Central Michigan University - Chippewa Yearbook (Mount Pleasant, MI)

Text from Pages 1 - 216 of the 1928 volume:

I V 1 . v A Q ..., ,.. Q. -X , , SX 1. f ,,,,,..4 rm.:--.-.,r -1-f-'--r-,.-V-..A.. .. - , 1- j 1-HRW. ,rv .1 ui f' I if A y, I dmmp-WTSm dl.,A,., b AAm M, W - A ggg ' 'lfx if v ,MZ COPYRIGHT This nineteenth volume of- THE CHIPPEWA O 4 is copyrighted. 1928, 'DY O 4 DUANE DELoAcH V Editor-in-Chief Q fi V We G4 V Is. 6,5V'61fg 26955 PRINTERS! THE GRATIOT COUNTY HERALD Ithaca., Michigan ENGRAVERS: SERVICE ENGRAVING COMPANY Detroit, Michigan BINDERS: THE BURKHARDT COMPANY Detroit, Michigan 2'-'E 'iifm nk, -5751 i. 'iy - 'fi' s. E5 7' 5 ,r, f, 1 W . ug. .11 J.. ..':' 1 I Y A gf. LI 'w T, If-r '2 -be 4 L ' I 'mr .., TW JS - fi 'r 1 Q' -. , , A :xx .14 M,,D-,1.m u a :Q-V 'AA' i 2 ,Lx A Th 1 Z 8 gwkxjl 1 5 ,TP I I j I 3 if! . if 'S 3 Q sf! N'i.,fK,,. :Y 'N.x' K W ,A T x w l ilflfh LM 'wk J ff q A A A . 1 I 3 N.,-9 . R I I JM! va - ' I is .I .. A NS - W .,- M FEE - Ill ' T I mf ll I 1 - ' . ' ts? A E. 1' -- A I wllll tw ll. T f ....- I . u ' I H . lliA'? ' Il I S ZZQJWW' 1 . - Pumv- p W . Q A A A Q X An Q x un - ' - ' i ' J ik-W W1 'ff i' A ' -V Em 1 m l ' 5 ' Wim: T A elm M ll M i' . ' 1 if SQ ' i S V v . V ',. x IIIWH - x W W L Q - in A I I Z1 IZ X , 3 4 4 Www: E5 rf? - I A 33 Q u ' ,lf , , I ' 1 5' Mix WWA K L Pi A 1 I m T KN X - g 1 X mg 4X ,qfmvn WN f A - 1 r r FQ ' 5 ' 5 X - ' 1 , A -C-'33-Z .. X - ,jl g M ' ' I 56m fm ' 4 ' - A W, f A SE sza:.:f:.,5 W M m L ,L E Q-d 5 3 EQ-mar W, -'-- iw . L1 wi -, , f ' A ill , fu I m N E H 'i W xiwn 777 f EEL- ii ' V S f S NNW w L - Q A IIIIIIHIII -I 0 I QW mu nu n W' 'B W -S 'JA Fm Q I X Q5 25:5 S T XX ev M 4 umm ..............,. ' sg IFJ- ,N Z - 4 ,I p U' g uy' - -S ' , ' A E 1 x .H'IIl,,,l1lnn mul if-. I' W , RXWXXR -, .- , Ylllllllpuu '1,, L- 7 'L , . in EE mmyrlll E fm., - An! N , - ...J-' , , I ,. mn.. .-- -, - ., V ,, iw ' , . .- n f- T4 ' . 'f, ' ? 1 5 mx Sim f . A 'T m v Tat EE mrmn mn nn - li - . - , f as r 'I W w f iimi N I Z . v ix-nu ll!! -mam Q Q fwmmmxi af 2 -' Tp was E - A -H55 A l mm V W 1 mmm 5 UM if 1 Jammu E wa 5' llfil mvafmm a f mnmmsw W - M, --M ,,.a.,-1Z'?- ,Mg ' CENTRAL STATE Timcums ccmeoe D991 IQIB if 2,i . 0 O 59 Annual Student Publlcatlon of A , ff' , CENTRAL STATE TEACHERS COLLEGE f I A M' h' 'V' Mount Pleasant - 1C lgan 0, A , QW W, EMM, ,L tm, ,W LAE, E ,E Q31 My'H-iwinnlgumnwxumw,-Ulm -aw'-NH-5 Vwsaxn-r-r-,,mf-N,-,,,.,,,,,,,,.,A,, n,,, ,, -,,m,,.,,- ,..,K.,.,,,,.,,,,.w,,,,, r,'. ,..,,....-. rf, .Q-. I' E H-F ' M A CT' my - ' u nf,-- ff 5' J f Qi' E LQ-mfiQ3a .....-,.,. f ....,-.....,,,,......... -. Y.........-f.-W.-......-,-.:z:..:-mg.-a N Dedicated to R. D. Calkins x! - 3 I-'N-.ll -fri' Y f-. ' lil A J. l fury, r fi. ....-.-,.... ,...,-..r--.n,-,...M.,,..,........,...,..r,....,,...Q:Q, 4'w-wi-Q 23'-'Jag Q T: 7 -Q-f X!'hN'x k 1 QQ? fr l ,E E il l l 2 k 5 if -Xk,x X 5? . p .1 r v N R 41+ iff - ' K . X. X 125 ,. .,,v U A LX A -. l 7 :Iles 1, l ' . Km l l Q A Tribute gm ll . ' E E Thirty-'three years of ll lg? 1 , f M teaching because he en- y X ' Q. 'i 'ah' f f' f joyed it have made R W 3 ' . ff l D Calkins a leader in I xl L Q 3 vp ,Q his field. To him, teach- lg ' F p lis k F, ing is the biggest job on f M i- f l EK egci jf b earth. For twenty-eight l years his efforts and in- j ' y lt ix fluence have contribut- y ' H ed much to Central's 'l . lg ll. progress. In his special l l lg l field of geography he is lg i nationally recognized as i H an authority. The sec- . L , gs ond . volume of The E Chippewa C1912D was 1 i l ,.:,. , dedicated to him. To- pl l p 3, day, sixteen years later, ' students .of Central re- l affirm this tribute to the teacher, R D Calkins. x, A...- s QTQ1 .M sy.. , A . -. u..........v...,.--....,.f, ..,.Y.. .... W, 4. , - - gezcfrw xassiog' Q J , - b 4 N in N1 A 9? D ' if ess 6, it-LQ-iiigig Q sxxisrg K Ri ca T T r tln lllfi i Foreword l Herewith We present i another edition of The f it 59 X 9 s ya f ' Chippewag the nine- teenth to be printed since 1910g the first to bear the proud name of Central State Teachers College. The book has changed ' in nineteen years even as the col- lege has changed. In the short space of a year since a former pub- lication - the campus and the spirit of this in- stitution have changed. We have tried to bring all the color and mem- ories of 1928 to you graphically. 1. , l l it -' A l T C'EfU'7f'Y f 8310399 NX , xx I f7f QTTQTQ-Q1 i AU Y 7' ' : 'L f-B , A I --1-D-um-1-1.x --2- J: if-1-af: -..N,m,., -.L,,,,,,,..f.-54-1+ Y WT 'NV 'fl 1 md QW i P9 THE CGLLEGEK Eg ,,, XJ ' Y ,,,:3,,,T ,.,-,,,:::.:,,.,, ,L .,.L.-..,,.. :-.v........-f.m- -.-f,---fm qw +-- -' .4--if - .-.-.--4.-W.--7-,A M--.,--F-auf ' Now.,-'Fatt I . ff: -2,35 I ,?i .' QQ''b'TQffQffi'Mif ffZif ' ' Q -- ag.C?Q-.igffvgsii 4 ,. -7 ,aug -3 gv-3r.,g,--'7-..vgJ,-visa- '. Ag 11 i ,iv-' I '11 1 1 , Q sa 'fl gllld I W W, x lm ,gg :,.,.,?,,.,,ir-..,,5x f u l, a-fe11h.lRl,,llyg:,2f1t. 1 . ,. . L... F' ,af .fl-, -'- --- T ' r .- ' ' ' ' E' - J .l' .F i ' fx - , .if - 1 . -my f-z 117, 11- lm' . ': 1- favs- 121:1 1 A N Ang? 10.1. 1,1141-.L - 1-.- mi- ,m. .Q U 57 ,ibzimpb filth. - if . - 'viii -3 U l -, lv . - V ff- W. '- :Thi , 715- -.ggi if 'W :il . - 3 ' lZ7f,i -'Z-f ' . Ll:.,,.'i:J'f - I, ' 4' . , 1 'ih ' X3 5:- j i' The Campus I In the spring, when all the walks are shaded and only the 'outlines of buildings may be seen through the trees, classes, administration, and other educational sundries fade into the background. . . . One does not forgetCentral's beautiful campus. . At an appropriate moment, when alumni gather round with those who are undergraduates here to admire and inspect the newest edifice on the campus, Central's Administration Building, we present this re- view in color of .... The Campus. A The Administration Building was completed for occupation at the end of the winter term, 1928. It stands on the site of the original structure of 1892 which was destroyed in the fire of December 7, 1925. Adjacent to it on the northwest across ad broad lawn stands the Gym- nasium. Built in the early part of the century, it surveys acres of ath- letic fields on which a thousand now instead of the hundreds of its day make games their sport. From the old Normal Woods to the far back- stops of the tennis courts, the campus has been a students' playground for more than thirty-five years. The Science Building will bear pungent memories to every co-ed and ed who sought classes there after the winter of '25, The structure was built about 1910. Why name the rooms or corners where wet slickers hung? Familiar it will ever be to Centralites. Seen through the trees, its shadowed portals suggest .... what? The girl, that prof , or only shade? The Training School whose high steps were counted soon enough when we were deemed wise enough to climb them with lesson-plans in hand seems less forbidding in the moonlight. The lights on Gover's corner creep too softly to alarm. The wide-ledged porch was never a better bench! Time was, that bench was not there and a queer-shaped cupola graced the roof's head. ' The Training School weaves its intimacy upon the Women's Dor- mitory, its neighbor. Ten o'clock and forty steps will carry a fleet couple to the Dormitory doors before they close! Pleasant memories must cling to the building for all its residents since 1923. It squats upon the campus edge like a wary matron, yet kindly too if it might repeat the many serenades sung upon its steps. Qur campus will never be forgotten. The college may mean four years work, possibly. a fine pos1t1on after Commencement is done, yet when graduates 'swing-out in June, their thoughts go back reminis- cently to .... the campus. gy Wi Administration Building Jwfsf f wQv53Q y, 1 -53 lCD4 f'lff6'Lf 'mb '- 4, -ggjig A g 4,3 ' 1QT9' A' ,J , 'w V v vs Gymnasium v 470 C23 Q Vg HQ QA? 2 v vm? fnfw., qw-1-A - 11 -- Z-U-V V-, Y ,, ---. - Q .D T- ' Qffff 1 ,gQZQQv1.,.,QQfQQ frfr Q,5'Tf? ? 'Z 11,7 fl N ,,-.M -W-, L HW fw H,......w 4LMilILL1T,gg g1g,,:,-4T,,gg,g,,Q .,, 34 , M 'wx si in ...J Training Schgol PCZQVQQ ba T., , , -- - - Y . 'W TP Kgiwlggm Science Building 211 A 'sbfvw Women's Dormitory 5 I ff . ' 'f' ff V ' f 2? -X jQ 'fb My . -Qlfsiw-f' fn . 12 ,J-.az . j J 94N Cf' 4 ' A I! CAMPUS FCJRGET-ME-NUTS? , ,f , -, u . , - 1 QW M W , K ff mow wp A 5 M130 KRcf,kfMfN?V,ffy6ij QU Y OOM, 1 5 L Wx ' J ,f 'mj JH WW? 'Aff J - 1 fi ft W x ,X 5 C - X , - gg , . 2 f AfjAWig1W7QQfgawfY'W 5 ' x- WfJjQ, M 'Zig-4 ,l A 4 - Jr ff!! , . F- X ff l f 'Aj . x-X,,f ' l -H 1 Uk rl Kfvff 'N I jff Bl!! ? M I S WG Nj 4, WS Q j M1 .wb , X x 7 ' A Z MQ WLf NW , 5 MMA Q 00 , y 4 C ff Wfijxf My M 'Wf' Mf W Q ' fxfminiggigfmg Ifwfw M 'QMIWNE M W 52' Hwffwi WVK x r s xg 6 1 5 . :WC . .01 ' JW it ilfylqiil XM! We ...X N o is ta ' 1 ,A 7 f 1 lf ff fy f fy 127' I I . . V, A' I fx R, - i C xxx in , X '.lK T lf . U ,f A gy f fl 1 z l' .fi , - - xv . JF ,V l . ni Y .L tx, Q is ff .r ,F 6. 2 'Q L.. . vl ' Vi Lg!! gd X 'Xl K , I 'Y . .ri ,i , Wk., ,. ,sf Mnlef fi! f ii if if ' C C C 'ms 4' I 9 4' f' ali' ll' ei'-f C1 h 'v jg 1 ' 1''gflgsfsfsfiziifljmjwi:'f'il1ii iZZif1iiiTi' iZfiiilLi1giTfi1Tii1i.s.'TL.ff,74'QQTTfsj . Egsicalfsp gli... so so .... is is l is 4 jf--we-hw---,'ijJj AMAA-s , N' ' iff - ii ffdi T' so o Qfi, Q , f ,f I will ff f if s f a asf, Q ix ad 1 X QI, v A . J N K5 I f 4-,fvifizffl f- I , ' ' wif t 1 I 1 .ll ' My M' f li 1 Ii iii' .ff l ' A 2 l l il I I' , l 5- - gl 1 , i' I ' A A ' lv 5 Y T T f , I ,f ' V V .L , 1 ,- il f All , ' ' l , W f ,W ,fl 5' Tifflff ' jfff. A1 it l l iw, , . , , , . ,, ,, , , ,. ,li , .i , s l , ,. ng, jgj ag:m,x-lim i gli , T 1 l Wi Mad ff ' N ' ,DIV Z I K V z jnzin . V M , . ' I iallliaill . ,a al ,m .lazl2ilflil l e ll i wi l Fi - ,. is i Z Administration ll fi ijf il!! D 0 1? qw 5 f Eg! ff YQ 'M 1 j, f ' 1 Nh?-J Q! f m X f! I vi' fi f I ' 1 N ll ff fiixiii y 0 Jixiif Iii W if 5 if N ff! , f ' f 1 f , .i , 1' . .. Q l 77 I! 6 ' out yi N f ' j Y, , ' , ,F if ll w T ,la , nj iff ,Q ' ffl gfwfwvf- fl 'V , J ll Qi H T . s l ' il . .fl All if i i 1 5, , . sl ' il. i 1 l' ' s l The Administration Passes in Refviefw ei l l f ' l X35 i ll -T-ll 1 1 ' i , L , ,iii When the student is allowed to express his thoughts freely about l ll the administration of his college, what does he say? Would he ask for , a better Prexy, a less-exacting Dean, an easier check-up of his credits? T, l l J The satisfied oaf would have nothing to say, the thinker's comment . . . ' il l l A .- . lil . ,H The administration personnel of Central State Teachers College is ,Q i 5 f, not invested only in the president, the deans, the registrar. The faculty ,, , 1 , 1 . ,g i member Who lectures for long hours may yet need to prepare his ad- fs l l E ' ministrative portion before the day is done. The Dean, after innumer- U m il X , :li i,l ' i l 5 ill able callers have streamed through the office, sighs before she turns to li T ll l lv Vi l li is her work of administration. And at that, when work has been pro- 1 vided for everyone, a few skilled pilots still are needed. 3, T 5 1 E ' 4 l K. P. Brooks and Van Lieu Minor, for the moment men and not l 3, professors, handle the destinies of countless school heads, of incoming , I l .l recruits for education, in their offices as members of the credits com- 5, I 5 mittee. The board of control of athletics, the committee inhcharge of publications, the commission seeking employment for students are like- ll l l wise teachers turned clerk for the day, to oil the wheels of the admin- T I l 1 istration. , i It is the thinking student of the Teachers College who expresses , l his appreciation to them-the other countless helpers in the adminis- , ,i tration. Growth of the college only has been made possible by hard 'g working men and women struggling for their best common interests. l l A president who has had the interests of Central students at heart ' !', . s 'gl through ten years of directing this work finds his reward not in a new 1 , desk or an easy chair, but in satisfaction of achievement. ' . , 'T 4 f O - N' 43 l l EQ Mi r .... .,,. , .,,,, s ,gr.,,,,r,r.s-.,-,,i ,.,. .... ,sys,.,m-.--M.,,,,,,,rm,miwJ iQ 1 V 'V mi 'Twin THT'Ti'rmi:R xl x 'W iki ',,,,,,,QQBN' 'VT' 'TTA' TWk ' 'i ffgi V 'V M6523 f, s s fig C. is r-i--.s--,s,-,..sl rijlsxbii E, Viyrkril Y- Q TTY, V Arima' ,YV-Y MMM-hW4LaL0-my V ,v,L,,V,Y-A Q ...rf-Y- ...V , ,, -,, ,-vm,.-i,...-,,,.,,...,..-.una , 3. , S K. si .K x N L g..i q Q X ,m E. C. WARRINER PRESIDENT Michigang A. M., Michigang M. Pd., Michigan State graduate study, Clark, Harvard, Columbia. Normal 3 rbi 1 r I mist acne W0I'4 to l0 in fl i here scho thre quir com stud yeal celt will poss ates date the i be f will I b the Q iate thal 1 and gl Off ' Spec ET214 H2111 Q ers' us' lhel maf lstr get be. K I A 0 fl Ll R long Y XM so -L l, ,. E ,. I I . CQ 5: -T K. JV? , ii 1, l li 1 li 1 V 1 r 'al lf 1, li. .1 ,l ' l 1 l v . lx nf .V Ql 'li ,ii ,mf l L , A I ir l il , W3 ll li ilk , . il nil .4 I, ,L. il il I 1 H 1 1 l. il 'S il 1 I fl l iz fl y. 1 ,l iv l i, J 4 .K 1-5, Q l l ff y, y . l . 'f Ji 1 , . -e - ,xl l li 4 . QJ .E Looking Ahead l ---gf 3 by It is better to look forward than backward. Behind us lie our , mistakes. Before us all is hope. This is the eleventh time I have pil, accepted the invitation of the editor of the Chippewa to write a fore- li' word for the annual. Instead of reviewing the past ten years, I prefer to look ahead into the next ten years. What may we hope for Central in the next decade? , Without doubt the dominating characteristic of the coming years ,lj here will be a finer spirit of scholarship. We V admit now only high ill school graduates and the life certificate course has been lengthened to three years. More and more, 'oy common consent if not by official re- quirement, the better students from high school graduating classes will lg come to Central. When a life certificate could be had by two years' Q in study, the Normal School was a short cut to a profession. The next ten lil years will see this largely changed. After 1931 no more two year life certificates will be given in Michigan. The additional year required I lj will elevate and dignify the profession of teaching as nothing else could lil possibly do. Besides, an increasing number of our Central life gradu- ates are sure to go on for the fourth year and the degree. -ll The presence on Central's campus of three hundred degree candi- 5 dates, twice as many as we have now, will make a marked difference in 'll the intellectual atmosphere of the school. Our beautiful new library will be filled more than our old one was with real students. More of them , will be here Saturday and Saturday night than now. Fewer will leave the campus for the-week end. Our courses of study will be different- gql iated more than at present and they will be arranged in sequence more W., than -now. More courses will be offered only for juniors and seniors ,,, and our Faculty will be augmented to this end. In line with the trend of teacher training everywhere we shall prepare our teachers more li specifically for their jobs. No longer will two year life- certificate pg graduates on the high school course be allowed to teach in the Kinder- I A garten and first grade. The increasing supply of applicants for teach- W, ers' certificates and the lengthened period of preparation will permit ll us both to select teachers for different sorts of positions, and to give 5 them more adequately the training they need for particular positions. Q V' In a word, as we look ahead, our big business here at Central is to make a college in fact. With the addition of our beautiful new admin- if F istration building and with the scholarly spirit always present here to- ! ii gether with the new' certificate regulations mentioned above, we shall I be able to achieve this goal fully and speedily. 1 , we 'I l il l ' ' i f f . C... ig tri, 'ffl fi-.Q l N. and K3 I 3: VJ fail'-'21 N ,TUV m,.,:., -,... .-----ju. ...-..2...-f..-, - - 4 -- --.--..f-Y - ---- -- 1 1 M gggg gggg g wg A H g M gggg ii' rig- ,A i M i .,,. i .... l 1 1 1 1 11 11 1 1 1 E 1 1 1 I 1 1 1 2 i1 1 1 -,......,g ......,..........1.-111rwwf1-H1-A-A-EAW!iff--fl '111 '11' 'E ' itti ' 33151 4315 iiim'TrMM tE --'Q-S-M--11 ll' - A e .VW . Fifi'if'p'j'fTQ5142i-Ti' t iiTLg.1 ' i 'fel vxgiixillyii, W ll rr V54 A 1.1.1.1 A --1,f1 1 We-m-km Agfa' '111 flftzf M' E E at cfc E- M -We 1,111 1 1 1 I-Q4 Q iii l 0 I 1 i 1 1 f 1 lf 1 1 QT 5 1 Q. S ' l l rv . 1 1 i I' Dean Bertha M. Ronan was director of 3 l if girls' physical education at Central in 1 lj 1910. She has acted as dean to girls of ll - Q 1 il the college for nearly ten years since f 5 that time. The Welfare of co-eds in 1 ,ll growing teachers college comes first l j ' wg . 1 , X ' her line of duty ,yet she still finds time 1 9 1 . . 1 1 ' 2 Ml to counsel organizations and serve on f l ll . . . 'f' 5 1 i W1 faculty committees. Her oiiice is a big 2 G gl unit in a smooth-Working administration l 11 machine. l 1 1 11 1 1 1 1 1 at l L 1 V l l 5 ' X1 f l F .l l 1 l nl lf 1 l 1Q1 l 1 1 31112 1 1 1 E 'S 1' 1 111 ll 1 l 1 Ml. 9 Q all 191 5 E 1l 5 1l1 f 1 1 1 1 il 5 l 1 1 1 1 1 1 vl 1 1 F ' 1 3 1 1' BERTHA M. RONAN 1 ' gf DEAN OF WOMEN 1 I Q Q11 B. S., Columbiag M. Ed., fHono1'a1'yl 1 Michigan State Normal College I 2 l 1 ! l l . 15 1 1, Dean Barnes has spent half of his if 2 l i A' eight years at Central directing and aid- l ll ing the affairs of the eds of the col- i lege. In his genial Way, he likes nothing A 1 better than something to direct. His in- i 131 terest in students as men and as teachers 5 1 is sincerely a part of him. He is five 2 feet eighteen inches of man one is not 1 1 likely to forget. A 1 gal: f 1 I oHAs. C. BARNES 1 11 REGISTRAR AND DEAN oF MEN y 1 1 1 xl 2 A. B., Central State Teachers' College. 1 1 I Graduate sway, Michigan ' 2 M A 1 li 1 M1--M-g...--.,- 1111 1 l ck gfrrrambes-M-MLB-ui..M..i.g.1Q,11.14114 an A ee as r.M---1 1 5 1 can 1'11 me-RQ-Ke 1 -E 'E a 11-fee-1.ed.41... .1 1 5 1 1 V 25 ':ly'I2 f+L--LA..-1.1. .1 . A ' --+------A-H-1.-A.-,..Ac.1,.A.,A,V,d-Y,LAN3A- APAEVJMYH' A E s W 6 l fil.1 gf . , ,,A 1 , i , A, A frm.-- 2 1 CC ' K L 1 C -I . . -. , 1--1, W 4 - gn ? ,y ,4 ., ialliizill al a ll ii Faculty . A Word About the Faculty Students who reassumed classes in the Administration Buildingin- stead of in the temporaries or the crowded Science Building did not realize what planninghad made the equipment or arrangement of their classrooms so complete. The Faculty l-Not only did they keep up regular hours of instruction, their administrative duties, their lesson plans, outside reading, and courses of study, but planned ideal homes for their classes as well. The faculty grows in ideas as well as num- bers, and spends its vacation periods in study to be able to offer new courses the following year. The complete profession of teaching, ser- iously undertaken, may well be studied in the faculty of those who' attend a teachers college. ' Eventful 1928 is told briefly in each departmental story opposite the instructors' photographs of this section. But each tells all too little or not broadly enough of the rapid strides in education being made by Central State Teachers College as a whole. Expansion of the student teaching into the public schools of Mt. Pleasant is but a small phase of the matter. A new degree under a professor's name may pass unno- ticed in the customary annals of a college year book, yet each item counts another step in progress of teaching. And after all, that's the prime purpose of this college-to train teachers. This section of' nearly eighty instructors and professors is prepared carefully, the write-ups 3 W are worth reading. ff Q l f E 4 P ivflsj l o If , fl V8 A :brig ,,..ggQ.l...-QQQQlillii...r,ri3:fg''Lic whiff'1I.QQQjw1QLQlIf,fl'f..'lfLff'.T.QQQ'.Qf.'.1Z1Zfulifui' ,hitfiiiiigiiiirff 'c'c' iic'iTf'i'gjT'cii.1m 'N'Lg QQ gall M p Sf. t .... - K .fkil-lil 91,4 lt . 71 el ' , A A ' 51 ff 3: A -' 'Mi ff My V f . .mi f,,,....-,.,,,,,,., ..,,., X g E 1 in ' 4 i J' LV' 'x,. SN- ...,-Y- .. f T I I, ff NGLISH ' 'Lfjff H-'px jgtsafiif 'i f 1 HARRY A. MILLER A. B., Michigan: A. M.,'Michigaug Grad- uate Study, Michigan Mr. Webster's successor is Mr. E. C. Beck, who will take up his duties here in the fall of 192'8. He expects to receive the doc- tor's degree this summer at Peabody College for Teachers' Nashville, Tenn. For the past four years Mr. Beck has been head of the English department at the Peru QNebraskaJ State Teachers' College. The English department occupies the east wing of the iirst floor of the Administration Building. The department has three class- rooms, two well-lighted offices with built-in shelves for a departmental library, and the student publications' office. Several changes took place in the personnel of the English department during the past year. Prof. Edward H. Webster, head of the department for three years, resigned to accept a similar position at the Montclair QN. JJ State Teachers' College. In the short time that Mr. Webster was at Central, he formed a genuine and abiding interest in its Welfare. Underlying all his teaching was the thought that his students were to be teachers. He was interested in presenting technique of teaching in such a Way that his students were able to take it with them. i MARY J. MEEK A. B., Indianag A. M. Chicago: Graduate Study, Columbia Z- f 19:1 1 3,1 J, i I -I I I AI I 'I I ny? I ,I II I I I , I I X of .I I ,Il 'II If II. I, II I I I I I I II,I III' gIII I I III Ie I , . I , I I IL III III II II I II III EI I2 II? II I .Il I II I II I II, I I I I .I I I 'I 'I I AI III II DU 3,-f ARTHUR H. RICE MRS. C. C. BARNES A. B., Central State Teachers College A. B., Central State Teachers' College HELEN 'HOTCHKISS MYRTLE ROWNTREE A. B., Oberlin,' A. M., Michigan, Graduate A. B., Umversity of Western Ontario Study, Chicago, Columbia A. M., Columbia b-. ,la sl r l l 1, ll u 1 1 l 4 ll so .M-,c.n sssr r ,,,?571!g-e-e- --WL1ingjijljjjjljgjjjfjjj11jj1j1fgjg1iQ1QTZT1'QIl1LLlfgffTLQ,EQff7lfffll.QM-.lf Uffllillg vt ' 1 so is c f'f ' ' H V H1 t- 1' f f Zffalli. Qif j,vAQQa55W,,l,.Q .,,,fe:?r.1?t,,,Wg1rffJ -,5ee,ics1e,e4ecfit1fge,f 1 4 ,ll ,Q l , as , crcc L - all V 4 fl Q, i s 5 1 -V in- s i if lw'i r I ms'If.:-' ' 'ilu' . 'Hill-ff f 1 N1 lzfgqg ,- .. 55 till' 1 Ijl.,'1' 'Wlgll if is i lfsitfr i '--1 l ' T l ,H .I 1l'j,QVIf,'r'1 - - : t A 1, If ,ill lH 'Il,1.rlP1lufm es 5 +A 'jk fm, N 'l V 'L lk E 4 fi 'VXA ' ri I l - l 'JA . i, fl, Wi rQ5, K ' Af ' l ll Each year, the art department makes V 5? . . 'li greater strides in expansion. In its new rooms ll on the second floor west, are modern tilt-top drawing tables, among other equipment, to Y, make art a real pleasure. A storeroom and files in the office for a departmental library of 'I l lo pictures adds to the facilities offered. Cork gg' ' ill L I dis la boards adorn the walls, and plate Ji' 2 lx p y 1 ll . . . . . 5, A ll glass display cases in the foyer will be utilized 5, ll l' i ll to exhibit work of classes from time to time. ll l ul Also, an art critic has been added to the faculty of the training school this year, under ,1, , l Professor Wightman's supervision. t ll l M l ELIZABETH R. WIGHTMAN ' 'Q Graduate Pratt Institute, Graduate Study, Chicago School of Applied and Normal ' Art, 'llfitlll the Bureau of University - ' if Trafvel in Italy and Franco V F . 4. f li l - . ,l f ll For the first time in three years, the art de- , lj partment is able to exhibit famous paintings 1 , 3' V and sponsor hangings of art work. Class- i, rooms of the department are constructed so l f that two of them may be thrown together for I lectures. Keeping in step with the growing M t enrollment, large classes can be accomrnodat- fl ed. The Art Club, a departmental organiza- 'i is tion, is open to all who are interested in the s 1 f l advanced study of art. i' 7 S BEss1E L GARISON l P1 att lazstztute A B Wmtlnop College Y. l sfll-A-41-3-ww, .,,,c .hw V on ..., .M Sw X C .x ,ti 0 Li 5 l.-J, , Q.-r rl 'f W- YV X v -M-5 - hawk' v --.LZ-fs,..'-L- .at-., 4 ,fm ..- .,....., .,,f..f.-..q,...c-., .,,-.Y- .-., n..,,-..-.s,.,.h.-,,,A , Y 5 'KM , V J 3 ,QSSX Q l , H15 TORY fl SUCIAL - rs -I '92 -0 he r SCIENCES if -. 1-gi-1, 5 , ' 1 A -is M or f. he - we- .. . . ,...., , 1 ... ,,,.... .. .,....L.,.. , .. , , . ,.,1.M ...... ..... 1 i- CLAUDE S. LARZELERE B. L., Michigang A. M., Harvard: M. Pd. illoiioraryj, Michigan State Normal Collcgeg Graduate Study, f Chicago, Oxford VAN LIEU MINOR A. B., Michigaug A. M., Michiganp Graduate Study, Chicago, Michigrvn, The work of the department has been much strengthened and extended by the addition of another instructor, Mr. Rolland H. Maybee. Mr. Maybee received his training in Columbia University. A third course in economics and a new course in sociology, called Social Adjustment, have been offered this year by Mr. Larzelere. Mr. Minor has given, for the first time, a course called the Founding of the Republic. The following new courses will be offered the coming year: American History and His- torians, Our American Neighbors, Nationalism, and the History of Civilization.. The following two-hour method courses will be given: History in the Elementary Grades, History in the Junior High School, History in the Senior High School, and Teaching the Social Studies. W F 1 1 w l ROLLAND H. MAYBEE A. B., Coluin,bia,- A. M., Columbia: Graduate lfVcstern. Sfatc Teachers' Collage 7' l MV f TQ: 9 ,fm cj PHYSICS CHEMISTR KENDALL P. BROOKS HEAD on DEPARTMENT A. B., Alma, A. M., Michigan: Graduate Study, Berlin Goettingen, Chicago, Wisconsin, Michigan GEORGE R. WHEELER B. S. Miclwfyan State College, Graduate Study, C0l'll'llL1?'I'lL The department of physics has again ex- panded and resumed its former area on the third floor of the Science building. The as- tronomy classes again have room in which to stretch their imaginations and the chemistry department can once more breath freely in its own choice atmosphere, unfettered by the stifling infiuence of fpure mathematics. For the first time in ten years these depart- ments can put their rooms to their intended use. This added freedom is to be used, insofar as is possible, to improve the work of the depart- ments, to 'the advantage of the students in the classes. . Much equipment has been added and many improvements can be found in the labora- tories. ' ALLAN D. WOOLEY A. B., Central State Teachers' College 1 1 1 1 I 1 I 'M VI l A V l , QW I w lf gf ily 1, U ffl fl fl ' l if lf if 1, lf, lf' lfl M! ,il l, flu ld fi ll lm M l l wg EU B ill lla if lull it up U ea wk SMX PQQU,-Q Y XX1 xx 1 1. J Y . 11, l ' lX'-7 5 .43 H5 D ik., 'Ag lb l N 'FEV ' l l 1 u ii ll 1 1. J1 lf 111 W1 Qt I. 1 ll li I: lgl Irl l all fl i l . 5. 14 1 l I 1 l 1 l il I1 1 'l l ,r .1 1 1. ll m - l l l! li li ll l l r l 1 1 1 I l r i 1? 'i I 1 1I l I l. l1 1 1 li ki p. f v i l ,Y If 1 .QL fl M4 f sf g Y if H, i 1 1 PHYSICAL -' fi A ED y CATIGN . A The aims of the Department of Physiology and Physical Education may be summarized as follows: A. To secure to specializing students 1. A broad, general college educa- tion with particular attention paid to English and science. 2. Thorough additional training in human anatomy and physiology. 3. A special training in the theory of physical education. 4. Practice in physical education ac- tivities including athletics and CHARLES F. TAMBLING A. B., Oberliug A. M., Columbiag Graduate Study, Michigan, Harvard, Chicago 5. 6. Student teaching experience. A good job Where the above training may function to ad- vantage. B. For students in general recreation. 1. To furnish the motor training needed by both young Women and young men for educational and hygienic reasons. 