Chapel Hill High School - Bulldog Yearbook (Tyler, TX)

Text from Pages 1 - 176 of the 1987 volume:

SHIFTING GEAR5 - . -D P X lk 05:2 -... ., 5 an, ns. Q 0 a .1 of Q . 1. .1-',.o.n .- .,':.A 1 i v. D., x 'Q an V IC I OO OWBYU 8 DTOFDISIFIQ fUtUI'6 AMS. Seniors Robin Hall, Sherrie G new S HMM Z K I W ,, ,li , N y L, 5 E -mrs'-f 2 S S s 1 Y X 2 . 1 w H A 'ffl V tl LAW ' 5 S A ,b., -1: wx, at p sf' f Q, 'Tig' iz.. f 'V V -x w ' 2 , f N ,X v X S APN, . ,MM QL Q A -- I Q . W, A Q nz 54 ., f ig! 45 Q . f X L iff H I, ? 8 5 -Sf 4-'W VHS ,Q , W Z, X 25 we L M , x H K 'T Sh'ff'ng GGCIFS I nfs? 5 Adzfwl' W b Mfvkiiiif fi GH Rt. 7 Box 34 Tyler, Texas M 75707 L l214j 566-3141 , N, K' V, .W,,wY-Wk isa ' fic , Q Q7 My V 353 ' ,M 'f 124 Afguijjx ,K , ig? K K jgk ww rv A1 wfn ,, Q M.: '25 ff , in 'W 155' ,wif A- K wwf-AFM fy? 22: -'vs - ak ., A k xii ,,sW?5?i32 hw- .q ,fn 4 fx R W 'EIT M qw 3, Saw W Qi 2 FI NG ,X K in fam 2 4551 W M H E Q fwyk , ,, f:.NSM:-1:'f'-:f- f 5 N - I M Q xxx V MM kwin , Q Q4 Q M v,,A5,,,,, , M k - g wmw HE: .QQ,fuis-35fW.115zf--gggfkg-wegg f,1Ss:msSS?2i2,2173,'2 42,55 M,?w??sZ. 55?? ' 4 5 I i 7 six: 1 - 1 A . M L,',':awfs'igf -,zgggfiwf wggggff,1 . LA A Xfkii. .,.,L , -.,, A .,.,, h, - , .,:, ,L ,,,,.,, . , .. ,. f K if MQQ SQ- lisesififia ff s' '1 fSEf'fff' W'-4ii.Vi R In A W 5 pm, A ,V K M 'S 2 is wx K mx f wus . -ii H X I X565 wi , -fx, :mg IN HIGH GEAR Progress depends on positive change, growth, mov- ing ahead . . . Moving ahead a little faster depends on shifting gears to gain momentum. The district is long out of cruise control and is speeding toward the future in high gear. Shifting Gears, the 1987 yearbook's theme, represents the forward thinking and achievements gained this year, a top-notch accreditation rating, community support through Bulldog Backers and the Spiritmobile and the PTA's Open House, student support through academic and athletic gains, faculty support in meeting the challenges of TECAT and TTAS, ad- ministrative support in recognizing and rewarding achievers with the UIL Literary Appreciation Tea and the Sports Banquet. The newly-painted wall on Highway 64 symbolizes the in- creased pride and strong sense of identity with the area. Graduates of '87 may recall the year as the first to celebrate the success of combined ef- forts toward excellence. We shifted gears, took off at full speed, and nothing can stop us now. if F .if ,f 1 5 - . fcgiqw I 'Q W -, Q I, Cgiglmili .94 if ff' 1 M X ' .. 2' I IQ w. f , N Q , I ,X I STARS AND STRIPES FOREVER. Renee Hood specializes in painting the American flag on the wall. JUST A LITTLE OFF THE SIDES, PLEASE. Ron Gooch tries a new look in theatre Class. f if? f I I 1 YOU TARZAN, ME JANE. Wayne Thomas and Vicki Gray take turns swinging from a rope while painting the wall, HAVE YOU MET MY HALF-BROTHER? Steve Jackson tries experimental make-up in drama. SHIFIING 'E i R' 1 :.:ffi:2-M171 z,-14422-g'l gijflfi' 1 -Azvzl-:sllfwli-Siififgmaurwlef1932. hfgiifggif r . f 'fuwt' .1-1,6-,S , , ' V, , 1,assi-M?4s,.f1l,.M-,ff ,SwifMws?.a:MF2lw.45s1i25f:sm .,. .f fm- . , v-- N ,,.. , , .. O, ,..,,...,, , . , .. I Ml:--fff,-f.I--..Qtf.m-Wel,vf:.l,.lM..-.,,l.-'Q-.Jigga z.,.1Qslw,1f. ll. -:. - -..fi7...iWl..1fl 5 ffaffff fwiafvmfi t,,Ef2fi i 3 If fnf:s::fwfe: 1- ll at W I fwiiillfilfi,ii'9lAiib?Q:E7-5f?l5!I5h-agesl F NRRL-X. 1. - 1 ,A : - o 4 W i ' if F I I I, VJ . a . ll f ' h -I rw 3. X XAA f I I : I M .0 f ll T' 1 Nix., W X ow. X .N 1 x, v,.. 5 I I wb . .L- I nf CLEAR THE WAY. Donnie Rhodes rockets through a Jacksonville defender, BEEP BEEP. Jennifer Lee clowns around at the Halloween Carnival, THEME E an mm PARTNERS. Bonnie Brumbelow and Windy Green work on a classroom project. ies CONCENTRATION. Aaron Russell tries designing an ad for the newspaper. Wfaeam .fini kgigkygg 5 gkiv r M kyii il COOL AS USUAL . . . Chad DeVos takes mascot tryouts in stride. GIVE ME A BEAT. Amy Ripley has fun at the sock hop. SMILE! Tracey Harvey and Clay Oldham look serious at the Sadie Hawkins dance. AL X A? sruosm use Divisiow GEAR5 5 ii,..y iyyy JAlili5HsiFriNGi L'4 eiii irii 1 rsi' V 'iiy iiis Ejgghiki kkL,.. l X XX Geors X3 X X Tiff? Y if f X eq X cf, lE l X XX l lQii il i f X ll X 93 LU lg 'K LQ A XXXX X 0 . 5 ? X 7 X XXX XX 8 3 S ,X X X Q ia' A XX X XX K X5 5 X X X51 ia! S555 Y J fi. 25 59 X X X X XX XX XX 5 Y, M X XX X XX XX XX? K X XX 13 M . XXXXX XX 2 4 X 1 H A M W mix: SK S f XXMXXX EXPN S '3 f 3811 XX as 2 S S 2 Y X X Xa 2 XX L iff' X Qs S Y A ag K X F Sidi! la X f ,f:XXf is K 5 , X XX XX XX XX Xa X S X 3585 K 2 X 3 S ff -XX X X K 5 Ja Zileragt 9' X X , X XQX, X 2 S L X XXX X gi pw 3 Y 3 5' Z I s 5 5' N XX S P ' X X mf! W X X X XX 3 E XXXX XM XX X X X XX XX X X A X XX X XJ X X K X X X, XX,, X, J' iff ' X -P :'-'X' --3Y'LAr Lif:E5Qf. ..XX .X k ' 'lfi ,:iE'XX- 'U?:I55Wf?Vi5:v, X:, Ig-in :W 'CV 'L .,fv.',fk.. W 'VA -' - . . X ., X ' ' XX: XXwX:XX-Xf1Xsf2fX2?2XXfWX: XX, X X X-iff X H -1 X: X' i' iw- X- X k k V' k 1 A kf42'V1Sg,X, 'WX gr-r52N5f'X:fPf,E-7,' k Mid XXX . ' gf' k k k ' L' H'Xf5lfT'5A . V' X '5fff'- X X X .X .X ff XgQX,ss,'fXXX, 'f s'1'1X,:.- X .i ' , k X - 1 X. X . ,,,,.,... ,..,, X , - :kk,, W, ,,,k iw,,qkiwwyqwigWW K H V XXXXXXX X ' X XX,,- X-XXX X,-XXX X ' ,,.' Q' 'ff ,'h'h 'A ' ' -- X XX X XXXX XXXX 5 f XX f XXXXX 1 XXXXXXX XXXX X X A'5'::5'Wi5biW 7ii2?.5ii3VJI3Tp'IVr'1'1'JM: WA-2WW1532535ff 7'A1fW1xfxvr'QSzYlfs1'IL was mg Q ,K X! ,XAXXXXX Mew: ,X ,l:P,2f.f WM . 24 12, vi: X-aff? XX. , A , , isfff'-fffigi' Aff F 'E MSE'LlwfX45s144:Xs,ifszfewfifiif'X Xwiszifwsksfsw 1ss1'P2rf3fws:f: :wr-'ww X ffzw ' 15lw?5f:X9ffWgg, ,sr -Xm -A qAg?ugf'w.XXXX .W-A.sXX.sm f?sz1Qsgf3fggSeg5s?5fs,ena:P:Xz, 1: sf -1 an Qfffikff zvyy X X. XXX .rs W gwssiiiiiii iasawr -.1 fir? , X iff,-ing e,55,XgXXXgfK XX...Q,,AXS,,, 1 ,gg .2 5 ,sg XXXXX iw as Az 91 sg sa Q was Q 1 Xms XXXX X2 .2 ,X If X1 ::'Flb5iZff1iAi? ii 352,i!?iL5545ii5?V5?i7f5?wW'5'35f5'hiii??i .X 1 we aw- X 1 fXX1ff,sfiLmgszv X , .. . ,,,A , ,,. m,A:Y,,,L. ,Z., 2,,f,W, A i ,qZ, .X X... xy, sgX::zbX1a1:+fwWA:.Xu1f1X f- , , 5.5455-ffgfWfgzgagf A m.,,,A.,XA,,A-, pX:XmWX..qXA.5m .XX QQQQESQQWQQ .mXw,AXe,,,,X74Jf QVXMM .wwf HK 1 X X wnsw- - XX- ,pg X, gm., X,fw,,A 2wffYS+f??f???eX?Z'fX,fis3zSXSWsfvXsw.s,AfXew' flswf X mwigggwgf,g,.,,WA, .. ,,,.L.,.. , , MX 1 wi, Xwfksssv-s MXAXXLAQ we XX, XXX X,,.XX 25, g ' i- , M. s5A7gHX.,XX4.L,XXX,7XX gi, 1.455 ,XXV 5, has wa: sf' X .fps1azs224sfs1issswsiiS5f2-XfliifggiklKXXESTEXQ 5f.'i'?z2f'- 'X -- ff X,,,w,As.XX- XX -XX W ,V ,A ,ew-ww - ,Q ,,.wmyfffsqisQgg,!ZgX!5Xi5ff ?'55mMs5Xsf-liz-fwmw nf: 5, gg 5151 QA M- A ,. if-X ,X -,f.rs,A X.,,.s2,A.Q, .XXM-W mmf SMX if NX,-1. ,,AXXAst:4.zz.s'wf'Q,fs,X wwefl' it1li?222242P39522122493E'1si52Xe?'?4eQ3'rXsz1ffXs2fff2X14155575ffzafseszIfimfisgisgglieggi trim: , , , -.Myra 'sem z1,fyf,:mrgwg kwfggyig ikgzgzfgvf- ,: . ,1 f.L,,A.fA-.-fmfaftifetgiX6s95Q2ifx?XQ?4Q,,112,112W:HX-ff-iv,X..fe:XffNff1:HFAXQS ,. ,.,,., , ,, ,X X X , , ,X-M X X gm 53 XX , ,f X ',m1:' 'k1 Y ' 'Q2zfnaQ2Af5zA?XzAsf Q, ,f,,., m.,,..,,,2, ,.,,,, .yA..,,..WXi5XXXXwX25vXf5XfuzvmXaz- A, ' 'fl I' T ,I2KsIWef?sEffiQifX:5i1'ih: 51' :li 5f:X5Xu??fidk?fZ3xiLi6ffSSiZfiiE?Mlf5?2i!w fehwgxwfingfXXw,XX2XXA.?,A.gX,1f,,, .A XA ww MXMAQQX lsssaaflmlfs, .1 .As AH' f fm mmvma, ax, H K, .,., .X X--fQ,..X,.'..fX,A 2-ggy5girggi2z4Si4!Su52i29S12i22?5eE,?ill K ' - zwfsswva mXXX.2,XXXXA HQEIEIEEVZE AXmXwXX.e vfwgrszffwm wXQ,.?,X -XXX. 51,5 '51 ' s11sws.',ifiwfg:, s21s1,2,?ffv'-,if XM, 5552 ew, .swf ,..XaX,..?X, ,U xxs X X 1, sizffizeiqfssff S X .X,.XX:LX W X. up M. imma, 11, ., ,, 6 . A .,,,.., ,X i2i555??Si2?fi9wS1i-2fv11z'zmysifwzaif'IXXX-.-vixefev,IfQ4f4.-s,uwgAisss:?z.fs A:,,:fXmX,fX Was,.m.WfKX-XXV ,,, .A ..,,..X,,i ,X-3 .ga 2:sfgg?g2554e24Q2zssgggggatz.ew,31iQg '55,121,A:Kv,Aeazfw:wq2-f:e,fX5X,fa2fsfxfewwifa 9365 XQAZQQEXES -sz A' giawiswm .XQX-swinimiw QA. ,mrsw AQ X,w?iX91,AXX,Q3XL iiiifiiiffwf 5 gm1a62Xeff'?EsAf5 XXQXXXXQMXXQQJ A New :QQ,Asats4a2'4sf , .f.m2,,.f, ,A.Q,,,-Xmw.-X - XX.X,,Xf-X ,..,, .XX . - .mlhizzi L?54i5seii4222719Q1,QIZAQPXX-'Lf? 4,1,emmykgijgfggiiggigggffy-5.532 ww, -v..f,, :aww ifsussizf 22552.52 Qsszisiigsamsffsg ..,, , M 21.-,ff k' kffi 'f ' ,,., ix'-.Q 2 I 1, 1 2 -isp,5'271.5'si:fE??22iz:::fif:3' XA f- 'WRVEQZE ,zfsmw ::':X, 1-2f.X,,Afu2,.f,Ae W k:ffk:f':v.., X., .V p.mXXQ,,..Q ,XE XX -XXX.-QXA V -X All iifffiig 2'f'sff4Qs'ffXzzz z?...eXfeA.f Xrsif - -, .X,A..XWX,mmXXXXX9XXXX X- ,X M X ,, A. ,W ,AXXAM c ?2E2?5i??33y?i2 135495 ,MX Xe www: WM E A GEAPXS X,E mm .MX ,X is, 2 se YQQQ BX Xgwxw 'kgfknfge ,X ME W af XX 'il We M Q 326 11 mf' 5. P' KJ X, MX! X X X X X Ps XXXXX XX ?'X GWSUYX X0 Kwiwfl WJ' 'W X X X X Wx WSW? K X 355 Xe ,X XXX A 2 jan XXQX gs? 5 1 - 3 'IWW' 'FY 'X -15 A W 'I iLfff'.ii-Yes XX -A 1,5 ,yy '- ,' 'fwww493,QXXQXXXQAXWX-XXXX,f2f5'f..zgePXv3w,X,X.Xw5X4X5PXXA.aw, A X W- Ama, .wi .12 ..,M. .,,. . -XfamzffgngwffgwfXX:-23:41,QAXQXWXHXNE,ygftyggukvim.XAX rffffs 1 - z2,f,,Xe,AW'..,zi1w..XX4f5a1f?f5Z iziivfsvswf,ffi,As21XgXggggigkgigsgp. LY?- ff'-57 Elf-'-Tiff -' ' -wif 5-'E:'i'ii?ZiAS3fWg?i'A3v1If-XX' ig sy mu 1. 6... . I .. . . :.:saz::sxrst+wflHv -25653 6524551213iss!ass?fisJ1f55?71f335'lf'E723Wfif, 52555232.2535 iiggsiie 2.22355 955' 'fl ji IV '. .. . .....! xiii ,,,..,,, -l9i'li?i'.i?.i5i' ifilT ?5Qi1'!IiE?i!tf,sZ5!?ZZifvMy 52 gziggggxii rsggtgxiilgelggx .556-jf,5g,J5.E?m.'fi'g2ii.:Z.. 1 I1 z...5...f-it.grlmgSlS,,,1fYiZ, iE495lf'fW5, 4. .. . N.. W ry.. iw ,N ..' ff f 2- , , '35 a ' , 1 is---A sw, OFF THE WALL Chapel Hill High School . . .where's that? ls that in Tyler? An identity crisis used to plague the school district, but no longer. We've become a force to be reckoned with, and community pride is on the upswing. The wall on Highway 64 - old, ugly, and graffiti-stained - did nothing for student and community image and morale. A fresh coat of paint, 100 gallons to be exact, transformed the ugliness into a source of pride. On December 3, 1987, work on the wall was completed. Art Instructor Dave Burnett, Physics Instructor Hershal Wheat, and Drafting Instructor Tony Adams supervised the project. The P.T.A. furnished refreshments. Over 50 students participated: Dee Daly, Tara Weikel, Debbie Briery, Danice Deffebach, Heidii Youngblood, Tim Elliston, Nicole Robinson, Christy Pruitt, Shannon Hillard, Scott Wigginton, Craig Williams, Tish Watson, Stephen Morrison, Keith Rhodes, Kyle Lindsey, Bryan Scruggs, Tim Crutcher, William Elder, Trampas Bass, Camela Williams, Amy Bland, Amy Davis, Michael Barton, Tamoy Carter, Joseph Jackson, Teddy Jackson, Sean Jenkins, Kelly Johnson, Hershal Massenburge, Albert Mumphrey, Jackie Smith, Jaime Soza, Don Sudduth, Mark Edwards, Shannon Kelley, Sherrie Gray, Vicki Gray, Toby Foster, Terence Thompson, Stephanie Polley, Philena Smith, Renee Hood, Wayne Thomas, Teri Sampson, Michele North, Scott Williams, Derrick Beal, Jodie Criag, Emery Josserand, Terri Green, Keri Kelley, Joe Cano, Libby Bryner, and Kim Pruitt. lt was a learning experience in working successfully as a group. Everyone involved received a certificate of appreciation. Evidence that this year was unique is the wall that will stand as a reminder of high school years. . ,- 5 QW, .I .. . i.i.t.Qtl l ifr1fQssgssflfr?fi ifwflv Sill? 'M sigfeegvsz 5 s -V '- W?ZEff5Sli.,1gE5 Mm. :amz ,, .W t--,, ,,,ii 7. . . -2. X W.. ssiwfgmmm X Mg. .5 se.. . 1535. I . IF? , ' ' fs fl . ::.wf,.,.,,,i.,i M. .liiii Qi., . . ..... .. P35 .cz Sxs:5fdzfm.f M-.. .I f--i ...btw ,.,. fm. ,,..-,l.,..,,..a,.., .... fi f. .,. . f ,... ......t Q mammafgisifiitsw'.'f:f2t1z.'ffsz?221Jfifii'1Q1Yfwe1i:iez4as11sz7:sQ2,..vz22.. -f muff-wwsw-iw.ffzf1i...nw.1...isnww:a.ffw.ei.w.m.W....- az f . KWQN H,t...1.lM..f,,t..Q .te-tez.w.' . . f- . gms sit. s ' as if . 'f '- 'UN 959-'E5if?E.affF r7'LsffEfi3v'illiiiisii ls' 1355759 1 if 3-M215 l li! Qfzilffiiligg A ' f sf ' E. ..ems,4.1..m.,f -- fis..eva.ff fwf.7.Qws.Afs1. f ..., ,.,., Me, . 5ZZ'.AS:::.:':...:.-V -..Z:1-gtfii ' 7WMl 5? :' - EQET3 1395 sfw sw1:MviQ.iiszisizlilzfiisi effaifi. Lfsfwfss 15715.55fEQi?53Ef553:TffWEZSVZEQfizlirfliiffslwfiitZQWZQXLSZI7f'Efi?5EI5?5I4i5fi'fb12f 1525? 51591572 S 5.Mft.fwmifssefficz'wei15i7'YfZ5wsws1'15221f?WWQw?252i2Q7 ifgfi-'cf fislsws S4923 at .1 at H .Mft :wi!.M.t...f..tf-vz.w 55? 5 95 55? azffe9f.rxs. ....-...sv iafgwgwfsgeviitiwwlft 951-fir'fffzvft-avatars?S35192555225eingivgrefvzfizzw5':+-M.. 11 H WMQQMMy3,,,,,5,,,.,,,,,,,g,,,,.,,,,., .,,.. .. . H9 ,i,, .. . . isis? .iw l sw , X? '.sfs.f'm 4Sss'sel.1i WEE:5iQPZf'!fl'wiig155?3??i '25?F-575355:'iifffiiiifif?ii2i'is?1'i iifM.t,wt,l.wi Wigaiw- -- yy' - . M'-WfM.f,Q..Q9lfs..Wfgsi1s2sims zirrlzfflgi f.s1:Qm'-if W3,QMafgei4fai5i5ssir1iss!gg'1ssf1fRlY ils3wSw :fwfr 1' f f f W ,1..m..l,.. .. WQSEQEKWV 'Q mlawswsat at ms Siiisqgfsggifzfsggwgwifiasmf.. , . .1'Q.flsssfe522sssesQ4fz2 . . 54 !Wsi1se1'v4f2P-:miss wwgwanlgw ,,.5f.2zgg5zsM5.zf ,S,,Q2fg,?lg..t,i2l:::: 355 wi kT7lsfr7Z'fwl fi1..mH wet?,3,,2g.1s,,t?. we era.. NL .. MM.....M, , s-3? mmff' 55 ...... . f . .17 5 nz.. 4 132.2 ?22gf5?UW452g9lf ,M--f .. . . A:-m5!3Zi'gZ'f5'f2f5 .J .fee A ,fb1S?:f2asi1Q1..i . , , V 'fl - ff timerflwzmseisfii assesses Mhlilwiwfwd P3 9 I-1 fs fszffteezfagkaaitiwezawassz Q . t........t . ,K . . . t--,, a. .. .1 .twzvialigsfifsmmswl .. .... e..,s...,..M. .,. A... .,..Q,.,.M-1.A...t.1 Us .W A... M. .. ,,..,,.. lg.,,,,,.,,s,itsl..2,i..,t.. saslaraffiswstwsfs. w5Q.sfe.Qi2sf 3 . . . ..... ,,,. ..,..,,,..5...,,,.,g ,. ,m.m.Sk .- qw-.ii gi ..a....t....Q..z.if.W... WW.. - -.. ...t.....A we-.,Nf,,m,. . N f . . , - . trex.3zsa.2sA ff :Iwi-111'-Ifzszuzzw. swsmn- .S-.iw - .fi .wwf nw-1 fimf.-.wQ1ii2.1is.? ii will . ....,,- ?Fi?5D5SEp?3I , .. tl..lt..1lmm.4al... ffff -wr' .fy .- is .. . I ,..ail.aLmgQ1 ..,.f1......,,..,,5 .. .. . . .. .t..,...,..,,..:..,,. ,,,,, , .iit .,,,.,,,--W ..ig..a..,,... .. ,. .. mit i,i'igs2v,1gmQl:f 'fssfaeswf-s.4fxz .f -...si 2--ff mi' isa.--':zv7fz1i57:Q,v i -ff-f,f-i I- fa ...w...F... ,... i ..... .... . , S. ...vi .xi ' T15Q5fPt12?2E,6Sl,,q,5fif25ss?xsif5sgsg1fiigzffz-'s'sg..fQi, 2- f .5fffff'iiIifigfiissffsvwfws .VL st. . .msn iz ,ww fm im.,-v.1 me. ge:2.1.zf,sfsz..ffas,sffss 2,ei4.sw1sf.x1. .wff'zvs1vzf.1v149.22ifiizimrsiwsifeafszfNew.1 1. 1. - ' ' A ' -2:51-.S.?3.1i:wzs. 55::tsz::412it,:fv.: in 23:.1l:7'w.:3'f .zll K7 :u5l41Qz914?5Z'LV..-.YHA-ii.-.If:.::7'if.'l. .' H4 .. . '.n.Alzstf i.-1-2 KwmvQ4tii:st.ffQ,s?f:fresffile:asitfizgiiszzgszwfzfsgait.tszi.twi.Qzz5ii:.'wx . ' xl . 1i. :1..1,..... -f.iif .-i......l..if..-1ww.tw,..lt..mt..-..t ...,.f ...,.,f fs. -ff- VZKSZEV V F I was glad I could help promote school spirit. Tamoy Carter I12I HOW MANY MORE? Terri Green and Stephanie Polley work on the flag. STAY IN THE LINES! Toby Foster adds his V painting expertise. -L IMA-IVH-5'ff255' --5 --M M 7. ...I .Ami . X. 7 . I. .. . -, .. ., W 4, W7.,,,. . 1' .- f - f' - ff-- w'f,2'ff22 5-Ziff: ysgiafgalgigg,1.wfts5gss1z.f2zx1sn-:fz2t..vxx.-11 - f. 'fzfxisz 1:51 i . .2 1.5.1 .3 ...... I. .. ..... . .. .... ,. ., Az ,, ,Wea swf 1 3 , 2 f 2 'fiklff' ' 3, 7 .3 .f mx 22 is . .is as .tag f .yfqggg .. . fi . ,..fi...w.Qt,wy.i --lisfisw.aw..lw ...ln J I 2 a I , f l mr Xl Isl Isa fa It ltr , mm tgp 1 is L .. ,jx . .y Mfg? . STATE MASCOT. Alben Mumphrey p3lI'ltS an :l, ig, 3g 5g ,5 5 ,5iS f g -.f 7f tw k,., eswql- fs. -'i:::k' ,-..... ... mf... .f , afmadwds fines- GEAR5 75,2 EZ2.'g5?Eg535Qgg7.i55-:N-1375192'f5QT1lH,.ffH'f,'j,.Q .ffiy-1rffi-,Q 5 YV i??i?57Zs5T5Ti1IfEi''isT.Il.tSllF ' l -rf .... V sz - t...t,.....1i . f f . - 1 I? I , ' Q . , .' 1,. - idss 'fiiif , ' .- 1 1 s X if ,X ' sX ,'a'f To surpass in good qualities you must learn to work together as a team with your friends. If in sports, debate, or on the job, changes will come. I have learned how to be part of a team and make decisions for the future here at C.H.H.S. Roderick Lewis 1101 A MEETING CHALLENGES Since 1985, teachers and students have been concerned about the fairness of the exit-level test which all juniors are required by law to take. Each student has a total of four chances to pass this test which covers basic mathematics and English skills. The test itself was brought about to guarantee that no student would graduate illiterate. Teachers tried to prepare students to the best of their ability. Mrs. Dottie Roark and Mrs. Arthurlene Greer gave a TEAMS pre-test to the sophomores last spring to identify areas in which the students needed help. I try to help students prepare for TEAMS by encourag- ing them to read, read, read. Not only does reading improve their spelling, vocabulary and thinking skills, but it also can be an en- joyable exercise forthe imagination, Mrs. Roark said. The TEAMS test lets the teachers know which students need the most help. Still the cry from some students remains, It's not fair! Sophomore Tommie Pangle stated passionately, I don't think that a test should determine graduation! However, there were other students who understand the reason for the test. Sophomore Venus Welch said, I think it is fair, but I also think there should be more preparation time and more classes that specialize in basic skills. The majority of the teachers in local schools remained very en- thusiastic about TEAMS. Mathematics teacher Paula Page said, The TEAMS test is a good idea. It will encourage students to learn English and math instead of copying answers for a grade on a report card. QA Q gs M ff f -' ,I 1 wesziisezizfyzzfxs.-'I1f-1,11sg:'12,ffl:i'fsifisiis im iw lr v i ' fn ',fgjgAi5I I f 'Wiki43Lf555E??i??Fff5f3i?i7ii?i?fiH25!l2?-fiflfiiifilsiiiwfffgghiiiigiimvtzti.rs azffsmggrgsllsligefwsw:ffw2r.:?m:w:2,fw:f'f'fr2i.s?2Gssifs:lrssszsszassiesisa ?4f4sf44sf1s1fe2sifs1afe??'eff sv? 'ttisiiwiffrf till fi5'YSa2fsi?w?f fiiszsezrfww .Q W ,ssW-qw'--West,f!:2rasw-wereW - - 7 X ,W ,cams , 1 , .7 'masmsfgf 'i Mswiamszffegsawrlfiwmirfizfiffss, nz, new ,,i ssK sf f925 , GEMS ii' 5: - A 2 Z A ZIA V - Vg F 4 - E :NZ 1ie,' ins fg zrxffmf' ' 5 ., 'f21Lz1'5'.tg,QQgE'fig? ' gr -.1f,. -1 , '11, ,.,, QW 5 7 1 ' , K V ,J lv? fn' X 1 X I Y 0 I' 5 1 M ' ar ' is F T if 013+ 0 I 'Y if T 7 1 1, .s2,,.szm, fl--il, ' f Sl-HFTING - Hlfjlls- ' Zwlfift-I' L 'f'f53i:'S- Q,QjSfffl1,flisl56Y:.f7, 1 O - ' flkifl K nffi 5- ' ' 1- ,1':Swi92i'gsz,1',' fx Ja, -1.,' 3? 4 IT COMES NATURALLY. Eileen Tabb seems 10 enjoy being nerdy during Spirit Week. ARE WE COOL, OR WHAT? Michele North, Sarah Burch, Keri Johnson, Julie Hughes, Laura Currey, Kim Weaver, and Bill Davis model current fads in clothing. STRUT THAT STUFF. Chad Devos shows his style during cheerleader tryouts. i ' ' f fame W ., f V4 ,fi-,,,,. ,-,,f- x L . T -. 5 ,sf , lf , if 1 I sf WHAT WAS Hoi Big news on the scene for '87 were Guess jeans and overalls, Coca Cola sportswear, Corona and Spuds McKenzie shirts, Levi's 501 jeans. Just about anything could be worn by either guys or girls. Role models included the revival of Buckwheat from the Little Rascals and Gumby from Saturday Night Live. Their faces decorated everything from T-shirts to coffee mugs to watches. Let's not forget Vanna White, nationally-famed letter-turner and hostess of Wheel of Fortune. A computer character became the star of a TV special and even- tually got his own show. Who else but Max Headroom? The year's fashions catered to daring designs and intense solids. Silver and gold metallic shoes and giant hairbows made eye-catching coordinates. Hairstyles relied on mousse to get either a flat-top 50's look or punky spikes worn by starkers. Everything comes back in style eventually proved true this year. l T Fads and fashions don t reveal who a per- son is but they help. Teresa Stroussl11j SOCIAL AWARENESS GEARS .X . FRN., f x 591 ll Rexx . xx , Nib-rw ' Q X 'ig T Nxt I lr: I .--+1 r'?f X , - ll f X 'W'5 -D -nu..-Q. .. lv. Love trips me outl lll see two people together and they re saying they love each other then a month or two later they re hating each other severely. Every once in awhile it works out but it usually doesn t. I guess it s just hard for 17 and 18-year-olds to get a grip on.' John Charlton 112, FRIENDS FOREVER For many teenagers in high school, love and dating seem to be the center of their lives. Many others, however, are more wrapped up in academic re- quirements, athletic achievements, and career plans. Group dating, with everyone going Dutch, has replaced the kind of formal dating of another generation. What qualities are looked for in the right one? I look for someone sensitive, who loves you for what you are and lets you be yourself. He will also have to be willing to stand by you always, senior Keri Kelly said. Some were more specific. She has to have a good personality and not be taller than me. She must be willing to share in the housework and love to go rodeoing, senior Jerry Wheat said. Pzaserw. Mmux na gf s avg? aussi Q Q if fm :g-g.v.,,,.f..- Q A, .E gg, - Ty., 5.55 is tfyssfsgffsieffgrgf ,, 512 J. f ' . .tx . 7. Q.. .s...:.J..:s fl . ff E SM.: ,g4g?sMg?5?fi55E5:-5 W .--.f-.f - -we M a- ff t--- 4 .- ...-is A. lf2lp.ems.,.. ,,,s.,tffQz4fg,i5g:,fg5 l ' ' :'i's54'is.i YT1.irliliiiiSi2Z:I5'51E5 1.ll'4Z'A EEZE:'swf 3- lxggggpg sigh z sriiiiif .5H'F,.:.f li 1 Egg 5 4.4.5.3 jf f . ff 2 A eww' sw f PET ff mfs islam. no N me ' f ra X, Q, n .... , 0 M f ffyy I gf xr V 1' I , , I QS! 1 1!,g fl Angry l2 ? s ' ,f X F-X X5 , - , Q ,1W- . A gf SNUGGLING CLOSE. Tara Weikel, Ken Johnson, Kandi Crawford, and thelr dates fFlaby Hampton Mlke 7nnm, and Robert Cabreraj en joy the Sadue Hawkins Dance '-g' A wHEnE s MARRYIN sm? Teddy Jackson and Tammy wnnaker may be contemplating a future URPRISE ATTACK. Wayne Thomas sneaks up on Sharlene Jureski, A W :I Q liflsi .1 1.1 .2 . , I ' .i , V X, 0 I 3 . 1 I 'I f . ,-ll . IX ' I I 3 f A .W . Eiiifipffxiziiifigfi Q? wash 5, HI. Liliiffii' .fd SfJ5iili 51i', ' 2- , K' ,fel ie , It ,f ?, Y, 'Z . W .Q ' VXI.-lsmsv-N ws. nel GOOD MORNING, MISS JONESI Pre-school children greet senior Loiuana Jones at Candy Cane Day Care Center. DISHING IT OUT. Elizabeth Ross and Tina Mumphrey help out in the cafeteria. BLUE 81 GOLD DAY. Laura Smith, Becky Harris. Joyce Taylor, and Rhonda Bennett discuss uamm-f-.minn nlnnn rhirinn liinr-I1 I hope to enlist in the Air Force. h. I I.. I , X 1 ' WB, J 'ff l j v uitf' f mf L-Tm:y'i5' , L fr, 1' . EIGHT DAYS A WEEK Not only were high school students dedicated to improving their grades, they were motivated to begin training for careers through after-school jobs. The HECE work program, under the direction of Nan Sulser, enabled students to go to school half a day and work the other half in business. I enjoy the work program. It gives me a chance to be responsible and to make my own money to buy things. The work program lets me participate in school activities, because I get out of work early enough to do so, senior Kelly Gilliam said. Angie Bueno, who works at Dairy Queen, added, Where I work, I get off at 5 p.m. so I have time for my family and my social life. The biggest concern of most working teenagers is how it will affect their classroom grades. It is hard for the students to work and go to school at the same time. Many are deciding that the benefits outweigh the added stress from part-time work. Nakomus Elliott f9j 'nf' igg 'SBS A252 iii FI 'X 't u' ?' V' V':9if'Afi' !:Lc,N.uZfff9fFffI 1fffififfi'Ft77'st?ifii1,iiE.J''57fssWsi57iL,il?Ki'EELU 'I ,Z igfxszsggia . ,,.. , , ., .. . ,,,..., , . .,,,. 235215 ' 1 97 fiigfiijlitiiiafi -iff-J-1' 't 'u's1'fS - 7'5S5.uffj-Q :JI .I of 5 -:frefszffzmwlwz .ff :U J , - , ... If -1 'es-,gfQfz ,'is,, .,,,,f,m -3,12 654353 HOMECOMING SPIRITMOBILE: HELMET ON WHEELS As the team progressed the Spirit Mobile added spirit to the game. Kandi Crawford 1127 It was the night of October 10. Blue and gold mums spotlighted the bleachers, and loyal Bulldog fans jumped to their feet as the battle cry was sounded. lt was Homecoming of 1986-87. Mascot Amy Ripley drove the brand new Spiritmobile that led the Bulldogs out onto the field. The Spirit- mobile was made possible through the efforts of the Bulldog Backers, Arp State Bank, and Threkeld-Covington insurance. Halftime saw the crowning of Queen Sherrie Gray, escorted by Toby Foster. Last year's Queen, Cyndi Belcher, crowned her withthe help of Chris Knotts and Brandy Elliott, attendants. HOMECOMING QUEEN: Sherrie Gray with escort 'Toby Foster, is crowned Homecoming Queen. QUEEN NOMINEE: Jackie Ates and her escort, Steven McGowan. QUEEN NOMINEE: Holly Carlton and her escort, MikeMoore. E l Q rr'l, A GEARS ,,:Qe3,,,:.,,:,lgA.., Lg ,V , KT ffl . . ' .. ',wl--f'.eggfls,fg7f,fussaggfqs' we ,- tw V ' K ' -xiii' K . s ur' f QUEEN NOMINEE: Kim Weaver and her escort, Scott Williams. l MIGHTY SPIRIT MOBILE: Amy Ripley makes a path for the Bulldogs. E I QUEEN NOMINEE: Vicki Gray and her escort, Shane Rose. y I y LAST YEAR'S QUEEN: Cyndi Belcher walks on field with attendants Chris Knotts and Brandy Elliott. QUEEN NOMINEE: Kelly Gilliam and her escort, Tod Christopher. . s te ' ilQ i Qlrlit :wif i' Nc: ,QP ., xi Q if . ,- S, :Y ailt N' Q ki E Mary Mladenka Doncing on the Ceiling The floor show was a huge success due to the tremendous teamwork and effort that everyone put forth. Angela Heisler 1111 Colorful balloons and decorative costumes filled the gym for the Highlighter Floor Show under the direc- tion of Terri Knotts. Opening was the full drill team with Hooray For Hollywood, continuing with special duets, solos, officer routines and special guest Cyndi Belcher, last year's captain, ending with Dancing On the Ceiling, featuring the full drill team once again. New officers were inducted: They in- clude Amy Bland, DeAnna Gilley, Stacy Gilley, Jennie Jeter, Shelley Kyser, and Michelle Mladenka. Special awards were given to Bonnie Brumbelow, Freshman Highlighter, DeAnna Gilley, Sophomore Highlighter, Shelley Kyser, Junior Highlighter, and Keri Johnson, Senior Highlighter. Highlighter of the Year was Kim O'Nell and Director's Awards went to Stephanie Polley and Carla Barnett. The Highlighters put on a spectacular performance. IN WITH THE NEW: New officers Amy Bland, Stacy Gilley, DeAnna Gilley, Jennie Jeter, Shelley Kyser, and Michelle Mladenka, and old officers Carla Barnett, Kim O'Neil, and Stephanie Polley are recognized at the induction ceremony. - f'111fff.ws.,w. wsiimzf , i fl , i if f x rfisifif 'fififimllfliltii ASTE vs. ,I 4 1 ig ' -- V site , eigsggxlgs -,,,?,,,?t,.,, a aww.. feta, ff' - Er ,fallacy -rig? at W,f-?f:- .Q-syppgw.. --sv .. f ' F- SPRING FLING STARS Mr. and Miss C.H.H.S.: Kelly Gilliam, Sherrie Gray, David Abbott, and Mick Still. Class Favorites: Sr. Jackie Ates, Vicki Gray, Tim Elliston, Shane Rose. Jr. Beverly Simmons, Eileen Tabb, Trampas Bass, Tim Griffin. Soph. Deborah Perry, Kim Seagler, Corey Ford, Ronald Sims. Fresh. Sharmea Johnson, Toni Poeschl, Kendrick Price, James Reed. Beauty and Handsome: Sr. Kelly Gilliam, Vicki Gray, Toby Foster, Steven McGowan. Jr. Kim Pruitt, Kimmie Swan, Sean Seelbach, Rusty Tate. Soph. Daphne Moore, Kim Seagler, Jason Broome, George Greer. Fresh. Jennifer Lee, Toni Poeschl, Todd Emmons, Alandus Matthews. NOMINEESJ FAVORITES BEAUTY AND HANDSOME MR. and MISS C.H.H.S.: Vicky Gray and Toby Foster SOPH: Debbie Briery and Mark Crutchfield SR: Lojuana Jones and Scotty Green JR1 Stacey Florence and Adrian Walker SOPH: Deanna Gilley and Gary Rayson FRESH: Windy Green and Robert Wallace ,,,, l. . F .I ' 't.t 20 FRESH: Tiffany Chastain and Craig Bass l l l MOST ATHLETIC Michele North and Mick Still WITTIEST Laura Currey and John Charlton Jr: tNot Pictured: Stephanie Ftettigl and Trampas Bass T ALL AROUND - Ftobin Hall and Mick Still Jr: Karen Kennedy and Adrian Walker MOST COURTEOUS Lojuana Jones and Tod Byrd MOST LIKELY TO SUCCEED Tracy Watson and Mick Still Soph.' Deborah Perry and Cecil Ford Soph: Debbie Briery and Corey Ford NOMINEES: MOST SCHOOL SPIRIT: Sarah Burch, Ftobin Hall, John Charlton, Willie Reed. MOST ATHLETIC: Kelly Gilliam, Amy Mosley, David Abbott, Dessie Ford. MOST COURTEOUS: Kandi Crawford, Kishl Loughmiller, Toby Foster, Steve Jackson. BEST DRESSED: Lanecha Thomp- son, Kim Weaver, David Abbott, Toby Foster, Steve McGowan, Lane Thnnvv- WITTIEST: Jackie Ates, Danice Def- febach, Farrell Pinke, Lane Thomas. MOST LIKELY TO SUCCEED: Danice Deffebach, Terri Green, Tim Elliston, Elbert Pruitt. FHIENDLIEST: Sr. Danice Def- febach, Keri Johnson, Joseph Cano, Scotty Green. Jr. Stacey Florence, Kim Pruitt, Tim Griffin, Rusty Tate. Soph. Amy Chastain, Deanna Gilley, Kelly Cross, Mark Crutchfield. Fresh. Toni Poeschl, Keysla Square, Tammy Whitaker, Timothy Garner, Alandus Matthews, Quaid Thomas. BEST-ALL-AROUND: Sr. Kelly Gilliam, Vicki Gray, Toby Foster, Shane Rose. Jr. Stacey Florence, Eileen Tabb, Trampas Bass, Ftusty Tate, Chad DeVos. Soph. Kim Seagler, Adrienne Welch, Ftobert Parnell, Bryan Scruggs, Fresh. Tif- fany Chastain, Sharmea Johnson, Craig Bass, Alandus Matthews. Fresh: Tiffany Chastain and Craig Bass Fresh: lNot Pictured: Toni Poeschli and Laq- gett Gipson if at . ,, ,,,,.,,. , ,... Wt, ,,. ,, -i ff f ix ,,..,, .,,,,,,,m, , I t . ,- mam, I 7- I ft, flat- LM-It ff,.7..f,.a-Q2VI.Q7H-W1 -t swf' twteztsizltf - , ,wmaafeiz-1 I., - U. semzli:-,ff - fisisfgigiif 5: . , -'ffiififfiifii K' gi , 2 f MIDNIGHT MASQUERADE 0 ,'1.'O.:. 6 l o -4 Q - . 0,4 n , 04 ,. .22 .if 12 . Q . . 9 4 gis t ' I Silver streamers, red and black decora- tions, and loud music were all highlights of the 1987 JuniorlSenior Prom. Over 300 peo- ple were in attendance and enjoyed a memorable evening with their dates. Midnight Masquerade was the theme chosen by the junior class. Decorations ranged from top hats andcanes to ballroom masks and ladies' gloves. Students stood in line patiently awaiting a chance to drink pineapple punch out of the souvenir champagne glasses, while others enjoyed dancing. This year's prom was held at the Rose Center located within the Tyler Rose Gardens. Students in the junior class began decorating early that day and their efforts made an enjoyable prom. Sponsors were Sherri Burrell, Vera Moore, Mary Vahovius, Andi Hartman, Joyce Buchanan. LONG LIVE THE KING AND QUEEN. Prom King Toby Foster crowns Queen Vicky Gray. SHARING TIMES. Students share the events of the evening while waiting for prom pictures. LET'S DANCE! Angie Heisler patiently waits for her date to ask her to dance. it 5 tssis ,.,. ,..,,, . .f,-- it-mtg-1'-....W ..f,.1tws--f - I : N eg,-U jiff 1:51 .-1 .::::.is?S22Yszi POEM TO THE SENIORS women vszm GOES PASSING BY ANQW-IER PROM IS HERE. TO THIS BRINGS A JOYOUS TO OTHERS, BRINGS A A PATH FROM DAWN TO STEEPER ANDTHE C A ERY GLA KNOW YOU.W ' ONE. AND TO T OF ' OUR PROMS7 WE DEDICATE .117 SUN.BUT NOW THE PA FOR FOUR YEARS YOU HAVE LIMB eeeurv wE'RE v D E LL Miss vo Youvs G U H DANCING THE NIGHT AWAY. This seems to be the idea of many who at- tended the prom. A Posnc eoooevls. Juniors wish graduating seniors a wonderful evening and a successful future. MIDNIGHT MASQUERADE. Juniors showed their creativity when selecting the theme for the prom. A SMILEI John Britt and Angie show their pearly whites. GET A LITTLE CLOSER. Students en- joy slow dancing at the prom. LOVE MATCH. Amy Bland and Jimmy Cunningham enloy an evening on the town. l Closs colors: turquoise ond silver Clossflowerz white rose V A:,, Zrzirrl s,,,5rr,Lr,,,,.r ,,,.l1 , SHFEEFETG if GEARS 1 , f : -' :f: ' f' rlfswgeefsrfziff-,r,.,,.W!e 2, , 4, f Hi-masse,-fM,:ss,'1sn V E ' k X ' ' 'fifW37Qf3QQ5fffs1ff.'5Lf?i1, f.!1fiiEf?Q1?f-f-fffwis?Qij ,-522557: Q7 . W ,su ff iesrwazisygf-:V -s iliczs-E,2z13zzgf4z2sezfr' -r' affix-.frzfffrsfi-.azzwel-ffm f-fr-lmafw x ' f I if ,fs:2z'E:'s5v:f4 -,fffg?ffgg95sgff,::- ,,,, Class motto: Special times, special places, special friends together. The moments pass so quickly, but the memories last forever CLASS, F 21953 zxzvg --'m i'-v. SffEf?9'l. -'75-if ' . visit 'I-S ::,illifr',7 , ffsmwd ffliifilw 1 --,r:.5b!f'.3 V lli: 'L75l 1 mi 'LSHZKVA 755 Swag? lfiwfl ' ' V. sais' ff: 11 ff -frggrrg-sl ' inivsfsiiikrgssrifrlssigggfqs weave , , 1 ' ' 1 ' fl K- . - rr - . ' f'fr:Qi7f1,::::', . - . ,V k GERS SPECIAL FRIENDS TOGETHER You can be anything you want to be, but first you have to want to be somebody. This was the keynote of the commencement address given by Frank Melton, president of TV-3, lnc. He received a standing ovation from the capacity crowd in Wagstaff Gymnasium. Melton offered several other points of sound advice to the class of '87, Your ancestors have made tremendous sacrifices so you can sit here tonight. Don't ever forget, and stay close to your own children, Melton told them. He said that instead of cherishing what older Americans have to tell us, we often cast them aside. A After cautioning graduates against the dangers of drugs and alcohol, he reminded them that they will always need help from other people. The ability to get along with others is priceless, he said. Others participating in commencement exercises were Mrs. Elaine Merr- bach, processionalg Mindy Webb, invocationg Tara Weikel, pledge of allegiance, Sheila Kimlicko, national anthem, Vicki Gray, welcomeg valedic- tory and salutatory addresses, Danice Deffebach and Sherrie Grayg benedic- tion, Carla Barnett, school song, Fiobin Hall and Amy Mosleyg and awarding of diplomas, Superintendent Johnny Johnston, Principal Jerry Hardy, and board members Jim Cunningham, Charles Edwards, Shirley Dean, W.E. Brumbelow, Mel Charlton, Cris Pinkerton, and Glynn Whitaker. REMEMBER LAKE CHAPEL HILL? Valedictorian Danice Deffebach adds a humorous touch to her address. WE MAY NEVER PASS THIS WAY AGAIN. Salutatorian Sherrie Gray congratulates her fellow classmates. A MOMENT OF PRIDE. Corey McCowinposes for a family photo. ermpumlon GEAR5 -Q new gems, iw '- -I :ff fri -iff 'C 26' F' 1:1551 ' 'I wisp v:1',1effff-s1f1azf: ' -' -' . -' : -:cliffigifigiikgiI2:3I955II5II5If43IIL-..l.W-is'59,-fwe .Jax-. . mi. it.'l:f,.5.f9Ef .': .,WILEYfi -f,'::f:.5E' 'infix -- I2 .QQ if Y ' ' ' 'ilfp ff giif- 1 -2 we :gi f f H - - fi-f:i'ff-wffrfl --wlfrf11 fffwffizwwwggf-2:w11rs1w,-1.1 izsexiwf-ifSa1,. ' ,. .. - -i .1 fs ,irr ,,.:.' v,,,,-,., ti ,iii ,f,,, f er,,..,,,,,, ,, . . I I Ifglswlt- 1-2 f-IWW, -,-1 -:vxxrzz fl.: fl 'TFSSJIL V 1, .. ...NE JOY TO THE WORLD. Graduates enjoy the traditional hat-tossing following the ceremony. L 1, LQVE 'YA. Toby Foster and Lojuana Jones are iubilant. WE DID IT! Renee Hood sharesmemories with Kim Weaver. GRA ATTON v,,if,,:fqgm-mpgzgiMffem' 1 .. , . K my-.fs -2anrw.sw'Qzs:sr:- ' ,mf fwxg ,ff3,,:,i. mi.-,W ,iw ., f .Mmmi,-,n-wifi-vig wif: rt. ,f:.:ff::v7- i --fr-A A. gm: . - f gm: 3--iy,,, . iff -im-ik ' ..,1f.asi92l'- ' - MW Nwfikirva ' , 1, - i .1 if ,V '- k 2? i ,A we I CONGRATULATIONS, AMY. Tim Crut- cher greets Amy Davis after the ceremonies, HUGS AND KISSES. Delores Jones hugs a young admirer. HEARTFELT. Tara Weikel shares an emotional moment. mis f 1. 51 .. 1. fi' if 'ffz W. .s .,,,if .- ., ffl? - 2 fasffes,sffz,. 1 'fzzgefv :gf ,, . -W wx WQZW iw 2. ,W ,,.g,L,,fqg,,, 1, . ..,,.. , . - lwffw -,: wife! -iw, .i seal yfykgiigig gg? 9,5 vszv-'H' 3 L 1 x, ..e5wfEvLf -L 2i'!?if?i97i:-5 ii ., , . ,--' is-',QM,s:: L, me H ,. - wr He, 1-in wwf 1-.ef . 1- ,mms ifdzse. -i K sniff' ' ' K , A .,..,,,. A .. J., i1e,g1..1, ,, wg: 1: '- ,iifsisslii . msssiksi ' nf, ,ir ,..,, Mp, A.., 75,7 'f i -,-asf H: s1Q4f4f,.5,, ' misses' S+ . K ,,.., We . . L,-:.,L-:.f ie mm, ,.., A--ex ,,f: , ,W . ,I , , .E W es, .gs-W, 1:-5 K K .pm issue, A-,Z wsffwagvggggggqg :ff f'- .ffriif , .,,11wafE1fm SWL . . , . -,mm M ig H , leafssslsw fi -f2Q:fief,eii' 3 ,f ,.,,, . . Q, .,,, S,,i,,,,.i,, 'iiilfifiiiii 'f ,, . ' w Vfw-,ui,f:s5mfm',,- D, -- V U-,,, .,,,. i 4- 1 1,,m:,f1Q,y , ,f .. ..,., ,,,... ,WW , ,.., , ...,,,.. ,, i, ezigsf -wsfffiiissizsim:1,'.f.vz1s-SIQQQQZS? ,L ,M ,,.. X, ..w, ,, fs, . WS, -- --Q' -wif,-., f ,,::.f,,:s1eQsvf .. H-:w2i4fe1Lsvz,,g-ff.7 :siisieifleskz-L,f. ., . ,. f U i:5f::w:w1m-.1271 ,, ,V , . , - -5 : .:cs,'555Hsf5iif5e ie .- ,,,, -mmfvz , ,wr my ' 'iwfzisvar ' 1 -- ,SZ 1, Q: f 2 I ' if f +V- , :hifi , .g ,gy K pig 1422.54-g, W 15554713 if-ei, -22 news. Sgwsgw, 1- ,if 1fmyme,.::z,. ,, f.-ff: f f - , .. S zz':fef:ez:fsa, 3 ,-fx - zz Jf fifff if, .L 5. 1 'g1i'f4wi 21' - w i . ' wiffg, - -Fi'2E'f:EN,Y1w,, , -- .-,,.eg.1mffmf 11.:.,,. .s,T'ieii.. ,, -I - .J , e,..m.,,. ,,,,:eWw-- . , S Q 2 Mi, . -- ff-wmv .-:,11Qwwfw1f1:.-1, - .:.e::.,,-eww: f- ,si-,fe -. Q-,ep 5:2255 i egqggggkgaszfafssfes, gsffggfiwsxfms, 53' - -- .1 ,111:,11'sQsagsag,i--fff,- ,--f-f:2fggv-:92izfmX:,,'fs1zf':S1'ffsz,'fes,-issgiesz ' W f -- Lf .. iw- -ww-Q: - Usfmm9smzi,f'f sv's:'z'sfezgezzss i H :sg L1-,, 7 Hi 'LGI ifgifaiaff'-rr' W 1 is-1s-'za:sf::z,,rzz ,i i.ex,:mz-:xii W x E iw- wfi 1: Wi,-,em . -. 1fmi,11w,.e:,f , 'few-' ffm,-5qq52gig4f.i if '-Wei-ef f 'fsfififfi 4 sigsguw - :,,-it 5,3 SX ,,...,, A is Q mf- f fw,.:5i.3isi gsgmivfr21,1.w f . , ivfrsifez gigiwigwim-7, P3 2 , ,if ,-11- l , .1-,W ww- ii' fa' Qi . , . , 'sexism 1' , 21-'if 3. mi ,,,,., ,.., , , k,,, .. ,, , .51 112. -If, ,,'f f ffwfsiesfzafsfz,-sv gg1:,11ei,fw1w, ..., f --W-fi,1eg1feiffe:111-, -new .iw f , iggggggi, f . ..,:Sl,,w.,,L H ESE. wwf. me 4: 2955? K , qi: f. ,s1f221sef'fz,, , ,.., VL, I Liifsrziifsegsiiiilefi K, Mssgf. - me 12. -i m e I 52' Lsifezissar ' 12 K K wiiffwg .,,.. i, . . f,:,1i,::f . . M ,ifem.,,,.,z,,f1,2f,s.:2ig:,,.:,, S, i 3 ,,,. ., lei ,A he mf we ww, .:. - iffsvggsiz A jemfif-T5ia5f.:f,,,-:,,. i 'Ili'viiiiiziiiiif553211-f,.f'SsQ, I??fS.eLfg3W , ,. -ifzzs 1 fQf5fef4ew1f,:' ,,11ie,141:wy1fevf?2f,aff:-as,msfwa?rrsefsz?f2.a: -- in A L, Mixes wi . X , a mi qsfegwqzs f .- - wif' ' V j 'J,-sues-:5L6f?f'i,LLC f-,,,:,ff,-M 1' I,::HIwffiffezzsfa-:ss'itx,mswiiss,-2.zwiirl11zv1s.z,f4wffv,w2 ff--wi' -z.'x1,fwsi-11111:'fsff4fr-f:s'smV,x- '11,fxz:::'is4:z,f:r1fff ,, ff 'fffHf We f K gfmnf yn , , Awe-.flame Q-111'-1' is M111 7 A-7ffmffsm-Q..-,H.,fi,:..Wmwif11i111. 1 , A , 1 - in , .gs22:31,151-we-iffffffiz 'fzvfegyfg--me . , V . K ,, ,.., , Z ,,,, -. YQ, I , ii, -,,,,.. . . K f , in ,.' 5.-m1.1,,' f ,ifiufwszzifezmzz ,-,Wi ,m,.si, 255911 f 1, kg :ff.1,fwQss1:ezgssSzf if-isizszissfsfifss 2,-ssfvlswfg A Y'95Sv121z's4z we 5513.35 S , --wwmsmzf.1-':,z-gegwz wfezw: --fe,f.f,efsz,ze,1Qf+ J - Q VKKI ,fl gm:-mf If 2 555, ,Q 'ses zssslseefsu , K :,k1g,,,,Wre, ,if5--'-vsmseflssw f , 1' Q A A 1-1K- i '?Ef,1'e ' fu , - 9 , :'f'illD'Qff: 'fin ' - ., Aww -..,11- :fi --11 1. -eww-X ,l,,.j5,K.mwu lm,,,2,Z, ,L:,,,.i.,i, ,,.., ,,, ,,, ,, A ffgffr-2,wfwiWi,-.sizeqee-fs M 'L l- We F -mmf View f.,..,, :J-:fi f, -f ff ,Wei L wi- .-fi i - - gi 'V -, , .. if--251--i -1 i:zwsfszzs.slfeU.. -:iv 1:.zz1'4'Ssiiw1fsevffeMf1-if 7 eff-s,ff5iz1f'f 'i ' --H111-eff 11 19i,4.e,f3?1f1ffm fwssizsl , M211 f. 5514854212 .9 fgfvi if , .nf .1.1 ,f - f.1-- g H :-z,..ff4,,,i1ws':e:,'fp-H - 1 2 X ,,:5,iTi.7 if Fi! 2. k3f1fi,i??ivi??V4i15592 .IV-'USE V. Vi -,sim 25 :ifwxzfsgs . :eg I-' ' ' we ii--me .fu ,-fsssfezw' -' -- i55f2zE'i':'fi'7 fi'f.5fmY4f1?i5Z ,ZZ-5152'ii5i,if3i?ii?5?4f35i4554451iii' Hi 'E 11 , f T .. .. .585 55,4 e 1'1 K11, 1 V ' fwy mx, ff.-si -aj si 214531 A:- nigzzf- 'aff-f-figs-fQ1z:.: -wfifms-effsfiifi. ' fs-lv: 5, W. ,KK1 ,11. 11, I f111K 2 me 1, .fear me 1 , fi z-- .qj sfu :41z,i:w,Qsw .1 , zz ., . ,224 , - 1 . . . 