1 1a,x.,d13.f,f. 1 1 1 P f wil ,l.25'SvM1 ll f,f1e7l1ilx-w 124- f5l'w1f??1?ge11 f 'zsisgw 11--.i1wrf7mS,s L5-,s,1w-m,,,1 1.-14a,f1wg.11,1V,.1 W AL,., 1 ..,,L ,,,A . 4 ,NA., z,..W ,,,, , , 1limCi Y 'wi-f-1115! , 'gffflijf : l, 1?'13f1 1- 7, 5' 1. ' f slfigg' fly is Kiwi? 1- K1 f+sv'f,v i fvwfe'-'21, zwzw l 1., 11 i, 15 V14-Q 53,5 421111 Aw1.,1,5s9w?f' ii K I 1 ., an L - f ...Mg v . fffLX:zQ 1 if? . ff Ffa -f - N, R 1 111 so fr.: fi. M H ar Q y 1 YV, ,. , x f ' , Q 1- -1' 1 A , sh 1 Q 'e-Rr A ' , 5 ! 5.1 1 'fi 4 ' ,X T ' 5 A .f ' S 11 p.r'..!i.. A. I Q V K ,,?Q,?,l. , xv , , ' ,, A V :Q 1 S Q .L WZYN gl 1 U , ' 41, , I, 92? 1 '--- :Q NX i 1 5 JA ll. JS.. L Ng x.,. Cindy McClendon Mike McClendon Cheryl McCord Geri Mitchell Paul Minshew 5 '8 x l x I fl 1 'Jig Danny Mims David Mills James McMicken Melody McDonald Candi McCubbin sophomores 1 177 1f??w5?f3f - ' 7 xml , ,1 all , id it ml 1111-1 M 1 aslflsmvfif 1MSf1,,,.1 '1 li.-51.2 f -, 5 'S'iisgiw-1fyiirfilifk in lx . if 121 5 is 7 '53 if gf wg fy, 11 ia, S , y Qi Q 1- if 152 iifgsf wtf-' lf? -we 1, A 5 lg if Q 1 f if ffzf, - 1 ,: 1,1151 :V ' ,vm 1 1 -fs , 'gi li wwf ll M W-V - ,i wf7,lf51lX,,51,.g,.,wal .i1l,,a,,wQv1r,Q,,,3wgi,M..M-vit,kif!,n,f?ffi,fX,,,i7A5,kQ,, M, ,xi Q gk , if L be N X , X ii 4 my we if es, Qi., .V V :Q . gee: , , - 1 , - .- , 178 f sophomores . ,lege 1... 'W 6 'x tw an 1 Q. 1b. ' IL iw, f X Teresa Robinson Kenny Rotenberry Tina Rowland l Zonya Samberson Karen Reilly .., . ff s Renee Reitzer . Wayne Sandridge Bobette Roark Beverly Saylors Troy Secchio R a s . .V ,.,L . .- 4 Q iw tx J if E N' 'Qt' Be 1 A x 33 1 .QV ' l + W N Q X Q ig Elva Trevino Glen Tuggle David Tumey Martha Turner Steve Underwood David VanNoy Karen VanNoy Melanie Veach Sandra Velasquez Valerie Whitley sophomores f 179 M ,. , - '+ fWM-W '--- ' ' -' ,, U , .. 'M' iz.-f., -fflfm ' -N '--' hr'---M-N--a6E..W-v,.,.f.,,,.,mmE '--- W' -2 ima- - '- . , . M ., 2 was -1r '1 2.05-:.,m5i ?52,?3 w ' -,1 'T F .Q H,,,e,. , ,K Q vm , ' 11 . Z 1: i iigfm iifi We eff f.wJf::f:f:w'1ff :I 9? 1,2 1:11 no ff if ,,,,. yd Q ' QQ 155, Ricky , rf: -fin.: if vs.. 180 f sophomores , oo o lr. '-2: ..- -om 6 A ' 4 f if is 1 5 SOPHOMORE CLASS OFFICERS were, FRONT ROW: Glenn Tuggle fvice presidentj, Mark Johnson fpresidentj. BACK ROW: Joy Wilshire Ctreasurerj, Juan Contreras Csecretaryj. sophomores 1 181 A special lady to many people, Mrs. LeeAnn Pyeatt completed her last year at Crowley for a while. She eagerly anticipated the birth of her first child in August and took a leave of absence from her position as speech and English teacher. She did much more than teach. Foremost, she was a friend. Many students and teachers found in her a ready, sympathetic, helpful listener, the pos- sessor of a calm, steady head in any crisis. Counseling is an active interest in my life because I want to learn more about my inner self, and I want to help others find themselves, she explained. She worked hard as senior class sponsor and Stu- dent Council sponsor. Mrs. Pyeatt assisted in drama productions as well as overseeing the myriad of per- formances and contests her speech students were involved in. As English teacher she established seri- ous study as a first priority in her classroom. Being a part of Crowley High School gives me a sense of pride. I have been here since we were very small, and the growth has been unbelievable. How- ever, there is still a chance to be close -- faculty members here usually communicate well with one another, and student-teacher relationships are very strong. I think a personal interest in each person as an individual is the key to happiness here at Crow- ley. It is special to me that students are friendly and speak to me when passing in the hall. My most spe- cial moments here have been in speech class. One student called us a family one day, and I considered that a compliment. The special feeling in speech is extreme honesty, openness, and most of all, empa- thy for one another. lt gives me a chance to see young people grow into mature adults, and I love it. Mrs. Pyeatt was the kind of teacher that would be impossible to replace. Marvis Conley was one of those nice people to be around. Whatever she was involved in, she seemed to always give it her best. Her best efforts were concentrated in two areas, other than the classroom. She was vice president of the junior class and as an officer was responsible for much of the work done in connection with the two big class projects, the magazine sales and the prom. Marvis' other great love was Talonettes. I learned a lot of new things in drill team, but, most of all, I had fun. Marvis was elected co-captain of the drill team at the end of the year. A member of the National Honor Society, Marvis talked about her school. To me the thing that makes being a student at Crowley High School spe- cial are the people and the faculty. They all seem to be together. Of course, we all have our little groups, but we all seem to get along most of the time. The faculty is also special. Most of the teachers are really involved in what they are doing and seem to put forth their best effort. I enjoy my teachers and am very thankful for them. Meet some VIP very interesting people We saw this senior as a hare in Aesop's Falli- bles, as Robin Goodfellow in the one act produc- tion, the Wizard of Oz, one of Snow White's dwarfs, and in a myriad of other roles in speech class pro- ductions. My interest in and out of school is having a blast at least 24 hours a day, was how he put it. Fortunatley, Gary Smith entertained a lot of us while he was at it. He used his large, brown eyes, mop of wheat-colored hair, expressive face, and spritely character to enchant us all. l've been going to Crowley scbools for eight years. l've seen how a small school acts more like a small family and just knowing I'm a part of that fam- ily makes me proud that I ever came here. Now I'm about to graduate, and even though school is big- ger, it's still the same little family, only bigger. That family won't be quite the same after he grad- uates. Some people might have thought Sherri Woer- ner was just plain crazy. The truth was, she was the possessor of boundless energy, a genuine exhuber- ance for all things, and a determination to pull everyone around her into that special joy called life. So she made us laugh - by wearing a balloon wrapped around her head, donning huge plastic ears, ballet dancing in English class, singing her special rendition of Huckleberry Twain, or trying to literally put her foot in her mouth. Sherri was also a skilled athlete. She played bas- ketball and volleyball, but really excelled in track where she ran sprints. Perhaps only an event which required a sudden, explosive outpouring of energy could tap that reservoir of power which constantly seemed to bubble within her. Sherri said this about Crowley High School: Crowley is unique because it's small enough to know everyone, but big enough to meet interesting people. She did her best to meet and get to know as many of us as she could, and we were all the happier for it. B the world runs smoothly, it does so only because someone is in the engine room oiling the wheels, tightening the bolts. Pamela Hanivell, more often than not, was behind whatever was currently under- way at school. Even the most cursory glance at the list of her senior year activities revealed a non-stop person, a doer. She worked all year as a member of both Stu- dent Council and Safety Council helping put together assemblies and activities which meant a break for the student body. She was an officer in Future Teachers of America and in that capacity delivered singing Valentines and greeted parents to Parents' Night at school. In journalism class she vol- unteered forthe section no one ever wants to do - faculty and administration. A member of the cre- ative writing class, she edited the creative writing magazine Slipstreams and helped design its cover. Outside school, church activities dominated her time. She was president of the youth organization, a member of the youth choir, and a member of the state council on youth ministries. Why did she work so hard? School, as with life, is what a person makes of it. Crowley High School gave me much, yet none of it came free. The place and people were special because I worked hard to make them so to me. It would have been easy to sit back, but involvement is the key to making school special. VIP What impressed most people about senior class president, Dan Martin, was his essential toughness. He could handle anything the world dished out and handle it well. In addition to working as a class officer, Dan was one of two in charge of running the journalism dark- room. He was a member of the National Honor Soci- ety, and, outside of school, vice president of the Texas Junior Polled Hereford Association. Essentailly a country boy, Dan planned to major in agricultural economics at Texas AGM. He was a hopeless Aggie fan and was rarely seen without his Aggie baseball cap. Much as he looked forward to new experiences as a legitimate Aggie, Dan also looked back. Anything that is a part of your life, particularly a part that you enjoy, is special to a person. l couldn't have gone to a finer school than Crowley. Not only does Crowley have that friendly, small town atmos- phere, but the students here are just super nice. There is just no way l'll ever be able to show or express thanks for the support that my friends and people have given me. Yes, Crowley will always have a special place in my memories. 