2. To afford the training in athletics and practice in- coaching needed by most young men graduates. 3. To help the woman grade and high school teachers to be leaders in girls' recreational activities. GRACE RYAN B. S., Michigcm State Normal Collage: Gradwcatc Study, Columbia, 9 ' fi, vec U X . -... .c . .. 'tix - . '-'-I-e- H -L , -1 e- ' . ..,..,....g..r...L ..L- - ,.. .. I - '.-fx 111 'XX 1, ,f- 1 K f 1 1 ' 1 1 1 1 X 1 ',' ', 11, I 1 1 I 1 1 fl 111 111 WALLACE C. PARKER B. P. E., S1H'7.'i'I.gff6ld,' B. S., North Carolivm State College B. S.,V Ilfllchfgcm State Normal College WI LMA SCHEARER BOURKE LODEVVYK A7l'Cllf'I.!jfl-T11 State Normal College, Wisconsin A- B-f Cfmtlal State TGGCILCTS' College: Grarluate Study, Illinois, Michigan 1 1 fx! 111 11 11 V. 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ,1 11111 111 1 .111 1 11 1 1 1 1 111 1 1 111 V 1 1 1 1 1 1 1 1 1 I 11 1 1 I 11 1 1 11 I. 11 1, 11 1 1 1 1 1 I 1 .1 111 1 11 1 ,1 11 1 11 1 1 ,1 1111 1 11. X4 1. VQYQ i Q Nx w 6 QJ! g TW QL' E5 X Mfr! f' X f Q, 1 1-7 , T' . 'g'f K 1 ' , , STEWART BUTLER IRMA A. SUNDLING IJ71i'l7lfl'SifQl of I'l2,d?.ll,'ll6L Central State fl'cachers' College RUTH WYCKOFF JA IWl'ClL1'fllL'l1,- State Normal College C,.,mg,.al Comma O T Tzu v ' f 11 ,,, , V 1, -.,., ,. ,, X., N 1 rw. 1',l-.'-- i 1 V4 I .I 47 Y- V ir V r ' 1 J l 'F' 'YW' J fcwrs .' ' 5 Q! is E S 1 I g'J 1 .i?:': 5 afflxsfggz NE: E ?v J ' igii Wwe' ll u.h..u CLEON C. RICHTMEYER A. B., Albion, Graduate Study, Chicago At the beginning of the spring term, 1928 the mathematics department moved from its cramped temporary quarters in the science building to its home in the new administration building. This suite consists of an office and two class-rooms furnished with new and up- to-date equipment. A halftime instructor was added to the de- partment this year, which permitted the in- troduction of several new courses. The new courses offered this year are: Advanced Al- gebra, Shop Mathematics, Theory of Equa- tions, and Differential Equations. A course in Plane Geometry was offered during the winter and spring terms for those who lacked entrance requirements in that subject. At least one new course, Advanced Analytic Geometry, will be introduced next year. Professor Webster H. Pearce, head of the department, is on leave of absence as he is now State Superintendent of Public Instruc- tion. During his absence Professor Cleon C. Richtmeyer is the acting head of the depart- ment. I if.. CASSIE GIBSON Cmziral State Tcacltcrs Cellcgc ROSA KINGSBURY .'l. B., Ivlichigang GrarI11atcSturly, Michigan 7 S 'lf -lin , Nil GRICULTURE A-.AB-Mai 3. .ff asia l fin' Y , V Q 4' ge 1 X Xl l Q ir ,e 1' Nh, A it I A' 3 , 1 5' , . ,I i, - 1, : ' 5 elf, !,,I- f N. , 1 ...S ,X ,. , . M , -5 :Q 'll '. ' . 2 4? -A' f Z' .. .3ffI:ig , , . W' i I igfiudh ' I . f ET: ,1 nt - --v . - A v I ,af - ' ' ,. - ' - . 1 1-7 An '- ' g 4 - il... ,A .wa - -'T,-- H m . W 2 B 7 Q i .A,, r it 1 ,, ,, l MYRON A. COBB M. S., Michigan Statc Collcgcg Graduate Study, Michigan, Iowa, Wisconsin The agricultural department aims to serve the cause of agriculture in the following Ways: first, assisting in the preparation of rural teach- ers, second, affordingan opportunity to any one who may be interested in electing one or more courses in agriculture, third, offering an oppor- tunity to any one who may care to major in the subject, possibly look- ing forward to a course in agriculture, or a boy's and girl's club Worker, extension man, science and agricultural teacher. . Constant additions are being made to our equipment. The fine rooms, apparatus, exhibits, and nearby 640 acre Indian School farm make us the best equipment of any school or college in the state, with the exception of M. S. C. Gur credits apply directly at the State College. PSYCHCDLOGY X D EDUCATIO CARL D. KILLIM B. S., North Carolina State Collegeg A. M., Teachers' College, Columbia, Graduate Study, North Carolina M' I LYDIA B. SHERRITT B. S., Columbia: A. M., Columbiag Graduate Study, Chicago ll it-J F ff: 1 il. f'Ql11:l'l , T l il' I ll ly ll 'l il.l 'illllllilul lll ,! , ' ,lllgfl so lllllHllfwlfl 'll l ,ll M tl sl 1' C iz., T l i l llllllls, ' ,l l li l ll ll ll ill l l l , f1l,, fl! l J. HAROLD POWERS B. S., Sotcthcrn California, Crane Normal l'I'LSfftlLtC' of Musicg Private Voice Wilh William Shll,CCS21CU,7'C cmd Hcrbcrt l'V'lltlLG'I'SjJ00'I?, T HE music department has as its primary purpose the development of supervisors and teachers of music. The activities cover a greater field than this, contribut- ing to professional as well as the social and artistic activities of the students. There are three glee clubs, two for women and one for men, the band, orchestra and chorus of eighty voices which appear in public on various occasions. The de- partment emphasizes its annual presentation of some popular opera. This year the famous Gilbert and Sullivan comic opera, The Mikado , was presented with a cast and chorus of fifty-five members, accompanied by the college orchestra. Several re- citals are given during the year by students in voice, piano and violin. The MacDowell club, composed of all students in the department and others chosen because of their musical interest and ability, meets bi-weekly for informal programs and ,social meetings. The three upper floors of the new tower are devoted to the music department as well as two classrooms on the second fioor. The music oflice occupies the third floor room, band and orchestra the fourth, and studios and practice rooms the fifth. With the wonderful space and equipment provided with the new building, the activities of the department have received an added impetus. iq., , 14 II 4, l in -,Mm MW--. gig gg.-W1:::ST1'T T''''x f'7m'5l33333355-fin-irlli5lf4Lf,5ili'WTI5 I A W R ,,V-F'fv. 1-'H E, C31-11Pi1'E.Wf'Am,jfjQjw m,1ffD1Q1,,.-,--W..H .11 X--..-CUM fi-Eff -I 5 R I-MTS V ' ' ' ' S S M I W1 QRS? WI 1 I ISA I I I I ew I. . I I 1 1 I, I I Vgx 1I II II I I 1 I I I I 1 I I I I I 1 I I I1 11 I I II 1I I :I 1 I I 11 I , 11' II I1 I 1 I 1 I II 1, I IE 1 II I I, 1I I III 1 IIN1 1 If I I1 I 11 I III 1 I1 II I 11 I It 1 II 1I 1I1 I I I 1 IQ I I I ai I II I If , I' 1 I 1 II I II g I1 I I1 I I I I I I f1 I .W W1 Ke. I I 1, I 'CQ I Yr? 1 I M. MARGARET PATTERSON B. M., Simpson Collegcg Graduate Study, Northwestern 1 I ALICE McINTIRE B. M., Simpson College, Graduate Study, No1'thwe.ste1'n I f, I, I II I I. 1 I pfovid mulll GERTRQD FRlI?bRIG'H I Michigan UniveI itylgsb ool 0f Musicg olyfi za JI If 1 ij ,WMAR -V.f1 - .,,:.,Sw,L,4MgTV Y 7 my I I Qi 71'-Vai-1, 'H-A H3l7?737 1 - fi -if I S141 I 'ii gg,,,4gg,:g,3,g,.lgf41iT'4'iiiiiiji Q7 ff.fP,I iQig-T-lI ,.,, I-, I I I'U H'I I If m1.IU'.aC'fI.fII it -Mm A54,MM ,,.MiMA,1 L...,,Y, ...A.,..s nd.-:LA V- I 1 f ,Q I AF I1 I I if I I II II I1 I I II, II I I II I I ' II II I 1 I IQ' Su tlon of th with ities Adm' The I adiac and 0 a0Ilie gent l'0j Whig? A 5 4 D xul! C5-il ll ll li ll ll ll lgl all ll lil rl L l l l 1 f l it l u le l ll li l 15 il li al if f I . li tl Nl li ll rl fx l ll li 'l lm 'l E l l l i 'w Q El L A if ' T --- - ' ' -- - fl Quiz Lf tl X f me l in ffm EDUCATIO Q Tj! gin? Wy Q qv MAURICE L. SMITH ' B. Pd., Kansasg B. S., Columbzag A. M., Columbiag Graduate Study, Columbia, Stanford The rural department has for its purpose the development of bet- ter school organization and procedure in rural districts, the investiga- tion of country social and educational situations, and the acquainting of the college student and faculty body with rural problems and needs. During the past year, the extension division has been combined with the rural department, thereby increasing the college's opportun- ities and efficiency in field service. Those quarters now occupied by the rural department in the new Administration Building were planned especially for the department. The suite occupies the entire north end of the west wing, is located adjacent to two entrances and an automobile driveway. Classrooms and oHflces are arranged so compactly that a unity in the work is achieved. Together with the field equipment provided, the depart- ment is placed second to none physically. A portable moving-picture projector makes possible an illustrated lecture -at any time or place which the department can reach. With the aid of a departmental or- ganization, the Kelley Club, programs of plays and music have been provided on field trips to distant rural districts this year and at com- munity gatherings. - ' -. i Qi , I ,HX ,.,,.,,.-,..,-.-..f-.---Y J- --- fd W' ' ' ' ' ' ' ' f nvTY.,,.,,,,, W, ,,,,, , ,., . ,,.,., -W7-..-N..-...-.....-...............,,, ,LN-ar, 'w Q-.. . V, V U Q 1 Hb if E- xh -1 ,t 1927-28 has been a happy and successful year for the Home Economics Department with all the others of Central State Teachers College. On our first Freshman Day, held at the be- ginning of Fall term, a goodly number chose to specialize in Home Economics. They, With the second and third year students, were proud to be the first in the fine 'rooms in the new Administration building. One of the interesting achievements of the department was the Winning of a prize by Miss Mabel Foutch, in one of Miss Larabee's Clothing classes fall term, all of Whom enter- ed a National Costume Design contest held by the Coed Dress Company. 1. ROSE J. HOGUE B. S., Michigan State Collegeg A. M., Chicago One of the eleven 'conferences called by Miss Ruth Freegard, State Supervisor of Home Economics Education was held in the depart- ment April 13 and 14. Some of the present students are planning to remain next year to finish for the B. S. degree. The growth from a two year to a three year life certificate coursexnd then a four year one for the de- gree has been rapid. The next goal is to meet the requirements for issuing Smith-Hughes certiiicates. One of these is at least six weeks residence in a home management house. Plans are under way for doing this next year. , .LOUISE LARRABEE B. S., Michigan State Collegeg A. M., Columbia V- ---- Y- ..--:.e.-sua.:-., ....-..-.-.e..f.vf.- L V - - ,.-'f' f ,. 1. .,1.,- I g J I V- ., . , 3 if img '-'-W --1 .1 . -- 1 ..,, ... ...,,,.......-.-....-..x-....., .,.. Y ,..,,........-...isa- lips yfxau-, . x iv -fr '.- QLJQXQP K i F43 tl vo, Vw 'U 5? 4 4 i M w l E S 1 2- Q K l ze 1 l i 11 a w Ld Q W :Kuhn '- .X-xi .. Ns, . . Nm i f ith? ml m f.. ,...... 4 I .0 G-1 . I. ,r -V AWA M 3.56 ',.,.,VgEb H LWNZQM- J wx v x 17 I . fi 4 X 1 DN 1 iliillw 'w 'Q I V .u.m .-I: fn' M- mv I ,A J - Q x ' g i s . lf. 1 A 1 Q' -ll 'px -1 J: H .- M ai R ' i i-I X Q. Ill il, ',f 5' 5 I A XJ If ' , l llf ' ' ' ANGIJAGES fff' f' N X -ii .if l '- ,- a ff 1- Q F , 1 M- .f f - ii' N H I 11 1 '- . mu NT, X ' lllllll lIUIIIlHlll U W mflllllll lIIl'lIIUl l Ill!lIIllMHlllIImUlllllllIilIllllllIllIlUlllllllUlll1llIllllllll1'lllllllllllfllllllll - - ' . ANNA M BARNARD A B Mzclugcm A M Columbia G1acl nate Study Marbury Berlm Rome Pans and Semlle IRMA LEFI ER Central State Teachers College Never before have so many students been enrolled in the beginning language 'courses nor has there been 'such a demand for so great a variety of courses. Because of the increased enrollment it has been necessary to seek the services of a third teacher and for two years Miss Irma Lefler has been half-time assistant in the department. For the first time in the history of the department, a course in second year Spanish has been given throughout the year i . The efficiency and possibilities of the Work in foreign languages have been greatly in creased by the added facilities of the well equipped rooms in the Administration Building and by the acquisition of a number of foreign books and pictures in the department and in the college library RACHEL LOUGHRIDGE A B lllnsl Lngmn College A M Columbza Gladzlate Study Pans H9 1 by . . ... I 1, - s 0 ,S I . . - er- . . . - by . . . . . . . ' 11 . in - A N - ' E W X , -I Y . , Y F T , w W nx l 5 u 4 , ,,,,,,Y,,,-,,f,,,,,Q,,, , r, ,, r,,, ,W M, ,, , , ,Q,,,Q,,, . , Qf , ' f' , ., , ,H , , M , , , ,, , , ' ,ww al' , g - -g fp 1hgrrrfrizfriiiinltagfwfiitffifqfmeeavwagxO- -tip VON Jtlhgff - - cnnPPBwA lang g jkya eg romana tgs.:ew.JO .Q e ef- as 1 O i -4 HAY -V A ....,. - ------1-- 5 il T T Q4 l s'lfX,ljgf'5h 44, szyfiggi ' 1 1 1 1 n ----41 I gl 1 i The commerce department occupies that T space in the new building, on the third floor, be- tween the tower and the library. The office has ample room for the desks, chairs, filing equip- ment, and other supplies which go to make up an eiiicient and attractive administrative work-shop. ' Next to this, on the east, is the room used for accounting, penmanship and other com- merce courses. It is equipped with thirty fine dark oak book-keeping desks, with, six draw- ers each. Individual keys are furnished each student. Built-in cupboards at the south side , ' i r FRANK E. ROBINSON 1 1 A. B., Central State Teachers College I' Graduate Study, Michigan - of the room furnish an excellent place for the 1 books, records and supplies of the department. Opening from the accounting room, to the east, is the typewriting and shorthand room. This is equipped with twenty-four drop head dark oak typewriting desks. Under- wood typewriters are fastened to each of these desks. Built-in cupboards, at the south 1 1 I side of this room, serve the same purpose for l the students in typewriting and shorthand, that those in the accounting room serve the i students there. An abundance of black-board 1 4 V4- l 5 135.7 space is provided in each room. i sax: i GAYNELL EMERY I it Central State Teachers College: Ferris Q Q Institute 6 Q to we 'QQ 'TTT O C f i'ii m o fjim j gg q ,...,.,, . , -..l.---.... 1-----l V t A94 1 N C C ,Q cccc -e ff' 'T . -gffQ,..- ct fl QQXQZZQQ, '73 i l fflf f ,, -A'- l , ' '- ---.-i.- i if ' 'I . '-, it ' l -TW. 1 . Assam: - '- E am if E T ' 7FeS9ii :Li 1: 5:22557 i sg, 5 .f' 5-152 s' 'Z K ' X 5 F 2 l 1 ' It E-. 1 sr., Q4 1 1 V3 . 5 sz' eff n 5 - J, lf 1 E - -1 9355's -: J , - - l OLIVER W. TROUTMAN HEAD OF DEPARTMENT Wynderse Academy, Wisconsin The new course in the manual arts depart- ment is making a desparate effort to acquaint the students with the 'proper stains and finish- es for thirty common woods used in cabinet furniture and interior finishing. Each student is equipped with two boards, each of the dif- ferent woods, making sixty odd samples with two services on each board in its most appro- priate color and finish which will mean test samples with stain, wax, fillers, oil, French polish, dull semi-gloss, and gloss in one hun- dred-sixty Variations. A special cabinet has been made in the de- partment which holds about sixty samples at a time for drying and protecting from dust. This keeps the temperature and oxygen right for drying. It is the aim of the class also to visit at least one large furniture factory in Grand Rapids to see finishing done on the commercial scale and afterwards applying this knowledge on school work. They have already studied the finishing on the furniture and wood-work in the Administration Buildingg analyzing woods as to their appropriateness to manual art work. ivli 7, 7 EINO PULKINER GEORGE DEPUY Central State Teachers Collcgc Central Sfatc Teachers College WL so or rar., ,,oo ,r-E,,rEl,,Mgr,h,,,MEM,l,r,.o,o so or 6' A ga a 5fll 'iff 5 ef! 1 ,J JILL till .. af- -Hu- ! ll ll 3. SPEECH j ws. lll 5 .Il f N . , ,, , . . V. i -- .... . -1 5 ' Blight ' 9 .:5:iZ:EiF1iF3ae?ssi1iEii !i55 A' 'hifififf -'-- 57?21u.3gg1 iiaah,,,,,.g.1 . iimljl lk 2 . Ha: f gszevaig nil.: asf- miiiw- l'.l5.F '122i: T 122252 if Film! . wat' ima i llama with iggeaew-, Ffa. ,i ' . lm. Fi 1 ii'iL51l2 gfggrl V ' lil .Faif-izsafffiaai '-'sul ---qui. . lil fl -.I l:...ll ---55. . :Blur 1 IH 1. :- 1: ::.::g:5:n.:.-'im' 1::1f.::izl azazslk slime ,, .... gem, I, E' :' .- -- 1. IRAV H. BEDDOW Ph. B., Michigang A. M., Columbia: Grad- uate Study, Michigan, Chicago, London sorts of social situations is a fundamental re- quisite. for successful, happy living. Speech training in the schools of the state culminates in the organized state-Wide high school con- tests in debating, oratory, declamation and extempore speaking. These activities create state-Wide interest and may extend to play production in the near future. The depart- ment is doing what it can to help prepare teachers for such Work. Student representatives of the department have debated during the present year with Albion, Hope, Michigan Normal, Kalamazoo and Olivet Colleges and with Notre Dame The purpose of the department is to pre- students for the Work of teaching, reading and speech. Courses are offered in the psychology and pedagogy of reading, in interpretative reading, Shakesperian reading, dramatic read- ing, play production, public speaking, speech correction, debating, and debating coaching. During the past few years, there has been a constantly increasing demand for teachers equipped for Work in these subjects. In junior and senior high schools, special teachers of speech are more and more in demand, and recently speech correction and speech impro- vement in the early and later elementary schools have been increasingly required. Rap- id, intelligent, silent reading is necessary in modern life. The ability to speak Well in all University. Faculty members have acted ex- . tensively as judges in the various kinds of contests. in ETTA M. PAULSON A. B., Western State Teachers College: Graduate Study, Chicago TX x., -N 15 QI 0 E. I '1 J1 x1 I I-,IIJI I I 1 .Ii 11 1I I 11' Ile 1I I1 I II I MI 1 I I11 IIII 111' :II III II1 1.I :II 111 III 211 III' 1I I1 II I1 1 I I II 111 If. I11 1?1 111 II II II 1 11 1. I. I1 111 I1' I'. II' III III III III III I1 1 I 1 1I II 11 I1 I1 I1 II 1 1 I1 I I I I I 1 I 1I II II .1 '1 I1 I1 I gl 11 1 I II I 1 19 II 5 A if Y ..7-W.,.-..., ..n,, ,, , W.. ,.,,,n ,, ..,. ...,-.- ,--...,,-.-,.... .1.,.,,- ..1.,.. -------- -- f------ - -Y -M 1 , 11 11 1 11 1. 11 1 I I II I 1 1 1 111 II 1 I I 1 1 I 1 U - II , 1 X 1. QI I 1 1 II I 1 - I 1I xy M V 7 l CU' I 1 N . ' , . 1 I X r .-I5 ..fl...,..- II, , 11 1 . I1 d Moving into the new library is the great If event of the year and one of the greatest events in the history of the school. We have QI, y now 18,000 books with no dead timber as they II I all have been ordered within the last two years I 1 to meet known needs. While the magazine files have many gaps, we have made a start toward a new collection and will fill in as fast Ig as possible. Many pamphlets have been cata- d loged and placed on the shelves with the books. An art collection and a file of miscel- II 1 laneous subjects have been started. 1 1 The new reading room is a joy. Its location I on the east end of the building protects the room from too great a glare of sunlight, while 'I it is beautifully lighted by the long windows ,II on three sides. The Ventilating system pro- vides an adequate supply of fresh air. Noise 'I 1 is reduced as far as possible, by the use of 1I1 non-resonant plaster and soft floor covering. The new charging desk and other furniture are 1 d specially adapted to the needs of the library. 1 I There is provision for future growth in the fg 1 I two Hoors of unfinished stacks. Altogether .1 ' ' IT the new library, to which the school has look- Q MARY E. DOW ed forward for years, is at last a reality. QI HEAD LIBIYAISLIAN . 'IQ 1 Cleveland Normal Traznzng School: Unz- II' versity of Wisconsin Library School I I 1 11 II 1 13 I 11 1 3 I 1I 1 I I I QI 1 I I ,AI f , IP:3.,,.5ZJ A. B., Central State Teachers College ELIZABETH SAXE QI 'R EUDOCIA STRATTON E Central State Teachers College 1' 1 ,Q ff? 1 I 1 1.1. 1 , , ... . ... ..-H . ..,,-.,,M,,5,:-.1-,m,1T,gms..-,,.-mr:-1-.1-Y .V .V I 1 i up v J Q THE CHIPPEWA 19201 Qi Q Q' L5 EARLY Q u FELEMENTARY pg HELEN R. EMMONS Graduate National Kindergarten and Ele- mentary Collegcg College of Education, Chicagog Chicago School of Civics and Philanthropy g Columbia T HE early elementary department has been the largest in its history, , having enrolled this year one hundred fifty-seven young Women. We are proud of this fact and hope that this Will be only a beginning towards better and finer things for-the education of young children. Some of the students this year have had two interesting exper- iences. They have visited the Merrill-Palmer Nursery School in De- troit and spent one day attending the International Kindergarten Union meeting in Grand Rapids. . The department has expanded in personnel, equipment, and quarters this past year. Our training possibilities have impressed visitors at the 553 college this year. VVe hope for more in the future. Miss Amy Wold, O lm ii H I '1 l A . 5 i nik Q 'fl l T.- F1 if -f.X' , . 2 il ll in E fl ll ll 4,-u .W , 4 it oi instructor in the department, does not have a picture at time of our Ll going to press. C551 - lv f Q-- .. ffm ff-Qlff'ff'iAQj 'M oo', eeee X ,,-,, We e--l - wweJ-WM.-6---b-M---f-M-Wfe--M--fi ol is 1019, 3 .QQ Q ?ff?ff? il ll it iiiii Ml lf ,,,..,,.f.-,Ag -,:n.,,.! B. 4 alla fm del dei Wi nat 1 ing wit Ollt top' the S l0w U! W r S fi r lf. W l l 2 I I ii Q tl l 1 l i I l f l 19 Sl 7 gi 1 '4. , :'l-E...... :irq 1' 7 ff.. 1 UTI l' 1 , v H .,-- 4 .---L -fn L -'-in V, , 15.2 r ,1 t ,1 , - E E. Fi 12 . The region in which Mount Pleasant is located is peculiarly well adapted for field Work in biology. This portion of Michigan is the zone Where both northern and southern types of animals and plants are found. Two elementary courses are offered in na- ture study. One for students planning to teach in the Elementary grades, another for those who expect to be leaders of boy and girl scout groups. A course in bird study given in the spring term is provocative of much interest. This region with its small lakes, a meandering river l MAE KROENIG WOLDT B. S., Michigan, M. S., Chicagog Graduate Study, Heidelberg, Columbia, Berlin ff, ,fl - f , , . w' ffsafiufqwil J I ,fl i,,,f J' -- aia-is and many Woods, offer unrivalled opportunity for field study of migrants and summer resi- dents. A course in field biology for advanced stu- dents stresses the relationship of plants to topography and helps in the enjoyment of the natural beauties of Michigan. The department of biology has an interest- ing and stimulating task When confronted with the problems of plant and animal study out-of-doors. This region which has a varied topography, and untouched forest areas give the opportunity of studying both upland and lowland plant associations. IRENE E. JORAE A. B., Michigan Graduate Study, California 1 l '-'fj j'f1j 'f'f 'Q,e ,QQ-QQQ1 'Qi 7 S T4-1-9Q'jijfrfx''ii:'i'lT 'j '1 'Q'5L5f'QMm'mwW'wN 71 WTWQX P 5 f2:3tP?7'tC I H13 CH W P E 'VV-A-f - .li-E'fL,-.. .....,.4llviGr. ,,.. Ml.L,.CCrtf-err-Wffwilil. ,-fe. 211.51 M----Q'-U L'-Wt 7'f riT'icixff riJ u'7M'W'-'. W i 1 - e e -t s q ajgiT'fi 1 ,Xxx-, W-AVWM A M, ,,,,,-,,, ,.,.,...-Y .H --- - - -- - '-' 1 -My X f f-:Nfl T ' A 1 9 , :,1gff1 f gf'-U - J VV! l l Yo' J A ' ' ' - 1 HY 2 5 : if - 4. :ff'vf . 1 U A j l 5,51-.L --IES- -- 3 - Tirgq' 1 'T U F-,L i 3 J, g qi uf- Y n -T' - 'un F'r!,,n ll Iurzj.. L . ,. T ' - -- W 'i' -H' T f . l GEOGRAPHY I It-5 f vi gig-1'r,, Egg.,-zfgjlf. , J I A fl - - ...ja 4 f in i X w .. J Sssfii : l ' lf 'X f -N r - Y ' Il 5-' Q 531 :YQ 1 V 1 E -X' s g...., fl X .. ' . XXX ' -4. fl lyffliff i ii 5 f i, I .Sink V ZJPT- ..,xy2l1.x fx sifting-' 1 '1 51 . ' -- - ' .51 L- fax N K lr f ' i ' f -- 'Ii-1.-4. .45 :-ei.. - : 1-1 'c - ' X X x X- p , l X K il s H Fg ' i 1 ll V3 I lk iii? il ' N The completion of the new Administration lr! building restores to the department the entire , space planned for it when the Science build- 5 D ing was built. Opportunity is thus given the it - 9 ggi department to organize into usable shape the W 5 4 ' 1 . material equipment which it possesses. Few W i 'L teachers' colleges have a better equipment for teaching geography. But material equipment is not the most important thing in a department. Geography deals with ideas. Its main business is to ex- lg plain the relationships that exist between life and natural environment. The sensing of such relationships requires much illustrative Ig material but once the relationships have been i grasped mentally they demand explanations. if , Geography, therefore, deals fundamentally i with ideas of cause and effect and its big i El ly business is to trace the events and phenomena , H El, Ti within its field backward to their causes and T 5 i R. D. CALKINS V 1 ill B. S., Chicagog M. S., Chicagog M. Pd. ,V 3 l A , ill flfonoraryl, Michigan State , , Norfmal College ' l. N' ! ei . l l forward to their consequences. The geo- l I u u 4 n s I graphic point of view 1S one that will prove M5 useful to students in after life whether they M ever teach a day of geography in the schools. M fs' Over seventy-five percent of the students 5d 4, 1' .1 gg. entering teachers' colleges have had no geo- l , graphy since they left the grades. Many of .X T Q Q them will be called upon to teach geography. i I l , 1 One cannot teach that which he does not l Q ii know. There are few subjects taught in the , l ll schools where such small investments of time 1 ,E and energy on the part of students will yield 5 flg such dividends of satisfaction to themselves 5 , Q. and prestige with superintendents and super- p :Ef Visors as will geography. V T During the three terms of the present col- i i lege year, over 680 students have been en- M rolled in the eleven different courses given b X Y 2 the department making an average of 57.2 i 1 3 students for ' gl Q each course and 31.5 students in JOSEPH P. CAREY Q, , i ,CQ-2' 1, 93.611 class. B. S., Chicagog Graduate Study, Chicago, J 5. 13231, V ' isgo Ygfi1t,,QfVasILi'ngton l if-92 ii 25141 i' 'T'fif-iill:.el--L-Qifl?il.i:4a.:..p S- gig?-,,,,,gegfa,fg4,gg,l,L.,-QS -1 girl El . r N. v Y. K .44 x-......, .xii .., .,-.-, -!,,- MMA... .....f- -- - 54 Q4 I M io al of hc roi at me ing del dol in sec DI' na DI' all Ye ele the ho .--Z ,. gm., Q I 1, 1.1 N- .. 1 H-riff , wx ' 1,1 Q.. li, Y? 1 ..,.f.l, .,. ..,1 T .Lf 1 1, V1 e 1 Qi i1 1 fi 1 i F 1 l I 15 I Ml A 1 l H I 1 k 1, 4 '11 1 . il lil 51 1 l '11 :1 11 li 11 15 1 9 ,il .v' sim ws 1 r2.f' ' l, 2 s H . ?, 't yqff X X 'i L.. :Mmm wx -1 Q 1 ig Wfffff 1 91 MTV? . , .., .....' -.W ., ..,,.... X-. ....x. ,V .. .. i za 11 1 K 1 1 it 1i 5 121 E53 E? 1 il 1 ' :lg is 1 5l 1 The women's dormitory, first of its kind in any teachersfcollege in ? Michigan, accommodates one hundred seventy-eight students. A spac- ious playroom in the basement of the building is again open to the girls li Q after its use as a temporary library for two years. The drawing rooms of the dormitory give the residents social privileges equaled in few homes. On special occasions, the dining hall is turned over into a ball- room for formal parties. ll 1 . . . . l Miss Beatrice Nelson, who I'GC61V6d her bachelor of science degree .E I at Michigan State College, succeeded Miss Gladys Hubbard as business manager of the dormitory this year. Mrs. D. U. Frear continued dur- ing the past year as social director. il i The dormitory is under student government. Officers of the resi- dence hall and the council administer the affairs of girls living in the dormitory. Bernice McLean has been president of the dormitory dur- - . . . . F ing the past year, with Dorothy Martin as vice-president, Helen Bennett, gg Q . ' lg Q secretary, and Louise Maynard, treasurer. Irene Bowden was head . . . .11 proctor. At an election held during May, the following officers were gli . . . . I named for 1928-29: Katherine Wilbur, president, June Goodell, vice- president, Virginia Bluem, secretary, and Ruth Pettit, treasurer. 