1 em'- iEi,,kM., , :ep LW 1 i?e21:4.i,ss vi-1-z,.s.zzfs2if:1:-:W-: -fzuwfff 1- S X 2 fi KH X X Wg ' X ii X N fi mi xi 2 J K Yi 9' S L L 5 , X 42 Mg 5 -Q 1 me K fi K , X ? ,W , Q ,6 w ,S Q wi X 5 K 3 .1 X 2 as 1 K , s 1 P. g N 2K S L ja K 3 fm, sw yi 2 f Q Xxx 5 3 U. fn! 5 5519 F K P 2. 3 52 1. 5 fd' Hy s , ,X , M 2 3 K , ,S as sri ,sa W K 'S PK 95 'ii K K a 1 Q 2' K, sms ' Y me ix f K Fix 2 H Q ws ii S 9 X Q X fe X P 5 ,4 K nf fx 1 4 S' v fm 16 E K' Q1 L 5 5 1 3 S 2 as K X X Q , ,gqgimm P1 1 ww vm 6 ,I its gy M X N H ii Yi S in if si 24 2 fix 1 f 9 gg! K 55 in 2 11 Q K fx 1 sg ,P ,J N S 2 X X if , 3 5 M ii Si 3. Q , 3 H32 NI P JRE Y Y f H3652 Q, 1 L , gp K Q Rf fx 3 H' Q4 S K L , , si X 2 2, X X s is Q Y M w 7 5 5, :sir K 'X fi Y Q Q Q mix if rf X iii? R gig K X K 10 if '25, , , ? 2 2 X 3, W4 K 'Q X X is W, 4, , 3 X fa Q ' ,, is fe fi 1 2 X X ' H ,K X is W N 2 5 sa Q 3 , gi . 4 S2 me is 5, K 3 ,Fa if YL mt? K ,X K Q in 3 2 g X xi aw E X ,QE X ,, Y, is S 5 dx .fx ,S ,S si ,, 22, U 2 fx lu L We 52, 2 if ix f , f Q 1. , Q Q M X 2 4 5 X S sk S r ' 5 S X si 3 .7 K dis X , , f , 1 A gf L 6 5 is S 5 ,E vp A I S I vi ,Z Z K V IQ' Q 6 ,asa 1 is 55 W W K ig P K rx XX' 6' 3 Z f K U35 Y, sg K 1, ai K sw, P fi is U sf , V 2 K, 2, , L 9: X mf E K 'S O S Us 8, 293 K 4 K 42 J 3 X I Qv S-I if V A rf vi asf 59' 'K S X sa DSX 25 KK X . , 5 L wa, , ..: iw: S4 is , f H- f ,J Q me X , ,ggfm ,f. gt,'::1::ei,.. K 1 - M f - ,. , -f '5 74552, iff 'f 'fk:iLQf'ii27f!5Ef1UL7 'L ' WV 3 ff , ,,,ifffrfs71sezm1 - Q:-'zlemzez' 2 ' Vifgjkxg K , f ' 5' 1-.,:-5 w: E'fr:5'r.S,3l .:'5:f'fi.i: ' , im- :, M,,,'ssez-.:z,,, f i,-isa,-:f'. - -- ' .7ff.1fiif : 'I wif' X K sg, A..,, . ,, 3 mmf wi u ai 1 , , H, xx W ? 1 L '25 S 2 U f M ,Q 2 , ,N ,. i 2 5 X 62 F X , ,Q N + xi Q , w in f Q i f is K 3 'fi Q X5 E 2 ' .S x W S 2 1 ,ii Pg , f me 1 is Qi .4 ig iss 21 X, S w 5, i 4 8, ,W W 2 4 X ,L gn is K ,Q 2 L 24 J 3 4 if K K Y 2 s K if i ,, K W f. V, , 1 K X 3 kin M Q X5 2 EJ if L eg K fi QQ 5,3 X L K QF: Y v S S K QM, 2 , ,Q at ie 5 5 5 YEA, TAMALA. Teresa Wilson offers best wishes to Tamala Reichard. KLEENEX FOR TWO. Emma Johnson and Janine Reeves wipe away the YBGFS. GRADUAT ON 'iii ,M W GEAR5 Q M N, eeei iisi '.i,. i,'i l 7f'TfQffffI77'iffL'T qL'iL A ' ? i EV ' , L, ,,i, - Inna... ,fl-1-gi' e sie, it AcAeemacs f iff N wseg nqfweff ft Mage? fix, Mvigxfaq ,Q 5 F X Gia bw gg fgsgiyilk .Y . 3 . rt Q ., 'ifjffiff fiw . V f'y,4+1sef,4:ge' 1 M - 4 Q g - - - Ji wxef-:wwf 3,,,.g4f,5LW K M 4' 5- Bynum helps Philena Smith and Derrick Ford with a layout. CHECK IT OUT. Matt Poeschl and Anthony Cooks share an interesting article. DEDICATION. Tanya Scruggs works on a photojournalism assignment. LOOK HERE. Overton Press Editor James wi-QS! Elf!--f, Xfs11f'XwX. X .XEf2X:X S f'--k'V ..'V i,f X f . fffX-ff'-fw1.XwXX, XX 35210 X g ii X Xa Q: 11 ss, . :few lfrlng Geors XX 'A A X 7:5 X 'X ' 5 g .fzff S 4 Q . L X XXX XX E gl XS Q ' 'X X X f 5 XX X S 5 , L 3 LX 3 X XX ,X X X S 9 35 I M X X XX XXX X XX Y 5 E W ga 3 8 YR X z x S 5 fi 2 X XS: .X .X , Q X, X9 X 3 . . , KX fx X .N X I X XX ,SX XX X ,S xi Us el K X., X. z XX wg S' .Qs111XX,gf3gsaX ,'XW-,g-gggggg, ,-XZ ,, Mig, ,, :fx gf11f':2w2 A .,:.fwgXXX 5, 521 ,k,, -- X1 gh f X X .- - f H XXXXXXX X-XXX. X XXXX --f'- .fsX..fX-:H-:fa sf: gi XXSXX-X ,W X2 M M K Ui: Mfg 7' ,Z I H - -I 31 ,.-535 , XF, XXXXXQX-,-. XM. , ..,, A ,X ffff XXX: XX S A X X ,iSiif'l '1ff5!f5i 1 SP 2 X 1 J K X M 2 L ix XX :2:,lisE:.,,-Efz+X. X ,S X XX E, X X P X M ,WX Y QXX bg Q ff XS 32 ,,f2,'i1,,,X'lXfXi5X X YX, - o 9 4 o 1 1 iff: X, , ,X X X' ,X X , 5 mx N 3 X X XX ' X 'Q AQ., X5 5 W 3 X is , XX X fx X Xi 351 'gf XX X 5 W F5 KNJL 3 Y Z X 7 W fe F X Q S X XA 0 X? M J XX 52 3 M XX gf 9' XX S K X XX X X H wg 2 X K X ,XXXX is X, XX ,S X K 55 W W Q S X X V X 'V V XX X X X X 35 is pw M f X S XS XX 1-N X 6 S X 9' 155, sx ,M 5 X .S Q 53 sei. X Q 5gCX?EW!CSJ2 X :XY X X XX XX g ABS U Q M EK xmgig 5 Q5-'E XXX XX XX X Q, XXX Q 912 9gfflgiyi'LX2X'li???fL3iwfLv?gg5Y-My 2:7155 sM-21452--1,,5zXgsX4fgXgA:k-1':5,g:.,,,:5ggM, r.XXX,q- 1 'yggfw X. 33 '5 ,.:Xrxii 5X . ,, ,, X X , . , , 'ff T'f-'f'ff59371?i fzef-Iffgwg-XfXf Xu,-swviffWXXXXXX11,5--'XQfX'1X'-f:Mwffef--X,XXXXXXXX wmff. XXXXX-XXX.,LX,.Xg,,,- f- -, W+2fv'iI - f f ' 1' fifi'kzH,sf'fFy?w:sEif 211SEV? 'ilH:?1Lfffff2i'L?1?lfgwfiwXgiXwffXX1w, f -292:15 A X SOMETHING DIFFERENT Holding students' interest through creative teaching ideas was the goal of most faculty members. From making ice cream in chemistry to wheelchair races in P E teachers worked to create variety and excitement in their classrooms Among the many projects were the spool experiment in physics blood typing in biology, a Helen Keller experiment in English ll youth in government activities, screenplay writing and libel trials in photojour nalism, and World War ll speakers in American History. OBJECTION YOUR HONOR! Beverl Simmons finds flaws in the rosecution s ar ument - Y P for libel in a photojournalism trial. CAUGHT 'YA. Are Scott Green and Jeff Langham goofing off in the library? ,t.t,.s-,, ,.,,. ,N CATCHING SOME ZZZ's. William Elder attempts to recover from a hard night of studying. K l 1 -'-' itrrs if ,f.f---fff mm ,,.. 'sewn--vef-mx ww gg :5g..7gf-- 5:35 ,.,- , l 1... ' A ,,. ' 9' GET DOWN. Whether stompin' to a country-western beat or jumping in aerobics, the p.e. classes enjoyed learning something new. CRAFTSMEN AT WORK. Boyd Sinclair practices his welding skills while Spon- sor Allan Emerson, Rafe Stout, and Anthony Cooks inspect his work. CAREFUL, NOW. Sharlene Jureski ex- periments with an x-acto knife and border tape dur- ing newspaper paste-up. 3, ff W s 'ig e 595, i.. 33 my my, l if 1 fiifhitrfif 'Wlff l f t ilk ::,',1fs1.-mfsiii 4 ' -Iflft'5gmi'i'Eistsfif2A'f-isf we ffisfmliiflf 'SWS W 23?,1.iw.,Vf?lfzzHE? tw A , t. is H gf ,rmlnszfferftfsit-fX,w sms, fmvsfefr.. if f .. . ..., ,. W , W .. . ...,,. ., . . .A H .. , .. ,sew g!?4ip,s.Ff1 V Wiifi' 7555? ?lli?ti1et2iJsH?2a.esg, Kiwi Vi1',f5i'f it if-i'. t35Ets i , 5 ' ,, !7Q?23iftg3g5gi,l?g5gg:l'i-5553 1?'Q,,g,,gggH.qg,L:l,5g rffgg-s.jf zg,5Qif'g, in n. I , rl I Valk . V ww gx .... -... . ,,..,,,,, .. ,,,M . ,t,, , m e ii. . . W SHOW IT OFF. Drama students Kishl Loughmiiler and Daniel Domain set up the drama table with trophies for the PTA Open House. BIG DAY. Terri McClain, UIL Coordinator, takes time out to check critique sheets. A vfffwff ! ,.fyf1g,..,?,ffQ,f.,14s5iS2Z:w'rPMmis? 'viii ii. ,, 23: 1-'H wtf? Q: 51:5 . ,, . , ,. . , , K He- 1-55 mfg:-.'.m4 mfr :sp-f ',.,:zg,1 .- vi tiie tiiit ,,m ,,:W,, ,Qi ,,,, A ,Mi ,. M. , .V Z L A , ,, ,, .. , rex- f f-'f. fr,--ffzzw ,if: 51- 'fi -f - . -i ff' at i ,rrt ,,.r UIL ACHIEVERS SCORE i AGAIN!!! DISTRICT U.l.L. Several students received recognition and qualified for regional competition in Denton at the District U.l.L. Literary Meet held March 21. Those receiving awards were Bill Davis and Mark Edwards, first place -- Team Debateg Tracy Watson, third place - Lincoln- Douglas Debate, Tracy Watson, first place - Extemporaneous infor- mative Speaking: Amy Bailey, first place - Poetry Interpretation, Tracey Harvey, second place - Poetry lnterpretationg Melissa Blackmon, first place -- Prose lnterpretationg Derrick Ford, third place -- Prose lnterpretationg Tamala Fieichard, alternate - Newswritingg Heidii Youngblood, alternate - Calculator: Jimmy Youngblood, third.. place - Number Sense, Tim Crutcher, first place - Science: William Elder, alternate - Scienceg Sandy Goodwyn and Wendy Hill, alternatesje- Shorthandg Dawn McManamy, third place - Spellingg.Lalura1Smi,th,.alternate - Spelling, Teri Sampson, alterf nate S-iAccount,ilng:gKeily Johnson, first place - Literary Criticismg and Derrick Ford, ihirdplace -Literary Criticism. A A PARTICIPANTS:fFr0htl1Rowj: Danice Deffebach, Mindy Webb, Tamala Reichard, Tracy Watson, BillfDavis, Stephanie Polley, Terri Green, 12nd Rowj: Jimmy Youngblood, Sandy Goodwyn, Derrick Ford, Traci Lowry, Kelly Johnson, Kishl Loughmiller, Sherrie Gray. fLast Rowj: Laura Smith, Dawn McManamy, Tim Crutcher, Amy Bailey, Melissa Blackmon, Stacey McHenry, Tracey Harvey, Mark Edwards. MOODS. A mysterious mood is created as Amy Bailey and Sarah Burch take the stage. BREAK-TIME. Lisa Warren, Cindy Fioach. and Crystal Craft take a break from U.l.L. activities. 'ii ,W 656535 - sv Q 12,gi,!iiisl?ifi5,,gssiigt1ia 7fe:-fs!!-:Haisaawfwvzmi-isa:esters K My'ffvseigmeir-:,fyie::sa:eewie,ifWs2':far-591 f Mfswfwid,i,M-,iegf iii!-is 67226552 affirm123421iggqmggewigz Sie- mrsigiifgragf-Sigma, S Y ,Zi I .ii .r - is : e f sir Uri. Q AWARD WINNERS Receiving the award makes me feel like all my hard work meant something. Kelly Johnson it 23 The Bloodsworth Scholarship was presented to Stephanie Polley. The Vivian Nlauldin Educational Secretaries Scholarship was presented to Carla Barnett, Angie Bueno received the Claudia Ray Scholarship, and the P.T.A. Scholarship was presented to Danice Def' tebach. The Lion's Club Joe Crawford Scholarship was presented to Tim Wells, with Sandy Goodwyn as Aiter- naie, The Chandelier Scholarship was presented to San- dy Gooclwyn, Lisa Gage received the Foreign Language Club Scholarship. The Thomas Jefferson Scholarship was presented to Evelyn Mumphrey. The David Crawford Theatre Scholarship was given to Kishl Loughmilier, The Fleetside Trucker's Scholarship was given to Tina Mum- phrey and Letishia Wesley. Free Enterprise Scholarships were given to Lisa Gage, Steven McGowan, Danice Def- tebach, Michelle Slinker, Tina Mumphrey, and Shannon Murphy. Independent Colleges and Universities of Texas Scholarships were given to Danice Deffebach and Sher- rie Gray. The Tyler Junior College Drafting Scholarship went to Derrick Beal. The ASM Opportunity Award went to Terri Green. Renee Hood received the TAFE Scholar- ship. Melissa Wilson received the Mobley Enterprise Scholarship. Jerry Ftaytord was presented with the Ray- mond Hedge Scholarship, and Sherrie Gray with the TJC Dean's Scholarship, Melissa Wilson received the Tyler- Smith County AGM Club Scholarship and The Young Ar- tist Scholarship QSFA1 went to Elbert Pruitt. John Charlton received the Carr Scholarship from San Angelo. The top ten graduates were given LeTourneau College scholarships. Awards were given to the following students: ROTARY CLUB - Keri Kelly and Mick Still PTA OUTSTANDING STUDENTS - Stephanie Polley and Tod Byrd DELTA SIGMA THETA - Robin Hall I DARE YOU LEADERSHIP - Stacey Florence and Adrian Walker KIWANIS SOPHOMORE OF THE YEAR - Donnie Whitworth RAY KROC AWARD - Kishl Loughmiller ZETA PHI BETA YOUTH AWARDS - Jackie Ates, Dessie Ford, Robin Hall, Jackie Johnson, Steven McGowan. Frank Mosley, Eveiyn Mumphrey, Shannon Murphy, Derrick Ford D.A.R. GOOD CITIZENSHIP AWARD - Danice Deffebach WOODMAN OF THE WORLD KHISTORYI - William Elder TOP TEN GRADUATES - Danice Deitebach, Sherrie Gray, Stephanie Polley, Tara Weikel, Libby Bryner, Melissa Wilson, Lisa Gage, Keri Kelly, Jerry Raytord, Terri Green. TJC MATH INVITATIONAL WINNERS: Mark Green. Tonya Alvis, Tim Crutcher, Shawn McManamy, Jimmy Youngblood, Tim Jackson, Leah Morphis, Steve LeBlanc UIL SCHOLAR AWARDS: Danice Deffebach, Sherrie Gray, Stephanie Polley PRESIDENTIAL ACADEMIC AWARDS: Sarah Burch, Jerry Rayford, Tim Wells, Joe Brumbelow, Libby Bryner, Terri Green, Melissa Wilson, Keri Kelly AN OCCASION FOR PRIDE. Superintendent Johnny Johnston congratulates the seniors on their achievements, 1987 HONOR GRADUATES: fFront Flowi: Tamala Reichard. Lisa Gage, Libby Bryner, Danice Deffebach, Sherrie Gray, Kishl Loughmiller, Stephanie Polley, Sarah Burch fSecond Rowj: Michele North, Kim Weaver, Joe Brumbelow, Ken Stegall. Elbert Pruitt, Tim Elliston, Tara Weikel, Mindy Webb fThird Howl: Terri Green, Melissa Wilson, Renee Hood, Lojuana Jones. Keri Johnson, Keri Kelly, Jerry Raytord, Kandi Crawtord, Dee Daly ,,.- ,,.. ..,. VATVV U A f K' wise .rrxswiswr 'igizimzi ,5.Qs,,fe5,,i,,,:, ,,.. .,,,ffs-,,,--fr.-W.,r,-is-gf:iTri::-ffwi1--rr-.rr .rr---if -rr: . 4 Av, Q 1 . A-M f .J I, , . ',.!L,,,,' t, sv My , I W it S riri I 5 Q, A V in leti 1 151' 5 4 f U -35' 1 15 A K :li I 5.--:ni-S f P' A . ' A -A A' in ' E 11' -Nfl , ny, , - .Mx 'M '- X151 gf A , .. ,, W-1 N, ' . X ., A ff is .Q .- Mew I L, lf A 1987 AWARDS ASSEMBLY WINNERS Principal Jerry Hardy presents awards to Sherrie-Gray, Stephanie Polley and Danioe Deffebach. DEPARTMENTAL AWARDS ART - Kelly Johnson COMPUTERS - Keri Kelly AUTO MECHANICS - Troy Smith. BAND -- Elbert Pruitt CHOIR - Penny Hendrix COSMETOLOGY - Angie Glaspie DRAFTING - Derrick Beal ENGLISH - Sherrie Gray I FOREIGN LANGUAGE - Libby Bryner I-IECE - Traci Lowry IIOMEMAKING - Renee Hood I HORTICULTURE - David Flemons AGRICULTURE -- Tim Wells MATH - Joe Cano METAL TRADES -- Matt Poeschl 1 NEWSPAPER - Tamala Reichard OFFICE EDUCATION - Jeanie Robertson SCIENCE AWARD - Tim Crutcher BAUSCH 81 LOMB AWARD - Danice Deffebach YEARBOOK - Kim Weaver SOCIAL STUDIES - Tracy Watson THEATRE -- Kishl Loughmiller DEBATE -- Bill Davis ' BUILDING TRADES -- Mike Tabb VALEDICTORIAN: Danice Deffebach SALUTATORIAN: Sherrie Gray AWARDS GEABS r f , k1,,4g.,f:f:s::ff: ,,.-Vll,,wif-Imesifwielgwfflfwzifeazieislsiiff-mymeits-w,w-111zQ.,mfw'f51 - K g., , f ?fzQ5+f'2xsew,5qu:flysafgffkf-qpw '1Maw ifnew'-rifzmmezzlsi-:rf-Mfr-:wf,ir'::,1'e,1n1- . fi fy 'fffwi f' M I ' ff I W: ' ' Wls,frrz11:.i .5 . . ,avi ff ,f ,,,.., ,,fe,Q:.-f,,,, gQg,g1sMi555,g2g3-:ness g.f1w, e, r, .W Z1 I. ,.,,W5si Y W r ii V' 4 ll M mm . .M . ..,,k ,, ,Mx ,V , .-:.,m:-W-,,, f-'f.. ..,,A ii.-Wir--. HELLO THEREIH Senior Traci Lowry gives the children an extra-special welcome at the Halloween carnival. ATTENTIONIII Truly in charge, junior Heidii Youngblood directs the band. WORK, WORK, WORK. Senior Michael Barton shares an inside joke with junior Sean Jenkins to break the monotony during painting the wall. 5 59 '-'jo S525 YQO? Q'YZ'S,QA QS QTY SHIFTING ESQ GEARSB7 -QQ ,,M gg 963652 Qo369533Q 55g5?6953Q QQYQOQQ . QQ- I YQN Q02 CD XY- Vvvpk Q35355Q5?w0 Og'C9v-bixfv-fsnbu' H-1' 11' 15, , :,ga?ii+i5'? NHS: y 5ERVlCEf SCHOLARSHIP t Being in the N.H.S. is one of the many great honors of high school, but if some of the smartest students in school can't even light a candle, something is wrong. William Elderii il T inducted into the NHS this year were Amy Bailey, Kari Barr, 'Lynn Bennett, Melissa Blackmon, Amy Bland, Tim Crutcher, Sherrie Edwards, William Elder, Stacey Florence, Blaine Forshage, Tracey Harvey, Angela Heisler, Karen Kennedy, Kristi Lindley, Evelyn Mumphrey, Amy Neill, Teri Parnell, Andre Price, Kim Pruitt, Keith Flhodes, Nicole Robinson, Eileen Tabb, Adrian Walker, Camela Williams, and Heidii' Youngblood. A .traditional candlelight ceremony in the gym honored these inductees. This year's fundraiser tor the NHS was the selling of Senior T-shirts. which included the names of every graduating senior. Newly reorganized by Greg Brown, was the Key Club.,Next year should be even more organized and on its way, because this year was a year to get something good on its way. NHS. fFronl Rowj: Dee Daly, Mindy Webb, Tim Elliston, Tara Weikel, lfSecond Howl: Melissa Wilson, Kim O'Nail, Sherrie Gray, Danice Det- febach, Tamale Fteichard, Ken Stegall, Emery Josserand, lThird Howl: 'Joe Brumbelow, Tim Wells, Dianna Reed, Kishl Loughmiller, Lisa Gage, Libby Bryner. Tod Byrd, fFourth Rowj: Vicki Gray, Kim Weaver. Keri,Kelly, Terri Green, Tracy Watson, Wayne Thomas, Sponsor Erma Thompson, 1Fifth Howl: Loiuanadones, Renee Hood. Janine Fleeves, Michele North, Sarah Burch, Steven McGowan, Elbert Pruitt, 1Last Rowji Kandi Crawford, Keri Johnson, Jerry Ftayford, Justin Blevins. KEY CLUB. 1FronI Rowj: Sponsor Greg Brown, Kelly Johnson, Tracy Watson, Heidii,Youngblood. fsecond Howl: William Elder, Debbie Perry, Sherrie Edwards, LaTonya Dudley, Robin Hall, Kim O'Nell, Jodie Craig, Kim March, Derrick Ford, ffhird Howl: Tracey Harvey, Sherri BISCKITIAOD, Stephanie Polley, Keri Kelly, Terri Green, Angela Helsler, Lisa Gage, Libby Bryner, fFourth Flowj: Jill Butcher, Amy Bailey, Melissa Blackman, Lisa Warren, Janine Reeves, Gary Earle, Tara Weikel, Wayne Thomas. Sarah Burch, Tlm Elliston, fFifth Rowl: Windy Green, Jennifer Lee, Kim Weaver, Kim Pruitt, Julie Hughes, Kandi Crawford, Keri Johnson, Mindy Webb. Dee Daly, Danica Deftebach, fSlhrth Flawj: Deanna Gilley, George Greer, Christy Hardin, Mike Sigler, Jimmy Youngblood, Michele North, T.K. Parnell, Amy Neill, Camela Williams. !LastFlow1: Amy Hardin, Bonnie Brumbelow, Jeff Langham. Jason Broome, Neal Stunkard, Christy Pruitt, Tracey Ripley, Eileen Tebb. .r,'W 5N W 2 if 'Y 4? T il ss J m..?r SUCCESS. The NHS shows off its newest members. f I PASS IT ON: PresidentfMindy Webb prepares new members for their duties. i S FINALLY. New inductees Kim Pruitt and Camela Wiiiiams seem to be glad that the induction ceremony is over, 'S 1i'i ' iisi l dds ni rdeii DON'T CRACK. Tod Byrd prepares his egg crate for the final test in physics. HALLOWEEN FUN. Toby Foster, Christy Pruitt, and Tracey Ripley work at the Drafting Club dart booth at the Halloween Carnival. LET'S GET SOME LEVERAGE. Tim Crutcher learns about pulleys from Kim Pruitt at the PTA's Open House. .W MW. V VL- . 5 MATH-SClENCE. fFront Howl: Sponsor Paula Page, Keri Kelly, Danica Deffehach, Stephanie Polley, Sponsor Hershal Wheat fSecond Fiowj: Tim Crutcher, Jerry Rayford, Sherrie Gray, Emery Josserand, Joe Cano, Amy Neill 1Third Rowj: Sean Green, William Elder, l.aTonya Dudley, Nicole Robinson, Amy Bland, Jodie Craig, .Chad Davos fFourth Rowj: Jeff Langham, Troy Bamett, Camels Williams, Heidi Youngbloo , T. K. Parnell, Blaine Forshage fLast owl: Mischel Kelley, Lynn Bennett, Kari Barr, Kim Pruitt . DRAFTING CLUB. IFrontRow1: Sean Seelbach, historian: Kyle Lindsey, secretary: Bryan Scruggs, sergeant-at-arms, Derrick Beal, presidentg Toby Foster, vice-president !Second Howl: Scott Williams, Vicki Gray, Michele North, Fernando Dean, Robert Williams, Jerry Rayford ,Qhird Rowl: Lane Thomas, Teddy Jackson, Neal Stunkard, Mark Adams, Tim Rains, Andy Payne f ourth Rowj: Sponsor Tony Adams, Craig Williams, Wayne Thomas, Aristo Rodriguez, Wil Hill, Brian Huff, Daniel Prather fLast Rowj: Keith Rhodes, Scott Wigginton, Karen Burton, Deanna Williams, Tish Watson, Stephen Morrison, Tracey Ripley . ,...,,...,,. . ,. ffm K I lw.cmM,-fm H .it-:ww -,ileafwr -1' it My 5 . ,,W,.,.,h,,. My .1 ., W., W ,. , ., ,,...,,, ,, .c .,.,. , , ,, A 2 ---ff A --ii eiwimwwi ,,,.. iii 'iir cc iii ss. a .... . .ccccc .... .... . ..., .,...., ,........,.... in K . I 'bQv4 ' ,,,m2a'i7!5Z V524 ' f 5. Q2 TECHNICAL MINDS Taking four years of drafting has really been beneficial in seeking a career. I advise everyone to take at least one year. Derrick Beal 1121 Tyler Junior College hosted the East Texas Industrial Arts.Dralting1 Regional l Competi- tion. Fromiifthis competition, Chapel Hill students won 24 plaques for best-in- division, 27 blue first-place ribbons, 27 red second-placegyribbonslgiland 17 third-place white ribbons! 7 7 Twenty-Gve students entered projects, drawings, and on-site testing. Qfthesey twentyfthree students' qualified for state competition in,Waco on May 1 and 2. Chapel Hill also won the Best Over-all, o School Awardjy' Students qualifying for state .include Mark Adams, Derrick Beal, is tMichaetiChastain,' Fernando Dean, Brian ' Dingler, Vicki Gray, Brian Huff, Kyle Lind- l, sey, Christy Marler, Stephen Morrison, , Michele,North, Clay Oldhani, Abe Russell, Keith Rhodes, and Norman Singer. A scholarship was given to Den'ick Beal, for S250 from Tyler Junior College. 7 SPLAT. Joe Brumbelow and Tara Weiker witness another crate bite the dust in the physics egg-drop experiment. MEN AT t WORK FFA strives to build leadership, character and in- volves youth in hands-on learning experience to prepare for the future, no matter what field they may choose for an occupation. Justin Blevins it 27 Steven Lenz 1121 As sunlight filtered through the greenhouse windows, horticulture students stayed busy producing healthy, pretty plants. They attended the Floraculture contest and the State Land- scaping contest and also toured one of the largest greenhouses in the U.S. at New Summerfield. A rewarding year was alsolexperienced by theauto mechanics classes. Lead by instructor David Sanders the class showed their talents against i in competition by having four projects qualify for state at the Vica regional contest. The most rewarding project for us this year was rebuilding a car that had been totally burned, Sanders said. SWEET-TALKING THE GERANIUMS. Jerry Wheat cares for his plants. KAUTO MECHANICSJ fFront Flowj: Steve Zucca, Quinten Kinard, Michelle Slinker, Shawn Saturley, Troy Smith,'Heath Ivy, Ben Johnson. fSecond Howl: Michael Chastain, Dan Deffebach, Robin Lane, Robert Duncan, Bart Phillips, Gene Hopkins. !Last Rowl: Sponsor David Sanders, Dean Campbell, Cullen Rogers, David Flemons. , lHORTlCULTUREl fFront Howl: Timothy Young, Jerry Wheat, Tamala Reichard, Penny Hendrix, Michael1Crist, Scott Williams. fSecond Flowl: Robert Brown, Vickie Coker, Michael Barton, Tim Wells, John Britt, Aaron Russell. fThird Rowl: David Flemons, Steve Lenz, Justin Blevins, William Hulsey, Tim Griffin, Shane Rose. fLast Howl: Russell Shlpp, Christopher Farrar, Darron Anderson, 'Mei ,, it - .L A it at-fi + aim' HQ fr Zvi Q m we f .,, if i A r at sl T CAFIEFUL, RUSTY! Rusty Tate carefully cuts todesign a plaque. .,Hl, HO! HI, HO! Sponsor Allen Emerson and troops transport the early chiidhood classes in 'the wagon they built. 'A A ff? BUILDING TRADES: fFront,Row1: Gene Hulsey, Teresa Pilkington, Rusty Tate, Tony Kenner, Pete Balbas fSecond Howl? Sean Saturley, Alvin'McCormick, Billy Willingham, James Jewet, Mark Thurman, William Kinard 1Third Howl: Joel Gardner, Doug Bates, Roderick Lewis, Robert Hazuka, Brad Allen, Leo Chester, Donald Cooper fFourth Rowji-,Mike Cooks, Billy Holland, Phil Hillard, Marcus Griffith, Jared Kilpatrick, Tracey Foster 1Fifth Fiowj: Bobby Perry, Kirk Ritch, Darren Glaspie,fAlvin Baker, Jermaine Thompson, Eric Betts fLast Rowj: Sponsor C. D. Gunter fNot Picturedj: Mike Tabb, Curley Bailey, Chanse Sisson, Rahia Melton, Cliff I-luckaby, Scott Smith J J E E METAL TRADES:'fFror1tiRow1: Bobby Stevens, Bud Norrell, Rafe Stout, Chris Hobbs, David Berryman fsecond Rowj: Matt Poeschl, Boyd. Sinclair, Anthony Cooks, Kent Gee, Leo Chester, Ray Calllhan fBack Rowj: Sponsor Allen Emerson, Andy Turner, Chad Short, Keith Newman, E, L. Ross, Dexter Johnson, Keith Rodriguez ' Q if it sr Burtoxwetenoes 555352515 e - lifts SIS - Lk- rsQ.?1' V 'i JSI?3i'5'flEii?E??riii.' ll ' : J. w . . ' Q ?E,f?W1i3'f1 -:ff I s - A33 75 oz srwlr-:f':iaesez,1Qw?? ,f X ff:.',,ff,.,,: .ft wisest. .:. 2ffT'1i-iiiifvf 'rf - W r, ,A ,,.... W r 4 6 51, V- 5, 2' . igfgrrgw, . gg, .Y V, www' fssitffv, 'i C' 11-lrssiszil : WFT' . . , gf9qfeWfffif,,e,,,, , H 5 ,W 4g,,,.,,ew,1ev,. - it t 4 'l li l -, ,Q ,Ml f ...,..,,,.,, I .,- ,,,,:rr 'o T ,,,, - ,,,,, I Y , ,V , , . A , 'X-rl Q' x' H V' 2 A ,iff 4- 1 l 1 1 get 7 l , any - wily if V. , . Q W ,W -.k k 35' 9 I' f,..4g5ggY ' ' 1 xg if 'x If f V7 F i ' , i A fy If ri 5 ' ' :L r ig I ', V' I ' 51: fi ff: - Tr ' ' t ' ' '1.:- 3' I ' ,-.i t- V, fy. 1 ,Z Q i xt, f 1+ f , s ,f . 1,1 I A F3 TYCNS W.. iw! -- -, it - t r,a.e-rf ax . M! f l CTTT... it tt Q wi it 1.,ews-T 1 1 . ' 1 W1 1 CREATIVE CONSTRUCTION This year has been a real pleasure due to the quality of the students inthe building trades program? , TT J , Sponsor C. D. Gunter Flat-a-tat-tat . . . Walking past the metal trades or building trades classes, students- get used to the unusual sounds coming from within - the steady hum of whirring drills and pounding .hammersgf tgg 43 T Undehthe leadership of Allen Emer- son, the metal trades department made a significant contribution to the Mental HeaIthfMerTtal Retardation department. The classes built at special cart with seatbelts to take preschoolers on out- door trips. They also entered a trailer in a Corpus Christi Contest. i Building trades classes stayed active threugh trips to Texas State Technical lnstitute and Six Flags. They built, a bookcase for the junior high library and remodeled the-vhouse of former auto mechanics sponsor, P. E. lsham. Pre-building trades classes worked on knife cases, baby cradlesg patio furf niture,gand a Governor Winthrop desk. 5' STAR wms? Mau Poescm, Chad snort, ana Dexter Johnson look like space cadets in the workshop. g ig T T sew - :fe are ieiswfrtzzfz - '- ' 11 ,gs , j', ,ju V V W , , '-':'Li.,i.,,,..z2geaes 'f T ' - fl TM: :wigs f , wt swarfst '.-tiTL1 ..c ff f s. .sl- , A ' CREATIVITY F LOURISHES in longuoge ond the orrs Having successful fund raisers of candy and stationery sales enabled the Foreign Language Club to participate in many events. The club enjoyed a delicious meal at El Chico, and was later given a chance to sample the finer cuisine at a French restaurant in Longview. With their remain- ing club funds, they awarded a S100 scholarship to the most deserving club senior. Theatre and debate students attended many festivals, workshops, and contests. Drama students won third place in the Mineola festival, and took second place sweepstakes at Robert E. Lee. They also entered U.l.L. One-Act-Play competition, Kishl Loughmiller was awarded All-Star cast honors, and Amy Bailey was given an honorable mention. The debate group attended a Baylor workshop in Longview at the beginning of the year. The remainder of the year was spent researching and developing cases for their topic, agriculture. ln U.l.L. literary competition, Bill Davis and Mark Edwards won first place in team debate, and Tracy Watson placed third in Lincoln-Douglas debate. DEBATE 1FrontRow1: Tracy Watson, Bill Davis. fSecond Rowj: April Sanders, Sponsor Terri McClain, Mark Ed- wards, Jimmy Youngblood fLastRow1: Marcy Warren, Crystal Craft, Roderick Burnley, Kenton Brown THESPIANS 1Front Rowj: Missy Blackmon, Amy Bailey, Kishl Loughmiller, Stacey McHenry fOFFlCERSl 1Second Rowj: Traci Lowry, Melvin Williams, LaTonya Dudley, Derrick Ford, Tracey Harvey, Bill Davis, William Elder fLast Rowj: Joel Gardner, Deann Crouch, Teresa Strouss, Eileen Tabb, Sponsor Terri McClain, Sarah Burch r:,. . X I ra-.H If J' 2. fxsnv Y Q ,K'7i K .. as A ,. .. W i l l I 1 1 QB' A :tt W LS 5, , AN ' 112 K 3 ,,: aa - A QM.. . . M. .1 l 4 , r ss LJ 5 ,gg M5 ft sf 1 wwf rash Exist 1 52 1 E SW Q 'eff QgfE3fQzf?x,.f.,,Q,: ' if 4 rx Q U 'MQ wt' - -A-Masta ,,.. 4 QSM-1 iff Lf. :cis-!:g4z3zt,sL,-M y ,. -1 ,3 V Y! A 'M' u m aa X ' ' ' Sw Y .Qtr vf,,,fZ Ke ' N0 f if? all vig' X i if 4 35559 I wfgflefy 5 5 Q W S Q is-'gtsjgax Ng rx X if S, W dlkwimea NW 3? wmv Q lg, Q53 A i ...Is K E 5 'Fi we, X , X-ft 'gg - asg, - l, LET'S GO T0 MEXICO. Foreign Language Club officers Kandi Crawford, Lisa Gage, and Lib- by Bryner count their loot from a recent fund-raiser. BEHIND THE SCENES. Joel Gardner shows that acting on stage is not the only important part to be played in the theatre: crews are necessary, too. FOREIGN LANGUAGE fFrontRow1: Mark Edwards, Heidii Youngblood, Lisa Gage, Shannon Kelly, Libby Bryner QOF- FICERSJ fSecond Rowj: Kim Pruitt, LaTonya Dudley, Robin Hall, April Sanders, Debbie Perry, Lara Stallings fThird Rowj: Janine Reeves, Stephanie Miller, Mindy Webb, Tara Weikel, Kari Barr, Alicia Farrell, Amy Chastain fFourth Flowj: Nicole Robinson, Stacey Florence, Stacey Gilley, Julie Hughes, Cori Ray, Lynn Bennett, Cherie Duncan, Carrie Clark fFifth Flowl: Christie Pruitt, Tracey Ripley, Kristi Harden, Camela Williams, Amy Neill, Leonard Hall, Shelley Kyser, Jennie Jeter, Sponsor Terri Farnsworth fLast Rowj: Pat Sturdivant, Carley Everett, Cody Kelly, Trampas Bass, Troy Barnett REBUTTAL TIME-OUT. Bill Davis discusses his agriculture case during district UIL meet. r'rr' f - LM, ' F sf if ' i ' li-fiezw--sl 7 :1.fJzL,,,'-,.',,--a t ,. H . ,,,, ., ,.., . , Yffflf if-fawiwfsfisil KF K t f lafsffssf,u7'.Qsfzs,f-sw,saws:mn ,I -f-:z.ff,w14pW5,,.1, s 5 , 4 'Yu' V5 Wifi? yxL575E.5 '-ffl 'F 225-'fazilelgyjigfssg lg,.f iff, . ' M ,3jggjg,gffiQ?1-eff-f 7 156 ' -5, L. ,A .,-,,,,.,m,,.,,, , ,,,, , 2,,,Mw!,w, V g, 7l mm wE - -Q -- - ' ' K Q, h ,h 1351353936-ar'gggg,L1aHTE3ig9nlLL 1'EAy4g 1Front nom: La Ton a Duale , Kim5Cl'N6lI, A ,if LL,,- 1Garla BBYRBH, Stephanjgfolley. Am Bland, Shelly Kyser Ascend gowj: Carolyn i.' - 1 Carlton, Dana Byrd, -LL, sly Dallleggfighndl CrawfQrd.,Michelle Mladenka, Angela Haisler ffhird Howl: Rhonda Bennahi-Mary MIEUQBKS. Kerliqohiison, Angie-Glasgia, -Q-iw Jennle Jeter, Jo cs Taylor 1Fourth'Flowj: T. K .-,1 Earnell,'SljxSIlygG:egor ,i'.53!!l,1-Ac er, ',-. Kerri ,Ksllyg Jogle Craig. Emma Johnson fFifth Rowj: Stacey Glllbl :--f giBorunlew-L-1 ,Brumbdldnijzdennlten LIN, Sherri Blackman, Gina Dobbs, DaAnna Gllley lZ61stRowJ: I2 -- TonlOkl .AA 'Trac Wdtiori'-Toshawalton 5 l ro1ALE?iuauhngyhB'draa1':amines Fun. Egan, Fun wiglfygllagtube murine. M6 l SMQKW9 W. I3 I 'Www ' , , N W , nwmlqx 7 , ,r,r -,l. ,r,,,, I , ,Qi i,, ii ,Q 'iff . M 'r - my A ' -1111.1-5 4., : azurg -.- f-1 f X-M ' X --'W rr.r ' L A' 5' 'WA' V -?'iif':', -' f W i ,, , F'Qif5C- if 1 L '-L , K sf4'Q 1 ' 3 ' I, , , , i r r,,r Y . M -wr i Howl: Carla Barnett, Stephanie Polleyflfim OlN5illlliIBack Howl: La' Tonya DudleygArny.nBIandg1Shelly Kysger ,J .nrr K ' MANAQERS:rGgtha Wallace, Angie Bueno, Nakomus Elliott yr Iyrr nr g n HONQELGUAIQQQQSQ.fFrqnLlBowj: Tim Griffin, George Greer, RobQrtnParnell3fBack Rqwj: Kelly CrossginlFarfellnlRihken l n,rrl 1 l l lnllnl W Q 55-r1n1Ne rl lrll W- f-v-. ,... f A.',A i -f,,. .- f. , -l 7 'K ' K lfifflf' -k'f 4 .k,. -- -1 msn -fn ,ir..-'ui-wggzzigfr,-1-g.,g 1 yr, A vf,,- g ifg,,g,,:,us2m , ztznicf 1 - - - ' -ww , f f'2m6?2 fm. - . . ,,,, ---an 'P wiki: W:-4,-M. - v W ,..,...Q,,, 7, , , M 'r Ne., DANCEe to ttll l f t accomtplishmernt s reoexvej two 1+ gratings and gtwo 1 ratin srstatiucompetitions.,This is thebest me tglghlighfefs he gdonse Over the t paSt lseveral yearsg and it t makes fme rf9BlsPfQUQ-5' i 5 ttsl r 1 i at 1 l it 1 1 g err ff s ss l stss s Q ssss ,Keri Johnson 1127, l s 7'fWBtgdlohft5realiZ6tlhattlthe real oppor- fU nltY9 sf0f SUCCESS!ISGS-jgwithlnlfhelltperson and not ini the l j obifthat you deans best get fo they QCP lhysf Qettinreiwi thee bottom of :hanger Terri rleligmjgnrersuirec- tor. , Said: ii Q i sstt l ll is f 2 t t Q y tfftfariiftertt the yeas: right With high hopes l garid so good l attitudes, thel lillghligthters their t onefweek Simmer :Q3fFlPa3 .uSl1tiDQ all week ' to keep! going so Q theyfd learn ,all Qfive Q Qroutihes io the bestlofstheiri ability, they s aPeffQfU1Sfdi ia? fh9iyV3fSifY7 eee f001bal' and Q btasketballii gamesgf and-marchedfinl the ij sanfwak eel g iee Rose Paradtel end Chrlstrnas 4Parade-fr eee e,e t t I l g1sArsisder ifsrom Eperfortmingr. or the lflighlightersf held undraisers to raise mcneyf ffer inns Stand e'r Confesfst they would errr be sattendlngfgsthroughout the yealijg Cai 'JWESHSS gland, garage 4 sales started the asummer. elrreee N Qtttstopplng at ragieedt 90 :Qaf washes, theyg !JOlZ1llFlU8dt gbyl rree selhngl candy and Calendarsef lee eeere t t 1 reer 1 Oomptetitionis rlye attended included ugheslg gwlne re the Highlighters freceiyed eee two. 1+ ratings f1th61TLlb6 .ands :High Kick s routines. Whllg ihgilvirlgg confidence ihl themselves they tperformeds send? rQO9iVedt two f'1i ratingsgoncei againgon the tube routine liillndgr the DSW! t owboyfflroutine at the i3'UQ raUClfGOldiF6SfiYa': 'fl me 'aft ter :pjart of fthe- year, the Hsghlighterlst wentto the Elagsloompetistion. or 9 Endingg thQ sY33'f Withi ag 'fhigh s kinky the Q?Hlghiighters heldg their s-traditional Floorj Shuowj'g which included routines from leach class fu an clg jiugdividual talent. The new ltl gl-iighliglttert Drill Team was spffwelnted fQrithetfirsfiefimse.1 4 f r 5'fDrill team-is! like llfeg iit hasrpits ups and gdownsjf? Terri Qxnonsr said, but she 3lW3Y5glQQkS fQfW3fCl to next yeart 1 eswitotkebagl elim Team 'oirecner Terra. Knees edds Sriirltltosthe Elallolfreeh meepirally. y t f:t..:e,,:,11t ,gm-gee?-ef-1 ,ef,,-:e:gee11g:.f awe, .i - ef K l SHIETING 3, t .,,, ,,tt t L ,M , 2 ,eltti ,L ,L CHQW DOWN. Tension-builds as Leonard Hall, Gary Earle, and Mark Crutchfield race to see who can eat the most ham- burgers in one minute at a sockhop. L GlVlNG T0 THE NEEDY. Bill Davis, Steven Maynard, Tara Weikel, Toby Foster, Sherrie Gray, Vicki Gray, Julie Hughes, Keri Johnson, Kim Weaver, Mindy Webb, Heidii Youngblood, Stephanie Miller, Danice Deftebach sort through the canned foods brought by other students. , 0 ,, ,ax an n an he IS lT FROM THEIR SWEETHEARTS? Adrienna Gill, Robin Malone and Martha Montelongo admire their carnations. TAFE: fFlant Howl: Terence Thompson, Sherrie Gray- Renee Hood, Robin Hall, Kim March fSecond Rowj: Lo'Seethia Jackson, Felicia Thomas, Amy Mosley, Carla Barnett, Kim O'Neil, Tanya Scruggs fThird Howl: Philena Smith, Keshea Pitts, Gatha Wallace, Patrick Warren, Angie Fielder, Christy Pruitt fFourth Rowj: Amy Bland, Nicole Robinson, Lisa Warren, Crystal Craft, Tracey Ripley, Shannon Hillard, Kim Pruitt 1Last Rowjr Tamela Johnson, Keri Johnson, Kandi Crawford, Heidii Youngblood fNotPictured1: Sponsor Linda Baker I STUDENT SENATE: fFront Howl: Heidii Youngblood, Tara Weikei, Sherrie Gray, Mindy Webb, Danice Deffebach ISecand Flowj: Donnie Whltworth, Tarnela Johnson, Keshea Pitts, Adrienna Welch, Robin Hall, Amy Mosley, Shannon Murphy 1Third Howl: Bonnie Brumbelow, Tammy Whitaker, Windy Green, ,Chad DeVos, Carla Barnett, Christi Harris, Lisa Warren, Sandy Tant 1Fourth Rowjr Vicki Gray, Tracey Harvey, Amy Neill, Camela Williams, T. K. Parnell, Kim Pruitt, Christy Pruitt, Tracey Ripley, Tim Honnoll fLaslFlaw1: Andy Christopher, Keri Johnson, Toby Foster, Kim Weaver. Stephanie Miller INot Picturedj: Sponsor Sydney Janak P ,,,, ,,, ,r r , ,,, rx ff? ENN-luslasrlc SERVICE This year Student Senate tried to focus on ser- vice proiects, such as fthe canned food drive and lhopelullyi the SADD Chapter for Chapel Hill instead of lust sponsoring dances. Presi- dent Sherrie Gray Student Senate officers started early by attending aillieadership camp for a week during the summer at S.F.A. in Nacogdoches. They began making plans for year, including the Beach Bash lfor decoration women some and they chose to leaders by going to the school leader ontheir own.l V Fora Homecoming, instead of the previous year's float for the Queen can- didates, the groupyi arranged for a presentation arch andihelped do a por- the total helium balloon releaser last fall after-game dance was a sockhop. a canned food drive, assisting the Salvation Army and a load of com- munity members in need, was held. The drive netted four times as many cans of food as the previous year's. Student- were placed in rooms Terri McClain's competition and free anothersockhop oc- curred and on 7, the traditional Sadie Hawkins Dance, complete with rustic decor, took place. ltgis expected that the Senate will in- augurate a SADD qStudents Against Drunk Drivingl chapter as this year's gift and legacy. J NS GALORE - Crystal Craft del at on lo ' J? - Y 1, I S i' wt 'J' ' 'i , L , '772'i , Ji 5 M u MW... - , 1 'MM ' 2 r ' ? B' g n . , W 6 ' uk. lowwfwg. ' K' E j 2 , ' if , 5' nn, , 3 V 11 9' 4 ,,,k '2 W '1 ' 1 1 - S22 ' V ii -1 L Employer Joyce Crawford happily accepts the Employer of the Year award from Letishia Wesley. lNot pictured: Employer Betty Moncrief of Bank of Tyler received the VOE Employer of the Year award from Kristi Lindley.l VOE fFront Howl: Kris North, Kim O'Neil, Jeanie Robertson, Holly Carlton, Cindy Cole, Mary Harris, Tonja Wyatt 1Second Howl: Donnie Williams, Kimberly March, Shannon Murphy, Johnna Adams, Michelle Davis, Lisa Moore, Kelley Dyess, Robin Malone fThird Fiowj: Ricky Thorn, Wllliam Moore, Thurman Lauderdale, Carolyn Carlton, Dusty Daille, Philena Smith, Corinna Bueno, Sandy Tant, Teresa Hobbs fBack Rowj: Sponsor Joyce Buchanan and Sponsor Mary Vahovius, Eric Jackson, Max Burch, Ladonna Westbrook, Kristi Murphy, Shelly Gregory, Christi Harris, and Lisa Barnett First Period HECE: fFrontRow1: Tina Mumphrey, Sandy Williams, Melinda Warren fSecond Fiowj: LaQuita Rober- son, Donna Rozelle, Shanita Robertson, Jackie Ates, Delores Jones fLastRow1: Kerri Green, Lojuana Jones, Elizabeth Ross, Mike Smith, Evelyn Mumphrey, and Sponsor Nan Sulser. Second Period HECE: 1Front Rowj: Traci Lowry, Angie Bueno, DeAndre Guthrie, Letishia Wesley iSecond Rowj: Sponsor Nan Sulser, Misti Dyess, Rhonda Goodrich, Abe Russell fBack Rowj: Steven Tant, Robert Duncan, Frank Mosley, Tamoy Carter ,. Q. was I 5i3'35??P?5Msss?4:ilf1Qssf:an5iag1?kwS7 t ,ef-,,':,,,:'2gif1f' ,f:fw1f'fiJ4 ai 11 . ,,.. ,L rrgsflf. A5 , wwgwzfirggff-affwi-mf-'ww ,-,..,,1f,,,,,f1V,V5,,.i,f,,g,45f:3Qfl S4 ' 3? r 1 -vi fffu 'i' ' R?'19r'SE7S'1'Q We FWi:iff3fStfi5Vl'7V!i'7C9fffW1fff5 lii57ilxETEfi3'f if - - UfU.'s5v!f?3:iZ257iM' Alma - fiisam es aim at zraeszms e wwwl 'if ifws 2 'er as sn tween ' r 12 e GEAR5? iii' it 5 assess ' 55 ga W my 'gunner- ? , Y ' HECE, VOE: GEARED FOP. THE FUTURE Hike getting outof school earlyybecause this enables me to devote more time tovmy iob. -5, Sandy Wiiliamsg i Looking forfa job? The HECE and the QEA programs, are designed to give on-the-job training. Child care, food service, clothing are some of the areas of work in HECE. Banking, and office iilobsiiiiareii areas of work in OEA.rj , s y i t At the end ofthe year, the students from tbotht r programs gave their employees an appreciation breakfast, which everyone enjoyed, both students and employees, Class studiesiiinclude money management, coworker and employee relation- ships, personality development at- titudes.fSponsors are Nan Sulser, Joyce Buchanan, and Mary Ann Vahovius. ' i BREAK-TIME. HECE members Traci Lowry and RobertrDuncan enjoy their pizza dinner at Pizza lnn with other HECE members. SAUCE wma THAT? Hickory Fareemplqyee Sandy Williams works intently to fill an order. V Y ' . ., it - V- sts, . ,- DON'T PLAY WITH FIRE. Student teacher, Elsey Graham, experiments to see how flax linen responds to fire. SERVE IT UPI Mr. Albert Horton, Dana Byrd, and Felicia Thomas help serve Christmas din- ner, prepared by Foods Nutritions students, for school board members, administration, and their spouses. -i'- ttt tr t,p'l, , , it irlrts , ,t I sil I : -.f' lf will .. . si w is , . YUM, YUM, YUM: FHA members have an ice cream party to start the year off right after a meeting. SULSER CHAPTER: 1Front Rowl: Laquita Roberson, Traci Lowry, Angie Bueno, Lojuana Jones fSecond Howl: Evelyn Mumphrey, Donna Rozelle, Kerri Green, Sandy Williams, Mike Smith Uhird Rowj: Shanita Roberson, Malinda Warren, Elizabeth Ross, Tamoy Caner, Ruth Welch, Robert Duncan fLast Rowl: Delores Jones, Frank Mosley, Tina Mumphrey, Mitch Burton, Sponsor Nan Sulser fNo1Pic1uredj: Rhonda Goodrich, Misti Dyess, Steven Tant, Jackie Ates. Tune Into the Mogic of FHA f HERCD FHA has been an exceptionally great organiza- tion. lt has inspired me to possess leadership abilities and gain basic skills. What I have learned in homemaking and FHA these past two years will certainly be with me for life! Felicia Thomas Q1 13 Homemaking students kicked off their year of magic and excitement with an ice cream party honoring 76 new members and officers. Monthly meetings were held at night so that members and their parents could receive information. Some of the programs presented in- cluded an installation ceremony for the officers and members, goal- setting challenges from Green Acres Youth Pastor, Eddie Cantug Christmas food and gift ideas from Joyce Shipp, Smith Co. Extension Agent, Teens and Alcohol, from Trooper Russ, Department of Public Safety, Watt .Watchers Energy Program, Vicki Noble, Home Service Adviser, and Teen Pregnancies from the March of Dimes organization. Special activities provided magical fun for the FHAJHERO members. A trip to Six Flags, the regional and state FHA meetings, service projects for the elderly, battered wives, and children, and participation in the PTA Halloween Carnival were among these activities. l PF HOMSGQMGING GE!