97 'V Q 6224 Gkvz wpf185 G G 3.- X 'cv 1 . ' ' .F ff' 4? 19 1? Zh 5, 4 if fa A ML K it xx X li .., 1 F A 2? x, X 186 1 juniors Craig Buchman Paul Caciola Sylvia Cantu Lisa Clark Rodney Coble Linda Coffey Marvis Conley Andrea Conzoneri Tammy Cox Jenny Daily 1151 Q. N x l f X A ea s. , Q 4:5 ze 1 Q15 rx li or f 7 Y -f - , T' if Q- 5' k, , G I 91 ill ff '3 all 444V ml lx , X- G 4. , Q '30 i X. G. nge Larry Garcia Rodney Garrison Judy Good Tyler Gore Jarrett Green Kenny Green Cindi Grinnel Kim Guidry Mare Guirey Mike Hallmark juniors I 187 13 ,rg hi 1 i42f K 'l A. A If' lL 4, V, if 1, 5215 ,. i ,.,,Lx. ,, sw: .:,,'i3,w 5 333' israml gr . gig mifigv' Um, ,. ,,, Hf5ff g,3,Qf ak 15 vgg:,,.:, f 5'fE,l: fm- ,Q Izviw jig eff? gg -f:f,-1'- we gm Wi ski . 112 ' if ia ,my ww -I iw: raw ww 0 x , ' 188 I juniors Maurene Kersey Andy Keserling Mark Kimberling Billy Knight Kim Koterbra Brian Kunzie Jimmy Lawson Mark Ledyard Kirk Lee Ronny LeJuene Hlx Holt 19 v , K 5 f . SYEXX rqfv mx K' W ' e K 3' H711 1 E , fi '5- .,,4 . NS X 'E ,S Xl ,qv with 9 xxx .'- l X X Xi K - N A r k iiii - ? . I Zi 5 , ,K K . . H M K ,,, . , ,. f 3 K, , , ,A . , 1, H. ,, vff- o,m,,,M.372 .. . . g, me ff-Q fr -my fizfi- ' .,x,,, L ,QU gimp, -V., iexiwwqzsg, .,L,,L3rvJ5 ,lg . I fe, z,, if- -:ll 'of 'tiff' iif3'?w1sz. ',1iwfri2i2?Qlf2ffl?ff1 ,f 1, K, Ay . ..X,,: , . v,,- , . . . ,,.,,,,,,,c,l.,,, i , S X, S v w f, ' , f, , V11 :,. ' 1 V, ff -r-ug 3 'wg' :.wgg4a,g Y gi ,jg ,lj QM rig Wilco if glgflf ,QQw2flfSQ5Ii'??k,:i? H .gifs iliifi, ff, ,'f5TiVn ,A , 5 15535Til.5-'WW9?4iiiii , .gr 'Ji' he I in-.fi . .HN 'H ,I , 'G' . , x X lf' ,. ep .4 Mx .. N,- G , JN 'L J Sarah New J Tony Ni A SHERRI -Q -T RE ,- me J ,J i'+ 1'? S ba J P , . h M., Chrys Orr Sheri Osmun Leslie Parker Jimmy Peacock Albert Perez Linda Peterson Jeff Pohoreske Jenny Poirier Mike Pool Markedda Price Y-ill' f fiiifif e2Q'3isif23K?feiE 153 MMWM ww' 190 I juniors Mike Sullivan Shellie Tackett Kim Tally Jodie Tammen Robert Teague Mike Terry Julie Thompson Danny Tidwell Tim Tinker Sandra Torrez 'C Y . .M 'i i 'ET' I-T 4 R 3 - .fy-P. me S i M a x ql fix ,sf QF' 5 X. wx' W gi. . QS i If 'L A ,T fi. E5 ' i Qi, M il T 13 i 1 8 ve' 3' xi, Jr -3 in-xl SA. 'HN' X ya J ,Eli A-A X.::, Sl- . 1 X., 'rf 1 l ' A I J - n WY' 4 Y . X , K rw. S 3 X . Ak I Rhonda Wright vo n noy - wright Donna VanNoy Edward VanNoy Vickie Vrba Patricia Veal Justin Waldrop Sherry Waldrop Chris Waldrop James Walker Jerry Waller Mark Walter J. D. Wardlaw Tisha Warren Mark Webb D'Nette Weiss Dana West Terry Whitbeck Tom Wilshire Sherri Woerner Allen Woodworth Bobby Worrell Dana Wright JUNIOR CLASS OFFICERS are Pam Hix Ctreasurerj, Marvis Conley Cvice-presidentj, and Kim Guidry Cpresidentj. Not shown is Albert Perez Csecretaryj. juniors! 191 7 ff 1 ww 1 'fi'-K x, 192 1 national honor society I 1 .- 1- 3 5 A NATIONAL HONOR SOCIETY members are Lynn Duncan, Tammy Cox, Roni Hornell, Cheryl Dinger, Lynda Duncan, Delinda Durbin. rg! as Q-Q , -:R ii-'-5, Q S Ii!! 3 N' E fm NATIONAL HONOR SOCIETY members are, FRONT ROW: Kim NATIONAL HONOR SOCIETY members are, SEATED: Sandra Guidry, Shellie Tackett. BACK ROW: Mike Deason, Andy Kesling, Laserna, Cheryl Garner, Sonja Hall. BACK ROW: Nathan Beach, Keith Duvall, Tony Nix, Jimmy Lott. Charles Secchio, Darshan Kapadia. Betty Anderson Brad Anderson Tamara Armistead Tim Atkinson gn-V is. Chester Barden 77? 194 f seniors Ricky Barrett Steve Bayse Brenda Bateman Tony Bargsley ,- X SENIQQ SPQTUGHT Recognition of the little known achiever is an American tradition. Yearbooks usually recognize the achievements of students in school activities, but there are equally deserving people whose goals take them outside the high school limelight. Gary Ybarra is such a person. In addition to attending high school and working forty-five hours a week, Gary trained daily as a welterweight boxer. In his four years of Golden Gloves competition he accumulated twenty-four wins, including eighteen knockouts. His losses only numbered three. His sophomore year Gary won third place in the Golden Gloves welterweight for the Fort Worth High School Division. His senior year he reached the finals before being eliminated. Dennis Baughman Nathan Beach Wayne Bishop Gary Bowie Ellen Bowman Cathy Brookins Michael Burnette Gerald Burns Dana Caciola Dwayne Cappers Jana Carroll Mike Castro Q27 196 f seniors to 'B' Bobby Conn Alicia Contreras Ricky Cook Michael Chapman Vicki Chevalier Lisa Clark Maw' SENU? SPQTUGHT Tony Bargsley did what many people will never do - handle two jobs well. At a time when one hears complaints about a lack of conscientious workers, Tony worked successfully as a butcher at Haley's Meat Market and as a maintenance man for the high school. After classes each day Tony went to Haley's where he put in several hours of work. He began as an apprentice butcher in the summer of his junior year and hoped to gain experience with a large supermarket eventually. Tony is a good worker and we think very highly of him. He does all kinds of work and does it weIl, remarked Mr. Haley. The high school came to depend upon Tony dur- ing the two years he worked as school janitor. In ICT competition his junior year Tony won an award for Maintenance Mechanics. Tony felt that a year of study at TSTA in market and processing would prepare him for the day when he would own his own business. Q., .' Sy :MY HIGH Sf' ff 495' UF 'WK Sharon Curtis Bruce DePrlest Kim Diffee bm Blake Cox James Cox Jim Crowley 47 Cheryl Dinger Michael Dishman Danny Ditmore seniors f 197 Laura Duncan Lynda Duncan Lynn Duncan ff? Kathy Earl Km., Paula Elkins 0' f 198 X seniors 'lpw M, Pam Ethetton Kyle Farley Shirley Fisher Pam Endsley xx . - ' -nh-...A SQQSIIQQ ni As a senior, Nathan Beach had many responsibili- ties. Among them, was the store owned by his fam- ily, one of the largest retail religious book stores in the Southwest. As Nathan looked back he stated, My father started the store with only a five dollar bill. He read about sending a five dollar bill to a pub- Iishing company in exchange for getting five books. These books quickly sold, and by sending off for more books the business was started. Nathan worked in the store six days a week, and on Sunday the store was closed, and his family went to the San- som Baptist Park Church where his father preached. When asked who would take over the store in the future, Nathan replied, I don't want to take over yet, and I haven't really thought about the future. l just want to take one step at a time. All my brothers and my sister are getting too old to take charge, so they need a young, energetic, bright per- son to take over. We just have to find him. Just kid- ding. I really enjoy working, because I get to meet the most interesting people you can think of. But as for taking over, I don't know yet. Rick Frisbie Mark Fritz Anita Garcia Katrina Fitch Isabel Flores Philip Franks Cheryl Garner Tina Goodwin Vance Goree Denelle Green Mike Greenhill Kelly Grimes W' ez 9!.. .'3 Pamela Harwell Teri Hatfield Larry Hausner Melinda Guyer Sonja Hall Jon Hargrave ilu Q-vw SENICDIQ SPCDILIGHI Styling and cutting hair was one of the many skills Melinda Guyer was planning to base her career on. As a senior, Melinda attended both high school and college. She was enrolled in the Ftoffler Barbers Col- lege in Ft. Worth. Melinda's typical day was a long one, she got out of high school at 1:00 and went directly to college where she stayed until 6:00. Then went home to do all her homework for both schools. When asked if she would like to own her own beauty shop Melinda replied, I plan on starting work in a shop in Duncanville, but later I intend to go into a partnership with my aunt. If I do have my own shop, I would like to build it somewhere near an airport because there are so many people around there for business. If I should not find an airport to work at, l would like to work anywhere that's busy. szzff Cindy Herran QW' John Hines Richard Holcomb 1 uni? ,db If 9, 'ki 1 Charles Holden Jacky Holder Roni Hornell Stacy Howard Debra Huff Lowry Hunt seniors f 201 Laurie Ingram Marc Jones Jerry Juliano Q...-H' Tracy Kern Tim Knowles Robert Krueger Mark Kam ix Darshan Kapadla Allan Karl ,Ar 'CLD' 202 f seniors SENIQQ SPQTLKSHT Summer of his junior year found Darshan Kapa- dia in Calcutta, India, revisiting his birthplace after six years. I think of India as my home, my mother country. Someday I would like to return there to live because my family is there, he commented. Darshan and his family moved from India to Ontario, Canada, when he was six years old. My dad, who works for Volkswagen, wanted to see the other side of the world. But the main reason was to allow us kids to take advantage of the educational system here, explained Darshan. They lived there for two years and then immigrated to the United States, living first in Tennessee and then moving to Fort Worth. Darshan and his family are Hindu, and the entire family is vegetarian except for him. Post-graduation plans for Darshan center around a double major of finance and accounting at the University of Texas at Arlington. 