1, il 1 . . . Stl New council members are Gladys Hess, Maude Coffey, Vivian Fox, E and Margy Tow. Isabel Kress acted as chairman of the council this l year. Helen Kates, Helen Smith, Betty Curtiss, and Reva Derby were . . . lr 1 elected members of the social committee for 1928-29. Evelyn Fry 1S the retiring social chairman, while Dorothy Martin, chairman of the f house committee. mqriijxl ff i l 1:??Ny ' Mb .... l '1 mm---M-em-K-ff - B - fri? ': ' ,'i'mm'WMsWnwfm i'!:' Z miuilwmi-nmzmwg Iiiyliij Firm'-'i'1i1cEn A i1 if f?Q,Q'1g'?'7'xj, '5,TiY'i5f, ,LM l,m,Mmw,,gMMMM....D ,...n..,., .... .... -...m-.DM... ..... .... - .fA.w...,.1 imwwf--1ee4'+'iJ - -. ... .. . ,. . V- . ......,....... ...,,...,,,....-, ....,....1...- .1...,-4-...,...... ...N ........L:n:f....., Q , i I i I 1 l 6 Ear, ,,..,. ,,,, - ,,,,.,..,, -...- ---- - - ' ' ' imap -F M- I I s e I E .QI II ngpsszry EEL Il i I if Q J , TRAINING SCHOOL '- FI l Ly'-tif K .I -' - . 5-.AfEi -lu: in ma 5. --- L: , 1' I III 1 ' f ' gk ' iv , fklif i lg e?ieQ fffIf?Infenf-- II I W . - -W-' -K ' , I ii S I l l l I lli IIT Il I ll ' A I.I . I . ll' I i Training School facilities for student gl: .Ii - teachers will be expanded next year into , every department of the city schools. This im- fi I VI ll 0 I portant change was decided upon by the city - f U3 o SD I1 Q.- o +-Is M Sl- C o SD Si o 5 N 5 Q- rf' 5' cu o . O S co UQ co I-Is S9 rs S r-4 rf' 24 I I I, with the consent of the State Board of Educa- , ji tion, early last spring. Within the Training II 1 , I School itself, expansion has been impossible iii . ,I ,I I il for it is crowded to capacity. One temporary Ei -1 Il , W building has been allotted to the junior high all il I i s s i , i for use as a gymnasium, while another rural ll I ,QI 1. i i I 'Q I' I I I 'I I I school has been added for students teaching gli , I I. . III on llmlted courses. I il' I I 'I I ,V 71 I'l I , . if T I PARK G. LANTZ I ,I SUPEIIINTENDENT OF TRAINING SCHOOL 5 A. B., I'ndia9w.,' A. M., Wiscoozsing Graduate i I I IQ Study, School of Columbia, il j Qi I I California ll: I .1 5 I Il . .I l I W iff ii lil lI'I It . I . . l '. I I .I For a number of years the college has felt' iii I . I .I In 'II I I: .II II II ,I In i the need of more practice teaching for stu- ll' I dents. Under the joint supervision of Su- ll 3 perintendent George Ganiard of the Mt. If Z I I Pleasant public schools and the college ad- l I ministration, many teachers in the city school ,Q , system will also be members of the college ill Ill faculty. They will further the training of jp student teachers in their classrooms. These ' j increased facilities will raise the standard of I , , , I 1 II experience for teachers graduated from Cen- if, Eli ' I I tral. The new three-year curriculum after ll ,, I.. ,I I Et 1930, together with expanded teacher-train- I I ,Is ing, will emphasize Central's slogan: We li I , 51 I make teachers who make good. il li . ll ' 1, xl 43:4 , , FA I I ' ,A , li - I I I 3 GEORGE E. GANIARD SUPERINTENDENT OF CITY ScIIooI.s il.-. I I I UI 5 1 In I Ie: .... ..... I... -..-+i..---- ...I - ,... rrsr .I I ,,,-,,Mw,M V, I, 2 , ... -..--...-,...-.-.-.f . I--f ,. Q. If-U ' X'r 1?s' A --we---I-A f --1-AQ ----ff:-M fr - - .fw,. .. ,,,,, ,V V ,,,,.,,,,m,,,,,.,,,,,, l Af,,..,,,. vm .Rah pg' I ,,u2,' .A LQ Iflf' I 1 I I I,I:'I'y-I'.IUI: ml QQ If Cmziflf K ,N N M' I . .... -.....m.... ..,.. .-... ...,. aww, ,.,,.M, ..,.,,e,,.--..-Qii':. LE-i'i 'f 'F1 If Uppiy I I i l l I l ii I Z rw A 54 0 Il A. l 1 1 1 ..,,...-,..,.,....,-.,...-.......-..l..... ..,.,. . .Y,Y, -W --.. .,.,. W., ,..A. , ,,,. I, 4 .- , fy... . .Y ,f,:, ,-e,I .,,. -...... ,. ,. ...,.-... . I 4... ,..... Nm., ,,.. ..- ..- ., - ,-- -My 1eM,,,-h,,,,.. A,,,..,,....,.,....-.gA-.-W.-fTf- q,:.0f.x1. J f, fP-m-----Y1---.--f-.P-.-..-.-....--.v..,.............-, ..,,,.7.,,,,.,,,,,,,,,,-Aw,-,,m,,,,A-,, H W' N -A-mv , -A V b E V 1. sf fA-l1Mu.f,af 1 . qw -Q , , T A, 3. , , K , 11-.. xi Q--...W A xh, --.,,,--1?iiii'Q..i1l.....,w-,.I..11.?Tf5?....-if H1Ei1'f1.YY.ff:,.,-,,Ei?,+E- Y,, ,Nfl wi 11 1- aa I' 'm'd'M'I t 'A V 'M '+ --R:-V --MEN -- - H-We -'R - 1 1 1 1 1 Q. 1 1 1 1 1 1 1 1111 111 1 11 1 1 11 11, 1 1 1 1 R , 1 . 1 11 1 , X 1, 1 111 1 1 1 Q1 1 2 1 1 1 1 1 ' MARGARET KOOPMAN Q ' ' 1 PRINCIPAL JUNIOR HIGII ITTLORENISE MEYER 1 A. B., Central State Teachers College' , .- UNIOR IGH RI,TIC , 1 Graduate Study, Columbia fl- B., Gvwmell Gvaduate Study 1 1 11 1 1 1 1 , 1 1 111 1 1 1 ' 1 1 1 1 L 1 1 1 1 I 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11 114 11 1 1 1 1 1 1 1 1 . 1 f if D A HEILBRONN - E N C RAY SUGARS 11 1 SIXTH GRADE RHIC FIFTH GRADE CRITIC 1 11 ' A- B-, Central Slate Teachers College: A. B., Central Slate Teaehers College: ,931 5 A. M., Columbiag Graduate Study, Chicago A- M-I Celumbla .54 y'fe . 1, If 1 1,5151 1-, ,.,. I ,,, , I b I I .... I I e . Wee..-W-ee e .Lfxkxfuf 1-1'k'f'f --f-, f'I - ' 'n ''Mn':W' 'L bn H WYv,Ym,v-'Qc'---VYTYW--K'-J--I :T-'WEN-M-47-W-JA--Wx-vnu---1 11 , -W-MQ QI iQ'Cf-X15-, lm,'p N. 1'.x1:1-1 11'111:'1'1-11'1x'11L , I 11 1 UFMLCQK-f'1!i? ----W-1 e 4-e e ,gif-'vggfiiwff M 'Qi7f'i 'N 'd'M'M'i'Q1I. f1f 1 i::Q1.iTlr.g I ,ff J I X-C r ELIZABETH BYERLY FOURTH GRADE CRITIC B. S., Kansas State Teachers Colhzgeg A. M., Columbia EBBA WAHLSTROM 'I'x-HRD GRADE CRITR: B. S., Mivmesota C E MAYME V. SMITH ' Slcvown GRADE CRl'rxc Ph. B., Chicago Stale T LILY A. ENGELSEN FIRST GRADE CR1'rIc caclzurs College, Wiv1,o11a, IL4i'lI.'ll.: Ph. H., Chicago 1' J .1 If A QU W V45 Qu , i I 1 I 1 , , I Q, W If N ,, Af 31 N 11 W .4 1! , X, , , , ,, ,, A I V 1 X, li U V3 ' N , , If II Ph. I F IJ U f if P '1 1 N I 1 w, wi wi 1 1 I Q fs O5 1 1 I 1 Lg 7 B' G23 hw I FRANCES HARRIS CIIITIC CEN'rR,x1. SCHOOL Ph. B., Chicagog Graduate Study, Chicago, C0lumb1'a 7 1 N IVIINNIE ROSEBERRY CICITIC F.fxNCmm SCIIOOL B. S., Kansas State Teachers Collegeg Graduate Study, Columbia MARY MCGUIRE CRITIC FANOHER SCHOOL xl. B., Central State Teaclwrs College HELEN L. JOHNSON Cmwlc FANC1-Ilan SOI-1001, fl. B., Central SLate Teachers College H j ' 1' Mil 5 i7l1'l'Y-HVZY111 PV it 1 7 3' , t, , 1 1,,,,,,AM H , Y , ,EA Y, ,,,,.m,,,, ..A, , Y, .wx A ,,.,,.,.,,... A Y Y ...A-4-f..u----A-Q-----M.,.uf.....-,..-..-....-..,.f.,..,.4 ...NM -.-'-.-- 'J 7 ll l l l, R li ll l 1 . 1 U 's .vox 1 l l sl z k ll in fl fi gi ,V 1 1 1 fi lu I ,Z I s I i S C gg ee ffnf:::'i'rfofc piffgiiiiiif C7C-a5l'i4?f ld QITNXYOW P- V R as R defer Tin: cH1PPEV'Q52 , l92s6m, isQX51e2vs m.!e kmrQnKa,Qf!1 QAQAO1 jAL-..- t a ai4seg,,Zignf-eeeew-me A' H an RW- A R R ,Egg t 4a RR get Q4 . ef L lT I 'SJ V53 W ,gjiy l I i a ll i E R 4 5 1 P Z 1 L 1 5 l l 5 Qi l lf ll E' i p it E Q i 3 R lx GEORGE HALZHAUSER LELA FUNK ' in Cnmc RURAL SCHOOL ART CRITIC n . VP Central State Teachers College Illinois State Normal Umverszty 33 i , 2 ' il , EI I l ll i l l ' 1 l no A l A in -l 5' E 1 ' b ll 1 . 1 Q gg! L The following critics and instructors in the Training School did not , , . . i . 55 Wg turn in photographs to the Chippewa before date of publication. Their EM 9 la 1 gig names belong in this department and are listed below: I ll? lil l l ill V2 4 l Q l all c lt ld, Amy Wold ....... ....... K indergarten Critic 1 li . V 2 ig . . . X A1106 FGFHOW ........ ......... C r1t1c Rural School R 44 ' E Ruth LEUTIOS .................. ......... C ritic Rural School 1 5 ' I i i 1 D x E A111121 E- Lawrence ........ ........... C r1t1c Central School gil l i lg H : Anna Kelley --------- ....... C ritic Opportunity Room E , ll l TJ -.-------- -----'- C .CCQV-,l 1 i ' 1 , 5. s,,,-3 ,fi i 1 i, A W fp J I rift ' Q I 'fl l ff 1 'iii' l if JJ i if,,j'i - ----i......,,-f,.,- .,,-,,--m- 3154 I I ij- ye .fem-A----,, Vw-f 1--12Z?ill.ilZIi.1 igi1:g33iggg to M' A as seeeel' www-W--we -- e-eA M--f-R-Ma' A1 S I 1 if! ,exft ' xv 1, N - ' '----N---Mvw-A-Q-W ---..-.H ,,,,..,.x.....,.a..,,.,.,.,,,,,.i...,.,..,..t-----,-me sf--U'-',, TZ,-,Q X, Tfyfn 1 if---V-!5'!Q-N.-Ffa l'.M,l-I vosrl' -' A zu 'V 3 ,' QU J' ft 2 -0- A-w---f- 3----.......,....--.,.....,g--,W...,,q,,,,mWMwt ,wwf ' 5 f Xqxwrbx -1,4 f,,,,,, ,Y Y W Y, . ,, - Y :T-, ,YYV , Y Y SQNJYT: ,mms-mvj-w ' W' f-- ---Q-Y--v-Q-e--2---...-mv.-neg WA.. . ,,,.,.,,,,.,,,...,-..... ..Y............f-...-.-.------' X-- ' ' ,fm . E I l .3352 A M 59 I 5 F Y x X 1 l W s . w 3 L 1 1 ii 'i l I n 1 Q -1 nu., , , KU A ff E, N--K. f-ffm 'x 1 3 . v . . 5 J Y I -, . ...,. .- n.Y. ,...., . NT,........w....-.,--,--.- .,.Q --..,-... Y. , Y, . ,,.., W AA,, ,A,,, ,,,m,, , Y,,, ,,,,,m,M W-mn,-wjqfi -if 5,1 f ' ' 'X X Q 3 ,f ,X XX f-. N.. W- rw f.. ,, ,f 1 L 'aa V, 3 n X 1 5 f 1 I u P l V 1 x ' f A ,,,4'f I 1.,f'I1'GLv If 'U J ,-f k ffggx gi 115 ff Ufiaij 1 VW! -I FQ , I D, ,I THE CLASSES! pill V+ ,, - -M-New 4--Q ffk- W- M M 'iigQ1Qi3i1iQ' 1iilT'fj Zi1iifWQiiQ. 95 Q, gm S-KW - w- W- uj ' ,.,,A.- .1 A. .. - - ' -W. Q.-4 . 4' X. ij' ' - ' , Q e yfcff. fu . ul-J! If--,Xl ZQQQE A ee H fi., v i f ci' 49 'r' iJmfviii c'1c.i.i..'?j.'.l:imiii.i--ih..-5it1 If 4 c c fa I fg X, QJQQWLJC' 'il pf x f L, , J ill .. 1 ' -1,-AJ -..v TT? . ,gl 5 I fl 'l ll lg 3 1 l l y, . - . 1 1 .1 gi ll L, w l l 1 1 V 'l 3! 'I 1, yi l 1 ,I I I is Q I 1 l .il , 4-sal A n Central's Classes---In Retrospect 5 , -'-- ' Classes-that magical word! Classes that entered the institution ll' at a tender age and wore green pots or not, as the worthy sopho- il! mores happened to decide, are pictured first in this section, now wear- ing the caps and gowns that are the venerated costume of seniors. The others follow through a four-year curriculum that has existed at Central 4 for nine years at this date, ' No foreword, class history, or other chronicle of events would completely calendar the various activities of the classes. Seniors revel gil in their swing-out in June, Juniors make much ado about nothing, knowing that in their fourth year they will be expected to graduate H l and activities cut down the mighty honor points 3 Sophomores get into 5 brawls with freshmen but otherwise live respectable lives, while the freshman, hazed from his first entrance into college, gets down to busi- lil ness and studies, gets out for athletics and 'earns a numeral, or unob- trusively quits the long first year before three terms are over. 5 Classes used to be not classes at all, but rather, students grouped ll? together as a class because they were enrolled on a particular course at Central. Since outgrowing the established Normal tradition, organized t' - classes have attained a rank which defers only to their number of ll years' service to the college, or as a wit would have it, how much of , I their four years' loaf they'd eaten. I ,i , . During their college residence, individual members of classes ach1eve.material honors, we have only been able to present this phase, l of activity as students themselves would cooperate with the all-student annual in prov1d1ng pictures and information. The classes are the rf, 1 spirit of Central. For them, this book was printed. To them belongs ll n the success of this publication-Here they are! iii Q F fi' l L, is LA il Q3 fm D i LQQW- avg? 111' . gp g , .... - -.c.f.mn. . , C M .. i S11 - it 1 ee SENICRS LOTTIE M. EVERDEN - - Owosso BACHELOR OF ARTS-JUNE, 1928 Cliophiles, Vice-President 1928 Senior Class, Treasurer 1928 Warriner Literary Society Women's League Y. W. C. A. GERALD REINSMITH - - Sheridan BACHELOR OF ARTS-JUNE, 1928 Le Cercle Francais - Y. M. C. A. AMOS BUTLER - 1- - Lowell BACHELOR OF ARTS-J UNE, 1928 Baseball 1925-1927-1928 Cliophiles 1927 AUDREY E. WILLE - - Mt. Pleasant BACHELOR OF AIETS-AULiUS'l', 1928 Cliophiles, Secretary 1924 -1925-1926-1927-1928 W0nLen's League, President 1925-1926 Ronan Round Table 1921,-1925-1926 CHIPPEWA Board 1925-1926, Y. W. C. A. 1925-1926 O LIFE Staff 1925-1926 OAKLEY W. BEST - - - Elwen BACHELOR OF ARTS-MARCH, 1928 Debating RALPH B. BAKER - - - Ovid BACHELOR OE ARTS-JUNE, 1928 Football 1922 LYMAN L. COREY - - - Evart BACHELOR OF AIi'l'S-JUNE, 1928 ' n Chorus DONALD F. WILSON - - Sheridan BACHELOR OF ARTS-DECEMBER, 1927 Cliophiles, Secretary 1927 Student Council 1928 LIFE .Staff Kelley Club IRMA LEFLER ' - - - ' Greenville BACHELOR OF ARTS-AUGUST, 1928 Women's League Board, Vice-President 1927-1928 Y. W. C. A. Cabinet 1927-1.928 Warriner Literary Society Le Cercle Francais EDNA M. GRAY - - Traverse City BACHELOR or ARTS-DECEMBER. 1927 Cliophvles, President 1925-1926 Tri-County Collegiate Central Triangle 4- '-A B' T 'lN '4T'1'F'vfflg MB H Y' ' ' 7 f ff-- - 1 Q 'Q'g'L.., -' 1573.1- 2 V965 J Q gang THE amp-Ewa WlLQZ3y 1- 11231211 to A ee A A . 1 . . A -A A - A O 4 K y 4-' FRANCES JACKSON - - - Clare ' BACHELOR 0F SCIENCE-AUGUST, 1928 V QJ ' Rachel Tate Literary Society 1927-1928 Q? f' Philharmonic Glee Club 1927-1928 li MacDowell Club 1927-1928 l 1 1928 CHIPPEWA Board fit Mercier 1927-1928 lt Mikado Mj Chorus GLENN P. MACDONALD - - Muskegon 1 BACHELOR Oli' ARTS-DECEMBER, 1928 1 ,if 1 Sports Editor LIFE 1923 ll' Baseball 1922-1923-1928 lt Varsity Club 1922-1923 ' Y. M. C. A. 1922-1923 U Basketball 1922-1923 1' Football 1921-11122 M l M JOSEPHINE BURDICK - - Shepherd - BACHELOR OF ARTS-JUNI5, 1928 l Lucy A. Sloan Literary Society 1927-1928 V4 ,lg MARY LENORE BANTON - Carson City Q3 l R 1 BACHELOR OF SCIENCE-MARCH, 1929 ,H Philharmonic Glee Club 1926-1927-1928 l Triangle Club, Vice-President 1928 Chorus 1926-1927-1928 l MacDowell Club 5Q Orchestra 1928 Il W , Mikado f PAUL WEATHERHEAD - - Hal'l'isOl'l ' BACHELOR OF ARTS-JUNE, 1928 4 I l LILTJIAN MORFORD - - - Tustin 1 BACHELOR OF ARTS-AUGUST, 1928 Philharmonic Glee Club 1926-1927-1928 , Central Triangle, President 1928 MacDowell, Secretary 1927-1928 - 1 Orchestra 1926-1927-1928 l, , Mikado p ll JAKE K. BURNHAM - - Mt. Pleasant V BACHELOR OF SCIENCE-AUGUST, 1928 1' l Men's Glee Club 1923-1924 1 l X Football 1923-1924-1927 V 1 3 Varsity Club 1927-1928 1 T1-ack 1923-1921,-1928 1 1 Student Council 1924 l ll ll t I l f MELVIN J. LEWIS - - - Lowell ll 1 1 BACHELOR OF SCIENCE-JUNE, 1928 A 1 Varsity Baseball 1927-1928 ll , I 1 ,l l ,Q ll J ,N M N l ll 1 'WILLIAM D. HOLCOMB - Mt. Pleasant , ll i BACHELOR-OF ARTS-MARCH, 1928 l V 1 l :Xa 1 5 , V- CASSIE D. GIBSON - - Mi. Pleasant - A BACHELOR OF ARTS-AUGUST, 1928 l 1 f f Ronan Round Table X . ,L I 5 'gil - .. . 1 YY +23 O -- Y- ,,,L,,, M ff ifrw' ff'fi'fiW in -- ----- - - -Ze ---N - - - fi-L' W ff L amp NL j FQ-6-Q, - 'Y -- - - - f - AV HSQQLYL 11,171.7 A ,Q in QYUVA W all-' ' ' '-------- - ---,- 1, . . 1 17 , W- W Y A M :mf--V YM ,fl A l 9 W Q. sf E N ,G '. '1 , ,,, 11 II , fr. l 'I .ll A ix' ' L l l u ,ll lil f' ll .51 iv Q 1 1, ,l w I 1. il ll R., lil jr 1 A ,K R V I V 14 M. .g:1i.g....gLjm? t.L.-..1,..4.l..g.g.gT. iORgg.-.tg'-5.f.g gif 1 :ggg:.g.g1g:.1.L'1f:gygQpg1'1.Rfi1:f5:Li.. R 'iifgfjfigffq O 1 .-..--D.l..-..fo1QR-3, ,,,, Y Y ,,,,, F, . ,.,. L Wi .,1f,,-111.-, H ,..f.,,-.1 1 .,,,, .-AL- .11 V.- .- Me- --- - f f- - A-. 1:-1-lu.L.1:7--W-T1?-,::rf-----f-he--A A----F?-A I? H ' 1 A F Q l i J 4 , J A if 1-jf' Q JACK CLINE - - - C1-osweu L. , BACHELOR OF SCIENCE-JUNE, 1928 Y. M. C. A., President 1924-1.925-1927-1928 'H Football 1923-1924-1926-1927 if A i Q Varsity 1921,-1.925-1927-1928 if ? if Trask 1924-1925-1927-1928 X 5 Senate 1928 ' CHESTER R. STACKHOUSE - Ashland, Ohio 1 BACHELOR OF SCIENCE-DECEMBER, 1928 U ll sl Sports Editor LIFE 1928 fl CHIPPEWA Board 1928 fi I Basketball 1928 1 Q Football 1927 HOWARD R. WOODRUFF .- Vicksburg D W iff, BACHELOR OF SCIENCE-AUGUST, 1928 i A Men's Glee Club 1925-1926-1927-1:-ms get , ' li xjla MacDowell Club 1925-1926-1927-1928 ' P , U Senate, T'reasurer1927-1928 R Tennis 1927 i A il li iff EINO PULKINER - - Negaunoe jj A BACHELOR OF SCIENCE-JUNE, 1929 ll . Varsity Club 1926-1927-1923 A lll Baseball 1926-1927-192.9 lil Basketball 1927-.mes ill i H . ! E E5 1 gig THOS. MCCONNELL - - Rosebush 1, A BACHELOR OF SCIENCE-AUGUST, 1928 1 Mercier Club 1925-1926-1927-1928 M A ill V . 4, 55 El 1 195 HILDA HILL - - - Mt. Pleasant H BACHELOR OF SCIENCE-JUNE, 1928 4 ' l. 1 il 1 l 2 ig . . 1 fl 2 FRANK B. GARDNER - - Osoode BACHELOR OF ARTS-JUNE, 1928 V 1 In Senior Class, Vice-President xi i 3 Student Council ? QE Cliophiles , ,i Forum E . ll l 1 DOROTHY WILSON - - vestabm-g A 1 '2 BACHELOR OF ARTS--JUNE, 1928 Q .V Le Cercle Francais . 21 Q Womenfs League xl Y. W. C. A. R A 1 i il V EVA HICBEE ' - '- - - Ionia A ' BACHELOR OF ARTS-JUNE, 1928 il . fl Kelley Club 33 i ROLAND E. BELLINGER - Bay Citi BACHELOR OF ARTS-JUNE, 1928 ,Z LIFE Staff A Orchestra ggjm Band ' . ,S ll l W K M3 A B K WD ,IX iss 1-Q U. 3, .595 5. -ra. l - 1 - O bil fr 9 is L f A AMW C .L ,Ma-.,L,L,aa.....aEL-A------W --ft-- at '1'C 'A i'1u 'M '1 Nl, 1 5. , ,Q - ' Q .f- 'V'-fn Fa. 1 ,V H, t 1 r 1 Z Wu 4 1 1 1 1, M- A- 1 --a- - -8- - A We C 1 4' fa 21 .Qt N. QQ- fzf P 34 jfJfJJtlE1'5?l?5fJfL E3 A .mia ,. ,C ,.- I 3 'Ui .. 4..n . . '. ., -. ,., .. , . - at l E .ti H ' 4 4 ' 1 i 'Al l ' 1 ' 11 1 2 1 y --A,,. - . g ttf 1 CECILE REUSCH - - Mt. Pleasant t, Q 3 Q 1 tg' .7 BACHELOR OF ARTS-JUNE, 1928 I ' . 1 i i if 3 y HELEN E. ESTEE - - Shepherd ' BACHELOR OF ARTS-JUNE, 1928 ' 1 Q Warriner Literary Society Wo'men's League ' Ff Cliophiles t , L 1 J ISABELLA BURCH - - Mt. Pleasant if Q ? BACHELOR OF ARTS-MARCH, 1928 1 Lucy A. Sloan Literary Society, President 1926 I t E 9 2 GEORGE F. DEPUY - - Mt. Pleasant 1 ' BACHELOR OF SCIENCE-J UNE, 1928 ' Senior Class, President 1.928 , ' l FRANK H. LEWIS - - Mt. Pleasant . BACHELOR OF ARTS'-JUNE, 1928 Student Council 1925-1926-1927-1928 , Y. M. C. A., Vice-President 1927 Junior Class President 1.927 Forum, President 1925 1 f 1 A E EDA DEXTER - Q - - Mt. Pleasant ' BACHELOR ARTS-JUNE,-1-928f 'Qfmwf' i j JOSIE SW RTHOUT HATCHEW - Stanton f 1 Bx ELOR OF ARTS-AUGUST, 1928 s EYQL. DISBROW - - Manton BACHELOR OF ARTS--AUGUST, 1928 1 f, , S Forum, President 1926 Debating' X 1 Band lf . 'DX' l E HARVEY THOMPSON - - Corunna BACHELOR OF ARTS1JUNE, 1928 1 f ' Le Cerele Francais, Secretary 1924-1925 A Y. M. C. A., Vice-President 1924-1925 Senate, Secretary 1927-1928 f Cheer Leader Chorus DORA SILVER - - - Lakeview MUSIC LIFE-JUNE, 1928 W0m.cn's League, President 1927-1928 ' i Warriner Literary Society 4 N Student Council f MacDo1vell Club Q 1 i H , A i Q ' ' 1' ' 1 r -l 1 11,111 ix-'g y.1vfg1mgg iw -1 . if 1 O Q 1 1 4 . 1 1 11 1 I 1 C R , A I 1 . If 5.,.fl,lw. 1 - A,.A .... ,wxlhis--.,JQ1Q?4..Q'ga! 1 X ff f--R ----A- V 4+ -A el: ff fi ,f-'.f- . ' R - 4- ---- 2 I 11,21 jk 1 195 3 1 1IyC1j' 5 , ' L I1 1 11 Y 1 l 1 IUNIORS 551,31 1, IVAN D. COLE - - Mn. Pleasant 111 1' DEGREE COURSE-MARCH, 1929 V Junior Class, Vice-President 1928 1'1 1 I 11 ' CARRIE TROMBLEY ' - - Saginavf f 1 HIGH SCHOOL LIFE-MAIRCI-I, 1928 , 1 So This Is London 1 Le Cercle Francais fi Cliophiles '! 41 1 DOROTHY SWIFT ---- Edmoe-O .'1 2 DEGREE COURSE-JUNE, 1929 jf? 1 11 1 I 1 ARTHUR THOMPSON - - C01-uma j1 1 DEGREE COURSE-JUNE, 1929 jli 1 Student Council, Treasurer 1.928 rl A' C CHIPPEWA Board 1927 111 K 5 Senate, President 1928 1 1 Wanderer-'s Club 1927 lj LIFE Staff 1927 1 Q i 1 5? '1 CLARENCE C. GREGG - - Chesaning 1 DEGREE COURSE-JUNE, 1929 11' 1 1, Y. M. C. A. 111 41, Czee Club f111 Forum ll I 1 , if n 1' 1 X LILA STICKLE - - - Rosebush ,i 1' 1 1 COMMERCIAL LIFE-JUNE, 1928 1i E Home Economics Club 1925-1926 2 . 1 1 1 Commercial Club 1927-1928 l 11 , 1 11 il 5 ll l 1 ' . E1 I 1 GLADYS DICKSON - - - Detrolt F HOME ECONOMICS LIFE-JUNE, 1928 1 'I 1 X Home Economics Club U 1 5 11 1 l I 1 1 1 C jf CLARENCE IIOLSTED - Mt. Pleasant N1 1 1 15 IVIANUAL ARTS LIFE--JUNE, 1928 111k 1 N 11 Nl' 1 1 1 W: 11 . fl 1 1 1 ,f I1 'Z 1 5 11 1 1 1 .1 LEON SNYDER - - - Central Lake 1 1 7 11 DEGREE COURSE-JUNE, 1929 M 1 ' ul Agriculture Club, President 1926 H gf! 1 1 Forimn. f 1 1 111 111 1 1 1 11 ll 1 . 1' 111 L 1 N 'I 1 I I 11 MYRTLE COBB - - - Bay City Q 3 1 DEGREE COURSE-JUNE, 1929 ,JI 1 Orchestra CCW! 1 1 Art Club 1 A P 1 -3 1 1 1 1 1 1 '35 ' 1 1. e ,L L . ,.,, C I MEL' 1, . .LLL 1 . ..... -L ..,,, ,.,.W,m.1:sm,mLmm71GLL1.E 5,41 1 i IV- A- J Viyh T ,,,, ,,, wap,-,Y-,,,, , ..,.-, , . .. H.- ---- -,4,.4.,.- 9.1.1 .1,. -f....L.,,,,,,,L.,.,L,,,,k,n,,,r,vv-,, ,M J, Y . 1, 1 ,tw 1 1 I..-' xl li 1gMf 3 .1P1,1f'1'u'-1f'1'v11: .. .-. , 1 l ina-n....,., 1 I I I I I 5:21 I I II IH I , I , I I I I I I I I .1 Ai I A...N -A f --ig vN im r'Lt,11'1L, fgtfiigggilggg f1glQ1ffif1fflfLgg. iii I J .V I F' V X.. jp '175f IQK ' I 2 WA 1928 Q2 591 I. IGQQ I Afflgoilm.- 1.Q-.-.- ---ffircfl AII-15-3-II-221555----fa.1,airs I bi 4 Numan H C G mmm 1 A-, ..M, A I I I I DUANE DELOACII - - - Ithaca 'fgsj I PRE-JOURNALISM COURSE--JUNE, 1929 ,rf 1929 CHIPPEWA Baa,-a I' I I LIFE Staff I - ' 'II I I , II I I RHEA CURTIS - - - WVebbervillu I PHYSICAL EDUCATION LIFE-J UNE, 1928 A I I Wornen's League Board 1927 II II Physical Education Club UI I Y. W. C. A. I 'I II I II I ZETA THOMAS - - - Hemlock ' I HOME EcoNoMIcS LIFE-JUNE, 1928 II I Rachel Tate Literary Society 1926-1927 Home Economics Club, President 1928 ' Le Cercle Francais 1926-1927 III II II I i I I N CLAYTON A. WALKER - - Gladwin III DEGREE COURSE-JUNE, 1929 II I I I I ' Forum, Treasurer 1927-1928 ,I 3 I II I I I I I, I MACK D. MILAN0 - - St. Charles I I DEGREE COURSE-JUNE, 1929 I I Varsity Club 1926-1927 I. I Baseball 1926-1927 II I . II I I II ELOY STRUBLE - - - Shephard I MUSIC LIFE-JUNE, 1928 II I I y MacDowell Club I II Y. W. c. A. III I Orchestra, , I , ' Chorus I II I I Iy I III 5, I I ALICE L. WOLCOTT - Mt. Pleasant I DEGREE COURSE-JUNE, 1929 Home Economics Club I II IQI I I KEITH E. WILLISON - - Lakeview II' I I ,I ' HIGH SCHOOL LIFE-MARCH, 1928 II I f Agriculture, President 1927 II I I I ' If. M. C. A. I I TH I I GRETA LAMPHIERD - - Flint . DEGREE COURSE-JUNE, 1929 I Ii VVomen's League Board 1927-1.928 II I I I I Y. W. C. A. 1927-1928 I I N I Cliophiles 1927-1929 II I I :I I I I II I I I I I IX VERNONE MASCHKE - Mt. Pleasant I IAF? Am- LIFE-JUNE, 1928 I ix V gg A1-1 ezab I I I I ' I 2 II GSE I I I I j 1751, I . .. - - - 1 1 S 11 I I 'MVA-.5ffI31I5 'x3 Inmmmrmrmmw M-W1-W af ---- -I-I figfffi 'II A I 9.1.25-' I IPAEE IPIETY-S111 ' ' Q Qf11'.,,'wF1' I -A--- 2.----. .. .A .-.-- - .I.... I. -IQ f.,-..A-ELIQL --fd I -C.-zz--.-1.1-fm-,AI-.-1 2-arm' -- -- ---- . . . . LM -A I 212 I I 9 1 4 PQ LP'l'PM M fwk ,f V. 1 lflf' if pf- A., , l '1 f ' 1 . V, , 3. 1 1 Q, 1 I l 1 I , , I , 4, 1. ll ' 'li' r. 3 ll : qv, l 11. ld il ' 'ri 3 W - 1:1 li I lr 1 lr lik 151 2 A I 'lg 1 11 I 4.' ll al U1 HE 1 li 'gl J? 111 wg sg l 11 . lg 1. 1 I1 il 'G 5 - ,1 I1 M 'I il Ill 2 wg :ln 11 13 il 'll H1121 ..- Tlx L, W QHE ,,, . P1241 z l li: 5 ir! H ,gf 1 if I ll ,sl 5 111 u Eg 1 I1 Q 111. 3 'HE I!! E E ll 1 'll-l . ' 9 1 H I 1 ll I 'X 1 li ll ll 3 13 1 lf I H il il li i-. ,M -2, 4,1 ,N l ECW-Na 1 N, ,J . WW 59,5 'Q , ,. . K ' lr I 1' -l '1 llf 'H N 1 - 1 ,hm 1: N., . X' K,,,...L,, ' ,R ' -.,, . ... .. ARTHUR STINSON - - Mt. Pleasant DEGREE COURSEWJUNE, 1929 Y. M. C. A. Forum MILDRED L. DURFEE - Mt. Pleasant DEGREE COURSE-JUNE, 1929 Physical Education Club 1926-1927 Wo'm.en's League Board 1927 1928 CHIPPEWA Board l Art Club 1926-1927 LIFE Stag 1928 BEATRICE O. LANEY - - Gaylord DEGREE COURSE--JUNE, 1929 Ronan Round Table ROWLAND D. HASS - - Jackson DEGREE COURSE-JUNE, 1929 Le Cercle Francais, Vice-President .1927-1923 1928 CHIPPEWA Board Men's Glee Club 1927-1928 MacDowell Club Mercier Club Mikado HARLEY REEK - - - Marshall DEGREE COITICSPJ-AI.T1ZLTS'l', 1929 Varsity Basketball 1928 Varsity Football 1927 MARY LOUISE KANE - Mt. Pleaiant HIGH SCHOOL LIFE--NIARCH, 1928 MacDowell Club, President 1927-1928 Lucy A. Sloan Literary Soeieiy Philharmonic Glee Club Mercier Club Chorus DONALD M. ROCHESTER - - Ionia HIGH SCHOOL LIFE-JUNE, 1928 Y. M. C. A. JANETTE CURTISS ADAMS - Shepherd DEGREE COURSE-JUNE, 1929 Lucy A. Sloan Literary Society, President 1927-192.9 Wofmenfs League Board, President 1928-1929 RAYMOND BRAINERD - - Chesaning DEGREE COURSE-JUNE, 1929 Debating Forum JAY OSTRANDER - - - Alma HIGH SCHOOL LIFE-MARCH, 1928 Kelley Club, Vice-President 1925-1926 3. L.--....... 1... 1 1, -,. -.,1- ...-,i-L.....---.... 1.11 1 ,Ju I I 4 l fl M if is 15' li 111 lm lily Elf 5.. lll Q1 r far we El 41 1 li QM lai li 1 1 I I 1 1 8 - 4 13 1 4 F , wi lli gm we ' R ll ll E5 gif f sl lg 2 9 I i X , lil 113 ?ll WE lfi all will lim il 1 ggi fly 1 nr .1 if 'L 1 ,, .. 1 91... . lg M 2 N Lfv 1 2-.5 5 'fu 5 l lfw H ff-MM-HJR 'l'1 o11Q41.iL:-..1LL.,4 I fzzii -7 . f':l.Qfm'7f577f3TAP t'1+ G'vMw 1'lM P'm'CA: ' C' ' ' P mms z1'Im-'f-sExEN ' lQ,fl'5 V'1JQyi 11.351 X9 1 1+ I 1..fz15w2f ,,., ..,. .Mm1.I.,.1,,Lu.,,- ....1 . .. A 57 1 'Z,fs... 'JBA , . ,,-... fr .......,,..,...........,....,.,..,-.,-,..........,,..--.,.. ....--rr1z,f:.-... -1, I ' V, QCA 7 'j -I IA., ,,.H., .,...m.L.jb V CC??AQAQW ' I lb- 4 1'XN ' N I ' 5 3 P I I -..,f,g ,A B V Qil I? 9 I .1 l 1 T y J fs . .11 1. Iv ll I. N L ig I li I 511 II? U yi 1 tl i E.: .H .4 l .M ..- J-an--f LLOYD J. CARTWRIGHT - - Akron HIGI-I SCHOOL LIFE-DECEMBER, 1927 Y. M. C. A. 1928 ' Debating 1927 Forum 1928 E. EDWINEA ECKFELD - Unionville DEGREE COURSE-JUNE, 1929 Rachel Tate Literary Society., Vice-President 1927 Wo'men's League Board, Secretary 1928 Le Cercle Francais Chorus E. HELEN KLEIN - - - St. Louis MUSIC LIFE-JUNE, 1928 Lucy A. Sloan Literary Society Philharmonic Glee Club MacDowell Club EILEEN WATERMAN - - Mt. Pleasant DEGREE COURSE-JUNE, 1929 Central Trianqle 1927 1928 Y W C A W ROBINSON Mt Pleaamt DEGREE COURSE JUNE 1929 Student Council 1925 1926 1927 1928 Freshman Class President 1925 1926 Junior Class President 1928 1929 Varsity Tennis 1927 1928 LEON I DILTS Ithaca HIGH bCHOOL LIFE JUNI' 1928 Kelly Club PERCY J GARDNER Cxoswell MANUAL AP'1S LIFE JUNE 1928 ERNEST SHELLEY Cazson Cnty HIGH ScIIo0L LIFE JUAE 1928 Ma1'Do'well Club Mens Glee Club Chorus THOMAS A HALCIN DctouI DEGREE COURSE MAPCII 1929 Melczm Club NIARGY TOW Stanton DPGIIEE COUPSE JUNE 1929 Le Cer cle Foancaw 1927 1928 Y W C A NNW if I is E fi if U E 59 gl 1. ' 5 Y lf ll? All I IL' I II I :il ' fl I ,, 1 15 I if 5 5 lg 2 -L l M I .FI .ef 1 , I 1' J IX- I M lol l s. L v N 4 A . 1,1 f. f P SOPHOMORES LYNN CORWIN - - - Cadillac HIGH SCHOOL LIFE-JUNE, 1928 Student Council, Vice-president 1928 President Sophomore Class CHIPPEWA Board Varsity Club 1928 Y. M. C. A. Senate Traci.: MARGARET LARSEN - - Johannesburg GRAMMAR LIFE-MARCH, 1928 Ronan Round Table Y. W. C. A. Kelly Club ERMA ROBINSON - - Mackinaw City EARLY ELEMENTARY LIFE-JUNE, 1928 Lucy A. Sloan Literary Society Helen R. Emmons Club Y. W. C. A. MONICA MCCONNELL - - Rosebush LATER ELEIVIENTAIIY LIFE-JUNE, 1928 Mercier Club, Secretary-Treasurer 1.027-1928 Rachel Tate Literary Society Art Club ELLEN C. CLUTE - - - Harrison LATER ELEMENTARY LIFE-JUNE, 1928 DOROTHY F. THOMAS - - Reed City EARLY ELEMENTARY LIFE'JUNE, 1928 Helen R. Emmons Club EDWINA MCARTHUR, - - - Ithaca COMMERCIAL LIFE-JUNE, 1928 Commercial Club DORIS ABBEY - - - - Midland MUSIC LIFE COURSE-JUNE, 1929 Philharmonic Glee Club MaeDo1vell Club Mikado Chorus JEANNETTE B. EWING - GI-and Rapids RURAL LIMITED-JUNE, 1928 Central Triangle Y. W. C. A. Kelly Club VERA E. PARMELEE - - New Lothroll V HIGH SCHOOL LIFE1AUGUS'l', 1928 Chorus ,HZQEQ ig O OO 54KefI-Q53 Q2 'S Q DAVID B. SNYDER - - Boyne Falls , HIGH SCHOOL LIFE-JUNE, 1928 I Forum 1927-1928 ll Men's Glee Club ll Chorus l Band I 1 XI 1 I ll, EDITH M. WEATHERHEAD Evansville, Ind. I y HIGH SCHOOL LIFE-JUNE, 1928 Q I I Orchestra Il Chorus I fI LOIS MCMACKEN - - - Sf. Johns l V PHYSICAL EDUCATION LIFE-JUNE, 1929 NI Physical Education Club+Secretary 1927 Lucy A. Sloan Literary Society E Y. W. C. A., President 1928 Head Proctor, Dormitory QI Dormitory Council 'I Cercle Francais I t I KERMIT WICKHAM - - Chesaning ly 2 HIGI-I SCHOOL LIFE-JUNE, 1928 4 l I I JOHN FRENCH - - - -- Dryden I 1 1'IIGH SCHOOL LIFE-JUNE, 1928 I Wanderers' Club ll Student Council E Senate E3 I li SHIRLEY B. SMITH - - - Fenton li y EARLY ELEMENTARY LIFE-JUNE, 1928 Lucy A. Sloan Literary Society Helen R. Emmons Club Il I J l I ' aff l HELEN HURD - - - Johannesburg I HIGPI SCHOOL LIFE-MARCH, 1928 Y. W. C. A. I I II I I l I ' I I I 5 II 1 I I I I I 9 l I I I HELEN WEISS - - - Suttons Bay I I EARLY ELEMENTARY LIFE-JUNE, 1928 I I Tri-County Collegiate , I ii? 1 'O' I? O3 I 1 new ISSI Iicf I LW W IQ V 19' 'I 'Hr C' E I I fa-f -'f-N-II-w-WI- M2----IHI2lT-72ll'i7iiiti'5i3Ii1ii1.5TQJJTTCI ' 1 L1iLgii.g,gjjjgij 'Qjjj'i5j'k f 5 329295 I I 3 Q-MI It S I I I If QQUQI I I BERTHA LUEK - - - Reed City gl 5 COMMERCIAL LIFE-JUNE, 1928 I Central Triangle Club Commercial Club I l li' 1 7 FLORA MADISON - - - Sidney I HIGH SCHOOL LIFE-JUNE, 1928 I I ,Qfl22LQ531-iw--ff A -AM W3l'1'?3W fi1T'5if5lT5 f 'il4-i1lfTl- .... iii: :QT':gi:.gj i'igg,1gj'j1 'E' -1' ' mf , 1 A Af. '19 '71 A - I - -.