-R5 sif.s1,1-- .f .,.1,:11e,5s:,,:s., i --ws -w e si,g:'::2f 1l'sa'ts if- . l W -- ,iggi 4'-if-Qfsksevzssisiai,.',g,,,,,,.,,:-sis. itsfaswavgieiiw'infi':evvfs ,S Y - -. f T YF -- iss it THIS TAPE'S TRICKY. Sharlene Jureski and Aaron Russell work to lay the border tape straight. PASTE UP INSTRUCTIONS. James Bynum instructs Cindy Roach, Julie Hughes, and Laura Currey on procedures. ms. ki-1 5 ,qw QUILL 81 SCROLL , fFront Rowj: Jackie Smith, Kelly Johnson, Bill Davis, Shane Rose, Kim Weaver, Tamala Reichard, Cindy Roach, Steve Jackson, Aaron Russell, Scott Williams. fSecond Rowj: Angela Heisler, Gary Earle, Keri Johnson, Don- nie Whitworth, Shannon Hillard, Amy Mosley, Derrick Ford, Sarah Burch, Michele North. fThird Flowj: Bettye Morris ladviserl, Dana Byrd, Jennifer Lee, Robert Parnell, Philena Smith, Sharlene Jureski, Brian Hutt fLast Rowj: Kerri Green, Farrell Pinke, Donna Rozelle. fNot Picturedj: Laura Currey APERJQYEARB K 15? F51 fr 51 HW aa SZ-IIFBNG GEARSV if YEARBOOK 1Front Howl: Steve Jackson, Bill Davis, Kim Weaver, Kelly Johnson, Jackie Smith fSe- cond Rowl: Gary Earle, Robert Parnell, Don- nie Whitworth, Keri Johnson, Shannon Hillard, Kerri Green I Third Rowj: Bettye Mor- ris, ladviserl Dana Byrd, Jennifer Lee, Julie Hughes, Sarah Burch, Michele North, Donna Rozelle fLast Rowl: Farrell Pinke, Angela Heisler fNot Picturedj: Brian Huff, Laura Currey NEWSPAPER 1Front Flowj: Shane Rose, Tamala Reichard, Cindy Roach ISecond Rowj: Philena Smith, Julie Hughes, Aaron Russell, Sharlene Jureski, Amy Mosley, Derrick Ford, Willie Reed fLast Rowj: Bettye Morris ladviserl, Jimmy Edwards, Scott Williams fNol Pic- turedj: Laura Currey, Steve Jackson ff? WL. - : v M.,.:.. . -K L1 Q'?2ffQffi.?2iiff . M ,f.,f...,. , .... ..' s illlzfma s IW W rlli lllgszf ' liiiii'ivi1yHQ1fss?4f2iiii2l5irswaseihikaisgi vin l,rie2?3Ss?se14i1 sf to L-afwieiiagyzfgr ,uf ezwfzgmewgtts-if az.-.Q ,Q , gvgQ,gyg,r.fg12,4,,,1'- , fvi'lEf5qfi7ffgi522N f 1, ' ' Jig? .. , 3 in s.i.:'2g.wq s. tW,25Qig55l,SY?ylS5e'Z,:zg,'7:j5i'ggff g ggggg gasses, .g,.4ggQggsq,kQg15:55E1i'ElsE lif. 1 . :.:.. Le. fi if 'l .:. s. .sWi:ri ' 'i' Tf' ffi7lf??f?fii7ili5LlL 45913-'7f1Sif ON THE GO Being on the yearbook staff has been tough and demanding but seeing the finished product makes it all worthwhile. Kelly Johnson U21 Keeping 800 students informed was the task of the publications department. The newspaper tried a new approach to sales with lucky shamrocks inthe St. Patrick's edition and also sold pizza kits as a fund-raiser. In preliminary U.l.L. events at Robert E. Lee, Tamala Fleichard, newspaper editor-in-chief, earned a first place in feature writing and a second place in newswriting. The yearbook staff toured Taylor Publishing in Dallas and lunched at the Galleria, presented a slide show com- plete with new lyrics to the Brass Monkey , and hosted the personality pageant in April. Quill 81 Scroll members enjoyed an end-of-the-year dinner at Papacita's. WINTER WONDERLANDlll Jennifer Lee and Sarah Burch take advantage of the ice skating rink during the yearbook staff's trip to the Galleria in Dallas. Yew '4 A l - ' I E - . tk ,-,. f 9 1 Y l -7 l G G SOUND OF Music Stage Band, the ultimate experience! c ' Wayne Thomas 4125 Beautiful music was heard' throughout the year, ,courtesy of the stageband and choir. , f Several stage band members earned in- dividual recognition. Elbert Pruitt, Emery Josserand,,and Wayne Thomas won All Region Jazz Ensemble awards. Time Elliston joined the rock group 'fBrazil which openedfor 'fSurvivor at theOil Palace. t is Choir entertained all first-period classes with a Christmas program of songs featur- ingf''WhiteChristmas , Silver Bells , and othervfavorite Christmas carols. The choir also has participated in UlL solo and ensemble contest and received three Ili'ss's' and two lll's. STAGE BAND fFront Fiowj: Tim Elliston, Lane Thomas fSeccnd Rowj: Elbert Pruitt, Emery Josserand, Jill Butcher, Libby Bryner, Wayne Thomas, Lisa Gage fNot Picturedl: Sidney Gollum, Craig Williams, Steven McGowan CHOIR: fFrontRow1: Jimmy Edwards, Vincent Sirls, Jacqueline Ates, Steve Jackson fSecond Rowj: Tim Honnoll, Melissa Sperling, Julia Sinclair, Deanne Odom, Laura Klinner, Mary Sperling, Tiffany Neyland, Bethany Sherrod, Becky Harris fThird Howl: Sponsor Sheila Kimlicko, Jacqueline White, Phenicee Neal, Tish Watson, Holly Weiss, Karen Gray, Melissa Bickerdike, Penny Hendrix, Teresa Brown IFourth Rowj: Hugh Phillips, Keith Warren, Linda McCullough, Gina Pollard, Lanecia Thompson, Machella Taylor, Lambert Shaw, Ward Carter fFifth Fiowj: Michael Bagley, Ricky Calico fNot Picturedj: Sha Bolton, James Moreland, Patricia Moreland, Misti McClendon, LaFresha Perry, Tyrone Scott, Carol Tave, Deon Waters 9 fs ,iwggz sia N' , , ,, .isrwflffzlw ifsitl' 5.46 5f',,fQl'i'49Q ' Q' ' ,YQ ,gixil .i.5:9Jih,,i 2 s 4 ' i TOTALLY ENGROSSED. Emery Josserand looks intense about his music. ALL-STATE. Elbert Pruitt may be considering playing the Flugelhorn, even though he made all-state on trumpet. -'E .g'l'l'LEiBOY BLUES. Ricky Calico entertains with I Saw Mommy. Kissing Santa L aus. E READY BEGIN. Choir Sponsor Sheila Kimlicko gives cues during the Christmas program. L L l SMGBBA Q it ii GBA!-25 ' --myJ..sqzQy:wi.,.f.feff-.isa 1 i. 3211255955252Q5ZQ.:f:a:f4S','ifm:g4?as.'f9sz15. rffglgifiiflsiiw--fffzffifisevi Z if 5 wide' lftmeimsffisgifss. ffwitam --1 -1 g'gQ:gfm i,.lifvfYi!l tm m,,..... ..,..l..--W .gt A.,.J,sn- M11ffeflg i ! -f!:az:1vs,zu-:gil'asia.is! we:!fvi3i-.vf fffffW-f:wnYM:Mfe- .. . . .aim-s:i4ff:w1s, .1 -we mt -i . .uf fiwlmww. smwfseirfglsis sfsess-Fw . . .g 1 , 1: ffriw .flew-Ev --1.-im-ii: sis ff1Yi?'EiSi:ffil21?vf?9ggsfi4firiiLi-5.-1211'i2fEi5fawz5+5Kf'f:2, f ' J K. f2gl'Lf-fi. 'ffpiiifiij-?l EQi: 'QW CONCENTRATION. Band Director John Standridge directs the Christmas concert at T ler J ' C IIN ii V V Band Neff 314811 iFfOr1t Fiowj: Tim Honnoil, Steven McGowan, Sidney Collum, Elbert gruitt?3nlgRi?w?9'Igi-na Jackson An ' A Ste hen M 3 d R . . I . d Stout, Mike Bugh, Ksmpnowy logssiolni gkS0gwg.h:g21IX1lLeisJs5Iil:1llaygg hgclellasnd, Aggela gtgig,f4lh gOlAr?.' Bisky Harris, Tina Wells, Daniel lgomain, Jill Butcher -4' , b . I , y im. can reen ow: et an herrod,TishW t ,A ' R 'd ,S ' 'I' fLast Rowj, Mike Guldry. Ken Brown, Jimmy Edward fM1dqIej: 11st Rowl: RIFLERS: Melanie Sprin field, Klm?:gfinSigraf 24 fir :FIS vggisnis W H M . S Y V D Co BY, 9 B Hi iam? andy Webb, Sharlene Jureski iLt.i Feature Twirler Robin Hall, Sherrie GralyziCapt.l, anice Deffebach, Meiissa Blackman, Christi P?J51Siu2?nNyco?en:iagd Nlelogte Carnes. 12rnzqRowj: FLAGS: Stacey McHenry, Michele oberts, Christy Pruitt, Tracey Ripley, Lisa Warren, Kim h 4 H .ai Y mo lnsoni ap .Q ianna sed, Crystal Craft, Agni Sanders, Shannon Hillard, and Venus Welch. fUpperMiddle1: Drum Ma- iiiynM,m2'Q?2ifFA'3JiVSiiV2?2fiiS't?e'iZL826iL2'WiiiL'S2?2i2 R a9'ka3e T Sma?f'LY dS M3C'i 8'2? '3 ' Rowif Mme' Came and , - ' ow: n rew ay, ' ames ee ,an hris HarpeIFiightSide1:1FrontRowj: fL to Ri Tern Green, Shelley Stunkard, Am Davis, and Tff N I d 2 d R - ' ' ' ' ' ' Lance f3rd Fiowi: Cherie Duncan, Chastain, Carrie Clarkignnj:Sgpuggsnf4tha?vgwE,l?i1vsIggsgittgelglnga pSg:ugr2?'cl?a?neiar?lio?gt2gn Diggs: Gray f5th Rowi. Emory JIOSSGYGNCU lm March. Amy, Stanleg 'lfonja Traylor f6lh Rowj: Keith Rhodes, Terence Thompson, Laurie Buckett, .lzpflggiggigeeguggh Howi. Tim Crutcher, Holly Harvey, hliena math, Catina Butler fLast Rowj: Lcseelhia Jackson, Paul Jones, Terrie Dennis, :i..i1?555?5??2i51L i V -3- . u-s'f1f21:g:-- . .' 'n , A - , I,-is . .H . , A f it f ot,. ,eet 3 Ei' ' 9 iror . ,,. - f 1 3' A fl - I , it ' V. T J H -, iikk Q i i -E ' y n? ig: ' A are ' T f T w i i f f :i',. f as ,e 31 Q ,Et ,- i . ' , G - ,z'75,7,-iiflr,-Q N . aa, , --1 ft 'T 4 I i D t ' L E .44 , -1 1 - , f i?'?p2i'Qii?'f- T, i 'jgffi' ' iff? - 1?-1f.f-vii -T ai' -,i, 1 -ge!-fri' , -5 t ' - ' A 'W M1 219 if 5 Mui ii x ' C A l ' Q ' Ki .. 1:,. ,,i.f,.lc I Lk 1: X, K ,-'R E, 'rx I rf' e -I ,K N fm 'ill N 'I .f5i,,ma,fer fe - , 1 'tw i tif: f N ' 712 4- ' .la Q--:Q 'N .gs'i4Q'e,'-7' V Y YA' i ' a fu-of :K 'Q 'A ' Q 5 XA W Z ' I R L 5 I gt f R 'et, A it i i l e ,ALL - , , S gn, . ' t,. 3' f t get ,J g..-i ' . .. in W kk W kkk .. V5 . 1? , . 1. Q A 'K H Z A N. iii E i E' f for ei' if if Q? 'i l i FLAG CORPS. fMiddle1: Kim Pruitt QLLQ, Nicole Robinson lCapt.i, Christy Pruitt fLeft - , SW'-H-J' see as , , to Fiighti: Tracey Ripley, Stacey McHenry, K ' . ' f W Dianna Fleed, Lisa Warren, Michele , A I , i. , A y , ' Roberts, Crystal Craft, Venus Weich, April it by if f A 'N' A has it Sanders, Shannon Hillard t, ,,,, 1 5 at to K I ' , i - ,ff Y ' zz- 1 , RIFLE connsfronrnowi: Christi Harris, i. t A, ' L wget, Q, A ,uc E April Conley, Sharlene Jureski iLt.i, ' 'T' ' X iw E Q Camela Williams, Melonie Cates fLast f Q ' , gm v -5? ef Q 1 - febach, Mindy Webb, Kim Stanley, Sandy 2 , A - - , Tant, Melanie Springfield fNotPictured1: if . M V , ' . ,E A ,an , ga Q - x,,, e , i X Lys. . 'g at, 5 A Fiowi: Melissa Blackman, Danice Def- ,, S- t 'fi ' 1 iw- '- g R . -i ,,,' . Capt, Sherrie Gray. T A FLAG GUARDS: Rusty Tate, Kirk Newman, Trent Minter, - Y..M..,. 1. 1 ,y ,fx .fir . Qs. klltxxx Gary Earle.i MAJORETTES fFront Rowi: Camela Williams, Sharlene Jureski fSecond Fiowi: Sandy Tant, Christi Harris fThird Rowi: Mindy Webb, Danice Deffebach iHeadi, fNot Pic- turedi: Sherrie Gray ISE ,gf lux linux! E 2 kwin 'gags ,fa sweat i I is ,emma aa a - ,,,.. ffeiimiftt, im-wie at a ,wtf--,f ,,., , ,fmiew f-,,,g.1f' f - f:--Mita--if:t.f .,,,u-.wt Ifeiiifwig- ,955 rg, ,.:,,g,g Q -- 1 gispiszsi fszgii 'Luz , . 5: '3Sif!Yf4.c-A-r-ugfsff-ifffsi if' nl35L'5?i'E' I iiiirsfi ,ru Zi. H12 'rt . ' . W -ff-X54,:5?Q-!J',--1,- . :r,a.',,-:fy , 1 iaifff--in-fixes wweVitt:-Weeffeiisigr,ffezeaisaffl-ef, Y--,w:at,tiie,ge, , -e,,,,,,,,4 if ' ii fu ,W,,e,e,,W tr,-ate,tmtfw-wee-,fe mw:fitffw1 ' 11: .. . . 1 1 + , 2 1 .. - f M , aw. ., .f - - v gg gg if gg Q if jg 1 AA1 . . 1... .i A A6 ii MV, in .V KA ky K .. .,x1- Kjiti.. 4321 K g- .- V 5.xh . 'll' X 'Hill' Q.: r -..... . In V -N. ,1 ' i I .4 -'if' .2 ,ff . 5 V L . Q ,V . .1 ' ...Q K K it - -s t ' ' X' Q . .Q .3551 ' 2 v . , 1- . LL.LLb 1 ' 5 .1 H V -1. 51: . , .if A lla. ,.-- is .4 ' Kk' ' -f t - -NS1 Q, Q e..e.s, -t 'a. .,:'fe. g A ...'j,,zs'g? ' , .css fleas-K -xx. I W. - A q,.,1. as ,, . .,.ct. si'wir' is.i.-?F'a1eli 1:2317 -gg, f 1 is-gg, N . it .. V .L 5 - M. 'M , 3. N- V ui. f i, s-:age-...4 qs. , K I 4, g, X Q W . .K V Aww w? wx, , . V. .. , W.. J is A - .,. - W ' s 195 . , ,:., , ,, . ,, .. .. .. .M ...cams X ,rw Q. 1 . -eq: f ' Y f 1 - s . V f 2 l 2ssf..- -- 'Trl-'.:.ta,.w .. Vs . M, I Z K' , ,..:vkiti,5,i .. ii. t ' A -1- . ' . X ' r tif ' - A r J N , T may t - It wr ' ' 'I 2. r 'x M' -h xg '44, stir.-:VK Nhsifglj' xr.-Ax. ,2:5j.sq.5s1,fi 1 X , 3 ,, ll' , i ' ' .- 1 . ' it T ' 'f ' ., -we if f f Ai. .t?ifAv 7 - T '- -W . lrsiiaz ii-sig. S Q 9 Z.--,Q ' H - . ' - f -fif L ' fi f ZS 'fx M' Lyirlwf -4 2 if tk 2 ifixg, ,: , . X is t fn x. 6 1 I? .ae V, gf- V I! QR af is ti ,,,,, 5: 294 54' f f, If Hi Q 4 ' f fl 22 f 'W 4,f M fir- ' F M 5 . if ff MUSIC TO MY EARS. , l liked performing during' football season most because it was exciting to finally get to perform the routines that we had been practicing all summer long. s ' ' r i Lisa'Warren iFlag Corpsl Bravol Good world . Many times throughout the year, a passerby could hear Band Director John Standridge encouraging his band to strive for excellence. is The band practiced during the sum- mer for about five hours a day during camp, and during footballseason after school perfectingtheir performance. Football season had an air of excite- ment during halftime as the band per- formed such songs as the Toronado , Samba deyRolIins , and the popular, Turtle idrum feature. Withflags, rifles, and pop flagsi the color guard also .entertained to this catchy tune. The U.l.L. Marching Contest was held at Lufkin High School this year. The Band received ya .third division overall rating, which was an improve- ment from years past. With hard work and determination, the future is looking brighter forthe Chapel Hill Bulldog Band. r - PUCKER UP. Keith Rhodes gives Sherrie Gray an affectionate kiss after crowning her Band Sweetheart. T T Agia -:Fifi 5-1f?if1W's2'f Hilfifi' if iifvifff -- if'-.s:'l.c:i''imnsai ri zzaszms'-1if..1al..' 'fzzx fvzswxl., -fws::.::- -' , , I Wrrykk, 7 ...V . .,,, , ...., , t,,tk. . . ,,.,. H, Zvy K , , 1 . . .. Geeks Q LAID-BACK PYRAMID. The cheerleaders' enjoy theirtime. to relax after all the sports areover. VARSITY CHEERLEADERSQ' fFr0nr Fiowj: 'Tara Weikel fS6CQIld 'Howl' Melissa Wilson, Eileen Tabb, Sarah Burch, Vicki Gray fThird Rowj: Cori Flay, Kim Weaver,eStacey Florence rLast Rowi: Kelly Gilliam ...mil ge imify W iii e 555524-Qelgi am- JUNIOR VARSITY CHEERLEADERS. fFront Howl: Adrienna WElCh fSecond Howl: Casey Jones, Daphne Moore, Kim Seaglery fThifd Howl: Debbie Briery 1Last Rowi: Misti Beckmon A FRESHMAN CHEERLEADERS. fFront Rowj: Windy Green !Second Rowj: Melissa Adair, A Tammy Whitaker, Toni Poeschl fThird Howl: Tiffany Chastain !Last Flow,l: Dayna Sanders DEDICATlON. The freshman cheerleaders pay their dues in the rain at the Jacksonville football game. it A si SEARS? ' 5 l - ., rfsflvzw, , Ja zum: ss ya-:assi 'elififalgialm,law--weggsifwl V, ,. ,M R. ' newfeezmmleasg f all .WW ha- if,,,- ,.,. ,X if , i , W, , ,, ,, ,, ,fr-if fwfiwf- ww f--f:g5M-'ft--wif-vvflfrMMM A A ,i ,, ' M::,..erkfm-1w,,f. ,v f r ei iiikleialilauriltflir REAQ-HNG g HEIGHTS l Ell s , lt was realty exciting to make it to the finals and be one of the top-'seven squads at summer camp. g Kim Weaver Q1 23 Most teenagers don't botherto set their alarms during the summer months. 5 ais y Cheerleaders wereiupr at the crackjof dawn, hoyvever, to work out at ETSU's summer campiifor valrsityftand TJC's for JV and freshmen. W W 1 Dedicationrsrlpaideoff as the varsity returned homes with fivelgold eiir superior ribbonsn iasrmrs eight blue ribbons, and a record first ofrankiyng asgaone of the top seven squads in the final round of competition. ' 41, , H Freshmen and JV isiirii 'cheerleaders ealrnedgctla spirit ,sticks together. The freshmen returned with two utigg blue and three red ribbons, and the Jviwon two blue and tworredlribboyns. Debbie Briery was named one off the' tops ten cheerleaders. at camp, gy l Most off the' riit varsity -squad had cheered together since junior hight iwhichiimadef for tsi.. a special closeness. f lt's been a great experience and one iltll neverforgebil ltlg senipr Vicki Gray said. lt was a great way toitgetta5ihvolved,with .the,,ischool, senior, Melissa Wilson 1. ,g,-1g .g. -g, I gi,gi I Viiggi. K l'm sure all the seniorfcheerleaders joinlfme glsr inexpressing appreciation to sponsor Teresa Pierceesutlertlvtsfor her help llgt andgsupport throughout the years. We leaveitalls ourggooyd times ...with ,the new squad, senior Kim Weaver said. AREN'T THEY COOL? Amy Ripley Qmaiscoty,gTara Wetltel, Kim Weaver, Stacey Florence, Vicki Gray, Salah Burch, Geri Flaygf,KeIlygGiilliam, and Eileen Tabb model their matching sleepwear' and sunglasses atcarnp. g , A, HALFIQME THRILL. Varsity cheerleaderslenter-' tainat at-basketball game. cly f y c g CRUSHQJON YQU! The varsity cheerleaders have all their movesttogether aslthey dance to,f'Crush on Youf' during the Homecoming pep rally. i A NEW VSTYtc'E. TheJ.v.itfiieheerleaderstlssnow ta new style in pyramidbuilding. W s ER s B285 :metsawwtefe :-ffirrle ities.:'wifiifit-f?,fl?1ff:ff A-Maff v z H ' .: fffaw it 1 - rits' Seam n mas. . .:,f ig w,g,, -yn., ,Ji in rf: -- ' is ' - X -mf' 1522:f1s7H.eg5tf3g,qf,g ef dist ' 5H' F7'NG if O ' 0 SHIFTING . nf ' O O :UO '. O 0 GEARS '87 Q K O FY- L , .4 f usiwgfmfg JM, W. ...M .-', , fggngy: . Qifhififgii-25222 . ,...,,. . 1. -H55 mv 2 fZEE,Y3i'l5f,, 3.95. -z . W -w:-wfila-Q ,Mysf.a::l2Sr K gsm ngmwzgy,QXgf- QQ fi viii Mx 7 ,.f', 511 V i?5i?AW f,.fffg,. f,f,fL.w,Mmg ,,fQm-W,f..su4ff- Sh W-rfz,.g .gf ffisvzwx ,fe5agg..gggm:gw.fg , wQi3fg!5szY.EmSwggQ W 7f.32f2p?izgg9gf fy:3,ps.f.-.14-ggw ,X mg.. vwfszsxvw... . , ,V . A 5.1 MH. H.-W wqgswafwf A ffwQswE22gxw?s1 Af.-,Mg wk g1g,Wg,,w..,..w1k, 5 ,ml fg,.w .Mag V 'wfesglfkshgggggsfwifxvbgssxff Q ,flQxfSae:w:f2:' WM., . m+sz71'fef4a+Saif' fy mi-25Zb?2fE.i5f-img. was Saiiiw Wviiifig, wwf.gggwlfifiiii-f.4AWW13W1'-ii715ifiVfhf?9i5Wsf?ifffw vfwgffwgf-115.-YY zgxifzi sf..,11f zwwg was? . nig?E.f:.5g1rzff'?A, 9551-wif:vwffiiwriqiizf-:gy..1v'r1-EWU-2zzwkf ww ff-- rfGN?1'ig,,af',g'A-mgfff yffik5g:yg':Qf , 711 1 H WL. .,.. '14 , . fgfafifszgf:fi5ifigQmsaf A, 212.PQ'wwwg,w1i22ig.52,.iziwifi 1f'?.Q.fW .. . g iff .. 4 , , af y .. W' ff M3eS5QffSf12:?ww2:f42211.xii 21'a:sf'+w: v A Q. . .XMggvfqgmgwgsgiwmgqw .,g,,.,.,..fW.-..Am.w1u.,z?..., QW.-f,,,.-,,i,.g1qxgsfQg.f,f.g,-g.,,.W1,5,,,2zffmmi.awgiq.7 45,9 Mwfww... A .ggwwwm'fi3h..S45ei5ipSf:1f5i5?7f 44,Z'i3m.wg:-315',e-ff,-mwfw iifgwf wg--wwwWsm12?H4l.Q1ggfw-rfgl? i5,gQ',4ge5g 1155.1 'V ' Wf A 1,553 ' m WA, ,. 5 gig 1.1. ESfiiiiiefffi-:+iff2g?gjf 1 ,fgyye.1sgjW ,4 my Sify-.tj.'Qgg5.WgL,1,3f21w3. 3gggf,'.,H.sQ'.3 5-1. f q'q hfL1:f1fEkQ'g wh -- 1291! - . .2i131f5?ss5i+f2w Lgwghfs .-1,---mzrivzrwwiim, fines? W fr fl- w V -wgfmff' -W QW-X ' - Qfxfwwwmmv -'M Q M ' W Qi N .C:1 1?' '. .L . H 'SS'si?25fQ1gW2i?s53f,S,25ggSQ2L462?ilfwiiffewggafifs,-1.ir-W5wZre?.g211f1:f-1.ff,': z:g:2z:fg.fz, - ,, lf- f tww mx, ,g wsm.m.fff,f ggkfgwx frm -inf.,.s,g,L,-55,15QQ.f,f.WW11,1 w..ffffg.fff--y..5:1...g,Kf,pM...Qsg.griq1g. f.pgQsi.f15.,,f- -9.5 L,qb.fQ1g55 fri fx .A ' fwswssgwziffifhh fm-31..Mf2-mfll ,:.ff-:gf-1422spvfsw gf., e, .. ..,, 3 A . g g ,,AL, H .5 ,.1g,,,,.:5f5f,J.,,. 7. f .1f,gy,.y H Mfifg..WW..QQ.:1.71521'j:QF5Q.ggggg5ygfasiayjggv f x4Q9MfW2?51eg,Jgw , fi554252Yff5??.ggWHwif5Q-12K2ii?'1'g8aw:fs:ig5f55ifEiii5Q?1S5ggf,g5592Wii3iH'5v5fQ23Qii,fK22W'1fWffwfgffw- K ,,,,w.1ysffI45.,5kk. I Vrkk ..V.k5..w5ig,sk1g.:ff...,,g.fgM5,5?g9?zQ5sff5.gigisygr -ngvwwqfggwAy5z.gg5gg5gggyg2gw4MQ.:f,.yK2'92Ls1fxiI:sw.s1,-.sane1w:efi?Q...s,1,,,.,..,.-lgfsiiigwsevrm-W-+ .wxvfgS?Y?gqieuy.-,,yfwivAwwf12:21'ia546kvaf5w -1ggqgAg,,fp:esamw.Qggg,5,,4g-.sv:sei.1:E2iv:ffa1,msmv.wff'A -2-Paivslesr ,gm 'L , 'fre Afsjzfgz-.yM.jQg,,M A fs 1 ifffwfa1f'SfX'bv?5Sf'f'WLM-1i5S2m55'4TiM?Qif22'1fAffZ' U . Afwiffivlfiifii 52 Zff WX'?fi?i'fffi1fwifff . ' ' VSV fsiww w X Q4 K., 5 K 31' kim? mam, ,f Yu 'mg Z Q REMGAM, ww :.-:,.: ww.. 1:.w.z--ru':11s:xVs41:2:.s-ij:'.V-1-'Egm k . , E A 1? YE.'-f.FNS5321-'f27eF..f1.:L ' wi- E?-5 7i'1Msf'f'95. fTkY:552L5' 5f5f'5fff'11:'l1f h' K A','xsugi4n2me-2mf1f..msgi.5:..ffm 4s1.'.s:21f'k5 ff '7 - .Iliff ESQ '1 M: LM.. ,f..gf,.15g--,mkgk f,,f:.L, cg-5-595 ww J .S ,.f-'ff -,gavzrssmsz 42, 'aw . ' K . ,, M in in .Q Q mp -WMM ff K 2 Y ' an ga DOWN BUT NOT OUT This was a good learning ex- perience. liwish its could have lasted longer. i in Steve Jackson U21 Being dedicated and willing to work hard is what football is all about, no matter if you win or lose. The Bulldogs didfiust that. Even though they lost a lot of good players, thisiyoung Bulldog team did not give up playing to the last moment.'Though the,BuIIdogs ended up with a 2-7 record, they tried hardand had a good time. This football season will always be remembered for the rest of my life. In years past l've looked up and the up- perclass friends of mine moved on. lt's an eerie feeling when you can't look forward to missing somebody because it is you who's going to be a memory, Willie Reed,-slot-back said. COACHING STAFF. fFront Flowj: Donnie Williams, TonyTLuton, Frank Hense, Danny Yar- borough, Terry Hardwick, T. J. McLean fBeck Howl: Barry Anderson, Jack Burrell, Alan- Johnston, Robert Bogus. Jesse Casey ALL-DISTRICT A FOOTBALL: J09 Bfgmbelgwl Mick Still, Dessie Ford, Adrian Walker, Matt Poeschl fNotPIctured1: Pete Balbas, Rob, Phelps f w g g lzlgggzgf I K j...,u1.z,vgg,:l,.,..i. . . I I , ,gagml b l, ,mg lmx.s,,.,,t.r-gtilz -ff---f -- f We ...sr .e-. .,,Qi.-fs-f,,l...z, .,. f .l ,,,. sf, , .. . -t fff.gw:f:rf:7'f 112241521fla24G?SkfWfdffsvgfww' ' Els? -- -:.fi+.2sw: f1 ' - me 'ry ,gl f . ' ' A.-,fff1:.7iz:szf,':ssz ' l. - --f- 1-ll.,.:e Q, Q. ,- .,.., V f f - , mx' -ff-Siieiills ff- 'ffS1fL2 ,LQ ,9Z'gg,-,l,,,,sWf.4 ss.: -s e11,a.sqglegg::2-,elf -- -- Q fs' Ma, SCOREBCDARD Them Us Gladewater 27 20 Terrell 22 30 Hallsville 24 13 Kilgore 16 13 Palestine 26 14 Athens 13 8 Henderson 20 6 Carthage 28 10 Jacksonville 22 32 Season Record 2-7 LOOK OUT, CUZl'Adrian Walker rushes for a first down. HERE WE COME. Mick Still and Willie Reed corner for a first down. 'f' 1 's'?4i'. H-r- n iff' ' f ,l 1 r.aeE3Y'5',.'?2??, ? -we K gi T V Hagan WAX 15. g. . fry. M1 is Q ls -2 - . 4.1963 2 , v , Li . . flt 2 . ffm? mc - 'A , Y ec 2: ffl-sv-3 29,2 .N 5-xfx 'K 51 q ,KKA A E , , ,. I , K. Q-Mig' .L ,' K ' g ' I A K f Q 1, . 5. . i + ,.. i I - ' 5 3. , ,S H. lkx .fb i'f. 'Q, - .w E 1. 333' ia ' 'Ai 'VV ' 'S hit K 7 -' . Af, ee-l rli 23 if fl A L! E. k te 1 TSI: f Y' H . . J '7 Z, ,.f Ii'-,. s., .wx V. ' .. -. at -. - ' x Q V. Y r U ,. . Sw, ,f:::g1if,:1 gust. ik- A 1, l. .- ,W , , , .-,M.,,.,., Q. A ., 1 2 ,.. M ,,,,. .5-A331 ,5- lll agewgiwwww - r-'r 1 . . ' ,r'. ex-T11 3 1 5 ..-X1-.-7 ff-'Ay' EYPFFQMM .-tm Nw. 'haf W . W3 . . - . 0 .1 .t gens. -v R 'ws' - - f QQ' ,fy +f .Q .',.,,,k: 4 uL?EQ'5,5w, . 33:1 J . VARSITY: fFront Flowj: Ricky Nicholson, Kyle Lindsey, Tim Lee, Corey Ford, Mike Sigler, Dessie Ford, Johnny Everhart, Shane Thorn, David Howell, Nell Stunkard, Lance Moss - fSecand Howl: QManagerJ Will Hill, Adrian Walker, Andre Price, Ward Carter, Mick Still, Chad DeVos, Steven Jackson, Kerry Mumphrey, Blaine Forshage, Troy Barnett, William Elder, Matt Poeschl, Cedric Edwards Manager! fLast Howl: John Charlton, Teddy Jackson, David Abbott, Rob Phelps, Andy Turner, Sean Sealbach, Joe Brumbelow, Frank Bennett, Brian Dingler, Willie Reed, Corey Redmond, Deon Waters. ji , AQEVZ,- F l-iflliiiw'itwlsefasggiilsgiaifwpifiiifggfages? fieegssssffr lffgfqw 2 my :wig-:xilienswiffi I .,,:.Qef,l: ff '- Em - A 1 if -' - f.: 1 1: -fffiw - Evrff14i'25E:li1v' -.,,sg::,,yffjg3g5Qgi, V -'5g3j'f37, 'li,7TiC?iiS'l 'Vrf5s57'Ui,,f .' 0 - 735373 ' it 5 ia-WMmWMMmmMMMWMWWWM Q OUT OF TOUCH. Robert Bryant outruns a defender during fourthfquarter action. g L wATcH our. Alvin Mumpnrey tries io find a block against Kilgore, o - xildllstt at-'wir Q-ff ur 1 Sa ill.. i B e e 0. 64 i J if , - M I . BYE-BYE. Joe Jackson bursts loose against Carthage. t ,. y g 3 sa ggy jgi JVTEAM -- 1FrontRowj: Melvin Massenburge, Joe Jackson, LambertShaw, Rodney Butler, 9 r 1 ' X ' Detrick Herron, William Nicholson fMiddle Howl: Hershal Massenburge, Jerry Williams, 533 '33, J ' S X Alfred Mumphrey,Floderlck Burnley, Albert Mumphrey, Travis Johnson, Keith Gardner, Bob- v 'i mb 5 ' sg , by Perry, Steve Harris, Eugene O'Neil, Randy Butler fiast Flowj: Sheddrick Mills, Marcus S W , g , i Griffith, Bryan Scruggs, Tyrant Gossett, Robert Williams, Carley Everett. Ronnie Simms, it S 5 .. ' t A is i ' Gary Mosley, Roderick Lewis, Robert Parnell, Jason Broome, Kelly McCowin,, s P- A A ,l,. A ., 'G 5- iii. i f is a Se. . ' ,,f ' L 1 V , I V V H . - :iv if .. , is .fx ' . n g A ,A ,,,V f , Tg.,,,25Tj, eiggz fi'-i :SSC Z ' fwfxzf svffzisss-.,,'v :wr . . ' asri'-sis fiiigfes5e'is?5?gs2S3s1win :ww - 'f A iw 5 ..,, I 57,f:Qk1l:: , :4,1EE547':.' ' N ii SZJZRQQ1' if5Lii? ' -iff15S5f5??'6f 'L 7 'livafesasii'swisiiifa5fiF,-I 5 srifsi' -5:37 Eggs' stains, izzsfasfisag gcggz- ge B M- iiill t .1 w IQ 9 Qs SCOREBCDARD Gladewater Terrell Hallsville Kilgore Palestine Athens Henderson Carthage Jacksonville 3-5-1 Them 0 0 0 18 14 1 2 12 36 24 KEE ING ofv T This was the most inspiring year in football I have ever coached. 1 2 CoachDonnie Williams When the Bullpupsltore through the spirit 1 banner before each game this seasonl they ran through with pride and respectq The team suffered from the loss of team members to the varsity. Even when they were out-manned, they played their hardest against iilt others but fell shorttspgmetimes. Whilefrnany peo- ple enjoyedffjlthei varsity on Friday night, they also itt 2 iiiiii enjoyed Thursday night football. 'Z Pt? siggiifisettw M 5 gwaw WSW it H g . ' H - - , , ,. , .. V sn f a t w 'K A r'4ais2'f3?,,gw .. , K tffsigsga g 5 PM-15: K , as . A ,fps 1 ' , anim-W-slat in tis , z , wfwgff-fa, 'awk ' ii 1 N' Q ' 3: '. A t-Wvsifszfdeiigff1v3!W4?7i5fI2f ': fi NEW BREED We proved to others as well as ourselves to be one of the many great freshman teams ever. r Alandus Matthews t9l .When the Bulldogs tore the spirit ban- ner, the opponents were startled at their size. Although they were small in size their enthusiasm was enormous. The freshmen started their season with a loss, but became more determined to be winners because of school pride. Desire, dedication and discipline were the leading factors to a 2-4 district season. The outlook for this year's freshman team and Coach Yarborough seems op- timistic. Playing a competitive district season, they should steadily improve in every aspect of the game. 1986 'FRESHMAN FOOTBALL TEAM: fLast Rowj: Frankie Russell, Johnny Jones, Joe Smith, Laggett Gipson, Robert Walls, Tony Murphy, Herschel Lewis, Michael Warren, Craig Bass, Quaid Thomas, Elvin Massenburge, Todd Emmons fSecond Howl: Audie Davis, Anthony Simms, Alandus Matthews, Maurice lngram, Derrick Thompson, Leonard Hall, Larry Bailey, Andy Payne, Michael Everhart, Andy Christopher, Donnie g Mosley !Front Howl: Gerry Jackson, Timothy Jackson, Matt Bell, Kerry Calico, Stephen Tharp, Jason Garrett, Jerry Byrd if f- r ,-f'fr r:-' WALL 7 2 itisr GEAP-S Xia. 'K . eeaeafepaee as , 4-3 Ha.. ff ' f A -rrs 'if J, 1 'i A, A E Z . YU ' s 15. as , , ' T5 A, E LL 1 . M. '.. sb, U . xxik kj X .rx E., D rfs 1- ' ,. .1 f ' N- s if, ,. , ,. ,V , ,,.. , ri... rs. ...,...,.- ls. ,A 1. - ., - f .. ..,...,gg W- -- .. , . , .,, 4. ,. ,, . . . -N, er ...igfiifw f if, 'gggggizi-mgiiiiffffiflfff f ' '- .. . M, f , .1 .Q we ' lf --'fgacf - ...wi lf!! 2 asifemsszzflsz fa.. at . ffm '22 -si 14221 seiszssezilezea i.si.,f'M7L Q,ii'!f: li 2,211 Er fr ff ii if ,V ,f 'sf-2 if., ' ,f . i':'11ii5'-.ifii.59r,-6 .ay , f f, f-.rw.i,,,,-w,f..s,w:amsm . f Q, . -- . --f- f .5 , I K , ti., .., ,sw .2 .- -w ,, . 25111 Lf5,g2s1,gti,gs,lg SCOREBGARD Us Gladewater 12 Terrell 14 Hallsville 0 Kilgore 6 Palestine 41 Athens 42 Henderson 6 Carthage 6 Jacksonville 6 2-4 for the season Them 27 0 21 0 20 16 12 12 12 PRE-GAME PEP-TALK. Coach Yarborough inspires his troops. I 1Vl F all It l Un ur u :ar n 1 m:.v:4 I Q ' aaqgwlwm .W 4 4 Y of - Elf auf? if 1. 2 if , i ' vi' f 1 11+ 5 W A li.,f W ' 1 , ' 5 , 4, A 'Q 'fd in , 4 . 1 arf 1-A K 7 , ml AW 91 Jw ' Sl-IAKING 'EM DOWN. Alandus Matthews shows his special skills. um ALL mom GANG, LET'S GET 'Emu' Tony Morpny leads me Bulldogs against Kilgore. l if' i'--- 'f11- i ffl l-- ll A 1 is sses lsll . slol sllll ael rsssol f sils , , :-,f -em -:fs': . f ,,..ff, llf senseles s' ,,g ii' ,iQ V GEARS way, 5 3 me YQ! gf? Mm?-WEBB would have meant third place in the district, another game for the play-offs, the varsit volleyball team's destiny to So close yet so for . . . Winning the last season game Y Despite the disappointing loss for the offs, the team pulled through with a 12 5 record. Everyone on the team worked hard for the season we had. Emotionally we were constantly up and down, which didn't help us during our most im- portant games, but we had a great season and were proud of that, senior Michele North said. To add to the great season record the volleyball team also accumulated-at second-place trophy from Grand Saline, a second-place trophy from Westwood and a first-place trophy from Chapel Hill's own invita- tional tournament. Cindy Roach, Michele North and Amy Mosley and Barbara Jacobs also received All- Tournament trophies. BUMP, SET, SPIKE! The devastating combination of 'Spike' and 'Awesome' was shown to the Arp Tigers as Michele North and Amy Mosley rip the net. PICTURE PERFECT. Christi Marier delivers one of the best back sets in the south zone. 0VERl OVERl Boy, Coach is sure going to be mad if Michele doesn't get this ball over the net! Jackie Johnson thinks. i -t 1 rr.' H -'t' t--' '-. I Y J E rrer Ja rre, kk ' iff? -' , ,.-',,' '- --'r ' - 'I ,V .V . 2' K Vkk, 7, Vkkh V. .V K. jgleizj 1, k'-,' Ti. 1, ,,,::'1, L., , ',g' 1 Vgkr- gjjfiztfl' 'i ' f , ,1ttgeWes,+f,.'.,gf,:gs,1,,f. -ef f. ,- -' , , 1' s,,' z. S11 - GEARS W. Rusk Fruitvale Ore City W. Rusk New Diana Leverett's Ch. J Carlisle Jacksonville Arp Palestine Whitehouse Athens New Diana J Jacksonville Palestine Whitehouse Athens Grand Saline Tourney Westwood Tourney, Chapel Hill Tourney Season Record 12-5 Amy 0 .0 'ff44o, b 0 99' 016i Q Q '462 'P' v 'Y 0406346 ,Z 6' O North Oglesbyy1Second Rowj: Johnson, Jackie Johnson Dean, Barbara Jacobson A t1 ,'l- 4 ' 0 Q C saas iitai taiiiit i iiit Qi 'SEARS KBDHH -,sl ,.., ., .. , ,.,. I I I wif, A,-, V , H., ls ,L Www-HQ, Deanna OgIesbyiYSecond Rowj: Rowj: Quianna Ford, Daphne Moore f Mayfield W . Tamela Johnson, Wendy McCor- . Kim Kimbrell fBack Howl: Tina Q f' Candi Risner, Tanya Alvis, Lara 6 ,A ,,... .,,::.e,ff-ty-ek, W,-,,,,M.,,, .WMM .,k, ,We,,.,W P JLQNIOR .lv 2 2 W. Rusk Fruitvale W. Rusk New Diana 2 Carlisle Westwood 2-'la' P 2 J'ville 2-0 Arp s ,2-0 1 - Palestine 2-0 W'house -2-Ot P Athens 2-0 New Diana ,2-0 , J'ville ' W1-22 Palestine 21-2 f W'house O-2 Athens 0-2 it FRESHMEN W P 2 UslT hem W.Rusk 2-0 Fruitvale 2-0 W. Rusk W 2-0 ' J'ville 2-1 Palestine 2 0-2 W W'house 2 1-2 2 Athens O-2 J'ville 2-0 ' Palestine 2-1 louse 2 O-2 x ,gt 4 xg. 1 f . Q. girls maintained i Volleyball was first designed as an indoor sport for businessmen who found basketball too vigorous. It was invented in 18 5 by William G. Morgan, the physical director of the YMCA. He called it mintonette until a professor from Springfield College proposed the name of vo leyball. The game soon became popular to everyone. he U.S. then introduced it to other countries. SURE SHOT. Kennard Choice goes up for one of his many under-the-bucket jump shots. SHARP SHOOTER. David Abbott shoots a jumper . over an Athens defender. H be A GET 'EM STRAIGHT. David Abbott leads ether offense against Tyler Lee. y H 351365 41:3 DON EDDY STYLE. Trampass Bass shows his Don Eddy shooting camp form as he scores a free throw against TyIerLee. COUNT IT. Tony Murphy shoots his graceful jumper over a Lindale defender as David Abbott comes in for the rebound. . S355 ii A Q ew zw mw 2411 K -- f fff12 C If mn gr'g21'g3--3' --g..,y..f.A-.sf ,V -f,- -- 2-1 f .gfs r,g.f ' ,sf ,,'f- we ,sfmii fax1fff.f,4'itsw'-siifsswi ,-,f f.fW pf, ,.,i wifi. 'Y --4...,,W.b, .. SCCDREBCDARD 1 . THEM Brownsboro A A 69 Lindale 91 ' 57 Tyler Lee 48 63 Bullard 1 68 67 Canton s 63 48 Tyler Lee M 45 . 87 West Flusk 71 68 Sabine 83 61 so J Arp 61 60 Troup 47 51 Terrell A j 69 39 Lindale 57 61 Troup 61 68 1 7 Grand Saline 56 46 Palestine 64 53 ' Athens 79 66 Henderson 1 A . 62 74 Carthage ' 53 , y 52 Jacksonville 54 ' 1+ 53, Palestine 63 557 A Athens 63 55 J Henderson 59 66 Carthage 51 y 56 Jacksonville 62, . 66 Record: 15-9 I 6 VARSlTY BASKETBALL: fFront Howl: Managers Clay Oldham and George .Greer 1Second Rowl: Coach Wally Dawkins, Cedric Edwards,,Anthony Mosley, David Abbott, Rob Phelps, Tony Murphy, Darron Anderson, Edward Ates, Victor Sirls, Trampas Bass. Frank Bennett, Joe Brumbelow, Jerome McGee, Charlie Johnson, Derrick Beal, Coach Alan Johnston i - .first team All-District guard David Abbott run- SEEING I5 BELIEVING Beating Palestine in front of their home crowd was one of my greatest coaching experiences. , X f Coach Wally Dawkins The press nicknamed them the sensational seven. Whatever the Bulldog varsity lacked in numbers, they made up for in talent. With ning the pace and post work from Edward Ates and-second team,.and All-District Ken- nard Choice, the varsity surprised a lot of peo- ple. When the Bulldog roster got downto only seven players, the team pulled together, became atclose-knit family, and turned heads by beatingjLPalestine and Carthage on the road. Every' member l',,l' of the sensational seven was an attribute to the team. The members of this team were: David Abbott first team All-District, 18.7 ppgg Trampass Bass second team All-District, 13.7 ppg: Kennard Choicelsecond team All-District, 13.6 ppgi Ed- ward Ates 111 rebounds a gamejg C arlie Johnson 18.7 ppg,il'11 assistslgiKelIy Mc- Cowin, and David arrett. ' COAST-TO-COAST. Charlie Johnson goes one-on-one for a lay-up against Lindale. GVETLIT BOYS .,.. Kelly McCowin goes for a lay- up as Jermaine Thompson comes in for the rebound. 7 .L ri 'f 'fiillealsfiW'ffiH -lii A T . ' -' ' r J' 'i 't't'i 'A ' ' ' 'A M ' ft if f'.. . .f'- ww:--'f:: mv-wfl-:fa t es TO THE HOOP The 1986-87 season was a great year for all teams. We are starting a win- ning tradition. The teams to follow us have winning expectations for them too. l'm looking forward to another good year next year. Donnie Whitworth 1103 J.V. BASKETBALL Having a winning team ahead of them, the J.V. boys had a lot expected of them. Playing before the varsity and having the crowd come in during the last eight minutes, the J.V. was mainly recognized only for their final score, not their overall play. Donnie Whitworth and Bryan Scruggs handled the guard positions, Donnie Rhodes had the forward, and Ronnie Sims and Sean Seelbach handled the post. Even though we weren't always. in the spotlight, we learned how it feels to win, and we became winners, Ronnie Sims said. With a winning season for the entire boys program, a winning tradition has emerged at Chapel Hill. SET lT UP. Charlie Johnsonlooks over the defense against Tyler Lee. FRESHMEN. fFront Howl: Matt Bell, Alandus Matthews, Gary Rayford, Fred Zimmerman, Gary Jackson, Tim Jackson. fSecond Row1:iRonnie Caldwell, Andy Christopher, Gary Wilson, Willie Mitchell, Tod Emmons, Coach Yarborough. !Not Picturedj: Jermaine Thompson, Coach Greg Brown. 1 J.V.. fFront Howl: Bryan Scruggs, A William Nicholson, Donnie Rhodes, Gary Rayson, David Barrett, Arneal March, Robert Bryant. 1Second Fiowj: George Greer, Robert Parnell, Ronnie Sims, Sean Seelbach, Paul Reichard, Roderick Lewis, Kelly McCowin, Don- T A nie Whitworth, Coach Alan Johnston. .il Y 80 lr r d .' . . i r l , SEARS NO PROBLEM, WE'RE WINNING. Ronnie Sims and Donnie Whitworth head casually for the locker room at halftime of the Palestine game. TWO THE EASY WAY. Kennard Choice goes above Palestine's Ivory Lee Brown for the easy bucket. EASY BUCKET. David Abbott shoots a free throw against Tyler Lee. 2. SOMEBODY HELP ME. Bryan Scruggs looks to dish off to someone against Jacksonville. T COUNT T IT. Donnie Whitworthi fgets all coest-to4coast lay-up agTainstJacksonville.l T 7 GET OFF ME. David Abbott shoots al jumper overs a Lindale defender. TT T ' 7 US THEM .iog -l-i T J J us them TT ,Bf0WFlSb0l'O '55 7 'T h' 56 y Palgstine 49 A Lindale TT T T50 TT 547 ' i ' Canfgn - 929 E 'iii Tyler Lee T55 T TT 47 Athens T39 7 Bullard T ' '13 T Whitehouse 28 TT Canton T 57499 if' 11746 ' Palestine T T 52 7 ' Tyler Lee 32 T ET Carthage 44 . WestFlusk 657' ' 741, T Whitehouse 72 TVOUP me 68 T 753509 J J T. KT Gorman 40 J Lindale' T T 67 TT - 9 Ljndale 37 C, H. Freshman 68 ' E 52 Troup 48 ,T TT T9fV9llTT Ts - 55 'T 57f Chapel HilIJ.V. T 68 T ' Grand Saline T 60 TT T T46 Terrell T 50 ' TSYFBHH' Ak K 47V Tgrrell I 46 TTGVHUG 535719 f 55 ' 5 '51 Jacksonville T 66 7 Palestine T 48 TT TT T567 T Cjntgn T 29 'i Athens' 'ii' ' 44 'L 59 T Palestine ' 58 Henderson 56 751 fi Jacksonyillg 7 66 Carthage TT 59 T, To JT 7.69 T itcannage T so Jacksonville ' 49 T T TT 61, TT Athens 49 Palestine 7 39 T 747 Whitehouse 59 Athens T T59 .T 47 - 91 T. K. Gorman T 83 A Henderson' 49 Tg 61 n Jacksonville 63 Carthage '46 45 TT ,T TT 7 Jecksonville 55 T TT 687 2 f E 'nec6ruii4-9 9 T T TRecord17-51 ' f iliiifigil :were A 'Eggs gs fe? li K My 'zfidazseesewefiimwaa ' w i L W was Q T -- 115 ,-5' X - f fl , - M L A geese ww - - TM ' T f. T -T51 e 11' sm .Hi-f.... :.f- - Wg? - V' H ' T -7 bsegggezeggs gw Y f L55 'S IT - . f- T swf ONTHE RISE With a young team and hardly any ex- perience, I feel like we did really well. g Cindy Roach Q1 11 i Showing a lot of heart and putting forth a lot of hard work, girl's varsity basketball went from 1-21 during the 1985-86 season to 8-15 this year, and earned a third place trophy at the Cayuga Tournament. There are set backs for the coming yearzgthe senior girls will graduate, and Kelli Risner, a first team all-district player, will have moved to Ohio. This next season will be a time to build and learn, not only fromsCoach Wallace, but also from each other'I'0 THE HOOP. Adrienna Welch shoots for two against Ore City. TEAM EFFORT. Kelli Risner and Cindy Roach trap an Ore City girl. PRACTICE MAKES PERFECT. Meosha Jor- -dan and Mandi Miller warm up. yafssmr GIRL s niskzrnatt GEXRS 7 . .... , Mgl5f.gfi,af52535gfr-ia133, i f L if 'ui L H ' 'H ll-igisfvli' 5 if 3.24 'gVL,Q1S34L ,lu-7 only :5?glj333j,gS' 5 . Q fp, ,,.g ..,a ' ':. : - - , ii: Af: ' iff f 8 f-figltlafeflfyyglakglyrf-s2we:1lqea4 :ffff,i1 -lf -wzwrwwieiaifff,-:ss-fflf ffwsfwf- I-we . .cww z':, IT,-PIM 5 lfiii-7 . ., , V, ,. , V ,,.. ,., .Jiiiilir 2 2 ,,,,,.,,,l,,,, . , ,,,. , , ,,, .,... K , , . .,,, . fa .,.l .le .,.. ,Ml,,.,. t K vt S'-' ' 1 i'll'1SJ4-w?:'5fE? f'lfQ77ffgl 1'r:'f-,':,'fY-7413254 5741555,vl75 5i3i'N5 WV':u xii A51 k-.fAf?l55, 'f H fill' - fy' If 1 as is Kim- ,N VARSITY SCOREBOARD Us Them Arp 37-28 Mabank 24-62 Van 45-47 Marshall 32-53 Marshall Tourn. 44-64 Marshall Tourn. 48-44 T. K. Gorman 45-25 Cayuga Tourn. 45-41 Cayuga Tourn. 32-44 Cayuga Tourn. 24-14 Ore City 40-31 T. K. Gorman 54-43 Hallsville 45-60 Carthage 33-58 Jacksonville 38-49 Palestine 26-48 Athens 39-61 Henderson 33-52 Carthage 21-40 Jacksonville 25-35 Palestine 41-40 Athens 33-46 Henderson 29-47 Kelli Risner - 1st Team all-district Cindy Roach - 2nd team all-district Sonia Nunn - Honorable Mention Adrienna Welch - Honorable Mention CONCENTRATION. Cindy Roach shoots a free throvv. y 1 REACHING HIGH. Sonia Nunn reaches high tofvvin' jump ball against Arp. Varsity Basketball y fFront Rowj: Carol Tave, Cindy Roach, -Rochelle Conley, Kelli Risner fTop Rowj. Manager - Marcy Warren, DeannaOglesby. Meosha Jordan, Jackie Johnson Evelyn Mumphrey, Sonia Nunn, Adriennal'Welch,-CandygRisner, Mandi Miller Coach Janice Wallace 1 f I , iglgf lls 1 4 J Vimslw eral. s BASKETBALL as 56 K X' ' , .,.. -. ami, .wg -feeble,-1ffgi.,?.,T5f ' lraweerseeile-.srffm feifzizzf at afsrzzwfrffffirs W V f - .. ,,z.fw.m.,,s N.: M k,-.