9 aff' F' fl' Becky Mabra Steve Mann Dan Martin in 204 I seniors Bryan Miller Darren Miller Kyle Million Pagel Martin Billy McElwrath Debbie Mikeska x ..,,f we , stlgtlllglwt Thinking about music all the time was one of Don Lang's favorite pastimes. As a senior Don had intro- duced his talents through many performances. Throughout his life he owned fourteen guitars, including his favorite guitar, the one he plays now and has lovingly named Lucille. When asked what made him start playing the guitar he replied, l went over to my friend's house and he was jamming with some of his friends and he asked if I wanted to learn how to play. That's how it started. From that point on, Don performed in many bands. As a senior he played with Lotsa Love, he was lead guitar player, and was one of the main singers. When asked if he was going to go further in his career he replied, l'd really like to find some great musicians and form a band to seek out fortune. l love playing the guitar because it gives me a feeling of doing my own thing. I Al Y'-0-v Lisa Murphy Rae Myers Valerie Neal Wx Darla Moore Tim Moore Eddie Morrow Valerie Newman Corrinne Orr Randy Parker seniors X 205 Kimberly Parks Kirk Parks Panel Pierce 206 f seniors Mike Raulerson Cheryl Rentzell Jackie Roark Robin Pierce Mike Raines Griff Rambo if' 0-5- .EM- M 1: WORTH SQ? SEIXIICDR SPCDTLKEHT How many people could claim that their cows were television stars? Larry Smith could. Part of his family's longhorn herd, the third largest longhorn herd in Texas, was used in filming the cattle trail sequence of the highly acclaimed television mini-series Cen- tennial. When asked how his cattle weathered the experience of being stars, Larry replied that they did fine with the exception of one steer whose horn was broken in one of the stampede sequences. Larry traveled all over the country to attend rodeos and cattle shows where his cattle often placed. He worked every day on his family's ranch, taking care of obligations there as well as those at school. Larry was an active student. He played Judd in the all-school musical production of Oklahoma perhaps feeling more at home than most in the role of a ranch hand. In addition, he was an expe- rienced speech student and held several major roles in speech class productions. Kathy Simon Cheryl Smith Gary Smith df' Carlene Ruckhardt Charles Secchio Clay Shirley Larry Smith Robin Smith Karla Stailey seniors I 207 208 I seniors Pam Statham Floger Streater Paula Swindell Karen Tritten Kathy Trltten Sheila Turner Jimmy Thomas Rowdy Thomas Joe Torrez lb' SENIQVQ SFJCDTLIGHT When McArthur High School in Irving, Texas, losd Kerry Wilson to Crowley High School early in thei school year, they lost a fine musician. Lead rhythm guitar in a local rock band, Kerryl also played a mean tenor sax in the Eagle bands.l Students first got a taste of his expertise on the gui-y tar during the Halloween assembly, California Jam, when Kerry played with the local rock group Lotsal Love. lt didn't take many band concerts for studentsl to realize that Kerry was an outstanding all-around musician. He and fellow band members Mike Deason, Paml Hix, and Tim Harper formed a quartet which travl eled all the way to State competition by earning al superior rating at District and Regional ensemble contests. W 67 if . Kathu Vondra Karen Vrba Barry Waldrop -117' Randy Ulrich Rhonda Van Winkle Nancy Voirin Donna Walters Toni Warren Jebi Watkins seniors X 209 Cathy Wells Sue Ann West Jay White Lisa Whitley 210 I seniors Shelly Womack Lisa Wilks Steve Williams fb' Slfhllill? R Usse SPQTLIGHT Class business was conducted by an especially capable group of officers. They were, seated, Dan Martin fpresldentj, Lynn Duncan Csecretarvii stand- ing, Darshan Kapadia Ctreasurerj, and Justin Landes fvice presidentj. All four were members of the National Honor Society. Alike in many ways - they were all bright, capable, personable people - they were also quite different. Dan was the Aggie fan who kept the jour- nalism darkroom running. Lynn was the sweet, quiet girl who added to school life on many fronts, among them athletics. Darshan was the scholar who always came just short of an A in English. Justin, the quiet one, was a behind-the-scenes worker and organizer. 4 Jesse Wright Gary Ybarra Darrell Wilson Donald Wilson Kerry Wilson by-0' I seniors X 211 Seniors nominated five boys and five girls for the title of Mr. and Miss CHS. The student body then voted for two of the ten nominees. After a runoff election the announcement was made that Mark Frittz and Kim Lee were the win- ners. G Sf.. . .-3 ii ,K .saga 212 1 mr. and miss c.h.s. Kim Lee quickly found friends when she moved to Crowley during her iunior year. She established her- self as a person of integ- rity, intelligence, and responsibility. She was active in OEA and was a member of the National Honor Society. Mark Frittz made friends with his ready smile and musical talent. He sang and played the piano. Mark was active in speech. 5:9 iw: MR ea M153 CHS MARK HQWZ KIM LEE 1 , ,sk if 9 :li . 's' L .fr 'K , . fi 9 +1 P' - 9 . -qnyxxk 1 f f . x ,,- i K 9 Ai Q -Q -'P' 4 i Ie fl, 1 X Q Y Q' 12 E ,W u X. L P 1' O , Aa? r 4 'E 1,9 iq -f 'mu 5 . ,D I ,f senior spectacular wk , t, -g . ft. tg.-W. V , ,. .. ., . K In - ,,, ,M,..,f,t,,J, gt. . my .X f - ,I ,th assi 1 '--' 'Q . ., Q fl if ' gi I f Behind the scenes of the actual performances, success evolved through the efforts of both the stars of the show and the people who would never step into the spotlight but worked diligently behind the curtain or with the lights and sound. More than fifty acts comprised the two perform- ances of the Senior Spectacular which were staged during the daytime for the student audience and in the evening for students and guests. One vital per- son behind the scenes was Mrs. Joan Leonard, the senior sponsor who supervised the production. She stated, Being a sponsor is exhausting, frustrating, a frantic, but totally exhilarating experience. She explained that because of the many activities in which the seniors were involved, it was virtually impossible to find a time when everybody could be present for practices. Seniors found they had more talent than they thought. Those who thought they had none whatso- ever found themselves proudly singing, Don't pick your nose, to a packed auditorium or miming the words to songs from Grease Fine dancing and singing acts were held loosely but comfortably together by the two emcees Rowdy Thomas and Griff Rambo. Decked out in tails and tennis shoes, they provided an extemporaneous commentary which put the audience at ease. When asked if he ever forgot his lines, Griff laughed, No, l never senior spectacular 1 215 mv-sr yi M Mutual acceptance developed among seniors Senior Spectacular offered something especially valuable to the senior class members. lt was the activity which probably brought them together the most prior to graduation. An attitude of mutual acceptance and support developed among them and continued through June 1 when they at last had to tell each other good-bye. They seemed to recog- nize that they were something special - a unique group of people whose newly-found closeness would end all too soon. ABOVE, SENIOR JESSE WRIGHT discos down to the boogie beat in the Senlor Spectacular. KIRK PARKS SINGS the senior class song, Come Sail Away , 4 216 ! senior spectacular WHO'S ON FlRST? , is the question Tony Bargsley puts to Darrell Wilson. sensor spectacular 4' Qi 'i s Hu 'H AN OVERALL VIEW ofthe T.C.U. ballroom shows some of the fun had that night. . I Qmmwcw.. wr V . f P 3 1 LATE NIGHT FANTASY 9 I B 'Z Aff 1 220 f prom X v Q LEFT, SENIORS LAURA Duncan and Dan Martnn dance to the music of Texas. LEFT, NANCY VOIRIN and Mr, BELOW, DRESSED IN their finest Mike Leach get one more dance in Larry Garcia and Tammy Borden before the band takes a break. dance. By evening, when guests began to arrive the blue stream- ers that hung from the ceiling were drooping a little, and the moon over the refreshment table whose eye was supposed to blink stared straight ahead. But these were insignificant details noticed by few, most of the seniors remarked on the over-all beauty of the blue sky ceiling, the silver stars which dangled from it, the red and yellow roses and the revolving mirrored ball above the dance floor. They knew the jun- iors had worked hard, and they appreciated it. Each girl was given a red rose at the door as each couple entered to be greeted by the music of Texas . The night was successful to me because it brought a lot of memories of the seniors. As long as they enjoyed themselves and thought of the night as success- ful it was worth it, said junior Sheri Osmun. Did the seniors appreciate it? Said Gary Smith, l'm a senior, and I did! . 1 N - A n A ,,, h xx 1 rn- I. -. I, 1 'ff ,,, , -,V ,Q sw K ' I fu' X 47' ,B , , ' in , J ' . - ' lf' at 6 , Q W v . .T ' - 'R 41 r -'P ' ' 1 f, ,, ,JA s g V- Q .,.,' 3 ff' .Q ., in q . f A . ir 404, .:PQt' ' .5 I, . ' Q4 f , 0 ' -' . , f- . ?fm5,g ,1- 2 '4'!'. x-i ' 3' 4: . . is . 1.1 K' 1 . K . ' ' Su ,Z . 4 ' ' A 4,3.,X,. , n Ll' as 2 - T' . 451 I ,Q .48 'vs an ', ' ' a- W , . 1 . 'ff Q ' 4 'V 3 1 1- L . N E fy :vw R. J K. sw SBS' I .. Q Q' 5 2 1 ' I Q ,f , pm-un ' in d VZLV ,,,1,,,a'4s.n5 Q -ng' -cv: - I Qin - f f . Q . maya.. 1 L' , . 