- - , 'R :ga M 'Z x'T3-qw ff A154-ijl?-Lk1JjA.nM,,f!PA a.-,..XaQas?,Ki X ,.,.,,. A WT? r jf- 1y',Cfi4l,Qw4i, .QAQ1 .W----M Q-'-H-H'--E-My-aw H- ,1H 4 A . 1- ' 'gfr:'-M 'A ff1g..1jiigif31.-1.f1 1 g.f',,a,1 1 1 , V .1 - :F51 1 1 122421 IC ,1 ' 11,1 1 1.73, 1 Exif 1. 1 1 1 1 1 .1 1 O 1 1 1 ,Lf . , FERN EDMONDS - - Mt. Pleasant an 1 2 1 qrflf' LATER EI.1cMENTAIzY LIFE-J UNE, 1928 Milf' X ali. Ronan lk'0'lL7?.d Table 11 1 1 1 11 11 1 1'1 1.x 11' ' 5:1 1 11 I1 1 311 ROBERT BOLLINGER - - Ca1-aan City 111 1 IIIGI-I SCHOOL LIVE-JIINE, 1928 Q Men's Iilee Club 111 Y. M. C. A. 111 1 Clnorus 131 . 1 WY 1 W 1 1 1 111, 1 QI 111 :1 11 1 'i 1 11 I. 111 MARGARET E. MCLEESE - - F1-aaland 1 v 19' LATER ELEMENTARY LIFE-JUNE, 1928 1 Helen R. Ifmmows Club 1 11 11 1 1 11 111 1 1 1 1 11 11 1 JOSEPHINE DONOHUE - - Mb. Pleasant '11 1 Q HIGH SCHOOL LIFE-JUNE, 11128 111 ' 1 Cercle Francais, President 1.927 1 11 If 1 111 1 Q 1 1 11 1 DOROTHY DUVALL - - Mt. P1aa-Qaat 1 1 '1 LATER ELEI1IEN'rAI:Y LIFE-JUNE, 1928 Baud 1927-1928 111 1 1 1 11 E1 11 1 1' 1 MARVEL BATES - - - Shepherd 1 .1 I'IlGI-I SCHOOL LIFE-JUNE, 1928 R 1 Library Staff 1928 1 ' ' 1 111 , 1 1 I 111 1 11 1 11- RACHEL COOK - - - Mt. Pleasant E HIGH SCHOOL LIFE-JUNE, 1928 I1 League of Women Voters, Treasurer 1928 1 1 Y. W. C. A., Secretary 1928 11 I 1 ' 1 1 . 1 1 1 - 1 ERMA JENSEN - - - saamaville 1 1 1 HIGH SCHOOL LIFE-JUNE. 1928 11. 1 51 Cuapmzaa 4 11 1 1 11 1 1 ., . '1 111 1 1 111 11: 11 I1 14. 1 f ELIZABETH VANMAREN - ,T1'aVe1'Se City 51 X HIGH SCHOOL LIFE-JUNE, 1923 11 1 Tri-County Club, President 1927-1928 1 . 1 Q1 Y. W. C. A., 1927-1928 . 1 11 - 'W 1 1 ,1 .1 . . 11 1 NORMA B. PAUL - - - Atlanta 161 HIGH SCHOOL LIFE-JUNE, 1928 11 A1911 QA lm' .K 1 11 1 . O1 C 1 P 611 51 1k..j1 ...... ,, .... ..-a aa aaaa A A aa if-H Dirfrrr- ffgiTE'I f 41 15 -We--AMM-M--V'-5-'-5-Rjjjxij'j'j6j3jQ3fgg1g,5g,1,.gg1ggi,1'O'-Qgiiligii...'.O.....J.M..-. -W--Aw.- N- -M ,M-M-M'----7-...A -A-f fn Ax - 1 ,L .f , If 7 au ' ,, 'n F. ,A . , . ,WI I 1: -'C-f 2.-A I 2 I' ---rf--fl? I' -QIIEJIS-'I I1 I',l'f - If I I H1 Xitl I+ I I I ' I Q If f W I ' A ' W I, Q Lf ..,., A-MW.. -14? L-.-- ' V Af ,A ww ,,, ,,,,-,,,,., , ,,., ,...,..f' ..f,.,,.,-.',1J+g,.,.,.--,.. .., ,......ff .GW .-.,.,.I. ' .- ...L 1 ' H. f ,V I md, I , ISI j 1. I I I ,I I SHERLEY I. DALTON - - - Leland COMMERCIAL LIFE-JUNE, 1928 Commercial Club SYLVIA SCHANK - - - Lansing JUNIOR HIGH SCHOOL LIFE-MARCH, 1928 Kelly Club LOUISE F. MAYNARD - - - Elsie HIGH SCHOOL LIFE-JUNE, 1928 Dormitory Treasurer, 1928 Debating 1.928 Y. W. C. A.. EDMOND VANSICKLE - A - Owosso H1111-I SCHOOL LIFE-JUNE, 1928 FRANCES HODGKINS - - - Ionia HIGH SCHOOL LIFE-JUNE, 1928 Phoeni:1:,Glee Club Cercle Francais Y. W. C. A. VEDA B. MOFVFATT - - - Sheridan COMMERCIAL LIFE-MARCH, 1928 Commercial Club ELLA B. COLLICKER - - Auburn GRAMMAR LIFELJUNE, 1928 Mercier Club SADIE NIELSEN - - - Lakeview GRAMMER LIFE-JUNE, 1928 - Y. W. C. A. WILLIAM J. BEACH - - - A15-on MANUAL ARTS LIFE-JUNE, 1929 i Band 1927-1928 ' LEONA SWINGILE - - - Manistique EARLY ELEMENTARY LIFE-JUNE, 1928 Helen R. Emmons Club II QI II I II I, fI iv I I I 'U X, I. C: I :fat I I EI II II I II Il II I I II 'I II II II i II II I II .I I I II II 'I fi ii CI 1 I I r I 1 I I ,,, ,I Z I iff i I w ...L Q.. '-., I I I ... ,- .--'Lg II II II I ,,, ----AYLY, I 1-R A f I- I I' I X lf., A-,,,,, , JV, RUTH RANNEY - - - Saginaw EARLY ELEMENTARY LIFE-JUNE, 1928 Rachel Tate Literary Society, President 1923 League of Women Voters Helen R. Emmons Club WILLARD MARKS - - - McBa4in HIGH SCHOOL LIFE-JUNE, 1928 Agriculture Club MILDRED TAYLOR - - Shephe,-d EARLY ELEMENTARY LIFE-AUGUST, 1928 MONICA SMITH - - - Charlevoix LATER ELEMENTARY LIFE-JUNE, 1928 HUGO J. MARTIN - - - Beal City COMMERCIAL LII-'E--AUGUST, 1928 Comnwrcial Club Kelly Club VIRGINIA R. HATCH - Lake Worth, Florida. SENIOR HIGH SCHOOL LIFE-JUNE, 1928 Student Council 1926-1927 Warriner Literary Society Women's League Board Cliophiles LULU E. DARGITZ - - Blanchard EARLY ELEMENTARY LIFE-JUNE, 1928 Helen R. Emmons Club Ronan Round Table VIVIAN SOWLE ---- Clare HIGH SCHOOL LIFE-AUGUST, 1928 Le Cercle Francais Cliophiles . MAUDE B. SHIVLIE - - - Cadillac GRAMMER LIFE--JUNE, 1928 Kelly Club MARY E. WHITE - - - - Flint EARLY ELEMENTARY LIFE-JUNE, 1923 Helen R. Emmons Club 5 I w I 1 I 5 , l :HMI 1 I I I M I vm? F- is A i -,-......Y ,far-N ---- '? 'Q ' 'L f , WAN, ,nmmnuww .-'M M 'g'-f A - - f 'G LMI , A fi 'Il 'E' L i l TW fig CT' Name E ,' 7 I. F INKQVC C C -aa Fraklabi-A-QWIPPEW-i 'l? 'I -DA QEDA A05 A A - -- gjiy. 7. L. am..aA--aaa - V- --N------- ' Yx- fmI M ''m8'U E 'M' 'l 'M 'MQ i N -'Mi 5. 41 W I 359 Q4 Sig J - I I I I . ' BERNICE McLEAN - - - Saginaw in 1 - EARLY ELEMENTARY LIFE-J UNE, 1928 'gill lug Rachel Tate Literary Society, Secretary 1927 ,V Helen R. Emmons Club, Secretary 1928 if if Women's League N E E 1 EVELYN TROGAN - - - Saginaw 5 5 T EARLY ELEMENTARY LIFE-JUNE, 1928 I Rachel Tate Literary Society , if I Helen R. Emmons Club I I Women's League 7 Mercier Club I: I ui I in WILLIS KRAUS - - Shai-nn Center U 1 PHYSICAL EDUCATION LIFE-JUNE, 1929 Mi Freshman Football 1927 I i , 1 Orchestra 1 T X' Baud I il ix ' I OLGA GINTHER - - - Miaianii I if EARLY ELEMEN'r.xRY LIEESJUNE, 1928 Helen R. Emmons Club iii 3 1 Wo'm,en's League ' IQ Y. W. C. A. ii 10 I , E, G . EBI 1 1 PATRICK F. SCOTT - - - Clare I IA HIGEI SCHOOL LIFE-AUl2US'P, 1928 I W 1 I iff 1 iii , A 'T DORIS MUSSER - - - Saginaw il 15 LATER ELEMENTARY LIFE-JUNE, 1928 ' Wanderers' Club I Y. W. C. A. fig I I I ei 7 I I if I Q I1 iii I i VIRGINIA MYERS - - Saginaw if iw? EARLY ELEMENTARY LIFE-JUNE, 1928 ij! I Rachel Tate Literary Society N Helen R. Emmons Club if E Women's League N i i' ii I ' 1 ii W ii !Ei I iii MARJORIE KEUHN - - Mi. Pleasant eil 1 LATER ELEMENTARY LIFE-JUNE, 1928 E , g is 5 HELEN E. BENNETT - - Cadillac I HIGH SCHOOL LIFE-MARCIi, 1928 fi 1 2 if Rachel Tate Literary Society l A Helen R. Emmons Club T Le Cercle Francais gif I f Student Council A ? 9 321 1 I JANET MURPHY - - - Shaphei-d ji g L iii EARLY ELEMENTARY LIFE-JUNE, 1928 355 I 'I r, 5 , i i 5 2,5113 s if--LE V 1-',f-ai 1 -- - a--A-if A .. S. , Im i aj'-in' w-rf 1'-fa. -A--....,..a,.,,,,. ,, I' ' r- - f -- . 1 , ,, A, ,,,, ,hm ,A,,.I,,,,,,,.I,.-.,,,.,.-....,---W-f ala-'-r- 'A ' in--in iii 8 if - I -1 , --- w .V J-.vw 4 1 I LUCU A. Sloan Literary Society, Treasurer 1927 1 ,Q - Helen R. Emmons Club 1 Mercier Club A ii T3 H55 I 1 1 l ,Qty . I regal ., .. ,,.. .HM ,MM ,,., W,-MM,,,v,.,,,,,,,,..,...,.,....-- f an--f- ,,f .a vi '-I ' I-'viii MMU Lgawa-f. -- a a..,-..j ,c...--.,,,L,,,,,,, LY M---mn --- ..,...... ...,. - ....,,,,,,,MM ...WMU-M Y ggifg. ..,. ,,Wm.1I1...--c..al 5521 Vo T' Sl A 'L b 4 bfi lf rl J! I 4 I . ,sg I 'bf' , ' Q 5 X4 . . la K.- I, F' .JJ fl 1' W! Q- W., f, m 3 2 ..L. L '-'Rf s A 1 H - ', X-,. , , Hwy . . , 'T H I M212 21 5 . 1 4 . ll . H 1 . I, l l ,.. Y 1 i 1 1 I r : 4: l n r 1 l l J 9 1 1 1 ... EVELYN JOHNSON - - - Ashley HIGH SCHOOL LIFE-JUNE, 1928 11.22 15 Y. W. C. A. if Y . A GRACE JOSEPH - - - H31-ietta ,j EARLY ELEMENTARY L1FE-JUNE, 1928 Helen R. Emmons Club 3 5 sl A E' Q DOROTHY WEBSTER - - East Jordan EARLY ELEMENTARY LIFE-JUNE, 1928 ' f Helen R. Emmons Club l Y. W. C. A. Q L 3 1 R 1 IDAH FRANCES NVILLISON - Lakeview f 3 COMMERCIAL LIFE-JUNE, 1928 Commercial Club Y. W. C. A. fl F1 l . W 1 1 1 5 i GRACE LOUISE REAGAN - Bay City ' 5 GRAMMAR LIFE-JUNE, 1928 1 Ronan Round Table 2 i 1 'QPV' L: l MAR jf INNER - - Atlanta 1 ARLY ELEMENTARY-JUNE, 1928 f Helen R. Emmons Club 1 Q 1 I . 1 ll GLENN MCDANIEL - - Manton. if HIGH SCHOOL LIFE-JUNE, 1928 1 Agriculture Club U W Men's Glee Club 1 PEARL A. FRITCHIE - - Lansing ' LATER ELEMENTARY LIFE-J UNE, 1928 ' lg Phoenix Glee Club pl Mercier Club f Chorus li 1 ! l I A. IRENE HOWE - - - S1.. Louis 2 . LATER ELEMENTARY LIFE1JUNE, 1923 1 - Y. W. C. A. I I I T 5 al I 'r BEVERLY DAY - - - OWOSSO I ! HIGH SCHOOL LIFE-JUNE, 1923 1 Y. W. c. A. Cliophiles ,LL-L lbw I S 5 V Q . .,,. W H AAA, ggwggw,mvg,,:,R3111gQ.R li!.li . 2 ' f T'lf-3 ,AAA f 4-5f!2Y?744f:we -We eR -'-Wf'- Ode' f E7f-:f'fzQ7' 'ffl is-.J Qfwjif if '-R T-,RR Swv 1 H1 HMM 4... WJ ,W ,,:, Q M ,,,,..SH.. ..... ,.--... .. T.. ....wf,N--.Hw----- -4--fn---'--'H' 4 m7' 'W' -- Y --Y-'W-P-f - - ff V jQ fffyf THE C1-UPPEWA was jyfggq QAM FLORENCE BELTINCK - Mt. Pleasant HIGH SCHOOL LIFE-JUNE, 1928 Le Ce1cle Fvancazs 1927-1928 JESSIE E SHARP - Lakeview HIGH SCHOOL LIFE-JUNE, 1928 League of Women Votevs President 1927-1928 Le Ce? cle F1a,nca,1s 1926-1927-1928 Centval Irmngle 1927-1928 Debatzng 1.926-1927 Y W C A. HARRIEI' NIGGEMAN - - Beaverton EARLY ELEMENTARY LIFE--JUNE, 1928 Helen R Emmons Club GENEVIEVE GREENWAY - Port Huron EXRLY ELEMENTARY L1EE-JUNE, 1928 Helen R Fmmons Club ROSABELLE KIESSEL - Sutton's Bay LATER ELEMENTARY LIFE-JUNE, 1928 111 County Collegiate Mercler Club Kelley Club Emu EIEMENTARY LIFE-JUNE, Helen R Emmons Club MABEL F CLOSE - - Saginaw HIGH SCHOOL LIFE-JUNE, 1928 Le Ce1cle Foancazs 1926-1927-1928 Clzophzles 1927-1928 4 ETHEL CLARK - - Stanton GRAMMAR LIFE MARCH, 1928 l D 0131 -Cifkixfff TT T L-SJ P YJ l I l l l I Z -J UNE, 1928 T Club - Mt l -JUNE, 1928 2 l Club la I l l ll fa Q. ol I Q? l Q VV QAQJJ M H is l --C S2-SQ, E I N Q lj, I is l ADAM WERLE -- - - Arcadia HIGH SCHOOL LIFE-JUNE, 1928 Agriculture Club, Sec'retary-T'rcasu1'eo' 1927-1.928 ALTA M. BESAW - - - Bellaire HIGH SCHOOL LIFE-JUNE, 1928 Y. W. C. A. 1 GRETCHEN PETERSON' - '- Edmore I EARLY ELEMENTARY LIFE-JUNE, 1928 Helen R. Emmons Club l Philharmonic Glee Club Chorus RUSSELL C. BENNINGTON - Gladwin COIIVIIIIIQIICIAI, LIFE--AUlIUS'l', 1928 GEORGIAN WOOD - - - Ithaca HIGH SCHOOL LIFE-MAIICH, 1928 FRANCIS A. ROBINSON - . Mt. Pleasant HIGH SCHOOL LIFE-DECEMBEII, 1928 DANA T. LAWRENCE - - Petoskey EARLY ELEIvIEN'I'.xI:Y LIFI-J--JUNI-3, 1928 Helen R. Emmons Club 1.928 Kinclc1'ga1'lcn Club 1027 RUTH M. FAIRCHILD - Mt. Pleasant EARLY ELE1xIIsN'I'.xIzY LIFE-JUNE, 1928 Ronan Round Table Kindergarten Club Y. W. C. A. AMBROSE LAUNDRA - - Saginaw VHIGI-I SCHOOL LIFE-JUNE, 1928 MAYME C. LINDELL - - LeRoy JUNIOR HIGH SCHOOL LIFE-AUGUST, 1928 J 1 l H 1 ' . 1 x , I 'l,Q.Q.Q,,,,.,, gmffgg 5 n K .K- F, I .. I pf -....-- we ---A A- ----1 1- R-f-'fR'ET .,. . I 11 1 . 1 1 O A .A .v ---1. R R ' ' fm .- 'WO-.. YQQVTNW I 1- V N ref- THE CHIPPEWA. wee y WSRQJ y yy Q KSA gg., QQAQAG A- 3-AQ 6- G Eg rjggmg. I A- A- ----- A A -A --AA A- - A M 4 y y y -1 'Od SH O B L DONNA J. BARNES - - ' Mt. Pleasant -r ' COMMERCIAL LIFE-JUNE, 1928 9 fr' Ronan Round Table, President 1928 X Sv Y. W. C. A., Plesident 1928 Women's League Board 'Commercial Club , i I . NINA BEACHUM - - - Shelby I JUNIOR HIGH LIFE-MARCH, 1928 Y. W. C. A. t ETHEL LEE DUBY - - Menominee EARLY ELEMENTARY LIFE-MARCH, 1928 Art Club, President 1927-1928 Lucy A. Sloan Literary Society 1927-1928 Mercier Club 1927-1928 Helen R. Emmons Club Phoenix Glee Club Chorus THELMA MARIA DUBY - Menominee EARLY ELEMENTARY LIFE1MARCH, 1928 Helen R. Emmons Club 1927-1928 Mercier Club 1927-1928 l Art Club 1927-1928 Phoenix Glee Club Chorus N ANITA MACDONALD - - East Jordan h, LATER ELEMENTARY LIFE-MARCH, 1928 I KATHRYN C. LEWIS - - Midland EARLY ELEMENTARY LIFE-JUNE, 1928 Kindergarten Club 1927-1928 Chorus 1927-1928 Y. W. C. A. CLIFFORD H. CAWTHORNE - Bear Lake HIGH SCHOOL LIFE-AUGUST, 1928 DOROTHY LARRABEE ' - - Lansing PHYSICAL EDUCATION LIFE-DECEMBER, 1928 Rachel Tate Literary Society Physical Education Club I ' LILLIAN V. KUHN - - - Morley EARLY ELEMENTARY-JUNE, 1928 Helen R. Emmons Club 1927-1928 Y. W. C. A. 1928 I VO WYLA BUCHANAN - Howard City I' .Q HIGH SCHOOL LIFE-J UNE, 1928 N -01 'J 2 Y. W. C. A. I ,fx S-'-A . Ly ke O Ig! IQ Vg? 1 -A A IIQQI N In -1 --A A -R11 A . fr- A ' . '7'M 'Wf S-Tv ELLA f z'A1.l': Huw -Ion II: il O 6 .. ' A Rf P1-H-2-eff R iii S LEE E 1,1 . wg . A-f-H el Ev 'N M A P sf i I I I ' I I i I 2 J A v4 JJ 1 sf. ,A -,,,,.,.. ..M----A-4--A-S----af-.7,V f-I'--If --f-A-:H I-.3 .,N ,'T'Qf' 'T' f '1'-A 'M f f'R-W'q ' wiv RX I ,mewwgf If-IR, I,H.If In so xi f. I If K, fmw I ,jo,L,1OI Ag, ,,, -. ,,.. -AJA -Q1 , j,..., A GA-..-1 . , IX' Q 131,-,I , . A-- - A A-A -- A - ,I-A ti-5 I , f ,, I :S.. M5524 I . ,9 mfg QM .1 .. rb- I I .411 W i I X . I I 3 1 A I - l LY.-- 'I L. ,.. RALPH J. WONDERS . - - Rockford os ' COIVIQMERCIAL LIFE-JUNE, 1928 'IT V E I Commercial Club 1 Z 1 l SARAH LEWIS - - - Marion 1 JUNIOR HIGH SCHOOL-JUNE, 1928 Warriner Literary Society, Vice-president '27-'28 Q Dormitory Council A 5 Student Council I E 5 HAZEL L. WARREN - - Petoskey LATER ELEMENTARY LII-'E-JUNE, 1928 Kelley Club 1927-1928 X HQ MARGARET MAE SPRAGUE - Gowen I P151 JUNIOR HIGH SCHOOL LIFE-JUNE, 1928 1, 1 'Ee , I H . if JT . if WILBUR C. MCMATH - - - Leslie HIGH SCHOOL LIFELJUNE, 1928 Agriculture Club, Vice-President 1928 Forum, Secretary 1.927-1928 3 ii' I ig I E. RUTH LOCKER - - I - Detroit 1 Q HIGH SCHOOL LIFE-JUNE, 1928 F Y. W. C. A. 7 5 5 I I Hi RALPH J. LANGLEY - - Fostoria 1 EQ HIGH SCHOOL LIFE-JUNE, 1928 . ,I fi l il I IRENE BOWDEN - - - Saginaw 1 EARLY ELEMENTARY LIFE-JUNE, 1928 I 12 Kindergarten Club 1927 5 55 Y. W. C. A. 1927 4 if I L Qs 5' ALICE WINTERS - - - Frankfort 5 ' EARLY ELEMENTARY LIFE-JUNE, 1928 5 Helen R. Emmons Club I I lx lg . lg CLINTON LA VERNE LESLEY - Grant A - HIGH SCHOOL LIFE-AUGUST, 1928 C Qi., Agriculture Club fir -X ! 1 ' Q fl 73 3 V0 663' j Q, rN4i ,II - I .. ... -I - I. . .- IIC .-AI..-- ...I ..... . ... -I-AAAsAAA V Tf I'R 'R' T jj--jA W!L1wwx,NJH,, J,,a,L,.L,,m.,.LA,,AA-..AL-...AI.,.,-.-.,. AA .W A Y -A ,f-ff' V- -QQ, .I , A-fs . -'H- 1 W W - - AHHH HW H- O SiZZ5?LQ3L.L.1I1IIM -L.. ff2ig3gigLW- ,,I,A,, AHL?fE3EEIA my KRNXKC HHE CHIPPEWA mes, , j 049,95 E4 E1 P Q! Q -ij! E3 1. X ' W N W I V I 3 in 45 wi 1 W, 4 11 Wi 53 hw L., Q X E 2,4122 5?-WET Lffg IQ' aww X J is 1 VI sm Q Nl 5 L Cm 4 1 1 11 I '1 . 1,41 1 1 1 1 9 3 1 1 1 1 1 1 1 1 3 1 1 1 ' 5.jQ',1fl 8 -- 7' 5L jfr1iyjj9'l3 fl-' R'f-8'--M A'--- -' '1'- f-w-----m1w-Y---'-- --9 --W4--Q, -A l--1..ff' JI.'93lL-..., LW: A M 573553-AQGT? I 1 A vA Q 5 A A ...,. . - . .1 1 , ,, ,W Y .,, , AY,,, h L , ,V ,Wy ry H E f 1112211 'Q41 1 1 1 X 'QI l 1 1 1 . 1 1 AGNES KIRSCHNER - - Mom-oe 1 R vi W PHYSICAL EDUCATION LIFE-JUNE, 1930 1 A 1 Physical Education Club I W1 1!1 1 It 1? 1 GLADYS J. HESS - - - Alil'0T1 1 PHYSICAL EDUCATION LIFE-JUNE, 1928 11' l J Rachel Tate Literary Society F? 3 1 Physical Education Club i l 1 ' lb BEULAH VOSS - - - Howard City X 11 EARLY ELEMENTARY LIFE-JUNE, 1928 1 ' I Helen R. Emmons Club ,1 1 7 119 Phoenix Glee Club 1 I Chorus 1 . L1 1 1 Q11 DOROTHY MARTIN - - Standish 51 1 A COMMERCIAL LIFE-JUNE, 1928 lf o Rachel Tate Literary Society Dormitory, Vice-President 1. i ' Commercial Club 1 y Q11 Y. W. C. A. 1? 1 1 314 11 1 1 I ff 1 I I DOROTHY DAWE - - Deckel-ville 11 I 1 HIGH SCHOOL LIFE-DECEMBER, 1928 1 111 311 1 ' 1111 1 1,11 1, 11 1 13 2 1 D-E OPAL COON .... st. Louis 1 1 HIGH SCHOOL LIFE--JUNE, 1928 11 i 1 1 ' 11 1 1 1 11 9 W1 1 fi 1 I 1 GRACE L. HUGGETT - - St. Johns ' W1 LATER ELEMENTARY LIFE-JUNE, 1928 1 u 1 111 1 gi 1 ii ARVILLA FAHNER - - Reed City 1 EARLY ELEMENTARY LIFE-JUNE, 1928 1 1 Helen R. Emmons Club 11' 3 ' 1 1 1 11 I 11 f 1 1 if 1 1 1 1 MAUD COFFEY - - - Lansing 1 If EARLY ELEMENTARY LIFE4JUNE, 1928 1 A 1 1 11 , 1 1 11 w 1 jj 1 1 f HAZEL SLOAN - - - Bal-1-yum . 1 COMINIERCIAL LIFE-JUNE, 1928 1 commemaz Club 1,1 111 8 UN .1 , 1 -1, 1 5 5 'f 12,1 O iiffrf ' V8 , .11. MWA, A by A I I I 1, 41 4.Qf:3Jv-,Q-AO?-.X ---Wee .1 -1 1-.....-- A A- m-11.--.-. A,--4. In 1jLgg.j'j' M Time Tiimjaj Q L1-,,f1 , L. . 1 ., I A y U HN A4 If sf Y 45 'Q 1 HF CHI5I2IffLaf.23fC 'TC921.f 'a391325lj MEI , ft L, Q5-DACQ O1-rj A L'- -Q 5' Gif t,1fTil'iiE.'i E' f37i'Q Tigo?'fi'ii 'i3i'i'f'!5 li? 1 CARROL R. BURCH - I - Rockford PHYSICAL EDUCATION-JUNE, 1928 Varsity Baseball 1.925-1926 Varsity Club IRMA BIGELOW - - - Big Rapids JUNIOR. HIGH SCI-IOOL LIFE-MARCPI, 1928 VERA YORKS ---- Evrt JUNIOR HIGH SCHOOL LIFE-JUNE, 1928 IRMA ST. JOHN - - - Saginaw EARLY ELEMENTARY LIFE-DECEMBER, 1928 Rachel Tate Literary Society Helen R. Emmons Club Phoenix Glee Club Chorus PHYLLIS HUTCHINSON - - Shepherd EARLY ELEMENTARY LIFE-MAIICII, 1928 I Helen R. Ernmons.Club 1.927 HELEN LOUGHREN - - McGregor LATER ELEMENTARY LIFE-DECEMBER, 1927 Women's League Kelley Club MYRTLE D. BARTON - ' - Lapeer EARLY ELEMENTARY LIFE-JUNE, 1928 Ronan Round Table Kindergarten Club VIRGIL K. ROWLAND - Mt. Pleasant HIGH SCHOOL LIFE-AUGUST, 1928 ' Men's Glee Club MacDowell Club LIFE Staff Mikado Senate ULA BOHLINGER - - West Branch EARLY ELEMENTARY LIFE-AUGUST, 1928 Phoenix Glee Club 1927-1928 A BERTHA E. FENNER - - Fairgrove EARLY ELEMENTARY LIFE-JUNE, 1928 Helen R. Emmons Club Y. W. C. A. fu f -A-..,.1L,1,,, mwymw -W A I .INV HU- Xi I VILLIY-1.70 1 J N.. ..,...,, .Y If 1' , ,--,. ,,-,.-.,,....,.L.-, -ww I I I. ,PRI-...V ' ' , . 'I Jrif' 'I 1 I. ,- 1. ,. J bi Ik Lkf. VP ' 2--',,y, 7 IX X , f V ww- , , f -. x .L -. RUTH CONWAY -- - - Flint LATER ELEMENTARY LIFE-JUNE, 1928 OTIS SWEET - - - Carsonville I HIGPI SCHOOL LIFE-JUNE, 1928 Agriculture Club MARY LARSEN - - - Lakeview HIGH SCHOOL LIFE-JUNE, 1928 Cercle Francais Y. W. C. A. KENNETH R. BISBEE - - Reed City YIIGH SCHOOL LII-QE-JUNE, 1928 Debating 1927-1928 Men's Glee Club Y. M. C. A. Chorus JESSE W. MORSE - - Central Lake HIGH SCHOOL LIFE-JUNE, 1928 Kelley Club Chorus CLARA DITTMER - - Scottville LATER ELEMENTARY LIFE4JUNE, 1928 Y. W. C. A. HELEN L. ROSE - - HIGH SCHOOL LIFE-JUNE, 1928 Central Triangle - Lansing Y. W. C. A. Cliophiles MABEL E. BROWN - - Owosso HIGH SCHOOL LIFE-JUNE, 1928 League of Women Voters Cerele Francais. MILDRED LEISMER - X - Petoskey EARLY ELEMENTARY-JUNE, 1928 Philharmonic Glee Club Helen R. Emmons Club Y. W. C. A. VIOLA LEONALL - - Cheboygan EARLY ELEMENTARY LIFE--JUNE, 1928 Helen R. Emmons Club Y. W. C. A. 1 1 'N I Y 'Q ' 'svn 13 lf... I, I , .1 ...L .... -- -...,...L-..L.. R f I ' S F' I I xx 1 III I P, If K 5 J -X 1 , IM.: ...J .C -,.2.1-..,,1A-L I..,......-.L,..... ..,.., ....1..2.-. ...,1LL,.,,.,, .. . , , .....,.1,, L...f....,.L..1 ' I I ,ii Il 'E i E . I I , , H l , , I 5 fl 7 I I l T I l lx 1 I. I I U 'I - i 1 I u I I .NI I I I , I - I 12 I . . .3 1 . my 'J E YS 4 X1 - - - - aaaea - M-WIT -ggg1g T'1'.. - -- A- --1----ff-9 1 'aah RTT GT If V R 797698 J CE 9 CEWKQ TH1i....9.Hf?.PH1WA1- .1221.-..1ll3TaLEI.. JAR .OIQIQQ R35-A jg gg gf:-1134, ,1.,Qgg,-.,--...1.. , . -M ,, - f QP4 -- 1-I -I qi ' ' I' '9 W u'3 V vor Q9 if . 'T FRANCIS FURMAN - - Fairgrove L.. In HIIGI-I SCHOOL LIFE--JUNE, 1928 af? fr? Track 1927-1928 6-Q3 I 3 N, I CT? T I GERALDINE FRIEDLI - - Saranac Q V EARLY ELEMENTARY-JUNE, 1928 T X' Helen R. Emmons Club 'I I H l 1 ll .IULIAN SPENCER. - - - Lansing lli . flg LATER ELEMENTARY LIFE-JUNE, 1928 , lvl League of Women Voters 1 la so This 19 London 1 1 I HQ Wanderer's Club- One-AGL Plays, 1 I5 U Y. W. C. A. 1,5 I HIFI I I ELIZABETH MCOONNELL - Rosebush Q1 A .51 GRAMMAR LIFE-JUNE, 1928 I l ' Mercier Club 2 1 I Kelley Club , il IE lip l I g .V.,.f.2 , il LOIS HETZMAN - - ' BI-eckam-mga I g, . .,11e 5 l f': HIGH SOI-IooL LIFE-J UNE, 1928 - g , Phoenix Gzaa Club 192741928 IEE l l C Llzl Ronan Round Table 1927 ii l ,, ' , A , Chorus 1927-1923 Nl l , - - Q I I 9 9 DOROTHY L. BRADER - - Ithaca I HOME ECONOMICS LIFE-JUNE, 1928 5, S Home Economics Club 1925-1926-1927-1928 A , ' Women's League 2 Q g A I Y. W. c. A. E55 X I... . f ' gl.. A I MABEL GILES - - - Saginaw il? l . I EARLY ELEMENTARY LIFE-JUNE, 1928 Q Helen R. Emmons Club 1 1 I g Philharmonic Glee Club P 1 I . Y. W. C. A. 1 , I we ,Av Chorus G ll? . l I My GLADEZ B. STINEMAN - T1-averse City Ii. JUNIOR HIGH LIFE-JUNE, 1928 T I ' Tri-County Collegiate 1927-1928 I H Phoenix Glee Club 1927-1928 E l Chorus 1927-1928 3 lilly YW.CA I 1 f GLINNIE R. THOMPSON - - Marian I k 'L LATER ELEMENTARY LIFE-JUNE, 1928 E A I , U ,, 1 .- 5 EVA IRWIN ..-- Alpena. EARLY ELEMENTARY LIFE-JUNE, 1928 1 Mix Helen R. Emmons Club 1927-1928 gil Mercier Club 1927-1928 11 21-.-.flh ills .... ,gi f A'l,' 93 VZ--. ew' .I Ill in 1' 1 O L9 , Is, , 5 in ' ll ll fr 'I I V'fTig'l ': 'm ?T'fmfnew-Q-an-mm-Z-3-..a-.E- -----.a.--a1EE1E.---.- .. . ,,.Y..-.. .. ., ...M . , W. ...,,,,--..-.- 2 '-rye:--rf-Q-, F-11 fff---1-v1-:-ff-----M---- ---- ------R ---M ---1-4...L'LQ.iigiGifiigEg.ggLgggQ,EEiggfiii.. '91-. ,a -- -'gjg:'Jaf EFT-U I-AGE S:cvIcN'1'Y-I-'OUR ' -CO NDJ ' 1 -f' --1 ,!,.,Q-f Q1'.,,,,,,,,,,,,,,,, 5,,IL:YY -W V Y mu-M-A W AAL A I - 'hi ' 1:4 ' -A-1:-m-fig:----...-E.. .EY S, -.-W . . M, , ,, ,u,uM-,::1,,,4H 4 ,,,,,,.,,,V,,i,,,L,, .,-- -........-- ' . - ---- I- . . ....v..........-,........---a-...,.-L,.A...- -..-.V-.--Y-.....a,,.-.I............,.1f.-..A....1Q --.au-.......,...,.....-..-.-.., I------' l I I l A 1 3 I 3 ANNA WAHR - - - Freesoil GRAMMAR LIFE-AUGUST, 1929 Mercier Club JUNE SAVILLE - - - Detroit LATER ELEMENTARY LIFE-AUGUST, 1929 Chorus IRMA CARROLL ---- Ionia HIGH SCHOOL LIFE-JUNE, 1928 Le Cercle Frafncais MARJORIE CASE - - Traverse City EARLY ELEMENTARY LIFE-JUNE, 1928 Tfri-County Collegiate, President 1917 Helen R. Emmons Club Ronan Round Table ILA LANDON - - - Mt. Pleasant HIGH SCHOOL LIFE-+JUNE, 1928 ESTELLA KAISER - - Mt. Pleasant EARLY ELEMENTARY LIFE-JUNE, 1928 JEWEL A. STERLING - - Wolverine LATER ELEMENTARY LIFE-JUNE, 1928 Won1en's League Y. W. C. A. ERMA ALLEN ---- Alden EARLY ELEMENTARY LIFE-JUNE, 1928 Helen R. Emmons Club EULA CLEARY ---- Flint EARLY ELEMENTARY LIFE-JUNE, 1928 Helen' R. Emmons Club ANNA MARIE MURPHY - Mt. Pleasant LATER ELEMENTARY LIFE-MARCH, 1928 Mercier Club 7. MA 1 5 '14 1 11 ll,l 1 f 1 1 1 1 1 E4 li ...I' XA-Tl MRS. DORIS CRIPPO - - St. Charles Inf -I 1 l il 31 I ,I Il HH as A-G ig :tiff git Q1igf'1 'G'ii:1i-11,QfffiffI'i1'fi, 572 iv C +7c.3 'Q THF CHIPPEWA was JUQYQQL Q Q QQA W ,QLDQQG .L , .IHIZL ,L 4 ,IAQ I gs .g HIGH SCHOOL LIFE-JUNE, 1928 ii W ' WT' Commercial Club - ,, I .1 I I c .5 5 1 ETHEL LOUISE FOX - B1-eckem-idge Q5 1 HIGH SCHOOL LIFE-DECEMBER, 1927 w ' Central Triangle, President 1926 lx j l Y. W. C. A. I 5 ll Cziopmzes ' I Wi li . 5 I' I Q I I ll I I . H I A K ALMON F. GALLOWAY - - OWOSSO I T 1 HIGH SCHOOL LIFE1JUNE, 1928 ll f I- T I I 11 , . I il fl 1 HE I I gli :X MARION LUXTON - - - Saginaw 1 EARLY ELEMENTARY LIFEHDECEMBER, 1928 i 1 Helen R. Emmons Club L ll Philharmonic Glee Club ', Chorus il 2 N . 1 l Il N Il ' 1 ' 'I 1 i JENNIE YALE - - - Kingsley M I ' HIGH SCHOOL LIFE-JUNE, 1928 L I ll Tri-County Collegiate Club Orchestra I - LIFE Staff l I . W 1 f KENNETH A. WRIGHT - - Elsie A HIGH SCHOOL LIFE-MAIZCH, 1928 - Q I ' Baseball 1925-1927 gi V . I N. If I I I Q 3 if l M MYRTLE B. ORCUTT - - Bellaire 1 HIGH SCHOOL LIFE-JUNE, 1928 H3 .I Y. W. C. A. M fi? LH ' 1 la I H E , I ll I W pf I Il PAULINE UHAN - - - k Ak,-on gl 3 I Il! HIGH SCHOOL LIFE-JUNE, 1928 il it 'N X' I3 . V 5 V I I' A i IE 15 l If E52 li - I El: F' Q f JOHN W. ALDRICH - - Mt. Pleasant E .115 HIGIYI SCHOOL LIFE-DECEMBER, 1927 I l U 5 il 34 P , K . . I U H! I lg ALLIE N. DAVIS - - - Alma 1 I HIGH SCHOOL LIFE-JUNE, 1928' ' f'?Q9 'v Cercle Francais I ,lk ,. ,, -.wr ,Q I 4 I I I I l I . ..,,,x Pi i jf' F ll ff . 'LSI ' I I It Tex EA3i j:T::i:.T:1fg5'fIigiiiriiiim.,,ElGng.glgRigH. I -..i.f'- AiALg..g.g5iO .---.ggiLg1' g,k,5j Iwffwlrsw .-.. I A - 1 . AA.. . J - :ICU A 1 L ...L Ag-Q...-....,.,...mA.,,A,4,L:AT , - -,,..,.,. ,,,,,,,..-, .,:i,Lm,,.,. L., I ...........-.-f-v------ '- x l I f I 9 . I .. W-.N A--N -f-' 'W ,,f ' L '1'fm'f1 f '- 'fm--'1 -----'-IM'--W--f--W-------A-A1A. I..-.,..-...-- ,L,,,,,'K,A , ,. I I I ffl I I I I l I I I I I. I I I I I I I I Vlfm- , I ,Q ,-. .. , , .1 , I I ':',.,If-gEgIlfiIw ,,E.4b...,-... 1.LI5fII'Q'Q1.Q2-A-,,w...- ,Nfl 'IQI?Q,.,,Lf 1'fV3'QWA 39446 ,J X 5 I, 4 I 3253 I 'C wCM7 MNAARWCCFMMV V AM 'Mu W T-E'M '4'E A'E8 -fin-A'1'C I I 'W E' I I I I nfl I I I I I I I r IJ' I HELEN WILBUR - - Mt. Pleasant I I EARLY ELEMENTARY LIFE-JUNE, 1928 I I,-Q! .I Warriner Literary Society 1.927-1928 ' l Halen R. EfIII'nI.ons Club 'AI II I WINFERD H. JUDD - - - 0W,,S,,,, HIGH SCHOOL LIFE-JUNE, 1928 III Y. M. C. A., Tfreasurer 1928 I III Kelley Club I I If'orum I II , II ' II AILIE LINDROOS - - - Icaleva I JUNIOR HIGH SCIIOOL LIFE-JUNE, 1923 . , Y. W. C. A. I Q I III I , I I I EUNICE CROTHERS - - Petoskey I II HIGH SCHOOL LIFE-JUNE, 1928 Ol I I Cuophizes ' I Chorus I I LI . I I II I IQ . I II MRS. CARRIE SMITH' - - Atlanta If I II EARLY ELEMENTARY-JUNE, 1928 ,I I I' Helen R. Emmons Club I II HELEN DERSNAH - - Mt. Pleasant , I5 LATER ELEMENTARY LIFE-JUNE, 1928 ,I Ronan Round Table 'I Kelley Club I I I I I I g I , I LETHA WALDORF - - Mt. Pleasant V, ' I I HIGH SCHOOL LIFE-JUNE, 1928 fy I I Cercle Francais, Secretary-T1'easuTer 1927 I 1 Cliophiles. . f fi I f f. I I' I VERA J. BELDING - - chat-IQVOIX ' I I I EARLY ELEMENTARY LIFE-JUNE, 1928. JM' I Helen R. E'm'm,ons Club, T'rea.su1'er 1927-1928 I I Phoenix Glee Club I Y. W. C. A. II I Il I I Chorus ff' I I I Q.,M,M,m,.,.... I I I I , I Ip I I I ESTHER LOGAN - - - Bay Otty II I I 2 EARLY ELEMENTARY LIFE-JUNE, 1928 I I I Helen R. Emmons Club I I Chorus I II I I ' I I H. H. HURSHBURGER - - Banmstel I Il, JUNIOR HIGH SCHOOL LIFE-AUGUST, 1928 ,II D I HSIKX Men's Glee Club 'VT ' Inv! Chorus I1-E.. I hi, My-3 r Y I If Af-I -E I I I 1 I I FII, I fx I IQLTNI ,I Q1 ?'I' I I all QI I I I UMUAWAYAW , I f H II Igbg:1:4Hft p A-We I - ,R I ff Goiilsivffif f 'O I I-,II:If 3-1lIIX'l'1N'lY 14'-I w ' A I A -I W siV-:JJl1I':.ffh:h4e,:Lg I . I. ,,.OL2--..iI I1 - - .., J.. I I 1 .., XE -I 1 IL S -...A III I I I II 'I II II III I I 'I II I SI I I I I I I 9'f'ffQlIi?' I EVITMMIIV I IEW I ly , 3 I I I IN.,,,,,! IEiiffI ,Q I I II I A, III I I I I I I I I I I II I I I I II I II i II II If ' II I I I II I II I II I II I I II I I3 I I I ' I II I I II III- I II I II I II I I' I 'II I II I II I . I I ,I I If i III II II I I , ' I I II I 'II I Is I II I II I 'II I I II I II I I II I II R il, I II I I II I II I I' I Us I II I I3 I II I II I I I ' I I II' IIQL1 I I. ,L II ' f V' I II L14 .fi QQII I I ' x qv t qw' up M 3 ,,,,,...... ,..1.,.......-..- - fb C... f-,-,.........,.Q.,....-,,,,,.,,, ,,, 7,17 V -MV Y xrrrg vgclwr-U rv WMM uhm'-Q .WW . - l . 2-. . f' I .2 P .- I II-If LI-II. If I Q ' 1 I.A,,,f f ,, . ., .L I-, 'J A J . 1' I I ,,.g .. I -1 .X gif. uf, 1.1, N---.A.,.,,,-.... - -. --...s -..,.,,.-,- , ,-.......,H W H H- A N 2 Y . X XM,-1 Q rm- A W4 V , W4--i- -W f--W----iw-ff--A ., . - W.. 1 . . . , , Y H A www! Ei Q I l- --All , . ul! in . R I . I ' I -,X -. v ,,N, , 'I ,.., 51 'I-.' I . l 'l ' ll I I I P I . I . .. , I ff 5 . . l -,. I X - N if NELL JANE DAMON - Mt. Pleasant -. SPECIAL ART LIFE-JUNE, 1929 .U LNIJI I' Warrineo' Literary Society 1927-1928 M H1 Women's League 1927-1928 I Il I .W Y. W. C. A. 1927-1928 . I 1 I : HOMER HUNN - - BI'cclccnI'iclge Qs. HIGH SCHOOL LIFE-JUNI-3, 1928 M lgi Band 1927 f I 'Il . III .15 I I I II . , I I 'I ll ll I 1. 