-,,-Wgglpflfazraffeft-f .ug,,, s A e,1,K,,,f : WHAT A kick! fflt was a lot of work getting used to coach and a new way of playing, but really learned a lot. Trent Minter U01 s Change was the biggest thing for the 1986-87 Chapel Hill soccer team. A new coach, Frank Hense, brought new ideas and a different way to play. There was much youth and inexperience, as they lost four seniors, and played with a freshman goalie. The benefits ofithisyhowever, will be younger playersigwithliemore experience to handle the respoinsgibilities during the 1987-88 season. CoaChHense has hopes for the players to improve individually, making a closer, better team. He is look- ing forward to an increase in players, and possibly starting a J.V. team. SCLID AS A ROCK. Kelly Cross throws himself his work. SOCCER TEAM: fFront Rowj: Michael Coleman, Tim Griffin, Aaron Wallace, Jason Garrett, Kelly Cross, Samouth Nuon, Heath Thurman. fBack Rowj: Kashon Gee, Mark Edwards, Ron Gooch, Randy Harris, Mark Thurman, Robert Page, Trent Minter, Bobby Benge, Chris Benge, Kirk Newman, Coach Frank Hense. iNot Pictured: John Britt, Shane Rose, Scott Williamsi SCOREBOARD Us Them Vvhhehouse 5 7 Cormcana 4 1 Kilgore 7 2 Vvhhehouse 2 8 SmphurSpnngs 4 1 Cormcana 3 2 Pmesune 1 1 JohnTymr 2 5 Mt. Pleasant 5 7 Vvhhehouse 3 4 Lufkin 1 3 Robert E. Lee 0 4 Nacogdoches 1 4 Pmeshne 2 5 JohnTymr 2 2 Vvhkehouse O 3 Lufkin 2 3 Robert E. Lee 1 9 Nacogdoches O 3 THE GREAT HAND-OFF. Glelth Mayfield kicks into gear as Tamala Johnson hands her the baton. T FLYING HIGH. Debbie In clearmg hurdles. ins -. fa. .1 f IFF 22.1. ., .-' if.-,. :WW -' ,av-aa, -A ,4.....wh-if GW wi Q X W J Qt -em f Sv as ' ' Steve Harris, Allred Mumphrey, fSecond Mark Crutchfield, Hershal Massenburge, Thomas, Tyrant Gossett, Donnie Rhodes, Wllliams, Rodney Butler, fLast Rowj: Coach Luton. Corey Ford, Robert Bryant. Walker, Andre Price. Corey Hill. Randy Butler, Coach Terry Hardwick GIRLS TRACK. fFront Flowj: Tamale Johnson, Debbie Perry, fLas! Howl: Manager Becky Risner, Tina Brooks, Sha Bolton Mum- phrey, Tiffany Chastain, Coach Leann TRACK 7' ' ff l.' C' -I-i1f2z i rrta L . Iwnixfliesaili Ylang.-W! Pwr' r. :gr 4, V 'f - .K , ,.-- 86 ,trrr he srlr I I rrlrr -2.x 6.1. ra SING THE VANCE . . . e good this year, but next l be betteff' Gleith Mayfield Q1 Ol .r three track athletes their-State Meet in Austin: eld, Corey Hill, and Corey er teammates in running o ed workin with Coach 'e Gleith Mayfield worked I i Y ' 9 ' Jn and :ff'alSO appreciated 't everyone gave me, Ii. re Corey Ford worked in practicing. He got first in the 200-meter clash at the 1 meet. l didnltaccomplish l have two more Ford said. rey Hill became interested mp his freshman year. He that they moved him up to y. He was first in district all id finished seventh in ill-went all the way to state ongjump. a year but l - u 1 ND. Adrian Walker gives a last and takes home a win. ei .Q ' 'K 1 5 , ' Y I i t i if fi.--,wsfimi--ti,--fi--fi - -ff,-,,ffq1-gwrcfflwe.fs.-.rise . fi. r , . i k iff' l55f'??3P345555 fsffrff . Q.. i.1isvi,f,'i.f,a- t am.. 7 - GEAR? J PERFECT SWING. Junior Kerry Murphy shows great form as he attempts to crack the Athens pitching staff. ind f - fi -rrr H A - as-A A te , , 1Front Rowj: Albert Mumphrey, Kyle Lindsey, Joe Jackson, Bud Reed fSecond Flowj: Lance Moss, Trampas Bass, Michael Campbell, Donnie Whit- worth, Kerry Murphy, Ward Carter fLast Rowj: Coach Donnie Williams, Bryan Scruggs, Shed- drick Mills, Mike Barton, Ronnie Sims, Flob Phelps, Kelly McCowin, Coach Alan Johnston le? W ' L' '--' ,,,., , , , ' ' . ,.... . ,,.,. W. W ..,............ .,.. .... .... . , , . . VARSITY BASEBALL OPPONENT Kilgore John Tyler QJV7 Mabank Seagoville Kilgore West Flusk West Rusk Bullard T.K. Gorman 'Palestine 'Athens 'Henderson 'Carthage 'Jacksonville 'Palestine 'Athens Henderson 'Carthage 'Jacksonville Record 10-9 Q THE , ,,, J, gg' CHAM i NSHlP BASEBALL ft itl,' fBasebaIl isgfaggttgreat sport. It takes a lot of to play this game. Not just our won the games: it took our wholefteam. Everyoneghelped each other out, at 55557 4 Lance Moss,'Catcher Effofgi, o Qwork, and dedication took rthigsgtjfyiiftjnlgiteam a longiway, ac- cordinglitottftifioach Donnierjtitilliams. The basebali, to team, fieldiingiijrii o af only two seniors, finished third in a h district. This wasgysan extremely young team with threyeggsophomores and four juniors in theg rro starting line-up. The team goal for the51987 season ,wggsgtijryhave a winning record. was ace, complished. The finished third inthe Athens tourney, defeating,-Jrilifii ,Tyler and Seagovilie. Championship Baseball was the team motto, and thoughy lihey didn't make the playoffs, theirffghafrd work proved that they were champions. Junior Kyle,,Lind- sey said, We grew t0geth6fe3Sff3 team and have high hopes for nextyqyear as age will no longer plague us. r batting champion Ward Carter slwingsjorrffanother base hit as he goes 3 for4 againstiifleihderson. gi o, SMACK. With a powerful good, eye, Junior Kyle Lindsey connectsgtforlanother base, hit ' ' Y -- W-W .... e r ,A :tml . .,,... ' ::.,..L .... ' i DR,l,fK4fgiiMichael Barton fanned a career-record 17 baffQfS42SjChapei Hill defeated Jacksonville 5 1 SPRING SPCRTS EXCEL! I was very Sherrie finishing in the district year. are year's and two Coach Jack Fourth in district - that's what the 1987 tennis team accomplished this year, and in the history of the tennis program, this has been a strong finish. Qfifhte golf team competed on 'greens this year to help their team get much experience for years. Senior Sherrie Gray ali-district honors as is swell as Outstanding Player? ifor 1987. Cooper. received Most Outstanding Player? for the boys. ln tennis, Michele North and Wayne Thomas received Most Outstanding Player Awards. The doubles team of Tod. Byrd and Wayne Thomas advanced allthe way to the semi-finals to help the Bulldogs to the fourth+in-district position. Not only did the teams excel, but also the athletes individually. THAT AWESOME FOREHAND. With that loc of intense concentration. Wayne Thom: prepares for a forehand serve. HTHANKS, COACH BOGUEV' Michele Nor andiwayne Thomas received Most Ou standing Players plaques for 1987. -swf.-wiffifa-sirlvlawg-mfgaeemmfff'-ff., . . .V 5.5 . Mgt .. Qi. I E55?fflg:f-me lf' 2+ sm gg-f ,3,,f.,.1-- 12 1:'Sf4iSi,.g -,A :ax 7 W if? .1 - ,..,.w.--:T .Q 'f tgikijtutslmewgggmjgf we 5-- ..,. ..4 V ..,s .. .... -ttyi t '.t. f ,.1 .,.... ..,..,,,.ees.,.. fl.,. t ..., ,,,. 's t .gf 'P . ,J . A , , W 1 ddr 5 K ,Af- ,', X Tod Byrd prepares for has semohnals doubles march, 1 H . L :J www' X 703' f Q93 r if YW' 'S' a Q wa 1 WW 'rid F -1,YIE:'Zi- .,VV.: !,f A 5 D.i?'ZsQ5,! t?'34' IslipwCwgjf:Sf'ff :Zi :f 5,Q2f55i5g5V i 1zf wfH , 42,151 'msg 1,1 fiSXf?'w1f12s5w4 H32 f M'-.vlmii WW - ..,., Q W ,,V,m,, Mm, gd, , . AN' I 1 MW 2 Wayne Thomas and Tod Byrd advance to the semiiinals of district cdmpefitioh Uwj Udlllly YdlUUfUUQll, JUS LadllU, VVdyIlU Ikilllllldb, IUU DYIU, TEAM - Christy Pruitt, Kim Pruitt, Sherrie Gray, and Vicki Gray. fNoi pictured: Tracey +?QN?2.?fw Andy Crim, Scott Cooper, Keith Rhodes, Craig Williams, and Daniel -Armstrong. zvfeigg , . .. f W.W1,,,'4,,':.f yr, W T lg! , 5 if awww, 9 J za aggw , 3 igi bxf Jixg! K wr 3,355 141 56 12 fr rf fi r 3, L 55 A Q55 6+ A5 94,9 li -1 s wi , , Q W P, ATHLETIC STARS As ia high ischooler, my career in sports has ended. So, I say to all the underclass athletes, don't sit and wait for something 'to come to you. If you have a goal, strive to accomplish that goal. A Dessie Ford T121 ALL DISTRICT HONORS Football Adrian Walker - First Team Joe Brumbelow - Second Team Dessie Ford - Second Team Matt Poeschl - First Team Mick Still First Team Pete Balbas Second Team Rob Phelps Second Team Basketball Kelll Fllsner First Team Cindy Roach Second Team Sonia Nunn Hon Ment David Abbott First Team Kennard Choice Second Team Trampas Bass Second Team Charlie Johnson Hon Ment Volleyball Cindy Roach First Team Amy Mosley Second Team Michele North Second Team Jackie Johnson Hon Ment Felisha Dean Hon Merit Stephanie Johnson Hon Mem Soccer John Britt Second Team Mark Thurman Hon Men! Track Gleith Mayfield Regional CoreyHllI Regional VOLLEYBALL Clnd Roach BOYS BASKETBALL David Abbott GIRLS BASKETBALL Kelli Rlsner SOCCER John Britt BOYS TRACK Corey Hill GIRLS TRACK Gleith Mayfield BASEBALL Michael Barton BOYS TENNIS Cralgwilliams GIRLS TENNIS Michele North BOYS GOLF Daniel Armstrong GIRLS GOLF Sherrie Gray FIGHTING HEART AWARD John Charlton FIGHTING HEART AWARD Evelyn Mumphrey Corey Ford - Regional FOOTBALL - Mick Still TENNIS RECOGNITION. Tammy Whitaker, Lara Stallings, Amy Ripley, Michele North, Stacey Florence, and Julie Babbitt receive awards. I CONGRATULATIONS, MICK. Mick Still receives a plaque for Outstanding Football Player. He will go to Lamar I- University on a four-year scholarship. is ALL-DISTRICT. fFront2: Adrian Walker, Sherrie Gray, Dessie Ford, Michele North, Evelyn Mum- phrey, fBackj: Joe Brumbelow, John Brin, Mick Still, David Abbott, John Charlton FIGHTING HEARTS. John Charlton and Evelyn Mumphrey receive Fighting Heart Awards. K 'ff- CONGRATULATIONS!!! Corey Hill receives r the Track Award for outstanding achievement. L. ,,..,, gg 5. Pegg HEP? Q is ps A 7 3 J , Q H Q N - Wo 'W W 7f'f-'lyefx 1156, .vfiffwy-Z Huw, :-,f:Gwf L :gm .w,,gf.,..,,,J,y. ,fw,,fw f:,,f,gm a, W Y if 5 in si wwf il X ,lf SHEIK FARRELL? Senior Farrell Pinke seems to favor the Arabian look in headgear. PLAY lT AGAIN! Everybody loves to party and senior Kim O'Neil most of all. GOING WILD. When pressure gets too tough senior Shane Rose lets go in a big way! -r 4-zzz. fizfh f - V 21 . ff - . 'w' A 2 ., 'iagmqf :wi , f ww J WQLJQ, ef M2132 X' M gf,ia K, 5 - rib Wiigg W Ye -af ffiek 'W '21 .i .' 4 - , , W W.. .,, A m , Wm .. Q 'mx Shlfflm 9? Geors ' 8 7 ea Tag 3,113 5? 'Q WL- ' Ai MEP' Ju My ' , ww w, Mgg, - ' f-1-M? V' Yew vw-. , - si.-J. yaavigaaxq. ' T3 A fg,5iQ?,w.,, swf . N -e 2 f we' QW 535 ,, , , qw, H ,5 1: -:A , . ,, 'F Y va X ' fs: ' K'Q2555',?'6i2. Miss QQEQE . 4, fm -mx we 'W ' . gk? wwgf, 3 'W x 'S 3 9 ' ' L 3 fi' 1 ,gif H, .-.ul v' wr gf? KYESQ5 Q 752' '?'3f'w. pm ' M , mf .pgs 2' 1, T Ak' 9533133 E3 C W25 wiki - w WWE? Www., s' ' fsafws. ms-3' , 4, my an as new '3- 5 fi, ma. ' A 'wwg p 5: lf 'R 'wig Q 'fx ,Qgai aw iw? L 'aim J v 'YQQL '1 We Q6 ,. W- gym ,Vt is f W 2 Q 4-:gg 45, fa 2 ,Q :El u dh, v9?g a x ,, 'Q wkkffqgmigi , E f K , 4 54 4333 -H25 'Z' 522 Q. -Wil! EWS v '-W :fww F . '9' z' ' X 3 4, - . I , ' '7 TA Q1 A '- -2. ff 7-P Wifi ' , ff. wm-.w?Vfn.- W QN ' in 6 'Far SQQA5' f A. W al . , Q , ,. , Q 3, 'L is .Aa 1-.mv we Mw1Flw-H2a9w'1-W dim-+5 fav K Yi-Aiggszfvxw A Wfwffcfwgm bf ,T 5' iff74f?'Rsm 1 iw . A ' -. w as Q A g A '3 mf ...Q - K3 Q Egfr- -,F 45,1 , A 'Mm-, ny! an qiwmx, +'?:af,hS,f-Ygi'5,'sh:-w'E'fw f Am -Q m--.wa V' Q, Qs, K 95,5 A-fm-, ,fee ,, if eww' 359'-32' V 1-f1f3 f3 ? if ffm - ws r rf me 'buff Hawaii 1-51:9 Q , 252:13 5 , ig. ' ia .3 ' Yfiv . New gp 1 hhmiihwax, 'TQ . 'MLS fan, sy .-22: Q ,f Qc' .-4' 1 if m , W K t W5 Q W M5 2-Y gf, x gb 6, -,N 4 JSA Wfgiiggt ,x 'Q 4, 21- ' 'G iw K fx M, ' Wm MEF Q . 4 4 ai 'Qty ' Z aw, 1 -Q , Haag? wri J H if. A Q , e 53 Xa? U v m?',.j4fQ,, A X, 'mmf :fa In . x 4 I A 1 T ' X4 V-f W, 35 Slfglik. V'f'i4-if'Q'w'f-ff wa few:-.J,3'.wegw, 'wgfwzf3gse:fl4Qif5LgswfgqgJg2g. -'iii-lfaqgzf 1 5 1 :wx . 1: . ashes mix. W''?zii':f77gff'2g24- we Q Wg? ' , r K2 f fazfzf :,, N ,, W, , E 2 fi X f:sr2ffzl1f+? 4-.gr-2ffmgktw-,fin F,i'fie-Aifimf' ' f: 'W wr wifff,45:vffgfaxwangamvizfwinsfwwwk.. , ' V . 3 sf inf... ,:ff'1-'ffgiig PM Q .. ew-- , wig W, rcci ee-i. I ciie I I i . I: :rf I I . Q Aye We g 522,55 Qwest K A qlifiiig of as Q f 3 gaftg we 7 t X Q, 2 as , gtxetazjlgeli H Rgwaw New gig if Jw Biff' QT in if 5 f awe wwf? li esffkwsfi emfiggi ,Q Q nf, We 9 2 ge warm ?, wit its '55 5' 1 e WZ' ww.. if i 1 Egfrwlffeee e aiu, ea ew 1 Kang Q if ,al WWCZ E555 ewwiw 1 W if fy Km fn F , ji 1345415 if gifjfylihfrpeea egg if 45? Q wmv I My i ami? e gig ?i, Q, ,R , fin it . 5 ei, etiwf M. f like grunge infra, fiigarfeee, 1- if 5 A ,a ,seg 7 jx, QQ 4. ff, fe ,ftgegi N, A ee, Q ig iv 4, l W f 1 X kgiglsla ffgkig dljiiigdzifqlgwaai, i if X52 5 gs f 2 if ,gr Q31 W M , af if i if if eiHifL?effg3QiwegL5giwi,E asia I A if me ar: ,wif fm fgffi gi i Q Si K 4 efmlffftrft ' e ?ifMT'Eii'?2 5 awe-R 'Q it eew at M i V92 we Hi 1,i..,,ik,. I 1 ,Wager ii f 2? 4 i we we 'ff 1 5' le is M My af iw ef s i M M i is i mi F1285 14123: g,PlgNfwY 7531? 4 l kgsfiqfkwvfmw, M mf Y fs, egwwaakiagfxi avg ,sax ,ui 2 Seniors at last. I I Most could look back with pride on the last twelve years and look forward with hope to a future of challenges. I The class of '87 will probably best be remembered for the completion of The Wall. This project gained the respect of both the student body and the community. Student Senate President Sherrie Gra said the main goal of the class was to establis a good name for Chapel Hill and felt they helped to ac- complish this. She added that the class did a good job of dealing with the many changes this year closed campus, state rules in education . . Vice-President Mindy Webb and Senior class president Vicki Gray left everyone with the advice 'go strive for excellence and never give up on your reams. A LITTLE T.L.C. David Flemons seems to be taking good care of the greenhouse plants. SAY BYE-BYE. Steve Jackson needs to leave Poochie at home. YOU'RE KIDDING. Kani Crawford looks amazed about something. CONCENTRATION. Toby Foster finishes his final strokes while painting the wall. SENIOR NIGHT LIVES. Judy Milstead, mother of David Abbott, is escorted by her son while Randall Milstead joins them. . If ,Xi e R.- -,., I new I p ' Fra . KA sg I , it er 5 -Q.-si S . rel 'ix Y 1 A': ...x.l... - A 1- ' ' ' , ,fi A: I S 5'-asS'f'r'isi?'ME2VI l ' 'Q 'iff 'Y 'Va eff' ,Lil Elo, IPSW-?7'f '1't'fi:QU.' 55.ii'-FTS,f9:?7I5'.'33?, f3595f.55Z3ea5i2fz1fif is f x f f in ' eeaeziiifim 5461 i11i4lswsz'ssffeziiw :ffssffiswizsfsfvi :axle ,irisiizaifget--:wSii--eyes lei - f f '- qifgiwewezifiigifwgigffgfvgwaim I., IM. ,, .H .mn W, 'gl E, I., M.. Wie, ' .Q My 1 , ei-'lf Q 6 i ew, .fi-ffwf.,s'+xv4:f --'fri :mv f-we rica- 'iffsiifizgerz vfmizsw- amgfge wwe 1 l l ig di g 3 ,gr V , 3 -L an ,Qi-, , V : : fi .. , v x ' . f Qi 41 E . 9 - 1 . f l yr 1' ,' ac, J 3 is - 4 Q 5 - -'l if al. , . seiqglixi wi r l 1 EWU W My , ,. , l MM i l , i'WllliQ-- ' ilaiil. ' X .ew ' l 1 3 ......,,, M ,. ,,.,,, ,V , , . K 1 8 Q' YAJifQi-2345354gi?fgss15ifi5fd'2f?gies'i3w , 'X f N ,le:iwal,fmaelfesfssweef,Q f X .,LA.,, A-f, --,, . 1 ii fl...e..,m,ilw,,,i.ma Q K .i.. i .WiW..il,2,,e,im.,fi.w,.Q,,,,li..i v -- rf, f vigillawgwsgivsilifa:.mm, -- if gamsizarisiggsggi . K U5EfS-'E.fPl'Q5Qi:5:i!55if1?f glgggigeessk fE5gg1flf:lw2il,..Q ,family B mg i5..liiv.c, K -K 112152151 -,igiflgsfsllfviggiissvfai :fi 5 sffesfsfiiigsiiiwfiiiwlyi-if-JL'2-Vl . if f-s.H-lBaI'7lt1'it I , f 'Q -tn -L1- - 1 wwf. ' A ,f : .a 1 --,f z 'f-.5-al -f' ' ,1 14615 g ggeeeviigjiglilssicsfggslggg ggez,-,gifs-fix: .215 4'K 3'-,ff A H ., l gyffgf'lglgy-1l.3flgi -gee -giifl-sig '-- - 1 if I V. V' B -51552. flriiivgg-is-f. - f'f iiffiiiisifiigg-'law-5 :': :QL ,' V 'f'l?ilsE,' '-sm' Slay 7 : VM 'V 2- 'fi v-'f-. . f' - -'-f gf1': f ,, f-1. W'kk imh B f . ' in fs' 5 ,wafiblfn f--, 7ff5'4?5iff?555?5lI55255i'5 f yklfi F ?5?!HV'UilxEiiL:l'if55iLr55i59i'3-155 Xf igki ieifl-X zs5z?lNif QW? .f--.kf, 'fi .s J,.. A-,fm 'fl-'ly -. K l f iliii e 3212 3 ef 7--- ififi'-'fsiwgsf 2 eiflffinfr Tl- :f'-: ii'-Vffilf-llffi i -f 2M-- Wrwwf!what..'25-itcl-.Q cgi, .. . , , We i Wai l Q S . S9351 0 i cms Q David Abbott AbbYlAd8FflS Johnnai Adams Shelly Adee Bradley Allen Jackie Ates Michael Bagley Carla Barnett .Michael Barton Efanklin Bennett Richard Bevel Sherri Blackmon Justin Blevins P xi as, ,f'ifi'f1i?' 'l'f'i3kY?1i? 5Hfin- 'EE :WSFlf2f'i.w5.iWh-E?iLi5iUgn: 'fiiiwyg'-r as ith:-.:ii, -ll 4 .L ' x 1Gt'it'ff--3?fi'Ei7f5l,'55HQ? zi?.v.-53.5-gf.Q,5,l--lj . iQQlV1gx.fxuf I.-'1 ggflggzkgij ,.., , i. ,, ,...,,. . gf T13-f -' ' -f . A SW? - . 5gv! 'ii?3'7f F71-fixstfeilli ?ZiY4ir7i5i27.g5-5535 V f 1 . , 3 f55,qjmjlift55:535555-L.5g:fzgj-gig.L: H,,,.m1i Qwgqkkimylimt :QVM S I E: C John Britt Brown Llgloe Brumbelow Libby Bryner Angie Bueno Maxwell Burch Sarah Burch Mitch,Burton y DQYIQQBYYU , rhrqatajgyrd C JOB CHUQ Holly Carlton HQairQeiifiTamoy Carter 5 C Ward Carter i John Charlton Tod Christopher Cindy Cole Sidney Collum Jodie Craig Kandn Craylrford Michael i ih C r Eddie Cundiff Laura Curreyi Dee Dee Daly C ' Amy Davis 1 x ' e ' za ,f -3 X f ,I ' J Wi' viii' T r irl' r ' elitist fw3i:'S.fl'x 5-a 5. fi P 12.7-ff' , KX ALR-fl -S+' 1 1 if .. ii fi I ' . f r i 5, f Q f 'QED nz' H l N f lf' .JL ,aff an, . C' , 1-We 'if , rv- an G.,,.,,', . ' ,vi 1 ,' if . . ,Y E C as fe 1 , 3.- .- fr' - l9Us I ' p . r Ni? ikvi Mx 9 fr-r A.. ,, . '-A 1'0- rgr . 'T F 4,f' 1 xy lllrpvm Q , 25,12 r gr, 5,57 YEJNWX7 Y fx 9 A fa 43. ,Z ' .SWEEM I if -MMR 2 . Ck fm 3 no et , J ,Mfr 'ii ' ' r . , x V: N, -A an M fg? 4 W r 5 sr '- ' Q' ' 1 , ' , f - .. Z 43 K 'limit' 5.1.4 ' .fl trial, . , 4 , 1- - fe. a , . ,,. V Q1 i rwx . 1 me .,, -vtgiy , I 3 -y -I 4 k ta, f. ', X 4 i .i f f I' V 55 ' 9.. 1 , 'f.73,, ' V r ,. -, ,' -Jef :SY ' 1 ft 5 ' ' X -f Lf' f ,- . -' an , 'Q . Z 5 . ,, , 32?gf - 5 gizam Sf' ' ' 'f- r!'f . , N P mifiwf fr me e , ,r ,,,. ,.., r.,, . r QP Q 5 +, 2 f f - ,- -- 1 K A V ,VII K , X wwf iiYi!Yfki22iriifif2l-vf'- f- fffi -119-5w:4f'1.s1Qzt:errzsawiis,arefrisfegwaisasfwrmy-sfggaffi-fxfrzfarrare.aags 1 f ,,.M 4,1-, 1 , ,tnfffi '2?1'.'1S',-fiefwf.ifsm'-ff'iflffeiazfsiifiazsffrfrfwffxezsfirf-rar--'risk Nsislwxfm-in - i'9F'r,!h.' , . ,rag ,, ,, r , 2. --fr -' X V . Wg. . s5s9l'i,':r . Bo if-ifi1.x: . ,A We Q-fiz'e-.ff2ff,rg,:1r fw3mAs'iwQf,i,v:1'f wzsln, 'wr ,':1-,-'4Q,ff:- . K 21 ' ff f Iyswiiafegir- .2f12'Mf:.4?'i3M2',ia3::fQ--mf?---.QH , A I -ff-- .,.e, ,.,.. 1 , l,,. fr ' V- A, M., ,f - K .. .... 2efifwmfgf5,f4f::,.,, fff.w,1m,fr1w-,wr wreifiwe fm t1frf:,f:S5,-mefiifzm t--f amimarfelkraf-Pimxrszwwifi-, -- rf ..,, fmfifrg .mane 1 J 5 ,-.imsw,,2,fs2Q,WeQ51fia5,,.ra354,3,t..eff,Xt,,ttQ1.f1,,m-fri,..r,,,grM,, ei.,m,,rmg,Mf1r,,,,,g r ' Y 'li 7'W-f1w'1-rmfeiesef12r-111.-sw3 rwwe,,-amassfartsirfagffgrxfifiivstemxewff'5iY i''' ' '-f- r Lv,-:fire-fer-Yfi2x2e5emirffwmarix-raesgaeztfwzrvfearfff-QriffQ--1121fisQi?:Jt2zairrragfsiffflfwsrerffef.,azzzfw,-,f.fwqixzzes Qefwfffaszwkzaegf:wznaff-Q. 1m,t.f7rg,,?rrrsmsQ, ,rw-femg,riwf f 1 ff,f:gf-,fm,r,,,3f,.mQfQMqu 1,2-sggggaeilwgzw. S t K wfrrfo,-frigfrg-e vi Lfrkfwwmrfvirrzww-sgrrg.:P,i:-.W Wfy41.m gif-,ezmfwrfzaitr:t,4f3,5lga4: ff ,,Lfg,f?wH 3 W A Rr ,rr A 15252 ggi ia -may aw rw ri ,QJSE gr W mf rr are Q rr M J Q N 5 H figgmykrggzitfgggrm R, aww I R5 0 raiiiiiia , a BNW- Bwr ra reefx, , r x,syJi:-w6 N, yy? Arg tw wear W Wa ,. 2 wrisfxfz Magi i Yi 2 ,aQ33'5'5Qlr2Tfg??i'srQ5 f it ri fx 1543 F ew swine we ' W I .. WA :'.. E: , r QSM' ' sf1fI5fS9?5j,jtg54fr X 155231 i?a?iQ:,'E'Eff,ify53j,vvf ,N ve-Q - 'ff ,,-- ' zrA..E,1r3553:'-ggjpii53,,fiA,4Q... ,IQ , . f 1 will- . :if-:.fT'iiiisizisri-2Qf:?'E5t NM. ffl ., ,A -gg? X giyQ,f,f:sr2r,af wf.e,M::f1,3, ,gf Mi., :wry or .ygfsiiiz k A, , i F r -- :, N1-1 gk K, , . west if-ilvi' f I,-515231. ig W, -arg' ,s' , , - .1 3 Y J ffm 4 f fl X 3 leaf as 1 1, 4 Q 5 X l s A 1 25514535 121715-'y ' fffzg1.t1'vif1af- gm Qiligffl-i ' Y 1271 --1'5 fESSi?i?f11:f51if9l iffcfmt f gegsivgzm ,gone five Svef455535irfiisigflgsiifig-5554 f 3 2 r:?ifiiii??Q?f?El'??5? N Mswlszaxw-we-f Q N sr 2, wggimfgisiggi is . WW:zefrweggw:ef-eggggngreHQ ww L vi e-r,l,fgi3:1:3Q,:e, 4:1:2,flff ff:eff!-'ggzzffif-xfesefwfvewskisvgf A3 , R3 5 xgmigqigyg .,.. M f--W ,,,m,w,r X 3 11 1,231 if dis'-szfigfzev my L P, Qi X fi , ,m.W - . . F 1. i imyfl -:-' -f : fun , --xx., L:'f F F F - F :gf1fw,:ffr f.,.. V, rr 4 1 V .ffm - W2 X r 9 , .V ,, M M. lg! ,sei L :2siif,gs5g4w ai,ree5?l2ss2gf12fe-ifif :Ti-ij it 1 we 7A.., ',2?2rs51f1lf5Y?s'E2 ish fm? fr- P ,exiffigg-vfizAf2Ea7A?iifiiisxfmfq x s 3 i as li ' gi, zz V '5Q'ii '-:--,-' so Q P , J eeeeo , ' 2 K K wg ,ff' - i A i ' 5 'LL' . ' L ' -L LNL'- L- -'f.- 1m'1 D l.i i 3 5 f rreo F D , , .1 k, W 5 A W Lf f ., V A , W , WZ .3 n x., F A , ? ,.M., W Q A Q , i.,A .. Q iere D D f 'wifdiiwi 3 R f 1 2,4 ,QW W ' F 5, iii, f i F ' ,.-. gf Q 4 .f r W, 'jf F i' A . . f' - ' ' i UQ J fi Bill Davis LH 5 fJf -'lfifff' Michelle Davis Q :ew ' fs- -1' - ' -f 5 , gf S, yy? do J K, my Fernando Dean .. af f 2 -, -ji '- SLB, K -4 K f 5 ly my 1 ,. Damce Deffebach lil in Qftiix, gy, i Brian Dingler l -. , i ,ll K.,V 1-7 4: qv-N , awww? 'jfhgirn g ,xl W :tml , 'I , N . V1 :n f , if H X f ffili if . , , 3:1 2 ill' Q il 'H l W , f 1-.N 2,- i i' x.,- Q- '- 2 ' A+ X-Emi: if 'f' i ' f 1 ,f ff as Robert Diirican Kelly Dykes Jimmy Edwards Tim Elliston David Flemons Dessie Ford Toby Foster Kevin Fuller LisajGrage Joeiigggardner L W um, M l XX 'M Q www i in ,gl mg me e a M fiiuefwe fr gow JEL, e N YW 9231? , we 3 ggi We sggwxs Q 1 Q' M3 iam ,JPN page ,iii I ,H ami rs lweig-me degli My gmwm Q, N M1 4 1 H f . 7 , - Q'sev1g,w1 wwgggvgw mg i- i' 5w-1,gZggg,.f,,ffff- --,-1 ,fgi-13,333 - ' QQQLEH H X my .' K , . -lffil' li?ii1.5eTii1f?i f.QE 545915-r15,,l 45 k Ll. --r.'s.fM'1mMflf-fin' , .fi Life?-1',mt'fsswfir 'Sz' f12'fffx545f iff :1:.nsf?'iE3Q9f5' , V fl Wil' fri fiiiti:341L'eff5 -.N-?iiili21iiEf?1:'Szbffswim:Tk31fei251vsX:4fi-5.1 Yiif'5f:L:-S.f-A f Kelly Gilliam Flenea Gilmore Angie Glaepie Rhonda Goodrich Sandy Goodwyn SherrielGray Vicki Gray Kerri Green Scotty Green Terri Green Robin Hall Chris Harpe , y Kim Hartsfield ,.i1VffHenny Hendrix naia 2 G Corey Hill 3 l 3 .Q QA G Z5 ,Q --1 Q w ip. ' Y 1. tai MF le Y W law ' ,ff ll 4 V, ,W ,ef A ff,, m,,,,4,,,.elwelff Q., Xl, W ff, ,-,-f , ng, 1m,.1551f,5 lgsw lf 3? 'T we , ,. Wwlgx 1fW1flw:.:ll- f wif- .i f,,,,,flkilmafwagzf. A-Www, -- . ,..ff,ff.,...,Q,, ,ml me ., .rf -ff-f, 12,-L, ,.w.e, ,ie ,, ..,, V- f,,.. .,.. , ,.l,lp,,,als,Wk - ' .,,...,.l. ,, .. 5,,,..,m A fx nair limb? in me, lii af? or EVERY iiile lrr G G, G 351? 5F0S?9'i 4iii ZQEQZQ f ?'5-ff alli iaii GYG4 iii G iii i G A G ' 1:1SIa1!1l SHIFHN6 P1 5 GEAR5 . V - .V L ,. f,'iS:Ni1f.?l'ff i-si''AH':,-law.zxngflfi?:f s z ' -fgggifzzelwfmei fir ,f'g2pjw':.1z-191, . K 1 I Vkyyh i ,ny . . , ., K, ,kl, ,. A h,.. .M v,l.W, M ,..,, ll, , ,. l 11:1-flf :'f.'f :if '-fsiif'''P11511Q?if?Qfs.-ifmffszi-'fi'gm1wc,1,.:gl,,ff-sag,,ifj1yl555w5fffznf 'HY . f. ' K ' +111- ' . 1 ' . . fi.. ff -Q-.mph'LETiQLi9izi:i5.HS'wfilf' - i' J 1551-iiii5iZ.T1'z'fiEfWil , , G n K - slswwaw-,,22rPwm,,-fa41:1,.f.,,i f - f,,.fffg,,l2--we ,,.l,f:,,i-l,,:,,,-A- lk of gl,He,.w,,,,, li,ik,l,x,-y yan K . flfym ff - f- .,- 1z,1:'-lesflgzffzisflsgflggof-ggfgllf 1. new ' 5 1 'Q ii i- My 3, . V 1 A , fl ' V . W 1 gy 3 0 Q. 1 Q f i f r ' zi. f - eu ff W - ,Q N x T 'f' N -5- , , V V Q , l i I, I. il' i -Q' gf flaw l iw Y r A 4 ,0- , lli , i f I as . ii. gi 4 ,V 3 Q . , 'QE :gl .. 'k :lysis i ' ' ' 1 T Q i A l W J Te . 4 sf 2 -qvx. I 1 Wendy Hill Leslye Holley Renee Hood Julie Hughes Gene Huisey Justin' Jackson LoSeethia'Jackson Steve Jackson Terry Jacobs Angie Jenkins ..l- Charlie Johnson Emma Johnson Jackie Johnson Kelly Johnson Keri Johnson Delores Jones Lojuana Jones Emery Josserand Keri Kelly Tony Kenner Toni Kizer Steve Lenz George Lewis Kishl Loughmiller Traci Lowry J ,1--f-T 'IQ , 5 iijl-T4 , :ff , 4ii,3: rijbjft 2 5 ,Q L PM Q, , N t 2 fr i 5 ' A fr E s uiEQw?55fi3i5iS55,,Wgig5,.gg5,g5g,hggfgtis-kM?Ek,lf.taE,-kg23,,.,.,Q.i:gmif:m7Qggggggxfecvggfigggg-w:g3ggggg:.,2ggQgifgggnf 35 Q.,:semi,i,t.,gE5,gig54,J:3 g55ggl:5g,gr1,QjLZgsihgfttmgggwsgmggii:fzg5i,g55ef5i,wgzgk1Egygi5,7,gs,i5,5g3J xg,-. gf Vogt W X gina r M- f 11 ggixftw f- -,. iiwwt '53 mwtu aegis ,rwmigi 1,.g5,,l.SSee54fffa11f1vL::,we1vi5f?5iqif-33:qs. 5,5:Q-5,-M ., ,, 3, Q v ,. -. 1 , i fi ,dai 4 5 We K' e 1 L I Ji L i t aeiggwign ,gh m,'gigy,3j 35efgiQ' were J tv Xa mms K K K' ,f'w1:57 WE- t1f:vf1 iaf.5 evsea fcv-1 'Laid-f fM 22f1'gf:wy2::mfg:gi,0.55311Wfizzfsziisifiiwas 'xii ffioiiffwficxfkqii 45351125 - . 1 H Wzisfs-eff-anwas gsfszwzzg--Q. :Wu1e:Qiff2s-.is-ifs2i- ctw, wr fas?f.551f -- Tw . .sqm-:i 7 A -- H2 M fi X M W i.sggai,trsws?1entr::sfSw t . 1. .X was , , W ,A .M-:.wfs,f s,J,M,, .,t, -Km. Sam., V-Legg, wqxgy --,fa - s1g,,i5,1Eg15f1'z,gidfQ 7s5ffsg1fw:a5ff11.fQ1-Q591.2g2ggz,f4,ia:zi5k.,-yy,..-51,5 ,,gfi, wg54.f4gig:5, . 1 A, I wekiifw-sr-fiizr'fer H2125 . . r- wie iseiwrfrwer r 5 MLmgw,Kii5im?,?gi N K 65515355 sa i S1 Q Eisfkffxf fill-??2g:. -if fiffidiwfixii L iz., f tem ..--2' nw-,-ffx-.:',gQes,g.Q,gs l l . an all -. 6555? ' Steve Maynard - !lf?5i'-- N355 iI5'z2,Li55'ffilii-'li573ilf--Hai 1557451 ljfgjfi-iii: 'Kill 9,591.2 gSffj'i,1,S'jlwf1',li?5pw'55-FE',.,T-j no WI'-f?5'lff1 '?Y -Eiwwiasfizlf 2' SEL-'E--w wah-Jr 1 S ,1wf-in-.flff l ff Hills--fdw-fffl-MS'-- W 1-Q2-ff?-P . lf 12552153 235721 'kifllpmffiiil.v,f'f-gQi'1QlJiU5 :TSE ,?.Qj?if-55752,mg,:i3ifv:,fiii,--'Ji9gig?-ikTiS'QfJ'9 kTill'-''2?l-7,33 27522 gllgellfggfier'silo-s5l:?.fPg'lfi??fqbzsgggg-gilzwgggfsyigegilgglslggzaggggggaigaggggmgg ,fffzfamsf fm- wgl 'Q--faf'fLlifn--3f- 'ffiiffz:1v:f-.law--.A1Y m.a,.-9w!kA11Wwg,- dw- tg , ., L... ,el l,yw,,,,.3l ,'a1 S: ww. --V - eggs will 1 . -fw-92 -fv 'Sfff'-35:5- lzi. - M - . - .- ,ef - H mm,--aw ,gp 1 ff ' l 5- wp -fi-f 2-W -- k arl Q-,-lm-W,-gy 5-Q, f ' EZZ 1 lf, Lmnlm. miA' b 2 is ang gi .M .l saw- wa,-K ew ,. f A ' eg lwS-flmef ,Mfg-Lllxl:.l,7-a,H,-QQ ,4ff1.,sgz1,.fgl. ll,.,,,.,,,, raw, if .. S, D, ,ell ,131 ,I ,.m,yF5, ww, ,,,,q,,,m at , ,Wm- I ifsffsllgist ri-fz2f2?is?:sm1 'FY-fzlwfl' 555. if 54 .-?lif'1lii5Q'ifi.figf-1322-919 L . za?f.,g,-f-Meow' V. .fe 1 aimmewfffaq,lla,-.mgaL-.eg-..gWl,555g..3 ...Se Qg,..Qffia-f' - H , Yi ,gm 7 as Lis'E-Willfnvi-..Jr.u 11.51. Lf V . ,q?x:.f,et1,,L,,gp3'L 75L:'z:,.,:zHL V M f -155: me ,aa ?eelilEEii5?W215fXE.:--sl,--'.eeg.aQ'-ss.- ig, . 'f' . nf- -favivfvzff-5I-fe--fve---4-rililm .W - f 7- Q use H V '2-'--'--ew 7-ws- --Aasf.5Zef:s--fwvssfzff..if-Wi?'l ffl- -yr--..szzLf-awe,gm 1-.f-5.5515 -if Wifi' ii-SQ -121225221215 iii.: Wifi? 5241-L ,ziiifiilfioifeeewfs.relfewf ya. . K ' ' -f -- ff wwf' -ff' fw2MF55Fwf--f- f K V A f .f-......z,..,f,-QW W- -fo,-.. ..mf,p..fwL mf Wg.. ,'el.afM,sLgH,-11?-WgQf fl, mf' M' S'x35g:'Vll3iU' K-550YsifL5W'kiff4ff3lli1legal-ffff ffl:- .k7ff5-'fig 'ykk k1'?Z'k'Li?i75'I9?,5if3fiflE!?f9-:J?3f2i'.:-TE?7iff55???5El55ft35lW'?kS?5i555E1ifiigliol-ii?-'J.ffi?Z595iliQ35iS'lietilflsffxifflfflfi3Q3S'f4l5fQill1?fRf63Y13fTf2N5iii?'ffZSf2:1??4?5fi7I43i5!25lX Q5F.S.:,liv45'l:5:i J A.-, e,.,.M,. .M M Amy Mosley l Frank Mosley Evelyn l Tina Mumphrey Shannon Murphy Corey McCowin Steven McGowan Mumphrey H 1 J E5 da -wi X ,Q 'r f '- .V ,J f if f Q Gary Newman Mike Norrell ,., f x .9 l l .- - ,Mi bl ip f W R will ,A :lik A ' , le. f 1 Q 4 , i, . - . - 1- ' so w ' - 4: J .. X 1- 1 pmti- ,H X ' '- 'nl 5 l c - -2 1 l- 'V-' E- -..f 1 'I+ , -' lf ' 52- lg . 5 ' . , , ' ' . . 4 - '1 X 5 521 ., . ,,,-. ,f tw fig 1 f. 3: , , ry ,,, lg- - v ' J , Q-I gpm? 4. N Fw Mlchele North . - ' e f - l ' 1 - , ' Q. nz l ' l Bruce Null ' ' elsif - 1 . ll -f - Q e 'fi l -fx 5 vw.. - W , . , Jw Q l l I K . s Y L 9 1-.ll . V all v K' O'N 'I ' - - 1 f 1 ' '-hz j-Y FQ-lf? I Y wr , 3 V , ' 'l - ' ' afilllm -f fr ' -4, Q Y , ' . 1 Tom Oxley gy e -e ' va . N 3 v , 2-5, ' A 55 ,' f .iii ff ig- ' ' X . 1 - Q 1 rg7 '1f.,rLfTfJ l ' f zigmg.. ,Nz 3 A X f' i l gy M-.gre-'7 my Q 5 , l Q 1 r s:-:e:-,.f1s.- .an---Q LQL'-1 l-ir-ff-gLiff,f.g ..'f2l,15-3-S.zzsip 3. lsgyf- f gggsvfzz -flwifgaff..,ff-191,.llaiwfif--fl,i'-lf' ixfw-f-ffl -4--Q gga-gigfar-gfgff.. Wg' ,Q offg2,'Q,f5em4f2.pugf1lfg,?g.-gfQgP34sa:.,ufle.,-15. ,454 2 +5111 X axis f--f .5 5.4 QE. - ss gi Aa- .wg Q15-f-'ilil .aw-Wegagqzfwlgiwmfsf-.5,:m9Sgf25gg,3.-41-ikszigylxllPffif-if-Sil,'.::v::1?1,g75g,...vf-.5 law, Li'555..fff:ff brig:-'lgfg ull, , gy,-,gin 'za-lf -136W .'x'.,.S1ll355...124555yw4.2l3g2,1y, 5gllfifqy-:g55lla,g.,,e..,3Y,,g,,55g 5gQ,X.gE5.5:55i3W3x . 2flQgwgLi,, FQ, lv ,. My k my-Z mi 1 M, ,Www lg A ' ,W -L -of If 'ia -, .- -, Liif-52-f1fi?Y---W--, ,W J, fiv..-,Si 2W,'V-Qliifai--T'-11ffm-Q,Lawwilliffif...fizzlfiafiilifi1 .. .finfs? XX-9?-f4ez4wifs4.'w3Q-fm-'.-ef,gyiqewz- 1 gffsii-Q7 . k ,:1,1,,llz H 1,,,1l3 .l,, l1?g, ff:2f.lft1fg1,1i-Hi' --1'-,, ' '2-?ffl1--g--w2n-- - f-fx,-A-if igrfiismnjgjeef--v,f-11252.wgssiiwgsv.fggagliaf-qw , - f ff AMW- fy-L :EgggLsf5..fxA21:sfyygg. 125'-1g,,f. - kggly..-,5,:3,1.1vf.,,:f - f y: ' wsxrlgflmflgflfzgs- wffw-ik f nw -W ef-H -1--lf? Fey- le-ff i-'lil-wi:11:m..fl-lg--T41 - if f -5lllfiassswzmi-215.emgszgg,3W,Qu egg.. ..4,-,ywf-ing: ..l.,.-f-,..il,,'g,: e gy K V Q K - ,V Qi? 3535 .-f'lfLfV'5Y1f '-if15i5?3?.---lxll-ifvii vi'-izarf-'iw'-fl-2535?16-21,-5-mga, 5255-::zg::f25:lfsiflwmiiiil: Qi7'-WiF YSSvf'v4 lxfwfv-f1QHl:',J.T'?1.HG: -,vf'fiq.l,1K -l-fffwiigzl--amg ..k ff,..J,. .qw -,,. .... gf'-L' 'f'--mx: mf-f.f:?i64?fmsfh:wxgel L- M...,..,43igqggvlg-finiggg'jiggjgliixgi-gage'--'.1uSQ'U5::ggliAY--.el , .9 J . .Wg4gg.Q:.,m --o...Fz.zf1?1vf:'.-:lame-5.-lf., f mu -M -wwl.1ffflew--rlAsefq1rKlwlle?1,?pglgaaz,..,33M?eip.'15i4Qf-'Sm .-wggug-1.:.: -if-KlSaf,ggql,,h.,-,, ,lg-'-,iv fn ..gA,ggTw,, fy aa-L wg lg: 4 QSSM-Egg wx 8 PXJWSKQEL Q, 1 11 a Q I amy? mm slfle ls. MW Sie? Wigs ff SDM H my fm Q sr EQ? we lg 35,5 ggrggkqas ,M f fi A27 P' Kgvgflw W? ibfimfmw KW' la a ,, .3 V Q2 ,P sf ke :Q we ,Q X er Emmmxv 333 7-f l?-5? 'fW,.!EL'?'f 11---ij ' 2iffl 'AffwfQgff' Qqi wxdjgi -,sag ,egmy-Di: if'L-La-m.-45552,i,9G:fRlL6z:5,:3gzgiy,,1L,gl-i.f.-,,,7,A .5531 .si--,wlfmll-5f,.5,3-ggygf mir-1-gm-fm,-ffl:-ff-ffM'l2g,f'f?7 ., ' l iw'ffaf:f.'-?1f51-YM:-1-l w:w,14as'v'fE'2Saf ASH- W ,. Aff rf 1 :W .Mya ,ww ey. :Knew lem' - 'llfgfslfsrwx-ez -lf' wry: 'W :ir--250 -.sw -vo,--fr .Q- we f -ffl V - , Q F -Sw l SX--11 h 55? . V. .. .. 21fKa.f3.5',sga rf oflags'-M'ls.-Wsfiffwizsf -'flaw fllffwsxlfwk- H7516-f'fe1..'f5.J' Viwxgmf ,.., fi.:-gf4!QgQw5k,.,,w:s115,,J,LQ..ae WM egg , f ,.m,LV,'g.l , L , fl 5 gag ,ya 3 XQH - ,-il ef-. i fi' S r ii be ' il J 1 y v i x - 47 ,E 4 :Us 13, get 1 is if K .WE , get wx, t ,. -fe.. E J ' a .M fri NJ X ' r . ,uct J If i J ,sewn . -We am, WW gi 4 ,,,, ., , ,,. P ' , .M A f A-H 5 r 1, 1 llokig is Q- I 2 x r l 1 ' A l fi 1 Q' vf 133 1 r . , ff., - 4 T L ,f ' 1 4 .25 ' , .4 ,es Q in it as si file 9 Q3 -of Pi' nj A if -.. L: f I ffl' 'Q-al ft il G f ' Q .4 Q., wig if .,,,,1 i K U, .4 'A K I H L 1 Q, i e in Wi 6 in Q, ,V:51x My ,g . 1 i- in ,-5? 'A Q gli gf: ' Z 1 ' J 4? ,Q ,if-at .ewes in ,asia Q5 ,fa , ' mw- Teresa Pilkinton Farrell Pinke S Stephanie Polley Elbert Pruitt Cynde Pyles Jerry Rayford Dianna Reed Jeanine Reeves Tamala Reichard Jeanie Robertson Juanita Rodriguez Shane Rose Elizabeth Ross Donna Rozelle Aaron Russell Abe Russell Shawn Saturley JuliaiSinclair S Vincent Sirls Michelle Sllnker Jackie Smith Mike Smith is Troy Smith Ken'Stegall c Mick Still R Siilll iiiii ti? R Q W E5 i We f s w ,'1--'f 1 Kiwis---:y,ff?4f:zScif in-fff2'smf.f'fu: ifrfsffzan-,:s'z:s. ,:i,f1.,,ffe:-f. .Q ,f1t,,--,,:..Q,,, asiggi isgfgtifj 9' i , 13422 . A i V is Us ,i,. ii.i i ' i . A , MQW, ,xg5--K,-:,:wzt:,'1..f,iifL,1::sE-few,'lim1w:',.-ii'-,.e,, ffm ' -. :fe -vamp rfb-2 rl, W I1 A l I s Rafe Stout Mike Tabb i Steven Tant Lane Thomas WaynetThomas LaNechia Thompson W Richard Thorn T Shane Thorn Chris Townend Sabrina Warren Deon Waters Coleen Watkins y Tracy Watson Kim Weaver y Mindy Webb , Bobbywedgeworth it yTara weaken y y HollylWeiss T D'AndreaWelch , yTimWelfls s T Letishia Wesley Jerry Wheat Sandy Williams Scott Williams Melissawilson 7?- ,f Nuff we I Ar 5' fl, Q5 .cg nb' , ', 1 V, ,i V - I f-I-4 ,J W ' 5? if EAW' PM-J f t 5 JPG, Q fs., ,UXV1 , , ,,l N yiv' .Q A f .l W ,tv X S , to .54 .,. -- 'Y if V, .4 3 I A, .. if 'Fl X , , 7 If I , df 9 e,a i 7 l . 1 -fs, , ' ' ' '-lf - if ' ' M ' X fa 1 ' - .' ' f , : , .Q SJ lx... R iff! , Q ,Q ' ag if gf - . ' ' ' . r .Qi il . ,T is 2 ef t-4 . . .AL .'. , ' 5, 1 -f ri-,J A I' i 'A -Q . L 4 1 lr 1 X an 1 if X V' .1 Y 135' . K gs' as j- 31,3 J j ,-slr'-' ,.,w. ., .. ' lid - ' ' H i. :f'-531' s ,--liwiiiliilffzi ' '77-4 -1' jiziw' 1:1.ess'ia Y its at 1, Q ,, ,ii l, Q , Y 5? , it l ,P ga 4 at sw if l Q if 1 44 , N1 +,,k'piiQ71.Q7-5, ! Wig ll!5f:5 '5-S 1 if tr m ll l l f 5 Wifi I 1, ill' J it it X l Ka :,i:'-:yfsj1i:i1, :,t.- Ligie- twgifi way W- gaifgi-'1--in ' 1 J 'Q 5,5 r- s 1 'F' id ' 4 a, V , 3 If : f ,pm 'i A ul l W 'J l 1 ii E g wnav S ff ' 5 if 1 ir W ii Wfi-:i'f,'E'Sfi1i1! fsQ fg1fft. Xf5 3 fit, QT' W, v5z1fM2'w,iD5if Ai Wi v 73l15FwQ-515'w-filffr' fff fi. '2'x ' ::??'::- 7 . 2'-:,2'-9:5 a i ,L is Q 5 f ,li K ask, i ky ' if ' M H l -, i 7 T Wo! picturedgparron Anderson, Derrick.BeaI,,Ied Boyce, Leo Chester, Wari- A i t a . ?'ei1,'5,T 5353- lsiiif 2 , . - L - ' '- V 'f 'Ll ti f li ' rrt,r s iDonnell,lDelton Durtch,pfrKevl0 Miller, Leticia Montelongo, Juan - A 1 623 5, - '- - ' - 'f ' 1' 71. in ' T - :Ramirez-, Willie Reed, Sherry Rupert, - T T T MW. at wfiisiuiifaiawi. i J:-V H -1 ig. tawlitwl M f . . I f , . V ' T M nf ITfa??.fw, as iTf'i'ffi1aSf:iffaf:-SE fel? tai ' . - , V, i V , - iv 11 ,. :L E' Always remember your 'highschool days and keep a y place in your heart for those Syoursharedthemwith!! y T Toby Fosterq12y b IS WAYNE SPACED OUT OR JUST CONTEMPLATING THE FUTURE? Wayne Thomas can't decide if he's a drummerlormajoretts. 1 - FUTURE,rLEADERS?r crass officers end ck-iss representatives vicki Gray, presidentzf Carla Barnett, vicefpresident: Robin Hall, secretaryg Amy Mosley, treasurerg and Representatives ererrr Toby Foster, Kim, Weaver and Keri Johnson, rr,' A by y YAH! YAHI EASY MISS! Angie Glaspie tries to drum up busineselgfor y thebdrill team'sodunking booth. y A yo,o A of me-mm ig ww AW, 25' H1-we-53? 'N3Q1W-ilbvlk v-QQY5:'l ' - . 11 -. .. ..,, , . . .. . F. awry WW, :QQ - ' :qi ., .... - .. . . . .. ' 22 1. .- .... L '- 'u f' V ff hfer ' V M jiyhgg f ff ities! . i i is t i or L Yf if Y W K ? 1Y' it iiiidi A if ,sw,,1 ,, aff. i, ft , -ee . X11-mf WSW 4 , a QV, swf W fwfr xffiaiiiggifv 'U S 5 gay we ,Y , gi 4 Q 'wb rf' ,.. 2 wists, f, J i teiteiftititiiifi ywgw tile ,f fi- 112524, 335, f X eg Sage: ,fx ft, as fi ff it Q ge t as .e,eWes. as K wi 40541 as 4 2 Qi fi get ,wi 35, ,fr Q, ag ass a 1 5 , Has in ,Mi , Q mga, als o? mfg,2,,,gi sy: as if rfgsffggiifa slag ix yn Am 352255, we Q, ey raw? tive, ,M 42 f f ei M 555 W We iw Fx A we we ata is at fi r Q' QQ we E21 ea f, P fe 5' sri' tw vim' We swf 212355: 4- f f , is at , 1 Mage wffwya M i ,3rQe,,,,.,.3f5ygg233m'2 M gps as ,N aft, 45, 'va i as aefg, atiatft fE'eff,gW 55,5538 F we af? if ,f ,ge 1 AK ggggcf! Pj? f Xing! ,W grigggx wigs 4 K if KW We MSN ,Q ,. .,.-VN-are ii 2 get gy aaftggxgf ff,,isasQ3r- ia,f,3,,,G Meg ef Mg? M3 ,Wg kfgfft we ,ares fagiqaia Wye ,wx X ,Q , Qt tksaf X 3' 'r 'XV My ft X if Mt: 3' if as we a f we , Wi Q. 2 f fisyes JT de Q' J 2 at ,tire f,,fe,,,,ef ttf wgga si 1 fe , f Q , , as in e Jia sf Ja, f Q2 335,96 ww gg we Wgjfl as Prom night the most magical night of the year for juniors and seniors. Our major goalthis year was to have a successful prom for the graduating class. We have been very close to the seniors since fifth grade, and they mean a great deal to us. They deservedito go out in style, repre- sentative Tracey Harvey said. i Bettering' human relations was another concern ofthe juniors. Not only should we treat our teachers properly, but we should show concern for one another. The day is coming when we will regret the way we treated our friends, and that day may be too late, Harvey said. Junior Derrick Ford said, We stood together as one and profited from our mistakes . . . made them stepping stones to achievement. a N es ,si fe' HTF? fa Y rf ease a..ss...a 5-ta .. NT fir: rg-w.1:w,?1.f11+1c r ' 1 -lwvsw. .. 1 1' 1'5,f.-1:if-isfsff,..:w1:wqw5ggg,ig,5,5,,-ni gk . ' L, 2 . Pg 'r -af M 'f' f?H : 'i'- AfS,?eEtsige,pg,gf,g,gg,g Q -fr -isis: A - A - . iw-.ft:,,aef,??.,wfsfwe,.giz:,..e.,swf ef 'W I , Q Q la' fa ,f ri - - 1 ..,jj -,,,e- i LOOK, SHERLOCKI Gary Earle and Rusty Tate are shocked to find the true meaning of nerd on the of- O ficiai Nerd Day. WHEN ARE THEY GONNA SING FROSTY ? First period students listen to the choirfs Christmas t serenade. g O ,ff .W H is, r 542, .1i25!':f3f:rf t5f7f1 -:ig it 1 giggltt 5:55. , x X 1 Rx 1 0 W, ., 3 e, ,QU tg '3 , we V 5 'ff ' Y?- Rv s it I Egfef' li s Q- .L Q wa X a Q 6 N W' Q 9' NNs+s 5 Giga ,A .vi fi Y W Sfiesiw. ' 2 lit -fs., H f ,gs OVEREXPOSED AGAIN. Martha Montelongo is critical of a newl developed negative. 0 4 i 4 5 1 I 3? fx img Merizelda Rodriguez and Beverly theirwa to theC r1'ditLau' er concert. eve v p 3 , nie JUNIOR LEADERS. Amy fBl and,representative: Camela Witliams, vice- presidentglelgm Pruitt, seeretaryg Amy Neit, frepresentativeg Tracey Harvey. representative: AndretPrnce, gresudentg Eileen Tabb, representative: T. K4 m Parneil, representative: Chad evosg representative t t e ttrr N r t.,. tttt M T Wagizm as'Wt 551 2 WHYYIB Adams , Q, Kenneth Allen W 5 5, E ag ly 7 iii . fJerryArchie I t f DarlaArdry 1, y , i l F f. yt , - Edward Ates ' if! 'A , 5 , B' Kelvin Ates X il fgfgf B , flfq ,E ., . .. . -K - 1 fit, Adil, H 'wxv' 'fly 2' W 'FV L ' 1' ' ii? l' . . f4Q , f X fee Delaney Atkins wf,lL'- . .ll A 1 B y Amy Bailey W ff'-B M1272 sl- LQ Daniel Bailey B eQ'e B 55 Q B ,fy Pere Balbas A ' T W' W! Troy Barnett - ' W K it ,Kari Barr , ' Trampas Bass 6 , . 'W it oanaaeeaer , , ,iz C -I BobbyyBenge L1 , l it D' J Lynn Bennett y - H David Berryman .Q B 5 Melissa Bickerdike 5 lg gjglggj, 3 i , Melissa Blackmon L y V, ,, 5, T, i' , AmyBland f 1: A B ' B B Y : B 'L Kamecca Bolton . ' 1 yi A B f 'M' 7 'La X BillyCampbell fa BA, H . ' Q y t B Michaelcampben Q .4 B f, lli ttee . t w,,'f'Jl 21ff',z-f. Q ::' , B B B mf wi ,qfQ,gvssiH52g1g2 , ., we 37 'f 3hGZ':.mfS' fm,1,: fm,.lsW it-153 f me V, .W A ,,,, , Q 'l f - fi M15 aiisay 1 ws, .EQEZQHH ,M ,Q 22555135 fi W.. , 5, ,, K ,,, .V K f'W:'f1535zxff'f2mi531V ,WA-1,,-.fz,'1,1i' 'ff' H me T way L Qifbswniii 5 illfiffilff K' ,, 'mfg .vw H 45 ff QQ' rf mam ew f S st W 2 Q Q f gf? ,Q A - we QQ? :sew ,avi .2sffE?x,,,,'ffss..X11-zwfhwf X - 1 ,..:fi?iw1'1e,fl?f?i1Fwfifqf f1P',1-gf:-ff' '4fmaz,11 if G W W v' 7.fr.Q,fQ:l W vw '..fffi-AQQT WWI' 51:5 'grimy-f? f'-51V'.5'5k'f35i2.,ff -F35 K g-Z5e'f:z-1 z1:zH52laHW P '7 f . W,l'5wk.ex msiti W. ,, M., .W .. W, ,W .. ' iw- -- - Qafts-.,'-weff:-,'::,.. ,wry X' ,ft f--- . kym.:fyff,z1'fw--5.17 Wim.. -,lygvw if-Qffm5-g2q5g,1E1?M fu ww ,. 2,7 lm wl J QQ ,, -- W v J' S Q Q wr? 2 0 X Q 5.5 , J .I , ,..' wi Q it 1 ' ,- ' ' Eww Wifi, c S- it we , ,za -- 3 f Q, Q an y it ii V iiiE in ',,s-wifi A s I 1? im, Q 5 .1 ' 95,1 . ,A . , Qitiwf J We , my gwefwmmengtw iamnfii V if W flew views Nh l H 4 2 Q, Q1 my mi aww 921 .tttl ii R x '93 , . ,A yi if gggfslwig Egfvlf it mwggxbwitsegtgmgwggt , ' 9?