0 5, mf: N f V 1 0- 4 7 ' a 3 ',, ' ,L A-'P . l f - 5 S .3 ,,. 'luaffil' W 3, -if 'W' wr ' ,hh V mhfw I i.ffw', 4tb:f75,f iq' v . f H W, 1 'Q - M11 , Zi -2', 5 Q I 5,5 5, we ,, N. an , 1 , dag., M we J' 2 , ..-, ..,',,,t.,g,, 5 W qw fx? VL' 1 v W ff, . ' ! ' - Ai , 1 vi L n. , .4 1' . - ': ., ,, Q. Qlupflyr Y 'gig V, ' I -. 'I-.' ' V V ' a ,rf Jig A if: k,,, 2, X ni Yi . ' Y if 'tiff Q. , I f Y , . I, N 'U 1. Y . J r A,-Q. 5.1 sf. I 1 i 1 I' 1 , 4 1 ' 'W W W, ,,,, , -If-nn.Q,,, 1--.M Nh... ,,,. - ,-,....f ! 1 , Q. .H p.. ., If I N-....., senior trip X 223 lv These dumb hats! - Which side does the tassle go on? -- anx- ious waiting -- lining up - Why did it have to rain? - Well, at least we have a nice auditorium - Shhhh! - Quiet! -- There's the music - Now it's going onstage. DONNA WALTERS PAUSES before lil? BUT ll-lE 1' ? 14 3 .L gf np i 4... Al ,j1tf,i fn' s 1 ff' LEFT, STEVE BAYSE and Vance Goree, gleefully realizing that the end is almost here, examine the program. RIGHT BOTTOM, SALUTATORIAN Justin Landes addresses his classmates. RIGHT TOP, VALEDICTORIAN Sonia Hall talks about what lies ahead SHQLJTING ' .., ,R xW, mx, WWC fo? If 55f beZ?4, 400 ' Q :Gsm c 6 f 22 V006 r fsc-6ooff5O4Zf4+8 S6 . 4 Pffyee 6700 SOQQ Q 961' 66771, 02 Cyp, ef 0E1'bef7f2p2p9,g,6 ,PCW7 061427 056 ,awp 0'bf - WW f 6272300 Z 66 40100 0006009 ' 09001: 'F .r070050f G 06000 a jf rf w0o4s0.vfbf05e 470 049001500009 4'994'1'000ogfQ22,Q,zyOf, '72fbJf00+0s0006w0f000f60f 000 0600f4waOg,f25fo5Q 004,270 PGS' 4f0 W0 000050 ss0'p0' 40 0001100109 007,0Lb60f0 emfeowfq crgqofks I '30 .9fO'1729,of51f0f00ff0.r0'?706o00 fo 160 619950 s06004,6f000Q' 00004700 00000 fo say 0501 we life!-45: M10 11040 s0000f,of004w074j 0500912 1730 co 'bf 0+0'b00 H1600 050 94900 0000.9 I s0600fhf0f0o004,0'h7?7, 6OQf6Of fo I4-0 60070 0-f20'fg0,f4 4146 0010 60070 f0sI0f0000,0f 0 6000 04050100 060004 of wb! 0060049 5170 001' 0000 O0 042' 0 'P 00' O 90 '77 Sf? W0 1071. 05 Io! 600' '0f90f 002' 0f050 C0050 000009 049.519 19600 26012- 01 has f0f00O'0Jf 00 0670 0,0 0 ,001-2' of MQ 00 .s:of00072.9 olfef 0, 000000 05026060002 .900 s00f0q M0607 Z0 0006 Cl0h4P'1W0O00' 00000 OU-0610 IO 0002 GOI' 010, 0004: 0501601 000 fogfohf 10 Ns-Q0 0 WGffv0Jfsf0'b0f?2 X5 xx 4650607 GOK A000 40 ' , '99 W2 00 047007007000 900170 J009'k,zf0 61057501 we . 000 fv 00000077.9122 Q 00300003329 loslng C Sf 22 46' fs Off, df Offoomfef 0046s i'gZi0'91Zfrf04a+0f 099 'O466ofbQ 'cesfoef7Jf fC X 'WP 'OO' Q0 600 A? 6,Ge4'?S'0yff'g1I,,efeiQ1j53,CiZPe 09'75ffbsfsf0'75e00ea0f' 0f0O'oC0of7 790616 00006004 ' 49440f1g100fr090 fvoof ofoqooevffewswelwoobbave asf0o0Q,CYf75049,1fff0f7f?pGf2'Z9f Gore 'fmoeooxf n . v aff if ,I '9fG'S'Zs 55x47O'9'1M'F'9c90kwfs0f7 40266 006 490160960606 QGQJWGQFQO 60065019 6' f 061ff06F604Z02W0 mf 06000 00015260 'S 'Rafe 650070 13 ,,'3: T4 If6'?76f' 050108 ff 06010 0007169 sI0Ogf7fs H061 0004916 hf0o6'06 66607602661 I0 sfbya f 26GfG f7G6'O'61f71'O 06 266 60460 01f,0f0,0f6 6166 600 0004- V678 070 ,OQPGC7 4 c?f70sI6ff 0600715 haf s0600f f-660601 2661 66620 fb ss X 0660601 061116617 616- hfofffyq 049046 600 hfbfkeg fbffow s00f6Q f660f56fs 600 61006016 40 6,004 fr oooefcgfb f0r0f6 4sJf666601Ef rbfs 0660 1279 606001 G01 'bf 00115 266 1301 1661 116' 0007600 f.3fy62'f6f276f060f66 SGWSQILGS V SZZFW P' N .03 in VG 600 464f01P0660 fsfff f2fC'0of70ffo'Z06fsb21v Ow4f6o00Qpar6f2,afm9 6561? eposoe GS HALLMARK PHARMACY ii? Prescriplions TROY WNSON School Supplies, G-i'Hs Perry Williamsw h T I4I Sheffield, F+. ig QTJIQQLHLTEEAT gig ONE 292855 ori' , exas Sebesfa X Shedcly Real Es+a+e 5320 Wedgmon+ Circle 292- l 779 5735 Crowley Road 55 l -096i Ls RCA soNY ZENITH SALES AND SERVICE kimzeg's LOOP 820 AT GRANBURY ROAD 1SOUTHCLlFF CENTER! JU Nm' igilgiz 230 f advert sung PLEASAN TVIEW BAPTIST CHURCH O.: x , 'X .f! xxx F ffl' P.O. Box 330 Rkjafiig Crowley, Texas , fy lm 1,5 fl,Ngg7 if Sian 'q, N II YI xfj Burch VarneII, Owner L. .. A , , .I Phone 292-9072 3828 aI+e mesa blvd. for'I WOI'I'I'1, Iexes 76 I 33 Phone 53153921 552I 'foresf hill for+ wor+I'1,Iexas 76I I9 Horseman's S+alI I20 S. Tarranf Crowley, Texas advertising X 231 5251 W weneewoon BOWL The Family Fun Cen'rer Free Bowling lnsfrucfions Wonder Dri tWorth, Tex' 292 1821 Reserva+ions for Graduafing Par+ies, Bir+hday Par+ies ...gage N 4 ,HQ 1 Home of the ff - G b k Q ,, reen ac Packers. - T' SWB, l If begs 'Q f ':' R sou hwest Banl-1 x,Nn,?W,, ,,,fu ' Loopaaoamnmnakgggigg HAI R DESIGNS UHEADS ,ff-X M 950 You wlN , i 51,5 -xr 'H f 5'Ll:i.f 5E , I 1? T . I Q W 8 j f ' J' Torres it guardian I'i+Ie company 294- I 330 292-9378 5039 Trail Lake Dr. 3825 AI+a Mesa wedgewood office 470 Alfa Mesa 292-07I2 Ice ory Phone 294-05 I 0 5320 Trail Lake you can be whai' you wan+ +o be . . . i+'s up +o you. Sheen King riisingf CompIeI'e Hair Care ' Hair Designing ' Body Wave ' Fros'ring ' Hair Coloring ' Ear Piercing ' Trichonalysis Iscienfific approach 'ro hairl ' RK ReI'aiI CenI'er I I2 Sou+I1 Tarrani' 297-979I CrowIey, Texas 76036 Von and Joyce Ragsdill Hair Designers 5296 B Trail Lake Drive F'I'. Wor+I'1, Texas 76I 33 297-98 I 0 T f 1 4 C-D I cz IMHHMQW mf, 0 QL C35 ,W .M Jr if W SALE 8: SERVICE I25 W. Main Crowley, Texas WE SERVICE WHAT WE SELL ,AZTEC Manufaciuring Company 400 NorI'I1 Tarra ni' Sfreei' Crowley, Texas 76036 Phone 297-436I 234! d W Q FIRST BAPTIST CHURCH I -. ' . 'i ' l , . ln ll , . - . 1 , 1 , Ia. , 4, . . I -P 'f fx I'-- E N - I .--T 1 -.nh Hun ' f ' - II I sI I I li I Te iff AOO SOUTH EAGLE DRIVE ' CROWLEY WILLIAM H. WHITE, D.MuN. CID we ,fs V2 -1 PASTOR fag? X E gl: C-JL :X MICHAE D REE ES 'I' 'I' JONATHAN AYNE Ill ,Il vgb. II . dl STEVE STANLEY 4. LIL HOT SHOT I I6 S. Tarranf S+. Crowley, Texas 76036 297-493I FI LM-PAK 20I S. Magnolia Crowley, Texas 76036 297-434 I .14 .2 T .5 gg. advertising f 235 D05-1 MGM- by ' Roe. A Q05 QYA1 A AGN.. 9005 KQOQX. xeem, Qxzfa A gxxcm, .001- been. docx-, XVQV Y 040 A A wav, A A A06 50-nl A A Afbzeqxoq qsA A Axoedzmk AA bowl A A AeKSN'Kz6'o0x6X'b':. A Awb-,A A Anxex QQ5 . A . v5Q0x0qQ990K A A Ake.c.o10eA A X010 :,oeg0e,0c,sA A 1:6006 e006xe,e-A A A0101 A9GQxo0v,66 A A A0N000xqexs A A A0600 . 9e.to1QQLN,'0A A A004009 A A A00-,e 49009 A A A0 A0e,9Q0f,0Qdxe.eA A 0000+ A Axewlavy A 0000+ S00 5A A Awd56e4l'5yd?4sA A Aosqxwx A Asvozqfkfx- - -3 Az-Azfgvabowla A Avlqxoqqeqex A . .QOQVOKN - -WWW 95- - ,QXQQXQSA I ,,4x',:,q,,59A A Agxqw, A A'x00xxzf,A A A00-zlsqzgww. . . gm, C,w,wxA A gdbwqx may A Aoo-0000195 A Aqvebxcwef. . .sfxi - - 3,4 A A A5xq,xKod5A A Axeootba A Af-,0oQ'aeee,eA A Af,x0NKe,0'n0xq0'9S. . .9009 A0m010eweA e0'wQo0A A Aqoqboxo A A .CAe'ox0YX0'v0- . -QGWOQQWL xsf-z-,A A A0-50-ge ' A A AXX0-,Ne0q01bKe. . NG. . rfb, 4 W'N'0'09- - 5 4 909,555 I - 409- A A-may A AamQ0x0Q00QPA A A Aw,:,os0sA A Aooee Qoow ' VXNNQOQS. A .eedxqzw . .QQNGW - -0500594 QW A-ff, A AXOGWA A .4000 . .vwww 4 -Q' A. A ,m,QNv,A A Axe,c,ox6eA A Ave,-alswgf A Aww 00005, . 04000094 A .2 'G-XQXGQXS A A AQ0f,xe,xs A A Azz f..A A AQee00qc,'ak6sA A Ad A A0502 A A AOAYN' sc,uQxxo0sA A Mel poxxx A A020-Q AA A Aewbwlxcve A 5000. A .05 fag0e,vbsA A A00 089. A A010-36 0000x005 gf 91014 . scxod 00 N' A A AQP A AQN A A A v5c,e,xdDQ0A A AJ' A-900i sol!-e KOQQXQQ gc 34 A1 A. A005 A Aooez A A Asoeo ooezt fy A A006-A A A' sxe,xsA A Di: ANN- ' vo P00005 A A Aww 501-A-xA A gvpxt we A A :AM , A A AXSXQOQG, A A ggeemoq cubs oweoxs A A AN- g,Qxo0xs6X6A A A' Q00 00924 A A A' pow A A .wget A aA A Aoooqvsiso 0 A Akeooibs. A A A0a0+Gowes. A mm 1550005 0 . AsxJSKe6'o16 xow-A A Q00 A . .NQXVQQQQQA 9c0Kwz,s M06 me QM. exe mv Q85 A Xie N A A A0201 od +A A Aqoqffw 2, A C QC Hu PHAFEFBTA A3 Y I ,7 Clrexas 297oWIeYS+. 1737 Pr DESC - I' r' . 'yerF3+gon a erwnd Ice W 'rhj fak come pr. m 'd . ung+i'n se wi+hr:,i 9 ese everyd a Y n ee ds . Foumra. 'n Pho Su +0 .f. cofgliegnthin .' g ehcs Zby :land I iffs eed ' ho 5. Se pe-A A Aera 0ewle0'zsq2xs A A QSOXQGQDQGK A A Azsqmcx A' Av, A Xxoqewc coq00eA A A4025 ooeeh A A0000 A5006 9600 ozxf, A A010150 55A A Ax06x0eA A04106M amos 000-y-,GCN-QA A A J. . .40o Q'9X9 5990010 A A X 0095. A AQQAN' A A Avubwlzme rose, 61000 A A' wkec aoxmbs A mx xpqooe A A Kxogzwab dak! A A-1-9eo0oe,sA A M0406 QOH 0005 A NQXQQ ,off A Ac,oXq90eJ 5 A A AWN Q06 A A Aiiouexvas- 90090 A -now-Q gy A Ac,o+e,eA A A400000 oqdxze A A015 HA L SELEEY. S M CORN-F ED BEEF T f 0 ' f ja 0 ,qi v h' 2 YT'-. . J Ho M E-K ILL 'l'o pe . and cn'ica+:DVRAP n PE D Cu ST OM c SLA row U leY.T?Xl1TERlN G C RE Row A-I-E A A0 ,A A Q0 fbi A 633000 Qxevk A A Abxii N005 A A .N-KQXN co yon Qow,0A A A 5+ 5oQQxe,eA A A-IM nee Ume xof,z6wo0sA A C fra ds iew A A Avl0x0Q00Q2'K gr ' Col el xosebxoqa A fd inc og fy d Ac,xezq01x0ee,A es nes' ru A AvkQx0q0zQ2fK ' an d g 000000185 A A W WMA Ad:z0+' E W 0 xr, no e- - - A A A A A :mow 30fQ'gz1UAf' FlLL'LL A wbmoc 9- ooez biogas A FMOA00 logs A- Y 0 - -was - - ' tb vsoi 605025 A A AONQAQQSA bm s A A A U Qzqmvze ,A A Ac.o0q00xo0eA A New R N 5 - Q- W0 fx, A A Axyggfzs A A xxfoox ggi! p05A A Agokx NSA A AzK'kxxcx5 fm... - ' - A A Af9z20xoq0NeA A ANwosxe0q0f9v,A A Mx DSI ,A A Aogeisxs 01050000005 A Asovwizseea A ANA A A0wxA tp - A5500 YO oi soqdxes A A Aqgqwvqcraxbs A A AQ00c,N-,A A 86 . N 2 Ns0A A AQZZPQKXQQGKQYL A ANX'ae0K39qifA A Sggiib 0 whey Qbgflxg- 4 Neg: mu oeooeszexuxx . - T ':Q9Q V:. . A0e0K6jQdxes Azooeoizgw kcpgffbvw v'f36- - -OOXSXU5 M qKxsAO+eA 0-qu-x...X2fN ,UYGC-OYS---'Q 'b' , -if, A QQQQQQQQQA A A000 0x0s0e,f-,A