'I II II. I Il SID SWANTON - - - Gladwin ill . . Il. HIGH SCHOOL LIFE-JUNE, 1928 ll I I 'l l I 1 ,. Baseball 1928 lI .II :I Y. M. c. 11. , E ll VI ill .II Il , I I lil . III ll ll Ml , . R 2 I1 MARJORIE OVENDEN - - ltlmcu II X I l l JUNIOR HIGH LIFE--JUNE, 1928 I 7 N Ronan Round Table Il l 1 I lI ll 1 . II . - WILLENE VER DUIN - Gl'2II1fl Haven l ' EARLY IELEBIENTAIKY LIFIQ-AUGUST, 1928 Helen R. Emmons Club li I I 'I ll I 1 RAYMOND NASH - - - C1111-U HIGH SCHOOL LIFE--JUNE, 1928 9 Senate, Vice-President 1928 E LI 1928 CHIPPEWA Board I l Ii So This ls London! H I fl Wande1'eI s Club . l , Debating I, I III I 9999 If r MELBURNE F. JOHNSON - Cadillac I . I i 'I l I l l I , I MANUAL ARTS LIFE-MAIICXYI, 1929 IH I I 5 Wande1'e'r's Club 1928 l l Y. M. C. A. 1928 I ll I I l. I lll I l SHERLEY I. DALTON - - Leland E COMMERCIAL LIFE-JUNE, 1928 HI I I Commercial Club 1927-1928 I ' 1' l I QI BEATRICE BECKMAN - - Scbewaing X 1' l l MUSIC LIFE-JUNE, 1928 ' 1 l i Philharmonic Glee' Club 1926-1927 li MacDowell Club 1926-1927-1923 gel I I 1 Orchestra 1926-1927 I I i Chorus 1926-1927 I Band 1926-1927 ill . II II l I ll DONALD GAGER - - - Carson City LQXI I V11 HIGH SCHOOL LIFE-JUNE, 1928 F511 Men's Glee Club 1927-1928 IQEJ E 'hi' MacDowell Club 1928 ff li I l Chorus 1927-1928 Y Il I l I l li 1522 IQI I . .,. .... . - I I X '1 ' ' - --1- ' 1 ' ' ' ' ' 'f ' g .'C 4,--+------- -- ' --f -2' GV,-1 .J ,, -- - H 1 . - Ln ' - K in-A -0-hm-'Aw Y -- - 7 ' Z ' 7 I . M. MARIE JEPSON - - Clarksville I li HIGH SCHOOL LIFE-JUNE, 1928 'GU FT? A I I A EAI? iigjiiiggei:eigiiigiiiii 1,Lff, O ig SIOACQQQDQ Q4 I I l R QL l gc, I N . , F- if Ii I I ELIZABETH PLUMB - - Saginaw Il? I I I ll 9 1 EARLY ELEMENTARY-JUNE, 1928 l 1 I Lucy A. Sloan Literary Society 1927-1928 1 l 1 Vice-President 1927, President 1928 Helen R. Emmons Club I V 'll l l l IV l Y I itll CAROLINE RICHARDSON - Bay City 5 lil W EARLY ELElvIENTARY-JUNE, 1928 ,I Orchestra ll W ,N I II? EVALEEN MCDONALD - Mt. Pleasant I I ,I E ll HIGH SCHOOL LIFE1JUNE, 1928 II . Cercle Francais 1927-1928 if I V i Mei-eier 1927-1928 I 5 I N fi I 1 I' ' I I lx ll ' Il I l ll MARGUERITE WALTER - Breckenridge if I 1 HIGII SCHOOL LIFE-JUNE, 1928 K Y. W. C. A. r I l 1 l Y lv I II l ll Y l ETHEL WALTER - - Breckenridge Q QI HIGH SCHOOL Lim-DECEMBER, 1928 1' 1 JM Y. W. C. A. 1 l ill ' I i I: ff l i I l I 5 lil T L A li MINA 'BENSTEEL - - Farmington I Ill i- IW, I I 5 igg HICH SCHOOL LIFE-AUGUST, 1928 Il? Phoenix Glee Club ' ll l I Il H g lx Y. W. C. A. I I lil Kelley Club A E IQ! Chorus I I Qld 1 L BERNICE MADISON - - - Flint I I ji EARLY ELEMENTARY LIFE-JUNE, 1928 1 Helen R. Emmons Club ii i II Orchestra A QV i E e 1 I i lip II g I M MARIEWILL SCHINDLER - - Bay City is 1 ll EARLY ELEMENTARY LIFE-JUNE, 1929 l Pi . li Helen R. Emmons Clube W, 3 l H li' l I I 13 I lil I il! I 5 li ELEANOR WILSON - - Greenville L EARLY ELEMENT II-'E NE, 1928 ll f-'if'N ' ' I 'UK ? Hel n Em o Club gba! I? ll I f i SLI I 'C iii 4 - 5 iii-aw 4 I I iiiie I .,.e,Q1 Viff?55522-,y17gjg3 h ig g W 'Wm: T'TC -W-W------3745143iilli'illIZlZijgi,11T2Qg.,L,1jfg:gg,jg. WQLQQLTQLAYTZAE if.-4 2 M,1.3C5i5w.Il4iNmm1'ligm-NmWWwmM Tb Jmqmwq 'Iifmzll ElG,ll,'l'Y 9 f IPF C 737571 FRES1-IME Back Row: Lucille MacDonough, Reva Derby, Mina Collier, Katherine Briggs, Miriam Mienzen, Florence Beltinck, Buena Wilson, Margaret Erwin, Marion Bowers. Second Row: Bernice La France, Elna Aurand, Gudrun Christensen, Lorraine Rossman, Carrie Arbogast, Virginia Blucm, Helen Kates, Ruth Ulrich. Front Row: Louise Frederick, Beulah Inch, Ellen Mullaly, Nadine Delling, Evelyn Beamish, Edith Milarch, Frances McIntosh - P , E Yr, Back Row: Bernice Patte1'son, Marion Davis, Marion Rhodes, Mary Pence, Dorothy Iverson, Janet King, Marie Sander, Florence Nelson, Opal Lamphierd. Second Row: Margaret Quinlan, Gertrude Chellis, Ruth Stone, Mildred Pobanz, Winifred Scharr, Marion ' Law, Beulah Pomeroy, Evelyn Barber. First Row: Delma Watson, Nina Reed, Mrs. Mabel Wheeler, Helen Hass, Florence Rohr, Hazel Van Etten, Helen Racignol, Lorena Vibber, Margaret Gohsman. I il, +w'3y A 75 LQ E me H ii? mg, ,f if f 1 i , , , X. ,4.w, July! , gg, 'X H---ae ffl- Wfj-ff' 'f f ' i D, Z VA W , , W A . H- A ,, ,,T -1-----U L ' if' 1i'5fl'Z :7'f'mi 1 W 'Y WWI' W , . f i i gps. , i ,i l l 1 l K' i li l , r I ' li T - ri l J i l i , l i 'l i i Q vi i Q lll l i , ,i l l M l , i Tl X, i li Back Row: Gladys Fox, Helen Drushal, Mrs. Nina Moore, Evelyn Baker, Margaret Galloway, Avis N l il Larsen, Lenore Wilson, Arlene Shanon. , i Third Row: Helen Moore, Dorothy Hubbard, Betty Somerville, Margaret Cameron, Ella Mac Johnson, i li Lena Cadwallader, Lila Gardner, Helen Kellogg, Frances Fish. i Second Row: Roselle Curtiss, Opal Bradford, Louise Lashbrook, Edna Smith, Agatha Woznick, EiTie -'1 1 v li Lambert, Loretta Hiller , l First Row: Retha Brookens, Beatrice McCarthy, Ruth Isbell, Evelyn Sovereen, Elna Aurand, Gwendolyn 'il Bristol, Velma McKnight, Doris Hensley, Joyce Disbrow. l ,l 2 Wi i' fi Q' V ' l 2 W 1 1 ii l i al l l i l ii i Y li 1 i U i j i 1 . Y, . , I 1 1 l Baci ROW' GV Gndolyn EVHUS1 BGSSIG H91lbFOHH, Betty Curtis, Katherine Wilber, Thelma Eaton, Alice i l Third ROW. M U LHRUC, AHhiG.ClH1'k, Leone Cadwallader, Gladys Rockett. ' ' aigautnsihagctolvv Mafle SGHKG, Pauline Burke, Helen Niles, Theda Cline, Margaret Armi- age, 'ua o inette, Jeannette Watson LaVern Latham H l ' M' ' i S d R : D i - Q , , een 1lle1. fir econ OW MIS' Ruth Mullet, MIS- M9119 H-alght, GGI't1'1ldG ShOVaI', Velma Williams, Marguerite Sage, S l Gladys Knight A - l , gathel MCCl1HtOClC Margaret Dou 'ht 1 F. t R 1 . X ' , ' 4 - ' 1 g y. I irs ow Mlldied Milaich, Frances Ernest, Esther Lax, Inez FOX, Irma Buffordy Edna Wendt, Joyce Ellsworth, Ione Spencer. 11 . Q J . T l 7777777717 W 7 N l Back Row-Ethelyn Dieterman, Eva Floria, Mrs. Martha Carter, Eva Baker, Florence Franili QEdith Miller, Arvilla Shclldrake, Greta Merrick. Third Row: Marie Laarman, Louise Blevins, Margaret Kelly, Anna Ferrigan, Helen Frazier, Caroline' Garety, Theresa Randall, Agnes Sabin. Second Row: Rosalie Morrison, Ruth Davis, Genevieve Schofield, Helen Ulam, Mabel D'Lamater, ' Genevieve Walker, Gladys Shepherd, Adah Whaley. First Row: Mae Witmer, Florence Herwig, Ruth Pettit, Ruth Hicks, Emma Rogers, Vera Kratz, S-' Mai-ion Fuller. xi, 1 r A X' Back Row: Norma Gustofsen, Esther Vanl-Iolt, Agnes Prout, Falice Day, Ida Rollenhagan, Marjorie ' Hileman, Laura Thompson, Vera Cutting. Third Row: Florence Dunn, Marguerite Forrester, Marguerite Hodgins, Eleanor Mork, Gwendolyn Harrison, Avis Young, Eunice Noble, Anna Bricora. Second Row: Evelyn Fuller, Beatrice McKeighan, Arlena Gurden, Rachel Meyers, Thelma Barker, Fleda Van Campen, Louise Monteith, Esther Reid, Helen Kellogg. First Row: Gayla Wiley, Julia Britton, Vivian Hetzman, Vivian Hutchinson, Kathryn Tumath, E. Louise Robinson, Hannah Cuthbert. D f ,Bd '30 J r w NX' . ,JV E I X . ,vi j ima A-X 2 I, .3 S . 1 min iuutsm ..-M - '! . ' - -0- hn Day - , . I-lodgg, Raymond Kniffen, GGOIDC COIIWZY, -TQ - Back Row: Byron Johnson, L09 Alkbni Holace Arley Reed, Palmer Kerri, Austin Hall' 'lh l R J k Kelley Louis Kelley Harold Curtis, RaylY10f1fl NVhi'Ct3l, Elmer Wilson, Robert Hayden, ' in OW! 80 1 ' ' Lewis Clark, Arden McNeil. 1 Q I S d Row Allen Rockwell Perry Critchell Wallace Johnson, Fred Phillips, Lyle McNett, Marvm 1 n I 1 ' Leo V Jones, Leo Wallafle- Front Row' Merle Wheeler Arthur Clark, Kenneth Tinker, Leland S3'Wye1'f David Ackerman' Clayton Demo, Duaine Bastian, Richard BilCOX. 1 ,,,,,,, , ,Y -V Back Row: Paul Munson, Archie Bremmer, Willis Lane, Lewis Thompson, Lawrence Brown, Murray Young, Warren Kooprnan, William Miller, Samuel Davidson. Third Row: Andrew Olson, Donald Messer, Willard Crapo, Aldie Long, Myron Curtis, Raymond Lenhart, E Cleland Beamish, Harvey Essenberg, Gordon Bliss. Second Row: Kenneth Schultz, Archie Walters, Frederick Mole, Elton Tubbs, Cleon Rumbaugh, Ralph Johnson, Eldon Robbins, Bonner Crawford. First Row: Joseph Kirkey, Wilbur Gordon, Harry Dunsrnore, John Plankhurst, Kenneth Bristol, Clare Shaffer, Carl Munson. X f , ! N: I I r k W V x '1 A r XJ if 1 x n i , I w a A K ' i w I I 1 J W 67 W7 Q53 'ww MMAMMMM 'NM mmMM!'wWW1QwmWw2ZfRiYfQl '4' lgmf' iff? ,,,..,-.,,. -. .,.,- ... .v..- M.-. ,..,.-- --if---r 'J 'A 2 f- -- f -'-- - -- -' - 'l 'i' T KiEE kX S-vlGC,iQ:KQx'iL'f5. Y21f'Pfi2 I J! V7 Af-41' ?, ,wg fi XY Q l i I , ' 1, J i 5 .J 3 . F W J 1 v h M in . 1 , 4 p Z m l i 1 . E 1 W E ' 'Q 2 3 lf-if 'ff-ffm X' K 'x 1 N LJ K ff ,.l,. 7. lE?'iT5J ggufii lff51JgQ IQQQ M' M' FQJ r-- .5 -h W ACTI ITIES f?gW - 3 EQFI ,XQ1 ,X Aj HNMNMHA-mM,wQW. M ,Wk,.,m,--,.. mW..-U-mMv.mWnN-.-M-.mwMwuu, iQfy,7 .q. Hfgxxqqfw- HHWNM -- --- mmf 'N Mm 'mN'WW7,f' 4 f' QCD xv V' 'nfl Cr iii fif-Qjfgy----WJ L- --A - 'W xA'- ' 4'- ' ' -' 'N M 'A' mi'f1?i,f, 1'-igiji i'if4,iiiiAiiMf':5TiqlgfiwI ff if ,..-,..,,.,. ...---- -..u--'1f::f -- ---ff--J -Q:-V ., 'AT ' 'TPL' ' 'J' MY Y AM' Y Y V il V Q 7 I .3 ,153-',' n f -1 . -fl -4 I 1 U U U. V, 3: ,YJ ' i1jf,Q,f 1 - Jim, 1- li-.. .L -.. 1.71 'K 4 1 1 f if i f li 1 H fl rf! 'Q lli 'T ' J Z ,M 1.3. v,,-,, i..-,-,,1 f-f Q- f- - - ' ' t ' ' K ' ' r 1 f a Social Activities Grow in Popularity Dance and the World dances with you, on the sidelines you sit alone. This expression has been especially true since the Winter term when the PE girls held night school to teach Wallflowers how to on With the dance I Dances, teas, entertainments, plays-all these make one round of gaiety at Central, and they're spread over the Whole year. In this section, the editors have tried to present all the parties the average student would remember, and to mention the others. Each organization began, during the Winter of 1927-28, to plan parties for its members as a regular feature of the club program. These, of course, find no mention outside the club histories for the year. Forewords can only list those activities Which have not been treated fully in the following pages. Possibly the Lyceum course pro- grams should appear, and assembly speakers as Well. A college annual is a vehicle of limited capacity. Professor BeddoW's one-act plays de- serve commendation, as among the year's outstanding entertainments. Teas and Banquets! They make short afternoons and full even- ings. Every free afternoon near a half-holiday is an excuse for some alert club to sponsor a tea. The sponsors shouldn't'offer such good food. When teas are popular, even with the men, there must be a reason. Speaking of afternoons, the fall term gave occasion for several Well-attended afternoon dances on athletic Week-ends. l 1 1 I l I 1 if 1 1 1 11 1, 1 114, -. I .1 1 , 1. 1: 1 1: . I 1.. ir. 1 fn, 1 l 1 11 . 111 1 I.. 1. 1 I 4 1 . 1 1 I 1:11 in 11 1 1s 1 . I 1 1 I 1 11 2 1 11 11 1? 11 1 1 I 1 1 1 K .1-1 fr, ' ,.-17, .41 1 1 1 1 4 1 I - 1 i 1 W.. 1N.w . - f -I --fI.e-.-..3..... Y ,. --.I - .za.-..p:.......-...- --.g W.-- 1 1 1 . 1 1 1 3 1 Physical Educations Stage I1 Clever Hallowe'en Party 1 - - 1 HIS is station C. S. T. C. broadcasting from way 1 up in the gymnasium overlooking the ballroom 11 floor at Mt. Pleasant, Michigan. 1 111111 Here we are on the wire again folks. How are 1 1 111 you all? 1 I surely thought Pd never get here tonight. Was 1 1 me-t at the door by two white ghosts who instructed me to go up some stairs, then through a room and up 11 more stairs that were winding. There a witch walked -11 111 around the balcony with me and took me to some more 1 1 rooms and down more stairs. In one of those dark- 11' 111 EMMA DOERR ened places I went through what might be called a re- 1 ' ceiving line. But what a reception, of cold icy hands 1 1 CHAIRMAN and white shrouded figures. I may be considered old- 1 fashioned but I do hate to shake hands with people I 1 1 1 U11 don't know. By the way, folks, this party is given by I the Physical Education Club, and one surely could tell 11 I it by the strength of those hand grips. 11 1 The Gym is transformed into a typical October 1 ,seg scene with huge shocks of corn and golden pumpkins 11 511 ,,- Fl strewn around. The ceiling is a compact mass of 111 orange and black and makes a pleasing effect. I Quite a crowd has gathered and I do believe they 1 are going to.play games. blow you see I'm not the 11 COMMITTEES only old-fashioned .one 1n this crowd. Every one 1S 11 1 111 enjoying himself immensely and the witches and 1 1 11 Pmgmms hosts are uite a sensation - 1 '1 Com LANE g q ' 1112 Miss Ryan is rushing around calling out direc- 1 '11 tions-I guess we're to be treated to a farmers' barn dance. And what nice looking farmer boys those 1 Decowmom Physical Ed girls make. Andi now it's a witches' 1 1111 Lois MCMACKEN 1 11 dance. 1 Wooley's orchestra just arrived on the scene. I 111 1 1 .li reckon we're going -to have some dancing. 1 1 . Well, folks, I just wandered down stairs and par- 1 1 took of some refreshments. Real cider and the -best 111 1 11 pumpkin pie! It tastes like more. 1 Old Father Time has been steadily ticking away 1 31 11 and once again it is time to go home. 1 1111 This is station C. s. T. C. signing Off at 11:00. 11 1 . Pleasant dreams folks. . 1 1 11 11 I 111 21 W5 'Q11 119 D221 I... 1. 5,111 11 J sf. . 11.65 1.11, .11 -.n-m.................,..,.,....n....---..- W . . ...--..-.-.-...-..,im,,E1 11 1 11 . .... .H i5.-5ff15i'f3g3i?if51:2 .,., - .1 . .1 J f , 391257355213 '1 1 Pseudo Men Attend Co ed Prom HIS is station C S T C broadcasting tonight foi the first time from Way up in the gymnasium NELL JANE DAMON CHAIRMAN COMMITTEES Favors and Prizes BETTY CURTIS Finance BERNICE BRONDSTETTEK Advertising DORIS MINOR Decorations and Music JANETTE ADAMS Refreshments VIHGINIA MULVEY Programs and Tickets RETHA BROOKENS overlooking the ballroom floor at Mt Pleasant, Mich igan. Hello, folks, isn't it a fine clear night and not much static in the air either, but I should say there is plenty in this room. It's surely quite a sight, and cer- tainly a scene of merriment even though members of our stronger sex are conspicuous by their absence. The patrons and patronesses of the evening are Mr. and Mrs. flrma and Vondaj Leflerg Mr. and Mrs. Major-alias Miss Edna Hifelbronn and Miss Amy Wold, George and Martha Washington, Mrs. D. W. Frear and Dean Bertha M. Ronan, and Mr. and Mrs. -otherwise Mrs. C. C. Warriner and Mrs. I. A. Bed- dow. . Everyone seems to be supplied with clever, red dance programs. They might give me one. The gymnasium is attractively decorated with pas- tel-colored streamers in a May-pole effect, which is es- pecially becoming to the orchestra's platform. Speak- ing of the orchestra, it is the Sissie Syncopatorsf' and confidentially, looks to me like Wooley's faithfuls in disguise. A march or parade is now forming. This surely resembles a great pageant revealing all nationalities and races of people drawn together in mutual interest. Well, Well, can you imagine it. There is' the Wiggins family and if it isn't Neva Fliegel and.Lois McMacker with Frances French as the baby. The judges are awarding them first prize as the funniest group and they surely deserve it. Helen Naumes and Marguerite Lytle as the Jack of Clubs and Queen of Hearts were just decreed the handsomest couple at the prom. They look pretty ine all right. More surprises! A wedding party is forming and yes, they are going to be married. Miss Josephine Rogers is the blushing bride and what a fine minister Nell Jane Damon makes. -Refreshments are to be served at the Campus Cafeteria. Hope they don't forget I'm still here. Back again and so soon. Some kind soul carried me a bottle of pop. And folks, while I was drinking it the orchestra played the final dance and now the crowd is rapidly dispersing. .Guess I'll go too, that pop made me hungry. .Signing ofif at 11:10, station C. S. T. C. Good- night everyone. l 1 1 I l 52, N, 1 . L , A X M.-1. .4-, i 3 w 'M . - 1 1 3 'ml I l V1 l 'F l 3 l i F , 5 'ef--' ' 1 .V ll r l nl . gl. l :l .l M l1'E JE ll .l, is il 1 1 :li M., i .SH li gl w 1411 .1 l l 1 fl 'I li yi f , . .yi 'al eu 'F x, 1 , . .,., WN, ...-...-. ,.,,, .?j,M.,, fe... .,,,,.. -.,.. W ,,,, .., .,,.,, W Y 'S .nf ri 2 l 'X f 'x' ' . J one . -.l.97if L, X-- gw.-f Q I -g. .1 ,rl Sym' N, GEMM if S ' 1 f i .4 1- - . .X . . ,. ,- --,,,., -,.,,L 444,-1 f X- - - Y. , , , v ,...-...E 7-.,......- .V.. .-... ..,.s. -, .. .... , A ..,...- ,,- V 1 Ax 1 -Y A ,nur r l ' x is 2 ll .z 'il X yl 51 ll .l Sl ll ll l 'm ,u fl .1 ra L1 '4 ii 1 l 4 Rachel Tate Gives Chr1stmas,Party 4,1 Ez. 3 I il - ' l 1' HIS is radio station C. S. T. C. broadcasting from way up in the gymnasium, overlooking the ball- li Mig room floor, at Mt. Pleasant, Michigan. 'Q Good evening, folks. The annual Christmas party is in progress. A few early comers have just gone Q. U1 through the receiving line and were greeted by Zeta lj ll Thomas of Hemlock, Ruth Ranney of Saginaw, Miss .. Fill Josephine Rogers, Mr. and Mrs. Rolland Maybee, and ll Dean and Mrs. C. C. Barnes. Smiles on the faces of 1' all are a sure sign that it isn't only little children who believe in santa. oieue. 45 ,lg Glance around the room. What a huge fireplace A greets our eyes. It looks almost real, folks, and on ,p f RUTH RANNEY the mantel are stockings hung and all filled. Santa GENERAL CHAIRMA Claus must have come early. From within the fire- N place comes a strain of music. Yes, it is Wooley's or- 'H ll chestra and it surely sounds as if they too have caught 1 the Christmas spirit. Three huge bells hang in the H Q , center of the room. Ah! a crowd already has gathered f and the party is going fine. , Here we are again after intermission. Had to go 5. W over and visit with Miss Rogers. Everybody seems 'f 4 '? , happy tonight, and how time flies! A feature dance- j l l M ' The Jingle Bells, and Skating by the Rachel Ta-te ' 5.1 girls in costume. Can you hear the encores? ,a 7 COMMITTEES Well, well, would you believe it? Santa Claus Nl Dec0,.ati,m himself just same right through the chimney, jingle 5, '1.l FRANCES FRENCH bells and all and a big pack on his back. He is hand- ,ij T Y P,.0g,.am ing out favors of little stockings filled with peanuts . l. DOVROTHY LARRABEE and candy. Canft see Neva Fleigel in the audience. j Advertising It looks suspicious. REVA DERBY I-Ie's gone now folks. Music is starting again. ll Favors The last dance already. Time surely does iiy at fl EVELYN CHRYSLER these parties. Well, folks the place looks quite de- ' l if serted now so we must leave too. :a ill - This is station C. S. T. C. signing off at 11:05. ll Goodnight everyone. all . K .l ll qw I l l il X2 w l,2,5,k 5 gl V ss a 1 C, - . .... , We li . H.. ZA 4 l P I t 1111 11 '11 11 11 l 1. l, 15 l ll I. 2 1. 11, in: P 1 1.11 1,1 1, 11 1 I 4 1:1 1 l, 1 L 14 Q 2 1 1. 1 1 .1 ' 1-1 ,1, i 1 11 1. 1 11 1 H1 n A ll 1 .1 ,1 1 1 i 1l1 T 1 1 1, l 1? 1 1 5 A 1 Nl 1 1 1 1 1 1 l 11 l'l l .11 1 1 1 1 1 11 1 1 11 1 1 1 1 11 1.5 as t'rt'igi:,T ,gg,I.L3Zm-.'..'3.TlZr,,,,,n,'j,Z1ig:' 1111.., TQ! ..,,,,gX -.1, .3 S . Z.'j5179'Q.ifsif?..11.,-.,-o 1,11 .1 1 - -A.,i..r,f:1Qlq'g,Q, Q 255-. gl 1 .. 11531 ' 0 0 'li-V W arrmer George W ashmgton Party l 1 f., Q-1 1 -- 5 1 I-IIS is station C. S. T. C. broadcasting from way up in the gymnasium overlooking the ballroom lil floor at Mt. Pleasant, Michigan. Good evening, radio audience. Tonight we're celebrating George Washington's birthday and the E21 Gym is .most effectively decorated with hatchets over the doors and windows. Pa-triotic colored streamers are ill hanging from the balcony and in the center of the l' room hangs a huge mass of vari-colored balloons. 1 At the door the guests are met by Beatrice Mc- l l Carthy, Mt. Pleasant, whointroduces them to Dorothy Botsford, Saginaw, Edward Finch, Blanchard, Miss 1' T Amy Wold, and 1Dean Bertha M. Ronan. 1 I W D B 1 The orchestra is seated in a bower of lattice work 11 1 OIEEIYRZRMRSSORD and cherry blossoms. It's Wooley's music makers. I1 ,V What could we do without them? There's a good crowd, folks. The Warriner girls COMMITTEES are the hostesses of the evening and they are all wear- 11 2 11 Dec,,,.at,0,, ing a felt W symbolic of their organization. . l BEATRICE MCCARTHY The orchestra just announced a Leap Year l 1 11 BETTY CURTISS A dance. Step right up and ask him girls, this is your 111 111 Com LANE chance to havethat longed for dance with your favor- 1 Ref,.eSh,,,e,,,s ite. Quite a few young men are standing in -the stag A 1 SARAH LEWIS line, a blow to their pride I guess. 1 A nice young lady just brought me up a glass of Q1l 1111 punch. It's cherry, and tastes mighty good. 1 Intermission, and everyone is crowding around a 1 circle in the center of the room. Now I see the reason, .1 Virginia Hatch and Irma -Sundling are givinga clog 11 dance. Judging from the encores it must have been 1 11 great. 11 111 Another clever feature, this time a Girls' Rob- 1'll ber Dance. The girls are mighty good sports to- 1111 night, and are tagging the handsome young men. It 1l1 shows the popular males and the best dancers. Now ll the boys can take their turns at being wall-flowers. 'ml 1' It seems a shame that such a nice party has to l 1 end but that's the way of it and the Gym is rapidly f emptying. 1 3 E1 This is station c. s. T. C.. Sign-ing off at 11:05. 1 Goodnight friends. 1 e1 1 February 18. 1 V 1 l 12 1511 f 1 l3.L,,fil!11 if Ml T--tg 1 1 1f21,-il 1 4-1, 1 1l l .--.:1T,..,.,,:,.:,,1 Lg: f 7 mm 7 1 3 1f1f'i5jjJfQ 'iii' 1 H giwl 'r 'ii 'yQijiQi1ii1iiTQiiiiiii fg.,gWfrigiii l 1 9-l'rri1l.4f1f-f!flg .... Ll -M ' 1 'L '1 ' 1' ,ff ,1Q.1,,-Q , U :mmm -- l a 1 Gsm, MUNsON CHAIRMAN COMMITTEES P'rog1'an1,s and Favors RALPH JOHNSON Decorations DOROTHY LARABE1: Refreshments MURIEL TRASK Finance MURRAY YOUNG Adizcrtising LOUIS KELLY Freshman Flurry HIS is radio station C. S. T. C. broadcasting from way up in the gymnasium overlooking the ball- room floor at Mt. Pleasant, Michigan. U Good evening, everyone. I came down a little early tonight so we could look over the place before the crowd arrives. The gymnasium is transformed into a lovely ball- room. I hardly recognize the place, a few decorations surely can do wonders. , Long strings of hearts extend from the edge of the balcony half way to the floor making a most pleasing effect. The ceiling is a huge American flag and in the center is a miniature aero- plane. Around the room are chairs and divans with shaded floor lamps throwing out a gleam of light. The' chairs must be for some one whose new shoes hurt. At one side is a mammoth valentine reaching from the Hoor tothe balcony. I do believe it's for the orchestra and they are already in place. The receiving line is composed of Carl Munson, Mt. Pleasant, Lulu Dargitz, Blanchard, President E. C. Warriner, Dean Bertha M. Ronan, Professor and Mrs. George R. Wheeler, Superintendent and Mrs. P. G. Lantz, Professor and Mrs. Harry A. Miller. Honored guests of the evening are Professor and Mrs. O. W. Troutman. The dancing is starting and just listen to that or- chestra. There certainly is a crowd tonight and not many late comers either. Dan Cupid is in evidence 'all right or else I mistake the meaning of those smiles and sly glances. The Grand March and so soon! ' Carl Munson and Lulu Dargitz are leading while Joel Gibbs and Edwina Eckfeld are bringing up the rear. . At last the punch shows up, and wafers too, served by girls in red dresses with bands of hearts around their heads. This is a grand party folks, and such music. Ah! Hilarity begins in earnest. The aeroplane in the center disgorged in a myriad of toy duplicates which are falling upon everyone. One just missed Prexy, and now serpentines are descending. Why folks, it's over all ready. That's a shame. I hadn't even started to be bored. But as long as the crowd is leaving we might just as well go, too. This is station C. S. T. C. signing off at 11:50. Goodnight folks. February 11. l l l f x ll i l I 1 i i l 1 A .1 l V rl l i w r '1 i pages .J.s----ea?lQ'ajgi.Li3He 2i-.ei+Q35's,gQ 4 A F ...M--T. M Q., O Wanderers' Ball First ,Q Party in New Cafeteria sn V 1 HIS is station C. S. T. C. broadcasting from way ll up in the .Women's Commons of the new Admin- p l istration Building, Mt. Pleasant, Michigan. g 1 Good evening, radio audience, here we are in a ll l grand new ballroom of Gothic setting, a beautiful , T ll place and just large enough for a lovely party. 3 The receiving line is composed of Mrs. Julian ' l Spencer, George Conway, Miss Margaret Patterson, . Dean Bertha M. Ronan, Professor and Mrs. K. P. . Brooks. . 1 y I was a little late tonight folks, and so the dancing l ll has already started. Just listen to the orchestra of GEORGE CONWAY Wooley's. They certainly are going fine, some en- il CHAIRMAN thusiasm over this new ballroom of ours must have in- V spired them. T Had a long ,talk with Dean Ronan just now and COMMITTEES she, too, is all excited over this initiation of the new Q p,,,g,.a,,,s cafeteria. P I ROMONA SHACKSON The Grand March is now forming with George ' FRANCES FRENCH Conway and Miss Margaret Patterson leading. It's a 2 Favors iine looking crowd here tonight, it must be spring that . MARION SHACKSON makes everyone -look so happy. The favors are clever. , ' DORIS MUSSER Umbrellas of pastel colors are being handed to the l Ref?'eS'W'1-'mis ladies and gentlemen are given canes with balloons tied I MRS. MTILLIASATSPENCER on the handles. ' ON A grand scramble is ensuing as to who can break 1 the most balloons. Well, that young fellow got what p was coming to him all right,-I guess intermission is T going to end the fight. A l Couples are wandering aimlessly up and down the Q halls. They're about as impatient as I am for the U music to commence again. 1, p E Punch is being served from a long table in the T 4 Woman's Commons. It tastes mighty good to me. ' T The music again and that orchestra is peppier T 5 ' il 'than ever. They surely are good tonight. p .p l What? Is the party over so soon? Like Cinder- l 5 T ella they vanish, but at the stroke of eleven. ' l pf This is station C. AS. T. C. signing off at 11:02. B y p Goodnight folks. I . ,lv F l ll l dl ff?-. Lil. 'Pl ' T Sill 1 ---e g-H -Me ...cw .-.V .,.,:,-..,-,.. .g x , V Q, QT p 'rf' L-le H LL -f---eAe K- ve 3- -L i 'i11iTT'ji rgii:ii:.ggi.g,4gg3gg.g: .g--ggg.f 'ii.'T.g1jT.j W evee H A- G I X EVELYN FRY CHAIRMAN COMMITTEES Decorations ISARELLE LEXVIS Favors SHIRLEY SMITH Press Notices DOROTHY MARTIN Poster EDITH HINTZ Feature Program RUTH RIXNNEY Ref1'esh'mcrLts MARION SH ACKSON Follow Up Committee SARAH LEWIS Programs DOROTHY LARABEE Orchestra Lois MCMACICEN TIT 5, ,,,g',.,f ll,l, V, Vb,,,,-,fl I Dormitory Formal HIS is station C. S. T. C. broadcasting from Ronan Hall at Mt. Pleasant Michigan. Good evening, radio listeners. I'm witnessing a beautiful party tonight, surely one of the loveliest of this year. The dining room of the Dormitory is trans- formed into a bower of cherry blossoms where strains of music add to the enchantment. Soft, shaded lights lend a mysterious beauty -to the scene. The guests are greeted at the door by Mrs. D. W. Frear and Miss Beatrice Nelson. As they come in I don't seem to recognize many of the young men. It must be the girls are showing off their out of town friends tonight. I I've been looking around the room again and noticed the lattice work of cherry blossoms covering each window. Japanese lanterns are hanging in the halls and long, tapering candles light the drawing rooms. This floor is ideal for dancing and WoOley's orchestra couldn't be better. The girls are in their best gowns tonight, pink evening dresses seem to be most prominent. It's intermission now and couples -are strolling about the halls or resting weary feet by sitting in the lovely drawing rooms. While I was wandering about I found some delicious punch in one of the parlors. I intend to go back for more when the crowd disperses. The dancing is resumed again and I have been talking with Mrs. Frear. She says the decorating com- mittee should be complimented upon their success for transforming the ballroom into such a fairyland. The orchestra just announced the last dance but upon special request they are playing the third extra. As the guests leave the ballroom they are forming a line and at the door Evelyn Fry and George Conway are handing out favors. The ladies are given powder boxes and the gentlemen pencils. As though loath to leave, couples have congre- gated in the drawing rooms and halls but at 12 :OO the Dormitory doors are to be locked and the lingering guests must depart. This is station C. S. T. C. signing off at 11:45. As tonight is our last party until next year, I -bid you all farewell. Good luck folks. May 12. il T Mi ,Y 7 An LL A g ,,-, MA, ,-,W MA,-, A.. -..,.H...