--f '- 112-11Fl2'f'f'?'3l ,'Zi12 7Q Y if WEA 15 , Elf 'il f UW -44 f QjifiiM,3i W lfNff':Sf vvf.Q,f1w,,f :s-V -my um ,-Sewiai llt ,, H Q. ,M ,Ms ,pf r ?Z1 LW'fffim-1335ISS!:IWfx:?iof!fezP5?Q31t,2fsff5f2vf.sfmMeFfEE,,,fg.w: -mm 2zETEffi'5Ergga?E3,tg5w,2 5,55 ,lv .,fk,,,-.W V., , -, A MKM, ff , L. , , 251,13 1,3,,!51g ,.,. ,, . , . . ,ll -, , f - fe half-,H f aw 'gf as 45, ,Q ei Mjaswu, f2,1'z5fey',fg:'lf-rg?-Jw ,--f 5-Qffflieg-lf fit, W BMG 9: S 22- , zwffff wiiiiiii ' il u f B v,,' 7 ,...., 1: M- ' A-,f . qg2Q,,,,.,, ,I , .,. 201 ,meer .t... 'ti V' ,'.. Q f M H Q I K 2 3 x 5, tl fx t fe :M 5' tg Q , W 1 ., g X f QM X egg Wm? Sw 5 M 2 it g Wi 5 5 uf 4 X fl fd f , , A 1 if H f X 1 G A, ,.., ,Q ,,,,. , im, ' . , .,... .555 , 5 v if: 'fwllfi VT fi J S . 1 5 if . g - U51 -V 9554.3 ' Qljiifffi-lyk 5? dkjigjzf' f 5,44 Sy , 5163?-.2 it fwWHs1gi'a1'iwfv J 1 , msi.fw,,l, f--it.-infwun ,abt ..t,,--,,..,: 7, nf-f,z:,xi K ,M ,,,W,- f, ki .-,,.,5, ,ff 7 H ,A l1,..x-7l,5t,iwg, -,H .MX V..-352 ,ngfggffff,E-Kew!.7,Q7.,,.5 3WgM5,,fX,,N ans ew! my Y, W ft .Ll ,Q ,f Q 2 f rf if 2 SLS, N M iw 34 5355 f am QSM WW .M QRS aww ,uh if mf W A As L 1 if wg 4, 11 Fw G? 5, f is W , 95 Xe is ew an 1 ,w,ng,1,fQ5trfg,53t my iw w S' r fmwmg 12? wi si Mfwiq igmvy f M W P A ug N wwxbi MM Mt - ff EN ' 1' ,wwf,14ff3if5g,E,f.g, f:,sf,e,mzw.fva,:t,zm,ta' A , Q9 gww,5.g',,'fS,M-M ,-my ,f u.5,gw7g,.Lt, QS f m lf. ,, . ef :IM -:- .,tffi,:f,vk,4gQgH ' ,1L'1f'eggfsss 7f' ff,2,,, it Ki.,-,Qgv,aggffL,pffw , V f-:134?,f,vw4iT1,:zQJ..sg4f .5?fgJi3?iff ASXSQ5'-xiii?,EPm.fl2ff,J':.i 2,..t,,.'ffL if , f,, swf.'4s2-fgfflglezfafwggffx B ff-- afgfm . r ,sq visas gilt .1- , Ms fa ,A f-CEQE: 'i??Elfss1z': -I-itlflsi 'A ' W ,,., LL,, iw 114222 K r 1 -W1-K A 2 . 5lSQZiiS5EiiQWq?'ii'f.1115Qfiigi-'lcuiiifii' 'L'5'?f4f1 .1'.'Ei9V?i .X Lmm, Q -fhfvzil' - 5 iffesr' 1' Q. - W A K- A r. rsiifsiywl, -- 21,j.g.3gf55fiig::'HJ J i?5E1211'f-if v--- ff, ,fr J Us 74 :5 H if - ,V.i5w,. ,, ,X , I rg, In Arm :F Q, W,.. Nat L.... E is--G --KI .'f-s5k'Q:5iz+-QM 'I A i ii 2 Me f , 4 rs 5ET1ii:rf'X?miwf2.' - I fSfiiiigifiuV5-V5'2Z74?55'f5?'-'fi'1si2'WiJff?i'ff?i?5fk' f ..,, A l 5 , . f or . E 5 Dana Cates - -' r M 0 wg C Michael Chastain .- cf ' 53 . ' , ' - ' ' 'U X .s- . 'C o f pg y Wendy Claklay ' 7 rw- . I ' TEIIYUCOOK m 35 , Q, 2, Anthony Cooks sa W 'J' Dann Cooks r E Q 1 f rf 'E AME f ar31.':-59 ' , 1 Rachelle Councilman ,ns ' jj E Deann Crouch ..r E o f if E of 4 , Timothy Crutcher- : fof K-- , , - r W r, E A fnnn 1 G f-J Dusty Dame Y A, ' A' Felrsha Deann fr wt-3 r-:gfyu E sf LaCar!a Dean r E E .sc ,.,:,a.:f Q .r ...ww 'T' L wfi t -,,H .?ff . y Y Dan Deffebach R, ,ir la ,F , rw E Chad DeVos K 'H ,fr j ' ,H To . A E is 1 5 . jg , . . .- E 'LQ LaTonya Dudley -r -' E E ' f 1' ,.., ft' ' - ' ' ,ov -.1 A 4 -: M 2 W MIST! DYBSS f 4 , - Gary Earle V f Y Brent Edwards A - E Cadriclidwards Q' , '37 . :fl-: V , ' 4, A to z , Sherne Edwards ,... 'L 'f y f -, E y .., Wntham Eider ww Annette Falrchrtd ' , ry Chrrs Farrar Q 5 1 ' I W-L'rff1,w4s1f-szgrzzgeygf . 7 1- - -.i W 1 O 1 C fgqkrggggs3z,,Kiw,3gmg-aff 5g:,sgn5gQgf.r,g3. ,,1r,5f,Kgg5tzri5rfgE5vgi1Sf iwirrgksz rosifzffkgviam 7' A .f , A W5 A if iryililiiq P , J l ,.?952V '25'5EZl'fA5',ial'asi. Alicia Farrell Stacey Florence T 1 Derrick'Ford Blaine Forshage 1 Eddie' Frizzell U90 FWS Tommy Gage :Traci Gee Stacey Gilley Natascha Gossett Sean Green Tim Griffin Eric Hanks Kristi Harden Greg Harpe Mary Harris Melvin Harvey G Tracey Harvey J Angela Heisler oy Shannon Hillard Jim Hines g .Chris Hobbs Gene Hopkins T Cliff Huckaby G Nick Hukill Eric Jackson Gregory Jackson Teddy Jackson Barbara Jacobs y Sean Jenkins Tracey Jenkins Jennie Jeter he Ben Johnson Dexter Johnson G Minerva Johnson Stephenia Johnson A Sabrina Jones Sharlene Jureski Jason Keilenburger J' Mischell Kelley T Shannon Kelley Karen Kennedy Quenten Kinard William Kinard Jennifer Kirk Shelley Kyser Kay Lance J Jeff Langham eff if I 'M A , fffig , - ' 37 J-eQm4Q32 , in , 3 Jn, 'Q .iw an ,, , in W i if-1.wc, fl 1. gazi ' 'ffiilwh :wi wp We f Af ga, F5-' , ,.--, ,M-A ' f 'Z 4 V-, r ff f 4312: fl ' r'-214-Mfeiaz-ig , - Q ,i . , .W .,,, ,,:, , ff f l - - .' wr, K ,, ' ' if - , ff ,. aw '- , .e f- . 421. f- ra ' ,VA H 1 0 A . f YNV, H 5, V . .r 'f L will ' Q' ' ' if ' . 'rs mi T .1 rx. f W ,Q 1, 1' . 5141? f - 1- ' 2- W J' Ji , , Q2 X T, Q T' ' ' - iiie , f f ' ' r' ,f if A , ,f te , z iifgj f- f Z V Z'5?E':f?Iii 'Li X K X33 7 ,Z A ' Aiwa, -',s ,f .51 qu ' A , .. ' -. T T l A 4 JU Q 4 93,3 ,Il - ,E ' p' . 111- , , ,. , , fi fe 1. f ' . . 1 ' W' if W ,, N fe. gl K , ' - ,.- A gn , ug., ' R M :xiii ef' f' ' ' - G ff- V - A Q l, J iw 'vm rl ' , H si - , 4, hi, -- VL 5:1 -, I ff 5- , Q rx X f 7' if M51 a.. A, f-,- , 5 fy K? in Y ,. , .,, Q 1 fi AV ,A 2 ,A 9 Q' 1 ,rr J li 4, v . T l T' T 1 Ili g W rg Q 14, . if .s ,gr -A ,., 1 J , ,QQ 3. M 'W ,k if 'Q I ' G 'VKI F3 ,af V' an V ' 3 A ' 0 11: i-fir .fx 4 5' 5n.r:e+ , gr+n,fqw.fiw- sl 'ff ll on if 3 ' if15Q12i ik' ., ' Y H - 5 rf . ' , ' fi 4 I alt . GUNW, TI ...A 2, KA AV LV 7 , o. wg, ji. , we ', key V '-'ff ' I ii ' L P J ' J' U v T T re? Q ' ' Y 4' J : V Li 1 1' V - T -Q' , i '1 1 W fs- ' if I , , if . ,.AQ. new I ., flw i 2 -' - 2 15-f ni 1 V Affwei if-Niixgdgvg WWF? 1 F MQW 2 it ff m ? 12 tg J , 5 F L i me 9 - .. ,se an y uf- fa:-,,., T-,,,,...fm ,i..,f:iifg,f ., Mew. ,-.qv-. N ,5 e,,Q,,Q,,, f. ST 'fill-ve? M , flies: jg? '-55:5-gg . ? ' . A , - yxefyfgfxexq 1iQzr,'?iifgfgflE:Lgy gee gg N . . so f 2 f -hw A ,Nei r J E , ew Hams' fir Ji' Mill Vibe is Y' Y rg Q' e A A . i 3' :, Ni N ,, 255: TE ie iw,-,ef,'Qg,j,1y , wig f, ..wlgm.i,,, 53, iz-fiw-i ,iz i ,Q ,i ,,L, .J,i,ig,,. -- ,ff V gig ,Jai igvfis :Z 1, mix, V We. -,-iw e,:,,111 Sfwiiei 'il 2-ei2s'12a,sv2g2eEii,i-ii fws,sgwiez1i1Ls 52,3 1 ii., , ,A.L , ,,,,L ,Azx, , W ,WL,,,L:L , ,, .,,, ,, ,mm ,,.- 1 5?lL,i'5fi? em,,,u,, ii ,, ii, iii, img, ,,,.,, 73133211222 Q, ,--. , s flfmfiiig :i -wg, aw:-yggaqg fig, We ,w,,u,,, Q A, QZ i n L if gggj5gge4.,,:3z,eazifwf i rw,- ff ii' 3f5i5f,,1zE i, 2, ,s, , S i if iv iw2we 'iz:- fifiiffeiieii ,nie .5 , A 35 we Q?wwx5Qge13g iiii ,iii if ,, ,f I ff NME'MQsefi25Iiiuggeeflww-Yiilvgiginlgi 'i e wew me mimgwy Z ylyi laameikufegilif 1 fee? 1 lwzieiiziiavleliziy- ymzvg ffm fe: gfsglwiifi 1 i .,,L . ,,A.m1. ,ei 1b::k Q, ,zgf 4-ifijhl qi, V i '17 g ,ggggggWUmwWV,MM Q ii 1 N 'wwf 1 X me ,ei AL.., fi JM, 5 .ei few me ge ,ii.eE,,, ,,Wg,,,,,li,, S 'i'e7'L.,i., eeiegfgiy -,,, Ei ll ,lei ,i 1 wee A f., ,w,,,..s,' l er ?' B Lf NY ef 59? is fe if wi gf Q l, f We ml W ,W ii e, 2 , L ,ri , fl S ,,f ifwiiiwl e,ee r is if ,ge fl if f if 15 enaezge je, K id le, ,wif SSM! Vx g figg,,,,,M, , ,, Ywgxfxm EJ 4 5 xii Q3 5 5, li it X f zlfieliflfl fgeyrfie S K Sa, l 5 1, Q K e Ki 561. ' .1 2 K K ,Q is , ii ,Sf 4 A , W 4 fi 5 f es fe 7, gf if X m ,X f , ,Q fl s ,, ml if 2 Qei e,i,e,nPeaMfWe 1 K in U ies Q K 43 if f 2 ei g l K 4, pw i le e, 5 , Q, W li r ee Z 1, if 'sl , 3 fn r rr K lf, , 5 fe, ,W i 552 fs? fe, S w, tvs ,,,, li ,Se Q Ng, ,px , am be, Q 1 3 S , Y, ,S 9,1 3, lp gf ,L , , W , ef 1 K 2 3 li Hes if YH ,J if sz, Q eg, ig Q9 , ,. e N le , fegiell, f gi sf in M 'iff e ke rK,,g,,e5:,e S alfa iw V f Q r L .Q li 9 S S fl 572 if ,523 D, def ie We QW, ling, U, ei 73 e + S' 5, S. T PM fi ,, 1 Q 2 le X as Q, W C exe fig? ,S J, 3, ,, e f si' A may 2 HMA? U ' 2 we se f fm, ,i,,,,.,,e e , e H ' ii WT if if 'lil 5 if e Q ,, ,B pq, re 5 views ,x , 51.5, ,,.,,. ,Z ,ii ,W 7,5 5 N m , iefwiewmwi ,wieeef QB Eg Kim fi: f 1, s iqie ef eflele? A LW? , 25, a 'Q gfiex 5 ,E nz. , fig, ,gm die ll'si fe Vai New fl X? 5 ,mind iw M25 WW 'Z ei rY if'3'l e,fv4 2 Y UM iiiifelfnr, VE, X ffl Jie, e haf fiwwmfiglv we ,see ll if ,xg My imp Vg, A ll ,S Q 5 2 , My E 5- Me, 3-,,, Q, ANZ, gf if H, e ,QW X 5 eijihimxm W A eww Y if SEQ? J 1 Sie? ,,, ilfilli M f ,YU New , , is ,X , 5 ,K ,gi ,V my M T if 9 QQ Q, Xa ee, W vfgeegegf ,Q ei ve 8,5 im l Q4 5 ,, M. a, 3 . I , ,Q i nm, , ,,.-, gin, W .deem in K5 1 inf' 'if5f:f?e,,,,L 'f fEQ'i',,f5Qi'.i,lefxfwgfszg ex--effweeii-2-.af , ,ff 32119, fimiye , ,, , .,,,. ,... M i Q , mW,,,i,,,.,e fl, 65 ity, M iweffiif We E24 i,Wkf A 5 i ig 1, i 5' , ,gy -i,,,, 3, 2lQ.1Ykf9YgfQY13Zlf ,ggi A 5 Pj 'Tilffc iiEZ3?'iE93+ JLWf:i 2 ei, eeew Q? gm, i?i157Ql1iTT?W S72 we f1'!Mf,fpi,izcrf-rg:Mve5,,u5-gm-if i -,ey ialiaivw ie,-1 N K1 WHY MH V , 5 . f . .. ,ilu L4 ' . - 435 , l ' , ,1 V' V 'Qi' Q i 'iw - 3 ,S-i . jf- - ' -. if , VI -. -. ., ' X ,i i, k i n, ,f , , f ., ' , f4,,,'.: , f I 90 3' nm, ,Ju f , A 514, i , Q . ,Zz F f ' , 1. ,j 1 . i' .yy - f I hy U .uf , 'E Le, N ,, 1, V ?j .W L 'M'-J ,- ie , 4.413 7.25 i l' 'i t A ,. , Mi? Z V X. g Wiz, i V ,V rm - , .,,,. - W L f A ' - i 1324- i 'K 'if iff f f ' Q xi f i.: A if , , fi l q x 521222 F if i? ,fi , im if J ye 5 if 2 he ,. 1 '12 -M Q '-fe? f'34 f ,Q MF' , , 4 ,mv in I if 5 , if iii , 4 ii iff, 1' 4, nfs' ,-1. ii, , WW il ' .4 W, 4' ', ,L 1 i '- 1 - 4, ,. -,J F 1 ,yi . LN fl l ee , I 2, , 4. , 5-1, 0 fn fi , W, .4- , 'Ay.'4A . l we X ,g Q8 fb i f ' aewveee , V Am , ,. ,ui ri , ff ' ,N ,J w , , ' 77 , ,L if 2 i , i ,, ,L ,Q y!.w 'W ' f , A fm ar 3Gs.evf:'in1iiefz.:,1f ,z-9Ew2L:,,': !5E?f?lTME5fvig1'27i,5mf3s93m We A L '31 mizlev mil-mv ieeief-M 1 1 4093? ' Thurman Lauderdale Danny Lee y Ana Lopez de Novales Charles Lewis Kyle Lindsey Michelle Lockridge Mike Magdaleno M Christy Marler Linda McCullough, Alvin McCormick Stacey McHenry Sean McPherson f Michelle Mladenka Rahia Melton Martha Montelongo Lise Moore Stephen Morrison ,Anthony Mosley L Lance Moss Kerry Murphy Kristi .Murphy L Patrick-Neal i Phenioee Neal Amy Neill 1 i Keith Newman Kristina North Clay Oldham L T. K. Parnell , Tim Perry Bart Phillips l L Miki J W we ein: eim,eQQaeGefgie3iw S We vi W Age. when me we P ,Sis ee Iii, 5 Qiiiifff We '52 Wi W fl:FlQ ieefee fe., ii S, , 2fT'gW'? ge E5 gfgiffnw flifl F W gwqiiw 255951 3, 5 law M3 452 wi-iiiemefiiili-H51 A wi...-.. ii? FH l' e ee 1 luis 3 ' -ill, l ,I , '- new , fi rl 5 5 , Liiwfll Y ' gLQjy5,1g'f1,j. fnikii -Zfixff ,T If2l:::L,,'-V IWQEQ :IZ?'f?3iJ51E,'E'i.:'Ti?-- fi .Tv K5 i , ' 4 , 'iff f EE ' 'C miie Y 'fi ..,z,?.-We 'sllllss Eii'ffE,H Q-1 , 4' 3- imf, ' it - -nie --fsewsftmi af, fill' 'I ' i.,, , , , .. he X ag he Sym ,Saga iw iiifzgeii ig f.e5Q.Q1t -i-ff---?22 ip: T fill- 'P' like fffese- my p22 2-:2sffg2, g22 e.2gsw42--'iw-W 22-ey we 1 f--def: 2: . ' 'Q 1 2 - 1 2 is sau 2 a .. Pl. -- 2 22 is ..., ' I ' 55Q'2f95w3f- 322, --W 22 222. 2 we -- wi 22 21122-s 2 2 2 2 .'k' - s ., l A2 23621-22 1 ' N X V f 4 . 2 pe fQf2s2ff,2 -.22 9 s'22.Q25a fi-22 QVL, 22-iff---f's1: ff-f2122fs2'se'-We 2-2- '-'if--vw--192 X221 if - -2 2 1 1 3 2 I 2 2 .L L2 5 2 - M 2 2 22 KYB 2 f X- 331:-212222-ze21fe2sfii22-55512221235'-ew s2.sS122e: 'W:3fme1 912412: fm 15212-221--21'22:-mf2i1?f1ee52flwf-22211f222if22- -2 -'ev-P 2 2-2-'2 21122: 22 26251 we :.. 2- 25 ' -- . -2 . . 22 ,2 1. H f' 2 lffi.i1v'Pf'fi2'-.PN mzavf lfm' 22'-lffefgfifi-'--so-'2222 f.-'2 ffl -121:25 -rMsi21V JN. f'22 5' 41- 1: X. 2 42 i l -'a 2 2 .2 - f' Lf. ,i 2,2 ,yi I A2 Thomas Pinkerton M 2- 22 2 M 4 gm Matt Poeschl 2 -'Mi in -f gg.. 2 w 2 A 52... T 22 Glna'PoIlard g 2 ,2 M, 2 g f 2,., 223, 22 li 2 Andre Price W 2 2 2,2 2 ' 2 1? 2 . . 22 '2 'l 1' '22 ' 4, Kim Pruitt ll 2 .2 2 1 ' ' ' ff' Andrew Ray 2 K W 2 2 2 2 I ' Cori nay R ii R Melissa Raynor W2 2 2 2, 2 2 2 , Nan0y Reiohafd R ' ---2 . 22 3 2 i ' 2 Angie Render if 2 2 2 ' - 'R StephanieRettiQ 2 2 .2 2 22 22 M 1. - 2 2 lf 22 2215332 22 6 2 ff? 'Q 691' af .W , - n -4. ' 2 ' f, ' ,, 2 S D 5 . M- .. .1 4 . 6 V I 5 Donnie Rhodes K- ,- 22' , , r. Q. 'QQ 2 , 2 -2 ,Q ' Q: H 'a ,, uf 4 Q I ' , nt u 1 If D l l f .2 ' 5 2, 5 , 222 2 2 2 4 222 J 'x A L li Keith Rhodes 6 2 21 M 2 H Amy Ripley f' 1 it iQ -'22 Y 2 2 Kelli nisner Ty 2 QM, g 1 ' Cindy Roach f 1 Q : 2, LaQuita Roberson A fy 2'2 2 1 2 2 i X Shanlt? RODQFSOD V2 I 1 222, V 1' A I a-A' .I I ' Michele Roberts 2 4 ' 'i , 2 1 Nicole Robinson iv' ff 'r N X Marizelda Rodriguez 1-aj, , 0 2 32 2, Cullen Rogers 'R A22 222 , i'i 'R' Sherry Rutledge 2,2 2,31 Teri Sampson danny Scruggs Tanya Scruggs Sean Seelbach Robyn Shank Russell Shipp Mike Sigler 2 -2' , 2 2 4 lf Q13 57 W F xl 2 A- l , -A+ Q vb A Y Mg or ' n 2 'fa I 2 H -111' r AAN fu lg v 2. Y ,b fa? fa A: 4: 2 5525-222 ,921.sslef,22ee:w2fmf' - H' 'W X-22322482252 g222.2,2,.2222.,22 W .2N22 2 22.22222 2 22 A.s22 2 2222 2 .A.2 2..22. 22s.2 2.i. we P ' 2 ff -21222 -2-22s2:f12:2--fe: 1 :Q f1: x2.l222 2 :ee 2 fr ' ' 1'iQ22ffv14-?12sre2:L.seE-fm ' wg-24 22f4s.s1:2-22 'ei -2.w2A.: 2 -52222-1 w ?i5xf1isf 2.F2fe2ie22x 221-2f M W- Q22 ,tee w ve in Q? We A3 PL Q S new .ui .ifalmfg 2 if 2, ' +5 ' fi 2 2 - 4' K' 2 it ,uv - ., vc ..,. ,ft -fig R 1' 5, 'f' f..- l r V. ,J Q M l! is I -v 'MJ f WW' xx V iq, 1 , , Q 4 .W 3. T S -S Q ,ig fn- W rf ,, ,,' 'V . ,, I LL ,f .t , 5? T M ,N B M -L ' iff:-7 b ,f ff tg 7 T. ,, -H ,x-. , 1 Tix ,W r H 4 - . j I 'V , I l I. ky g K, E ,fs u mv. my 1? , e ' 0,1 T ' ' 5-:Lf if A V M ,J I V itfgi 'Z F- ' i . V if 4- W.. or 7, at or gina T W ia S gig ' I ' k Z. 'W Q M W k I ,i,a,l,w A 5 ' . lf , q 1 ll, ' 'X , f S , ,V wwf 1 36, 1 H 10 ,Av K, f X' . H ijt: 'EH' ull X Y xi A if 0 . rr at to fa 6 S ff' gg- W Q T 5: ,i il A Ark, 5 ,E I rf ,fr a wintry fm, JQVQ , Q. M rf kk,k I ,,:, ,,f, 5: , VY, , , I F, ' 1 t l .mfr W LV 4 Na: 0, . , 'Q ' f .3 1 W .J Q' . S, ji, A ' LL ' , A 13, . ., , J ill .. E, VAII H K. x : 1 n 2 Q, qi as ll! -il ML A W - Q- . S rf - S 12 Q. 'T Evdd 'I Lim-J , .- ' r 1, . Y . , , 'f L,,. 3 M, A ' 1 N2 ' u f -1 Y f ' 31: Y ianaf' i H ,Qi .,,. A T gr gg T T l 5LJa5.5'ff:x ' - V I , , gf V.,, , vc 'mf '-1E .mQaaQ-.lg -H I fr ' l fl S 4:2 , S I' J WA I, 5, -3 H ,Jr ja It I g , V 'S rr' rr ' ' ' fl W 'i' S if ' 5 S 'MQW ' X S H Q -'A' W. ,A tx ff- X' A -Q.. Beverly Simmons T Boyd Sinclair T Tony Sinclair Norman Singer Victor Sirlsi Chanse Sisson Philena Smith Scott Smith Kelle Smotherman Mary Sperling T Jaime Soza 1 S Robert Soza Alvin Stansell CalvinjStansell Ricky Starksi l 1 Teresa Strouss Neal. Situnkard 5 Q Kim Swan - Eileen Tabb S W S Rustyffateh Felicia Thomas T T Terence Thompson Mark Thurman T ' Andy Turner Valli Victory Adrian Walker l Keithwarreni Patrick Warren Joeywestl S S Ladonna Westbrook Scott Wigginton Camela Williams Chris Williams craig williams Donnie Williams Melvin Williams Metha Williams y Rolando Williams . Sandra Williams Billy Willingham Steve Wright T y Tonya Wyatt Timothy Young T Heidii Ycungbloodf Brandon Yowell Kevin Zuoca l Steve Zucca 'T gy gm Wm or gig yawn- 'qv-nf' -:QQ 1, 'ar gi! of Mei Mfwiii aaweavmewi? ia an ri Si xiii S95 iwiiiis 52 3-rim MMWWQQQF i'i.fe3'13i?X-scifi .W it l 'ig kia. owvi' 5 few Riagg ' AMW lt ii AL f F its K ea fe i Kin ,, it if ,,t et W ie, er 2,23 iff ,ig ,ww I It I qi 7 eq mt it. 955 ig., mi it ee . L .ti yi I, Ze 1- it .,.fit,,i,e5,et.. .. f wat A 1 M K ,pe L I if I H ff! za 9 6 , it .ti at ii S M i 5 ee we it , 3 at 5 J it., H .s if X t t 1 2 Sfiwsei., geset The middle child in a family is often uninten- tionally slighted. No longer receiving the undivided attention the baby gets or the freedom the oldest gets, sophomores often feel frustrated. To combat this attitude, the Kiwanis Club spon- sors a Sophomore of the Year award for a stu- dent nominated by the teachers and elected by the Kiwanis. The recipient of this award, Donnie Whit- wonh, sophomore class president received a S100 scholarship. Donnie stated, I feel that our student body and people of our community need to pull together and be supportive of our teams. High attendance at the games will build school spirit and bring victory back into our school. Thisyear, there was more support at the basketball games than ever and they had a very memorable season. For our school, the future can only get better. Sophomore class treasurer Christy Pruitt said, I think that as a school and community,we need to be involved and support our school. Secretary Tracey Ripley added that she hoped her class' next two years would be great and that she hoped her classmates would shoot for their dreams and strive to reach their goals in life. 'lti 11' iii 'kk' i 1 ,iif tfffviwtiiir 'si ' r'-- -' W -. .J.'. .figs 1-'i ',-1 i 11 '.,: 'tti Wifi? iff?ii:-ffWFi'ffi?iif ii' if ii? '-- ,T zzfiii. Q 7f:- I ..-- ..l, Mgflgff-gfilflg,l-1-li.-'git1, -f 1 . awwfr.i,sgg..et,f,-I.. .....i.s., i.f.r.. ..r. ,....ir. 3 ,... MIXING THE STYLES. Debbie Briery can't decide between being a cowgirl and being a prep. GROWING OLD. Bryan Scruggs explains to Flon Gooch how to groom a mustache. BUCKET HEADS CAN BE COOL. Mark Crutchfield reveals his preferences in fried chicken. Andy Christopher wishes he had a bucket, too. if ,,:,L O BEAT Patrick Hall shows his 87 CLASS OFFICERS AND REPS. fBack Rowj: Christy Pruitt, Dqnnie Whitworth, Adrienne Welch, Tracey Ripley. fFront Howl: Sandy Tant, Lisa Warren, Christi Har- ris, Timothy Honnoll. faqs wma A ,K sr vm pg ,v S imi f T a A Q it Y 5 2 vig' we f ff .i - .r w - : . .' -2' - . 55? ,2. :.':: ' :- 2-ji. ,f Hg ::,jmr :,,',g ' ,Q l 1 X69 'r-l ' -152 4 a ---- . ' F62 R32-.. -: --. .,'i.'1F 52 - 'U- W ' -:'x: .E-I f XE-'ii..I'ii'f: f'!5xi?5s. .- 'iii' MarkiAdams Daniel Armstrong Damon Bailey Patricia Bailey Raymond Bailey ' Lisa Barnett y David Barrett Misti Beckmon 'Cedric Benjamin Rhonda Bennett Earl Bevel David Bickerdike Kevin Blair James Bowen Amy Branscum Debbie Briery Jason Broome Kenton Brown' RobertlBrown Robert Bryant Corinna Bueno Mike Bugh Roderick Burnley Q M, Q 'at - .. ww .131 QQ -fa sl 'K f KM.. ' .fzilklii-,f za -1 7-+I-'1 f .rt if very? :gg 'ew 123- iw 394, Sal 5 . me in is 1 T ylkx if. fs ga i Qi , :ew ' Q -N ., X ' ,.... 35 we Sgr D it if ee. ,W W . 4 Zh .off T 3 ' r ' Q . ,- . ,..'k75, .F 5 ff ' 15:1 r '- l ' ij is . , Q. . . :ff I -'4 gg,.eQ,,R ,ik ,N 5 in K l rf Xi! ' Q i Y K .,.. S Q .Q Div A ww 1 1 an K N 1 . , 7? ii QQ y i by kwin A . .- ' 5 X . ,fm .iff rm A t , .w5m:,, ,, , fiwiifif slifsfivu ' ,Z M. tiiiu' , . 4 A 25EQQg7A:?'fLj, l A ' ' K ,,,, Q 3 ,.ef.:w.:,f V: gym stef 1f,1r11f:A:-ffgyge, lzffaywyfggrfri.-fl as ef 5 P2 'iii ea ' We .. 2 H5 ij-' 1, 16. , e f v1F5,r ,ww ,L wi aa W, i Nt ww it 1. e t tu, ..,, NE. ..,, fe ,if -' Fw A-- i tt t Q wt Sz: 1-Qfffavz,-'f 'fsftfifli'sg:gu,tqgg,,lw- 'gpggifgmggg,,.ffgQ,fg,zfwsqji1-gijs.5g,f5gi,gi -- .. .Hu .wr . ,1we2feffe.wiilr3?fni-as-avr,-ittszw '1w2sefg,.ffi' 2. 'fi 1 .f, 1 fest- K iii: if-iee1'ffr1'Ff5 T 3:5 .... tw. Q- ff ' f ,Z J - ',A- - ,,, ,-.1 ,r,,,,, -- 4,, -, 'i,, '.,, , ggi, -iitl 1 , . J 1 M, i--vigil ' 5 el: ,f LF V7'i:-ii5?'3??5'f5i.,f1i L fi Q 'jf.fi3's .,i:iiQ5ff1 1 itil! ' ' . . l Q -. p 'Q , V ' M. ..a.. A A ,-sur iisiii, ifsgglgwf'1:F2:,5i2sw.:2if usiiigij- -'fm 1,5-:gN,,y--i ,mf naw, M: 5,5 .. iiiiffli if fgliff , 1, w:2i411, 2 i l f elf r r rr'r K 1 f .,.. V-'.tf'-:wa -fairs .w - milftf2:gg1gfi,.:.,f.1P5iesg1fv fQ7:w,l.fee,fQ we iF je 11 5 SQPHOMQRES SHIFESNG E at Q ,.., f --rr 'rv ff ,Nw 5 K K w me to A,,, 'lx Y X y - T o sill?-frm ' Lfx, Q.Z,, 2.,.1. . . ,.,, V e,::zfi56vf: .w wwe- W S: . .H are-elf-Wa-of-,,i,, r-n,mg,f,-ar. f Q1 K a P, ' Q e, U ,..t,.,N ws ,Q V f. .. sl L we WQMSQ V ,. ei? ,owl ' sz 2 f1f1:15fog,gy,o'pa', ' -- A ' ie. A 1 -- 7 Mr aifexirf H ria f fl as Kofi:--g::il,1for.-1 5: 5 f S , , F. , Q i .. y .L ' , Qs f2a',ii'e .- lf. 25? f':'f'1 - gf-545 3 if 7 . -' 1 M - ,,., l We of .-, ,M ., .i i T 2 . ', K ' 1. J' . ii.f , f..:i f Q if 1 y ,.s, 3 4. , wwf ' I 1 -Q. VY' M new 'Hu Q. 'YT' 4 A.: l l , . .neg Y .- Q vo., A T N., ,ix 'Q f , TL . ' V I ' 'K :ii 1 Z! ' W r -3 ' Q-Q ro -fi 7 T o - r- 27 Z 'X 41? , A ' .IIN -2 tif A , .2 is-f lf' . ,. T f ,l V ,lf , , iii? r T 'ins-so 1 '!. I .....,-., Q if k S . ki Q. .. ' ... -, 45 ' A ' , 1515, I f .V-1 -- ' W 1 V: K - '-ff' 'K 'Q ,, ' 1 if f , . , Le g , -' ' ' irgilio . 5- ,,1L.:. ,, . 'L if ' ' , 1 . N ' A .,,., U 'T 1 . 6 ' A 53 T Q. L ne. , T f X , f Q A , L Q if ' N' Q, 4 or-. , ' Mg fl f ,t , V' , if , I A .5 lit' A 7? ff? It A , 7 I 'f 'I .V A we ' -' A. - V at A it T 1 4 A ' ,nh- , , - gr ,, 11, 'T ,K o' ' --.Jw .5 F ' ?, -' if . li 1 51' ' , f r .. . , 'f ' , , 1, , . ,T - - , . 1 - P ? , 1 -A 1, oe. I 5 r rm? W to fr 3 5 Mem' 53' Q we 'iftweaosf 9 1 1 in are M1 M fl ,tw STYBQSS 'uw m sg S H 9'F39L19'L P Sandy Tam Carol Taye. Joyce Taylor Machella Taylor Heath Thurman James Vineyard Tosha Walton Lisa Ward Annie Warren y ., Lisa Warren T Tanya Warren Donny Watkins Tish. Watson Adrienne Welch Venus Welch Vivian Welch Jackilene .White T oonnieiwnirwonn Morioernywilks DeAnna Williams Donovan Williams i .Jerry williams Robert Williams Teresa Wilson Terry Yates ' Jimmy Youngblood on was or .N .f asm, Q , W wwf Ml ww? awk: W f I f l . of Q-ef'-W-W- ifmoy . i 'Q . -' - . zr:?wLfwg5fZ55f5icf f zzs5i!ifG1 'ffkzli ' P X ' ' 44271 S? ?iLi ' 57 ,f5f'5k i:VJlDIi4l r .,,., 5535 V3 r r -- . , . ,1. lzsezfmfli2f:+2,11oi44feEii:1i 221,221,251'faint-1fl-ilfgizl:-2:Eiazffssev221255 :iff fvJlf5,:,,a1f1'r':'e -all W.. fXiew.t,..fll..-mf. 2. ,ew.sve,,s,. , k,,X5,,A, .fg5b.,,l5err- if-fgmwpw ,4 ': ,- -wow, o -- ,jggswfffesisietffftgeiiszfliiieixf .qfiff IH cf V E.fiii-i'fff3ff5iff5?Zi ft' , f ff teifegfsmwgig::,.,:gq ,Q '11,,-'fsfifiszzsiiss'isis-we 5 3 esfiifii '1 we , sf gi' if - , f 'fs :xt 4,, g-:fc .. A: 3 .z, Ml- -ff. -t . J t.-zf, 1' f f 1 '-L-' i Young, full of energy, and eager to learn - this describes the typical freshman embarking on a high school adventure. Freshman this year were confronted with massive changes in education - TEAMS, HB 72. S Freshmen class president Sharmea Johnson expressed the feelings of most in her class: The more involved you get, the better experience you'll have in standing for something at Chapel HilI. Treasurer Tamela Johnson echoed these feel- ings: Our goals were to achieve academically and to respect our teachers and fellow classmates. Our projects were to help those that were in need by sharing and caring. Following the motto that education is the key to success, Tamala noted that as a class we tried to abide by school rules and to be supportive of school events. In the future, we hope to excell as one of the best classes of Chapel Hill High School. .,, ,... f.ni HOW HIGH WAS IT? Freshman cheerleader Melissa Adair practices mid-air splits. HURRY UP, GIRL! Tonya Traylor and Catina Butler head for second period. fi 1-. 'FLAGS R US'. Teresa Sylvester, Tessa Tate, Mark Edwards Shondi Earle, Marci Jerger enjoy halftime at the Terrell game. I ff' 1 r H 5!'51.x,V X ,M 4, A-Lilly!! J fi if-PV M Wh ' ,Q ,x M fv ,, ,Ln Vw M 4 wx' :lx Qigu Q Q5 ,gfivq , 42 ' v gba if .A A, fa ,V A, . 'f ff ,V 1' W Jlll Acker 3 ,Z A V '- 5, ,V M . A . N V ,,, ,A f, V--V U ,V , ,M - Mehsysa Adasr A W V, A ' A AA. A V ,A, t 4, A- Ehzabeth Adams my ' - 5 A A A- ,VV , A Q . AA .V , :,. V 4. VVAQAAZQ , TOl'1y3 AIVIS -' I '-'A ' vii' ' - ,, 1' VmcentArvnzo ' 5 A ' 1- B Ai - V , ' Bobby AfKlf1S . , ' 5 f -' P , -5. xi 5 VV ff K V1 ' VK nlulxe Babbitt B , 4 A . A Curlae Balley ' B' '- A A 3 f- mi Larry Bailey ' - L V ... Vf 3 , 2 jr, Albert BSKBI' V A ,ga , , I V Q 1 A V 52:- 'LA1' :Y 1 ' V , L60 BSKSI' M T. 'ggfl 4.7 mf ff .1 f ,iK,5ff',, Craig Bass - V XA A VVS- A: ,V , - -W . fag: .wg V ., ' :rg , .O-' 4 o.ef, .nw V. V . V. 51 Qi, VJ, ,,. - - -1 .. . '1V4,,5SVA.f' X FX, Matt Bell V- X ' y Chris Benge ' N a Eric Betts La- I -V- f V ,L , .30 Rachel Brooks BV , AA Tuna Brooks 1 f V , - , I t 2 jf- af' Helalne Brown ff 3 f .Q V A AA V .W fr Bonnie Brumbelow 1' -V .w V Dan Budro ' 75' ' A Y A A 'f' Bums' H'-F11 , Catma Butler X Q 'y r' , JSFFY BYVC' B 1 f Q K C Hs: E gi Tj-wk' SVVY 3 'CO W V h rf, ' 34,5 23-V,,gw Vx J - V 'H' V - ffaxza , . - W , 1 .Jw VV ,V:4:zV-Y , ' Vw , N X ,I ,,.::,1V,, A, X Rm'-.Li A ,5A:VV5AeV55yf5g,A.VVi5, ' V 52:1 ,ifiA,.LwHvV LLS, PR A2.Ws3Vff95g5 gi? 5 ' , Q :SSH V ' A V. ' gffffvfvv - AAi14ggrgV:sv1AefM?a'3?l Af Z H E H A .,V. A f'VV'VV .A.VVf-WAV.,-Q Vf, A ,V VQV MV . V ' Nm: - fi: A '- . - 1 ' ' Q 3 A, I ,wif Q W lr ' rs: -QM MQQFQL wwfVV4.VVf:11fAwx Va,Iefffsz-:ffesp:fs:faxsismiiiirawsfss'-:EV31VV2 f VV.,-,AW.myVQQHAEVQFQQEQQWLQEQQQf4i2gg2VVHw.vVV,5.w, .QVAA VV.-AV,AA,WV,-gffg,iamm,sA1mx-Afffw ,ffiwizVii,124522125szAssf1Qvv2f1r3iHSiw? 1'?55feVFV5f5?f5A5gi3ggfgQiA155221V.gJ5AsQVmya2gsi5Vfmaes?fQwsfVwi-swf .fVVf2vzvgisQs,zesz wif,--591554 Q'+3sfA22HfiV1Q'AEig QQAAQEAAAVRQVAAYVV Sai 1:55 wr '1riKsisssY4Qv5sxs1s31s' L25 V-- VVVQ.AmV1Vmav,wssrAfQVA53uSwSsz1?1s,VAsSsV-SVVA5 fVWAV,,MV,.A.g,SMF, -Lv .5s5i?5?Qgggw wg,-1251 Vgs.-A he ,,.V ,MAA AA ,A As, AS, ,, A, A A W ,.,. A ,,,, 49,1 Ass, Sf, 'PAA AA V,A-2 -www-si -9-W KVA-A,VAV,Afg, SME,AQ,.4Vx.-VV.,5q,-Va, Lwggwgagwkifzypvwifi VV-- ffl..- Hm ..,, .V f,:,VVszr 1 Q 'IVV B -' ,, ,,,g:VVVtfA,V,A5,-ff,--V,V, -VVA VVV- lm A , .VVS-V1-,V ,,fVV5EV4?53f' Q21 Aww FAQXQQV2 ' . . .,.,,. , ,,..., .,,, W, , ,.x., , 4 AVVQ, ,A ,, AA ,, A,,Ag,fAMfmfgy43.3,kpfQq1ggA5E,AAAAV-AASVAAWA, 5 C 1 V V a ifmAe3V.1f52.fVVVVfV3fQwaih kg-AV:,, A. H ' .Va V ,V 9 Vw VV-11swV1VV2:e , V V1-2 Ay.. .' ,K -wx, A , V H an V . . 'W K' ffqfwVg -5 H, Vw V flfgzzgw. gif 1 3123 A MQVWQEXWAEQKA V 2 ff A 5 VVWLEW2V-'T-7U'ff?r1 ?'ii5?ifSiT ::3Z,?:S?f.f'f'37f5fi.3S:Fifi! V x A 5 X gg5fgggsks9Q3??w5Zgi3ggS?fggz'ig U, A, ' , pw A, .,,A..., -wVfffVV.fW. 51? f?4'171AA-ew ,, V. ,A ,kk,,, A, A, -- X cs1is5,f1zssV14w1sees2ss1'sms'-ssszVgs121VzVsw..VVWV:AAwAAf21-f?4z,iVks??if??:s:5?1rvffs2f:mV:fm1Af'ii1ffVif Vvt A -r 11,1 z,..1V'-.hi-1'322,f45HQ?2vfazAr:sfff2EV1V-5ff.w2V,.VAS, x YAAisfirzlaimwggsvli-s?K1ff9fwQrfYfsV1?53Wzf:3IVf:fI-'E fvwf wgsgsssA4527V1?2zffAz2i-sgmggg,zgexffaifff3ggf9ggAgs25efzf5gmgVffpigggigygg-Qifggiggqggg-Aty-:IQAQW A ps.u, ',pAg'f1::AVgAgy:13gVzgag13?yzVV21.-AVA,1V,1 V,-V1 1 gv1VAfV was A r 'r D K' ll , A ' filfiiiii Lfwl 5 : f,,.V'Vff' 'li SPV 5 V 9 VVVV ,V r ' ' 2 , , ,.,. L, f,. Ar fx V,,AaV,AA5 Av, V .VV,AVx,,A.,x NA.. ,.,A?iLA.A..A .,,A.,, AAAWA ,,,. W. ,Vr,,rAVxVa,,!.,f,. ,. f?A... A ,A 4V,,nx,fV,x. .A ,.,.,,a,V .A??'..TwA , AA , .T 1Vwwwm.-2VVf9VV.-VV.,.wwf V ,,,.,, WA ,,,, AW, A T ,A YVAAVVV---VW-V, V ..VV.. .VV,x,AwVfQ.VA,..w.fs4Vff,,AAVVAS-V,Vf,Vaf-,V--1VVa,AAsx,AA,,WA, A, A W-ff-' -'fp V' 'Viwv2fE.4r2Vf.-.' ' t5iVfes1fs5?5a2,Vg,Qsw,:ewes'asffwmwzf 2z!w..W:fiAswe2sf3K 659935 5 ,L-ff I,,uf,.:?.i:i,A:SVA1eVAA23VA?2ifiwasliis fax 14,Agggy1SYf-EVE,--fffgf!,Mf-r-5:-YH,g:V,ggV,V1 A,V.Agfa-XVVV,gPfQ52f5ggi1fQg5ff3,,AA q::-,gVf:AwV?- VVA,::5ygQgg-r5gg,VL,3k,- f,,, V.zV,kg155353-nSi?iQ557g5Afp5 Mfr ag. ,, -VVV-,,VVV,gmfVAAfeVg5wAbAAAfVVg,?1ggV:wr: K V:VVVA,?zV3Fw'?ZrifSf51Z?ifVs??T53iEa?5:p5.SV1mfr X f isaVzV2zfV.s-VswQrfVm3,-A., '2:'f:49i?fv'imfMVIQ-41251 ,AfswaVzfA,,AfQ,'A'A2 3 saftfrsagga ffxf ,V r,,A. AA,A.,, A VVAAVVVAA VVAA W.-1ffzVs zffw,-VVA-A An, ,A VV Alf. -,afg,,1gV.,,MVV,,,VA:,VAAV ,y , A MAA, ,AA 'TSM' iAjQ5:? VL ffg fe :vii Vfr iiifsiiifs 1 fVV,ff-VwfA'VVfssssz.A ,A V V 'A AA,n.sVV ,asf m,VsQV,1:f,sw:V,.,-gAA,, 'V,g VAr,Af,VA:V,V55A5gA V AVAV1,AfV,VAfxVff,AsmsAA A K K f HWVSVK-ifi' '3'1'::iU??IEi VV . V 1 fiifgf C . Karen BUNCH Q A, ,. rl- Randy Butler C J Rodney Butler l cf- L' - - ,llflfi , M ' . - ' . ' Rickey C3llC0 , ff l fC Ray Calllharl ' C fi eff, ' . - 1 James Calvert gf. H ,, 'Carolyn Carlton A Lv Z - 'A A J C l X X M F 5, Shella Carr , C f-Q, L 'M' 'N 'C C ' ,C Richard Ch3HdOl'll3 ly ,l lx' , 1 w e L . rf? Chasfam V, - sc :fl 4333 --ff 1, 3 - , I M f H Carrle Clark 5- Y f H , C ,,,. W we jx U H I ., A ks. M H A .1 1 , Vlck Coker lC1,,fz. 4 M eff: 'E' A4 K i C - -'flea el 1 . M C W , J I i C- , - , ,. Robert Colley ,lf 13,21 . as -- , 1 April Conleya , z :ff ' M 'aff-'ff ,. . I J Michael Cooks E V .Y 6 rel ? V, --Q f' V l -1 ,lf f 'V J.: ' DOl'l8ld COOPBI' T' -.5 lg' C L Sc0t1C00PGf M 1 Crystal Cfafl V . - Af , . . ,Q -. , ,W P ,Q f C Kelly CIOSS .. fl l C ,V , a - M C Mark Crutchfield , -, fe-. f3,l,7,:E ,iff if - . 'ff 1 M M, 1 + , Steve Dallle raw A '-P' Q iii C Y 'Z' - 'CC' f Melissa Davus N C Davld Dawson C l CC C Latrena Dean , f - A l , , 1 C ff I , L Nequela Dean . JC ' K-1 'C , ' ffl Sam Deel il if C ' fVsYlQi'C9Q f '-ef fzi, X 1 C C C LSL Y Daniel Domalfl L. v 2 ' ,ff 2 Cheme Duncan ' or fe ,,re in wg -bf. gf C f ff Mark Edwards Q xagfw, - V, A l ik: i no f Carley Everett ,ky C-Lk g. T1 - ' Q C2 C 231 C KR 'fi-I -he CC 5' 5' A , ffm, K is?.if?5l7. l Q . 5 'V ,mlsEfff3yfggE?Qwe, x . , CC ' ls l' -vli1C?C'- -vi N flliiw 515' ff :- ff lx-if! eW,:k2H-fmviwww.Wwe, ,,E'g3,.. ig, fm f , ,,,,grQq4fE.lf 4 - 1 M ff ., U S 'QC Z, ,, f iss? .f in ll lg , ' ,, -C fiEii:1? : , T L C - 1 . i H- C! .,4 f W W .A-.: Q55 '54AgZfgf,As51M-153,-gg 5 f gl' -- flQgjj-Yllwlfi ' ' CCCC L EV , ..,,. ,.,..,,,,z a we, ,, , A Wgaalm i ,-,,. ,,. vu. , ,,r,,,l, ,l ,, .K IW ml, waxy H1 Mfg,-,E :gy - lfW,,13jg,55,i?3l,,,fk ,wggwg , ,.f,9-ff2z4lill5m5'f5- lszf'Cz,,l?1lff-Qperl .. ifrwallrxlill - l, fiitvflll. -'1ff-fliigf'f'SfCf:- - 'C Q' C' 1 ni' iff2sf5mzfge5vizSfSfz2iil'l'Qx,lg,S - C .C flf- llefver-:Q'f1,,, -Cfll f Cl if , ,w il -f -lff V ,ig,,:gl,w A A fagreymi-g,W,e , ,e,,115zMe.: A.ezgggzrfnll,liH2g,4ls,-als2,X..?e?3w,.fw,.f,,f,,le?1a-mi,M,,4, ,,,X,gp,m:,,kk :33QZi,MM.,,w,gg5,m5, - .. fr-fmwwr,e,,v,,l,,,gll,lq,,,e,,iglffgl,,, A Qs V' - N wfifflfbiigiilmawx L,A:f,L:LlM:.:z ,h,m,,' ' weep, l 151 if 1 Sv B mm fem 1 ' sw J ffgwql Q1 HI 2 ,Q ,age Fr Q ,fl we r rwarwv v , 3 E53 emo., .Q if , 1 ' , Ur 1 f . 1: XC , M - , .m-:,,.W,,l.,..r..l ,..., ,Q f Patti Fairchild Vicki Fairchild Julie Furguson Shawnessy Fleming Cecil Ford 1 Coreyi Ford QuIana1Ford Sharon Gabbard Keith Gardner ,yf Chrystai Garrett ' F Candy Gee Kent Gee . , , Adrienna Gill DeAnna Gilley F i Darren Glaspie Burney Gonzalesr Ron Gooch Tyrant Gossett 1 Karen Gray George Greer Shelley Gregory Douglass Griffin Marcus Griffith S 'F S Patrick Hall Becky Harris Christi Harris , Steve Harris ' Detrick Herron Janice High 1 Will Hill ,r N.. W M ! Q 'L 4 Q I 5 1 4 , f 4 . .' , f if 1 J , 1 1 ' ' fe Z N r x is fvi. A 'Q ,. Zi i . , YQ. ' rf .WMF ' , W -N ' 32, , .f ,fair g , Us In 1 3, 111744. QA ' 1 fl 2' r i I ,, H ' . -'97 SW ' 1 X WW' S '-' ' fgzwf ' fi T J? '. N fl . -We , . , -1 K 1 W :V , jw Vi' it ,,kk , 3 i: if ?: l'5i'f . 5 W 7' ' F .. 'ff ' A ' .1 1- E, - X W ' ,Lg -ff 1. 1 4 r - if 1 -A QF! s , if 1' -.- ., K' 5 ' 1 ' gf in 2, H f ' 1 r if fy r J: F. i? ' ' 412 . 'S' xi ' 3 L, ,Ti t , i,,, fi Ai' -.if W E 5' -- , .1 - ilk . 7 ' 1, x1 ' f 1 iii- .. f it - - 2 ,,' +f4?'- -1 jfag KM, Wi 4' 'V M 2 K 4' X 1 i xr' '- RH. ii, Q 177 V' 4 ?,. exp. Q' 5 7 V . 'V ' 5 iw' W 12 i 4 1 - r Q , 5 1 i f,. a -'-ff f' . . . . , if fy .mlm 5 11, W, Q K KW' Q-. 'U' J ':' I' , :Q 5, , 1 rr L, 5 K: 3, VJ My ,I X 2... . N Q , X L i L4457' fi? 9ei?Q?emiw11i51 - smiles 1M-Vi, .11 ,.i...Q, W, .. Hriurjy ,, V 'ifflfiiilgi Saw? 1 . 1 A-wa71asz1i5zz .. 5i5g,gg:v:sbi1 . Y, -1, , il, .. ix1iaz,3wiSJ42ffffi1ii?Q2114+ 1- email W. ,, ...e,.ie:4srQeigfaii-29:1 ,fi 'z ,M a .11m1,1i1, - ,fe11eL1e,v1s:11111.-- .,,,-f 1 --efff::eszz4ssez4s'wieivwe , wrt 1.2141 ,. W i,l,,,,M.... . f l l J -f --,, f s--f 5:-.iMtwg:1.f -, f- , if 5:11.-,,.?9iiU-5 35557 1 15,31 my yiofy4:...wgf 1m .xfizzrfas - Fi V' ,2ilQQQQf5f,v,wijfw 1: 'E : Li K it ...-.-.115.e:xesr:'isgfiszI?,ii2g exfffsifzi .fr fiYsS3i:H'.fs5:ams2?esif? 2 fr , l 1am ' .ei . 1ll4f5i35i?i-fiffilirff1fes25?f5?3H574fi?f . , fr 3.,,,,w,,ii.iy, .V,a . .W . f ,,,. A ,A ,, ,wuuaigizlfw-af-QigZe2z.if1gg1391ii,.me,WMg.iW::r1-,ra--,if zefffiii-in if Sisiifgfifsas-2fiieseirfififfii'ifseisxfssr-f 111451 -deff ae?ifigwQf+w-1 I :maine 11 M A-1.l1,,f1fmMei.1e,me .Qi-1.wiweN at-eir:111i,11Qi, 1122113252: 1. - , 29153255 svgfizrssaq-512.53 ,, fs ' 1 ..fw,.--,iz.::5wr'-- r , - ,fiiffim .,,,. ,, N,M.,,,..,, . , 5. 1fv'f,ri:21:rs24e2f1 ,. , 1-1 is-M 7 Qi l : . he his-2552 H e ' ' :Lwith-v':s5f?i7l537,fiL5 X is 5 Quai?ug,4sy54e?4fE?411eeH59all-41 . us-fx59fsL,EsWs5i5E?..2?'EE I iill5i.fi5i5!'37X?5EE3? igiggggk, 2 in f me .:-. Wien. ,r ir QR . W in e'45sa?ai'Qk Y ,1 , rlwisififwfili - 1iiS:,1f?2i1f.,iiff:-:2gr.- .... . ,, f,.i.i..5i.-W,..- we 11 11-Iirfsmfffi 1 QZWM L: fri, .,c,.,lw ,rri M35 5515 ,,-. i me ,.- If:,ffM M1 W if miz1yf.afgSzf , fi 5iSg5gEf'iiszr1fwfrffirj' 1 i:is4iWgiw,1 in-12 - ilaiffifenfaifiieizrisslg., Q f ..,.,3,.,W,,5,1.g,ii zsifgwfifz1sswweiem iiMa'L.si,..,,, if m1 w:mimme,,r .fuiff V -is if ri ,f iw 2 Y 1 T .1 ,..,a,1ew.w1fi,71,74 in . ,-M,,,, 115131 ig ..,f it ii ei 14a,1f11,M5 , Q ,AL Svrlsaafggggggfsayi me i w - ,um1s2?'..'1s:f2ip1-'ig?'1fi Pi an 3 1-w,im1wfa1,-..: . , H .,-..i. , .. :,,,,,Nw-L- 1 l. r i J,2,L,,Q,l,iQ k,,,kk,,k.,, l,,.1,, 4 ,f.s,.a,.l,,4, . W sgaifrffrsflsgi 1.,11.-sizing-2 7 1?Ss1fQH??s2w Q ,gi .W iraiirfikfieif 1V3'?ifs2r,1i2.ii k k ' 11. 114 Lsvieaessieosw 5 Filk. , ilirfM251fze4ta,i1 ,. e,,.. M ...,...,. -fi , . 1 5 '!fi2?75?3K?5i'f?fL51 fi 1 ' i i' M . ay lla, . 1,-'J ii,-5:?:sfEZ,L55ii .... ,M.,,,r ,V ,. MM ---f Mai,-,Af,...L,.r.,A.,,..k,,AW, 1 f,war:f?1.z1 4, A ,.ai.ai,l ,li,11.,,e QEig5igQayiarffe?3,im 5 ,, .lir.a..M.f ,tis-Q, ri.i:1fgmi y-,, iii' , ,'f?Ei1L?TQ?li4i9?, if ' l,.19Ef455iT4Qfl:QI7l' H ...V MW 1i, , ..,,....,,.. .,,, ,,,.. l,. ,lr,,.., Z, .,,... ,,l,,, A ,,.,,, A,,f- 1.,,, E .X W,.-, , 1 ..,e,..1,i.f,,-1..,,,, v,,- ,,.511Mgg1ie1i H A.V. i,,,.ef:,1 M Y V . H , -'lffifiiffl A 11iE:li:5T7lf5:s:iT :5fFSH' 559511554e,fIi7ifeE,'I??i,Zf'lif' 'VQEES 7152. i2Ee:55:fs3'1,t:?5fg'52.jifQ:iiQiiQi?.'I5f'ff:55'55Z'Tilii53'.?5E,Ef W: A 1:FYfis' ,ff 5,2533KLf''5Yf5f.'71Eff'E1 JE, ,.-f'f1f.'??i2fi!:+- , T.-ff,1S1:,5 li '1iq:,rf:!fare:fr31,1 :J :Q ifffiiegiiifaglizif..ff: 1,-ffliffeiiagirawileizfgxeiff,gig-gggfgeffigzqgglgigq,.sa,gfii-is3555555515,1.1fgyg..fi1f: A-,11.1,5115f5155.-I 1 ., 113.155 , 1,11-,f . lla, .,,,w.emfef,,f Hsfrefsrzazmze- A1511 .if-gfggggigigrgiggwwg..M5g,3m5m5mhis5.5,,i.e5Qg,1g,Mw5gg5,h,,,z1 ,V ,.....ls?,EM5..,,,.M I k..1a..:W K ,A.,W?if.kw.,k, ' 5 ' xiaragmiw E wrwefgaiga YG 05' fam 1 as HGMORES iii ,rig5i gi. xy af? 53 , eiaiewsiix in ,saw p ,awww mi X, i i erii,r6EAiFSf,5i 3 WM W. 11 . ,--- , 1 iw--if -iw' , ., , g2faefgs,r1fg,,:f:iw1 1 1 1 7 11 , - 5,5-,fffgfgfg 1 , , W. . 'X' ' 7-Wil kiliifk -925251530 - i-5ff'3iiW3f'MT L f ' f - f ,, ?.Jf:5'f:i:SQEf:9J155WF'Refill e v ai s:'w,..1,-wassmQiiQ1fa1Tf 21ftwl:?'l?f if fl - I11 .w,.- ,I Af.jasliiafeqiazfi.ffe93??2fff?M5fj -eww. Ts' at 'f 4.1, , ' , TN 4 .A 5-J gf ,., m, 1 ,Q a f K . L i 44 H- if a-fa if 1 iff i 2 a .fb f fl it a , , px y y l 1 ,, , I if 11 Cav ya - w 41 ! af I I 'r K ' . H ,Q A WT ,N .,., fa: in I Q, if 'vm -V V ' fi f ,. i, i V L -iv za X V7:, z ' , . 4, ji l y i , , it 11 Vi: Q-xt ,, as '-'S , 4 f , N3 i 3 e 5 V2.1 Q 57, ,ga l.a.t, A i i ' W i gf f t 3,10 ,gala J, jx? Vriy -V .- I ig, , ' . 5 ' . f , fr I 4 5,8 ' A ,wg Wleftl-il? X ' 4, f t , K , if i W . f 45 f t'qag,,5A - - A I- -- 'gp' ll fl '-,' ,gg A A ag . 1 l ' '5,Ql5I2t2!i ' Tig t av 'Gif - 4 a r f if if? i i J i Sr Y gag if -f -A -fi:-J H 1 X ,V . , T QVI ' Q I n , V J V A V 9 A A H' if L ,A V Q vp' . ff? 1 i i lf? F , ' fr i! ' Wf - 379: 14 Phil Hillard Billy Holland Tim Honnoll i Brian Huff Candy lvey Heath ivy Joseprwackson Monicadacksone Tyvian Jackson t James Jewetti i aximuqnpson 5 Tfa9iSiJ0hhSQD Kasevdones at t Paulgones, . t Kathy Kea it i Cody Kellyf 'i'l ya y Laura Kelly A Kevfwevfiedvia Marlene Kepler l Jared Kilpatrick Corbett Kirxley Lora Klinner James Lacy Lana Lane Steve LeBlanc1 Ri, L. Lewist . t Roderick Lewis EdwinlLong e e Cesariopez it i KimiLoughi ty i Robin Malone Arneal March Kimberly March Hershal Massenburge Melvin Massenburge Gleith Mayfeila Kelly Mccowin i Dawn Mcmanarhyl it i Shawn MGMan2mv a t Sheddrick Mills Robert Minteri - DBQhI'I6'hMOf?I'Qk f Paul Morgan in i Gary MOSIBY f i Alb6rfiMiuiTlPhrev Alfred.Mumphrey Glenda Mumphryl Dawn Nash a was gg gt MQ V Y M M EQZZL, NAM 2 1 eg 5' fi Wi f i N35 Q M 'QW E Af ia it 1 F? H' ? E 'g'? ja' i t W I lseimesi-swf fa Wight 33 .' 'T' V--Q-22,f - 1 , ,. ' 2' , Ke. K iw i 'ff , 235,45 we ,,- ,,,:,fam, ff iiiwi bgiaig aw 'faw ae1Sfva,,: - -1 .. . av.- at me-is -::. Wq,,q i i Fig f Q eww Q me :KNEE Kirk Newman Tifiany Neyland Sonia Nunn L tDeAnne Odom S Deanna Oglesby i Gene O'Neil Robert Page Tommie' Pangle Robert Parnell . . Bobby Perry Debbie Perry LaFresha Perry Elizabeth Phillips Hugh PhllllpSi I Kathi Pinke Daniel Prather Sokun Prem ' Christy Pruitt Lisa Purcell TimRainsi Gary Rf-Ivsofi Paul Fleichard TraceyRipley Kirk Ritch LaShellee Robinson Keith Rodriguez Benjamin Rogers E. L.,Ross P Louie Sanchez P P April Sanders' L Bryan Scruggs i i Kim Seagler Tim Selman y Lambert Shaw Bethany 'Sherrod Chad Short Ronnie Sims Laura Smith Veronica Smith MeIissaSperIing Kim Stanley P Melinda Stanley Vicki Stanley Bobby Stevens Rochelle Steward o Debra Stuart Patrick Sturdivant Don Suddeth ufzseagggm Fir at iizgflfiigyiitei lewis giga W , ,,, ,,. ,,1,f1 5, aw? 4 at ,A i .X wi 1 . . ,. 'J 'rl V K s .u i ff' . M ff ti' , 5 Q ,V :A 1 ,Q ' V 1' I 'R it ff i I ' . .4 W V6 I 'X P X me , ,,l, t 1 . f i xg P , f' if ., H Vw VK 551 in fs Q ,g , W i at . W f 5' -1 , .v',,,g, , 'fly lv, Q ,fy , ,Tv 4 gy fl ' K 1 ... W5 ,L W P , ,t,, V W2 . f W f l lllc Q ' N 0 'fliilgf iai if if l 1 f wig ,. at if lk y 2' Hz I 1. f E , fw. gf' ,. ., ,. N F7 - f' ff fam .fu ,Z aft' ip-- uffnf. W -J L, 1, fd PH is .Q I 'z Q ig' iirlli' , li ' f ll ll H f Sl 'le f Y v f Y Z 1 a J i i if f ti'i all .Pi Q- l i i Qs ww get ,Qfy 'lf my Wifi ?YbWRM M55Sv it ' il k V 2 wi may: a,f:e--iimler- is if ' ' it .fel Aim-o4,,fae-f ,V , Me ' - fi- fat . . iii 7 L53 Q. are 11?tatQ1-e..,M,1 ,ee-, 1 .az-,. K f' ,JZ yu.,,t5i!,,f 7,..fM-1i,4tt, i i , Ac e, et f 1 L N1 f 'K - - t .. - -T 5 - wi Magwwe Q , 1 at I iliiffi i ei 2 ,1ffZW:z?V B mf mage 6' www i , H .,, .ZA I I ,.,V f ' ., ,S , . - f',' :-l,,s , 1 .I QW' A' .,,,l ff , , , . - M' 'if ii A 1 ' L L' ,,, QQ A t it l V ,:, W,o, Y 71, J? l f We if it all Z lg. I F ' l .Q ,W ,if - d 1 V L ., KL f lzzut 1 ia 1 IX T ,, K ., an ,V i I I 4 -if V01 'Q -ea. ij z ,,, , s Q 1 f fx of ,f l Em' ' Tia Carter V .lo M. Melonie Cates - A - A I Kevin Chance ' A 'Y RhondaChapman ,iz , A, M 2 l i Tiffany Chastain y f rgip yirf' ff Le he Andy Christopher Michael Coleman Ronnie Collins Alicia Coots J C' ' T 1 'T Andy Crim 3 .. X - ' , I . . I K K M. ,. ,W x my Cindy Crouch Audie Davis 5 r - .J 'n ,E 3 W' Mashelle Dawson A Virginia Deiatorre 1 , ,ef if y yy .. A 'ffl ff' T in f x ,I C Gina Dobbs ,Z A 5 f Y A VM ix ,L T Trey Dobbs 5 A M ' .iggfifg VI,k W e y Alex Dodd ,f.i 3 ' A D A Dusti Dykes ' T , I C lj, ,L A C y Way Nakomus Elliott H M ' 'A W' A 5 1 ' Vai 5 COW Ellis 2 yy . A y ill ,le , Felicia Ellis - j-' lell A 1, T Todd Emmons ' ,Aie, , , - l W' 4 A , Michael Everhart rx.. A --llee vi T A -W.f :fb -.3 ,max if ' W A , K i r if' K I 'X A liii, - 1 f , ef fa , il, A rf . lg ' FRESFWMEN f QQ 52 ei A wifi- 9, ,sm A: zzgsxxfff'-f ,wgwz-1 ,,,.. f Wi, ,:f:,4-YM.-,izfA:.J, ,,.ff'P-xsf,--'--.-'Z-Sill,-M, -,AwJ,-ilsrvfz-7 Qngiiglrsj ,ff 'ffiiiiii' :Lfl'Ei7E'T5i:1.-,'iKZ?i???1E5i'l. .. ' li 55' I fi::?f,34S?lls?5?,1Q '1.i7Ue,fi.,fz,i2?ZiiVE?liQi 1 lf' A , ,m..m,f..2e iffmafif gi K W ' fins? . . 