A Ae-006000 A A Qoqffow aln S --09600 A A40+s0s+eeA A A000-u,0QQ0L,A A Moexebfvabxe. -27 .fr 5005. A ,ww f,0QQXxe,e-A A Ao00Q9faiY0QA . AQNQS. . A4 ee+ -QQQQQA A 909000 A Aw-wwofy A ANQSNQDQSA . ,QQQAQN A A Acxex QM-,A A A0000-x e-000N0e. . . Axooqv A 4010900 A . Aqvoxokoxsvxoq -9.0001 56566 A A Ac,oq00f, A A A0004 cbd Hoqxoqqndlfs A A AKxoqe10z0Q0Nv:0 R 'f-A A ANtosKz0:0'9K5- - - Cesid A ARMS A AQMQGQSA O e 006 x m nf' so 500005 Fa m Ia' 4.0091 A A0006 A rms erci xoqe A A C .3 P45 D La 'rea 9 ' or e P e RE oghy W roperw AL ro BI To ke k R, I' er A .V 23 6 1 ad venisi HQ P JP I- QUALITY HAIR CAR EUAMPTGDNQS Across from +he Q SQHQQII EEE TTZTM T U U L H TM S+' 29 E1 M H E H I IN E HN E. 77 ,P 44 ff virgn L. Ed J L. Ed B 525-C I y T sour:-I gk, Loop AuTo PARTS YOUR FULL SERVICE AUTO PARTS STORE WE CAN HELP OPEN - 7 DAYS A WEEK - FOR YOU Machine Shop AI+erna+ors Repaired Brake Drums Turned Disc Rolors Turned Fly Wheels Turned Axle Bearings Pressed Valves Ground Heads Milled Blocks Bored Engines RebuiI+ Blocks VaI+ed Cam Bearings Ins+aIIed Speed Equipmenl' FOREIGN AND DOMESTIC CAR PARTS 5639 CROWLEY ROAD, FORT WORTH PHONE - 293-5OOI PORTER'S LAWN SERVICE RESIDENTIAL 81 COMMERCIAL LAWN CARE TREE WORK - HAULING 300 HampI'on Road, Crowley, Texas Congra+uIaI'ions Seniors FT. WORTH LUMBER CO. Wholesale Lumber and Building Ma+eriaIs 9IOI S. Freeway Box 969 FI. Wor+h, Texas 76 I OI 3 N5 1 + l ,C ' au-is a-SHIRTS for 3343 M'm,gvngw3Ag Business, Teams Adverfising Promofion CUSTOMER T-SHIRTS JACK D. McDOWELL - Owner 5302 Trail Lake Dr., FI. Wor'I'I1, Texas 76I33 I iiislfs - as 4 OFF.: 294-OIOO RES.: 293-0883 2 ad t's' gf WAYNE'S FOOD MART Corner of Main and TarranI' Crowley, Texas 76036 FRESH MEAT FRESH PRODUCE SUPER MARKET PRICES WITH HOME TOWN SERVICE PHONE - 297-968I SUPPORT THE STORE THAT SUPPORTS THE COMMUNITY HILLEY'S PHARMACY Serving Crowley area for 20 yea rs. Free Delivery Service +o Crowley I2I NorI'heas+ Wilshire Burleson, Texas 76028 Phone 295-I I25 SWAFFORD FLORIST Weldon and Dorofhy Sue Farris, Owners Joy Bales, Crowley Represen'I'a+ive I4 I 6 NW PHONE 25+I'u Sf. 624-84I2 B I G r Q u R LARGE ENOUGH TO FILL YOUR ORDERS SMALL ENOUGH TO APPRECIATE IT Furnifure Appliances 295-IOI I I I2 S. Main S+. Burleson, Texas 76028 WE SERVICE WHAT WE SELL M advertising X 241 INV! ' M00 M 81 M HAIR FASHIONS 292-3662 Complete Beauty Service 5201 Wonder Drive X - 5 Ig L For DAIRY QUEEN i 6 ' Wedgewood Area 6 i ua I I-I-Y 5208 Wonder Drive B ko 5,,,m a n mg BROTHERS II fi CLEANERS :fo I-00k +0 685 Westcreelr Drive Fort Worth 292-SOI I Z 5 E 8. M BANK g R. In Burleson f R' DAIRY QUEEN I, bios somh Hulen 297-4673 Congrafulafions Seniors I f E Stud ni Center. vid ul.. Who fixes the best tasting burgers in town? Your neorby WV Whotoburger restouront. The student center. After closs. G After the gome. After oll . . . nobody hos 0 better meol for the student's body. WHATABURGER-t Whotoburger is whot o burger should be. 242 X advertising CARPET TREE Carpei' 8: Vinyl Sales Professional Ins+aIIa+ion 5I I7 Old Granbury Road For+ Wor+I1,Texas 76I33 N Ph0neIan7I294-1550 Insurance Pgggfggis , WESTERN WEA R YOUR ENTIRE FAMILY STORE LOCATED AT 808 Crowley Rd. We Feafure LEVI - WRANGLER Free AI+era+ions Open I0:00 a m 'Io 6:00 p.m. d Q 243 DODSOIYI IIUTO PIIRTS Wholesale - Re+auI Machine Shop ? B Q sns TsT E T Val e Jobs Maor Brands Par+s - Ac e o es Block Bored Mofo Ols-Tools8m Eq p e + VaH' g Dr mg Q Rgfgfg T rned is szl s s E H ad 8: Block S 'Fac g 2 V I eSea+sl sfalled s 4 ' T Val G deslnsfalled B Bea gs P essed Glass Beading I 6 IO9 H y. 73I, C ley, Te as I 7 'A strong savings 8n1oan is one of the safest places you can find to keep your money GIBRFILTFIR SFIVIDGS THE LARGEST IN TEXAS 330 Easf Ma n Cro ley Te as 244 d g DOII 'S Va rieI'y a nd TrusI'wor'rl1y Hardware , .I Mr. and Mrs. J. A. Hargrave .E wk I I7 Crowley Road Sou+h MY 297-I646 CONGRATULATIONS - SENIORS I979 FI! II! 'If FI! ALLAN'S GARAGE All makes Service Par+s S+ocked Washers - Dryers - Refrigeralors - Freezers - Windows 8: Cen+ral Air 3 l 2 Soulll Hamplon Road Condilioning - I-10+ wa+er Hea+ers Crowley. Texas 297-9 I 6' Compadors 8: Disposals - Ranges EU ix Sales 8: Services fi ...s...s 9 Aufhorized Whirlpool Dealer OFFICE: 297-40I I 300 E. Main 297-4I I0 Crowley, Tn. 2 a i S 14 H advertising X 245 Go Eagles Air Condifioning Heaiing Good Luck Eagles Hearing - Aur Condihonung - Weafherrron Owner Area Code 8 I 7 Phone 297-4l 5l Myer's Deparfmenr S+ore M fg- - Burleson, Texas 76028 Do Your Shopping Close To Home Phone 8 I 7-293-5303 Trophies By Flair Box I 6037 Crowley, Texas '37 Hillefv 5+fee+ Burleson, Texas 293-339l L. S. LCNGHCDRNS P. O. Box C Crowley, Tex. 76036 VISITORS WELCOME LARRY P. SMITH FAMILY 297-I I42 297-I I45 X d rr Q N' Lifflv Tykv' X cms Ive cum: RE if CA EXPLORATION DISCOVERY . ACHIEVEMENT 924 Wesf Main, Crowley 297- I 472 WORRELL 81 WORRELL INSURANCE, INC. QLL 9 Won 'Iv s u R ANG WE CAN MEET YOUR INSURANCE NEEDS UTO-FIRE-LIF - T 96 ,wr 5 0 A E BOA HOMEOWNERS - COMMERCIAL 204 WEST MAIN, CROWLEY, TEXAS PHONE 297-4344 Y.. U Hallmark .. gf ' 'fl -is ,, ' . 2 2 H r ' ,M ' IA 1 -2 '-K , J fg..0gQ,,,g g ,QW I I , I 1 2 M' fm- I we ,S A 3 . K F 3 .. .. W ,. .mifiwfk .X ,E eg K Beaufy Wi'II1in Your Budgef Phone 293-7606 6938 S. Freeway Ft Worfh, Texas 7bI 34 Emergency 293-62I I ad ms Q 1 247 Arq1ericq's I favorite drlve-ln Q, l QUIZ? Bm fm? . 1 K RQ 13 z + ff: f QQlY 1- IF J SQNIC 326 W. MAIN - CROWLEY, TEXAS 297-995I using CARPET EACH OFFICE IS INDIVIDUALLY OWNED 8: OPERATED Da rI'er AND Assoclares EE-W I EB 297-4326 MLS 20I N. Hampfon Rd. MANOR' Crowley, Texas 0 , SGH Gre n S am re egljvgllllo fhe Selle? ai Elosljuza C T h r E e gf' forlgaclwfauday exclusive gf! :srkzrugluusflng ef currenf 6 6 Come Io Crowley Thrifly for your every need in groceries, mea+ and produce lO9W.Main 297-I52I Place where all The sfudenfs go 928 W. Main -- Crowley, Texas Phone 297-93 I 6 advertising I 249 T . jx 0K A BHWTIFUZZ TOMORROW START A SAVINGS ACCOUNT AT THE BANK THAT LIKES PEOPLE BANK OF m 'mMm , W r0wIey V FDIC 817-297-4331 ' P O BOX 605 ' ONE CROWLEY PLAZA ' Y, TEXAS 76036 250 dvertising A l ,Mg 1-. ' Q A A A IP U DIAMOND J. CROWLEY PUBLIC SCHOOLS Adminis+ra+ion Office STUDIO Capfure 'rhe Pride of Eagleland Lei' us record Y ph 'r g ph C g fli' C ly 'Umm CHRISTINA BANEZ WORKS on a job in Typing I. 252 f index Index aaa Adams, Barbara 110140, 41, 96, 174 Academic Awards 146-149 Adderly, Rick 1101 174 Aesop's FalIibles 4, 102, 103, 106, 107, 183 All-District Athletes 87 All HaIlow's Eve 5, 14, 15, 150 Allen, Debbie 110140, 174 Allinder, Debbie 1101 174 Alvarez, Diane 1101 40, 96, 135, 174 Alderly, Ricky 1101 140 Alderman, Derek 1101 174 Anders, George 11 11 51, 75, 86, 1 16, 186, 187 ANDERSON, BETTY 1121 194 ANDERSON, BRAD 1121 66, 68, 69, 75, 88, 194 Anderson, Charissa 1101 109, 12, 174 Anderson, Cheryl 1111 186 Anderson, Lisa 19130, 31 , 40, 97, 166 Anderton, Kim 19194, 166 Angton, Tommy 1101 174 AR1lg?TEAD, TAMRA112131, 56, 138, Arredondo, Sabrina 11 11 186 Arrizola, Leo 1101 174 Arrizola, Ruby 191 166 art 90, 124, 125, 148 assemblies 14, 15 Atchison, Wesley 191 34, 55, 74, 75, 16 Athletic Awards 86, 87 Atkinson, Cynthia 1101 40, 97, 174 ATKINSON, TIM 112140, 97, 194 Auberry, Tammie11116, 186 Auberry, Tracy 11 11 36, 129, 135, 186 Awards Assembly 4 Axtell, Andrea 191 166 Bagley, Kristi 19135, 46, 47, 59, 64, 65, 76, 166 Bailey, John1111131, 186 Bailey, Karen 110124, 39, 82, 135, 137, 174 Bailey, Tirol 110140, 97, 98, 174 Baker, Belinda 110140, 43, 45, 126, 148, 174 Baker, Brenda 11 11 139, 186 Baker, Mr. Harry 159 Baker, Ray 1101 17, 54, 76, 77, 174 aanew, sue 11 op 174 band 2, 6, 19, 20, 4043, 91-93, 96-101, 14a Banez, Christina 191 147, 148, 149, 166 Banez, Ramon 1101 146, 174 Banker, Mrs. Karen 144, 160 BARDEN, CHESTER 1121 194 BARGSLEY, TONY 1121 133, 141, 194, 196, 197, 216 Baker, DeeDee1111 186 Barker, George 11 11 140, 186 Barker, Steve 1101 54, 77, 174 Bamett, Ms. Barbra 120 Barnett, David 191 96, 166 Bamett, Sammy 1101 174 BARRETT, RICKY 1121 194 Barrow, Ray 1101 174 Bartholomew, Brian 11 11 186 Barton, Tracie 191 166 baseball 78-81 basketball 38, 60-71, 86, 183 Bassett, MaeIe191 76, 166 BATEMAN, BRENDA 1121 24, 46, 47, 106, 194 Bates, Steve 19134, 55, 70, 77, 166 Baudin, Mrs. Hortensia 160 BAUGHMAN, DENNIS 1121 134, 195 Baxter, Annette 1101 31 , 56, 59, 60, 135, 142, 174 BAYSE, STEVE 1121 133, 141 , 194, 223, 225 BEACH, NATHAN 1121 15, 17, 35, 37, 50-53, 86, 142, 146, 193, 195, 198, 199, 214 Beaird, Lecia191 166 Beaird, Troy 11 11 142, 186 Bean, Mr. Eldon 89, 153 Bean, Mrs. Eldon 87, 88, 89 Beck, David 11 11 51, 67, 69, 74, 75, aa, 126, 229 Beck, Susan 1916, 59, 76, 119, 135, 166 Bedford, Tony 191 166 Beiker, Randy 191 55, 166 Bentley, Bobby 11 11 144, 186 Bentley, Missy 110140, 41, 97, 174 Bentson, Marla 1101 174 Bianchi, Marti 191 82, 104, 166 Biggers, Johnny 1101 174 Biggers, Tammy 11 11 8, 134, 186 Billingslea, James 11 11 186 Billingslea, Shermitta 110145 Bishop, Pete 191 166 BISHOP, WAYNE 11 21 144, 195 Blalggey, Darla 11 1160, 62, 73, 157, Board of Education 113 Booker, Bobby 191 55, 71 , 79, 80, 166 Boone, Gay Lynne 11 11 119, 128, 186 Borden, Tammy 11 11 142, 186, 220 Bowie, Connie 1101 24, 40, 45, 104, 174 BOWIE, GARY 112133, 69, 195 BOWMAN, ELLEN 1121 195 Bowser, Kathy 1101 174 Boyce, Butch 1111 186 Boyce, Rhys 191 166, 