--. -L-.,..,-. A. 4, ..,..,1. :.,.r..-- .... W, 1.-,....,., 1.1--,..1, ' , 'ff rrvaj., J , ,x.I, xl. I, li X. E , U2 lllilhy E io I fl fe yy -I TH, 1 , X Mixed ll 3 ' lk , a - 4 I ,, l 1-as lui it CHAIRMEN Decorations ETHEL DUBY Sponsors GAY EMORY 1 Orclwslgra IIELEN WI1.nU1: Finance Doicorur MARTIN Favors J ANETTE ADAMS Programs and Tickets TIELEN KATES Refreshments ISABELLE LEWVIS Publicity DONNA BARNES .,a....,....,., -f. ,1- ww., c....-r, me-, A,.....,.-. N-fe ko, .lf t --am., fi e. M-fa W....-...-,-r.-.-I....,r,m.,M, V 4 'Women's League Formal Completes Social Season HI-S is station C. S. T. C. broadcasting from way up in the gymnasium overlooking the ballroom floor. Good evening again, folks. This is a big night, the Woman's League Formal, and it's surely one 0 the most successful parties of this year. We are in an old-fashioned garden. Hollyhocks surround the walls and in the corner is an old stone well, it reminds me of the old oaken bucket that hangs 'by the well. Rustic benches and wicker chairs add to the comfort of the scene, and there is a real old-fashioned foot bridge leading across a tinkling stream. Roses are climbing up white washed lattices and flowers are abundant everywhere. Why, folks, I'm finding it a pleasure just to be in this lovely place, and judging from the smiling faces of the guests others are enjoying it also. ' A ' At the door everyone is greeted by Lynn Corwin who introduces them to President and Mrs. E. C. War- riner, Dean Bertha M. Ronan, Professor'and Mrs. J. Harold Powers, Irma LeHer, Rolland Hass and Nell Jane Damon. . r The programs are a picture of an old-fashioned couple, quite in keeping with the spirit of the evening. The orchestra is at their best. It's the Keithstone Revelers from Lansing and they surely are good. This wonderful June night would inspire anyone. Miss Ronan just came up with a face wreathed in smiles., She is remarking about this lovely party, and how beautiful the room looks. Intermission! It must be they are having it early tonight. And refreshments are the next order of the evening. ' , , - That orchestra's just about right. They didn't drag on with intermission and are already tuning up for the next frolic. The Grand March is forming. It certainly makes a long line around this room. There's a fine crowd here tonight and I see several alumni back. They just can't resist the lure of their college days. Favors are being handed out to the' couples. Mr. Warriner just came, up to talk with me. He's quite enthusiastic over the success of this last formal of the year. I wonder why every one is walking towards the floor.. Why, even the orchestra is leaving. The party 15 OVQ1' folks, and it doesn't seem possible. Well friends, We'11 be back next year for more good times. Now I must join the crowd at Gover's. i This is station C. S. T. C. at Mt. Pleasant, Mich- lg-9-H, Slgning' Off at 11:30. Good luck, folks. .W ..-.-. ...,.... - . .....,..-.,...-.....,... ...... Q ew 1 I I 1 'T i M i 'ue---prix?- .Lv I Q? I I i 1 1 l I 1 r l i is alll . - rf. . .. isl , ,Jffjl l 6 f ..,.. . . ,....i.,,:-X I, .Q---.,,.w. .....-.,.,.,m...,,,q A 1.7- ,.,n,,W,,,Li g P ---MUN MN W .H , . . . ,. , M ,,,.., A. 4 V - Klint. . ,V Y KI' .. 'fl ' ----fx--cv'-1-.L.,....,...-. , X , f 15, ., . .-. -miss Z.. , , K ,V x ll 4. ll ,-. -.-M . Y NED? :Q si..,.--.--gCf?Q?4jl-3i fl Wil CH 1!lJlJlfl7a- Ag, il l 2 . v ik-7:14 ix.:-FQ., ... gh, ,X Y , l 4 .ww 'x f 1 ll -l li .1 1 ll 'l z l ix, l, ls 1 x ' .., I 4 lil :NN , 4 I ll Campus . ACT1 VITIELT lt I E Campus Men and Women, Their Deeds ll . - Q All too soon pass the days of our college adolescence when we en- joyed campus activities and thought them innocent sport! Then the bitter hour . . . toawake disillusioned and discover that the fun was only a sugar coating to the educative pill! Debating! Ah, the thrill of standing before a peppered auditorium with speech on tongue and hand somewhere behind you feeling for the table. And at the end of the season, the pins didn't come! College newspaper! Romance at last to the hungry news-hound. Only at 5 term's end does he find all his work classified as credits in English. The Band ! Here at la.st is an outside vocation of honor and high esteem j in one's fellows' eyes. Oh-Oh! The band went to but one outside game. You were late and had to buy your tickets. Pat? He isn't a member of the Student Council any more. r No. They met just on afternoons when he was up river. So it goes. Glory and responsibility, hand in hand. -One learns things. One cannot help learning independence, and sportsmanship, and giving for a cause, and-all sorts of other things. Evil When he's through, he's a man. He's educated. But not with books. W Oh, no! In company with a thousand more, he plays their .games to new rules, he judges contests between younger members, in turn he directs the activities of a generation. 5 No wonder the college graduate remembers his school with a fond JI look in his eye, and boasts a little about it, perhaps. His college activi- ties never lose their interest for him. When professor and student both were men . . . the play's the thing! On with the dents. les. lp, 51. ii'iA 2Qg1,.gipi..g1L--gg3r33.1..4.444.ggyggggigy 4'tiiiiilfi!iZiTl1l?!lI5l?f''O if 4337? iill Q4.. 17 if - - .. . - . 1 4 l l mil 1 M 1928 Student Council Active Administrators i 1 i 1 . 1 b Back Row: Donald Wilson, Francis Robinson, Arthur Thompson,'Carl Munson, John French. Second Row: Dora Silver Sarah Lewis, Betty Fox, Ruth Isbell. First Row: Lynn Corwin, George DePuy, 'Jack Kelly, Lawrence Robinson, Frank Lewis. Not in picture: 'Helen Bennett. Lois McMacken, . N Frank'Gardner and William Hersee succeeded to vacancies during the- year. It is the aim of the Student Council of Central State Teachers College to be an easy and authoritative medium of communication between the faculty and the student body. The Student Council endeavors to present suggestions to the faculty on matters pertaining to the student body in accordance with their wishes. Aside from all-college dances which it is customary for the Student Council to sponsor, the first big event of the year under its direction was the annual Home- Comingjheld October 21 and 22, 1927. True to form, this year's affair was bigger and better than ever. No enthusiastic visitor or alumnus could have been disappointed in his football team as it .swept to victory over Western State. b . The Campus Comedy, which had slept since 1926, was revived this spring and at- tainedtpopularity rivaling the fall Home-Coming. Its overwhelming success was due partly to the fact that it was the first entertainment to be presented in the new college auditorium. ,i In addition, each competing organization was given a share of the pro- ceeds. The remainder was used to purchase new equipment for the stage. A new constitution has been adopted as another step in the progress of the Stu- dent Council of 1928. The Work of' this body is becoming more vital each year. The Council of 1927-28 wishes to express to succeeding councils its trust and faith in their ability to cope successfully with growing problems and responsibilities. i L -gl -J V5 'K LJ rw' A fl H! J Twelve Who Edited Student Annual for 1928 f 1 PERSONNEL OF BOARD , Back Row: Duane DeLoach, Editor-in-chief, Rowland Hass, Class Editor, Leonard Barnes, Finance Secretary, Chester Stackhouse, Athletic Editorg Lynn Corwin, Departmental Editor, Raymond Nash, Associate-editorg Mr Arthur H. Rice, Faculty Adviser. Front Row: Virginia Bluem, Feature Editor, Muriel Trask, Social Activities Editor, Emma Doerr, Wo'men's Athletics Editor, Mildred Durfee, Art Editor, Frances Jackson, Organization Editorg Helen Smith, Activities Editor. In its fourth year as an all-student annual, the CHIPPEWA was edited by a group of twelve students appointed by the editor late in the fall term. The positions of editor and business manager were com- bined by the student council at its fall election. Double duty on the part of the editor-in-chief has been heavy but the plan has worked successfully for 1928 since it' centralizes both the buying and spending units of the yearbook in one person. Every year, student editors strive to publish a better and more ex- pensive book than the last. By carefully selecting material and cutting items of obsolete interest, the 1928 CHIPPEWA Board has eliminated part of this problem. New ideas are hard to find, yet the yearbook of '28 contains several changes of more than passing interest. The use of actual photographs for division title pages, uniform size engravings, a modified art theme combining a portrayal of student life with the Gothic air of the new Administration Building, action pictures of ath- letic events, campus buildings in color and student activities made to live in pictures 5-these things have all been accomplished within one year by this publication. The book has been built throughout with a college attitude, looking forward into a new era of accomplishment. A fm' ' ' 7 v '-A---- Y - -f'- -- V--V-Y -I K-W - --'-- 'f,f,:-A----av.-2.3.-N-W --ss-A--va..,.,.a....s..--.-,,,,.,.,,,.,,...t.,,.,..,..,.,-N.--- Ya ,. WL.,,....?,., ll ' is eesl .,., isii iggggegifg,Qgg:gQgA-.i.c ,,,i lpir i iii, - fQiigi1s Witt I If f .S l 1 I 4 Q H l I l I I I I v v f i L I L I I w 1 I 1 11 ii , ! 5 E I I 1 R I v l i its 1 I 2 :..4.n,. 1 1 i li 3 i ,. l w l i l 1 V V ffif' THE CHlPPEWA,,Mn9g.8. F Q L ofd '55 QAQQ jig afli M I We If fi ACQI t 4 F F Ie cc, iff. O . U Newspaper Staff Publishes Better Sheet a V Q5 ., gr ' V . i , 1 I e Q 1, I L i i E i i lg . il . Q I - ' I q I ti STAFF FALL WINTER SPRING El 1 Managing Editor Arthur L. Thompson Virgil Rowland Virgil Rowland fi News Editor Bertha R. Helmer Beulah Inch Beulah Inch Ass't News Editor Virgil Rowland Muriel Trask Mabel Brown Society Editor Helen M. Smith Nell Jane Damon Emma Doerr Sports Editor Max DeHart Chester Stackhouse Chester Stackhouse f Alumni Editor Donald F. Wilson Bertha R. Helmer Creta Lanphierd x , Organizations Beulah Inch Laura Thompson I Ass't Sports Clarence Gregg Gerald Selby Make-up Editor Clarence Gregg Exchange Editor Lucile Macdonaugh Jennie M. Yale Bertha R. Helmer l Departments Katherine Briggs Mildred English , Ross Matteson Jil Loraine Rossman Wager Clunis Mildred Durfee ii Wager Clunis Rowland Hass Eldon Robbins 5 Jennie M. Yale Helen Jefferson Roland Bellinger 1 Lois Hetzman 5 Faculty Director ................. ,.......... A rthur H. Rice Faculty Business Manager ....... ..... C leon C. Richtmeyer Student Advertising Manager ...... ,,,,,,,, D uane DeLoach f Q Central's student newspaper started the year of 1927-28 under the new name of Central -State LIFE. This change from -Central Normal LIF-E was adopted to corres- Pond to the new name of the college. The same edition f'Septernber 28, 19275 that F I announced the new name of the publication also introduced a larger paper. Keeping i pace with the growth of the college, LIEE changed from a four to a five column papef, .with correspondingly longer columns. This gave the paper more reading space than . . gl any other minor college student newspaper in Michigan. l I I Appreciatmg the inadequacy of only two hours' credit each term for the study Of J school Journalism, the faculty changed the course to four hoursv Credit, taking effect QE .hiv in the winter term. Students may now elect to take two full credit courses in school L22 Journalism, which includes service on the staff of' Central -State LIFE. f I 7 . . l . 0 A , ' I 1 LIFE IS new editorial room at the east end of the first Hoor corridor is ldeally if ocated and 1S well equlpped. It is shared with the student annual staff. 5155 G ii' t si LQ! ess we A A A as b. A F L g F I U In-li' g l' ii I!:fIE:T A-IQ U1 A I I is ol J'-4---ef N Sl lil' . is of Fo., , F 1.-mg-Qi-in-UA-If 1 V Miss Patterson Directs Phoenix Glee Club Fourth Row: Belding, M. Shackson, Spencer, Wislson, Evans, Hodgkins, Kent, Fox, Guest. Third Row: Voss, Fritchie, Peterson, Mork, Grubaugh, St. Johns, Schewe, L. Goodwin. Second Row: Wisner, Tumath, Brondstetter, Rhode, Hetzman, Fuller, Goodwin, Bollinger. First Row: Niggeman, R. Shackson, Armitage, Miss Patterson, Director, Luxton, Buehl, Watson. The Phoenix Glee club is an organization for girls who are not en- rolled in the Music course. The membership is limited and is based on try-outs by its director at theibeginning of the school year. If mem- bers discontinue between terms, new ones are added from those Who are Waiting. Practises are held once or twice a Week and social meetings occa- sionally. The club appears at Various times during the year in assembly and takes part in the term concerts of the music department. While its sister organization, the Philharmonic glee club, is a pro- fessional group for students enrolled on music courses only, the Phoenix glee club also studies and rehearses with a similar program. Musical numbers chosen are usually more popular and less difficult than those in the repertoire of the professional group. Singing is, With them, an enjoyable activity limited only by the range of ability and the choice of songs. rp , c i i -..T iii! c ..:?:mwi1..iTti 'irgg ep p QAK O QV TW 25,1926 g ' pTHEj- - ' 4--W L ii 9 -A ef A Aid 4 t iiii Mi' r ti P? O . 0 0 O i Philharmonic Is Group For Specializing Students 7' 1 A 'cu' E2 V Q V T , ve n 1. Cris. usco , ina o ier, eva erb , Phyfllis Morrison, Vivi n Fox, Carrie Baizrlil-Zgt ESe?gZndFR53w1? Max LoiiiseMKan3 liJora RSilvei3 glen Cookingham, Thehzifia Barker, Marjorie Sage, Frances Jackson, Doris Abbey, Lucille Benedict. First Row: Lillian Morford, Mary Banton, Beatrice Beckman, Miss Alice Mclntire, L. Church, Vivian Hetzman, Elda Sexton. I l ' The Philharmonic Glee Club membership is made up of all special music and art course students. Although required of all girls major- ing in music, these girls have Worked hard and faithfully. Their Work 4 this past year has been commended highly. The personnel of the group is limited to twenty-five, all of Whom have spent extensive study on music and are-talented musicians. It has been said this year that the Philharmonic Glee club consists A of some of the iinest voices to appear in campus concerts. The Teachers p College may Well be proud of them. i The Philharmonic club' has appeared at many school functions A A' throughout the year and credited themselves with a splendid perform- 2 l .ES ' ance at the state glee club contest held at Albion in May. as.. gb P Q tg Q l ,HQ iv v i it-4.4 i eeQ-, is iv' Q VC? Ve? 1 i ii ,J TF1 i 1 li l 1 I 51 1L 'E l 4 1 s I i . s. 1 db Mpf' ,M 1 gif 1,f i 11.1 1 1,3 l F11 i li i1 1 15 W1 111, 111i Il f ji tii ill 11 iii F 1Ei 1 11 1? 1 1, I I1 11, ll W I1 Ti? i ei . 1,1 J 9.1 M 115 115 i i1f 1 1? 1 Ei l il 1 i i ll 1 li 1 Iii 3 V 1 if 113 1 li? 1 11, Q ii 11 11 .1 1+ i if 1 11k il ll 1 WI! ' I ,ii 1 ' ii Q 1 'jj 1 -553 in 1. 1i'NK 1 1 1 1 L I Y y 1 1 1 JI 'I T1 ll , Z, ,L-...,-.Lfee, ----.--M -A --- -----4-------M -- -We ------ V V Qgfiffigl Y ,,,,,,, ,, ,I V -.Yr 1,-,....,....,-.-:I -A1 -f-161 ,-I ,,. , NW, T - ,,,f,i7 ....Q, , ,,,,,x .,,lK1:-f-.-,..-.,..... .---...... - w v 4- ., J - ., 3 3- Q! , ZCDQQW,7,fWM,.,,1ES63fr .1mfdeigffflTf.'QWT 1111 ,11, lifts... 1111 3?2s1.--,e ----.Q..C -EQ-1 5 Y, Serenaders are Trained in Men's Glee Club Back Row: Glenn McDaniels, Lester NVilkinson, Neal Lindquist, P1'of. J. Harold Powers, Virgil Rowland, Max Matteson and Kenneth Wilson. Third Row: Lee Lambert, Ernest Shelley, Ferdinand Gorsche, Howard WoodruH, Gilbert Marks, and Robert Bollinger. Second Row: Paul Sutton, Lee Clark, Aldie Long, Kenneth Bisbee, George Simpson, Owen Bigelow and Harvey Essenburg. First Row: David Snyder, Donald Messer, Hari I-Iurshburger, Robert Johnston, Clarence Gregg and Douglas King. The men's glee club is an organization under the direction of Prof. J. Harold Powers, head of the music department, that is open to all men interested in singing. The group has sung in assemblies, and for the winter term commencement exercises in the gymnasium. Twenty members attended the state collegiate glee club contest held at Albion on May 25. ' Singing with the choral club or college chorus, which meets every two weeks, is another activity of the group. Rehearsals have been held each Wednesday this year. There is no 'limits to membership. The art of song is manifested not only on public occasions by men of the glee club but also in frequent dormitory serenades. Over time rehearsals are not compulsory. -. ........,.....-.,,.-..-- .. ,...,-.,-,..... ... .., .-.,.. ,.,, .... ,... . 5d, , , . N-. ..,.. ...HA-. 1 ..----i------- .,.....- .a .,,. -- ...... I L31 L 26.3 7, ,,,.,,..,... ,........,Y.e,-,.. Y- V ,.,,.,..-.-..a. .M---ww---- '9g'f2 , ,, . - . v. , ...f 5, I .iii V. f -. ff C it mis. Q. wp. i .wi I l if 5 i ,Mfg ,ff f,C5JQ.':' .i..1:.i..-H --N f N- M-H' 'M'Q ff 2 l Cu .rd J, M-M .,wm,w,,,, ...... -N A 1 V Y W V A Y , .. - f Y i I . 3 l Q 0 Lure of Rostrum Draws Forens1c Candidates Back Row: Prof. I. A. Becldow, Sidney Disbrow, Raymond Nash, Ray Brainerd. Second Row: George Simpson, Oakley Best, Horace Hodge. William Holcomb, K0Y1T19'Ch BiSb00- Front Row: Paul Sutton, George Conway. The debating season was -opened under a severe handicap. Both the men's and women's teams were composed primarily of inexperienced material. The questions chosen by the Inter-Collegiate Debating League were, Resolved, that our present Latin-American policy be condemned and Resolved, that it is unwise that so many people go to college. The former question was debated 'by the men and the latter by the women. The season was opened by a clash between the co-edsqof Michigan State Normal College and Central State in which the Central girls won the decisionf The co-ed team consisted of Louise Maynard of Elsie, Bertha Helmer of Lakeview, Ottilia Kominske of Grand Haven, and Jessie Sharp of Lakeview, who acted as alternate. The second forensic clash occurred betweenthe men of Central debating Hope at Holland and Olivet at home. The negative at Holland lost, while the affirmative, speaking before a large home audience, won the decision. The co-eds next debated Kalamazoo College at Kalamazoo. This argument was won by the girls of the Celery City. The men's teams next met Albion and Ypsi- lanti. Central's teams were defeated both at home and away. The last debates sched- uled for the season were with the .Wranglers Club of Notre Dame and the negative team from McMurry -College, Texas. The Texas team was unable to fulfill its en- gagement while the Notre Dame men met our negative team in a contest at which no decision was given. . - R The men's affirmative team consisted of Raymond Nash of Clare, Arden Disbrow of Manton, and Ray Brainerd of Chesaning. The negative consisted of William Hol- comb of Mt. Pleasant, Kenneth Bisbee of Reed City, and Oakley Best of Elwell. The negative alternates were Horace Hodge of 'Leslie and George Simpson of Mtf Pleasant. The alternates for the affirmative consisted of George Conway of Manistee and Paul Sutton of Central Lake. - Both the men's and women's teams celebrated the close of a fairly successful and a thoroughly enjoyable forensic season with a banquet sponsored by the coaches. 1 r 1 JNI1 l-TTT'-if' S l ,gy 1, Ui 1 Nei Orchestra and Band Active On Campus l . BACK ROW: Richard Bilcox, cornetg Ferdinand Gorsche, tubag Rolland Bellinger, tromboneg Willis Kraus, claArinct,' C. C. Richtmeyer, trumpet, Nina Webster, trumpet. THIRD ROW: Beatrice Beckman, French horn, Floy Struble, violing Miss Gertrude Friedrich, violing Aldie Long, violin, Myrtle Cobb, violin,- Frances MacIntosh, flute. SECOND RONV: Mary Banton, oioling Bernice Madison, violing Mrs. Paul Weatherhead, 'violing Mrs C. C. Richtmeyer, 'uioling Dora Silver, violin, Miss Margaret Patterson, bass viol. FIRST ROW: Caroline Richardson, cello, Lillian Morford, 'violing Ellen Cookingham, piano, Prof. J. Harold Powers, conrluctorg Leland Sawyer, violing Ruth Isbell, violin. The college band led some spirited demonstrations during the athletic season last fall and during home basketball games. Under the direction of Mr. Cleon Richtmeyer this last year, members of the band have shown loyalty to attendance on state occasions. The college orchestra has grown with the entrance of students in- terested in instrumental music. Prof. J. Harold Powers continued its direction and presented some iine musical scores during the year. J A O a l H STANDING-Frances McIntosh, jfluteg Sidney Disbrow, drumsg Eldon Robbins, drunzsg L. C. Barnes, alto horn: Miss Gertrude Friedrich, bassoong Richa1'd Bilcox, baritone, Ferdinand Gorsche, tuba., Rolland Bellinger, trombone. SEATED-Owen Bigelow, saxophoncg Arthur Cooper, saxophoneg Willis Kraus, clarinet, Janet King, clarinet, Gaylord Bush, elarinetg Amos Butler, clarinet, Andrew Olsen, baritone, Edwina Church, sarco- phoneg C. C. Richtmeyer, band l1'ader,- Oakley Best, saavoplloneg Avery Peavey, William Beach, Arden McNeil, Aldie Long, Richard Potter, Cleon Rumbaugh, George Simpson, f7 llf'fll2JCfS. w 'fri l 1' X mn, , ,.,,.w.. ..! F..- --- .v,. ' I Frosh Lose Flag-Rush In Fifteen Minute Battle h' ' t f flying wedge, the quick wit and charge of a fewmbiarvles sbnpghsntcrialfrecakathe frosh formation before it should hit and drive the defenders from the pole, and ,the annual rush Was On- The sophomores had rallied 'round their standard on a somewhat muddy field. Spirit ran high in both classes, due to nearly a week of gang fighting and ducking, Members of both classes had walked home from enforced joy rides out to the Red Bridge and beyond. Many had come back in the wee small hours-wet, bedraggled and barefooted. With these memories to incite them to the greatest effort possible, the frosh, besmeared with green, charged for the guarded pole, deter- . O Se . . . . mined to get both the flag and revenge. The s crouched around the ensign, an eager mob, ing the onslaught. Nor had they long to crack of a pistol they came, slowly at first increasing speed, like a freight train gain- down grade. The embattled sophs surged them, tense, waiting, no longer an excited derly fighting machine. Like an irresist- ing an immovable body, yearlings met a maddened, tearing, sweating mob, fight cloth. Again and again the attackers surged to.be torn back by its frenzied guards. shirts, belts, anything and everything that break quickly littered the field of battle, to the mud by the struggling classes. For an age to the competitors, the fight battle royal. When the pistol cracked again eagerly charged the field, stumbled off dis- bruised. And the camp-us, next day bloom- ff, 1 L5 - , . vhs, nsing their spirit nervously await- wait, for at the but with ever- ing hea d W a y out t o m e e t mob, but an or- able force meet- sophs, to become ing 'for a bit of to the pole, only S w e a t shirts, would tear o r be trampled in fifteen minutes, progres-s e d, a men who had so heartened a n d ed with pots, . 131325,-. A . L Q 4-x, ,-.i 1 Y. ,, a...,, -...,...i.. ,,,. -..,,.. ,...-..r.r.....,.-..s.....a,.,. M. Q , Ma.. ..-..--...,.,.e......,--.........,..,. - ,... -W . . , -..- h A ,f , 1,174 .V 1, .,.-... . . ...A....-,... .. .M ,.,. .. . W -... ,M lx-71 Mr - X 1' 1 W A. l .i : ,ni .X v .l 1 i 1 -31 f 3 , , 1 I . A 'x ,. ii I 1.3 EI 1 gl 5 1 J L 'A ll f w ll ,V it fi? :li 1,5 l.l if .,. pg lib f li mg fl: fl I. wi 4 I . 5 :lf .H gl fl 1 4 ii fi 'J H' Ea 1? 1, it ll it El 1 ll J il! 1 V1 1 lt 1 M lx 2,5 I if .1 il Sgr: ' l? vf' lg Q1 T! ll: if 1 ,g ,l ii 1 Q3 T! :ia jli ,g 1 H f,,,,.ga.x 51.22- ,ly V-...X gg . QS lfai lang E935 C. if TH P CH 2 P P :anim we H .Q ,J ,.-. A.- ......- 4- ,.. .,. -..,.....-.. ,.-.- .........- . V . 1.?...r..-......,. ,...,-.,-. . ,...-Y.- . --.N - ,J Am--d ,A .J ,--:-- YN 0 . ' Y V Victory Over Western Climax to Home-Coming OUR LEADING CITIZENS The 1927 Home-Coming has never been equaled for its vivacity and pep. Formzr students, alumni, faculty members, and old lettermen of Central all responded one thousand strong to the call of the Maroon and Gold. The entire city of Mt. Plea:ant was filled with enthusiasm. Department stores, other business establishments, and even the private homes proudly displayed the college colors. It was exactly four years ago when Central launched the first Home-Coming oc- casion. Even then there was a growing need for some appointed time at which all the alumni could come back and visit their old friends. .It was decided that a good foot- ball game should be the center of the gaietics. Thus, Home-Coming originated. Friday evening, October 21, the celelbrators gathered around a huge bonfire pro- vided by the Freshman class for a spirited pep-meeting in 'preparation for the game with Western State Teachers College the following day. Although the Varsity squad could not be present, yet Central's :football heroes of the past- Skipper Hicks, Chet Potter, Jimmy Ryan-were there recalling other pleasant scenes and adding to the enthusiasm of the happy group. , President E. C. Warriner and Dean C. C. Barnes were also within the golden circle urging Central's warriors on to victory. Songs followed speeches and yells fol- lowed songs-until the highest pitch of enthusiasm was reached. Dancing in the gym- nasium followed the out-door program. A I Saturday was a perfect day for the festivities. At 9:30 a. m. all those who had not seen the interior of the new Administration Building formed a group and gave it a thorough inspection. Following this, came the Big Parade downtown in which about a thousand Centralites took part. Leading it were the alumni, faculty members, and the band. The four classes then fell into file according to their rank. In the ,afternoon the game with Western State Teachers College took place. Home-Comers, faculty members, and students crowded the bleachers far beyond their seating capacity. The final score of 18 to 12 left Central wild with excitement and exultation. The Grand Finale, kept a mystery until the very 'last moment, turned out to be a dance in the gymnasium. No one unless he were there could imagine the perfect spirit of contentedness. Old friends, Central victorious at the game-both made this final dance a perfect ending to a likewise perfect Home-Coming. new A-Lu: .-fm.,.,,,A ,4,umA- ,A kr A ,A ,V Y V , . VA A , . M..- W ....m.,- , .. -AB 1.,.,,. ,BTW A., - , -.-.- -...-.-L-:few A-V --AM -wm- fiat Q ,Q -.,...,-X ......r...,.. .........v,,....,....,,. 1 A ,. .AJ-.4 . ,W ,4,.. ...man . . V ' Y' V siififirrifgrrr. ., gg.11.Lr4Lfft 1 -. ,.,lj2gf?f1fCf V ....-n7.-mf..-.,.,,.-Y Y I ..,.,f.,.., 5 V? 1 1 it Il 5 l 'xii z 1. 1 1 i Y E l H l 1, I .. -13 i 1 5 U ui 1 i A ,J ll xl 1 . . li 5 . i In L, .. 1 i 5 ,NI in ,i 1 1 5 1 i if HI 5 1 ,. c 5 1 If 'r 3 ll y 1 I I . ' 1 B 1. 1 l V! 1 ,i .EI il in ,., ii 1. 