2 ,- K i K K. i .s .5 ..,,,,k W , Wfifii, mf .ie-wf?e.5i.ifi',t fi 14' 21 fi ' fu fix? , Wi. ,Mes-21221, i W .jim ., -ww .. A-f: -V 2 fi: 111. uf f, ,eaiwza-.,:.izxwimsizffliiiff f ff ff T 561 U2 ,, Meigifeziiefwxi M if'LQIWW-'G fL'ffg:eW.Qi:-2,,ff fa ,mm fi v.iw:2f .1- 1 4,-rf: . , Ffiiiiiiif- ,,f'il57ilil:f -5 f :i1::i51a?:51if5.VfiS1f5G9.1L:F97fS5QfE?33W??liZifij f..,a Siena:'zvgagfffsgff5:5f.gvffgzze-.iggggizggqiwgqzi13izfiey!2gs: ,H54555uptiyljzfigyigqffg,fT'g?5?W-fglfycigfxjiifv 4 7' 5fQFf:5'Q5fEiL3A, l 522: f W' Sifwiwfuefvf- New 'A' we . ,. i AL,, Q . Yff, '.h. S Y QQ , .sa L ,f-e,.,, is-i.. YH ,gmigsimi ,,.. me is ,-,.?iv,i2Yf2,,,Qff!2f'- :iii.'ffz2sszs:i1f'fL1.ig-2V.. ffigimfq,.,,f..sfz,,.',,,:,-. -,wwi,wmwififfw.f:sswqfg1fgsQ..f .raw,,,,i:2g3p,A5ig? 1f1S:zf-ffl Q or ff mga, ziaig M ,W VQ,.. .W ,. 5 .. f W, Y, U-.,,L ,yi if ff :S W K ,W ,W Q ,..., . ,. ar., -we qmfgfir- 1- A , ,-M-fi5Lg,gn21g- as--.. gr 1..,,,i,..v- ,1y,,..m f .L -W-g,, , mem rgwi- ,ffm..5y. H . ,L 1,, . ,,,. ,,, i ,, X,,, . f.,,,zee1,a,g,5yggj,gi3ggf.5zasffsiflfx f,f .1i4.gJ.i21wv:Svfs' ,ik ,K f-.,: .x .f-. fff,f- wg 5 f.Aff' 1 f :f.- 1- nrt' Chris Fate Chris Foster Tracy Foster James Frizzeil Stephanie Gage Tom Galvez Tim Garner Jason Garrett Kashon Gee Kesha Gee Leggett Gipson i Kim Goolsby Amy Graham Mark Green Stacey Green Windy Green Lorenza Griffin Michaei Guidry Leonard Hall Amy Harden Nicky Hardy Eric Harper Randy Harris Vicki Harris Hoiley Harvey Calvin Hazuka Cory Hazuka Angela Hearon Annette Hendrix Briana Henson ' 'IYQV nr , :Qu . ea ' - ...S -7 f li' ,, Kly i 9 Is' ,, N Q is 'X iv i V, Xxx: . 7 Y , , m. .... -,egg . 6-, , 4 ' I I . kt,rf pt fX,,, i , J 5' r-af ' - - if ' f My . e af .M- S i fif'1 1 . ,ii. f.-- f is iii iii ii W as 11 EA N95 f M ., r N145 'S H3 ff: .riff I ff, ' av ' We .4 'ei 3. 7 if iv an '5 fa. J TMI QQ ' qymil ' , I .will 1 V 1 fn , . i f f k if i '.j ,,1 I 11:5 ,H U 4' w xg! fr .v , L .e . . 'iv Q' - S' J EK? Q 'W Q . . 'fvjafff J wifw' Alf 2 at . V. Vw, . .V ' f --Q A H g Q kim - W 9 19 Qin! A 1 1 x',A ' , 51 , -df ,. wi ' ' J. vs :rw ' . is 1 ff Ag a 23 I 5 l 5 f' J- ' .t . y ff- ' Wi - W ,- ,V V 2. yay , ,W K ,, f - , 1 if ' 5 EE?-T2 f ' , Q-1:1-- v zf' l I 1 A sf J V 12 i 4 is A 2 5 , ,J Ai, ' I 1, 4 ' ... f -1, ,, 7.4 fl ,.o , V ff ji xx! 4-', -fu 3' VV A 'ki 2 L, .J ' ef' if , K 'W K! y . vf. V A y inf., V. H7 If -,. I ' . :- 4 , .V if 3 fi W f fs ii 3' 440' L . A if K j K , X , ' A -,VP . 4 xv if .5 gag Q- 'G s. f 56 f, 'G'L J ' in f h 1 'X 'Q Z, -4 l f ,f. ga ., A , if J .l . U A, V L ' 'ng f ' A VL, Larry Hicks Darcie Hill Kim Hines Carrie Holmes Gary Holmes Kenneth Hukill Maurice Ingram Keith Jackson Timothy Jackson Tina Jackson J Tyrone Jackson Nathan Jaymes Scott Jenkins Tami Jenkins J Jerry Jerger i Bryan Johnson J Kaprena Johnson Oscar Johnson Sharmea Johnson TamalaJohnson Randy Johnston Johnny Jones Meosha Jordan Cristi Kelley Larry Kerr Clint Kilgore Kim Kimbrell Lewis Kimmel Denise Kizer Wendy Knight Jennifer Lee Mandy Lees J. Herschel Lewis y BradLooney J J Marlette Loughmiller Kristie Madigan Kenna March Elvin Massenburge Alandus Mathews Mandi Miller Stephanie Miller Willie Mitchell - Mary Mladenka Eddie Moore J William Moore J James Moreland J Patricia Moreland Leah Morphis s itil lllr Lawn M298 Z que 52,5 leaggmigg wi iff l l ,al 2 eff 9, rvfw el? I E I , 5 seifesaafbssigggiggg if . ul lfsiafff-wxcg gsviggszgy 14: fi us? Wgibmaezl Wi 256: Sw My ef? B 4 mer el y- J Donny Mosley Sebastian Mosley Jody Mumphrey Doss,Murphy Natalie Murphy ' TonyMurphy ,, Mistie McClendon Wendy McCormick Wayne Mcl.elland i it iTony'McFlee i J Samouth Nuon Patricia Orlando o Vicki Orlando Joe Palmer Aubrey Patterson Andy Payne Sandy Payne J Keshia Pitts Jeff Plunkett Toni Poeschl Kendrick Price Laurie Puckett Gary Flayford Shejuana Redmond A James Reed J Todd Rhodes Mancil Richardson Candy Risner Aristeo Rodriguez Scott Russell A Spanky Russell Dayna Sanders , Virginia Scotts . Anthony Sims Janie Slinker Donald Smith J Missy Southern , Jodie Spittler Melanie,Springfield A Keysla Square Lara Stallings Amy Stanley Wesley Stevens Andrew Stout Angela Stout Shelley Stunkard Chris Tatsch Jen Tatum are .sf 45, gerpereav gil, it pgs f s..,.,.n- J ?JJ,, rg A Amr? at y J - lit Mg .441 , L . jf, J 4, , W X 44 gp Ns,.,,, ,, J 2 , ,,l.l, X I af W frfggmg mil es. M gggggegym in Sta My str Q53 Wfwiniawasg S EW ik r 2 - .ty 4 ,, , , V 'AA' y , y J lm W f lk K W K r A ix : YJ V: Agek. . ffl ' - W, or ilt, -,'a ,, 'e l J 5 . J' Q-3 2 A l,,r A 72 a , , ,Vii 'irr 3 ,V V, A qi , , e'r ' t A ., J' -irl 39 S 55 1 , Y-.CN I H Ji, . . Q X 3 'J Sli ' .rtrl ll if 'V' I Q, , f 1' J .sei all J 4 ' ' 9? K A A A iri iii J 'i i' V ,, f ' ' - J ' ' av W Q. - if r rf' . ,Ks P J fi T V if Ii' ' -Mr I me.. Q. sl . rr, ,, I ,Jai ,Q - ,, ' i Q, J fl 7 ff fi, . 9 T-J - f ' 7- I ii al -1. 1.2 K Avky K' 4 , FA J K Q ., -, , . .JW zz, 4' 'Y ' f 5 J' Jw? rrss .-. U .gg srr y r r ctc. Ji ,mm ,.,vl, 2 EIL , 3 l ' ' i we If -A H , ,- ri, J 1: . .1 1 'fi' . Z fl. J? Q , f 5 sw '11 , .,,, -'14 211' 'J J- ' . Q51 ,1,,'-7, ,f N r gf f ' fl Qi, l X 4. ' l - ,fr N, r': 1 . ,rel -xl lf, J , Q. , .-. - X 1 - MA A 4 0 an M- r nf, A 1+ W V, ,K 'S' ' J, , V! V ,J af 91 f ' f , .,,,ei ,.,, M. 4 J , , Je -S J J J S, J, A X iff , , ' , , ' V .i,' 15 J.,, 15 ' , , W ' 'I if ' -'J ' 'J W ' sign vga 3 , rf, j- -Q, W V .. 31,7 , , If ' ' J ' ' f' ,. 'rv fy 1 I ,I Jw, '. . s A saw -L W 'A 'A , . J ' ' ' 3? l w f . , 'Z 2 ' ' Jim 132 Jffa - id ' ff 'l-i r s ' ' , ': f me liaii fczfz' xx'zfz.f 511 ,52 'i..-JEJEPIQ:-lr7F?'iM , erm,- ' J M , I ,, ' R gk . 4 . an 'a arizvgzsszgfwl sfze l mwt rf-r:fv:e:fassQv :sw-1 3 ' ,W , ff r-gsm-J-QIJ f ease--,.Laff:.J,,f. Ji-Sw - MM wmv ,fzfsrwQggSLl1ets:,f,g aisan,?:eias2g::5Je?'Jz,,sf ?Z1'irf'f,Jwsgr' 'isles , ' L -- ,if win 2 'w 1 , - .. ' 112' ' ' f T ,. A . i WY l ,, L,,,.,., T., . My 5' , A if f l 1 iff 4 f My gn JI I . sm., . T ,, , -J rl W 10' Y' ,.,' - f , M , : f Q4 y 5-gf 1-ll -f, ' ,w 2' ,5l,f,,5,gj ,Wge5'f 4, -1-1' ,S -27, ' , ,ILL K f H he ,Ii Q if aff l l 3 eq-g-7 'I' -. lv'f,,EQ,.-il.. ' , , E ,, l, , ' - To A - ' M W 2 , N V7 , 3 , I , h 5 X 1, A A' 'i i V, l 5 6, ,, fa. T' - .' J is ' 3 V4 L , ., 1' l , iw ,sl T- , 'Q' Q -' -A , .W 1 ef'-, h iQ f 5 . , gg, I ! Wx ,jr l I Q, - 'A 4' .. ' M 1121. ' -,Q , ' 5 5 , . W T in 1 ' F HH -Q uv me U 7 f. M913 l 2,.ss2ifEsI5Qitii:i5e27lias1:, .lw.,lla,flaywfmzmx fieifffseiaem 5555551335-Sign lblililflfiiglw' semi' ,fa45gsMlclalmzll4f??Eg ,: ew 5 Na fwxllm :mms gm, W T N ' 7 if ,'lL-Wzwlfllilliiz' 'K' , .- -,,w, ,Wi -,,5:Q55gg3,,5g,,,fl ,,, - - 3 , ,,,L:i:z, , K .Cv li- V5?'4fV??ll?l?1ffff35?fluff-WQ::1?Z:Lm::9Ng.lZ. wi 'IQ E!f2llgg5af7g1gs5i'3ifl'-WQMA fgw ,. ,Wm ,X me is . . Wa, W .. ,.,:-.Wgf-,g,,7zgw2sfmga:'szlgsilmgswgfrwfagA-agengaslsssxifflafrfefsivfe, 3 ll gmyf.sza.al,,l,ff,, 1-wiaelfl 'QQ ,gEll,N..v1, A may s Steven Tharp Chris Thomas Dresdan Thomas Heather Thomas Quaid Thomas Derek Thompson Jermaine Thompson Terry Toole Sherri Townsend Tonja Traylor , Nicole Vanover i iiii Rebecca Vincent Apryl Walker Aaron Wallace Gatha Wallace Robert Walls Michael Warren y Tina Wells W Tammy Whitaker John Wilkins Petula Williams Susie Williams Mali Willis Billy Wilson Gary Wilson Tammy Wyatt i li fse5T1i2E3lAiS5gjE9f6 ,f li? 53?':fifEffiV,'f3 lf if 515745'li55,,lf52ii5g'f?5:'? .---' ML--3,glsgvjafgggpdfjqgqEE: ,,: 42,'fiz?fwVaia5iEi5xl?5ls35iegsfail 411- 2 1 if ,elifgbeisszlsafillsglggiifae 33 7'VkitffffiffsiYifE?75fil1,ifigs:sl .,: , -',llf11'lfafimff2il.'4hi .-,'- , were SKS!!! A-'fEfw 41-ll' if-Y-ru-lin . lass L' i ,iigwjgil ww. My 1315 gs:-ies-.f5,5 ii ,T-we y gm fgl.,S5igf- lffwwgggl qyf ? A ,,Q,k,, ,,,, lla,- ,,. Q ,lll , , A AA I W --ll , ll 'l f ggggwvwsxsswlifliffg f 5?sf,g,fe,1la,ls 5 Q we 5 l' r Li , K ' ' --,,'. ' ' is l -- K if 3? i i ' 'i W , .l f m l Qelffffwlw,,W-,,M l QL if f , K , Q aff ' .V gym.-515Qg,f,: Y,,k ,m:n,:eus,,i,zfs,f --ffl-WM M fi A ff f lm. va l ll, f f eww: ee gpm 5 54? KNEE Ei 2 FW al aww i A in Y l is ,, e 2 lanes 4 ,S 1 Y We K GEARSf?3?gs'W M Y 'WNW W fag.gg:f:,::g5.-,,f::q,f.,55,v,sL,xx zq f-zf1,,,ggs5g,.fr4gg zwgqxgv fg V ,xy V: V75 Vlphgiljfiligiili-5Plu5,l?5Yii 'l fil SZTT-v E VT 5f : fflllffillefi is ' ' ' 'm1a,,w.miiflzzaslf Swfiieifflffllisiezgsffemaisles?-51'lawiz,iaMzig4ses':.: ,-.-fl-1221-'1gQz1:esgsq3g1Lzasfpgixx me ,X a1lia14:.ifQ 11i.a? if Tif f, ' iifiz: H+? ffewllifiiisl-ifnf- ',,,c-we:f,,.wal5f7LifY2-lil - ' . ,, ,veg 1f'fais.1T swszfglz-iilL1f2fi . .. El of essays:,zwmff-I-fif,ffl-ywslloz iw sl ,-,A A l. ,,4s2rlflm,+ fmz ye fezwqmifie .f',,:Ef,.i' ,.,., -Axle ef tif ,gpviw- M eeigarnisrmri e eeiks ,t Q, iiffwisisiesyfw sw frff 1' :-k-'- 1 '1 11' f C y il t. K 1:talf1ttQ-ffszzttwoaz ,gi far, --::-- we -L-f NNQ::Hr1ltfflz,fQM,f - iglxggzm A ,I 1 - --fy ., ,- ii. ' A- --... W THE WINNER IS . . . Mildred Cunningham, president of PTA, waits patiently while Assistant Principal Janis Walling draws a name for the door prize winner at the Open House. AND NOW Principal Jerry Hardy gets the audiences attention and keeps it! THANK YOU, BULLDOG BACKERSIP' Superintendent Johnny Johnston addresses the Homecoming crowd about the new Spiritmobile, made possible through the generosity of the Bulldog Backers, Arp State Bank, and Threlkeld-Covington Insurance. Q if Qox Q58 SQQG 5v5'.Yb,Q gsq SHIFTINC? 35Q GEARS87 - V5 , f O X' .5e7355i5 RQ? ' TQSX- YAQQ ' YQSQ ,3'vfxQ2 - YQ? QSQYQQSS-R95 g5kSvQQ2'Yk S X . 95555535535 123 , .,1A , iig J i 1 i E - -'W -f-' Anas- V, 5 :gy ' h A fi 2-visas limi is at , cs, W- at H ,s..,fswm.ausmiiiiit . :ss ' IN TUNE WITH J A - ' A TCMORROW sus .Q i aw g t, i .st Safes? time it 253234 tl, 4, at 1 .S i 3 5 ti ti? it - at Qi i 4 A M . .W , . , A ,f . 7? 3 J L' fi.: ' Y' if 97,1-' i s zfieiifil . feta U H .4 ,jp A 32 A X Ji5i'gp.'7T.'iI555f, 'S 531 jk iigg fiyi jlkfgh f V 'gt4:i'?ii f - it g fFrant Rowj: Jim Cunningham, Vice-President: W. E. Brumbelow, President: Glynn Whitaker, Secretary fSecond Fiowj: Mel Charlton, Cris Pinkerton, Shirley Dean, Charles Edwards ILast Howl: Johnny -Johnston,Superlntendent, g y A J J . Herbert Norris. . Special Programs Director .pf ,,i,,. i... g ' Cleo Tompkins 5 CI H Curriculum Coordinator i Dewayne Bethea Business Services Director in Joann Noithcutt Budget Officer Winona Goldsberry lReceptionist!Secretaryj Laura Jones lAdministrative Secretaryl Barbara Brooks lBookkeeperl Evelyn Johnston iBookkeeperlPayrolll ADOPTED GOALS 1983-'88 Goal One - Students should acquire the basic skills necessary to be socially and economically competent. - Goal Two - Students should gain skills in the logical process of thought. Goal Three -- Students should develop skills to enter the world of work. . Goal Four - Students should develop knowledge of the fundamental structure and processes of the American Economic System Goal Five - Students should acquire attitudes which will promote good health and physical fitness. Goal Six - Students should develop an appreciation of our American heritage. ' Goal Seven -- Students should acquire an understanding oi and respect of differences and similarities among cultures. Goal Eight - Students should develop an understanding of our changing world. Goal Nine - Students should develop good character and self-worth. r Goal Ten -- Students should perceive culture and beauty as expressed through literature, art, music, drama, and nature. . - . .X . 1 ,WL V t fi i. 1f,g-We ,Wei .-tits''sxf7:i??HKA-frii it ' N at-'fiykflufi kzlfililicisiywg if , A K I V' ' ' , lf, 2 ' -L i .555 gwugiffsiQ5ll,,QfgQQg,5igI- K K r V ,Qi H-g:. fP1Zgtl1' mtv' 'X,fgilwS'XfhEtEf,5-tl Fnjlfi ilk kjjggifggtie? -32:-bwgjgf gigg is 31 wfaiffssissvfaiiwi 1 i ' 'S .. trier' at X-. a is -Si 5 it Q. ,4 Q SH at Reflecting they districts up- ward trend toward excellence, the T.E.A. Accreditation Monitoring Team rated the school system as fully ac- creditedf' ln a memo of praise to faculty and staff, Superinten- dent Johnny Johnston noted thatffthe resulting report pro- fessionally supports what we have known -- C.H.l.S.D. is an outstanding school system because of the good work which you do. Weiare proud of you and your contributions. i Jerrytl-lard ,Principal James Sur J er, Assistant Principal t Janisgwalling, Assistant y Principal y V s ti Jessedones, Counselor .Roland Lane, Counselor i 1 Claudia Pruitt, Secretary to Marg Lane, Mr. Jones Shirley Gilley, 0 J it J J FieceptionistlBookkeeper Annierlvlassenburgse, i t j Attendance Clerk Kaye Hayden, Secretary to s r Principaltlardyi J , ,Tax OfiiceStaff:s J i g J JOArin BO6thei, Eula Sloan, sis L is is . s J PatrFord,i Secretary to J s s J Mr. Siurber, Mrs. Walling ',I f t ff:t 1 -fyr ra t-.,fgl rs -, Q 11- ,X V L 7, .. t., H -:,,- ls... K 1,,,, ,V ,.s. - X. J, ,,',, rf, ,,t,, i f.1M,m at - . , alms, -vwiisesflfzfsMfflil V we 'N so 'f ' , W r pineal ,f W5 4, s1,t,e-fdggejwrgftzrmw MAKING THE GRADE . jf 5 'fa,,V!' E' IQ: -:VLBA . mm 'A 'L 2555 . . efeaarwefaeargffsare A ieae rgwigm Km f V - f .44 ye, Q, E gggwmgx weve' aww? ig? Myfgggwgeh imma Ae M r -- H fa A A ., W. .,n,M,efgM. .rig .N . awsiiwf ,'.2ssfaieirQi z Neff- 2553- ,mfwee W QM C ,Ze -my M, me V95 , E, wee f 6 f M, at am Q veg ia jg we 3 M 2 1 , l K A A elf? A ,cf f slgf gre 1 35? , exe r are Like, as is i migrate f EMEA? M 'fl New ferfiqfg ,l ,A.Q2aM,,,., A W as er fre seiko, 1 Sly, Seng, are 2' -1 X M M42 x me was We 4'?tX7W0f3 fa'es1r?i'Wr53Wn Qffgklfffp rr if rl tfiiey fer? rein? if ref V M HM Swift? is tel fiai' f Xia' l if 4 Aim SK fy ' s, 4 ,giE'3iwri?5vl?r'rgyam,2gW IW Em, 'Q rg X eargfiit , 9 ' reflaiz we .4 . 5? 1 he Qfi ,f 14. H .aaa '?'Q'ffiSAgiYgi'l195?ij??aaegVw,,i5 ra, rr iii? eerxigeegeleeg rw? ,. we get sw , Simiswlg Afgrfg Z gage? rl K K M1312 Sr x Q X 9 X Y' S s r x M We mersgx aging? if 1 A L4 ea wig, Sz, wt we we gm 65 xfajriyg ,wkf K W We ,railway i,,H,Y'?kwe me gg ff,,me,m Qing lm? at P'?,,,w,-grim We Vary! 1552517 Qgtemy A K Wi. new M Nami, , is S, ,Q J ,3 , ref My ew X f gf 1 f we 'Neem N M ge e V is K News if Xisemelaugadfg mi V in ,ik XQ age! rf ff Q rf? 32 ?7e'j'l'fMfefwat? '.,,gfg,,gqu 5 ,-s,fq 52fQ'm,eeer, T X9 far' S wy K WL Barry Anderson Nanette Anderson Linda Baker Earlene Bethea Robert Bogue James Browder Greg Brown Joyce Buchanan Dave Burnett Jack Burrell Sherri Burrell Marty Busbee Scott Butler Teresa Butler Walter Dawkins Allen Emerson Terri Farnsworth Molly Ferguson Arthurlene'Greer AC. D. Gunter Terry Hardwick Andrea Hartman Frank Hense Callie Hooper Linda Horton David lrvvin Sydney Janak Sheila Kimlicko Tom King Terri Knotts Greer Lipscomb Tony Luton Rosemary Martin Randall Milstead Vera Moore Q , 4, me J ff A Q Mi mesh: 4' ffl! f FREEZE! Mr. Wheat gives in to- angry physics 'students and promises them an A Fon their next test. lHA!J ...iw Q, fc -f f .X- X. s if A, 'Z X Q ,.1 qs can V.. ' .-' ff f - - Qs . .. Y jf, N 5 'F ,. . A l - , H A ' -it - - , 5 . ' a V... - 5 , r fl it ' Q, mt 'V .X fi g KL ' .gt life' W. J A F5 ' ,Q .r Wt L 'rffmrxfqfzfflr fl A 4 rrr H IPR 1 em i Q. 4+ -'fr . le f A f M cf ffm 1 re 'gaftww QM 62 r . -1 1 V was 'x , r 'v .ff,.. LJ 5 my .wiv I X u . fx s- ,ew elfkerx , 5. if if fra ef- .r H ' 1 ' . 1..3i,3.s: :Er E . sry .Y 5 t X ei teee . yr, . ,,,, 4 441 ' 3 4 W R W fi .. 4' r ,f 4 rw t r 2 1 1 ff , r 1 ,fir .r PM -Q ,..uf. 5 Q Q 't i 'ffl' if A Q 1' , , . xx 354 M, ,,., ,,. , We Q 1. ,Q 1 .2 ' , .W re rf Y , Z , fi .. .V ' V 'st ' 5 . .. I . WM .,, 1 . ,. ,mf ,W 5.1-' ri - r f Ai f - W- ' 'JM' W -f ' ZZ . ',rQ',1an-eve'-: ag lr - ',1'..ar, l . rf , W. we .,, rw.-.1 9 . ' p ri.wf. Jr ,e 455, ,'aa.:a4.m l,. r. 1 'iff 44r ' ffl. Y X L., g x I' E. A. BettyeMorris 1 f i ,ge F ff Terri McClain y . . 11, 9 ' Carolyn McCIendon ' Q C' N l- C f ' Patricia McLean , Y . Paula Page e xif , ' , Billie nice Mickey Richey . Dottie Roark .: W Delores Roberson 1- ' Linda RODITISOTI . - David Sanders o .. E John Standridge 4 9 -i b fi., I Nan Sulser 51 IA. Efma Thompson I I' Beckyrynei I xp 2' H Mafyfmnvanovius .M if Q: I . r 5 Janicewallacef 4 N Hershalwheat ' Beverlywilson as 'Q x he ,, Q t Danny Yarborough 7 ,,f1lf X' 5 o'ror.-1o onin Charlene Young I I YOU DON T SAY? Coach Bogue seems surprised by what Mr. Jones is telling him. IT S GOSSIP TIMEI Mrs. Horton and Mrs. Martin sneak off to the kitchen to exchange the latest gossip. I CAN T BELIEVE IT! Mrs. Tompkins tells Ms. Tyner about yesterday s episode of All My Children. fmaggpg AMW 16k -eflwghmgis fi L55 eeiwm . -V i f fi .w - wipigx 'wifi fef eiifzillqf fy WT . :' .15:a ::.. ik, s . E f f . , t. X555 ' ' -s':: :E'.:t '.::. 7 - , X A V M .W M , ,wi ,sp Q , ,. ,t-rl . A X? kimji k .. ,f -eigyygyqswr h '4,,-:--I: -:.,: .., gli' .. 1 -I . - I' ,wriees , Mefqgweri .fs ,S tr - 'gzwftu f -f -. . V, -k:. 1:', ... . V- 2 - 2,195 www ,zeieiwm Pawfarw- M , at as f - . . f .xf gpii e .saaV1'a2wH5'QfnxfeQ,W f. ma A . . . . I I A LITTLE BIT OF HISTORY . GUESS WHO? I Tia T i if' B 741: . VOTED MOST PEP SQUAD! VALEDICTORIAN RECEIVED A ATHLETIC OFFICER Sydney Janak FOUR-YEAR BAND Walter Dawkins Pat Ford SCHCZLAFISHIP nnie Massenburge r TEACHER S PETS . , V tif ,i fi gif , is snerri Burrell: Two cars: Fluff 411 years may and Garfield I4 years oldj Dottie Roark: A black cat named Mo Roarkf' M 'I Andi Hartman: A Bengi-like dog named Stinky. STUDENT VAHSETY Nan Anderson: Twin black and white cats named Tippie and Tyler, COUNCH. and 8 dog flamed Pearle. I ,. ', , I REPRESEN1'ATIiVE,Vk Carolyn McClendon: A dognamed Mingwong Perry Chen Mc. Jams Waning - . g ,:5,:,:3,555, l HIGH SCHOOL ACTIVITIES . . . CLASS OF 'l9?? Earlene Bethea: Basketball i3 yearsi, Cheerleader Q3 years, 2 Carolyn McClendon:Volleyball, basketball, track, drill tearmvoted years heady, Member of Thespians, Football Sweetheart, Class High School Athlete of the Year. Favorite, and played the bells, marimba and timpan. Mickey Richey: Member of the choir and the drum and bugle Terrie Farnsworth: President of German Club, NHS, received corps. Spanish Award, graduated top ten Paula Page: Member of the band, drill team, National Honor Socie Dave Burnett - Ag, drama, UIL Science ty, and the Ped Cross. Bettye Morris - Drill team, yearbook, Thespians MEMORIES ' FACUQW at M I 1Mff,fif:ms.iww ami- f ,+ :- v'fsf:',:w , , ,- :fifbFffz2ffifissfi' -flfw'fx:s:7,,,,lisig4y1i2-Qggglffzigf, 55231 1 1 :Ag 11 fvfaiiffrt.-tar Qi i 2 fllfisfflff-2:-w214ra'ffUs41:1xaz,f::i:ww4s-I, .Wi -sagesgwifsefelliifrezaiwv. 5291- ifiym EHSL5Gl55?,'iET1 fsfilbfffxiv' 'f-?t5:!'w.E,t:.w,'sm59:,an,L'f2xf.:i2:.4f?tt2wLfbh:l5lK7tfkf9?Z:Qx'l6N5It-Emem QEIAVVESZ ,,,.. -V , -- fl . s,,:r.f,.,l,.a.,lf,,,t,,:,,, We ,W ,ii fi five ' . Q., , , :ii3isitfLfs7i fi' irvflilfsirliiieslA.f're,.rea,i -a3at2f:.a:X Wir -Q its as ia?e?e?f 2 - lil? gi : 'f l 541772-9f 7'S-tif' 'T' 7c'I75'W-I'75I1E: ,fU1d'.:Z,,li5155ii':5:SI!'f7?SIGZ5IiT 5'3Efi9Sl3I5Zii5f5?l 751555IfffikiiIWW51iiTf5iFdiff1V1Q5WiMimxV:kaiZiIir?imxIi ' ' , ggi? gg .. Stealing a Rebel flag directly from the hands of a LARGE R.E.L. girl in a car. . Terri McClain CAFETERIA iALMOST Home HQMESTYLE Cookine Q , .Y st fi .Q f X 1 Y 'K tvs' A x i w tv - I ' ...Q 'H . JV x g vq 4,g. K 9 . , M, U . T Za. 5, s. D Y f fi .M 'fs 1 Q-cgi f r yjsav 1 is W' lt's not Taco Bell, but since, we have to go l there, lr feel they try to make it as goodas possible. T t , G Tara Weikel 4122 . Since the school board voted1Q close the highschool campus at lunchytor safety reasons, the cafeteria had to deal withythe increased number of diners. ' Three lunch periods were established, and Mrs. Walling worked with lunchroom committeesgstudents chosen from each grade level to give inputto the cafeteria workers. g,5Studentss selected were Jason Garrett, Amy Harden, Mashelle Dawson i9lg Gary Mosley, Bobby Perry P41033 Rochelle Councilman i11i:geand Tamoy Carter, Delaney Atkins, and Vicki Gray 1121. 'G G i T Eollowingrstudent suggestions, the cafeteria added taco salads and soft-serve ice cream to themenu. g T il i Peggy siren from service Directory Ky ii y Patsy KirkleyiCafeteria Managerl g 5 Christine Perdue iSecretaryl P T 3- ,i . J. D. Nantz lDlrector of Transpcvrtationj 4 iili Roy, Lynch i,Directorofilivlaintenancej f .f or -. , ,f T Frances Barnett iCafeteriaJ S 9 Ima Brown lM.S. Cafeteriaj if ..g., . i Lura Brown fcateterial i t g N5 + .. 'Belinda Ferguson iCafeterial G Lisa Garrett iCafeteriaJ P Thomas ,Ghee qmaintenancei . . S, 1 ,Vercile Jackson lMaintenanc f in Tina Murnphrey tCafeteriai ' Cynthia Parrott lCafeteriai T Terry Phillips lMaintenanceJ. P . H 1. ,,.,,.. as r . r - Elizabeth Ross 4Cafeterial We 1 P V T i Barbara Scott iMaintenance7 ,,-- t Debbie Starkey iCafeteriaJ . sa.. Bonnie Williams lCafeterial Gsiieva WilllSEiCafeteria7 Q 4 5 ., 1:-5.0 S , 1 t - , ' Wk ' '-s 'ff f s - . A N -...A CAFETERIA AlDES. Tina Mumphrey, Evelyn Mumphrey, oeltogesg Jones, G ' Melinda Warren and Elizabeth Ross work as food service aides for both the middle school and high school cafeterias. fNotPictured,i: Terry Jacobs and , Danny Scruggs. P :.fl.:w.v:f...e. 'Q - r r- I H1 Asif fifszwlf ,Qfg:g5gzgiQ2f'fi2f1!W Q- A K si N. .ua .kissmm ' --'ewfsfegsg' 'fm-,w,g'1.,--I4 K., , 1 i 1 f - isrisfu-zffsw,ser1f2s:s.:e:.::v1.--is-f.sMmfr..:.....sr--s.,..s,s2, W f W.f11,wf1...:s.::-.f -me-.iz - ' faxgisezi4fivff3S29igwe:1f.2.1:31...iwrf:mfwexisfazsl-'igryfigxfgf, . f 'A wg, . ....1...:w.-ear. :f.ifs.ffaeeeu.ii1:i ff-' - ff-mf.:-fffttf. .W -fm wa.--sififieifsiw Vw sfvvswi f:',z.ssisw:::s-1-2.1. ::fe:wewfs.ff...fs-.srfgifgaisglfgdfasrimmm eng ., ., . ,wmv .165 . ..,.. ,..., . ,, EQEARS 5 180 I CAN DO IT MYSELF! Wise Elementary students teach Jackie Ates the finer points of dominoes. YOU WANT CHOCOLATE ON THAT? Angie Bueno shows the life of a workin' gal. CALGON, TAKE ME AWAY! Lojuana Jones seems to be daydreaming of a better life. 'K ADVERTISING GEAHS r -V ff . . , i 5 Qixf f , . M ' i 5 ' m,A, ,1hX 4 'V Vm'mhh' hm f' l Q l 4 ',j2' ,,g .jV ,,f ,, 45,A -, T .m, ..X'i Q Q f1 1 ,A A 1 l , ii, Aaf',i f 'kfu 1 3' . ,, x '4?':,f'-' W h M'f'1W Wm W ' ' ' .. jj : I V. A K . ,n,,L.,,. S X N. .. A , S.. Y fqigggf: -f r+N.fg,zA ,V ,gsm 23 fniygxiswxz rfifaasfsi ,nmgggsg QQESFQ' is 5312. Q 5iI:fsrs53i,,g.w?Zw15!?',X?W' ' 539195259 2 f' I-6124 - If -was v s- my W 12 5 2- gy-sw -, A1832-f25x?5zw,2 , E1 'G ' Iszfwr :g s gin? if , 2 Wfwfibf- f ggciariv ax Q i , , ,L y 2: i K ' :. 'mg1mp2: 5 Z ? 3 sislizgisfg .::. - ffifigg fi v A 1 : 423-EQQEEN 5 fs ' : 2 'xL1ML .,, fg 'w35f': 2555555 35 g jim X asfig . Aff-1 H' , 'X il? 555 f.. ?i?i?S3x a' ' KZ V . f f W f Q -QW A- ' MQW m ay V . wgywffxl-5:1 L, iz, mxkggia 5 55551 vgzfgsf dgw lg Q18 Q, fy M 7 Ia Q1 Wf,?5?1'n95 5 225-2 M '+P 1 2. Mm Q N ,V ,,.. MALE ,1LiM:afm,B:-.,:,V, WW, -. . H Y H1 1 iv A15 ax M 5 ,.:i , ....: i fi F . 355173 Z' Lb QQQEQE35 ,gQv1s?1siiifiawWgSH lzgtvmi .Wig Y mWi,1 'rex'-Avi, fas Hr-V:gs1rs1Hf4:E' .avg , f,?axg1ff W X 1 riaxw.. -6775 Elf! 115' 5 Q, Q 3,3 , fymmi r-Qbzvwmc ,J ME ,N Nm Wm, . M..TM m.,,.,..WM,M. mmy-35,-g.3f ' vw f , ff Ja: , ,,. . fsm l A NWN, X K 3 , - , kr ,I , m, , Mm at , -- Y V 3 wpkig EE K 55' i w YQ lx! S: gf l 4 P M g 4 1 H 6 A 1-'-fn .ew -WMM , ....:: .,. .. S 1' . ,,w..3, .... Www I . ,GQ 'Q . , Q 5- : ' - MMM-, 'x f ,f , ,xxx Ar,---n Vffk I 3. ,gf .Y iff lf.: 'A ' ' SY X 1 W N I . I V A S . . L4 'Qu X .x . -5551. S . I IL f1 ru7'g 1 'N' W al- S x 5 s 5 5 ,, ...,., ,,, ... . . .,.,,,., T, ,. ,A 4 ,, . 4'5M,4Lm?aJ,fifff1 ,ff r5 , A, mmwmf ww f. V... ' fv... A Q, WM A- Wm.,,, g 22 f P 1 , 21 gal , EL 5 5 2' Ze, 3 'iguii EVE: ,325 155 4 F Q 5 I W 'JE if f S , I si is 'E La SE 'a H 2 ix iff 4 22? iii? 2. i 2 ?f I wi: 2 E Z Sig E 5 if ' P E 5? 4, gf? I, 531 x S5 QSV' mix I H N - 3 .5! E5 W- L fezfgfzmm ' w w? W I? iv y : 35: 5 W K - W Y 2 291? g, mfg T 1 .m,.:,, ig? VA F N . , . , K .42-3-I ,, . L Mp 2 E3g. , iWwm12a 7: ,. A ,W E.-52: 5 -Ei g f -wi. m,.9E31, M, , -EEL . . Q, M A :ah-,,5 -f-f 1. . ' MAJ 5, MW x- f f 1 ,w., . ,,'q f Q imma H! 1 4 xi f' 1 438113 Z, gjfifli eb, 8.-wr, h-HM Z ,, 513, 5 -H1 M EE? ZH , i 1? ggi ,mamma ggi A ww 1 if S55 5 12? H X M 3 ,M is m ix gif 4.f 1 -2, P? 9 m ay W K ' Uk ' 9 K 552 Ears- 1-Q , ' 5' V2 3 H-W' 2 --- - ...,,ww.ag.,,,W ,mm '-' 1m'fi?n-1-,M mwwm, A 5:-.dm ,ue ,,, ag . N- 1 4 ww g wx my 1 A X 1 -- -V -- M ,. .. my X34 3 E ,J E 5 11 51 ,4 P3 F Us- 55 'a 4 if 5 xx . ,N E i f , gg -Q V, mm HE K Ji ,... is LIFT. ,... ,.F,... ,... i A ..,..., ,ETL , A A .. ,,,.. Www, .. W 1 3 W - 3531 L-www' W-Maw: :ie it E st fr L. , W if 5, Q? 5 32 ' x , . S1829 .W T 115 U dawg ' 5 waz. flwi?Erlr'EE58?52sJf.1z1ef.2:mrie'?ffiz?2+?:2i'?t6j!57S5525f'H:wVsiLs'.ai::f3fL?iL3lEd '-was gif vw f' ,gigfggllflgfkevlsirfikr :ris2?sg3?i3Srsff?H?E'Sf lil Hglhv-nw''eafgfixwigygfgiwwfjgaf ,ytsftgwgmgwr 54 -if ff? . W,.- tt Myygjgy1-oggfggggfmgg,zl,5,,..,g,,w.gwl3ly.t .v,w:4p:4,5qgLt3yfgyaggyggggggsyygs, k ggrgmlu K gQ,1rQAE,5,Qg5'2gz2gQgs5g271.fQWarsl-f 5 flgazl .5135 rr-rg7z.,r5rf-zztrwgizffx'fr+,e'31gA2s'7544bz'r1wf L -fiwiffiiiiiiflwwwilu , ,, gksiselzzgwirifgitrgykktw!ffzkrsiwaiflfiglalikfagisisitriirfegfvifiilf ,-,' fsiif :Wi A 'K A K f1f15'i1i5'9:EEE?5Hl51if?'.l'i:1f3:vlE' , ei J: f-135112, ffsaevgszrz ,. S ,4 is E Qmgmaw Q ff- 5251: f' 1 1 . 1 frrmtwia if 521 2 - We re there when you need us. E , A Subsidiary of The Trane Company . 2115115556855lsifLEz1Fi5'i?'3is J MaI'lUfaCtUl'el' of QUallty . . . . . . Residential Central Air Conditioning 5 T Products 'fi alarm:-aw,5i,i12gfl3g5wg3 gl. 6200 Troup Highway, Tyler, Texas 581-3200 3 .. ff ' me ..i, in A .. tl it :fy-.11 - r is Q f 1 - FVVWV YOU haVe been 3 2 .o oo .A joy to us and you 5 E rzuy sei-4oso Post Ollke Box H0189 Tyler. Tens 7S7I3-0l89 naman mc light up our lives. Stay as sweet as you are now. - 3 SARAH BURCH TYLEKNATIONAL BANK , 1 S ffmgm. Wi. S ,,,,f. li la V ,f ,. ,, .,.7l!.k35 f ' W -sa ,,,, , E f 49 L 1,2 4.3, -, .W . VY' VI? ' i . Best Wishes to a lah Remarkable Son Student 8t Friend S? ' ll JW 1 I s 'St' 'ff ' f, ' b.,1f,'t . W I Terence Thompson Member: Chapel Hill H.S. Band 184-87l f -:WI , , ,, , x. , tg... 7 A SQ 1 1+ L- F51 ji 2 r , - ,f Q 'tl u, , , ,.,5 5 5 , f 5 LAURA ANNE CURREY Q 'M l You ve come a long A A way baby! of you. Love Mom 81 Dad l . AJ f' 1 rf fl f FI I . r- , J M ,, ' ' ', Aqazzuwaias Xgfsw g W-Sw Y- sux A -xusgsgt 1 -N , fmixdtys B N sm A M 'Wi . A . cn m 'li S 'U it -1 K o 5 S N - rf rr 'T L ' L 9 if ' X' C we A sis- A--1 A 5 Q Q1 .LJ +6 4 'J TAFE V.P. 1861 Senior 4885 . x W 'wil N-rf Momwad .... We love you ww fwilmlistfsfz gtar?Efa:1f.ys,, A K At KA miwfw, :5wQvww..zzm?ss,, QSASYIWFQQQQ-afgm446ml. W am 1w3Qf,a:gfsgXg.,fzrw-wwf 'aiwvlfiiii 9113 fire r r r ' ,MQW .Q ,?. ,..A, , elif!- L to 8, s,.gglyg5l,flyl ,nsff J QQ 5 5, mgza 5535? . , ,EW A5 Q , wi is lsisilrsfii A 'xx xi V xl 5,553 ww iii S E, t,,,.. wins xl ifi31fE'5l99 5 1-1 sgrzmfzts . ,,f.. Nef,,fm1f.msm:rmw, Uff, s.m,fr2gyfwr5-ff-- f ,ffl iivdiiiri .,z2fff. Iiwinfiizra um Jlxiiifwzzttems 1 rw 4 W1 3335 ,ml es, Q. A 2? fr are 1 t,r.f , ..,. W, P it gi K tw Aix , iigigglirfslzrzf. i-sms its ,, at .W .1 r.?zff:ssz-Q ,,...,,1. - r:w,,-Hf,?5f,w.az,, ff.:,2f.,s. :Jfs41f.li 55133 Q T Lf,-.r,3...z U salma ff- -ffsf :ffw it 2'a1,feaswr iff: sg . svgzrsmewfAe1eA:1QQ':z fi? fsfiiaiiilg tliiiikiifitsf lg,..1raitWRf2,--.Mr gm- em A ,fs . ,,..,,..t ,, if in 'swf 'if 5... , .,yy . 2 . , .t, .fm tt., A X-Q, Xl ff... Y Q- .t ifsizisezassffgizi :raw yr .L H 5 me Hp, V. izligswzzfmaiwlsiirk. iff Ati 135: 2625 5 Stella 1 4 fm at ,T atiwisszfalieszgeaf wise 544 2. ?2fll 'l'1' 7.sL,f.g 11. 1:Wig-f5A2Er1.rf525512522 fest .4 atHs.fs-w..,,.!ss-rxwwrsml-fre. 13s'lzrfWf5ffGSKf wrrifi ' Wt:,.1zz,w1wtr-zV f---.wrt 1rW...wmsw. .. ., www.: - ' wwf K . o,,.o,, mmf. f'si?iJ2Tfi: ,W .... , ,,,,go,,.,,,, 7 f-.eil Him 1' , ,Qz'-.imxfffggs ' 1f7EE.:ffk.:5S5iil'iiil ..,,41fts W K 2,,,,,.t.M K 2 . , jf :f:gr,.v4g4igg st grwtfggfs . ,el if , 7,.f zuegqgs r s 8 4io,,.,,5. rr: :sew 7 ms? J 557 ifiiziiil mm swgftgifrz fi 'iigdfs xlt :slr 45222 or, fs, A 5 .. ,fe ..r1,fwi , . -- . A , X 2,2 4 2 L , me fl 'M-1 - L. -V if ,, .. sg,,f,,ffi..ses.em-um 1 . 2' :air-2 ,Q ewes, 335. . Q ,F 7 - f fy A--7 : 5 1Em.aH,f::e s ay- , uf-5 qiwsyfgimfygwtwyqg: - N , S J S3-Srwizearrf-Qfzmai'K-:A'Gigi fae ri e .: gEgSIrL2Q5ffs5sazss2af3?i?A55'1sS f QW rf . YW X .1-Z 1- ., - ilfzigzlgslwwi- Zi'-iihfwsraifaaifavffai ' .:'. -HW: : l Z z 2 Y 'f 3 ,E . . -.,, as XE' Af Keira? mM'?:J5 :F few .M 5 4, ' ,aft z sa' 4, my rg K X sax 15513 if-as fm if is Irsxgrsfs ' at rfb,-..s11-:tw Sgfgaagsiaffisttessfz' m.ws.iei A--ff .. - V V f ' N 3 ff Exif Y' 121 Wfqiii W in TjiVV ' -- -- I '? ' .EF-f '5,a :I Q IffV ff1 if 5' A Q 6 :. :5?':v:5faa-55,15 -4 Ml 3'2l5'5i W7 ,M-VSQW :' f -: :'--':'4::E.:.5' 4 9 3' i ' V Q ' ' I ff : - : '52-Vfgf f f f I5I55i42wWW If '51 MT I 35 , V Lf we-V ,V V 4' I V' V11 42:3-'ffwf' My 2' Hfu'f4-vfffififwfisg r5f1I?Vfi?f?f2GfZQw' Q5 J.. A?ife4fff?vVK5Z55f1eewi5sv'f:fZ9'f fwslwi ' -51 fmiisweg N55 15 15243 ,525 Wa, A 5352? WH? '35 A555 Q VV-- ' ,Q - ,fi 'fy 35 V iss I8 ' Q 5 MQVVWVI1Vwfgfffffw V . A , rm, 2 54 , ' In .W Va-,3 vw? V ggfw WV,VViVfV4QQwf .I W2 121121 ,.,,,Mm 1 . WFS' - Mi umm ,Wraefh -,islfii :g f 2 V5 Q3 4 V QQLQV , H V, ,I 1 , .Y Xgg33I5:1V jj I .,,-, I ,V . .v,..y11J V. V... 'IYVEWJS :E - ' f.aa2zs:szrFa,.' A I' Vk 'fx . if-M VVS ,. ,, ,, 3121 M 112542 in I ' I S E? mega gf 15' cfleiff Vm :ay I 5 ME?'z?jM M2353 I X fg i V .. w- -a H a gua , V I , 31s3W?'gQg 5 '4 :1 ' K f-- P ' 2- M . VP 1' I I, .E ,..... ,E . api'- E5g22.f,'.ai:I.: if . ,Q W ze: gs 5 sv gg if 5 I .E m AA , g Vi s M 2535 E W 1 xr SI , , ff ga L sxi fijfw Q V wg? , ' , fa ,iiggigggggiii JQIQ '- C fi.. .naw Q - V -V . 1wg2535r f i4,g,5M ,Qi V 5,gg4Lg5' , v 5 V22 V , M .3-.IV-1 --x 5, W +6 1 Q I a 5? 1+ B nf wfighfjg-gf ly ,fi QW Q 5 f aw aww! 4, W ' VEQYJ Q W I 'W Q 6,529 I Is 2 QQ THAT THIS FRIENDS FOREVER DANICE DEFFEBACH, KANDI CRAWFORD, KERI JOHNSON, MINDY WEBB, TARA WEIKEL I THEN . . . NOW w e - 3- V ,,, x,,-,,,V,:,,,g,E,, f- VK- . :,'-1 -a n nfV'-- v'f ', :w w H7492 -:a w wa.. :-w.ff.' -- ----- ---' '-' ' ,. M - :'V-Wiz ! Malawi, W H-A M, 38 ' W iff V! I Ig , V- ' + : FQ Ife ' I ' g Q15 '--- I . - f -W . ' 'f-- v 1 .3 kfgq E' ' I I '- V V -V f- V A ,- .. ,,... ,... . :Q-eww www nm fvwmfg P' - -V---M arf -- WWMHM 2 'S ...,I... V- ,E H zmwwi mmvw f W '-:WW'fw1m:fM.wQ5,fWfwf ' Hmmm H' ' '- ,W B THE , ggi ' I f WAS za if I w c.- 2 1 I L T Z ,,., 'EW FWWLII '.?f'T75 f Q 1 ff M5 www vwef feswll-www fe .A ,.- .T 5 MTH.. .. .. . , .. . 4 , 7 .- we -.-rm H T were fre-.wi L '.f- 11' . 2 fs. - . - Mm wageastll?-Teifzrlifllsznfslglsmlrfs.?ll'3e.,15:sw,1s55'tmz'f1ss126a'w-:seesgfr 1-17'Wii5V'f'3N'2 Wife- T 1 Wfsfgeldsi w A 535 . ' If ,we--MWXQV45 -mmm .W T as 'E' - T:1Q2f5fS9is?11fe'3'si5:m Q. . - X T flftfslalearmfftrfezgsegz - . . - - ,,f,f-grim.-5' 5 ' 'T T , - - ls ' ' 4 I ' W5fF1'.:1'.5e,.5f . ' 'T 1 5 5 l 1 1 ' :sl A fl'-l.m2f?rvr:f yf::w-1:eS-arms ' ' Qygswpyl. Svszwffstf ' In 1937 Mr. Joyner and Ml. F h d ' fi I FY, a a notlon Tyler could use a mens store. 7 l my - ht if-I ,gqzgr 'fewer gg 'gflw 1 mens ' T 5 - ga ' ll T Q SCRUGGS HOUSE MOVING T - Y ' -:- mm uni 5 ie? 'W ' 2 HOE ROOM ' 1 - v Ladle-Su You CAN T ' f giizliiz, T Rf 3 Box 1375 AFFORD TO Miss THIS li- ' ' ' Corner of Loo 323 81 Front t T T ner Texas 75705 Phone 214-59 - p S Westwood ' Shopping Center T . lacross from Brookshlresl if Q ,AsfffT?'+f5i?eW5 T I psf mg: f- ig, elif- wie. f,,.. if-:f.le5,,.e .lr Q. 7 -is 1 sou counsfs si ' X G3 ,5 . ..ffimsgirewii Y ef ' .' ' Wg! 1 Loopl323 at Old Troup Hwy. f 3 Next to Green Acres Bowl Phone: 561-7750 ' M5527 H- - WTA ,Sill Tyler, Texas.75701 fs. .5391 , ,e,TZL +1 Julle Hughes 1 ll l. 55 ' 1 . fxlaiwaffwrix... Colophon T rr fwfr , 1987 Bulldog lei' fs flrr, 11 fi . ' ' mmm Taylor Publlshlng Dallas, Texas Company Representative. Nelda Orman 150 p ills ages Cover Art. Dolores Jones ar-5 s I - 5100 old Bullard Road Typogmphy' Sem Gotmc Binding' Smyth f - r l5?lQQ,.gfs 2 Tyler, TX 75703 Telephone 12141 581-3841 l Paper. 11 Enamel I if .3 Class Portralts: Delk Photography ,- . ,7 K . 51,35 3 r 5.7 5 . .- zz -- . .5 sr'l .. -. f . 5 wigiwilgm s ss w : 55 2252 5 0 . ggi T 5 . 555 me h e ees -few 5 155521 .7 ' JW. . -A t 'I : T534 x x J ,mfg-' H ,mgvffysi ??I'!?7Wf?5Yii? nw'N'5V??Vf' 71I3W f'fm Ff'95W 'f ,2W9IZI. X :I '5'?5i 's: f a? r? 5 .II nf f 'SV-A WZ fwffiililfil' iw 5511 I vw D- I 5 ,IW I 7 I It g I 5 Sr iw' Nm J 0 'Sa . eh TROY SMITH I i f My Preclous Angel, I am 7- A so very proud of you and srsr A your accomplrshments A A through your past 12 years' ' I . ' I ' f - , f V You ve Col-ne a long way a ' N and a big Stru Ie in a A that deserves The best If A Sh0fttIm9 fOr Omm - A 1 that life has to offer. I :Q- ffni,: a .-QW-,I I , r ff k f I b . A i f 1 sf yy an s oraways erng g V I ur,u , 't'ff?7g were for me- Lex 81 Lana- .. A I We IO G IIIU 1 eff 5 Good Luck 8. God Bless! , Q 1 S0 mUC - its A. 'Z L A, 1 if I S Ove ways, ge I Mommy Lex I ' A ' ' Lana 8t John IVIOITI 81 Dad f , G mnastics DM' D -. . Abbott ADVANCED TUMBLING Fon CHEERLEADERS ' Boys and cms I 'Tiny Tumblers Ages 4-6 'School Age f I' Instructor: K.P. Pete Walker 2 Human De elopment Cen er Q fssms figig W -- F. - iw- 'KF-M is-Y 5 T Y L E R L AT nf: uulvznsrrv J I 19' WV if 'ox 'haf The Unlverslly ol Texas al Tyler ON th UPC H H S L Health and Physlcal Educallon Department 8 way ' ' ' .I I Love, Mom 81 Pop was ii- 2 5, , I I eo 23 Llbby, I5 From lst grade on ,S if E I we V9 b9eI I pI'OUd of AEA your efforts and proud 'lf W4 I E ? .. I, Q If 5 Q W f-,, 'I , x 15 5 A 5521 ml: A 5 ,Q , we S , A -1 w-INN 9, S. L. 2.7 3-,msg :gear 1, we is-fqz:fQE3'. wg fffvf -, S2525-ssl! Q Wlmdw, ff, H A ,,-,' , I . :kim if 5315 ' ' as 3 A 1- Egfr? .lt asf I I 9' YSI -7 LW , W A Iwwwfzissq-::1v5'?fPf3I5- Wi' -fax E ,W E was W -A A-Sa fe ,I I '55, tw .N ff? Z va I A Q1 sms . ,sw s SIE? ,: it Jlozw .ASNE ,, ,I H U , ,, ' I . W c , Q of you, Love Blankenshlp 1 xl Post Office Box 60 Tyler Texas 75701 214 597-9325 II I eww .wmzm :,., 9 v t I Dad 81 Mom 2 1 f f lf' I I E5 V4 uf E I Z. E, , f I V. 3 Q All If 5' I3 W S2 , I! gr 'EI :gl We love you Bulldogs! 7, The 87 Staff L W ,gf r w Ak? 33, QM sw, X ,r a-0 Ame, Q-41 .1 sw , yr-Vp? Zi K was W 1:5 L . , L ,- , . W '---' V H: M, K V ,, ,, ,.: , W I M WWM :WWA .M.,,Q,,,s-:,,,w H MQ 3 115, a ,5:: 'Zq. if? 'Vis 1vg: . -.QW i n fi Qafff I A ff A r,gw- -Q To,. X' MEA. ,mrs I, -I A- gf 2 A Q E A, ,5 A I' I I ff -. D ,JJ ca at wffv I 'A ff 59 Mfwd X29 at .Mx f gd 2 A ,SAW V 'ei I gems-5 , yr f ,exam ff Otav A 325 If A Tha nk as A gif EH? rs fs 4 ff mg wglews est WF INMII, Igidxtiffef I 3 t ,fxrxfggi fI'1e'592 fxfgmg w5t5ff,I4i' M s ssffwvgwfrl S, E fl lil , V I , , I, A f .W . H353 -' I ' A I ' ' L' ' I ' ' ' ' ' 'WQWY5 -1 r'-. Iffjifff FI T '71 Y, 1,-WWWHWISKVT .5 7 fN5'!?i FWHM' f f L- l- f' MfL1Y',,fieM1FW N .,,A., Q . ,gimp My .mif1w..J Q, f -Q?N.21Qge4f,1Z,,'gQMQ,ffxek34,,,, ,gg - p ww-H2 .-HM ,msffw-wa.:xzzifmeiz-5x',,we .ff--f,w.-was 'Q-Hwewfw 2f2f1wwfr7fffvr2+FM?1 we KW- wiwe525,e-ww we ffsffwf4i,f.w.wwfmxfw ,g,,,,.M,.5.Lk, 5:,..,,,,,w.:,3,k,.. J.. .WV k,,.,J,,,. ,H K Nm.. .f..,,,,,..,V fi :,Mr,,,A - f fs, QM ...,k.. M ., .gm w?i5cg,,,,+,,?g1f-gg2z,,f.L,,.fe:wS,vw.giS2,f mc,-wk..fx-.,,Mfr1.ezgx,5l,lw.yw,5y.Hs :.weff...e, .L.,fff,ww.2,BQ,2:w Wr..,,,f.y,v1.w:f' f A Yw4,qmwrf.4?w-HWW may M S5 'f'1l'A-ffwvwffgilgWm is-fff'-NWW2-2izfffw-f iZ?ifff7-2222 B3-givgwym1.55.-,,,M,,5Wa.eg.ggfi,q,,.mg,,351,Y53.gg,4.i?Ega,gj1eLQ5-vw,..L,:,5.4,.WQQZQQQQSQSVi ZW :-:f,Q5wwfvsviEfQ eaf,,,:M2:f4':7:z J.-Uwlw wifi , Mgwwgmez?2iwaw?,XiEf?5gk?e,.Lg?QfS11'ew--.f11fS1w.i2wix,filifiiigflv1111.125,,b,..S,,4.,,,,. 593555 f wwf., ge!-gg.,..y,31Qg f-.. i , rfl5g, We LW MMS? MS, 7 .5 11 ri - - iszeiffilzfiifi,-' ,Emile-.f ,,:3g1r'f2 .. .W QW. 5 ',. E iii f ff? 5' x What a joy you have been! KELLY GILLIAIVI Love, Kelly ennam Mom and Dad EM,5'4'efffi5??iiisSiwxQrflii.5 'MQ weiiie' wwf . M ,fu A: M 7 Qikfisfgggvxxief , ml ,M .5351 lwffm,-he W gf, ifiifiiii .:-5?L:9f75.f5'55 ' X X ,W ff' W, 95 ' M5315 fu .wa Lg- ..,m,f 231 ffzlfwzs 'mi iyfavhsiiie :WZ like : .w g-5,5W .M um ,X' ,vPgS,AgKefK,q1.s, f1,:,g55iE,q .1eqg,H2m5.,f5 , , 1 Q ,.,,, K h ef ,1zL.M,,,, ,,fxf.q.3,v'i 1-Q:..g,f..Qg3 , f.. 5 f f .1 MSW--.,,,,ihzQ,ef.Q,g N f Q K, .15 QE11gv27gf2?i5iiQWfpw',l3Q' 'PY45152 .1 seq' wifi ,w gizsgiegii-ibm. f, -W. ,v .QM-A513 , f -W -4 55155 EM szeiiifaai X . i fF'sss':s,2zg9 ,ly 'Q-Qfgggff ,gl Q ig 2 ' ,14EI.- . 'W S5 f ,- V. - - X 'S ' . mx, ,-.wr ,A...w..,...,,... ,W,, - f ew - f ff2f,'ss5g??'2:iwf1i 22355 :eff 'Q N32-Qs244s2i2Q:5lw,1,.wfS,2 ut orxzed Sales and SCFVICC M - My i ev -f, ,4 -. Q sw '.23K13Kr2i f:vWf?'5ti Dean Cagle f- 7 4 Q ass O General M21UHgCf dai 91 4 6 7 1 Troup 5 8 1-7 1 - wy xg, 1,1fesfsf-Qgsw1s,Pf5.2f,.fW z ww 2 -A 7 web essmnfmfa,Mxfff M 'Q'-5'V57'.i9Ef5.'i5fif5i'2:!T5Q5 3 if 5 A ffm.. ,,,. .Wm ',,,,'f, H41 .' Mei e , f Z .. ..,... . .. .. . .. . . . .. ..... . , .. . . Y, VVI- v ' f , .'::sLaasS-mefhvw mweffzwf ,v:5f,z:mfw:f: .f 'Eie,.:??Lf5i2' fQ? gaJ Iwi'-gfws .fmw v-. W gi,egwff,.fQyg,Q, K- ff. 'S -ff..gewM.1,zf..fM .g..g.Qf,f:egyf5 3? .. M .. . mm . ::, -- ,mf Zfgiwf, Qsx:i5fw:rQvz4.:iQ5 eFZw?3zgwgf551fiw,-...,,.l ,Z,ZK.,.s,15,gQqg,.geg5.1551-5,f .f..,,.ww?kvwffi zmeazmzs-wzisziv'-dv K .. . Q.. - -- : ..:: .. ,,. ,. ,. . -. .W , ., ,,.., ASME, . EW 4,5 X ffm , 5 My Q51 In JN . ipwisy , 3 -M mQa35gkggf3,1.y,-wi, ffrf5vswwwL:iffkww,--'K-lziwwezg .mfw.euf1Qg.gp,g..vzg 5''zfasiswkwxe f ggpxggmgg9,..sf?v.QQ,, ,x .QE ,5+ggQ?e21Mzs2KggL - y n 1' -Ml 75,5 3 ,g,w53g,Mfq5-ew,w,,wyggjg W 2 Wk g qgfgg ,, I .V In ., ,, .-K draw? ... ..,m?,M5,,,5.Q-Axis, s QnQqx,f,..,f-,fX. f.. g.k,,,.tf5fff.,,.5w,:mQmQW.-.V,-..,,,.wv.f.r11::efwL .heyy--m,4.f2,,.exq,QM in Q , ,,,.. zwg,,7,ff,9v3,4gg U. , f .V We-5? f -.,fmf.5,.,.e,.,,...e,,awLg-, .: M - .Ag- if 2. 1 -if-S 455. 3 Z , M22 A f -Y gSsf,gf5.eQ-, wi: We l 1 ip. M2 53 gm, ,5f,,M555?fQgx. f gg55g5,,,3.gL1gg5qg9wy5 gs4g5..?S2s5g53w+fiwi'Wf'f5e15v5-Lfiejgivf Ye w f ':'f.H iffiflfsieisimgfiff? was 'fffw-Dgiivsei M1ff:sQ?1Trf?ia???ffMX'Y?5S2'A:If 'IZWQH s. 1w:s3ggwSefQ1,v.f'i Q Q Q . 35,3 :SML - igeii k gi .V .V Jk 5iii5:2,?g,E -7,5 'mf' ,flfQ3gEf,f'4-mv' ,X-f Iw igfgvg mpg Hi 1,1 3 .5--,EE E: QW VS, SVEEZFQ- My KV,gLVifj'1V52,'gygfgvfif W' AN, , U kk,,LkL, k , ,x. V k M WH. .,..,, 1. .,. ,,,, ,,, ,,- .,, M. 1. L,,,..w.,. ,... ,. M M V. ,, . ,.. .. i7HQ.,fllfif2il2Q57I..5izf1SE AH5: , M. 5 we 1 7 31- 1 11: 5' A f Qi55,2Q'i'fQ' -. :-- . ...,. ' Q mw 'eff .. -7 11 A v M 1 .,,,,, ,,.,.:. ---, , V- ff ,,... ., -:-4 3 .. 5 N,,, we .,...3, ---f 12-ww-Mwf g. 3 If- ff 11- fi: 2 3' ,,,., ...x 2 ,, W frl- gggg ia! w e 555132511 5 ' ,, m A I9tOl'l C0flQfafU'af'0flS z 7 ELECTRIC COMPANY FIELD ENGINEER ggjy w V ' 1 gfffi and Best W'SheS f J I . 1 ggi, ' QQQSW L, ,f ' 1' V 5 ,If H74 1 QW H 12 Love. lg, 7-we M , , O SF an 5 V 'MMM J 151. . E ::. an 1.1 M! 1, 5 7 7 7 5411 ' 75 Dadd . Route 10, Box 1083 Tyler, Texas 75707 42143 592-8666 5 , W H ' y 1 1 lil? WWWQa ll lllm 211 1325 rn I - e CO, mc. THE OVERTON PRESS Qgiea 5 7 . . . Printers and Publishers LIQHUVPQ Poles 3' ACCGSSOVIGS since 1930 an AllAmerican made product ?mW?m Phone BH' Ellman M A CHARLTON 77 214-834-3636 Publisher PRESIDENT Route 10 Box 1083 Tyler Texas 7570712141 566-1391 32: 2 , .5 1 l ff l l 5 f 11 7.1 3 1 L f g .,:: 1 K i 3 7291 'W 'L M532 5 S .L T we 1 l' 1 f-151g 1 gi ' SE HK-..,,, I - 1 5312 5 55354 W? f r wgg fl. 1,71 3 'HS-1 21 sl fi 1. U1 H 1 M. ' 555 .31 251 7 ' 9 r lf A 7 Q, Wx H1475 55:25 5 3 if :ax ,, S ggi , F' 1 1 1 , 1 :FQ Q? -373 as 15555 . 