168 Boyd, Mike 19140, 97, 166 Bradford, Sherry 1101 65, 73, 174 Brady, Kevin 191 166 Branby, Scott 11 11 51, 186, 196 Brandenburg, Mrs. Amanda 135, 160 Brannon, Wanda 1101 174 Braudaway, William 1101 140, 141, 174 Brawley, Derek 191 166 Brawley, Donna 11 11 186 Bray, Michelle 1101 30, 31, 59, 65, 73, 174 Bray, Mike 11 11 140, 186 Bray, Mrs. Becky 160 Bresciani, Mr. Herman 140, 160 Brittain, Billy 11 11 141, 186 BRODKINS, CATHY1121 149, 192, 195 Brooks, Dale 191 149, 166 Brooks, John 191 166 Broughton, Mr. Ray 157 Brown, CarI111118, 118,186 Brownfield, Pat 191 71, 166 Broyles, Darla 191 166 Broyles, Randy 1101 174, 176 Buckley, Mr. William F. 91, 118 Buchman, Craig 11 11 186 Bueno, Joe 191 166 Bueno, Sherrie 1101 174 Bullick, Jeff 1101 174 Bumpus, Mrs. Gail 129, 135, 160 Burch, Clibton110154, 174 Burden, Leesa 11 11 174 Burger, Mr. Robert 15, 160, 165 Burk, Mr. Dennis 9, 37, 50, 51, 160, 221 Burke, Angela 1101 175 Blglglr-,ETTE, MICHAEL 110140, 97, 98, BURNS, GERALD 1121 31, 141, 195 Bush, Frankie 191 166 business 126, 127 CCC CACIDLA, DANA 11201 134, 195 Caciola, Paul 1111 186 cafeteria 158, 159 Cain, Karen 191 135, 166 Caldwell, Stacey 191 166 Cantu, Sylvia 11 11 186 Campbell, Gary 191 55, 71, 82, 166 CAPPERS, DWAYNE1121 196 Cappers, Linda 191 145, 166 Capshaw, Redonda 19164, 65, 166, 167 Carr, Mrs. Pat 159 CARROLL, JANA1121 19, 24, 40, 45, 116, 117, 196 Carroll, Tommy 1101 54, 175 Castillo, Velma 191 17, 167 CASTRO, MIKE 1121 50, 51, 140,196 Castro, Terry 191 55, 167 Caviness, Mr. Harvey 145, 160 Chapman, Kelly 1101 82, 175 CHAPMAN, MICHAEL 11 21 24, 25, 40, 92, 97, 104,105,196 Chappell, Paul 1101 54, 175 Chazaretta, Santos191 55, 77, 167 cheerleaders 3, 16-19, 46, 47, 89 Chenault, Chuck 110140, 97, 175 CHEVALIER, VICKl112194, 116, 117, 196 chorus 92-95, 148 Clark, Mrs. Diane 120, 160 index X 253 2541 1 X f 5 of 1 5 f Ma g 1,,s ,Q 11 1 f BRIGITTA SIMON TUGS away on the sophomore tug-of-war team on Ranch Day. index Clark, Mrs. Georgia 159 CLARK, LISA 1121 196 Clark, Lisa 1101 135, 186 Clement, Cheryl 191 30, 31, 59, 65, 73, 167, 1 73 Clement, Kenen 19165, 135, 167 Clouser, Billy 1101 175 Coble, Rodney 11 11 145, 186 Cochran, Wayne 191 167 Coffey, Linda 111145, 114, 186, 192 Coffman, KiaI1101175 Coker, Daniel 1101 54, 175 Coker, Mrs. Noella 157 Cole, Jeff 1101 20, 54, 71,175 Cole, Mrs. Delores 152 George 1101 21, 40, 91, 97, 98, Collins, Sherea 191 107 Community Education 156 Conley, Marvis111140, 45, 182, 186, 191, 192 Conley, Yolanda 191 59, 64, 65, 135, 167 CONN, BOBBY 1121 196 CONTRERAS, ALICIA 1121 142, 143, 196 Contreras, Juan 1101 54, 71, 79, 149, 165, 179, 181 Conzoneri, Andrea 11 11 186 Conzoneri, Angela 1101 115, 175 Cook, Mr. Mike 66, 69, 119, 161 COOK, RICKY 1121 133, 141, 147, 149, 196, 223 Cook, Steve 1101 175 Cook, Synthia11015,135,146,175 Cooper, Cindy 19194, 167 Cooper, Thomas 1101 54, 175 Corbell, Beth 110140, 97, 175 Cornish, Mr. Vermon 161 Coronado, Diga1101 175 COTTLE, CAYE1121 147 COX, BLAKE 1121 197 COX, JAMES 1121 197 cox, Tammy11 1146, 47, 59, 65, 113, 186, 193, 227 Crawford, Lisa 191 107 Creative Writing 146, 184 Crockett, Jon 191 167 Crouch, Mrs. Sue 153 CRow, Mrs. Karen 3, 38, 64, 161 Crowley, Miss Barbara 110, 118, 161, Cunningham, Mr. Lewis 54, 161 144,147,148,197 222 CROWLEY, JIM1121135, 142,197 Crowley, Larry 1101 175 Cummins, Darrel 191 167 CURTIS, SHARON 1121 135, 197, 226 CVAE-VOCCT 144-145 CVAE-VOCT 144-145 ddd Daily, Jennifer 11 11 146, 186 Daniel, Mr. Don 39, 155 Davenport, Sherri 19194, 167 Davenport, Terri 191 167 Davis, Bryan 191 167 Davis, Debbie 19146, 96, 167 Davis, Opal 191 175 Davis, Renee 11 11 134, 187 Davis, Tammy 11 11 142, 187 Davis, Terri 191 59, 167 Davis, Vince 1101 143, 175 Dawson, Tonia 191 167 season, Miken 1124, 31,49, 82, 97, 93, 99, 106, 146, 187, 193,194 DECA 142, 143 nepnlesr, BRUCE1121 24, 25, 94, 106, DePriest, Bryce 191 167 DePriest, Bryce 1101 175 Dick, Gary 11 11 74, 75, 187 Dickson, DeVaun111111,187 Dietz, Mrs. Peggy 33, 122, 161 DIFFEE, KIM 112145, 197 Diffee, Ramona 11 1140, 73, 93, 97, 98, 187 DINGER, CHERYL112120, 22, 31 , 40, 97, 193, 197 Dinger, Donnie 191 40, 97, 119, 167 DISHMAN, MICHAEL 1121 197 DITMORE, DANNY 1121 140, 197 Ditmore, Mrs. Vivia 155 Dixon, Leslie 1101 175 Dobbins, Charles 11 11 175 Dobbins, Robert 11 11 187 Doeppe, Steve 11 11 6, 51,187 Dominey, JoAnn 19165, 76, 167 Dominguez, Connie 191 167 Donaldson, Andy 191 40, 96, 167 Donohue, Lance 191 167 Donohue, Shelley 191 59, 65, 76, 167 Douglas, John 191 167 Douglas, Roger111171, 109,187 Dowdy, Derek 1101 175 Downey, Lisa 1111 187 Doyle, Nancy 1101 186, 175 drama 102, 103 Duckett, Sandra 191 145, 167 DUNCAN, LAURA 1121 19, 40, 97, 198, 220 DUNCAN, LYNDA112131, 40, 97, 148, 193, 198 DUNCAN, LYNN 1121 56, 50, 53, 72, 73, 86, 87, 193, 198, 211 Dunn, Mike 11 11 141, 187 Duplissey, Robbyn1101 175 Durbin, Delinda1111187,193 Durko, Robert 110140, 96, 175 Duvall, Keith 1111 18,31, 71, 75, 116, 187,193 Duvall, Mrs. Peggy 139, 161 Dwyer, Mellissa1101175 Dyess, Charles 11 11 4, 187 Dyess, James 191 55, 167 EARL, KATHY 1121 136, 137, 192,198 Edmondson, Quata 11 11 187 Elkins, Anita 191 167 Elkins, Carol 191 175 ELKINS, PAULA1121198 Eller, Terri 11 1165, 73, 97, 118, 187 Ellis, LeeAnn 110129, 40, 41, 96, 175 Ellis, Tracy 191 65, 167 Ellsworth, Sharon 191 76, 167 ENDSLEY, PAM 1121 5, 38, 56, 57, 63, 86, 87, 198 English 5, 90, 112, 113, 146, 182, 183 Escalante, Susie 1101 59, 175 Ethetton, Mike 1101 54, 175 ETHETTON, PAM 112145, 198, 217, 223 Eubanks, Kimberly 1101 175 Evans, Linda 111140, 92, 97, 98, 187 fff Falk, DeeDee 11014, 65, 76, 176 FARLEY, KYLE 1121 66, 69, 85, 88, 198 Famik, Don 19140, 96, 167 Faudree, Chuck 11 11 6, 187 Featherston, Barry 11 11 38, 51, 84, 187 Fene, Colleen 110165, 76, 176 FHA 134, 135 FISHER, SHIRLEY 1121 31, 33,116,117, 128,147,198 FITCH, KATRINA 1121 30, 31, 40, 61, 99,148,199 flag corps 5, 41 Flint, Mrs. Isabel 159 Flores, Felix 1101 176 FLORES, lSABEL1121 199 football 2, 3, 38, 48-55, 86, 150 Fotenot, Pat 191 167 Fothergill, Mr. Velden 161 Fouts, Kelvin 1101 104, 176 Fowler, Dan 191 168 Fox, Frank 191 55, 123, 167 Franks, Glen 1101 176 FRANKS, PHILIP 1121 2, 8,16, 24, 25, 76, 106, 199 Frasier, Mrs. Alic 161 Frasier Frasier, Frasier, 1 Karen111160, 186,192 Karen 111160, 187,192 Tim 19140, 77, 97, 168, 172 French, Mrs. Eugenia 24, 94 FRISBIE, RICK 1121 32, 50-53, 66, 69, 88, 199 Frittz, Mr. Gene 153 FRITTZ, MARK 1121 108, 112, 199, 212 213 Frittz, Steve 1101 176 FTA 136, 137, 184 888 Gaines, John 191 168 Gallop, Mike 11 11 98, 187 Galloway, David 11 11 187 GARCIA, ANITA1121139,199 Garcia, Esther 11 11 119, 142, 187 Garcia, Larry 11 11 187, 220 GARNER, CHERYL112140, 97, 193, 199 Garner, Lori 1101 5, 40, 97, 176 Garrett, G. W. 191 168 Garrett, Loraine 1101 146, 176 index X 255 of quita, , 4 , JOHN BAILEY CHECKS the contents of his work. 256 X index :Mc gf' ,Az , me ,pr I ,V,A: Garrison, Rodney 11 11 51, 187 Gathings, Phillip 191 94, 168 George, Tammie191 168 George, Terry 1101 176 Glass, Mrs. Vicki 11, 161 Glossup, Teresa 1101 176 Godbey, Vance 87 golf 84, 85 Good, Judy11111,187 Good, Rudy 191 77, 168 Goodwin, Patty 191 168 Goodwin, Scott 191 77, 168 GOODWIN, TINA 1121 139, 199 Gore, Tyler 11 11 141, 187 GOREE, VANCE 1121 198, 225 Graves, Angie 191 135, 168 Graves, Mrs. Janet 158, 159 Gray, Chris 191 70, 166, 168 Green, Alicia 1101 176 GREEN, DENELLE1121134, 200 Green, Jarrett 11 11 187 Green, Kenny 11 11 1, 18, 24, 187 Green, Marshall 110140, 70, 71, 77, 97, 176 Green, Shelly 1101 142, 176 GREENHILL, MIKE 1121 140, 200 Greenwood, Kerry1101 176 Gregory, Mrs. Barbara 118, 119, 131, 162 Griffin, Billy 191 77, 168 GRIMES, KELLY 1121 142, 200 Grinnell, Cindy 11 11 187 Grinnell, Vincent 1101 176 Guajardo, Victor 11 11 79, 80, 140 Guidry, Kenneth 19155, 77, 168 Guidry, Kim 11 11 31, 56, so, 61, ss, 72, 73,86, 114, 148,187, 191,193 Guirey, Mare111140, 41, 97,187 GUYER, MELINDA1121200, 201 hhh Haley, Jill 1101 176 Halford, Sheri 110140, 96, 176 Hall, Mrs. Barbara 126, 162 Hall, Karen 191 58, 59, 65, 76, 121, 168 Hall, Keith 191 55, 168 Hall, Shell 191 168 HALL, SONJA1121 17, 40, 106, 193, 200, 225 Hall, Tina 1101 24, 94, 104, 106, 176 Hallmark, Mike 11 11 187 Hardin, Gia 110120, 24, 40, 45, 176 Hargrave, Dr. Jim 153 HARGRAVE, JON 1121 50-53, 78-80, 200, 214 Harkin, Debbie 110140, 176 Harper, Tim 11 11 24, 40, 97, 98, 188 Harris, Kelly 11 1140, 97, 98, 100, 188 Harris, Mrs. Mary 32, 126, 162 Hams, Mike1101 176 Harris, Tracy 1101 176 Harvey, Missy 1101 76, 122, 135 HARWELL, PAMELA 1121 14, 30, 31, 116,136,137,184,200 Haskell, Patricia 11 11 58, 59, 118, 188 Hastings, Bobby 11 11 41, 188 HATFIELD, TERl1121 14, 21, 40, 46, 47, 56, 106,116,117, 151, 200 Hatton, Gaye 191 168 Hausner, John 19130, 31, 55, 110, 168, 170,173 HAUSNER, LARRY 1121 38, so-53, 78- 81, ae, 87, 88, zoo Hawkins, Joel 110138, 54, 71, 77, 176 Hay, Patty 191 168 Hayes, Randy 1101 54, 77, 176 Haynie, Donna 19140, 96, 168 Hazelton, Willie 191 168 Heald, Terry 11 11 140, 188 Heisey, Mark 1101 145, 176 Henderson, Mrs. Janet 31, 32, 136, 137 162,219 Henderson, Vivian 19194, 169 Hendsley, Eric 110196, 98, 176 Henson, Becky 191 168 Henson, Joey 11 11 188 Herrera, Diane 11 11 139, 188 Herrera, lrene1101 176 Hernandez, Linda 1101 176 HERRON, CINDY 1121 201 Herweg, Jim 11 11 188 Herweg, John 1101 82, 176 Hewlett, Mark 11 11 40, 97, 188 Hill, Denise 191 168 Hinchcliff, Debbie 