14 M gi v Y .ME o gj'1iq'i to 1j.ggi'fifjg A. A QQ. if 45. 2 .qi 53,4 4-MW, Q ,,V .,.., A ,.. . f. . . ,vQ ,-- 1 - --- H - H e ' i , hgh E 1 22,2 - if 135 Dope Bucket Upset In Annual Cagers' Tourney ,Q 511 . 1 -- 2' 1 1 ' . ,VT- Central's gymnasium has been the scene of many exciting games Q and contests, but the event of probably greatest common interest to 1 alumni and students of Central Michigan high schools was the basket 1 gf ball tournament staged here March 9, 10, and 11. Enthusiastic fans 1 crowded the gym to its capacity, on the evening of the finals, and even 1 li, packed themselves in the ante-rooms in an effort to hear the games. 1 eg Eg Alma clearly showed championship calibre. Speed, superior pass- 3 6 , . , N 4' ii ing, and shooting enabled that team to outclass Caro in the Class B fin- 1 als, 28-10. Reed City, last year champions in Class C, showed pros- p pects of repeating the conquest when they tookthree hard games to 5 earn the regional A tory until the last 1 , , TOURNAMEN O 4 , 3 Q51 title here. R e e d CLASSTBSC RES minute. Both teams , City's victory, 26-21, Alma lglfgsigfniggdigfs 19- showed a well-bal- il N over Chesaning in ' Aim? 523310 10' anced offense and 1 Class C was the Reed city 18, st. Andrews qsaginawy 8 defense. In Class D, 5 most Closel fo Clglmeetsinigrlty 2?1,D?d-azfrid M 1 R d . . Y ug Reed Cityg26, ,Chesaning 21. ap e apl S an ll fig game 11'1 the fiH31S- CLASS D Morley put up a nip N Q lg Chesaning 11 a d a L.th3f3.?12,.1E.?EQ53i32.32213 5315.-- and tuck battle for 1 , rint n . ' fi' clever fighting team MCB1-ide lSt.2J211G1l1 clflisexvillem 8. three quarters, then gd . iosey 7 erri 7. i 1 . ' gd that kept 1tS follow- MaD'3Ii?fedR235i ltuggf1i'i105gf11?gf1Y 19- Maple Rapids Spurt- r ,ii ers hoping for a vic- ed to win 23-16. ,ii 1 5 - 45 H . . 1, 1 High school pep in a high degree was demonstrated by the iii? 'fl various delegations that followed their teams to the tournament. Various groups competed in attempting to raise the roof, while I their youthful yell leaders went through a number of clever antics and contortions. . Ml 112 in Of the eighteen teams that took part in the tournament, seven were coached by Central State men, while four of the six teams that If played in the finals were coached by Central graduates. i ' il all 1 Wfgf, ' 1 1? 'z' xv- ,. '- M 4, ,. , ,Y W 1 -,-,,,,, .--,.. H... , ang,-L vi ,six tl .- ,gl 2 -'fy 1 td i J K in-1 C .1 1- - lf X f -H-M -- ---- -My -,zggtgixzigi 1Q1QQlIl2..Ti' Tn.. . ,. 1 l1'i'l-10.1111 VI .num TI.-1 A E ji 553-13. ,AQ ,, n..- ,,..4amL.,..J Record Attendance at County Normal Day A new record was reached when six hundred and fifty-six visitors representing twenty-seven counties attended the tenth annual County Normal conference Thursday and Friday, April 26 and 27. Last year's attendance was the largest until that year with almost six hundred county normal students here. . The visitors wandered over the campus Thursday afternoon, meet- ing old friends. and making themselves at home. They were delighted with the buildings, with their modern facilities, and with the spirit of friendliness which they found everywhere upon the campus. In the evening the visitors were guests of the college at the first production of 'l he Mikado given by the music department. County Normal day proper began at 9 a. ni. Friday with visits to the. Training School. Special demonstrations were arranged to give the visitors an opportunity to see the different groups of children at work. In the evening, a farewell supper was given for the students in the col- lege cafeteria after which the various county groups put on their stunts in the auditorum. i Thirty Schools Enter District Music Contest It is competition that brings out the best that is in individuals, and when the Central people were hosts to the nine hundred high school musicians who entered in the eighth annual music contest, they discov- ered the truth of this. . I Among the thirty schools that registered in the music contest that was held here May 4 were: Class B-Alpena, Cadillac, Ludington, Ionia, Midland, Big Rapids, Owosso, East Jordan and Lansing Voca- tional school, Class C-Clare, Carson City, Durand, Fremont, Gaylord, Greenville, Ithaca, Laingsburg, Lakeview, Mt. Morris, Onekema, Reed City, Remus, St. Louis, White Cloud, Saranac, East Lansing, Kingsley, Hesperia, Lansing West Junior High, Lansing Pattengill Junior High, and Saginaw Junior High. Those that received first and second places in the contest were: CLASS B Girls' Glee Club-Alpena, first, Midland, second. Boys' Glee Club-Alpena, first, Ludington, second. Mixed Chorus-Alpena, first. t Orchestra-Big Rapids, first, Ionia, second. Bands-Lansing Vocational, first, East Jordan, second. CLASS C Girls' Glee Club-Reed City, first, Clare, second. Boys' Glee Club-Greenville, first, Mt. Morris, second. Mixed Chorus-Ithaca, first, Mt. Morris, second. Orchestra-East Lansing, fi-rst, Kingsley, second. I I . Bands-Lansing Pattengill Junior High, first, Lansing Junior High, second. The judges were Mrs. Foster Krake of Chicago for the vocal num- bers and Mr. Arthur Farrell of Michigan State College for the instru- mental numbers. 'T' I F'i'A' TM ' ,fflf.LffQQ4Lll.L2..il1li ,Q-L..Q.-c...,--Us.. ,LQ..W....d,---was--s, ,M- f,1 ' ' ' I , I f, , F if i E A if . .,.,.. ..., , LL-. ' .- H -Wt Y 1 , ff H A rr V1 H ry Y, .. f .p jfsilyg-, 1 T! 61 -X Q C555 ' lf.. 'CJ-A.: .I ll' r.. Nw f .fl ,x,Q-ag ,JL cc an I Chorus of 50 Voices Sang in The Mikad0 The Mikado , a Gilbert and Sullivan comic opera in two acts, was presented by av cast and chorus of Central students in the auditorium on Thursday and Saturday evenings, April 26 and 28. Utilizing the new auditorium, with its large stage and complete equipment, the pro- duction had the atmosphere and attributes of a professional presenta- tion. ' - f --H525 The comedy of the play centered about Ko-Ko, the tender-hearted executioner. His list of victims who never would be missed by socie- ty could be supplemented without difficulty by campus cynics. Another well-known lyrical number that proved especially entertaining was the duet with Ko-Ko and Nankie-Poo C 'The Flowers that bloom in the Spring, tra-la- D, Poo-Bah, as Lord High Everything Else, furnished much of the delightful comedy of the opera. The serious nonsense of the plot and repartee of The Mikado seemed to have hidden meanings for a college audience. Students ap- parently were very much amused in seeing foolish dignity so cleverly ridiculed. Instructors were entertained by three silly little school girls, and by the grandstand play of romantic youth. The Mikado fulfilled its promise of being the most colorful, tuneful, and finished musical production ever offered by students of Central State. This was made possible only by the faithful work of every member of cast and chorus, and the thorough methods of the music faculty. The opera was produced under the direction of Prof. J. Harold Powers, assisted by Miss Gertrude Friedrich in the orchestra, Miss Mar- garet Patterson at the piano, and Miss Alice McIntyre in the chorus work. l l , O . I, I y 1 I i Q-,fQgQ1 .......g- QQQ,,,QFgi!ffg ..g,z4gg,'Q1giQQ,g.,'g'ft fQQ-QQ---iggwggllg . f,.,,, , ..- , ., V' 'T' X 440' AL -- - ' KW-'B----' 7-g--s-- -mv- gZv,..CD.,oI,f7,..C- in -Iaffxi c- A, , I a 4 nf'- i 'ix ?vwi'i H' X bX' we -ruff!--L-.QL---.iiilQff 'Ll ' ' IALSL,,n,,-'Nli1fA'i'j o V I 4 2 FII r I I I I I I I I II I I ,I 2'- I I I I I I I I I I I I I I I I I I II I II II I I II II I I I I I I I I I I I I I I I I I I i' 1 I I I I l Forum Has Winning Campus Comedy Act With a Roman burlesque in which the characters were wierd car- icatures of local faculty celebrities, the Forum, junior men's literary organization, won the cup for the best Campus Comedy act in the in- augural entertainment taking place here Friday evening, April 13. Fourteen organizations competed. Two years ago, when the clubs participated in putting across a Campus Comedy, the Senate won first place. ' The leading members of the cast were: Frank Lewis as Barneius, David Snyder as Larzelerius, Elmer Wilson as Minorius, Charles Well- ington as Calkinus, Gerald Reinsmith as Beddowius, Ray Brainerd as Hilarius Millarius, and Leon Snyder as Cleopatra. Three clubs received honorable mention. The Warriner Literary Society put over a clever skit entitled We'r'e Going Over. This act was a burlesque on the occupation of the new building. Second mention went to the Senate, the other men's organization at Central. Their act, The Next on the Program, was a satire on a typical assembly. Le Cercle Francais received third honorable mention for its act, Centralites in Paris. The judges for the Campus Comedy were Mrs. C. C. Barnes, J. P. Carey, and the Rev. C. B. Hawkins. The other acts were also of high merit and dealt with a great va- riety of subjects. I The Campus Comedy, started several years ago by the Student II Council, was discontinued two years ago when interest in it Hfagged out. This lack of interest was entirely due to the fact that so many :QQ organizations were putting on similar performances at about the same I time. This year, however, the organizations seemed very enthusiastic ' over it and on the evening of the performance, both the main floor and I IKQI balcony of the auditorium were well filled. ff-I Q4 Is'--HW-'W eee--ee B a a aa - af gg ' - L MT'igjr4g.,,,,,,.g,,,,,. WM, W I-A -Wg A my i..i LLL 'INl I'7f'l.'fQilmwum til'-M401-WMI QQ? Z , L. 'ts' I 73-1-55I?tl'I'fW' fi -1515113 1 li in ic -of., ' 14 ff!! - ,.--....1.,:'....-J .. ' ......Q. -9.11 1... M M.,,f1,.,tK,. ir-..Wiwi-iw-.W--V--f-aff-Hfiiggif-fgfiiffc I M M-.. 3 Q , ,...... -..L M-M WWMM -,,N,,,1-.- M.. 5 BQC-'51, .,.,f ,.-.,1,...,-n.. ..,, ft-,X V64 Mi' A f ! l ill! ' Interest In Scholastic Contest Leaps 1 2, 4- . if lj? ,V apwf is 21 1 ill lil ii i.. li 2:5 we j'1 all E11 :li in fl? 221 512 Y il l 1 1 4 ,ia Qi? QW. bfi ,lf nj xy 1 4 l ,. 'a 4 4 A 1 v K 1 X ii .1 as I-A 1 .Hi .il .N ,-I 5 ,gl 1 i .ls ll V . ,I 1, fe Ji .1. ,dv 'a IH I I 1 l . 1 ,,,. yi! 1 1 ,. J' ii ii fl A 7 , l ' 2 4 . l f, .,, if E I 1 l Tl H145 il Qi 1, 'i I I .. A Seventy-one schools had winners in the third annual state-wide high school scholastic contest at Central State Teachers' College Fri- day,,1VIay 18. There were 1,461 contestants from 91 high schools in 42 different counties, representing practically every section in the lower peninsula. This is an increase of 311 contestants, as compared with :the 1927 total of 1,150 students from 76'high. schools. The plan of high school competition in academic and vocational subjects was introduced in'Michigan by Central State Teachers' College two years ago., In that first contest, 1926, there were 671 students from 51 high schools. - VVinners of last year's class divisions werechief contenders again this spring. In 'Class AB Flint forged to the front with 42 points in the academic division. St. Johns was in third place this spring with 20 points, and Alma had just one point more to take second place with 21 points. In the vocational division of Class AB Alma took first with 33 points, Mt. Pleasant was just two points less, and Midland was third with 14 points. In Class C, Elsie advanced from second place in 1927 to first place in 1928, in the academic division, and St. Louis repeated its 1927 record in winning first honors in the vocational group. Elsie led the Class C academic group with 24 points. Cass City and St. Louis were new winners in this division with 23 and 18 points, respectively, for second and third places. In the vocational group, St. Louis with 38 points had a big margin over East Jordan with 24 points, while Clare was third with 10 points. The closest race was between Class D schools in the academic di- vision. One point margins decided the winners as Howard City, first with 17 points: New Baltimore. second with 16 points, and Richland and Coleman tied for third with 15 points. The vocational. award for Class D was a walk-away for Akron. Akron scored 62 points, the greatest total for any school in any division. Woodland and Richland followed as second and third with 9 and 8 points respectively. A tlgefifaculty of the collegeand assisting students in one day. Winners o rst and second place in each event received pins, . and winning ichoolgfirst place in each division were awarded trophy shields. Points or in 1v1dual tests were counted as follows: first place, 5 polntsg sec- ond 101306, 3 points, third place, 1 point, moroximately two thousand tests were conducted and graded by 1 c . 1 I . , .. , . .: 1. 1 .,..1,..,L- ..., 1-.. 1....-, 1..- .. ., 4. 3 4, -Q MMM Lmxv ,WN Vw-. PYVV I -A 1. ..-....-., ..,., . L., ... ,....4,,1 ,.,. . -N--AP-G l ef ,--A, f, Y l X .i ,i i f 1 ' w i il 1 i l , .1 li ,T . l , i l r I , E 1 3 l ln 1 . l in l, 'r Q 1 ,Ns 1 .it-,f ,m,,,, if b , , A gljsgv ,,x W Y 'T f 'vig-1gk4'. I A VQif! T wif I l gli T o l Commencement Play Gwen June 16 T35 5 lil 1 , ll 2 i 3 Q V . .E l if 2 LOOK OUT, BABY! HERE 1 COME! - Scene from a rehearsal of the Gilbert and Sullivan comedy by Prof. Beddow's class E, in play production. The actors were not in costume when this picture was taken. ,. CAST OF CHARACTERS 5 Alfred Horieycutt, Howard Woodruff, Jennings, Lady Ducksworth's butler, George Conway: Lady Beau- champ, Mrs. Julian Spencer, Elinor Beauchamp, Carrie Trombley: A flurzkey at the Ritz, Lewis Kelly: QE, Hiram Draper, Jr., Raymond Nash, Hiram Draper, Al West: Mrs. Hiram Draper, Doris Muscott 5 Thomas, M a butler, Paul Sutton: Sir Percy Beauchamp, Ray Brainerd. ji lg cc Q 9 So This Is London' QQ' ' Jil l . . A The annual commencement play will be given in the auditorium of the new Ad- ministration Building on June 16. This is. an annual event anticipated by the entire il, college and given by Professor Beddow's class in play production. 1 T! This year So This ls London! is the name of the play which is to be produced. TQ, The popular comedy was first presented in the Hudson Theatre, New York City, Au- ? gust 30,1922, by Geor e M. Cohan. The author of the play is Arthur Goodrich. ' M, s 5 ' Mr. Beddow described it as a comedy of ,international misunderstandings. The 3 T, first act takes place in The Draper's suite at the Ritz, London, the second act in Sir ,A Percy Beauchamp's living room in Brimshot, and the third act in Lady Ducksworth's i drawing room. On board ship from America to England, Junior, Raymond Nash, falls ' in love with Elinor Beauchamp, 'Carrie Tromibley. The play centers around their love Z for each other and parental opposition. Junior's father, .Hiram Draper, Sr., or Alfred West, has no use for Englishmen and Sir Percy Beaucha.mp, 'Elinor's father, or Ray Brainerd, has the same feeling for Americans. Lady Ducksworth, an Englishwoman, LJ4, is in sympathy with the young folks and arranges a meeting between the two families AV, 1 at her home in Brimshot. This meeting and how the opposition is overcome furnished ,al delightful comedy. 'gli I 1 Ca, g if-2Q'i'35E.ffff'i if fQfQQff'M f' , pyg , r A 4-MMMHM Nw fm Y ,V f ,W -.T...i-fa--V-if-----ii -'il 'ffl ffl, Qf'fff ffA iE35ge3aL-,.J.Ci'i JALQQ J E 4 -M-,,,,,,,,,....-- -aaa-f ' G4 , . E23 Commencement Exercises, HOIUQ Cfimlliga and Dedication of New Administration Building :Q ir' June 8-18, 1928 U 1 U FRID8A5,riIjF15IifeilEent and Mrs. Warriner at home to Facul-ty, Alumni and Graduates, ,il 301 E, High Street. SUNDAY JUNE 10- li l 6 p in-Vesper Services, Conducted by Y. M. C. A. and Y. W. C. A.-Cathedral ,U Woods. Jn?NET1?ai-m-ng School Operetta, Hansel and Gretel -Auditorium. 1? . , THURSDAY, JUNE 14- li - t' 'lC f ce. . 1 3 p' lxlburhcglgglalOllriiheragnecleelland the 'Course of Study, Dr. Ernest Horn, Uni- f i: ' f I . . . l . Prac71?iIc2t3TecachiJnVgai.n a Teachers College, DT- W- W- Chaftefi UI'-1V9FS1'fY It ll of Chicago. , , . ., fx li Research and the Teachers College,' Dr. Clifford Woody, University of g' Michigan. 5 l FRIDAY, JUNE 15- 1 11 a. m.-Final Student Assembly for the year. Address by President Stratton. 'f D. Brooks, University of Missouri. U 2 p. m.--Ninth Grade Commencement Exercises, Training School Auditorium. , Hi, 8:15 p. m.--Wovlfsohn Concert Quartette-Betsy Lane Shepherd, soprano: Elsie J l Baker, contraltog Arthur Hackett-Granville, tenor: William Simmons, bari- f Gil tone. - 1 l i l 1 l lx 10 p. m.-Commencement Dance. l 1 U SATURDAY, JUNE 16- 1 l ,I Alumni Day. 1 9 a. m.-Class and Group Reunions. ' - . 10 a. m.-Informal Reception by Faculty and former members of the Faculty to all Alumni, Stud-ents and Friends. 10:30 a. m.-Class Day Exercises for Senior and Sophomore Classes. . ll 11 a. m.-Annual Meeting of Alumni Association. , ' . , l 1 p. m.-Annual business meeting of Central State Teachers College Alumni , i ii, Association. , gp Q, 2 p. m.-Unveiling of Memorial Tablet. lf . ,N 1, 1 . ,U 3 p. m.-Pageant- The Builders -Auditorium. Directed by Miss Grace Ryan, 11 ' Department of Physical Education. 1 6 p. m.-Alumni Supper in Cafeteria. H ,I 8:30 p. m.+Commencement Play- So This Is London! -Auditorium. Directed 1 U 1 by Professor Ira A. Beddow, Department -of Public -Speaking. I 1 fi ll 1' il 1 1 lg SUNDAY, JUNE 17- . 1 2:30 p. m.-Auditorium-Dedication of New Administration Building. ' l U s li Address, Hon. A. M. Freelan-d, President State Board of Education. ' , . l l Q! Add1'ESS, Hon. Howard Lawrence, executive secretary to Governor Fred W. V 1 reen. 1 l Address, Hon. Charles T. Grawn, President of Central Michigan Normal H School from 1900 to 1918. l, E , Address, Hon. WebstergH. Pearce, .State Superintendent of Public Instruction. , , 5, Dedicatory Address, The Contribution of Science to Religion, Shailer li A li lg Mathews, Dean of the Divinity School, University of Chicago. li l 511:- ab 4-IQ. I MONDAY, JUNE 18- 9:15 a. m.-Academic Procession. 5'i 'A4 I S 0 C0U11T1G11Cement Address- What You Will Do for Michigan, William MC- 4 Andrew, Chicago. l Nl 0' EC. iv 1 0 1 Qafg E-----A-ff A- .... .... x1,.-,,gA-sm--N-VMMYW ,Y U - Ev 4 Q Qwagilafij.-tE'3,'fffl'l X. 'H 'i f'-rf -H-Q-5941 Vllb UST'UUHY'JmffI'lff.lflQiiZ1.LliljT.ffewHQ wg ,,1.Q..a.a ..laa..alZllQl. 'l -'m?Ew:, V62-P9 , Z Keiffgs-'if1.--.,ll VN, A-gn 1 K m-Karger dglq W 'AV- 9 UW? HUM :iii ' Y G ,wi E F4 f A ' ' L ff- - af ...ai-.a -ag: . . . -- W ' ' l 4 ii I 5 l I V l P ii I l l il l l l H if i .U . P' 'xv- I I I I I I I I I I I I I I I I I I I I I I I . I I I I I I I I I I I I I I I I I I I I II .x I I -' ..,.A Q, v-If XI N , ,U W ,X X f I N xxx Axx I I I x I I - I-I - X X I I ATHLETICS ,,, ,. ...,. 7, gg 1 If 1 I I I ,f X ffl I I II I I I I I I I I I 2 I I 1 I I I I I I I I I I I I I I I :I I I I I ,371 ,,:5. LIS FYQTI I I AFLV' ff --, FQ' I7 IV Iflx O y ' , sv 53 I J ff, . I' I I3 -P-7' Y f f I -'A ff -W 1 X I f . , v-'MM-M--. 'T' ' I I5 ff W, X I 5 I I bb N X: X i I X I X J I X 1 I ,f v 3 H i ! i 1 Q l fi 1 . it li itiii 53 , . - Qi Q' 5 f if - 5 f f 1f A f'A - f A we t to f-1 e -s yi A C, i i l l i x....i 5 ' i ii 7 i ii C. F. TAMBLING - V Central's Athletes . . VERY young man must find some Worthy proJect 1 so engaging in interest to him that he will throw l himself into this one thing with all his might. Only thus may one firmly link up the neurones that make i strong character and habits of success. . l Many a boy finds this opportunity in athletics. The interest is there. The organized struggle for li Alma Mater sets the habit of high endeavor for life. True, some athletes never develop further, but Cen- 5 tral's published Alumni Directory, covering a 'period of ten years, shows that Central's Alumni Who Wore fa a varsity letter at college were on the average ere- Q, ceiving ten per cent larger salaries than the average for non-varsity alumni. gi Here's to the strenuous varsity athlete Who suc- 1,4 ceeds first in athletics, then in his profession. il is s ,ff ' . 5.521 X 't ss'i F, iifl 71 3 Q,,.7A---gjcfr' i- 1 1 1 4 Q, L4-J , ,- .-. .,....,.-,-fn-eh:.w-H x ff' ' lr l ff K ff' ' 00 uf I - I I l Football C CAPT. GEORGE HACKETT Capable leader of the Maroon and Goldg Central Michigan champions and runners-up for All-State Minor College Honors. x 4 1 I ,Q 1-mu' l. . L VQVQH jp 45,-5f'l'fIgQ THF CHFPPFWA B972 liken JL 5fGQ',rJ! g l Wallace C. Parker, Coach I Team Morale Success in athletics is impossible Without team morale developed to a high degree. It is rather difficult to put into Words the real mean- t ing of morale, but it might be described as an intangible mental vir- tue which makes an individual feel confident to encounter the task i confronting him. - In athletics it has a still deeper meaning in that each individual member of the team must not only have a feeling of confidence in him- . self, but must as Well have a feeling of confidence in-a Willingness to i cooperate with and be loyal to-the other members of the team. Such spirit is manifested by a spirit of team-Work, cooperation, and deter- l mination which makes players give their best , not for their own per- l l , I p sonal glory but for their team, their coach, and school. Any team I , 1 possessing these qualities is never beaten until the last Whistle blows, fo l 1 Q and even if defeated are glorious in defeat. . i Whatever success We have had at Central in athletics I attribute ia to the fact that We have had a fine team morale . What the future Q, i wi, in , L i holds for us, Ithink will depend upon the morale We have on our teams. M ,ins g . li l l We ff? l KO Gil l 695579 'et to fe aaae, a- 21:1 .... 1-,1gga:1.,..gg.-.nfg e' V G3 VXA, 'i o Ni- -Q wg,W, ,Y ' .l if Q5 A l llV'vf'c hw il V7 w i X 1 ,f , eff - ,ffm ,.,,Lx ' f fl X , . 17,7 Y- . ,,,,,,,,kN, . k WA ,o. ,,. . I The Maroon and Gold Steam Roller l Y, rl' sl' lu it ,, ll l Z'l me Il iw ll H 1 ll? u-rl ,, il X, w l 'if . li! Oct 1 li lfg Oct il tl Oct sa il Oct ll iff ,I .M -v Back Row: Coach Butler, Sweeney, Munson, Hickman, Johnson, Fenton, Coach Parker. Second Row: Reek, West, Stackhouse, Kimball, Burnham, Monaghan. Front Row: Michelson, Brotzman, Knapp, Capt. Hackett, Kelly, Cline, Stamats. Central Adrian C entral Ferris Central Olivet Central Western -..XPQE Central State ..... . Statistical Summary of the Season Oct. 29 Central Ypsilanti Nov. 5 Central Northern Nov. 11 Central Alma Nov. 24 Central Detroit Touchdowns Points after touchdown Season total xr, X. 1. 'I w fx W l l, li ,I Il , 1 1 i i l x ,, X ,. 'f l, , , H , il 'N 1 l Wi ll , l l , li l in ' , W ,ll ,,. l l 1 I My l i ull may in ,ly la? I, 1' ll? ,IXI il I W ,ll 'I ily 13 ll' 'il ill. wll 'fl Ll! 1 1 ll iv, ll'1 l, 'll l in in ll. gel -.X 5 1 3 7 i ' 19 ' 10 124 f 6 l. 1 l Opponents ......... ff bio. L ,,! - E 'gsm J f 4 l?f5 .,, Y f '. l f l MLMX V AMW,-Y Mwngg-W ,rltilzmfzze efxr eye ff 1 --- Y-...mmv ------:age , A,:lZ,f,T:,,,,, ,- J , Y., --.e,4.--...,.- -Y - - ivmpvvv-QYTTILYA gf-i -fri: , A ,Vi , Dv. ffjf 105 deff -jj I X J 3 K JAM J V , V, .. .Y ,A ,N . F, l ,- f X lv, I Mi : V 1 f , - , hiv! 2,1 u-Mu, l 1 Review of the Season Early in September thirty-three football candidates reported for pre-season practice under Head Coach Parker and Line Coach Butler. From this squad which worked faithfully under the blazing sun and later in soaking rain and bitter cold, eighteen finished the season as varsity lettermen. I l . In considering the season's record of seven victories and a lone defeat, and the strength of opposition met, it is only fair to say that the team of 1927 was the greatest to wear Central's colors. Success came to them as a result of cooperation, hard work, and tireless spirit. It was a starless team. Every man was a unit in the machine. Their play was determined by the strength of the opposition. When hard pressed, there wasalways a comeback of immeasurable strength. Cool, confident play in tight places was the best thing they did, punting on the fourth down on nearly every occasion, many times from behind their own goal. Not once in eight games was a punt blocked. Powerful line smashes built up yardage for the Bearcats. Passes were used conservatively but with remarkable success. On an average, two-thirds of all passes thrown were completed and not one found its way into enemy hands. Fumbling was rare. Central's fast charging line deserves credit for the team's offensive power, and as a tower of strength behind which the Parker-coached backfield ran, kicked and passed their way to victory. ' While earning the reputation of playing hard, bone-crushing foot- ball, the Maroon and Gold has also commanded the respect of oppo- nents .and fans by their sportsmanlike conduct on the field. Central State is fortunate .in having men in charge of athletics who insist upon the better things in sport. Four Bearcats Earn Berths on All-Conference Eleven Kelley, West, Monaghan and Reek on Second Selection C l I l H k - , . ac ett Fnd Cline-Halfback Burnham-Tackle H Coach Stewart Butler Coach Butler joined Central State's ,coaching staff as line coach at the beginning of the 1927 foot- ball season. In developing the strongest line that ever represented the Maroon and Gold, Butler was in a large degree responsible for the record made by last year's eleven. Following the football season other responsibilities fell on the shoulders of the dynamic little giant, and he has handled them so well that he is considered as a permanent part of Central's Board of Strategy. Butler was a letter man in foot- ball and track at the University of Indiana. He was a member of the football team in '22, '23, '24, Be- sides captaining the Hoosiers in '23 ' he was all-conference center in the Big Ten. The same year two of the three Indiana state papers se- lected him as all-state center over Walsh of Notre Dame, who won All- American honors. Butler returned the following year to coach the line for his Alma Mater. In '26 he developed a state championship team at Hillsboro highschool of Tampa, Florida, and now it is Central's good fortune to have him here. Stewart Butler, Coach Captain-Elect Chester R. Stackhouse of Ashland, Ohio, Captain-elect for 1928, is one of the best centers ever to represent Central. He was a tower of strength on defense while his offensive play was faultless. His play during the season rightfully earned him a place on the All-Confer- ence team and general recognition as the out- standing center in Minor College circles. Stackhouse has all the qualities of a lead- er. He has earned the good will and respect of every member on the squad and plays the type of game that inspires his team-mates to their greatest heights. With Stack as its , Captain the 1928 team should have an excellent 1 season. Stackhouse, Center Y ., ,,,,,.,..,......,1.N-- -- Y l LL W NVLYVLAL vm 01 1- L:LgLU,,L,-:,-- 1-:Ye .. -1 -wwf-in - - ' H , 1, Y 1 M UV, ,.n......f.n.-gave.-x,-H, qv., 'fr' , ,,,. . ..-F.,-5 ,e ,, f . c, .1 - ,. , ,J ,li-.g+i.,'u:fg,f' ki, 'aj 'ffl A. .1 - .... 1. f f for as e e F 0 YJ. ...,, ..,,... . .. V nv I K , Central Defeats Mt. Pleasant, Oct. 1-As an- indication of what might happen in later games, Central State Gridders ran rough shod over Adrian College warriors here this afternoon, scoring touch- downs in every quarter to win the game 26-0. Early in the game Central had a first down on Adrian's 30-yard line as a result of a 15-yard pass from Kelly to Captain Hackett. On the next play Cline dashed off tackle for a touchdown. Late in the second quarter Cen- tral had the ball on the 20-yard line, fourth down and 6 yards to go. Stamats carried the ball over the goal for the second score. Monaghan kicked the extra point. At the start of the second half Captain Hackett kicked off to Green. A series of line plays failed and Adrian punted to Kel- ly, who ran the ball back 20 yards to the center of the field. Adrian's line wilted before a line plunging attack, led by Michel- son, which placed the ball well into enemy territory. Fans were given a thrill in the closing minutes when Michelson .H , R V I W , -lf VH. Y I 2 arf ,. l W 1 fs f if '1 F fr - 3 A 1,1 - M ,r , H., , ,...... 