5 3 l S .,,,h.. , 2155 fi E if , ..,,,, .si 1 rf 1 El il i i 5 1 .. es 3 H 15 15 wg k551'?9 , 15 Z CD C I P Z 0 I'I1 515 wsw Loop 323 P o Box 7820 Tyler, TX 75711 1214, 581 0077 THRELKELD-CUVINGTUN 1 ' ' Lffff 11 ' ff- f--- lr----vm .. . W, f- f--- -'---- . ,- W ,. .,,...,.. .. . ., , ., . . g i nw 'Ai i ,... .... , . .17 V H S A V K V . .. , .., fl la.. f ' MW W ' Tim ' , F' ' .. -- ,,, 52533. , V M-EM 1 7' 1' '?' 1 W, P-f 7 TT ,,,,,,,, ,lmmw-me - el 1 1 Iii A . .33--mf - 1 , , V ,,,,,, g-g- , mm -Qs.. 2- E 1 5 11: , . 1 V .. 7 'W ,. -D... ----- --we-wc:J wQ'm - 1 4, ...A , M 5 S ' ' 1 1 1.5522153153-wh . :73i35Zrfff' .Qf Z'w5 ai W 'gf 5 , - 1- '-' -- N - 'E' 1 1511. mn . 1:15, K 2 -:-:51,-5.-- iff W, - N ,S -ff ,-. sm, -.. . 1 1, . -f - 5 1 . gl S 1 1 .,..l 'M is W -W - fj 1 ' .. H .. . .... .. r r ,... V 0 W: gg W wg mms 3 -- ' ' ' ' ' - 0' 'I - ' 1: 5'-55 1 ,:r'2'i' wms,.2.,x3.,.,.-- .W -M.if,sa5.asW-W-- 1 lm- V- 5,,,,1- 1. 7 RFQ 1-fu A Aww .L ' as -7f-g--sfe11-g,-,fgg5ey-- -gis5?az9 Q?hfi-25: -:z5f'z:ftf:..,z.- 1 . ,, ,Q-zyfgi--zg zzwir-1:-1 Sinn--zsxi-1a4es:i'f2,-21:api2W--Q52s?if1SiQ2gi?fafS:a5iff--kwin' fiiwfefii-i-siiefhfsil-ifviz-H511-satin?wasfiw-wiwfimisffaiizii'-wfeitelfvfgggiififf' ' ifrwgigggairsl -amtggigwgf,g,4efe1:-f'-Sfiiv-,---1,-if-,sim-i,-,-in-,.e--,, ,L i,EW-,gwge.Q--.me-at,,.-QTQL?,,-MSM-X,...uim9M.q9.as,,5gaQW,..,.,N,,,,.-N ,war ,,.. lejgegt, ..,, A .ygewMswegdi-7-K,523wid1oggme-sggignnifsggggx--A,52fm,, gf mm H-QW,-V.l. -Qtgggii., V k.g:,gg-g.k.a1.mff,, ogfgqigge,if-:afflif5,,fvf4ff551,'f-sf Q,g,ig,qggw.14sirx14ar::,531--W'wi-e1nzawfSs1'ssF15-SSL-Hzf-iiUf1Wf'1'.'W-.wssiflJ ,wuz-1 -'fa,1.'z1-st Rig--5'Lgg,1,25qWf-ff, frm- .,,n,f2fa .., . ,M ,.,.. k,,...e,,,a-t,asmgf ,L W...y.,5m,,nm-o..e,,,t--.m--l-- W,-h . L. ,.,, --W---W ff--mf--Q-have is , A -1 ig -fenfoaim,-M, -W W1-is-w-mfa, V ,-,.,..N.,.. ,,,k3,,,,,,M,,ma,,,.- ..,,, k,,,kk ,,,, ,,.,,w,-, ,,..f,,..s...,,W,,.l., .sm wL,,,2,,w,,,,m.fsm.4,,.,. ..., .,,, ,,..., ,,,k . k,,.L,. . 7. 3, ,LW ,M N, A.., geeky.. -2.433 Q,HQ,,,,.a,..o Wm-I ..,-.na---sz-----f..xzLwwmgm W e kS..s.,ma WS,,lW ,M , ky, .W ui,,m.52,a,,.:,y5Hgn.g fmt.-f,2,w 4 .W M, . .K-,.sf-, f .QSM -if. . V -.-we-2,-.-.--.-fi--wa-tdxiggw-...,,fim3E'Qf3.1?-QQTQEZXQN- bmw a.,fWm1sss-W .,,-aas--w--f---Wm--.,,,-ter -me 4,5-it-,.-Kgs Q4I-M.,WlM-.ewgigkM dwg.,-J 4 '5 5,-f -1 .,qg--WW, . WW- 5-.fs41--gffzm,-grass'ff in-iaftfwloffzmiisifi--ngwwf swf-ff 'srf'if:ff1fP-4 Y .-2. M agwe, M32 ,7 -ffT5W5f .I Ef'T'P:rEHSz,'Ll,i W ow -. -.-fi, 713ai..f,l,,n H - Egg asain 22IEQ-,14s1s1i+z1M5z5L-3ef91- -:-I ws , z-Qglsfz 55, :E is 2 gee miii 1 T TW 5 Q 5 :EXP 55' s 5' Q z : 3 3? . ai 54 xii 1 5 T. Qi T '99 w i Q ' -- , 1 r s va if H RLTO Senlor Chapel Hull Hugh School LEFT Senior night hlllowing blow-out TOP RIGHT Senior year at Chapel Hill. MIDDLE Healthy seven-year old second grader MIDDLF RIGHT Two-way starter for Bulldogs. BOTTOM In Cessna cockpit following hrs! solo at 16.. - my 'Q' -E r 4 lou R CLASS OF '87 ' wi 355252, am f 2.1-Mamas. wx.. .vii 9 4 X JL Y ,g , f ' 4 . , - My W Y - A 1 ,.,,. V, .. o,,e ., , 45EU?I Qfff' ,, gf W fir ft hfax x he f -f 3 A K+ .Q s +5 ah, K it I A , 7551Lgfgggggiffyyglggg535:Higggmgzzifgf3 ggiuyeg mi-fi'--z, -E 'HU' 9235,-2i,z: 'F wifi' .fiwsfw 4 sifzfix Z ,i5i?+2:,f'ds?i1: Asa? ---7Evi'??152E 'W' 1- W': ' it . . . W. T 1 'E 7 MV H 7 ,-1.N .V A X.-Wa.,,. 5. .,,f usggwt ,mo: E.-,?,e?g,,.x-f23,3g,, .3 no 4595 W,N,,,fi,,o,, 9f.. , .,,,,..,,l. an .ogg ,L of-y ff -:ii-sz-,fjygfgzi-sf.: Noi 2531 'fi M, 439, We Q,-1iM.W,nf.. ,gg ,rm-s.,,,z..ag, fs Aww 'H--iii, Y! w s S fQx,,W,, ,w sang? A og, WHEN .ao,gwf1m ,425 dime f Q at W sf i mmf -fx -Hmm of aura gm W Wim wma iw gefwffwv' imfsaile- my Nvii- -A 'fix-km H,,rfgg5g ,p,5+,.g--pf, eggs-,-342112 ,WN-QP: '-1, -Hg .Lay f f. f of few :aww fi, -: -144 , vw-- S, W 1 ww Ag ,A 5 Wa 5 Q -ww H swifiwww n Lal! Wee semi an 2- xy' A- we-zfAf553+'Qs Qi'-wg I Agizw- ,Jgfp,g5g7Mgagg,,7.'i aesfrvgyggj'--72 T? me .,,.. . N, .,,l... -7 V- ,,,.,,1 W,.M-we nw A-fmifffw-Aw -452 : T 'FW ,T Ni were f A- W fi Wert K .Q sweep? if W E EST 56 T .i,, 5 qs f' Q fe an 9 A fx SEX? gf : Q2 --Sve n? gi .W risk gp, WS g as ,mf 5 U 1' -M X2 ff - iw-f W tiene-aaypn :ti1,it,-v.zg,g-figs-:tg , ss si.3Q1gYa'r 4555-ff3Q5Swf2t.xw'fmt '- , at Mya, - A .wwfifkf al ,iii o,..o,,,. ,,,,...,i s vi . it-ff 5. mmf' .ML ,, We ... .ww 8 55, my :1mQs?a:x.::e-V 2 f-fss'aammrwQEvf Mass,- we . . X might- fi in L ,W-lf, mam. gy:,-1m--.ieEM-,,-- A fine fi ,,,6:fL2YZQ11y, . 19' T235 A A--Sb V, T532 in sm? 1 M -,Z X ,wezirq-g-fi:-msg , .ig-Q -,,, mm 'ffiilfbiizl sfifiiildsiii GSW ' . ,lL, l:,, . i,,,lli,,olf,L, -f W f-,i4fmggg:w:11sw Y -nf .S1.s---W --fm-gf f L . f-.W-wt--f it --sexi-ofiff-i 555 , A M fgplw-,am--raft M. . EW , ,masse 3.gg2w3i,U.??f?i 'iigimsaiff , -:,ii4fa:'f5-'-ia . ,i-fem-tif. .-ff W5-.mmf ,-.-3xwv,Q,.gfvfiiwfY2f8:-or--w 4 Y w M M 32. -Iil-2255153,igfsrlffrfggiiiltiff szggrgaiff --ihifiiv Ag- , 2, , ., .e--i,. V fwgis, 1,-1I',3,':',2 Marx-ft :W- ii,-WV-Q33zgggslszmfsfmr 8 - , ----- , .sa ,fy . L- fggj5gEszgi::5555 1 --We . ,,..,,..,, L, S we A ,.fe.,mQ if - fe-,mmefa- on 35543y.2sgi5gqg1j-15i-,gfgigiffiigv -- -if ztmw--fi.- , .. ..,,, K X ,ti W-Aef:'5'e ra 5505 -Xsmwmi ' 12651 - fii--v ,,-..- W ..y ia.,-fe..-4 isgfgg L--si-1fs'iis21.:1Qi5?Qgf25j22i3 Egfr!-2a1aii?'W55ig5im5-i3'iiz' 2--35-1,.ggqggm-,-ggi HQ? . Jtt - fi, , .--f -4-- .W .-,-, ,.-.,,.. .L sfo-asks',wzaaiginfs 1 --aa-, -at ,f , ,rr wezzwm., Snsghi , V '--s1aE5z,g-,:--se,lvgfmssiiywf .1 9 ,3ymw:..1-2322259 --fa --ft ,,- i--sit.-H -WW -1 H-.flaw ' sw- . ..,,.. ,Wwe ,,.,, 'U' J' , ' wif-w:.1:e 55: ill,-5 A322725 ,, E 1, , , ,T f. -W- 1,1-.sm-.-A ,f-- -F-W.-ess, .. i.,,..,,, if WZ . ..oxA.2x, ::w'iQ?i If JLss?lh3tli2'TtYN 9'7z'l-325' sg Ii Ui f -- .1 .-oi, fxfb is, 1-.--,1 1y2,g2eff 1 ,,.f-wfhff fsstgfzzew - 92011155 six-5:51335--,--3 . , my W7 f-.TWQ-,,f.,-,5gQ3,5., if slim rff'- vp.. JSA: - t lr.-iiibihllig-'v'f.SKi WW- Y 21 -mm - f-of , , f-iiesl-gig-sgggeff22-51-Dyer' ws tem-:J.f--emi-wwwas ,zQ?v,1.,2ff'F12ffl-,fif-'milfalzmf 3 ,. A is 'IGS 3 E + H H -7- , . 65.55 ,IL -ew. if iff M11 if 'S ,XF , .1-..5i53M Q- 4 .-M.-W ,- ,,-1 ,ff,, M, . .. o,,, .,Q, ...,,W,,,1,,.. ,hs -fit--,,mif me-1-:q, ,.i-.r. . 2-.wt .. 'N ' Q N M.. W Sw g .l,ii. 5 ,,..... M ii. . M er-5 , tw: -Mate L ew Wg ' :a. 5593? ,,, ms K s fr Us 4 SR. H fi. ,tm .fy-f,i,ff,e ,ff gsm. , ,mg -,, - - if-...Q is -. . .2 .31 R b L, 3 M fvqqggzzgf L5 Q- Mfsr-L2 . NJ- V fsswr- Q K 'xwgif fffiiiiwiiei Hs- r r We ff 5- J 'gs ax 1? 5 fm 5 'Y 'SK 1, E' f Q L 7 K ff, QC Le Q , X 2 55 23, f 5' , 55215 Wage ,T K 8,3 4 as 13? V X y 4 wx es 1, fe 5 me Q ,H 5 . if We Q Z ,V ,ig S K V 1 ,fr T94 f ggfe SEQ-s w 1 L we 2 2, gg, S- as S 'fag 95,215 ve me 'W Ev Q My ,TSQSKX W Psi 1 1 3 1 ,N fn. ,L fm i . J- Q55 Q f ., Q 2 f ogg .Me A. aj, ' ew W 3? T 3' k T W is egg 2 , , 2 i via.: :K :H srfZg51??.,rfQgi'Qf5 : pLfK1.J'!74 w5'fi-xfiiifm' 'filiiff 17 -'iii-0? 2 Q-V , W A K -go qs V Wggm B V s I .V ,. .. ,...,,.- an Y Q. S .. Q x5553e,g?gR,..e?g,MZ9L Q K. t K -2 an N Mai as an M ,I if WWW M L 6 Sifim.. E 3 WX W gg. 11 I 252 . N v Complete lzne of Dance wear QSSPSEQQQSE ,L1NA'gEMj'EUvQ'gQQS I Nl E X Q H 0 Recreation wear 'Gymnastic supplies Center For East Texas ' Batons ' Foot Wea' ' Custom costume 0 Drill Team supplies D1Um0ndS For Certified Appraisals V , designs ' Aefobic Wea' F Custom fits guaranfeed f Zffffiifvz :-1 i , Bile Ton q uality brands a nd service R H S Largest selection in East Texas CI::vT::rAubuChon Green Acres Village 1 1733 Troup Hwy. 1700 S. SE. LOOP 323 Tyler, Texas 75701 HBl'OId Driver SUITE 110 pnone C2141 595-3299 Owner TYLER' TEXAS 75701 A DEFFEBA H IF YOU THINK YOU ARE BEATEN, YOU ARE, 1 . IF YOU THINK YOU DARE NOT, YOU DON IF YOU D LIKE TO WIN, BUT THINK YOU CAN T X IT'S ALMOST A CINCH YOU WON'T IF YOU THINK YOU'LL LOSE, YOU'RE LOST, . FOB OUT IN THE WORLD WE FIND SUCCESS BEGINS WITH A EELLOW'S WILL, IT'S ALL IN THE STATE OF MIND. IF YOU THINK YOU RE OUTCLASSED YOU ARE YOU VE GOT TO THINK HIGH TO RISE. gg f YOU VE GOT TO BE SU RE OF YOU RSELF I BEFORE YOU CAN EVER WIN A PRIZE. I LIFE S BATTLES DON T ALWAYS OO TO THE STRONGER OR EASTER MAN' if gy, I9 I BUT SOON OR LATE THE MAN WHO WINS IS THE ONE WHO THINKS HE CAN. - Earl I .L GO FOR THE WORLD DANICE' YOU CAN DO IT! A BL I WITH LOVE DAD MOM AND DAN JR lab, . g Q. 00' TIME SOSUZEBESCEEETESWSAJITE aao I - 3 ,. Y Us I -ffz lilfig f mf,s:EssAsQ.'zs' TB I S B2l1?55IAfl5?-'3L!53E9feI:ziigflu ' ' . Zvi Q gl g , in I I T IS: W Y I TYLER, TEXAS 75703 12143 sei-:ms BLQM wal. gal, , Ilff-,geszzaji Isfilffmwq . .rf - AUTHORIZED cAPEzIO DEALER - DANCE dr RECREATIONAL BODYWEAR - 3, 21 East SOUIITGHSI Loop SHOES - ACCESSORIES - CUSTOM COSTUMES , sr 5,1 Tw B Bmw Af f , fm . SE' ALE,-ml BI TYIGI Texas 75701 JUDY BROOKS MAY AMY ORAINGER , Ir u ,.. . j OWNER MGR BUYER ' I if ffwvgfize' -Qff2QfI 1sSwzIII51 qw gg,,f4wgiEs2,gI5ffg,,,ii5i3g5gx mmwwD,mmmmm,mw , M ., . .. . . . .. T T'1: 1-- . . . . ,,,..m A fW4Qxz1'2 3if'i: l'f We ijn m : 2iif3 i' f ??ii Q2 T 251 sift ' ww' '-T.,1i f f A .zI i'24 .I , r rf - ' I . - A . g T A' , fsw-M w fl ikgke-,rf Ang .Is -,419 Y ff I I -BwT ,s::f::-:yrs we vffw --4?2.pWaf?'- NLM rw' A wife-93 sw -E .-1 -. N., M' -B-M1-fe-rmflff-fwf?8f'5W.B awww w e, My ggi -Isle 1115:-fri-flf zvA!lS1:?:1f1z2f if Airs .-: 9' V Wi? 4' SEBI'-A A 511 X T wsiziffeifiii I'2542255fx5t.fiL2?1jpfggsSf mil wf'??f+2,sv-ff .Wi - wi 'ESSAY , :JE - ' vffbf gif- 'Liv Li His! ff- 'ffiill M1 an A , ' ' , , 11 fff'- ,1, H 1 gg61.11g1-11,f1g1-qw?q11fNQ3fgg31rw,?giT1Lm13gggg6111gQw,V,gm:95,X,,,gr5qr1,,g.6ygFgE5g,,,z,,w,M51m,,,m3Am,,.:f ,,. Em ,I--W,-1..,5g,151r5,g411,, .,ME1911165153-few-J1y,f111+1v11af?I1feQgam1-rf :W1112:-fewgwsezzusffzm422116235236-:5fr:111,'fs -+1g1r1gifN1QfQE:e1-.1611, 6611:1W6rffssgiwrf17?'5i 1 .sv 1 fzxff -121311-WEL-'f 1ff21,Ef?5f1serr5lg,f51 gvgggggginq' g,f1g,1Umg,Qsfs551gi31S213gag11fQ531gig13552Tia?2222Y52ff?62?ggi66113SZf51Q1fe6:5egav1gEr1?1,sgfi1M151??i13f11,1 f'621uf1ggLSiF -ii 1' 2 ' ia ' WEI KEL CON STR UCTION IN C ' S hl n g 1gg?fr23216az1fzi'ffig2 lr: P.O. BOX 130622 I T LER, TEXAS 75713 K ,- Experlenced Speclallsts ln. D a B ,J fi? FOUNDATIONS - SIDEWALKS - CONCRETE a CURBS - GU I I ERS - RETAINING WALLS DECORATIVE CONCRETE 515312555iiE11ff:.-1,715 E 5-355511 fe, A I Top quahty work at reasonable prlces. Qi ' Prompt free esnmates We love yOu, NO JOB TOO DIFFICULT Y . Bob We'ke' Gafv We'k9' 71 ,ZTL275 116715 few .WL 133551553365 Phone 12141 566-9106 152141 566-8151 E6 53 11 v'L:1:,, W ,MQ lg 1 1 ' P 6 '.. , 1, A GAME FEEDEFIS ' - I 1: 45 1 ' . 8 QM Owelt I A A FII. 10, BOX 1165 A Y' .N 12141566-2391 5' ' ,, sq ' QISI Q Op , I 1, , pg Tyler, Texas 75707 ,VI A 1 Norman COIIUFTI Q M R . as ll 5 1a noA owA v A ,, , ,, ' ' , ' - 21 TVI-EW TEXAS 7 5 703 ' f 'I' 5- I . 4 ' 'f - ' ly' 5 5 1 .0 I 01 A f'luu'Prn fur .411 fh'l'lI.KIllllX C011 ra Ula lgns Ta er ' ' Q ' 'R 'I uf' , if JAC K 81 PEGGY WALDIE gf 1 ,1 ' f11ser44L3??5si'l3Q5?51f1wr1.smlisz - 1r'??f:xx1'J'o9W'-55'AV :21r.-111.31713 fmiezigeisifffs 1 1 if5i'4'lm5szs2,f'51z 1 1 . iiigiigfggsesziirv11::f3i'1?711f6e3112yg The Complete College SCIIOUI Supphes :f1ls?5'.5'1'1 I 1,159 ' 1 . 1151-111-.aw - '- m1w1W6 M..1Egi,1g6 Shop Aft Supplles . ' ' f5:TT!!iE , Textbooks Dfaffmg SUPPIWS , b Paper ack Books Novelty Items Study GUICICS 1427 S. B21XtC1' 11116116 5 Calculators Phone: 592-4 1 12 Greetmg Cards Carroll L. Thompson f 1rfff6:s111111r1fs1r1ze ' ' ii,51116-saIL1f1ti'111+f6 1 1 1 1 Shifts ACIOSS the Street 3 6,-'Ur W''1:t'1:e,aw 1Q??1i5ifM5Ti99iQ 1 1 -25-if:Iz5f537f'5i???3f3f.LHa1i?i1, ' 5 A- f11W1vUff?'5IQll5s:f?ffE1.lM'l!?rff2 P 1552? 1??l5??5iVgQa11f133fEi S517-aiiz EE 'fs'M3?21s15?y'2e15fZ31?11f1s1Vs-M5265 -ygg,1rffS1:6a?g1r1:1gp 27521249111 Af111-2511'issssffrfmz X ',,,.. , - 7 51126giesifesiitlgii,lffizsaiziisaiag l839 W, Gentry 597-5565 I dfeSS Shop fobnf Shop A- 1 '1 ' awimizg gxixfvnrmk, my r m . rf 1111gf1s,,e1 -M11 1, 1 6,,...,,. ..,, J K, wk Kew., 111- 355:51 ,1.. - Q1 , 1 1 . 6 W 1 6 ...,r. Nr.6 ,, . YP -1 6 ,r, , 1 A 11.. :em1,,.1w 1, v1f1,sr:1gaZr5,mi, 1 5,56 55,4 ,.. 11r6,1,r-?,:,,.r,v1,,, k,1,i16,f ,, ferr,-,mf :e.!5g11gg5,:, Z- 1 3 1 :..111:s1A1s,1Y1,Q3 -Sim,wi11215121111Qwguawf1561-m1s1a1,11wil9M:en616116, 1e,,rfMg1,1 --9114x1161 .ww1i1g,fr51f3wesr:6,,1'1.-1,1-.6,ws536f,,.,,1,ew 1. WN:4fs1e21f11fvee1r.M15?m,f211.16 ,- MLS? AWS i:k,.c,,ge3,lMQ.gl,,,lZ:L M l iqfyguf, M5,,liV,A,lH, KVVVVA 5X3M?g,iMl:,,,,aging75, -,fWfN,f5.,5L,,,m,, ,, E-L as Wi 1-zfE:gggk,ggq57'af'4g, 3 Amfwwisgfiggglk Y' ,L W-1 f112fs:QV 5J,Q4tt i' F'W i YfEZ,Tf::1WLfrM2fC2Z.sz 3.12-me-fy-51.sMr33c,7E7LEvi.774fs772,S1.L:f??5WPif 'ffywffieliff '-ii 'iM f 'fit' 11227221 mmKSMQ'RSi?' ft V if H ij31,gf5,,,jl,7il1MM tg:4f,QtQQfi1g?Qg2I,,:g gg5?g93253Q?fE3gS!ivi5rff Q--'v, slam' :Lx -:ffw5i7fl1'91is1fw' 172was5729923726Wi?iQ4SilfwygglggggEgfyifillliilllxgg? ' s.f,:.1Ei5,E-2,-121-ff1i1?1w?fi?54u5fEf7!7fii!ffi12f2ii-fi?ff5' lf- f 11fEl41s22714sm Awsvii M gf if-sims-swafrneaii, .V 7,--'iffwfseziywll-AS Qfizifwziri- 214 2711 275372 1flfw'-ifiwifivflff 5 Z f-- m52Z5W5?iff 4 'X- 'wwf Skfiwiiis-QQWHEELZU:ff1',f7zszff'zfiusfiii .E -E,-Esiilameflszaixm-fmfwife 1xrfEfzw5:,75A:5ffS1ffA Asufwis-mf1xm7, .g,.tu, V-'few-Qwwv-sw:ff- MIEI7,fswmmas. . 1, ,7.w,E,7.7.fQ,fs7Eal,fia,are,fs,WAf2Ae2fAQK QMiis1fs?,w:-if--5l'fIr ,,2Afisgfssi.-E1fxwMv'4lff'52S'W1w7fA if A--f Affrffffsffi-1 f f -f 'ffwasf4'7m1ffff ' ' ' Vg 1Ee:a1g5gfQgj2i271iQ77rf'we we 1 f T55 15 wives' If 7, 1,911 1, if E- ,E flwfsii . ,via 722:-Zlli'?cL:vZi4 e'??5V55?EQ'fr?YJ,5:f if f ggsislms,legasexwtap-.sfiiff 2 A J ' . L- EW' s3lfL6TT5IL2'fl2::7i2.fst ggj.:f5g:w.77-1:29 'is-msxe-11'-grf' ,Vim-iI,,MgEa,lasfggfk 'ws J gf' We Wm? 735457 Wf M ' ?,1 .. , . 7275741515 IQQQFIT i'fR M?iz's:5 ffs:gSl1?4i7lSlig3?l'6l5i?5 ewisasiifrgpsfvliwf A521322 AMfiHQ.55f3friE51 V f .owe WW' 'MA f -:,- sxzxtrfssclwi 5545551 sv ms7l.swzs,ta uggiigir 4551459 57415359255 ggi,W,1.,,5i,l.Y,, I fmt? 'fsff5i'7W!Y5+if5SZf Hfmfiflfiiiiifiiii'ffifflfmii Efffsyaezlffsglfsikasyrtwa is ?gis.,.il?lv55?flfiiif'5fW5?fUlfLQ 'f 'P? li ll 3157? allsamfgEf1Egii457i,Qg:3'fsg1lAge' If'f?3i53El ff5lEg?lQlQEl?i755si,5gQ 3rr3ilxfiExfMti.1'5G2f1-7715555 wgsalggwggiigafggsigefaisit 725774227 was-.ftss 21551353 mu 121 EAST TEXAS HEAD REPAIR Complete Diesel and Automotive Head Reconditioning TRUCK AUTO GAS 8. DIESEL REPAIR DON HILLARD 24 HOUR 7 E22 14w FLATS ' ELECTRICAL ' WELDING ' TRAILER REPAIR 973457 ,. 2141595-1560 TYLER, TEXAS 75707 -7' 2'l4!S92-B962 V15 TYLER. TEXAS Mmmcqd ROAD SERVICE HWY. 64 E 8t Kristy Lane Q, .4 see-0981 0? H5515 RICK S CANDLES 85 797 I Approved Driver Education Classes Q54 IMPQRTS 3,5 Aconducted year round RICK BARNES 1 14 East Sth Tyler, Texas 75707 Ladies Accessories LEON BARNES Monday --- I 214-595-3227 Special rates to students from Chapel Hill BETTY BARNES 214-566-2370 School .wif-Q New to East Texas - I l Self paced programs starting each 'fig K For Additional information Call 566-0981 JI I A B e5 579 , S X 1 Pl ,Q 5 Precision Driving School IAQ A ' ,iazssffseslmaw w w -is 5: -fffffxwivs1,Q,zf'2ei:y:E we . if I TF'6:t6e'4'c I -If ,X QQEZEEFZQ 'fi' l ,Fifi 71' , HsHf1s'5iTE l ze :Mrs 7 G,,v.sSi+ii?l,75Ltl, 2 D LEW. g2if52Sg?5llgiQ511Q2i152771 P H A R M A C ' g2s,f2???mP2 ,iblitiijilfix :-wi-A n 'sf ,tw .,fl,,m M,,l,.,l as S c5?'EE'5F9IQQ7iiF 7?iMi7f?5:7 lJf5?Ef . 2 Ast. l ,W-,,fAeMsm,,g Wllls, - 17.5- 9-Q ails v, Lwggdjg, 41:1-Agway' 7 lf asiwsaffsfsswawtfz F YOU V 1 gigr5ggigf3iss57a4Esi5I?lGi7g2 , 7 EQ, Yami:'tis-AgfffiEszisssugzlefi W, ,,'...,, Wwmtmte ffi.i5?2JfWf55lf'lfi f57ili5bZ55i'fi7fi 57374 eseqgfff if' :Q Qiifmfa' V 7 5!7YS2ilQ?EIie?7f:Q af! 4 Ns:-77--fw.- ,iivikayaxles We '35riUf:f 'pEfQil.?7lLEQ2i?5i1lE il'7 i - A 7 Congratulations . 1 ww:?g:+ Q-.7--':f.2z,:1:7,em I I we I ,K ,, w11if:.'f'i:'-5532255ii U. f mfg77f53:Q57?fQ.27ElM f - d fww MAR E A I TI 9 n S - - rzgazgganssawafls'ARMA , 11 iisfixitv-fs' ff 2 1' gilizznsgzaigtfgjsslY5jjf3'5iE55'5g?E'w A E HY! ,,AQ:1If:'yr'l.:g:,t31gw: mi ' ' calm, ,,W,.,..N.,l,is' Rf :ri-lgzzgiglewagsifgsefygtiil ' - 1 mi,75g14fQg:5avtgg:M:. fm: 7 22595 75' . X EW MAY - Q E N G I N E E R S 9 S U R V E Y O R S I EEQQEASQSA iiLiw!Jfl5gg,Jif?vz'127:-F7--iw: EQ -- A .7 ,fm ZQEEEMQQQQEEQSM7.-fu,-gc, 4,5 BLESSING new leSs5Q,.1g 'fy 1112 E WIT if sgaifsaszwefezeas:mf +G 5571QiiSSiiQg?Y?iiQ5iil45i414i?? U FLFQKRREEEQSSP 5Sl:75ifIi5lTi95'll H Q 2 AlV'13!5?5SUl555QfN5i7fill! If 7:1 L -,smsfamiiw ,at ,W E ' 7' 7 ,mif1L77eA, is if waters if at rr E7 ll :flLi1ivv'swzA1E2a2K12iT'' aw ggtam-A 5 WL sx5tiHfig95' 'f25S5EM?2?Q5fF-?Ef:'Z, 'nb ggllflfalflik ff1fIQ,f1lQf?iEi?fQflLf, fill? IE swfqggfflaif-5ef4E71f' rf A .!K,,tmc,xs.,t , -at , QEQAHZWIXKEEQEZEEEQ. ,. I, f 7 -, ,,.. : , L , Zu ,MA KL'-Hwlz, WEVM-f eq 5 .g,,25Y, M ,N in 43554 HSN? my 3 HwwylwQisgzbiinegiv Y,-.,3,5g- K WL, ,,,, 35515 q,3M5i..J'Vig7,ft A W: f3iQkA:i:fjm:i- KN W,5H,f,,Aggm15qgg,h:,L5,g 1 wf:,,5g,jgt'5j, Ai Q'f'v:::.':?ffsQggQg gl 'Vw' 1 L'SLS.-55624754 4. .2 fr' 5 LTIQTTL-157.4 riff.7'!5wi.5i1QLlL3'Fjflfliglh il all,ZLEFTTf'ff'l-igifp i:'f71!5QQc7E?3ET hi:5wf7i '57i45'K'L Ugkflwil , t,,, ,tt,, , , J Wll- 4:12 f f 'fffffwfsifissvwffgiw--v A-Alias-2 , yggasy atgggiaygtgmgec eszagliavew-gqgggggvpkggfagvigrhfwzelryzlirff-Qr .f----vest-gfasfwfsl7-rf :f--rwEwtefffvlffiii ''512427ffsm:,mi1s'z:,sfz'f.':mwes1'472fi Frxpwffwfc1WIwif-R'Zfv9iflfMmf2:z2ssa53wasf - s tgkflssiviy - .1-I---l k. , :M5y,Z.g3,V MA ,M 5,535i?ifl,gtf,I1-VM,,ff,,My ,,M,,l,,-,limmg V, if V, I I ,w w ,k,,,l7u a5,Emmgslg:5p,it,,,: grief, sfffs7l.efgg.Ag7: ,f 7512 .ai its fi o2gg:.1syCf,l,75gt1l12eEf ,-rl A veffiwifiis 3vl:fs:fswi71'i5 , 5: brlfvgivli 7 iiii A Ha- . . ., .. , ,, .... ,. .. .--- , M ..,, 1 U 'xp LL ' W mf f wi, my 5 vu I ,, a 'wwf :F :G - Q2- , I JJ 6 U 1 E W f X Z 2 C 3 Q cu 'iff - 'u Q, or S S- U 'I CD Up 'l Q, .U F11 rn m c: -- -35- X fn -A I E E 135, xx .5:,s::.Nf, fgflxlss i - . .:, .f'. lg 2 m O 5 2 Q Q O 1 5534 W I 2 E E X J, I I g cn Wg 5 3 wsff 3 5 5 51 . . . . . Z 5' 'E O 3- C - -1 ' S 'U 3 U' 5' Q 0 X 5 o 5 fv N F1 g Q, 9? I ff' fb ff' sv 3 -4 3 ' .- -1 - 2 - 4 U' ff' Q - fn -4 m A rn m Q. -A -. V7 O r- to X r. m ow 5 9, I, Q 'D '62 - 3 -Q LB no cn cn - ow Z CJ. E. fn m : A .4 ' m 'O ,X m .L o - CD CD r' 33 '5 ,, 0 Q CD 2 :U 2 . f , JP gp f5S ig31?+f'.,, ,.,.. .A C 2' w. r , .,... G ,v ,K .,....,.. ..,.. ..., . I- - ' R44 , 1 ,fvmmfsg mwqxw, 2.,,.:L,. Q5Q,3.fggw EQ, X - Ls- 4m.f'e-was :-':5:,v.:.1,,-if ..-1 - a.. -:ffl O, C 1 QQ.: :nf-FfZ'?', - , 5, a.fP1:'.' - , ' '4 Q f- R Q , , , 3 Ear, ,,21455 wZ,.,j3 . . sq rn X: x, , , ij' X :WLM O , O 'l gg N CD W X f ,i'f5i? Ze? A-zessgfzfsizwafg if Q 5 ,V Q A- wg azgwfa gg 2, ' W' . 'Q ,Q Wg C -L 0 E .-o- gg Q 3 :ff m 2 Q' f iQ CD Q ' Wil 5 Czlf I' F if -1 9' m l'l'l ,mm 55 U' Q. I CD 1 5 , Q, , S an -4 F1 C j 1' 7 f 1 C X - , Q, . ,X ,, R,-f f- N 1512 3 . 5 I- WMM 9 S , , ' ' 5 '4 X1 11 F U U A ' W f -X ' f 1 '- Q Q P Z , 5, . Q. . 4 , , : R. N . nz MW ,ww ,W svn ,f ., ,s... . my Q Z ,N 'Q N- 1, 5 Z M ,Q , ,-Q , ,X Q , 71 A GL- -?w,ffw.,1 13 U, , Q,w:?pgyg,,gX M m - m 3 Msixp 55-sgfesez?'?2,efif5WZ:f ,Y , , f sig, X , ,,,,,,, ,.,,Q,,, z ,,M.,., , .Q -- Q ,Q W,,,Q,,ff-:-vfzmw 0 1 n O Q -N 'N i ff -' A - Q o , f NY 'N , Si ,f 2 22 E A ' , ifnrw 222 r. vm Q V .. My m 8 1- QQ Q -f V- - .- ... Wi -4 v 1 - f Q-1 Q ' - .Q - iw fffif -Wm: F' ,,,,,f ,N ,,,, I ,, ,,,. ,,,, ,,,,M,,,,,M, .M -NX.---W ,, .,, ,,,,, f,,, - , .. , . N. -- 11-.. 2- .,,, ,, ,,, ,. . , ,Wh ,,,, ., A W , , , V V, H V W v . I Q V fxxx H Q fl SMI-if-Y Wi , 5,5 'g gi Saw' N 3.4-uw --,,gwg,g3qiLQ5ff'fygyggagiwgf,,ewgggfgfigigiqggggfgggyiff-2d,X:swing fiQE253z-wef1PSv:l,:?f!i7Q,,,gdefwfii,':lm,'ggs?ff,Q- fuss?wg,:fPfWwf:'2l5av4fii2-fw Ml, A5351 wiA12,ffw17Gf'5:5i?. 3425,-2439?-gf awkyaciivi., 'ILE-wfiftffftgfif QV' piggy? V4 ,iefilfmmif-fi 1 Jffglxfgz iii?Fil-ifzii1wJesa5s2egl?f,F'21J2?g1i15?i::,ff1'vf-f??,f,zsgsfg,2aN?w?'71v?---52,59341:-ivwmsfvegv QGQZEQAQZLEWMMQ54551113vffiizmafiififisiass fisffwf iw NSs:Qw5?'??iQ2z'f'fsf53fQ5f?fi2xwi?2W?95Sff-f Q, ,g -H153 M 'A ,if,,?53,vsg:1 ,,: ,M :,,Qiwiwfi 5,m5,M:2L,m,:E i,,,:L! 5,,,QWL3,a,,, ,Qgiwgqzg,f?gm,5,L355?5,2,e5gggQQwrg,f?QM45?Q5fgffWgg,,E,3WE3L,f47h,,pMXN-i,,gZ,,:,,,i 74552 ,gm2,,,fmfy, ,,,f?mQ,w,ng,- fbvwlwfw'fzf-fffiffnzwwifffwazniiafilfz,g?ffg4fzrqmaf2fr?fQ3, -we Haag- 5.iQ5qL,if,l,, Q, -QQQQ gi A , mi , , :I ,, ,,g,,, X 25, We-1 ,259,gg,g,,fggg3gMw,mwgEg?3Au5w,,w,sa, b,Mvf5:,,Wx,,x,,,,,W T, ,fmpv ,,f,5FwmWaVN,, M, Q, r:,x.4,,,,w ,X ,,,, W Qgzifngggamfggggyyqg r Skipyimf, we -2 ,mr,ffww,,4 W ff-, , 1,Exe:--w,Q,,w2,,,,e :ff ,,,--Qgfwff--,X,,M-,, -,umm I ff, ,2wv,f,-mifffzfxqfifmwgmms 'RW f , ,gn ,,,fffifgQ,f,fm:fWf 151:-mfs 414, M Qsfwsmw 4 M A ,, X, ,, 4 ,, M? , Ama Pr if ei si, . T , 3 El il is 1 L2 X ss' Q . T., 3 Els .V .- l l ' r Z i ll : ge 3 T ire, li .gl it ,P .El Q T rr . 25,5 KXVA lf? Y . .. . A r u . . .. ,. . ,,, r t ,, 1.M..., ., ..... .. ,M ... ra, . ,. , is -T: ,... . .... ,, A ,,,A . . ... ,T ,. .. . .Q , H-as 7- --ww. T...-l at tw.. ..z.r .qua-,.:,,.L..,,mr.J..,4r. gg .. 2 .A. E S ' Th Cn I H'lI A it 'K 6 Fl 9 8 9 I T98 ' rv' Q o 'Tx , F 95? - l DOUG S AUTO SERVICE W il Q, COMPLETE AUTO REPAIR Brakes, Tune-up, Front End, Exhaust, at Motor Overhaul 8. Automotive Diesel Repair Auto Electric Service lg? fa A 1 ' fgiifilffiwtf My 3 . ,gli l Hwy. 64 East and spur 248 DOUG BOYD 5 Tyler, Texas 75707 12143 566-4700 gg T al If rt Says Osbums It Says Enough gli gi 0 X 4 BUR P KI T :ffl I H - . , . f s? A , .T any D. 1 rg MGD n-an-:fig L+ --'gg riff-lla JT-X -U Federal Inspected Meat i ll! 21 MQW LIL, Ml xi tl WMEQMI :vi - l!gwX all -. 5 5-- 7 gg' 'rl-'ff -. '- I x X' N x , , , 'f', -' .5 JF , .7 . ,..LKrjfX- ERt3.' 1835 East Erwrn ' . L :life iff- ' 7 1- 5 lfrijnfjiii X . Tyler, Texas 75701 M- f - i ' rg--i 2 - ' , sr- ff if 'T 'T B V, 'il 1:1351 l . gm AC 214-593-5792 5 I -io. , , ..-f l U If f . ,afre,. .,si'.--3 -f9A4'q.5'! we il -' A i--TJ U :I ? gl g - ' , -- cl g , - ' i T1'3 'Jf', Q fl X V 7 I , Qt 2 Gorng to McDonald,s'E is almost as T: 2-1:-...-1:-5- expfessg ' 5 lg much a part of school as gorng to class. ALL THE CAR .535 You ve made us the place to meet, to E WWHOUT THE coNFUS'0N it f ffgfw f ' T talk, to have a good mme, to celebrate 5 your vrctorres and help forget defeats. i YOLI,VC made NlCDOr1alCl,S more than Just another place to eat. And that's why, ' rg af MCDOHHWS, WITHOUT TH E E' we say. . . i Jail.-7 - 1 CONFUSION 7 IT S A GOOD TIME 1828 E.s.E. Loop 323 suite 4 get - . at i Fon THE GREAT TASTE We' Texas 75701 S., Q21 41 592-1 522 l V l TYLER LINDALE ATHENS 5 V f ' 691984 McDonalds Corporation .5 fa- : fe T i ,El we it ' 452 sir -' 53:' ' 2, 7 W at .... ..., . 2 , ,,,. , , .. , ,, ., ..,....,.. ... ,. 2 .. M.. ' 2 7 7 'T PM l me .. - A- ' K 'TQ ' -V f , rf f, ::.f V HEI EVERYBODY IS SOMEBODY D JESUS S LO Congratulatlons to the 1987 Graduates of C H H S and Best Wlshes to Our Own ll , 'gli 5521 gl-l r l1l il Fl-1l if -il EEE! E525 Ei-I Richard Bevel Mltch Burton Danlce Deffebach Steven Maynard Jerry Rayford Janine Reeves gill 551 g11l IllIllllllllllllllllllllllllllil I :- --I :- I-I -I -il 2- l-I !- SHARON BAPTJST'CHURCH -- ' H Justin Blevins Tod Byrd Ken Dobbs Bud Norrell Dnanna Reed T J Thomas SHARON BAPTIST OHURCH NEW CHAPEL HILL RASTOR ONAN GARDNE ASSOCIATE RASTOR RICK JOHNSON RHONE 566 I564 k . A1 L -,MZ ' I-,, LGF. ' v s I' L 7 1 L up 52,1 I .rfr1-- N 'Z ,- .1 I .fi ,H ra e . .5 'ff' I 2 H r...-gg 'A' ,pp ..' , ...Q ng-gQgg,, ?f 'z gay,-1.g.'5 f7z , H g ,f.,. i42:-,fi'Hig!J.i55? -SJ+- ' ' 1 .-zcafi fi. -Y ,, , -.-. wi 4 -4, -, - -- ,Qu A, ,, 2 13,-.lzy , 1 flex -L, -- -' rv ' N I it- ,: -:L :W . , -, HW, 5. I. 11-'Y 9. 'I'-lie. En' -:,::::- A-Q-:. 4-x'..1f ' ' Inf?-f:'4 ' Y -H --- , -14' H, jz?l'n'1L'7 .- by T :Q - L -y, ,I ,: . L-EL. 'fix - V -- -Q - El ' I 55 , , J' Luge .. L ' if ..,.i ' 1-4-- 'Phi gi 1-1:5 .1 ' . ff -, ,. L ... 'A' 1.11 -af--,15l!.':' f ' - ,. I - -1'-' .a. -124.111 1 -,:g5:-Q- -vfi---1-A' vm u f ---'e ,- 'jg I f, 1 ,pL-1- - A. I -:.r. -L I ee 1-S-3.53-iff? ,5 :. .f'-P24332 -.55-sg..f.Lr: , QM' .' , -f ,-'15-' -4 - .ig : -ff ' ww' ..-... - -In--' 4 'I ,. ., .- l 55?'??l'7:Yr'i.-2 -fqfrrss .-.,f- ' S' fax-ev sf ' su? -dan: ,W , . N ,-.W HJ. , J., L., MM - ,- ,. .Q Ly lm , ' ' 'fefirfif--rr .- '-' , -4 Y T' V -- . - . -.I - - ' - L I fl - .V . g vu -Fir.. -4 ,u - , K. .-ru w-.v- .FI S. ,-..: .1 ' 'v sf '- 4 -:'. - V7- 1 1' -. M-L, ... i 1-'.f ,, ., - -L. .. -. - 1 .-vfff. .,,,'- 1 cgi. 4' . 'Ii' , . x- --Q: are .QT--fP'a'i5:, ,sf ,, ' , . ' l . 1-1 .-wp , .'-1-: +.'1gnff.--1-QL: Q ' 'E,.VI'fI?. ., . .31 gf . . .. , , . ,..1 , . -, ,..a- -,L ,,. , -Q., :r -9 lj 1g?' ,A f 'i' T -'int-5 - f : 5' 'A ::1Tf'H-??5 2-5?T?:1 Zr'ii1,- -- '. -'1' - - J' .,. -...... I-,I-1' -11 '- --ss... -wears: will L-- '-f- -1 1 ' ' i. K. ...'.5r.-..-ht- qs'-1.7 V-fig-H 'TS-1'fr:.Y f, . ...ez :'1 - -1. -. 31' '-P'-,r?E4 lT,i?-EAI' -ffT'ig'i'., ?:F-4'i5-fJ4'- 155 Fig-fi-f ii' ,:,.,. I. ,.,,f- ,,,. , .,f ' ' 'v'- fzQ:- ,V -:Jr-ft f .111 1: H . -3- - Sis., ,- ' -L?:.,: '5'-v In ' -A - -A - - -, YS- fr : 1 :vie-ge, ' L 4- .. .-. as-.,. ... ...---.Q------. -.,-- Q.-M .. -- . , - f ur 'f.-'-1--:v.-.es-J-, , .-4----.-sz: - ,- - 5-f --- H- ' '.:1, -3:5 ' ,: -1 V -E, . .: -1 '-'f - ygffff R 46mm r ' Office Supplies ' Business Interiors Tyler s Quality Office Outfitter 7015 Beckham SLpplc5P 11 3 421111593 592 MW T I. T X15 75701 ' 1214359314014 E FARMERS 99 A 'gg'gQ,'g,ffA F'IcrJcLveIryStJ ff by L 1 I 1 I CLINTOND Pnum , P. 3708 Paluxy dt Loop 323 u I -.5 Tyler' Texlas 75703 it - f BUS: 581-0000 Res: 566-09116 Jostens Amm-Qgdmng. Wfwfa-WW 9'W m AUTO FIRE LIFE COMMERCIAL COMMERCIAL INDUSTRIAL lowest-nn INSTITUTIONAL LONESTAR GENERAL CONTRACTORS INC P.O. BOX 7881, TYLER, TEXAS 75711 Q3 I.IIIu,, 424 41 581 -0330 ,,, MW . i O I I 1 rn Ill l yle ef . l'LlTl1llLlf9 I' d 7 I f V x- .r ww-sIIfx.aII0n In Symbol of Suponnr Simca Broadway Square Mall Soulhpark Shopping Conn-r sm w25O 593 o2I7 VISA INIBQICYC ll' :Ind AYTICFIC ml XDFCSS VVCICOUIC 1 AP rf g x . 59 X X, 44. 0 ' I . I 11 60 A if III I A I '10 I , I 3 Nw? N. ,GI -1 1 -I' f o 0 Q - AD GEARS I SRIFTING I A lfzzlllillllllzzzzfzz ,I N E N N N N 1 N4 N Q N Nm N N N 5 N N N N N N 2 N N N N N N N N N N N 2 2 111Illllllillllillllllllllll'IIA lf ff ffl N .. 9 N rp O O Efg OOQOEO , in 5 F 'C 4 5 69552 J x ,4- gb A,, 5' H6 - ., N E F ,, -- gfCj?Xx . V 5 1 N 2 N 'ig 2 ? 0 . 'g '5 ima a Q Q N if N E N Q ' 52.1 5 I 2g+R4EoBf'fwuLfcY3EQ4'3 ?f.H+6 f2fsfmcU'SES . 8:-s.1Naur.L IMSTKUCYION Au. Leue1sCSPM1S19 DEVELUPMENTFL 1 Axycxms-ws1c-oaAm- comm. mvsmus 0 Y 'SIMM - I TRIPS LEARNING cuamcuxun qmmcs mmsw Fm' 'g,'wgL4gf'371RN4smzTATmN Toi FRJN ALL AT ALL LEVELS , CEALEL Bl'-,L,WH1TEl:l9US.E 505400 - FULL TIME PART TIME X D09-'INS UNIX! HOURS OF OPERATION ' 6:00 AM-6:00 PM AGES: la. . SS-JA'Ebf ER SMS . . y ew sph Vw' iw-.1 cmov CASE SOUTH 1 Slflofw - Lau-mf, D- sa-Aj CHILIN 5 561 15.33 CARE CENTERS CANDY CANE EAST 566 8739 Owners N zrvnm CANDY CANE NORTH . Gusty hvlwq 597 8353 HORIZON SCHOOL ' N wx ncufgcms ik fx xmoemmeu -wma UM GRADE ERE- CQ'lU'llD'l'll 1inu3g1wu.LY Piztgn nu-we sucuass on HW comer: amen? swxuwrxoq IIGIL PIIIIAISYURI IAPIDLLAIIE PTH! Mm LIAHINI nn an n H Awrmmob swam, .... .. ..... 561-1557 Us rl3.' f5sd...xj N N Aus E E 147 2 W l ,,Milalsiggsgs..a,tM,gmffm,QlgrflW ww :gs,fewn,sfmwm'gr5a wif Wm- gg W Lfsgwm --- Ag. Wgef.ggs -ff ., ,aS' 5.1 Qatar ,W f it -5: X .. 5 ' ' ' 1, l, .-wf.:,w:,fgg :sfgvf-ft egg, 3: Kiwis' sm-8z.l:,4:5m, le .gr f 2X1si1f?f?F!Qf2QtHf', ., 7.s2's?rsmsma ,gnilltfm ei-,mfg 1 was so Z , rex K K 5 Q: ,- asm is gg -,lysis 5,-:,atig', .mis 3 fr -w2se4fw's?is2 Wliwl' -i'fE.'5i:.. Y .Q Wi. fum V2 mga? ,m.W ,, :N L . - T. i agsgg E, we A ,se , gifzl 1' 6 3 55! .gs-Ji. ia ,FQ MKL , sm. X i , Q:., .W A Q Q 4 - :rf Y L L ,P-: ef 2? ig- 1 f Sam wi F' L iff: 'f::ifT5-Hgfgguiiiigfsi'lfiififi' X4-A suilsfsivr Sf - Q X sf-A ,fx LU 1Wff.:f,vwgf-gf .tml if .A vfv- L llf ,kf 5:35 Bethel Baptist Church SENIOR MEMBERS David Abbott Laura Currey Kelly Gilliam Charlie Johnson Scott Williams Joe Brumbelow Brian Dingler Julie Hughes Kim Weaver Melissa Wilson E aa, f Q F :ai A at t rr As 355 I E li ' xv E? 5 ll i E, l-6 '5 r .Q l l T QE -, Y 2 1 f l 2 Q , f t. l ,L 5' gag 5 is ami? me 4 m y . .l fl 3 411 : 4 .155 Wi ' it nfs 'ff N l .. . i 2 til ., . ti 5 I X Bl ll lil le eil is i i Q? - 1-W S, wg Sl li .El is 'Q Ez E E xl z fl s il li fl -s it l l HZ 'af if Y 1 in E-5? s i' 5 air ga 2 5s E, ii 5 1 l l s 4 3 5 QE .gg 5 em it i l , if SEE l 2 l ,l i A E Q ll 2 is ' ?'5Af'zf?5 1' gf if Mmssffggg, gg ..,A gi: Sflluxfx, 51E.:,E?sa:w'z'N 4 f E -- -,.. -,. . .mf . .. ,l . . ,,w-M,.4.m-.-wf,- .pw---ll -M me af.. Q -me .ww:---:---1-W-we-fwqgagfsq ---- A lla:-fw-wr,----wfw: lm-:-wr:-lvf:vff'w:' .,.,, l f - ---ff f -fm - -- -- -- I 1- ' . - Jews: s ' ' we D--' ,..... t f . :'::ez r -. ' N ew wg,--,mf awk if V , .M Q' 1 fi Fl 4 W, Emu t.,. . WigsM,,i -91 .L lr9j : ,5rgyls.,f 1., .- , f ...,a., My Y. l.mfl.v-Wm? ..,.. ffm, .Pegg .5 if--rt, .,-- sg, .V 5. Sn is ,. ,if , V ,M m .Q , ,. , ,.... -A M - -l .. .W K, WWW l 'J r w M1 M El 5 , ,,,, , - -f .. at - ' .P l f EMEM E' . Qigr'-e'1 e --V . - - mm . .., g ,- Q Q We . 1- .,,,. M, ., e,e,..1 ,.1,, s.jQi'3 1. 1 ,gflgfgsar E345 1- 151 1 Q SM .y l1g1t9L.,.. S xo new 11. f Q-WYE?-11 nga fwgemxe nlklltsleg' 2519 14 mn 9121 5' U . 1 - Q 1 9 4 ., 1 . . A 1. 1. M.. ,. ,MH,1, .. 1- Q. X. I 1 . 1-1, V 1- - 1 1-eyes ff,1,'j'2 'l- r L , 11' vie:-i -4- 'K 1' J - 1 lm- 2.-,fwrfnr - E , 1 ,A.,, .1 ,,i.x,,., , M131 fy - .9 , ,. ,,,.:,,,1L,Zi ,,., ,Q ,,,, A.V, .. . 1 iw 1 S, 1, K.. .. X Q X my is X Q, U 34 gg rf f we-vga 2 Solis 'f 5 J le 11 ' lim 1 we E? Sf' 6111? wwf as 1 1 1 ge , 1 , 1 s W 5, 11 e 1 1 Y yr-15 K 1, R U, -V in 91. 15321353 H giixkgggy 11145312 1 1 is gi .1x3m3i3S f ywimgw as X Sf my gf-,f Q J? U ramx gym 1355 Q 91 Yainiiie A 5 5,125 if W W X P x 3 1 bf se M as 'Z .. , - r ww M M nd. 1 JK? 1 N 'elk His ff wir' 14 5 ewes . 451' a a. if .rm M 4 HE reef a M32 L. 4V,,,,. W 111. .. .W1pe1ae,, 131, 22- 1 2235533-HS-1 v F1 rf! Round Dmp Cfoozz ef 4 115292112 55255395132 7 -- .L -gs l 'Z '. of-ig, 1 SCDLJTI-I Sl 1:1 E State Eamk X ':'1,1,.siQvase1-T-M ,1 -- or SOUTHSIDE Sm te Ba nk Tyler, Texas Member FDIC ai ' Wx afwnislriseifY5s1.1sffif:f?114g-2122 m' ' ' i 1 W Ll1Q 1f e 1 VL One for the Money. -1 3 ffw,.:heizg ,ff I U 2 YJ 73555 31511552 5 'ifilflf 1. , S O U TH Broadway Bank South Broadway at Grande Blvd. Member FDIC 3:7 2 Hia. .13 F12 1 - figereematilfl 2? sfiwezz 1a 0 - ' VVIIIIHITISOFI Cr C - X lr T 'X 211 ll- ll ' 1 '-, '5 ' 'T' ' qu --,-- W.. N: , . ,mr A rw:-w X7-Q Y 5 --M W Y T -- O ' -s 'X 1 1 I r v 'O I C X- ef' ' ff . if -- N- ' 2 ,oo.o . 1 f 111.-1 , Palntlng Contractors - 21 1 ongratu atlons P-O-BOX6562 SPUR248 1 TYLER, TX 7571 1 566-1881 12 11 '... 2 1 5 ' ' - -fam-521111 Trust ln the Lord with all our heart, and ,, ,..e,.,,,r,1,,Wg11,11., lean not on your own understandmg, nn all Soup 81 Sandwich Plates Video Games 81 5 your ways acknowledge Hum, and He shall POPCOVU ,: fm 1. ' M ,fiwvsiaie - I-1515655 f. , dlrefrf YOUV PHUWS- ff PFOVGVDS 3-5-6 , .gf 0 qv -11. 0 1 5:1 I tu, Q 0 ' W'-217,12 1 Your Full Servlce Chrlstlan Bookstore - 9 gg? A fe ma a 51' Ro '.?lfZ?f?i-255'-9115 rv .J i ' 1232 E. Fifth Street Tyler, Tx. 75701 2141597-3725 Margne Payne Cheryl POOI Fl0maf1 Dee Dee Hanson Shane Payne Owners Managers - 115- ,u5,,w, .,,, 1 ,1 1 ,K ,,v,,,:E4 1 .1. A. .U , ,,,,, ,. - ,Q ,.,,g,::-K::,-1-5-,--- .-1. I , 7, in ,H MN. w.Nl1W7,. ,WN -f- 5Z..,aw1 ,1-fe1..e,-,..1Q1,115,-,1 11, g.e1f f.m'a,1,-- 1. or -W , . H 1-11 .1 '1f rv J ' '.-fr. F 1- 1- f111g.Q2121:gi1e1'--11 e-,w f-f-- lfj-512-W-n:ff11 ef.. ' W lt 1 7' fe- fss rr -sb ,,,L w e 2 U A 1 'M 1 . ' 1. .1.,, ,.., 1 ., 1. ,,.,,,., Oz - ' I , , , H .r,r 1.4-1:-I at .. -1 , 1 - 11.1 fu 1. ,,1 fwfwk w'1gm,. 1f-- W ,.t' 41 , 1 :M ff Uwe- 1 1 - :F in 1 fi-A,fssiew:'fs1f,-.sqm ,,11.111 .1 - 1,.. 1 1 ,11-.11e.,. ...,. 11 fa 1- '.--1. 1 e M 1 - f '- :. '.' 122211: E: -1' - ,1 15-141 11fft2 K-'rl-?1fW1i A Q2 , f W I' ' If WW I F 71 , A 1 122-.9f?'i, 331121 515191655 . . . fig-W3 .w.12w 114.11 '-13,1 uf-i::1-Ye 4 11 ig 1. hrefffyffr- nav'- Lf- 'ff' 'f A f- Ifmf f -Fm-' --Mfr' A :If M. oifzfzsf.. 3,1418 F' ,.' 1.1.1 , V , - F ' I A fm M A '21 +.:Q,::. 1' ' flvgzwiifify,,gfikiswggggggggjgj EES: -' . ':1 '-'L 1, A 1 gxsgfai iafx?-1 jg ' 1 ' ' 7 ' '-7 :' E ' as Aw F' i7 A if -.T fi WITH A 4'fI 'up .X,w,fFwffmmf-:TA ,V -GV. A .. -V f. 33. veg- f. IM - W, RA 7 M S-'V , ffaf'-U M E P ST EV E F R E N N I E R 7 A! I W 1 R ,V .J 4 IL S AST STAFF SERGEANT LOOP 323 ON u. s. ARMV FIELD RECRUITER 566 1450 u. s. ARMY RECRUITING STATION 1 tone Q 25Ol E FIFTH sr. OFFICE PHONE 12141 597-1 19611 197 'Q : JE If OF GRANITE Tv1.En, TEXAS 757018544 HOME PHONE 12141 591-5976 - SS ? I-5 O R G1 LASS. r gsfii' A ..,11 114 112. ' g i , 1 EEFF BOLES POTATO CHIP CO. EAS I I EXAS img? 7755221 7 ' 2551, - .1 I ' Hand Cooked Made In . MS 3, 2109 East Flfth Street .3 I, Potato Tr East . - Tyler, TGXHS Chxps . Texas 1 . 3331 2929 T D A. -1 MARY CREEI- S2355 '- eague -1 J h my .EL . ana GI' GHC el' li . Eg- Ag Tyler, I X 7 5701 A 12145597-9908 214 593 4424 A :gg ,is , 33?'IZ-:'H4'I'4-:iTS55Z' 5:14512 .55 - , ,IAIQQlliwiifgilillgsiggg 1 51 v- - 5 2 11 1 . . FABULOUS nsmou nuucs ' I F I H If 0 AND ruuumnc I 8 0 rl Ina am' al ICU e rs v , ' a HEADQUARTERS IO! SCHOOL I. 2 NMR I 11ufq111w, I... I , coswaz names L nm: , iljfg : o :Pvgrmsrtnv A ournv rnmcs 7 N A . I t N d d ' U imc ' 5 '-'mf' ' 0 OID HIGH 88 8 2 A uccnu PATTERNS 2 pp .11 5: 12 4f?Ifi?f?I?3??f'f' s PM 2 TTU Most Complete Sdcctuovl : S- Broadway a f , Ol Ewmnq 4. srmu Famer , kv a 1 7 Tyl9l', TX 75701 ' I214I 581-4940 ' - 7 2 1 : 1507 Twouv vwv TYLER Z ' Y Z .111,,. .. ......... .............., 2 MOVIE 5, VFD QFMTA , ,.' - LS 4 1 ix' W SXT ,,:LA5:kwZh4bl, 35191271 15' 51 3341555251 If W Arima? A111191 eww A f 2131 w2f1KII?31s?lZ?Is5v,1e1 A msz221s1s1sEaiM51fi?Tf15 ,1.,,,i. 3 H..Q1f1I:IfZfLT1Q??Z?f35?2L .,,s,Lw,,1M,,S,,1 ., W- 7- ,IW 1 2 .1w 1,, ,5, H A .1 2 AE' WA, 3525 1: I is . , . 5, , lm -..--.,. ,,, 55325533332 I H511 A ?, L UZISSSS1' Sfmiv . ii Fifi! - an '- 1 1' -X EiE4S?iaz..w111Q-wp. fp,g5,yfEf,w7M211ai4:xms'' F 17' W' QW 413,35 ,T -1? Wim HN f If ,,1 AP 19 A Y wig .7 1 , ::1 .E .l. ii1S5i71'?EffSfi:J :ny ,Z s 1151 211111: f f, ,.-sg, ' W is 1 .,w?K1EzA,1:73J , ,.,1 ,, ',I:: ':: -I.: 7531. 'z' fT'TIf'i3fi s IM 055 :IFF-4+ 51 , ART a FRAMES if 5 2120 EAST 5th TYLER. TEXAS 75701 I214I 597-9545 an -44 I I I ORIGINAL OILS 0 LTD. ED. PRINTS I NEEDLEWORK FRAMING FIEADY MADE FRAMES I COMPLETE LINE OF CUSTOM FRAMING ' 9. ,. A , A E IS I 3 Ripe video HWY 64 EAST - 5.8 MILES FROM LOOP 525 BLAZIN BLUE BACKERS ., OWNERS .i I H214-566-8437 IOHN 8: NANDA RIPLEY N? Y 2 n X ,.,. mg V mgxggwv A yr 0 fm Ewan max yt, , QAJQ HIV ,,.. .. ..,,..v, .,.. ,,. Tux, Wg: YM, .wl.?3:,.V.,,,.. ,. A I A AM, ww Aw 1 1115544143 Aww WA Q, 1 3 M-1f5fIA?w1if1g,13I5w 54.5.4141 WI X329 ' ' ' ., 535' ,IPS 7 1 . f ,. ,. AK'-11'211f TN fm- A ,I av -A ff! ,W-. fwff., 44- . . rf' A -. . G m .. 7 .. , - A T A M A ww Mwi , , W 159522145 653,11 52552 J 53,6 Q21-QHIEWQ ,, pi TW My 51' E., Ei AW 11 A In if 1 12 F 1 - Aw' I -- T 1 1 A' 1 ww wf 5 A . 3 31 I 1 A I Ig iv ,Ve is A 285 I ,pg L 7 1' V 1 f M fp V T if mf A 171 A I AAT I A 1- If W EE me ,T gm A I 1 A555 gg ,Q I 33415 , E- , 1 'E' MIL L f Q Q .sf E I Q? -IA' 3 x 11 ff 5' TIZFIIJ I' I 1 AEXFIIA Efggg Wlxff I , 'E -.J.1. ,15h ,Qi mf' I 11 g 3 1 af 1 31, gr 7 7 11 1 N I Sf ax 5 1 1 1 fe , gm 52,5 Tiff ,A mgEgf2I,,,, Ixifhqw VIII? 3 If T'Aq?2'EI, TI :L ,I SVI! I I nt Aiikwgf gxggggi f S2 X 1 Egmsvfipisgfi? kggisvx My 2 QE A5 14535 K rg, M2 ,E I Jia, Kiln, 91555 , grain? R an ig XXI Q J 1 9 5 ,X M Q I I - I Ea ff , If Ig, I, ,,,,7,,I, f gy I 7 SEQ' I I A 1 fm .T Fm FTTHTEIITWE H JIYWZE W w IWLAMAFA S I A A V, I A T 1 A if .7 M sh ,K T? Q ggi L Q , xv Af 9 1454 If was , It I E ,R 1 Has eff pffin fra-ffgi VA yy? 45 ggi? Vin, 'Ev 'I QW 1 I 9f, f1 11 5 W - Fx 'I' F 14 K ' 3 M 7 ,W ,.g., .1,, ,... 1 .QMS , A .- --II 1 .Lifit M1 V' '1' : :E I ' --T 7 I4I5'F WEE' fbiiifff f7 TV-Jfffkyafifsi H QL-F 'Aff 57f1.15I2-JI-45'5i2l5f511N'7A7fx: I I IIIIFTIIEEI '5 -::5F IZ.E i' .. I kg-73 I . E : '. - 5'..':' I 1. 1 - W,mm..,.m, W W , WN, ,,AA . -,- .A.. s.,.,,.-.,,, . f ,,., .. W. W ., - r,1 ,,, N W - , A Wm'-H ,gf wx Rez' swat - H , ,.. L A Y , .,,. . ,. .., .. V , . ,, , iw- H' '55 + L - 1 7' f W nk ,fam H4 5 u my ' , ... h , If: ' , A 2: :XM 'Y K -,122- : 4:3- :4,?ff5 . .... ,. . ,, .,.. ...,.. . 'i 'Q 13 ig? E re 05 gf - gy :- fr platnlu tomorrow s . meial f6day stronger and more brillianf fhan gold of . ca lower prlcc fhan M remounts repairs, sizing and special order work - with our pledge of fine A at W N . ,.... . my -M--7 JEWELER ., in ' u Sffhtj' ' I ...y H J,-1,75 1817-C Troup Highway 'N ' ' Green Acres Village Tyler, Texas 7 5701 nzwguans workmanship quick service and fair prices. e are YOUR shop to do your stone setting, . 1 ' ig: 1 5,f+PM, Sjigff. , ir .Sy s t 5 :k ..,s: ,E. fa 1 ---f. :: ,EU -ag, :- f. -sa - W 1 ' f f' I 'M L f ' M A H gh M K in E 'r fr arf? 'ki' ai My f , ,.. f Q I ' 5 - 1 0 y 1 f . I 'I ' I .I GBP' GLENWOOD BLI D Sl AWNIN RT. 14 BOX 94 3025 OLD HENDERSON HIGHWAY TYLER TEXAS 75707 Z14f597-2088 we Wg 2 -1 .kr, ,, L15 ssl, . ra W L k ' J ef x 6 Q fi i Y a: l ar e . ,. ,,1,, A . 9 .Q lee, A - ,ya xi Q ' l lg ffw ' i.. .,, A a f rlfg 3 ta I gi 5 Zak. 3 2 y S1 5 NF f, ,Qi ,. lf f lff Q it ' 154 sf -1 , 1 , ii i Q .az f . seg f. is E, i ts wk gg ., Yi fl .2 f y? fa ., a EE T. ig? S.: EEE w at git? r' ,K W, mf, if li ,, .7 ,INS :if 'M Q V f at ty i n ia . E 21252 3 5 a 'KY-3 M ragga .5 2 fre ' 1 E 5 , ...,. at . X - .9 :Elf - 5 V 51:53, ' F ' if , . i V H5535 K M ,, ff -x A it 5 'f is la Ha ig. aj- ig. 7 we P al l K ag, mam, A get . 'Iii We fl. al .- az , 'll . .' L E 2 A 5 2 6 r is or 2 lg gg!! Sig? ,Q . as Q 3' Q 5 . S . 5 K gk 5 M if -1 an r as . : gg? 3' 1 hewl ett i f I ' i f f' M 152 7 K ffr fws Y 1 : jg gf Este? - - jig W ,.. 15. Wg, as , Q cl 5. ..' . t,.J .51 V iss ffarfmgi 6 sg? 5 Q a f. : f :'Jf...:'f 551 5,1 r K ...,,,,E,:.,E X 3. 522 2 si assi We ,f iw fr 452 54 4 a ir w a, -.-at f- NET.: 2 W. ze .Ma gi -. H- my 6 A? We 2 , 2+ H Q n v ff ' Y at Mm ,E V T7 3 m y Q1 Q64 -ev? L J: . iw a ' ing? a 9 f . gy .si e' a t 5 ' ti : vii. W . ,,.. JW. s f? Egg rf lr 5, ga . so f ggi! J 455 ' 'K it ,W gg i is J K f , f if :arena - Q 5 Q2 ,J'f?a y l 5' W' 2 fi Egg s ez W l , f -.. ,if gi ,, . - 4. . . fl? i ,.55,f,i ,L ,- rwi . 4. ., 'K ' SFX aiw g 52666 38 vi I 31, iii ,if f ig 9 Y eff X Sit s Q . , . .,.. . V M ., -'---- .. . , Av .. ..., , ...,,,. ,,... .,... ....., . . ., M. U 5? X Vvwe A -- -v.- K 7 sw, MI' - .ln vvvp, '- E . A tl f . af ,vvlyl I . - - ,. 4 A Wim. 'N M ...,. -' . .7 f .- ..,, .. .. 5 ii M- -a-,V--- 'M Nm. .. W HW-A-wifi' M ,,.. -- 2 7 L '- l WgWwW's.--.,f My-'r4 MHf?' I WL' '11-A--W M MW- -MWVW W-1 - 1 '14 'T 'fl tw-A -. ,.... ITT' gem,-4 .,.. W- M.., , , , gig? -1 Q fl .. ,H W V 5 541' 31 'I A CIIA 111 7 E Lil - Eff., It i53l fa , s 4, ii 'I f kia L 1 E g -,, ,, .. . W .Nia , A. , 2 Aiar 4 A. -1 :52 . ti, I' :rf ' ye Q'-: s ' 15 ff A . ' 231,174 , 14 t gp Ay Ig - I I iii' I ' 53 5 5 f air 14 1. 