191 168 Hines, Chris 1101 91, 176 HINES, JOHN 112140, 97, 201 Hill, Mr. Bill 87 Hix, Charles 19140, 91 , 96, 168 Hix, Pam 11116, 31,40, 97, 98,188, 191,192 Holcomb, Amy 19140, 97, 168 HOLCOMB, RICHARD 1121 144, 201 HOLDEN, CHARLES 1121 12, 144, 201 HOLDER, JACKY1121201 Holland, Byron 11 11 188 Holmes, Kelli 191 168 Holt, .loLynn 191 168 Holt, Ronnie 11 11 188 homecoming 3, 20-23 Hopkins, Mr. Kenneth 153 Hopkins, Mark 191 168 Horn, Mrs. Betty 152 Hornell, Artie 11 1124, 79, 188, 190 HORNELL, RONI112120, 22, 60, 61 , 86, 135,193, 201 HowAno, STACY1121 3, 19-22, 40, 44, 45, 139, 201 Howdy Assembly 9, 151 Huckabee, Kim 191 135, 168 Hudson, Kim 19138, 59, 65, 76, 168 Hudson, Mickie110140, 176 HUFF, DEBRA 1121 135, 21 Huff, Jeanie 191 135, 168 Hughes, Lynn 19165, 169 Hughes, Victor 1101 176 HUNT, LOWRY112150-53, 79, 80, 201 Hunt, Randall 191 169 111 Ingram, Mrs. Judy 162 INGRAM, LAURlE112151, 56, 60, 61, 127, 202 Irwin, Darrell 1111 141, 188 Ivy, Mr. James 50, 51 , 162 111 Jacobs, Denise 191 94, 169 Jacobs, Leslie 1101 176 Jarrett, Patty 1101 177 Jaso, Angie 1101 177 Jenkins, Carol 19146, 96, 169 Jennings, Chris 11 11 51 , 188 Jerabek, Chris 11 11 51, 188 Jerabek, Gina 11 11 188 Jimenez Johnson Johnson Johnson 1 81 , Edward 191 97, 169 Johnson, Angie 191 169 , Becky 1101 24, 94, 177 , Mr. Charles 141, 162 Johnson, Greg 11 11 75, 188 , Mark 1101 54, 71,175,177, Jones, MARC 112140, 97,202 Jones, R icky 11 11 188 Jong3WaIter19190, 132, 133, 145, 1 journalism 116, 117, 184 JULIANO, JERRY 1121 202 Juliano, Terry 11 11 40, 188 Jumper, Jumper, Jumper, Carol 191 169 Darla 1101 177 Debra 11 11 36, 126, 1 kkk KAMP, MARK 1121 141, 201 KAPADIA, DARSHAN1121 193, 202, 203, 21 1 Kapadia, Trupti1101 177 KARL, ALLEN 1121202 Karl, Ch eryI1101177 Karsk, Michella1111 106, 107, 188 Keen, Tony 191 40, 96, 169 Keils, Susan 191 169 88 kann, Mr. Layton 3, 8, 97, 98, 101, 185, 162 Keller, Marc 191 169 Keller, Marcus 1101 116, 177 Kelley, Terry 1101 177 Kelly, Bi Kendall, Kendall, 11ie19194, 169 April 1111 188 Elizebeth191 169 Kennedy, Kathy 11 11 64, 65, 7 Kem, Barrie 191 59, 169 KERN, TRACY 1121 202 Kersey, Maureen 11 11 188 Kesling, 1 93 2, 73, 188 Kersten, Jerry 191 169 Andy 11 11 54, 75, 146, 188, index f 257 AMERICAN HISTORY REPORTS were fairly common for freshmen. 258 I index Kidder, Charles 193 169 Kimberling, Lisa 193 169 Kimberling, Mark 11 13 188 Kincaid, Kenny 19340, 169 Kincaid, Mr. Richard 3, 96, 100, 162 King, Paige 193 169 King, Mrs. Sheen 157 Kivela, Terry 110340, 98, 177 Knight, BiILy 11 13 24, 40, 97, 98, 111 Knight, Mary 19394, 169 KNOWLES, TIM 1123 28, 142, 202 Koterba, Kim 11 13 24, 28, 102, 103, 104,106,107,114,180 Kratochvil, Alben 193 169 Knusezn, noasnr 112340, 41, 43, 97, 101, 202 Kurger, Terri 11035, 177 Kunze, Bryan 11 13 188 Lacy, Chris 193 145, 169 Lacy, Tracy 193 169 Landes, Justin 1123 10, 148, 192, 203, 211, 223, 225, 227 Lane, Mary 193 169 LANG, DON 1123 141, 203, 204, 205, 214 Lanier, Mr. Larry 50, 51, 162 Langdale, Steve 11 1340 Laserna, Alan 19371, 77, 122, 169 Laserna, Judy 193 122, 169 LASERNA, SANDRA 1123 115,122, 146, 149, 193, 203 Laseter, Teresa 1103 177 Laseter, Terry 1103 177 Latshaw, Becky 1103 59, 65, 136, 137, 177 Lauderbach, Sheila 1103 24, 25, 40, 45, 177 Lawler, Gary 1123 203 Lawson, Jimmy 11 13 188 Leach, Mr. Mike 28, 155, 220 Ledyard, Mark 11 13 51, 75, 84,188 Lee, Jeff 193 127, 169 Lee, Jonathon 19382, 83, 86, 146, 169 LEE, KIM 1123 20, 22, 60, 138, 139, 147 182, 203, 212, 213, 227 Lee, Kirk 11 13 188 LeJeune, Ronnie 11 13 33, 51, 80, 188 LeJeune, Sherie191 29, 40, 96, 135, 169 Lenamon, Katrina 19140, 97, 169 Leonard, Mrs. Joan 163, 215 library 110, 111, 146 Lightner, Mrs. Ruth 159 Lilly, Mrs. Barbra 157 LINDSEY, DOYLE1121 134, 203 Lindsey, Todd 1101 177 Lindsey, Willie 191 77, 169 Loftin, Johnny 1101 54, 82, 177 LOFTIN, ROBERT 1121 48, 50-53, 203 Logiglgst, David 19140, 55, 77, 97, 121, LOTT, JAMES 11213, 78-80, 120, 193, 203 LOVE, SHANNA1121 139, 146, 203 Lucas, Mrs. Sylvia 120, 163 Luther, Sandy 1101 177 Lyons, Diane 19140, 96, 169 MABRA, BECKY112145, 137, 204 Mabra, Beverly 1101 177 Mabra, Dennis 1101 177 Mabra, Mistie 191 169 Magnuson, Cindy 1101 177 Magnuson, Sandra 11 11 189 Mgzscihi, Lisa 11 1124, 102, 114, 189, MANN, STEVE 1121 204 Mann, Victor 1101 133, 140, 141, 177 Manous, Jimmie 10 82, 83, 170 MARTIN, DAN 112121, 31,116,117, 184,192, 204, 211, 214, 220 Martin, Doug 110197, 98, 177 MARTIN, PAGEL 112140, 97, 98, 99, 204 Martin, Mrs. Sue 6, 86, 130, 134, 163 Martinez, Norma 19140, 97, 98, 170 Marx, Cissy191 170 Massengale, Mrs. Nancy 153 Math 122,123, 149 Matthews, Debbie 1101 177 Mauldin, Lori 1101 177 McClendon, Cindy 1101 177 McClendon, Mike 1101 177 McClure, Todd 11 11 51, 189 McConathy, Mike 191 30, 31, 170 McCord, Cheryl 1101 177 McCubbin, Candi 1101 177 McDonald, Melody 1101 5, 6, 8, 40, 97, 123, 1 35, 1 77 McELWRATH, BILLY 1121204 McMicken, James 11 01 177 McMillan, Brenda 11 11 138, 139, 189 McMillan, Mary 191 59, 170 Medford, David 191 77, 170 Medina, Annette 11 11 189 Medina, Jorge 191 55, 77, 170 Melton, Sherri 11 11 189 Mendoza, Pam 19140, 96, 170 Miffleton, Charles 191 170 MIKESKA, DEBBIE 1121 135, 204 MILLER, BRYAN 1121 16, 79, 80, 128, 204 MILLER, DARREN1121204 Miller, Tracy 191 170 MILLION, KYLE 11 21 130, 204 Mills, David 1101 5, 133, 177 Mitchell, Geri 110140, 94, 97, 177 Mitchell, Mr. Jim 163 Mitchell, Randall 11 1140, 96, 97, 98, 189 Mitchell, Todd 11 11 134, 189 Minshew, Paul 1101 54, 177 Mims, Danny 11 O1 177 Mixon, Marion 191 170 Mixon, Ricky 11 11 142, 189 Moncrief, Mark 11 11 51, 75, 189 Moncrief, Mike 11 11 17, 51, 189 Molrggomery, Delmar 11 O1 69, 75, 142, Moore, Candy 19194, 170 Moore, Cindy 11 1194, 189 MOORE, DARLA112197, 205 Moore, Doug 1101 77, 178 Moore, Ed1111189 Moore, Ernest 11 11 18, 79, 189 Moore, Gerald 191 170 Moore, Jacky 191 76, 170 Moore, Sonja 11015, 19, 30, 31, 36, 47, 56, 57, 60, 62, 73, 86, 87, 146, 149, 178 MOORE, TIM 1121205 Moreno, Leo 191 70, 71, 170 Morgan, Danny 11 11 189 Morris, Chris 191 170 Morris, Cindy 11 O1 114, 135, 178 Morris, Holly 191 170 Morris, Robby 1101 178 Morris, Skipper 1101 24, 178 MORROW, EDDIE 1121 205 Mr. and Miss CHS 212, 213 Mullen, David 11 11 189 Mullen, Mark 11 11 140 Mlalgeg, Mrs. Diane 6, 87, 129, 131, 142 Murphy, Cindy 1101 178 Murphy, John 111124, 94, 104, 149, 189 MURPHY, LISA 1121 40, 41, 97, 112, 205 Murphy, Scott 1101 55, 77, 125, 178 Murphy, Sheila 11 11 189 Murphy, Tammy 11 11 144 Murray, Mr. Willard 4, 152 Music 92, 93 Myers, Cathryn 1101 76, 178 Myers, Doug 111171,79, 116,117, 189 Mvzns, RAE 1121 205 National Honor Society 147, 149, 182, 192-193 Neagle, Dwayne 11 1166-69, 78-80, 87, 88, 189 Neal, Nathan 191 170 NEAL, VALERlE1121 112, 148, 205 New, Mrs. Lavava 159 New, Sarah 11 11 134, 189 Newman, Don 1101 54, 178 NEWMAN, VALERlE11214O, 97, 137, 205 Nix, Susan 19140, 97, 170 Nix, Tony1111142,147, 188,189, 193 Norcross, James 11 11 189 Norman, Hal 1101 178 OOO OEA 138, 139 Oklahoma! 8, 24, 25, 102, 151, 228 Olson, Diane 191 170 Olson, Philip 11 11 141, 189 Orr, Chrys1111 134, 189 index X 259 LISA WILKS SITS in the cafeteria on All Hallow's Eve. 260 X index ORR, CORlNNE112130, 31,192, 205 Orr, Zane 191 170 Osmun, Jeff 191 55, 170 Osmun, Sheri 1111 59, 65, 72, 73, 108, 189, 221 PPP Park, Tim 19140, 55, 96,111,151,170 Parker, Greg 1101 178 Parker, LaDonna 19140, 96, 170 Parker, Leslie 11 1140, 45, 189 PARKER, RANDY 1121 205 Parks, Mr. Dallas 153 Parks, DeAnne 1101 142, 178 PARKS, KIMBERLY 1121 148, 206, 214, 221 PARKS, KIRK 1121 50, 51,142, 143, 206, 216 Peacock, Jimmy111171,189 Peacock, Mike 19196, 170 Pedigo, Tommy 191 55, 77, 170 Pedroza, Joe 1101 178 pep rallies 2, 9,16-19,151 Perez, Alben 11 11 12, 51, 75, se, 87, 1a9,191 Perez, Tim 19140, 96, 170 Perkins, Renee 191 170 Pervere, Diane 1101 108, 178 Pervere, Douglas 191 170 Peterson, Linda 11 118, 24, 25, 30, 31 , 40, 45,138,139,189 Petty, Ed 191 77, 90, 132, 133, 170 PIERCE, RANEL1121 107, 206 PIERCE, ROBIN 1121206 Pillars, Mr. Larry 78 Plan A 157 Pohoreske, Bre11191 170 Pnhggeske, Jeff 11 11 69, 79, 145, 147, Poirier, Jenny 11 11 189 Pool, Mike 11 1140, 97,198,189 Porter, Mrs. Ann 157 Porter, Sharon 110159, 65, 72, 73, 178 Pounds, Keith 191 170 Powell, Charles 1101 133, 178 Poyner, Kelli 19130, 31,171,173 Poynter, Marilyn 191 24, 25, 94, 104, 171 , 228 Poynter, Mrs. Nancy 24, 102, 104, 106, 163, 228 Poynter, Dr. Sidney 152, 153 Prado, Alberto 191 171 Presley, Norma 191 96, 171 Presley, Norman 110140, 96, 178 Presley, Rick 14, 15, 36, 37 pre-vocations 90, 132, 133 Price, Markeddah1111 125, 189 Price, Wade 191 40, 97, 171 Priester, Jerry 1101 190 Pritchett, Jeaninne1111 1, 190 prom 21 8-221 Pruitt, Scott1101 54, 71, 77, 178 Purdy, Brenda 1101 59, 73, 178 Pyeatt, Mrs. LeeAnn 9, 24, 31, 90, 108, 131, 163, 182, 228 Pyeatt, Mr. Tommy 121 ITI' Raines, Don 1101 96, 98, 178 nmues, Mike 112140, 94, 95, 97, 99, 1oo, 206, 214 RAMBO, GRIFF112117, 48-53, 86, 87, 90,104-107,108, 109,146, 150, 206, 215, 217 Ramos, Fred 11 118, 144, 190 Ranch Day 32-35 Randolph, Scott 11 11 144, 190 Ratliff, Jeff 1101 149, 178 Ratliff, John 11 11 124, 190 nAuLERsoN, MIKE 1121 69, 116, 117, 127,192, 206, 214, 229 Reasons, Gary 11 11 33, 51, 66, 69, 75, 80, 81, 87, 88, 150, 190 Redding, Leslye 11 1140, 97, 98, 99, 190 Reed, Terrie 1101 178 Reese, Lisa 191 59, 65, 76, 171, 173 Reese, Melanie 11 11 59, 64, 65, 190 Reid, Christi 19140, 