5 ,if 4 44131-fr '- ef Q A wie 44 , if ,Ei if I HE 4 4 121 'F Agn A a 1' K 45 Win 1 J, 1. .. , ' f l .-r - 31 E . as S1 WWW' 'if 4-so ' 17 - 14 4 4 -me '44 4 ,A ,ir ,r we - :E Lrg 1 els i f S Q., fr' . -' ' Q M,, ,,,,hV -- A ww :ar rf: 4 4,4 - E its , A . 5 A 5: uf ' E1 'Y fa' 155 I is 1 I Ct 5 1 4- 1' :.. I .1 'ff 7 i s a 1,- ' 974 4 W Ugg? is fi A54 ls , 2 , .. . lie 7 . eggs 11 Lf' , 2122 4:21 4- , .-7 I as si: .. ,rp - min .iii 112 gf - I we -.12-11 1 .. ,. ,I I .W ' ,A YL , ' 7113? S, J gg 454 1- '- is we '1 .fi s Irs I1 KARL'S CAMERAS INC. Fine Cameras, Darkroom Equipment and Photofinishing Olde English Village Post Office Box 7819 Phone 561-4154 Tyler Texas Service is the Most Important Part ofthe Sale COMPUTER PLACE OF' TYLER 592-8800 COMPUTERS - PRINTERS - SUPPLIES APPLE EPSON HEWLETT PACKARD PANASONIC glulhorrzeo Dealer 1918 E SE Loop 323 Tyler, Texas 75701 75711 5625 s. BROADWAY TYLER TEXAS 75711 P.O. BOX 6908 AC 214 561-7137 39 Saltwater tanks - 107 Freshwater tanks Since 1975 Birds Fish and Small Animals 12141 592-3474 12141 592-FISH 1612 Leolynn 593-9424 GREE ACRES BAPTIST CHURCH l 1:00 Worship Wednesday - 6:30 pm High School Midweek Study Paul Powell Pastor Eddie Cantu Minister of Youth Sunday - 9:45 Youth Bible Study BROADWAY LIGH ING CENTER I I Z r I 1 2 1 S I , Watson's Tropical Fish 81 Birds 1 E . I 15' 1 E I I 3 s rr 1 fl F1 424 1 . . . : 2 111 1 2 1 -' ' W - A 'mv 1' 1 .,,, ..., 2 I is 1' Iwi ,R ,.1t I .,,. E4 , rrmea-NMMA WT 'f:4,,,irm-24-44 .4 A 4 efwf'-Mew? CI a t-521 AE '--' .v-... 2 ,,,,'T 1 A NP' T' A .1 WBA J ,EI 2',:,'Z34.. 1, . 1e KWH Q5 MQ! Q WEETLE 3535? 7'-HT M ' .M .443 i n 5 ' 5t 2 ki2 fi? ........ .. .... ,.... . . .. ,gf F R' 0'. -' 'm1X ' f 'Rig,qJ' ---f ., -v-.-v - .v-v -. V' 7 3 ' 'Pm' ' 'gli u i .,,... ' G . 1 gl em V I ' - A-W Clair,-1-lag 444' gfaef-2'WE fmE ---W :I-I A 'wairsiwi Eff , 2 at me I ll I is I s -1 5 5 5 5 rig I if A 1 3 A v,::. We SWE ml ef Cgwmwsgm 'QT BWWCWYQ lt'9i3.Wxm? w'W3'.3eWA if AWK 951 Af VYCQQWV W QV Y Y W Y WW' Vie w ZA AA AA A A w4 AAAAAA A A A ,N A A . N AAAA A lb, A i A ,X , A AA A AA AA A A A A , m A A A AA AA A A ' iii 2,5-ileriw 53521 f gsgafeeeedeeeemeaee Sega :ve swat.. iiaAAe,feeAAe5fiif2Aeee5eEefffQ:eeife2eeemseeeAa3.eare3egge S 1295 we We AQ A. ms 'zfflil 35' kia -Exif 35525 ialffig? 555 Ai A1 33 V,-2' LA-QEAAQTQ-AsS? 1171, 1. -4 'V Biafra' Z 355-,Qf4Q4FAif3l wk MA 'Aff-if 1 -Q7::f'm:Q' k5 eff X 952 'iii Jf f if' zAf4 ' Af . if A A AA A A AA A A A AA AA A A A AAA AAAA AAAA ,A AAAAA AAA , A Y sf i f A A ew I is a!eAifAaAMg,,A,,l,A ,JST At F ... AA A ' i: W 75533 'li MA m?'2iL3Y5i-A.,fe A Ars iii' M-.. AA AA AA A AA 1 El 5 A A A, if : N ' J E l Aw' AfAAser'f:ay,:fAra A AeA M IK AJEMEZAAMQ' :NH RA wid? SAMS? i -- liiiieivfwr- A ,QAQAJH-iq5AAwfAw,gesgfAA- :fe A - -, - f- AAAAAA W SQ, W A ' f s ? is ' ' ' 4 .. A r: f.::i r'i!I' F ' Ai f -ww .. Li Asa f A . w e, ,A .AWA ' fz' Afgwwf s in is B' A S 2 z5A.f'wfA ,xl tix: A A Yzmi V.. 5 Heal args 3 A f ' L Lf A A A i OFFICERS VA -P A Chairman of Board Vice President John lVl. Parker Mary Lanham . . . President Cashier, Vice President A W. A. Kleam Jr. David Swinney Sr Vice President V' p d 't Ice resi en f ea Shirley Langford Jean Barber Vice President Asst. Cashier Pat Bedalf Valerie Hardy Vice President Asst. to President Darrell Taliaferro Delane Sanders , Asst. to Chairman of Board Banking Officer A... A-- -Weil 5 - Alice Clover Ann Russell A 'i'f'f ff'f'4VfW'1'.aA '1 X ' Arp. Texas ivi.F.n.l.c. Tyler Phone: 593-1803 1 1 2? fx AW? ja-A 11 time Q 4 A ei 5? P T T lag If is Q si gif 5 ii Q5 E lg, iii ii? lf. l 2 , A L ES 5 sq s 3 ' 5 34 is E E if la il il 1 i 3 U 5 .3 E ' 1 is l H AA , ,A - V A A A, AA .A A. A e w e 's ee ,W , ,- ,e ,,.1,,,,. , A AAA - ,- 3 A - f WW - we er e A ,,Qg.5m ig. ,W A.f,..W...,,-A,:,a,.,,.,w .. 3 7 are .I W X A ..ws.f5xAsGQzt5,,nsef,eA,,f- wA -Af,-1 A, .,, .A ,R.. A A .. T293 ,SAV ,A ,,.,4i6SAAg,, MVA gAAAA,A3AsJAA,:g-AAeeefAw.eeeAf e 1 el-eff eeeaezfe ' J' N W ' K.. X 7 fm.. if Aeweee efzeffsw' f-- . . M5 -f l -- Ae mmf -. ,A . A, 1 51 A ,afggfgg -- g A f i, .El y AA ' AA AA A A 7 1 ' J r . A C 'A X A . A -- A 4' A 'S f QV 'Pg 12' S W A H ef - il wisgfm y A-A Ai A .A A ,Mar W , a,A Q A M A .Q A .Ae gag 1 aa Ae S21 aw? 4? A ei 5 We K5 ,,a,..,. : ,,1,. A A ,V A W A: . ll A, .KLA A, jay, .A vig mx ,,, ,.,A.. w . e5V.TA.y,e Aim, Wwe L. Q X Q ., . A P J gi Aa f e g , K ez H ,Z N 4 Ae? aww! .wa 3 .1 Ax AAA. 5 p V a .Q A AJ, A. f .34 i 3 ' g ig 67 'Pig 3. ee ' A Q y X A ff M 'fbi I if ix W Hn' ev ,Q , A A S Ag.. WW .A .A A, A A 5, .T MS , QQ, A, .Ae . 4 .A X' f M 2 a A W ie! Ae 4' 3 , 6 A Aa A e x A Q E ,- . ff , ,f we -was J' A V A - .Al Pvixmszszwymmmmsgrgifiglgwfgggwangu1fi,,711gi.F35,?gi.3,eg5Z's?lI'wigggiisfyiafimggfg 'A-1555,gmamwwgamgzmgiggggggggigsewrgkfgfyfgafglgvgsfrgqggaw Zasgiwfagyi-sgwmef Kifaygww g?g'1W3gQw1fQ'fSI PF1Q5fGQef5lf2fx'WW P1121 VNWQ11 I I I. if rw A4., ra: ,, ffIsf Xf,.. J- - ,r Li., , 1 11,64 am New I . ,Q . ff rf f ff: 5 ,z a ,f - if My W., 5:51 IH ,,mg.iQVAg5 mmm W ml J, myVHymnig,,f,I,3IMsggywgwhfirgv,,Mk, ,,,,f4+af,W fffA.5qg5,g,,,w W ef .FW .I ei- we vt?-fi-w TS, sz' tw 'I' an ff si ew we Iiletw. Y We iff! f -I HH ff if A It 7 fs-fs::isg.s1s.22-17r2I-,f- .asf A--f west -L -SGW 51 ILIIIIW f3W3W 4- 11 1:f,r1',,mfliifi1 If-1 - N, f -sen 71 K lfiz ' ,4l'l7T' ,sew hw , ' f- ,,f, -iggtgei . LW,, W, af? 1 H sag, B5f,g?5f42g,.wGiQ,,4,,1 ,,, - ' L! fi?-135161 2 f eggs 1515215 15 arg lr i,Ssf5gQ2i, ,,r+i:-Algswiprg5-ta:-Q1yg ,ngegfvfl leg 1 L I , is-I'-saw' fu gm My f4iE5i2i?521Ia1g.f,lx1a2?Q?al 4 ,, ,W ,.,, if ,,,- . Qg ,55??Etsssa x a:'C was wee A' 5 weave, -I Eur , .m,M.u,,:12i' ,175 ..,,f I--f, f ff: W,-fm M we - r as eww ,.,1i5,i.fW assi wi r' 91 115'-1 2 i flaiggii-rf fi gawk .giggil ill smell- -WX I Q ,, sassy, 'PE 4115'5V1l5f.f6lf feS9s?w- 1 ifwrfssgqi is 'sam L gQ5efsg.ie.,r Y fiswfgisi , iP'5?'5,f 15 ,,,, - ffiiaii f? 'sl 1625113 2 vi, Zi-,fwfr f.'Q51'Qi1'-1 935512 IsfWfivg'f,imf I , If,,f:2,f- f- ,ff 'a.. :- ..-. -so We 1 me affi rms ' 3355: - , .. ,, ,w,,ra at I 11 5 we wzffwsweiiilg ,egawfe is 1 s .5 wie fiifeesmgse,easteriaeeretmttfaeeiraeM W Ttlefgeff 5 be Xgfg,g2g.gr??yawi.irrQa51ffismaeeeefill., ff' I ,, s WI 1 1 ever ...Wear f it ia We 1 iIIt1fa'rall15fIitIHlZElQI?G?iISQfeEiW9?I IW' 'I Wiifw 1 A VW V an was A 1 322. 1 was emfv ffl eIx ' si r S21 'I ewnsE' Q a gar, Tri ,I ,14i:,rL,7 ,Q 1. 1.32-ifraiwffye T'-1' w e sz an y if .. : f -T H F V Mft. AN OLD FASHIONED Family Owned and Operated Jewelry Store Morris Kyser Specializes ln: CUSTOM DESIGN SIZING CASTING REMOUNTING REPAIRS We Guarantee Our Quality and Workmanship Just outside the loop at 3011 E. Fifth 566-4256 WE ALSO SELL RINGS. SHOP-N -SAVE Chapel Hill s Only Supermarket 566-3921 n Henderson Hwy. GARRETT BAIT 81. TACKLE Groceries, Picnic Supplies Live Bait, Fishing Supplies Gasoline, Diesel, Kerosene Open 7 Days a Week Lake Tyler Road 566-1 1 17 X iff X X U if X1 Z1 X, A Iwi REAL ESTATE UTILITY CONSULTANTS 1324 So. Beckham HAYES Tyler Texas - 75701 ASSOCIATES 42145592-8822 ROBERT I-I HAYES Christian s Photographic Supplies IIC YOUR COMPLETE PHOTOGRAPHIC SUPPLIER 1406 SOUTH FLEISHEL ST. TYLER TEXAS 75701 42149595-2360 7 I . 1900 E SE Loop 323 Tyler, Tx 75702 597 7223 I I I I A I if I -. gs I I I - 2 I - I I I S - A3 5' I I 9 I I I I I , I Isl , r e f -- H '- - ag 1,51 J. . , M ,. ., A . . ., I. .. , , , L ,,,, . ,M ,I .M .. . ,, .. ,, .I .H .. ,A . . ,. -.24 .. , rs .. . .. 316-y V ra Xin s f A .7 V .. . ,., , ,.,, , ,, H ,M V mu., ,,,, it. I 1 -s,: fi' I J 5' .': 5 -251.-15 f'5'IS ,IW af '1i f E' 1f 'ii :.Uii fii mik 5--,H aifa 'NE fi.-Qs,5:+Qfi'E:1 'Z'5:' M I EE: :1-gulf ' -- .. r Wafgjjiiiti' 51 af, K , Ks'Mfi. f , .Y .... P . . . .5 .g . , . . .. Ie ,. ..l. sr., isagewsz .aa at ra I ev K f .L. i mma 2, ,..., s A 2, I is 'A I ' 9523. K I I ggi 3. it fri , I al I1 I 5, 5 . Q ,. l f:' I I gi iii! ,S 'il 93 gi? I 1 I ?Ii i I ... . .I M 4 ge QQ -ew.h f . 1 W A gi gills ' TES I I Q I A I 5 U5 A Af r S S 1 ' 5 Z' '- lr .i es , S N, any r 5 - lifes' aff w as ' if - , V -4: - .gf f ' w.rQqYaa1EiIE55WRS25:Ef.5fWp wigs ff we ei A - we ... im 'Z ' I M QV? 4 : i I- - Qi! . . , ls I .5 P fril' af , 4553.3 T255 I It , rQ i i?!g5. ,M 'W Q,4E1.ifdWm3i?,f .l IS? 'S as 4 , , I S RON S AUTOMOTIVE I I 5 ii 1' Bus: 566-2591 I FAMILY HAIR CARE 1936 TROUP HWY. TYLER TEXAS 597-3931 Pat Fincher HOURS: MON.-FRI. 8:30-5:30 6' ...Q Ia - g a.. f, - 93 :aa in Q-f 14155 i s 3: 12 M yr: I YS! QE: 7, w f If. 35 K, .I , I? Q? Jeri' 1 2 Qe5.i ew2WgQ. Y' L M w fif ' Y 3-'1-m '2 ' I5Lf 1' L L ' ' F ffl? f' cf '-f1?'T AT - Q. fl., fa -1 ii, iii,-E-:W Ifr AWJ'-fkfiifii ezrwfiirffzrevfruriiz' fs: WN ir , . 79'-1,,, fo -as fb! ,V ,'.: f: Q :II , L.,,v gg ,577 , . H , ,, . , . ,M ,, , . We A,:. I :,,,: .. ,Q .. . 7 A A I A I fer . fm! 1 5 . Office Res1dence wig 566-1065 566-2378 I 1 1: ,i E2 I- 1' 12 L .: f-- Ian ni ai? ii Manufacturers of CHAPEL HILL fr ETER1 ARY CLINIC 1- al'lVaS w . ' . P r d t B111 jermgan, D. V. M. . Chris Williams ns 14 sox zao 5 1' 0 -,A 4. :F r IE '1',. f Hwy. 64 E. at Spu r 248 H HI r' Po rt ' .r . I 11 . 1 I 1 . 7 Res: 566-8584 RON TATE Office 566-3737 Z I I P5 Roscoe Anderson Owner I Fair- I , .. M . . A Q53 A J A f 43 VL -I ,QQ eq , I .,.. , A . ,, . U . .. A . . .. .E . . , , ANDERSON CARPETS Mailing Address: 3411 Timber Lane 75701 ,gif P' 'ef Egg I Q ,W K we 2 M X Jw I AE?,,al,5? M ,+X ..,.. ,, , MW 1. E ,. E ...L , I I a I , 1 I I i 5 xxx I l, I I I . I wx W A 5 -fx 1, W XX 1 pa 1!'iu Ax ? A, I aff 5,41 4 u v w x ggi PM ve ef-eg 9 435 K I: ,1 5 1 , 2 K iwiiff Mow U 3 1 I wi I 1 1 Ag -1,111 r Ff.f'Z2.Wb-,- 5 ff if I ' 3 fi ,.,3 5,f,x,s 5491! Y ,ggi g,,,.gc3i 1.1l wi L4 sa 5 ,Wh , ,x ,WWF Ne w i s Kgs ZIih Q,fv if 4'5 irp'I3:fgv 111742 'iE'iN2k51,?gAII'II Mb a 46 21.621 H Q i 2 E5 13 gi 1,9 711:11 4 i I I rg 4 , if X ,I 'ggi In giaiiy ip fri? IF! Q ly 3 IF If I d I gs fd..-2 gi f 'ggi 1 is 1 44, 31 32 SM I Q I 1 I .W ,J I r 45 F L F f K Y 41 BSE 1' 42155-'11-A 414 Mt 4 J I F13 f A. ' 55733 'B I 5 If A - .7 -R.. .. , U , ., . ..... ff.. .... . ., Ku . .'Ii. '.f'IfgiBA,f:f - .,...., .M -..HM.122.- ,,.. - Lf 1... , .gm ,H , .,,s,,,w , ,.,. mM, -..,, , f -Ziff 11 f- , -2f'f21f'M 2 . -2 -c,.,.: ,f f -- -:mw..::We.M .:q:---MW. ,Q-we-W - .265 w e E.. wsligaid I 2, 15 7, E W Wig Zl5jf7iWQ5fi2I3 f 12 21 N ,pg WWI 4215 ' ' 1 I A II .Sin I. -.QW M 7752 LEG. VI I af: cr ff if v- - 51 I Awami-ea M3119-V' 756 ' 2' as 1 21' , , , - 1 55 Milfs My , we Y er, 'W + ,Lf I If in f. ggi fa- wn . , 1 S I 5 M ,ia ,455 . I. ef I. I f 1 5 F.fiELzf?55'i4E'-A M. i- E291 f .. X I ss, , 12 .21-ha s yi- I, . gig? L I.. r:fi6As:24-M: E .Ms 1'xv'1axr:sf5v, fiat' ,- M E:'2:'5 i i :V EIN fi W '53 3 ' . f- f f' .1 7 . : 'ie ..-- . 2 if I r 1 , V Q fe 1. K . if . aliffl ng, Sv , v fs! 5 K . gg.. . , , 25 w , s f J , .S -rf A fig, L- i w 4 g .asf em ,l f lg., ggi eff? ' wr 1 ig. eff...---,-are 9 Y ' ,. 'e:e+ge,2m-V T7 Y ...M f5W.Jxm-fe'miw'V H 3'-W-W M .,., T' VQQQW1' TAW 'VW:'i - A-Q54-fwnfsxfr 'V ,1i2r 'L'Mi,1e:-E... A---ni. -we-Wm' NW. 'W M bf' W, Mm? - f M 'M,geanvmmS ,. 5 211: awww ' 1111 ie-M-M'I' , 111-11. -w::'1f1:fi11 ' i1T?i'L11f 'W-fwemiifgfg M Ll, '3?,T.,.. , ..,....ww 0 .fm ..- e,...,, ,.. I 1 ,N 1. . 1 , We ,Mmm MA nm. ,MW www , 1 wew,7.....w,, mms immilf fvwxi we 1 - 2 - ,L 1. -: xi w'- W-1: 531: -ww -- e1 M 53l -fe ' M W' W-Mt M ' ,:::r:.---w-- ,M .,.,.. ,111E, eY,,x .,W 1 1,1 . We M M , .. me ,:ie.,fs,,. . . .. ...W .... we .... .,..Ww..W1mfmw..-A Wm. - 'rv V A 1-'M mafezexgmmemem L:.1aSwi?WHi11,,, ff21111m'1mSef:e.f. - My-aww-we ge , 1 . .,, Qwwwwe A rv tj T' b af? w- fl A ,I i 1 11, 1 New 3P553 l 5 ' 21 S , ff A 'Gire eg' 1,11- - w s 2 if -. .. ,. - T i w ? 1 .5 ,fe 1 gil W , . 1 11 . 11. 51 k A 'Qi e l 1 Ti 5 .. ' ff ' gi 2 1 15533 Q ga , ' 4' , 1 ,w.Mev EWMWQ1 enema? ,Qgewme :awww Ewmms - 3 ....,. ' '1' .1-I-- f:a af':ffl5w:: 11. 1 I f W3 iigifgi -if 2+ 5 .. , ... . 1 3 -i 5:9s1w?! 'Iif i'i' Mime 2 L, by z i af i ff ia fer ' , .. .J ei ei 1 2 :.....'Q: K xzfl ii' li ke if fn- 1 sv - 1 1 .5r ..:::Ei33: 1 ,ff-E'!,. :I -' :-: Ei ' 'V L EF T .: 1 lm-1. .5 1- .- --+5 1' '.:: 1 , .. ,, .. Q 1 M r? 5 e i 2 , 1 ' 1 f 3 W - gs ' 1 VV 1 ' , F w E- i..-1 fl E Q , S Q ik 4 ' rf i f - + mgmfw -Q71 iw ff, We .a.if5f - :.:H: 2:. f l wewm? if gl 1 5 aw r QM1 5:55, gsm, 46' .. f 121:15 , J irq? Y me Jag, - ALJ Y ' :Fw 'E:.. 1 Wm .1 ... 1--512 is iw X- . 2: . ii :r f 5 f QRS? QQ? if W, gf 'ix i hws gi 6 1 ig? , x x EQ? 'P f vw ,1 .WEE YQ n in e sw 5 im M? W is W li' 'ffl .1 Q 1 i .1 ei :i j-4. 5, 'T gif ? 5: 'K ' sim , 23115221 .V ,M .. X 'i Wi if 515, Fx Kama. -1 , 12 f is Q We wipe QWM1 9,1 1 V fly Q1 ev 5 'x wk 2 1+ ' ' f ffg F 'eu X 3 1 X Q 1 MQQML KJ ,lerwv xir 67?m1F 51 85 THE EVES AUTOMOTIVE COPE SERVICE Parts and Service or Spur 124 at Renee Dr. Lghanliigaws Rf. 414 Box 111 WSH Owen Tyler, Texas 2145976938 I ers J J TRANsM1ss1o COIVIPLIIVIENTS O El friend BRIAN A. REEVES DVM i 2711 University Blvd. i Office: Spur 248 - Tyler, Texas 75707 12141566-2212 Also Prof. Chain Sharpening Authorized Sales and Service Center i 7 f U Rr. 14 Box 836 Henderson Hwy. at Spur 248 2 l4f566-1786 Tyler, Texas 75707 l I '1 i 1 Z E f 1 1 al 1 1 1 1 if . .. W 1 Q ' W IM S he We M ESS' 7 f 0 U mifffg ww f Nm me W 1 2 E - f le? E . 2 1 il A. f ismfir 24, E . . . .1 .. .,,. 1 .. 1 . -- . . W if , y ,L . 1. .. . ,I - . H 1 mf? 2 5 1 1.1-- - ,i51:.fr:w,f:: ., . WM fr ,dwg A ig, F' '-ffw' iff - S V f .:,Q-'Z1g-:- -- g N -5 , - ' , 'M'--1 ,.- -- '- ' Tffmw Mewgwei --12-- Rr ,.,.,., ,MAE 1 , 1+ 5 31 J, , sg 3 4 Md 3 1 11 . gl fl S 'S' S 5 it 'QL T x 5 IX K Q Q KE Q' Y 'f J ,if .MSVWNM 1 1 1 ggi K mf ,figs F S M rg? egg 2 ,gig iii? Ain, gmmwmmmwwfwim. A 1 A--A 1 1 if f -1 P x ! ' , L yi I 'vi W E r bf- ei X 45, W fel- ,Mix if mm ' M WN 'TTT' Wfmissw K S M 2 CL SBSIG M 22 ex Q E E ge 2, GEABS 'K Y 1 11 'h A g'.- ,g.. 'k K2 ngwfj' 5534- ash- , if 19 'f'.:if E21 Egij fif k . Eli? -gikgj' k Q Fairchild, Annette: 101 Gipson, Laggett: 21, 118 : Choice, K A Abbott, David: 20, 21 , 78, 79, 91, 92, 96, 96A, 136 Acker, Jill: 18, 19, 50, 51, 116 Adair, Melissa L.: 64, 65, 116, 117 Adams, Abby: 96A Adams, Elizabeth: 116 GARY ADAMS: 142 Adams, Johnna: 45, 54, 96A Adams, Mark: 108 Adams, Wayne: 100 Adee, Shelly: 96A Allen, Kenneth: 100 Allen, Brad: 46, 96A ALL THAT JAZZ: 140 Alvis, Tanya: 76, 116 ANDERSON'S CARPETS: 155 Anderson, Barry: 126 Anderson, Darron: 78, 79, 96H Anderson, Nannette: 126 APPLETON: 138 Archie, Jerry: 100 Ardry, Darla: 100 Armstrong, Daniel: 91, 108 ARMY: 150 ARP STATE BANK: 153 Anfizo, Vincent: 116 Ates, Edward: 78, 100 Ates, Jacqueline D.: 14, 20, 60, 96A Ates, Kelvin: 19, 100 Atkins, Bobby: 116 Atkins, Delaney: 56, 100 AUSTIN MEMORlALS:150 80, 81, 21, 54, Babbitt, Julie: 92, 116 Bagley, Micheal: 60, 96A Bailey, Amy: 34, 35, 100 Bailey, Curlie: 116 Bailey, Damon: 108 INDEX BOUDREAU: 141 Cole, Cindy: 54 Bowen, James: 108 Coleman, Mich 63117 if Branscum, Amy: 108 COLLEGE B, J 1415 Brie , Debbie: 21, 64, 65, 66, 76, 86, Colley, Robe,J,Q,41'X79 5 102,108 Collins, Roririlerflm H- Britt, John: 92, 93, 96B C0lIUm,SI 1456B,141 1: Edwards, Vinny: 58, 60, 62, 96C Elder, William L.: 6,40, 101 Elliot, Nakomusz 15, 50, 117 Ellis, Cory: 117 Ellis, Felicia: 117 Emerson, Allen: 126 Emmons, Todd: 20, 80, 117 ESTHER'S:150 E.T. BARBER COLLEGE: 150 E.T. HEAD REPAIR: 141 Everett, Carley: 109 Elliston, Tim: 20, 21 , 60, 96C Everhart, Michael: 117 Everhart, Johnnie: 15,133 EYEPRO: 144 5. BRDADWAYJR.-SR.: 143 COMPU-1 A y 152 BROADWAY LIGHTING CENTER: Conley? 11, .109 152 Cookajiiamligrlizri Brooks, Barbara: 124 Coolgsg 1'AiiiQeQi'i'1i-21: 30, 46, 101 Q Brooks, Patience: C 1153 lnT101 fi Brooks, Rachel:116 Cftgg-,.-f Xael:46,109 Q Brooks, Tina: 75, 115 nala: 45, 109 Broome, Jason: 21, 108 ,gQogQgLi5ZgScott: 91, 109 1, Browder, James: 126 62, 117 Brown, Greg: 126 L, :156 Brown, Helaine: 116 Eldred: Brown, Ima: 128 Rachelle: 101 Brown, Kenton: 62, 108 Crystal: 35, 52, 53, 62, 63, 109 Brown. Lura: 128 Jodie: 19, 40, 50, 51 , 96B Brown, Robert: 108 Kandi: 13, 19, 21, 50, 51, Brown, Teresa: 955, 100 53,9513 Brumbelow, Bonnie: 3, 50, 51, Crim, Andy: 62, 91, 117 Brumbelow,Joe:19,92,93, , Crist, Michael: 96B Brumbelow, W.E.: 124 Cross, Kelly: 21, 109 Bryant, Robert: 108 Crouch, Cindy: 117 Bryner, Libby: 50, 91, 9681 Crouch, Daanh: 101 Buchanan, Joyce: 54, Budro, Dan: ,W A Bueno, Angie: 15, 50, Bueno, Corinna: 54, 1 is 'CROWN BUSINESS INTERIORS 146 CROWN SUBARU: 137 Crutcher, Timothy: 34, 62, 101 Bugh,Mike: Cgugggjfield, 20.521, 106 Burch, Sarah: 10,,Sgf,gig,45i8, sa. 59. : 54,e5,95B, :Ctir1orig,:gg.1g95gggfW Burol1,Max: Qfinni ' l15r11:i,g11:S.. ,,:: , Burnett, 7 ws-Currem 56. 59, 962 Burnley' Rod 25.1354 gpnrgezx 133 5 51g,Mg4S3h5s,5 gg, Burrell, Burrell, Burion, igjiegigirsog' Bul't0l'1.jQfjQOljjiQf sea Busbeg5:54ag3yi:126 ButchgQj5l111gQU.62, 116 K A -fa 62, 1QQ46H1:5m5' BUMQQZLBQGGV: 31093: Birffefliiodneyz 109 55. 1,--P 'JN A . 7- 5 61. fs: 5 A 'f1 -- f V '1.'T.-5.4454 2 A1329 ., 4- 2: if 5 as aa: -.44 s -Asa -1. 9. ---.1 .:. its xr: .. -:f..m1r- 2 ,1,,,1... af 5..., .4 mr . ...M ,,,w.Wi ,. 4 .5 : : 1 5 1. -- -.J-5 D.. as va 4 ously: 19, 50.51, 54, 101 11 -ar siovo: 109 , Dee ggi, Davenport PGVIU 1592 if My Davis, Arrjiy::62, 96B 5? 5,4 -1 1. 191:- :::,.L.:-Y.,s no 4 9' - 1 Fairchild, Patti: 110 Fairchild, Vicki: 110 FANTASTIC SAMS: 150 Farnsworth, Terri: 126 'i,Farrar, Chris: 101 farrell, Alicia: 102 Eate, Chris: 118 Ferguson, Belinda: 128 Ferguson, Molly: 126 Flijence, Stacey: 20, 21, 64, 65, 91 92,102 Fleming, Shawnessy: 62, 110 Flerrions, David: 96C FLo1iigERl.AND: 143 Ford, Cecil: 21, 110 Ford, Qorey: 20, 21, 110 Ford, Dessie: 21 , 92, 93, 96C Ford, Derrick: 34, 58, 102 Ford, Ouw' na: 76, 110 4-ir: --4,54 aforshaggs Blaine: 102 :war Tester, Chris: 118 Foster, Toby: 7, 20, 21, 43, 52, 96 f1Q6A,96C?f,?7 Foster, Tracy: 118 Friizell, Eddie: 102 Friziell, Jamegz 9, 118 Fhller, Kevin: QC E. 1 Gilley, Shirley: 125 g, Aubraroiignl: 102 Ford, Pat: 125 it .1 .H Q, ...as 44 . tiabbardi Sharon: Gage, Stephanie: 116 Gfage,Tog'1my: 102 Ghge, Lis2:160,96C, 195 Gaiinsnr, :21,87,11? Garcia, Jcfihnny: Galvez, Tram: 118 Gar n ,,Keith:110 Gafggiiifgliiiloel: 45, 49, seo, C.QRRE1'r's: 154 Ga1l'rett,Chrystal: 110 Eg Garrett, Jason: 11B Garrett, Lisa: 128 Q5e9e5nay:11o Gee, Kashon: 118 Gee, Kesha: 118 : Gee, Koiitti 110 152 fires, Traci: 102 2111 ffihee, ffhomasz 128 giQQQ1ll,,Adrienna: 13, 64,65, 110 ED A : 19, 20. 21, 502551, e nna 2 si B 'l ,D : 1: 100 1265 1 5 ' 'll: lo, 34. 4823 95A, Bgilgy, 45,116 5.515939525518521 12?-126-157 if 1471 0252.557 Bailey, Patricia: 55, 108 ag..-51151115-113319511111 50- 53- 55- 58- 965-1,141 Davis, Audie: 117 Bailey, Raymond: 108, 116 J5 1'Y5 45- 1,15 --' 1 Davis,DiannaiMichellel:3i?g1gy:gQQ25ga Balbas, Pete: 15, loo 10111 20- 99 91 , Davisf'Melissa: 109 Balrsr,Albar1: 115 Dawlrins,wanar:125 Baker, Len: 1 1 6 Dawson, David: 1 09 Baker, Linda: 126 Davilson, Mashelle: 1 17 g Barnett, Carla: 18, 19, 50, 51, Deap, Felisha: 75, 101 96A, 97 ggi Dean, Fernando: 43, 96C Bameff- Ffancesi 123 c 5 s SPORTING 06511 I-HCHYIHI 101 Barnett. Lisa: 54. 108 Calico, Kerry: 115 Degn. LBUSHBZ 109 Barnett, Troy: 19, 43. 100 Calico, Ricky: eo, 61, 109 DQQU1-NeqUe'a252-109 Ban: 113111 190 callihan, Ray: Dash. Ronald: Barrett, David: 80, 108 Calven Jamesiiqw fi f ' 5 Dean, Shirley: 124 Barton,Michael:38. C ba, B-,, E62 ,oo Deiefl,Sam:109 Bass, Craig: 20, 21 , Cgmgbenz 023,159 2 DeffBbach,Dan:101 B353 Tfampasf 21. 100 Campbell Michael- 62 88 100 DBfWbBCI'l. DBHICEZ 19, 21, Sales- D0119546- 1 CANDY CANE DAY CARE CENTER: 535955-112-134-140 Beal, Derrick: 20,, 147 3 2 De LQ Torre, Virginia: 117 Beckmon-,M1S112.5.Qfgw-1,05 Cano, Jos: 21, 912,955 DE'-IYQPHOTOGRAPHYI Beeler, Dana: CAPCO: 1 55 , gag Dennis, Terre: 62 3911- Carlton. Carolyn: il,8:,19.': gf! VF? gig: 362921. enge. Q, as 109 31- 109 9 qi V - 5.555.- Bange, chrl,e.5l51,-liao Carlton' HOW, 54' 55' 963 Dobbs, Gina: 18. 19.50. Benjamin 08 Carr, Sheila: 9, 1 09 233900551 TIFYI 1 17 Bennen.-5rQn3giL56. 66. 96A carlor, Tamoy: 7, 54, 57, 968 ,, !20dd..Alexr1'17 , Benngggihhgiw Carter, Tia: 117 . Domain, Daniel: 34, 35, Benn , 14, 15, 19, 50, 51, Cam,,.'wa,d:50, 88'96B DEN HILLARQ ROAD 142 calos, Dana: 101 . DOQGS Auro-sgnvlggaeeii + Bef- F V1d'45 100 Cates. Melonie:62. 63. A V 5 124 Qilligiflfarlenez 124 15675952 BAPTIST CHURCH: 148 BOOKS: 149 frm jfgoigsfieric: 115 M Earl: 108 at 4 515 55431 :Q 191515 535-if 15:2 'W 591251, Riohara: 96A David: 108 in: 05'52z:: 55Bickerdike: Melissa: 60, 100 Blackmon, Melissa: 34, 35, 62, 63, 100 Blackmon, Sherri. 50, 51, 56, 96A Blair, Kevin: 108 Chance, Kevin: 117 3, Chandonia, Richard: 109 CHAPEL HILL VET CLlNlCfij55 Chapman, Rhonda: 117 7-51, Driggers, Billy: Dudley LaTonya: 40, 50, 51, 101 DuitclQQelton: , 191, DuncaQfiQ,l3erie: 62, 109 YPUNQQYMDIQHCYI 5 ,y 137 Gilmore, Renea: 96D Charlton, John: 12, 21, 92, 93, 955, 960 139 117 Charlton, Mel: 124 17 Chastain, Amy: 21,62, 109 515: 5 t5f54,96C Chastain, Michael: 1o1 1 9.515 ,Q 12.101 z.. Chastain, Tifrany: 20, 21 54, 55, 117 ennard: 78. 79, 80 W -135497515 9 T e Gilley, Stacey: 19,50,51,102 .8 Gilliam, Kelly: 15, 20. 21, 54, 55, 9501, if Glaspie, Angie: 50, 51 , 96D, 97 - Glaspie,46,110 gi GLENWOOD BLIND 81 AWNING: 151 is Goldsberry, Winona: 124 Gonzales, Burney: 110 4 Goodrich, Rhonda: 4, 96D CHRISTIANS PHOTOGRAPHIC SUPPLIES: 154 am .. s, .sa Goodwyn, Sandra: 5, 96D Gooch,Fton:2, 106,110 Bland. Amy: 20. 21. 50. 51. 53. 100. Christopher, Andy: 80,106,117 Earle, Gary: 58, 62,101,157 GOOISDV-Kim1118 Z, , tm QMAQ Christopher, Tod: 968 Edwards, Brent: 101 32:22:11: .':5g:pi:11O02 .ay .g,.f2.,. .-.. :,C,lal4le,y-wenoy:10,1.,...a , EdwardS,Cedri'::101 - ' ft P M ' i 515 4 -it..-S ', .53 :- ff-5 '15 55: i - 5v,5'5.-- 5 sa 1 ' . , . . , .:,. , ' ,T f ' 4 A ,S 5.5 22 115 Q :5,,z535-1-3555 Lwmifkgi 115131155355 4 .-1:3f5..i3.1-1--5 1185 51154 5551125525945 , .gre QW B eguhwg aw ES .. 515691- ' iQ : 5 ,555.2 teas: 41:1- racsras-isasra 1 I f ,, X QQZEQQ5 ? fl Q N5 giggle Gra , Vicki: 2, 7, 20, 21, 43, 52, 64 Gg, 91, 96, 96A, 96D, 97 GREEN ACRES BAPTIST CHURCH: 152 Green, Kerri: 7, 8, 54, 57, 58, 96D Green, Mark: 62, 118 Green, Scotty: 9, 20, 21 , 96D Green, Sean: 62, 102 Green, Stacey: 76, 118 Green, Terri: 7, 10, 21 , 34, 62, 63 96D Green, Windy: 52, 64, 65, 118 Greer, Arthurlenez 126 Greer, George: 20, 45, 50,110 Gregory, Shelley: 50, 51 , 54, 59, 110 Griffin, Douglas: 110 Grihin, Tim: 11,21,45, 50, 102 Griffin, Lorenza: 118 Griliith, Marcus: 46, 110 Grimes, Shannon: Guidry, Michael: 45, 62, 118 Gunter, Don: 126 Guthrie, DeAndrie: 54 Hall, Leonard: 118 Hall, Patrick: 9, 106, 110 Hall, Robin: 11, 21, 40, 42, 97 HAIR-PORT: 155 Hanks, Eric: 102 Harden, Amy: 118 Harden, Kristi: 102 Hardy, Jerry: 37, 125 Hardy,Nicl11y:11B Hardwick, erry: 126 Harpe, Chris: 12, 62, 91, 96D Harpe, Greg: 102 Harper, Eric: 118 Harris, Becky: 7, 14, 60, 62, 110 53, 96D. IMAGES: 150 Ingram, Maurice: 119 Irwin, David: 45, 126 Ivy, Heath: 111 Ivey, Candy: 111 Jacobs, Barbara: 19, 75, 102 Kepler, Marleiiaz 111 Mathews, Alandusz 21, 80, 119 Kerr, Larrygg,1,19 Mayfield, Gleith: 76, 86,111 Kilgvfe-Q,1il1ti1h1,19 :E 1, Maynard, Steve: 52,9sA, 96F Killvaific 529159245-111: Mel1on,Rahia:1oa Kimbrel!i,,:1lf?j:1ZQ.21 19 Miller, Doug: Kimliclsff, 1315126 1:1 Miller,lvlandi:119 Kimm , 15119 Miller, Stephanie: 96A,119 Kinaf'v.?,Qf., t4in: 45, 102 gf Mills, Elizabeth: Jacobs, Terri: 96E Jackson , Eric: 54, 102 Kiqqiiiigyiilfilrl: 102 11, Mills, Sheddrick: ae, 111 KiIjQQlIDQ?5325 Milstead, Randall: 96, 126 102 Minter, Robben: 52, 111 ,Qty ,!9vS7Gbrbet11 111 MITCHELL DRESS SHOP: 141 - NQZKIQY. Patsy: 128 Mitchell, Willie: 80, 119 i22f222'gfgLii?1o2 119 M'HdBf1kH.Mafy250.51.119 JacksOn'J0s2ph.1,8 111 , Q1from:96E Mladenke, Michelle: 21,5o, 51,103 Jackson' Justin- 96E' . Lora: 111 M0me'0 901 Leticia Jackson' Ke11h,'119 Wendyi 119 Montelongo, Martha: 103 Jackson' Lo.Sae1h1a.53 62 9615 Terri1125 1 Moore, Daphne: 12, 20, 64, 65, 76 Jackson- Monica, 111 1 1 Ayixijfgkgkyser, Shelley: 18, 19. 50. 51, 102 111 ' Q : Moore, Eddie: 119 Jagggon, Steven. 2, 34. 58. 60. 111! Moore' 151531541 103 . 1 Moore, Vera: 8, 126 Jackson,Teddy.1343,66,102 Moore'w1111am1541119 JBCKSOTI , Timothy: 119 4.1 1 3 les, l K., o 1 1... Moreland, James: 119 Jackson,Tina:62,119 ,-'f Lacy. James: 111 . . , Jackson, Tyrone: 1 19 Langham, Jeff: 102 gxg1feEr?d15:jfr1ff1'?' 119 Jackson,Tyvian: 62,111 Lance, Kay: 62,102 M gh.'L 11,119 .laeksoh,vereile: 128 Lane,Lana:111 M1g'gS'Sgeeae,'126 Jacobs, Terry: 128 La,-11,11-10b1,,1: M bn gy -henlsz 103 J3D3k.SYdF'l6y:126 Lane, Roland:125 'S ' E21 52 53 58 75 95,1 Jaymes,Nathan:119 Lauderdale, Thurman: 54,103 Mgzlgybfmy' ' ' ' ' ' ' .lELANE's: 143 Lelalane, Steve: 45, 11111: 1 . Jenkins, Angie: 96E i,'I Lee ,Jenniterg gg.2gjgQgf51,,l1531 591 MosIex'AmhOrfy'1O3 Jenkins, soon: 119, 1 N 11, 5111141141 1 X' mg::2Yg1,,'2g':1':1Y:511226F Jankins,Sean: fiifi W. MoS1ey'gGa '111' 1111111-Tf1m11 sslr LSP? M311 11 Mosley' 120 Jenkins.Tracey: 1 Tlmqt , si Mossy1la3ce.88 103 Jerger,Jeftrey:i111,HI?i..1g3g?' w,15,.t:,,31i:.eggenz, M '11 . A1be11,7 88111 .lEHRY's CLEPS 1351575314143 is5f2r2.?51gl:Ei:i11fgf5E'ZPQwBwis, : Ump 'mt - 1 1 . 102 . G 9615 umphrey,WIred:111 Je'e'1Jenn'e-3555. eiifge- h i -54 75 86 92 THE JEWELQQQ3Q55lQ45 He,geehal:119 'SV' 519 Vn' ' ' ' Jewen' 1 all 1 1 1 Muihphrey, Giqnda: 111 JlM'S JEVtfE'llEHSg151 if ln: agggm 11: 11 - .1:,igQi?i1QffRoderick: 8, 46, 111 Mumphrey, Jody: 120 12 :es Hams, Christi: 52, 54, 62, ea, 107. JLJTFQNSMEGIONS: 156 , ee ,K l :43, ,ioa 1 - 1. H1111 M 5, ,oz :::: Je m::g1g'g'3:3::i5,i,91f1-'28195 rr . a : . he 'M' 2 '1 1 ' 1 a 15 VY A Johns9511gQryQg1.119 1 ,l1iiQgcomb,Greer.126 ,11Nurphy11Ke11,y:8811103 Harf1S.F1andy.11a Johns6m,G2hgf1le:78,79,80,96E ngckrldge. Michelle. Murpm,1K,1s11. 451154 103 Hams. 31115111130 Johnsflinilliieikterz 47,1102 lQg2ez,Cesgi?111 shy-Na1a11e,1120. HWS- 'C 'I Jol11igol:ig5h1ma:19,'5o, 51,9615 1 ney,Brgd:119 hi p ' ' . 11 Henmen.Anarea:126 .lolurigghfg fckiez 75,9615 I-LONESTAR GENERAL mipgv. ?22nP5'1g1-3g,1g654.96F HaffSf'e'd1K'mf'3196D 119 T'0N1 146 MEEZGI INCW138 Harvey, Holley: 62.118 34,5Q,96E 14,1 1::ong,Edvgin:111 Harvey, Tracey: 4, 34, 52, 62, 102 Ke,-1: 101 fgy g11141g..,gi.1,QlfQ1,,l,1 Lough,Kim:111 1 S3151 'Qe 'f1.L'33 S81 :: : 1151112113-M 2 li ay e . aye. r1son,Kln1.111 -- ,,11,:.,,.LoughmlHer1Marletle. 119 HAY ES ASSQ: 154 son, Minerva: 102 :Exist ijgeggjiyowry, Tigacl: 34, 38, 48, 54, 57, 1 5535151 :a2U:a.gaIvIf111gB gL2'g.QQ.tfij1finson. 0scar: 119 Tony: 126 ,:, Nantz,gl.D.: 12Q 1 azu a. OW: ehnsoh. Sharmea: 2o,21. 119 Rbvf 128 NHSh. awn:1113 HBZUKB. RODGHI .QQ Step hania: 75, 102 Neal, Patrick: 103 1 Hearon. Angela: 118 1 Tamalaz 52, 53, 62, flQi?j5e?gNeaI, Phenicee:50, 103 Heisler, Angela: 19,50, 51,5B, 1025 :V:,, , 119 g113g111e111'An1y: 18113131 157 Hendrix.Arlrlette:117,118,157 Johnson, Trevis:111e4,,,:1:,:i11' ,, :fQiii1:12iiQf1if?ilewmah2 G3I'yj96F Hendrix,Penny:14,60,96D Johnston,EveIyn:12fWi:i 75 i' G K 1cC1a1n'a1,em134 126 Hense, Frank: 126 Johnston, Johnny: 3g124 f mcclena 611 C5101 11,74 76 126 62,112 Henson,Brlana:118 Johnston.Randy:11 , M: C1 d 1 'M 11.2210 1.21. 1m13,11E1e11i111ey1and1,91-111a111,1141601621112 Herron,Detrick:118 Jones. Delores: 54,5 596E H M90 ef' 92 A15 1 1031 lvlighelle: 10,21,43,58,74,75, Hicks, Larry:118 Jones,Jesse:125 M?C0 !CkgwV 'a ,76 120 90,91,g92,93,96F High. Jahice:11o Jones, Johnny: 119 if Mge0 T C eff 95111: 1 Joah11:124 1 Hill,corey:15,9a,9sD Jones, Kasey: 64, 65,111 :fTijvl6Cgw!n'KQreyig 80 B8 ,:iii1i?5ii?11i'?iSN0ffe -QWGI45-95F HiIl,Darcie:119 Jones,Laura: 124 S225 52 ' '111 S2525 :::: S'iil1fiN0ffiS- l:fefb0f15124 ' - 1., ' 1 V Wiki. W 1 , 5 5 . HEiI'WfiF?ih9GE :.:i:i: JoSl?E115?iuana 'A' 20'::? '5 Linda? ZEll:,BgIE,Zf?f2 - ' -. . ' h Lirida:6o 62 103 ' ' . Hlllero, Phil. 46,111 Jones. Paul. 62.111 1,,:,e,,WCUil?U9 1 , 1 1 Nuon,Qemouiig.12o Hillard, Shannon: sqgiegiigsfea, 102 Jones,Sabrina:102 Vg, Hi eS'Ji ':102 Jomanf Meoshai 76419 rgigeenfizi 62 96F Hlnes,Ken:62, 1159, Jureskl, SharIene,13, 62, 63,102 -. .1 . 1 1 gveflefiw 1 Hobbs, Chris: Holland, Billy: 4gj1:xj11,jef Holley, Lesley:86E 1i Josserand, Emery: 12, 60, 62, JOYNER FRY: 135 - 1 Beffvr 2, 3.11. : ig? We l :sn , E--:1lZl'5Henry, Stacey: 34, 62, 63, ' Mcteean, Patricia: 126 Mctelland, Wayne: 62, 120 Odom, DeAnne: 112 Oglegby, Deanna: 76, 112 H l .c fi6f?gff19 ., , , Hglmgg. MCM11i1f1mv1 111 :,:g,f111j1ff111 1312 103 1. HoneVcunf'LW5?iii3 li MCMBMWY' l'ii o'Neeimkim?i1i '19 40 so 51 53 54 i Honn0II,2Fii'nESQ352, 106,111 KARATS BY KYSER, 154 CPNGYSQVU- ,,:, QSF1, - 1 1 1 1 1 1 . Hood Renee:21fl sa see , : , MCRBe1Tf1f'45f1fA , . 7 Hooperitiiiildiizs ' KARL SCAMERAS: 152 MCWHIQMBX gt0g135 o NQfi,G6I1OZ1112 Ho k11g,..1,11:'TT102 Keaujodyg Mmsdighhrrggxf- 51 OgJgndo,Vlckl:120 Ho?1o1111E1Gf1n?91 56 126 Kea'Kafhy:111 Magda1e11ai1,Q1H5111111111f , Patricia:12O Hu 1:11 162 Kellenberger, Jason: 102 MalQne1 1.111 'OSBURN PACKING COMPANY: 144 H 13511 111 Kelley, Cristi: 9,118 MAR Oxley, Toni:19,50, 51,91-JF, 157 10' 21. 411 491521581 Kelley, Mlschell: 102 Marler,Crlstys743155,3o31.ee 1 '11- THE OVERTON PRESS. 138 QGE1 135 Kel'9Y. Shannon: 102 1 March, Aeneal: 111 Hqgiliikenneih: 119 Ke Y- C0141 '11 March, Kenna: 75, 119 Kelly, Keri. 19, 50, 51 , 96E . , M41 1,514 Ken Laura-111 March, Kimberly. 53, 54, 62,111 Niek:1o2 KenY11 edy Kgrenm 75 102 Manin,Rosemery:125 I W, 1111: fikfgi - 1 - , 1 - .. 1 4- , ' 1, ,, ,ef ,,i11,,11 11 Q 1:11 M ' ' all g14,?5542,?w,1 :le ..1., ' ngr ig Ei'175ifts:::15Efii2lfi11:.1i . 1 . :ww 1.1 -1 Jn Bl N5 11,, if .l': 1' ::: 1 11111111111 1: 1 Nags, ,::M11y,,11v311w:4,:11,11n- ,,,1le.,,1?f ::-1 5.1, N1 1 .4 11 wwf' 1031 9755121 QW 1? ii 32514 15 M Ne, 1 wr 'W g il Y? of ,wig LX he fi.. 11 ,ml 51' U? 313358 1932 161113 1111 hi' QEQ 2,1 ew? G 151215 1,4 53' 111 ' Psi 11.11 1 . :e 1 . - 111 51111111 1155: 5' ' 1514 ' 1-4.25: . , :: .' E' -:- 'i fi 7 92: 1 , 11312, - Vgvjjf 522, : -ng Sgjggxfglg ' ,snilq www ::. Q, 1 ' 1 I Parnell, Robert: 21, 50, 80, 112 Parnell, T.K.: 19, 50, 51, 52, 103 Parrott, Cynthia: 128 Patterson, Aubrey: 120 Patterson, Dean: 120 Payne, Andy: 120 Payne, Sandy: 120 Roberson, Delores: 126 Roberson, LaQuita: 54, 104 Roberson, Shanita: 54, 104 Roberts, Tina: 62, 63, 104 Robertson, Jeanie: 54, 96G Robinson, LaSheIIie: 112 Robinson, Linda: Stanley, M f1nda:112:3 Stanley, V' 1ti:112 .-W2 Stansell 1015 Stanse 2 ,fQn: 05 '2 stark,532f'f' ls:1128 ie SYBYIQQTQPQR A fa 05 Staeigg-15,111 fe: t Walling, Janis: 125 Walls, Robert: 9, 121, 157 Walton, Tosha: 19, 50, 51, 113 Ward, Lisa: 113 Warren, Annie: 113 Warren, Keith: 60, 105 Warren, Lisa: 35, 53, 60, 62, 63, 107, 113 Perdue, Christine:12B 20glf1S0f1.f'2Q0le2 5fi.2i,2. 53.104 S e1KEQg?19,96G 51 W M 11 d 54 Perry,Bobby:112 0 riguez. rlsteor SQ 1 bby:46,112 Hffen- U' 35 Perry, Debbie: 20, 21, 40, 76, 112 Rodriguez, Keith: 112 Stgtipnsgwesley: 120 Warren, Michael: 121 Perry, Larreshag 112 Rodriguez, Juanita: 966 gg fftochellez 112 Warren, Patrick: 53, 105 Perry1Timg 103 Rodriguez, Marizelda: 104 135- V ge, John: 121,126 Warren,Tanya:113 Phelps, Reb: aa, 96F Rogers, Benjamin: 112 1, ,Teresa:11,62,63,104,105 WawfS.De0n196H Phillips,Angela: Rogers, CuIIen:104 iCk:20,21192193196G 2,1 Watk1ns,Coleen:96H Phillips, Bart: 45,103 F1091-2fS.SC0111 ..5ivSl?:?:QSt t, Andrew: 62,120 1 Watklns, Donny: 113 Phillips, Elizabeth: 112 neeesnane:2o,21,4s,5a,9sG ul, Angela: 62,120 WATSON'S TROPICAL F'5H 3' PhillipS,HUght 60,112 Rees, Elizabeth: 14, 54. 966.123 Rafe: 46, 96H if wE?RDS1.7?1260 62 113 Phil1ips,Terry:128 RON'SAUToMOTlVE3155 Debra:112 ason, IS : , , Pnllllps, Welton: Ross, E.L.: 112 Neal: 105 Watson. Traceyi 34. 50. 51- 96H Pilkinton,Teresa:46,96G ROYAL PAGODA:140 stunlrard, Shelly: 62,120 1 Weave'-Km10-21-52-53-64-65 Pinl-e, Farrell: 20, 21.50, ss, 966 RozeIle,Donna:54,58,96G srufalvanr, Patrick: 112 1 96H-142HARMACY.142 Pinke,Kathi:112 RusseIl.Aaron: 58. 966 suaaetn,Den:112 2.1 WEAV'i:1'2 I 19 34 52 62 63 9611 Pinkerton, Cris: 124 Russell,Abe:12,96G Sul5ef1Nan3541126 Webb. 'fl Y- . 19611 - r Pinkerton, Thomas: 104 Sussex, gcott1Q1202o Surber, James: 125 --1 ON, 141 Pitts, Kesha: 53, 62,120 usse , pan y: 11 , ' plunkei-t1Jeff:120 Rup9f11Sheffyg96G T 1 Welkel, Tara:13, 64, 65, 96H . R ,ed 'Sh :104 weres,Helly:6o,s2,96H P0eSch Ma'7330'46'47'104 U' ge my 1, welen,Adrlana:21,52,7s,106,113 Poeschl, Tonl. 20, 21,64, 65, 76, 120 ,11w,1Q.,,, 1 Welch D,Andrea1 9611 Pollard Gina:60 104 . 1 - - ' .' I , e gy Tabb, EIISSHZ 10, 20, 64,65,105 s Welch, Venus: 62, 63, 113 P0glfyg626ph3nI9. 7, 18. 19, 34. 50, Tabb1Mike:96H vXgweIch'V1v1an1113 Prather, Daniel: 112 Sanchez Luis. lanlgan yi 107. 113 m1Nells,T1m:196H PRECISION DRIVING: 142 - :1m1Q '- lf: , N' wells-Tlfla-62-121 6- P' ,A cl :104 ' , - fa f S- Yf K211:1Ck1201120 3.1'f1atd 1111 w tbroek. Ladonna: 54,105 Prieto,Thomasa:96G S 1 F1 gff bea-1 1 3' -s fig. : Whggt' He'Sha'1127 PRUETTS JEWELERS:140 S2011 251,15 ' Wh,,l. Jeffvr 96112 EE1?11121:'1f1l1fBQNgf:gQ13 91 103 seonivf T945 ' T?1:a, n n 1 1' , ,Q 143,21,52,64, 65 l 115 ' ' ' ' ' ' ' scnuom --,J 'lNG:135 e ergjwgarnemae, Chris: 121 et 91,912,93,121 prum Claudia. 125 Scru 551' n: 21. 43. 80. 215 - U K, h8mas, Dresdan: 121 Mi? White,J5lckilene'60, 113 - ' . ' 112 gjalQgi,.25S f ?g'i,.l?Vi.2f1:fr fiomas, Felicia: 53,105 li, 7 Whitwoegh, Donnie: 52, 58, 67, 80, 81 Pruitt, Elbert. 19, 21, 61, 62, 96G S 1 I J 1 ,,3a,,1W,.g5ie.g gn 1, pmm K11111 20 21 52 53 62 63 org gg,-fgqhnny.104,126,Weefeesie--g1.:1g1,.g,je,.g:fThomas,HeatQer,g,121 f 88,10Q113 . 6. . . . . . . 21. 1, . ,S ,H .,,,,, egg? ., 1 . A I 91.104 SCL9Ei.1?Hf'vH2 S rl-it Tnernae, Lane:::21,g1aq so, 62, 9624, S4lllgglngton.Scot1:105 '- 2 20 Seas '?Kim:20g21.64.65.1125 157 wlllrlne,.legn:121 g3:g?'LES:1r1e1g '1 43, 80, 81304 Thomalsdbuaid: wilk5,Merg41img113 pyl6S1Cynde:96G QL1111-.Tlm2111? ThomgS, Wayne: 2,4-1 7,111 -N 11,190,91. 3:3 WJ' 1lIlams,Bg.rnard:105 . .,. if-ggeaitf ,T : ,- 1 7 fig?-:-e?'f1':Tgg -51 , : Pun Pun GOLF 8' GAMES' 135 Ftggmyrnmg 04 if Tniiglsgn, Derek: Q gg?nrgE:16? 63, 105 1535512751-lARoN BAPIIST CHURCI-11145 Tn0rnpsen,Erma:112 wgugamsghrq 3233591 105 157 1,,?,1g:,,3flaw,Lambel1t:9,60,112 1 1 Thognpson,Jermalne: Q1 ! lams- 'al 1- - - .jg1Q1ygj,3-Sherrod, 5 Th mpson,LaNechia: 2.1 gg' , gglr1:11 413.11Jg3 1:gre,,1?mat13f3:5f'Shipp,Russellriff' Th mpson,Terence:53,, QW111111 5'Do11ovi1,1.113 SHOE ROOM:135 Tngrn,nienard: 54, 9614 lwllliarilsuer :1 3 SHOP'N'SAVE:154 1 T rn,snane: 9611 aw,,,ia,11sjMef,1Q,,j1 5 Short, cnaa: 47,112 if TQREKE'-D-COVUNGTO ?5w1llian51s,Me1na:1 5 RainS.OIa:125 -iii, . 1 SlQlef.M'ke1104 'gf ffiffizegl T rman, Heath: 45,113 gWilIiamp.PetuIa:1 Rajn51Tjm:112 i Silas,Garcia:118 ffEa ' ki.? -: Tlgurman,Mark: illiam5,Rober1:4 113 Ray1Andfgwg621911104 Sims, Anthony: 45,120 T MTHUMB PAGE:154 I illia .sandra:1 Ray 00,1154 55 104 ,Q- ,'.. Sim51R0nnie3hg1Q 8g,112. 5i71sgj E T mpklns, Cleo: 124 -, illiams, Sandy: 54, 7,96H Rayi0yd1GarQl-120 1251: Simmons, Be'h5!?28w106 Tm b f T Ie,Terry:121 1 illiamE,Scott:43,453,58,96H Rayf0rd,J9rryg43,96 -f' Sinclair, Boy 46,105 E1 it T nend,Chris:96H .SuSier62.12?1,a Ray,-i0r1Meti55ag1041 'f2'f'fg-5' Sinclair,Julia?96G E Ni To nsend,Sherri:121 ' SON PAINT: 9 Rayson1Gary:8o11xw1N F53 glnclairNTony:gl025 105 1 111 153 1:11nggam,Bllly2g6, 1092 RED BARN FLQWEQ . lnger, ormag: , il 3 1 1 , l IS, eneva: Rgddicll-isa: Sirls,Vlctor:10 Tra or, Tonya: 62,121 illiS.MS:I1?1 127 'kg R d d'Co y:...S1gfZ,ej'iV Sirls,Vlncent:6 ,966 ff 31: 3 Turn r, Andy: 46,105 i,?g3,0. VG' Yi Rge2g:anna:rg5?5i23f-if siesencnansefgos 1 A TYLE13 BEVERAGE: 141 1 ---- W1s0g1g1,,y1,5c1 2 QE R edu, 1 l1:Yw'1120 sKAGGs:135 TYLER NATlONALBANK: 1 'fi,L Wilsoy, ary: ,1 1 Rgedyvamgii Slinker,Janie: L'V'M' Tynerflgecky: 127 EWHSOIQ. MSHSSSZ 54. 65. 9611 REEVES s TQQANIMAL CLINIC: Slirlker.MicheIIe:96G ii., 3Wi'S0,,5-Teresa-19-105-113 156 Sloan, Eula: 125 gg Wright, Steve: 105 F1 ' h T . .11 - 1 - H 'E 1, if on 35 - Rg:ghg?g?fN :ig4p 2 sm:1n,La,::.l:14,34,112 GYMN1fg111CS.1 Angelica: 21 Fleichififil TQHVHS34-53-959 Smith-JaCkie153-966 ' KV ' 62, 104 Smith, Malte: 54, see f Y 11 Flelt 1 Q'anle:21,5e,1o4 sm1tn,Pnilena:53,54, gs ,105 11, R 3, ao, 86,104 Smith,Scot1:105 .1 figftieitht 62, 91, 104 smlln, Trey: 966, 136 ' 1 t 1 W g'Todd:120 Smith,Veronica:112 115 'Tyan ',f1' 1 Ann: 54,127 Ve 1 Yarborough,Don:127 A '15 iIlie:126 1 Sm0therrnar1,Kelle:19,105 11? EE y1feS.T8frv:11S1 Tdson,ManclI:120 Southern, Mlssy.120 V165 05 OUUQ. 1harIene.127 W, y,Micky:126 SOUTHSIDE l S. BROADN1Jlgi5ag,,wee 51, 3 ' ca: 12 541, If Young,Tlmothy:105 ..2y,.ij33g3.gK's CANDELS3142 BANK: 149 JL. .-fr y: 1,2 11,5 Youngblood, Heldil: 38, 40, 52, 5 g?Z?ig1ggS'f Sfaignfsgi Sozmaimel 105 s 11 is Yeil2ng?lgQe:10iEr:1?r?y 62 113 .T ' l : s ,R bert: 105 , 1 , . 1 : . fQEf jgi?R1p1ey' A111111 41 641 651 911 104 Sgga1ng?Mary1105 1 Yowell, Brandon: 105 5- nlpleg, Tracey: 52, sa, 62, ea, 106, Sperling, Melissa: 60,112 R' 1-WST 111 Spittler, Jodie: 120 Z Rlsflef. Cafldvr 76. 86. 120. 157 Springfield, Melanie: 13, 62, 63, 120 MT' 7 ' . .1 Square, Keysla: 21,62,120 Walker, Adrian: 19, 20, 21 86 K I!3.ig eYl??iLge-- :.,,,5l4fiQ!f1-:S0nl?'!,f?Qg:-f:, ,M :, 'Qi 1 : ' 15' 92' ZuCCa.Kevir111O5 A 1 gy r 1 :- - -T it : - A 'fli f T -- f fy as '- we 1 Ri :,11 .1 1 1 l' O FW? .Wales lem 1 . re: 1, is yigavfeglsgiwg 123119 111 3 Sf. gm l l ..:,,.,. 311.11 .... gtnglwge :,,: ..,,:. QS.,:..,. , 'Q -me 1 31545 'L Qs-s'-215, et ay- 1 2+ e W 4 V , :v1,,S:s'n-: 5 M , V- , . Wi. 1 , 1, a We 1 get as 1 , .. 1' ,V IWW,,.+-.ea-ee11113,.g1,,g,m,aaaf.,1 Eg!! KN? 'ml Y5iWzfVf.Vl.-2:5 L'VQr' M 5li :2.:l?av -fi' INS? - 15551 S ' T 'l t5:,.f V' ,yi V ii J' fl HWS .: E- -' - :leafsf,iw:.::f4iff?2sfLs!Qie3 ge fefwsiz.-wfwe el. XTEJQXEEWQ 'B' Q ,1,1,151W, . , ., v ,,.., :. :r' : . iani.:ls.' .'::.. ':fww:a?ieV rifmlvrieiielsf -' 122:11-ifh::v:eza: -.12-f -5 B ' S1 -WWE' w::: P151 3' 'l fre' 135-A: P fn ?11:u.:sY5555322513422--wr, Eiljgjg, 'L-fjZQi'j .g.gg1,:??-Q35 113 11 1 e ,. 90:31.55 1 1 .?,.1.1..,La,.?g1.: ia .iw 11 2 fig. .,w,,g,1., we ee l.-.eg New .a. .1 ff Uri? all Ainwbtf s ae . S . we f wi? fl xewwtet fs as N 'Q vi 6 Y 1 2 mi -' 2 . ff- W af ' Q E 1 r 5 A 1 I O . 3 1 1 rm 'X 4 Y , ,W in I ki ,EJ ' N,-L ny f ,, , . ,mmldea Q '- 'mm N Q 4 X N51 I , I s fm? f x . -. .id . 5 MSE. . mf.:- . , ,gig W X Q 'ng Q-if , . M Geored for the F urure The best years of your life . . . that's what they say about high school days. We hope that you get older land wiserj, while browsing through this yearbook, you'll realize they were right. We've tried to capture the best of the year. Chapel Hill is truly shifting gears - academically, socially, and athletically, A new school and stadium, the Spiritmobile donated by the Bulldog Backers, a record-setting canned food drive, Kiss the Bulldog and Nerd Day, outstanding basketball teams and high stan- dardized test scores all contributed to a new feel- ing of pride. We believe that this book reflects the best of our school and community. Thanks for sharing the good times with us.