171 Reid, Tammy 191 94, 171 Reilly, Karen 1101 178 Renfro, Lisa1111116,117,190 RENTZELL, CHERYL1121 139, 206 Rhodes, Mike 191 40, 96, 171 Rice, Kelly 191 58, 59, 65, 76, 177 Richardson, Paige 11 11 24, 94, 190 Reitzer, Renee 1101 19, 40, 45, 178 Riney, Belinda 11 1176, 130, 190 Riney, Joseph 191 102, 103, 104, 171 Roark, Bobette1101 5, 178 ROARK, JACKIE 1121 19, 40, 44, 45, 139, 206 Robison, Don 1101 178 Robin GoodfeIIow 102, 104, 105, 183 Robinson, Teresa 1101 40, 45, 94, 178 Rollins, Mrs. Cecelia 133, 163 Rose, Mike 11 11 190 Rosta, Jane 1101 107, 178 Rosta, John 11 11 190 Rotenberry, Kenny 1101 178 Rofgraberry, Tommy 11 11 51, 53, 79, 80, Rowland, Sherry 11 1140, 96, 135, 190 Rowland, Tina 110140, 41, 96, 178 Royal, Jerry 11 11 33, 51,190 RUCKHARDT, CARLENE1121139, 207 SSS Safety Council 30, 184, 185 Saint, PauI1111106, 107,190 Salas, Renee191 171 Samberson, Zonya 110140, 97, 98, 178 Sandridge, Wayne 1101 54, 178 Saylors, Beverly 1101 142, 178 Scott, Laura 11 11 119, 190 SECCHIO, CHARLES 11 21 128, 193, 207 Secchio, Tammy 191 171 Secchio, Troy 1101 17, 54, 71, 77, 178 Sefcik, Kelei 110146, 47, 58, 59, 64, 65, 149, 172 Sefcik, Mr. Ray 17, 18, 50, 51, 87, 89, 163 Senior Sepctacular 214-217, 227 Senior trip 222, 223 Shackleford, Mrs. Debbie 163 SHIRLEY, CLAY 1121 50-53, 74, 87, 75, 130, 207, 214 Shirley, Julie 1101 179 shop 124, 125 Short, Tricia 1101 179 Shunkey, James 191 40, 96, 171 Shutter, Tamara 11 11 6, 20, 23, 40, 42, 45, 186, 190 Shutter, Vicki 19140, 171 Simon, Brigitta1101 5, 40, 45, 137, 179, 180 SIMON, KATHY 1121 40, 45, 129, 207, 214 Slack, Bart 1101 40, 54, 77, 97, 154 Slack, Raymond 191 171 Slack, Sharon 1101 76, 179 Sladnovik, Jeff 191 55, 177 Sladnovik, Tammie1101 136, 137, 179 Sloan, Sharon 191 125, 171 Smades, Jules 191 171 SMITH, CHERYL1121207 Smith, Mrs. Cheryl 164 Smith, Danny 191 55, 171 SMITH, GARY 1121 104-107, 108, 182, 207, 221, 22a Smith, Gwen 1101 59, 64, 65, 73, 1 16, 179 SMITH, LARRY 1121 24, 25, 106, 109, 134, 206, 207, 214, 219 Smith, Larry 11 11 190 Smith, Lori 110124, 30, 31, 104, 179 Smith, Marci 11 11 135, 190 Smith, Melanie 110197, 98, 137 Smith, Rianna191 171 SMITH, ROBIN 1121 141, 207 Smith, Sharon 191 171 Smith, Sonja 1101 179 Smithee, R0ry1111 140 Snapp, Kris 11 11 56, 62, 134, 190 social science 90, 91, 148, 151 Solis, Francisco 1101 179 Solomon, Mrs. Aileen 164 Soriano, Mrs. Judy 112, 116, 164 Spaeth, Betty 191 135, 171 Spanish 114, 115,146 speech, 4, 90, 91, 108, 109, 146, 182 Spells, Derek 110140, 97, 98, 179, 185 Spring Fever Week 15, 36, 37 STAILEY, KARLA112130, 31 , 56, 60-62, 1 16, 151, 207 Stanford, Eric 1101 179 STATHAM, PAM 1121 148, 208 Statham, Tricia 191 171 Steele, Mr. Robert 164 Steenbergen, Karen 11 11 59, 65, 144 Steglgens, Chuck 1101 24, 25, 103-107, Stephens, Gregory 191 94, 171 Stephens, Sharon 191 59, 65, 73, 171 index 1 261 FRESHMAN ATHLETES SOON learned to pound away at their opponents. 262 X index Stevens, Kathy 11 11 190 Stewart, Yvonne 110140, 45, 108, 179 Stoker, Mike 191 171 Stones, James 191 171 Stotts, Donna 191 171 STREATER, Rosen 112140, 41, 97, 99 208 Stribling, Mr. Danny 18, 164 Strickland, Kelly 191 135, 148, 171 Strickland, Melissa 11 1140, 45, 134, 135, 147, 190 Student Council 8, 1 1, 12, 15, 20, 30- 37, 184, 185, 229 Sulak, Julie 1101 5, 28, 30, 31, 40, 45, 121, 179, 185 Sullivan, Lisa 1101 179 Sullivan, Mike 1111 31, 75,190 Sweet, Rochelle 1101 135, 179 Swindell, Paul 1101 179 sw1No1aLL, PAuLA11212o, 22, 35, 46, 47, 139, 208 iff Tackett, Doug 1101 54, 70, 71, 179 Tackett, SheIlie111129, 90, 108, 135, 146, 190, 193 Taggan, Sherry 191 2o, 23, ss, 59, 65, 76, 170, 171 Tally, Kim1111139,190 Talon6, 8,9,10,14,116,117 Talonettes 3, 15, 17, 19, 21, 40-45, 89 182, 185 Taylor, Kenny 191 166, 171 Taylor, Mrs. Pat 159 Teague, R0bert111151, 75, 147, 190 Teague, Tommy 191 90, 132, 133, 171 tennis 82, 83 Terry, Mike 11 11 190 Terry, Tricia 19140, 97, 135, 171 Test, Mr. Harold 164 Thames, Eldon 191 172 THOMAS, JIMMY 1121 208 Thomas, Lisa 191 172 Thomas, Robin 191 172 THOMAS, nowov 1121 14, 16, 208, 215, 217 Thomas, Tracy 191 172 Thompson, Brian19140, 97, 99, 149, 174 Thompson, Julie 11 11 190 Thompson, Mark 191 172 Thornhill, Kim 1101 179 Tidwell, Danny 11 11 79, 190 Tidwell, Gary 110177, 176, 179 Tinker, Tim 11 11 190 TORREZ, JOE 1121 141, 208, 223 Torrez, Sandra 11 1140, 97-100, 190 track, 38, 72, 74, 75, 183 Trayior, Wesley 191 172 Trevino, Alma 1101 179 Trevino, Elva 110194, 179 Trenna, Beth 1101 135, 179 TRITTEN, KAREN 1121 24, 31, 56, 60, 73, 86, 192, 208, 219 TRITTEN, KATHY 1121 126, 208 Tuggle, Glen 1101 24, 54, 157, 179, 181 Tumey, David 1101 179 Truner, Martha 1101 179 TURNER, SHEILA1121139, 208 W Tyler, Miss Ann 164 1 1 L L1 L1 U ULRICH, RANDY 1121 140, 141, 209 Underwood, Loretta 19140, 97, 172 Underwood, Steve 1101 179 Up-to-Date 26-29 VVV VanNoy, David 1101 179 Van Noy, Donna 1111 139, 191 Van Noy, Edward 11 11 144, 191 Van Noy, Karen 110140, 45, 179 VAN WINKLE, RHONDA 112140, 45, 209, 215 Veach, Melanie 1101 170 Veal, Patricia 11 11 191 Velasquez, Sandra 1101 179 Venator, Ben 191 172 VICA-ICT 133, 140, 141 Villarreal, Lydia 191 172 VIP 182-185 Vocations 128-131, 147 VOIRIN, NANCY 1121 1, 5, 56, 60, 61, 62, 209, 220 Voirin, Oscar 19140, 96, 172 volleyball 3, 38, 56-59, 86, 183 VONDRA, KATHY 1121 40, 209 VRBA, KAREN 1121 127, 135, 147, 192, 209, 223 vfba, Vickie1111135,146,191 WWW Waldrep, Justin 11 11 191 Waldrip, Dee191 172 Waldrip, Sherri 1111 144, 191 WALDROP, BARRY 1121 141, 209 Waldrop, Chris 11 11 135, 191 Walker, James 11 11 141, 191 Waller, Jerry 11 11 191 Waller, Wallace 191 172 Walter, Mark 11 11 51, 191 Walter, Ricky 110194, 180 WALTERS, DONNA 1121 142, 209, 224 Wardlaw, J. D. 1111 191 Warren, Tisha 1111 191 WARREN, TONl1121 135, 148, 209 WATKINS, DEBl112145, 139, 209 Watson, Miss Susan 38, 56, 58, 60, 164 Wayland, Jimmy 191 172 Weaver, Lynette 1101 142, 180 Webb, Mark 11 11 141, 191 Weiss, D'Nette11114O, 41, 97,191 Weiss, Frank 110140, 97, 180 WELLS, CATHY1121 134, 147, 210 West, Dana 11 1140, 97, 98, 191 West, Larry 191 172 WEST, SUE ANN 1121210, 217 Westmoreland, Mr. Larry 132, 164 Wheeler, Hoss 1101 188 Wheeler, Ralph 19194, 173 Whelen, Mrs. Barbara 159 Whilhelm, David 19140, 97 Whitbeck, Cindy 191 173 Whitbeck, Terry 11 11 191 WHITE, JAY 112140, 210 White, Mrs. Ronna 135, 164 WHITLEY, LISA 1121 210 Whitley, Valerie 1101 58, 59, 179 WILKS, LISA 1121 30, 31, 82,116, 210 Williams, Mrs. JoAnn 165 WILLIAMS, STEVE 1121 210 Williams, Susan 1101 180 Wilshire, Joy 1101 5, 24, 76, 94, 146, 149, 180, 181 Wilshire, Tom 111140, 96, 191 WILSON, DARRELL 1121 4, 108, 211 WILSON, DONALD 1121 16, 211, 216 Wilson, Gary 191 173 Wilson, Jeff 1101 WILSON, KERRY 1121 24, 40, 93, 97, 98, 208, 209, 21 1 Wilson, Paula 191 113, 125, 173 Wingo, Kevin 19140, 96, 173 Woerner, Jeff 11 11 140 woemer, Sherry 11 11 1 1, 59, 65, 72, 73, as,11o,1s3,1s9,191 wo1v1AcK, SHELLY 112140, 45, 137, 139,210 WOOD, RUSSELL 11 21 211 Woodby, Dale 191 55, 77, 173 Woods, Robie1101 180 Woodworth, Allen 11 11 140, 191 Woodworth, Christi 19140, 173 Wooly, Liz 1101 132, 1-80 Worrell, Bobby 11 11 24, 292 Worrell, Lisa 191 113, 173 Wright, Dana 1111 191 WRIGHT, JESSE 1121 21 1, 216 Wright, Scott 19140, 43, 55, 96, 173 Wright, Rhonda 11 11 139, 191 Wyatt, Lynette 191 173 YYY Yarger, Don 191 55, 77, 173 Yarger, Mike 191 55, 77, 135, 173 YBARRA, GARY 1121 194, 195, 211, 223 Yerigan, Scott 1101 40, 97, 98, 180 Zamboni, Lisa 191 173 Zubia, Alex 191 173 Zubia, Monica 1101 58, 59, 180 index X 263 Autographs COLOPHON The 1979 Talon was printed using the offset lithography process by the Taylor Publishing Com- pany of Dallas, Texas. Mr. David Dixon was the com- pany representative. Approximately 3500 frames of black and white film were shot by student photographers for use by the Talon. The senior portraits, prom, club, home- coming, and commencement pictures were taken by photographers from Marcel's Studio of Fort Worth, Texas. Two photographs on page 159 were taken by Mr. Pete Kendall of the Cleburne Times-Review of Cleburne, Texas. Underclassmen portraits were taken by Delmar Studio. Film was processed and prints made by Talon staff members Mike Flauler- son and Dan Martin. Artwork in the advertising sec- tion was done by Mr. Jim Mitchell's art students Leo Arrizola and Daniel Cummins. All body copy in the book was set in 8, 10, and 12 point News Gothic. All captions were set in 6 and 8 point News Gothic. Main titles were hand-set by staff using Zipatone transfer lettering in Avant Garde. Headlines were set in 18 and 24 point Pala- tino. The staff-designed cover was silk screened. The fabric was black vinyl, and the applied color was 381 Silver. The opening section spot color was 381 Silver. Other spot colors were various screens of it 1 Black. The 264 page book was printed on 70 pound enamel paper. The press run was 650. All copy in the book was written by staff members with the bulk edited or written by copy editor Jana Carroll. The Talon is a member of the Texas lnterscholas- tic League Press Conference, University of Texas, Austin, Texas. I X I 'I' ,ga 1 . fix A f A special good-bye to Mr. Don Daniel who at the end ofthe year resigned his position as principal to become assistant superintendent with the school district. He pushed us to achieve the best that was in us but kept us still the same. Teri Hatfield John Hines Talon editors