1 .f wa.. .ri '- .NY r. , , , ...ff L1 iff' Adrian in Opener plunged through center, reversed his field and scampered 30 yards for the last touchdown. Monte's intended drop-kick was blocked but he ran the end successfully for the extra point. Mt. Pleasant, Oct. 8-What was heralded as the greatest team in the history of Ferris In- stitute invaded Tambling Field this afternoon. The dope bucket was upset when Coach Wallace C. Parker's pigskin toters rolled over their Big Rapids visitors to the tune of 20-0. Ferris confidently started their strong reserve team with the hope that they would wear down their opponents. In seven suc- cessive line plays Central gained 50 yards. With the ball on the one yard line, the entire Ferris varsity was hurried into the game. On the next play The Parkermen scored a touchdown. Touchdowns were scored in such a decisive manner that many substitutions were rushed into the game but to little avail. It was a battered Ferris team that trudged of the field. Wax, aw: , -J:- qffe, ' lnlfxu -X .7 t -'ff i- ----LLLL, ,rw . MYA Ng am ' S w 1 ,- j -t--M-eh c f 1 , 11-iv' Bearcats Crush Western in Homecoming Game Mt. Pleasant, Oct. 26-Mount Pleasant was hilarious here to- night as a result of Central's 125-12 victory over Western State's powerful grid machine. Coach Parker's gridders enter- ed the game decidedly as under dogs. Through the first quarter Western had the ball in scoring position at ,all times. Twice Monaghan was forced to punt from behind his own goal line. Late in the period Captain Ful- goni was tackled by Stackhouse, Maroon center, so hard that he fumbled the ball. Captain Hack- ett scooped it up and carried it to midfield to give Central the first break in the game. Western passed 25 yards for a touchdown in the second quarter. The try for point was blocked. It was the first time that Central's goal line had been crossed in the season. The Bearcats came back and slashed and tore their way down the field for 50 yards to score a touchdown as the half ended. Central took advantage of Western's short punt in the open- ing minutes. Johnson and Cline made one first down after an- other through big holes that were torn in the enemy's defense. Not for a second did they stop until the white line was behind them and Central was leading 12-6. There was still a narrow mar- gin between the two teams as they battled on and gave their very blood to win. An end run by Knapp gave Central its third score. I Man after man had been sub- stituted for Western. A pass gave Coach Martineau's men a first down to Central's six yard line. Three times they hit the line. On a fourth desperate plunge Wes- tern scored its second touchdown. The try for point was wide. The Bearcats were marching up the field as the game ended. Western State had hurled three fresh teams at that Maroon line but had only three first downs to show for it, whereas those Cen- tral men tore through the Brown and Gold for thirteen first downs. It was the roughest, hardest fought game ever witnessed on Tambling Field. ' ' .J . f I , X'-Mi..-1... if . ' in . 1, l lg..-i,,-2,...4g.,u gr, , W , ,, ,,,,i,,,,., ,,,, . . .... .,.,.-,B, mia.. . ,kwa mf i . . .LA-Y --g ? -------f -- .-.. . ,,,. -..XVI , ,., - W- ,,.,, , ,WW . ..- - - - - - A .. ., Cgvajv .gyr..f-'ix - eefe --f----f-A -f me--f-'ff' 4'1f'f - 4 ff fu X1 ,i 11 vm x. .if -1 ufv4.,fr-alias . N 5 L, W- A ful vWQi'5L 11f wwf-'g'1'5f 11-11: r111P1E121f1 was J QCQAQZT1 1 1 Q Lone Score Gives YPSI Title, Northern Defeated 1 1 Ypsilanti Oct 29-Ypsilanti the last stanza as darkness set 1 1 nosed out Central State for the tled over the field Ypsi ran a M C C championship in the closing minutes of a great home coming game here this afternoon punt back to the Maroons 18 yard line Three attempts through the center of the line gained 2 1 11 ,1 111 1 1 1 1 1 ' 1 1 1 I0 .111 1 .1 I 1 1 1 1 1 1 1 -1 11 1 1 1 1 1 1 1 1 1 1 1 1 11 1 1 11 111 1 11 1 '1 1 1 1 1 1111 1 1111 1 11 11'1 1 111 1 1,1 1 1 111 11 , 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11 111 '11 1 1 1 1 111 1 1' 1 1 1 111 1 11 1 1 1 1 1 ' 111 1 1 1 11 1 111 ' 1 1 1 wifi 1 111255. 1 1.1011 1 1 1 If .,1 0 vs 1. 17 1. X vj! 1 T' f At no time in the game didthe Maroon and Gold show the great strength that has featured her earlier games. 1 The first half was a puntmg duel with Monaghan of Central having a slight edge. Ypsilanti played a safe game and booted the ball on the first down throughout the half. Late in the second period Central started an offensive drive which carried the ball to the 16-yard line but Ypsi took it on downs and punted out of danger. Astrong offense launched by the Green and White in the third quarter carried the ball to the 10-yard line where Ypsi had a first down. Here the' visitor's line rose to great heights to take the ball on downs. Three times in this period they found their backs to the wall in the shadow of their own goal and three times tore Ypsi to threads and punted out of danger. The lone touchdown came in yards With a fourth down and 8 yards to go Ypsilanti threw a long pass over the goal line. The pass was knocked down but the official called it interference and Ypsi had a first down on Central's one yard line. They made the needed yard and were out in front by six points. Central made a desperate, last- minute attempt to score when Knapp caught .Monaghan's 30- yard pass and carried it to the 17-yard line before being tackled by the Ypsi safety man. Marquette, Nov. 5-A crippled football team from Central State Teachers' college was the guest of Northern Normal at her annual home coming game here today. The southern visitors scored a 6-0 victory when Captain Hackett in- tercepted a forward pass and galloped 40 yards for a touch- down in the first quarter of the game. fContinued on page 1231 1 .Aa Lo. W 1 . 1 11 111 1 1 1 A . .1 11 1 11 11 11 11 211 11 11 11 11 11 11 11 11 11 .1 11 11 11 1 11 .11 .1 1 1 11 11 '1 11 115 11 11 111 11 1' 11 1 11 11 121 111 1 11 1. 111 ',1 11' 11 1 1 11 1 1 '1 1 11 11 1 .Lv -.v 'fs' 152 fN. 39.14 I, EN 1 Q11 11 is 1 1 M 116 ,MF1-f-111' --T- Q-- L1-cavflr:-,,:4Y,, ,zwiiz Vvrr W V dr Y i V i U V 1 i -rl' V VA 5 A V H K F Vi:-Ji W 1 I v Vila-ik 4.3 s eyewear-221' if- - 1 A 1 1 1. 1 .1 1 ' ' 415.191, 1 111- -ff Q1 11 1. LMASW 1 v -VMLSM-I-JALQV W 1 Y Y l'i1-V113 NN '11 11 111'-I 'I' W QNTVJP' YQ E A 17' :V Q LW W rw iv HW -4 I uv T---Qzffl-Lx.-1.-..-.hfiz -,Mm ,W-1. 1 Al, , . , - 11 11 111 ii Maroon Wave Crushes Alma, Olivet Vanquished Alma, Nov. 11-Alma's most colorful football crowd witnessed a truly great football classic here today when the championship Alma College eleven faltered be- fore a terrific onslaught ,of the Maroon and Gold gridders from Central State Teachers' College. The narrow margin of victory was more sensational due to the great comeback staged by the visitors after they had apparent- ly been defeated in the first half. Three consecutive penalties en- abled Alma to place the .ball on Central's 10-yard line. Here Alma pulled a clever pass which netted a touchdown. Captain Hackett's savage tackle prevent- ed the extra point when Alma tried to run the end. Three minutes later Stamats took a lateral pass from Kelly and raced down the side line for 43 yards before being thrown out of bounds. Michelson made 15 yards through the line and placed the ball on Alma's 7-yard line. A second break saved Alma when Central was penalized 15 yards for holding. ' Alma won her sec- ond score when Monaghan's 50- yard punt was run back to the 5-yard line to give them a 13-0 lead at half time. Starting the half apparently beaten, the Maroon tide staged a great rally that swept the M. I. A. A. Champions off their feet. Battering line bucks, sharp off- tackle thrusts, and a beautiful aerial attack netted fifty yards and a touchdown, the first one scored against Alma's proud team all season. In the closing stanza, Alma's shaken but non-beaten team fought gamely on and repulsed three advances. When Central started her fourth advance upon the enemy's goal, the big Maroon line tore big gaps in Alma's de- fense through which slippery backs carried the ball to the 10- yard line. On the next play a Cen- tral warrior had the ball clasped in his arms behind the goal. Five thousand spectators held their breath while Monaghan drop- kicked the ball neatly between the posts and it was a 14-13 vic- tory for Central State. Mt. Pleasant, Oct. 15-Tam- bling Field was again the scene of triumph for Coach Parker's Bear- cats as they vanquished Olivet's game littQe football machine here today. The margin of one lone touchdown does not show the su- periority of Central's men. At no time did Olivet advance into the Bearcats' territory. How- ever her men fought gallantly in the shadow of their owngoal and should be commended for their wonderful spirit in the face of overwhelming odds. ,Throughout the first half Central harassed the scoring zone but never quite crashed through for a score. Early in the second half Knapp carried the ball around the ends for long gains and finally grabbed a pass from Kelly to place the ball on the 6-yard line. On the next play Johnson followed the wedge line over for a touchdown. Following this outburst Central lapsed back into a conservative style of play which kept the ball in -mid-field. ' CContinued from page 1225 The game was played .on a snow covered field. In addition to the bad footing, there was a driving snowstorm which hid the teams from view at times. Neith- Q?-fa,-. ,,.,f,.. 1 f,-,. ,,..-Y. . ,., ,l.,., ,1,n,,.. Mm A. -.V---.M -- l!9 1.1 er team gained consistently. Time after time, Central advanced on Northern?s goal line only to lose the ball on downs when the sec- ondary defense stiffened under their own goal posts. l i l ,!4 WWbHA. ,,,, 14,1 I 5 4 r l . , z f if , l 1 3 . l I I I i 3 I 1 QI, 1 l WI it vi' l L u.. n l il- 4 ll lm. w -A ., Sl v 'K t.,- B t w A N 1 l . 3 I 4 A u -----7 --3555 ifffiiii'giTg'f5iLiiti.t -g i - ...K 4 ., Tm---in . -T - 5 E J.C.wf - , A 4...i.n,n,,i.. ------ -f Q 'A ---------- - Y P F Munies Lose Again in Turkey Day Fracas if Q V 1 ET!!-5 Detroit, Nov. 27-A Teachers' Northwestern Field, play was dif- l College eleven from Mt. Pleasant ficult but 3,0Q0 spectators saw lk? 3 1 today defeated City College in its action every minute. Tl 1 'f annual Turkey day classic by an The Munies rallied in the third l 1 5 overwhelming tally, 33 to 6. The period .to hold the visitors score- ? Wi score marks a seventh successive less. Hickman, playing for Cap- t fl victory over the Munies by Cen- tain Hackett, Who was injured 1 J li tral State. Zuber, aDetroit line- early in the game, received a T i J man, tallied his team's only score pass over the stripe for Central's li in the second quarter when he third score. i lx intercepted a pass and evaded Brotzman and Kelly added six ' qi tacklers for a touchdown. points each. The visitor's line ,i,. Cline of Central State turned seemed impregnable, and offen- l M the game into a track meet. In sively, nearly pushed the lighter . . the first play of the game, he green-clads off their feet. Sub- ' broke away for a 78-yard run to stitutions late in the game gave 2 score. A fevv minutes, he again Central reserve strength which took the pigskin and raced 40 City College could not hold on a 7 L tri yards to the goal. On muddy slippery field. l Wi P 3 i i li, Grid Schedule for 1928 Sept- 29-OQQIL Oct. 27--Ypsilanti at Mt. Pleasant. T , ! Oct- 6-Adflan, at Adfiali- Nov. 3-Valparaiso at Mt. Pleasant. . Q Oct- 13-Toledo, at Toledo. Nov. 10-Ferris Institute, at Big Rapids. Oct. 20--Northern State Teachers, at Nov. 24-Western State, at Kalamazoo. ' l Q Mt. Pleasant. Nov. 29-City College, at Detroit. , ll. 5 l 1 5 l T l I ll i 2 Hr A . ,sql 3 E Q 3 ii' ' Eli l l ill 1 l V' . l if V X ,,-as C2 .Gil e 1 2 X 'lfmlzfl if 92,23 I..-:aim .--T ...D M , ff gtmfktltltyf all ,PifTiiifgq-lLl'TT:PPfPA-'P '1.gg1'Qi,,- . igingnggr 1, g . ..tifl.fQffQ.f..Qff' ,W e - Q9tQf15i?i gn-w4,,,.,,,g.,...-.M---of-------fe V - ---A A-+4-J -Y - f -1-M -- e- -V ee L..eL.K,....L...,,......,,,... . ,,,,,, :rm-1. M I ,KWAMYVMH YUM-M -Ml-Ad Wm A WM A -- Y.-V LM-W -uw rx-----My-WV,,,,,, C Q, F: . ..Tl.T.,--.2Wa-.Qei - 1.....d,,.... 4, YYYFTU-N M ,,.,,....a..--fg- fx-1 ' gn- of , , R-W g if SV A- H Km 3 iv W erik- K-.-wee-:M..1,fzLe:.:. ,. ., . .gy MN .. it fiivdif le e' vw 1 Q 1211 JG f 4 N L1 'MM ,. .. fo 1111- Cel. 11 J , ,, 7, ,-. .V . MILD.-,j'Axsf.. -- A -fe'-J-Jie -f--A-'Y H- -W -A ff i je-3----Qf-L-li --VV -.- ..,.e.e'Zgl.,Qif-'fs2iQ,ML,,H-QL-G WJVif..l,gjikmf?.eA5..Q X . P1 Tnwvnmr, 1 A , -,.,,..-, A . ...- . . ..-..,.,..i-. .AL W, X -....,.. wie r ,Rl YY g . --qelrf CAPTAIN GEORGE HACKETT, Hart ALL-CONFERENCE END In his third year as a varsity man, George played his usual great football. His work as a defensive end gained state wide recognition. Gains around his end of the line have been measured in feet, not yards. Captain Hackett has led his Central gridders through seven impressive victories. In addition to his fine work on the gridiron he is a clean cut, four-square man of whom any college would be proud. ' CHESTER STACKHOUSE, Ashland, O., ALL-CONFERENCE CENTER Good old Stack is a dependable hard hitting player who is al- ways there in the pinches. His work at the pivot position was of high rank, quick to diagnose plays on defense and large enough to tear up an opposing line on offense. Just another reason whythe Maroon and Gold wedge never failed. 1 JOHN CLINE, Croswell - ALL-CONFERENCE HALFBACK Coach Parker will lose a valuable man with the passing of Jack Cline. His work this year was a Htting climax to other great years. When a few or many yards were needed Jack usually produced. De- troit will long remember that 72-yard dash on the first play of the game. Likewise Western will not forget whom they failed to stop at our home coming game. JAKE BURNHAM, St. Louis ALL-CONFERENCE TACKLE In the three years that Jake has carried C.entral's colors into gridiron battles he has tasted defeat but three times. Burnham is a man who can take a deliberate foul blow in the face, then come back and play clean, hard football to win with a smile. Yes, he is one of the sharpest claws of the Central Bearcat. ALFRED WEST, Cass City GUARD Playing his second year as a regular lineman, Al established himself as one of the best guards in the state. He is big enough to tear 'em up on defense, and fast enough to get into the interference. Seldom sensational but always there at the right time. LAWRENCE SWEENEY, Mount Pleasant CENTER Doc , the fighting fool, was promoted from last year's reserves to a full fledged letter man this fall. There is little reason to wonder why. He is as neat a pivot man as one could wish for, and as hard a tackler as Central has. Sweeney never knows whenehe is licked and is sure to cut himself a large slice of moleskin glory next season. CLARE MONAGHAN, Alpena END You can't keep the fighting Irish down , so opponents learned when they tried to send a play over Monty, He is a football team in himself. When he is not snagging passes or tackling an opponent he is back of the line punting, passing or dropkicking. It was his steady toe that booted the winning point in the Alma game. . JAMES KNAPP, Marlette A SHALFBACK Jimmy has completed his second year of football with the Parker-men. He is the fastest man in the backfield and a shark at catching passes. Always a ground gainer when he did not run over his own interference. Knapp will thrill Central fans again next year. , Lil-,,lL,,-E A ,L -' 1: -f- -4' A f l ' T R -V .-N.. ee I 1lf.....f l ,vla- l 6' 1 .K , . J -A-,. . ,E Qi? ,I1 ll ,. l 1l ,, il 1 1 11 5 111 l L1 . .11 1 1 l 1 lf 1 1 1 i .1 N ml 111, L ll I 1 lf 111 Ill l 11 11, ll 11x l l l . 3 ' 1 1 l l 1 1 l .1 J! .l1 11, 1 av 1 Q J le B921 - . . .ax .E 1 l l 11 ll l V 1l CARL MICHELSON, Newberry FULLBACK A blond colored flash of lightning. That is Zeke crashing through center for a first down. Michelson is a senior Bearcat who has profitted by three years' service with the Parkermen. He is a de- pendable fullback in spite of his light weight. JACK BROTZMAN, Chesaning HALFBACK Jack is a light, fast back with plenty of ability in bucking the line, blocking or open field running. Two years of faithful service on the reserves was rewarded by a chance in the great Alma battle. Start- ing the game as a substitute, Jack played a heroic game through four hectic quarters and had Alma eating out of his hand at the finish. Now that he has found his stride nothing should stop him in the future. HARLEY REEK, Marshall TACKLE Cal's appearance on Central's gridiron was preceded by his re- putation as a tackle. He is feared by opposing backs. He recovered a fumble over Alma's goal line for the winning touchdown, which is a nice thing for any boy to do. DONALD STAMATS QUARTERBACK Don is another stranger on Central's campus who has become one of the family as a result of his brilliant work with the pigskin. He can play quarter or half equally well and has accounted for many of the Maroon and Gold scores by his dazzling open field running. Donald insists that size doesn.'t count. Perhaps he is right. ROY KIMBALL, Mt. Pleasant GUARD Three years of varsity football have made Roy into a great guard. Speed and cleverness compensated for his lack of weight. Consistent work 1n 'every game has made him the little giant in Coach Butler s powerful line. L56 .I .. I, K X ,- X1 QV, -' 4- -......'- .-'.,,.,.,L.s,,.,,,, L, A , -,,,.,,,....---..----ff'f A-'- ' KENNETH KELLY, Royal Oak QUARTER A peculiar cross between a comedian and a sage old philosopher. That is Bill Kelly. As nice a quarter as Mount Pleasant ever pro- duced. His flawless generalship won him the confidence and admira- tion of every man on the squad. Bill played safety man and has many nice runbacks to his credit. He will carry the pigskin for the Maroon and Gold again next fall. LYMAN FENTON, Lexington GUARD Tiny is one of the old timers on the Maroon and Gold squad. He is not only large but very active and a hard man for any team to run over. Tiny showed his mettle in the Ypsilanti game by playing on even though he was knocked out on his feet. FRED HICKMAN, Mancelona END A nice punter, neat receiver of forward passes, and a deadly tackle in defensive play, all of that is Hick. A letter man from last year, Fred joined the squad late and proved to be a valuable man in the Northern and Detroit games. Coach Parker expects much of him on next year's team. CARL MUNSON, Mount Pleasant TACKLE Still a youngster in age but all man on the football field. Shine has played nice football this year and we predict a great success for him in the future. If onlyla cub now what will he be when a full grown Bearcat? - I BYRON JOHNSON, Reed City 4 FULLBACK Joining the squad as a' freshman Johnny has literally plunged and twisted his way to a place on the varsity. When his two-hundred pounds of brawn hits the line something gives and it's usually the op- posing line. x l i i l v mg f V A..- . ...X L, Q-A--r --- --rf- f .. . A . . V-L--f -----v- ,I ,fy A. I If ,aiqvv A Pd R- iffy .. . , i ie.. Wi E sk 4 X! J if 9 i .4 H- if I y , ...- H , , V - if, , ,..,....:.c .-1-1 X I Q 5 - l N T F l Central State's First Frgfslaman Football Teangr ,xi U YR, 1,Cy,j't ls : h Ld k, F't l t-'ck, Blood, Tambling, Vtfalters, Akin, Reed, Hayden, Taylor, Back ROW Coac O evgbhouset Zllizibbls, Donald, Rochester, Assistant Coach. . ' Second Row: Harrison, Sawyer, Olsen, Kniffen, Laree, Kraus, Robbins, McN1tt. 'Front Row: ' Miller, Kelly, Keenoy, Doane, Donaghue, Kern, Mole, Kelley. Review of the Season With Central State becoming a member of the Michigan Collegiate Conference, the Freshmen eligibility rule became a reality here. From the fifty-five ambitious yearlings that greeted Coach '-'Dutch Lodewyk the first night of football practice, a strong Freshman team Was devel- oped. In addition to learning the -fundamentals of college football, the beginners received plenty of action under fire 'in the six game sched- ule arranged for them. By placing five of those games on the right side of the ledger the season was a decided success. Eighteen men were glven Frosh sweaters and numerals at the end of the year. From th1S number several are expected to climb into varsity berths in the futufe- Breckenridge Independents .......... ,,...... 0 Alma College Freshmen ........... ....------ - 13 Central State ,Freshmen ........... ........ 6 Central State Freshmen ............... .....--- ---- 2 0 M11SkGg0n Junior Colleg ,,,,,,,,,,,,, ,,,,,-,, 0 P H ' C 11 ,,,,,,,,,,.,, ,,........ .... 0 Central State Freshmen? ........ ......... 0 Cg1IiJEtraluSi3teTlFI1lbzIhme,n.?? .......................... .32 Flint Junior C011ese ----------------------- ......... 1 2 Alma College Freshmen .................. CForfeitl Central State Freshmen ............. ......... 0 Central State Freshmen .......... f ,lx ff ' 14 1- .- V, -1: ., 1 1 I 1 Ji 1 1-1155 , 11 eg ,s V .ive .... -V , ..,-....,, , 1 M: Basketball . ., Captain Sam McClutchey Captain Sam McClutchey piloted the Maroon and Gold to eleven victories in a hard sixteen game schedule. Second place in the Michi- gan Collegiate Conference makes the 1927-28 season a very successful one. l011 15111 t, fig! 1 . ,g Vu t N i,.,,i. 1lL. ',4L.'-- - ,LJ , iC ,1 l 1 I 13 11 E 57' 1 I gal 1? i 51 1 11 F P5 E li :1 5-1 I 1 I gl ' 11 QI 1. 1 1 11 ' gl 11 1 52 l 1 1 1' 1 51 I 11 :fi ! l 1 L. 'I 1,1 S1 311 lf I ll 11 NI V! 111 '1 E Hi ff Ei V 5 1 I F 1 15 Nil 11 1.5 1 1 '1 1 1 1 1,1 '1 sf 1 ' 111 11' 1'l 1 1 1 gi UI 1 l l i 1 11 1-1 il1 ,lx ' 1 E 1,1-Q 4 I' W 1 ffl 1 at Tni.igfia.ce,1ififlei 121it:igg.':g'gii':iw e' lil! F51 ll X E 1 111 o 1 1 1 N111 1 11Y1'?P1 Yc1N'N f HMM,-J q-oA A 4. J --W-1-Aff---feefiw-M'-mv'at it C , 4, '11 Of W, it A ,lt A A A jpg- A g ,MW wg q,, , p ,S kg, Ag g V tr Ie A A A ' I I I BOURKE LODEWYK ll. B., Central .State Teachers' College: Graduate Study, Illinois, Michigan What We Strive For The greatest reward for a coach is to feel that after a season has been completed, each player is a better man for having participated. Physically alone ?-Not by any means! That material achievement is slight as compared with the greater rewards, sportsmanship, manli- I I I I ness, and cooperation. If any one of these principles, in part or in . I I I l , l . I whole, is instilled into the coach's product, he has accomplished and I! his. efforts have been profitable, whether he has gained or lost in ma- I terlal success. I i I . . , I I Statistical Summary I I Date P1306 Score Date Place Score Dec. 3, Home ........... Central State ............... 46 Feb. 3, Home ........... Central State ....i.......... 40 I Alumni Team ............... 27 Battle Creek .................. 27 Dec. 9, Home ........... Central State ............... 25 Feb. 10, Home ........ Central State ............... 24 A Flint Tech. ..................... 11 Western State ............ 40 I I Jan. 6, Home ........... Central State. ............... 51 Feb. 14, Away ...., Central State ............... 29 If, F e1'1'1S Institute Alma College ............... 21 . Jan. 13, Home ..... Central State ............... 32 Feb 18, Away ........ Central State ............... 25 Calvm Cvllege . Western State 23 Jan. 14, Home ..... Central State ............... Feb 24, Away ........ Central State ............... 22 l , De'01'0111 Clty .................. Detroit City .,................ 33 I l Jan- 20, Home ...., Central -State ............... Feb. 2.5 Away ........ Central State ............... 30 I IQ Ypsdanti ........................... Ypsilanti ....,...................... 29 I .nb I Jan' 27, Away ........ Central State ............... Feb. 28, Home ........ Central State ............... 32 I Northern State Aim., College ............... 25 5 Jan- 23, Away ---..... ICIentral State Mar. 3, Home ........ Central State ............... 33 C521 Oughten College ------ Northern State 44 I I9 gv leo 4 iJLLf1iQiii: ',4Qf'Q 'V!hA ,mm-,Q-comm ,I I 1.-.-.1,. lag taa1,t,-- . ... .a..,,-.,e4e4ewf,,taig . .. 0 0 0 iw ' ' 95 'ver-'93'e'-K F2751 t e' e4'e i,.gg3:3gg:,,. . :-L--. JM'-J Maroon and Cold Varsity Leather Tossers Back Row: Coach Bourke Lodewyk, Brotzman, Burnham, Monaghan, West, Kelly, Asst. Coach Wallace Parker Front Row: Reek, Munson, Captain McClutchey, Stackhouse, Pulkiner. The Season Coach Dutch Lodevvykis first year as mentor of Central State's basketball team Was a marked success. Second place in the Michigan Collegiate Conference and a double victory over Alma College were the high spots of the season. Captain McClutchey led his team to eleven triumphs in a hard, sixteen game schedule. The season Was opened With the Alumni game. The old Grads failed to shine as informer years and finished on the short end of a 46-27 score. The Maroon and Gold entertained their first college competition a Week later by trouncing Flint Tech. 25-11, in a tight de- fensive game. The squad made an extensive pre-season trip during Christmas vacation. A successful six game schedule Was climaxed When the Bearcats broke the World champion Detroit Y. M. C. A. team's string of 26 straight Wins in a brilliant 45-40 victory. After decisively defeating Ferris Institute at Big Rapids, 46-25, Central entertained their neighbors here at the beginning of the Winter term. Expert sharpshooting enabled the Maroon to hand Ferris a 51-30 trimming. Plucky little Calvin College Was the next opponent to fall. They threw a scare into the Central State camp before yield- ing to a 32-23 count. . Central's basketeers lost their first conference start to Detroit City in a great battle. Super-ball enabled the Detroiters to earn a 44-34 verdict. Ypsilanti invaded the hunting ground of the Bearcats a Week later and left their scalp behind after losing a fierce 44-30 struggle. The game Was close for the first three quarters With Ypsi leading, but the revlamped Centralites were not to be denied their first conference riump . c Q is no ,GQ C., ff ii., WMA?5i25'fi.i-,i.-...-..,s--...-.--Ll! T-W e -'-----W'93-'M 1'Ai 7'W'i'Tff' 0 'Ut so so A A 2 -ki A five day trip to the upper, peninsula resulted in an even break for the Lodewykites. Northern State used long shots to win by a 37-28 margin. The following night the Centralites vanquished Hough- ton College of Mines in a 39-26 frolic. The Maroon and Gold celebrat- ed their return by running away with Battle Creek College by a 40-27 next week Western State defeated Central before a record breaking .Home-coming crowd in an erratic game, 40-24. The Bearcatscame back with a vengeance the following Tuesday to hand the powerful Alma College quintet a 29-21 setback. It was the first Central victory scored on the Presbyterian floor in five years. The Maroon played desperately brilliant ball to cut down Alma's early 13-3 lead to 17-12 at half time. Then a typical Central State offense netted 17 points while an inspired defense held Alma scoreless from the field in the closing half as the Maroon and G-old triumphed. Three days later Central State's colors were carried to another remarkable victory when Western State was given a bitter defeat at Kazoo. The Hiltoppers broke a half time tie by taking a 20-12 lead in the third quarter. With six minutes to go, the Bearcats tied the score with a brilliant spurt, and won the game, 25-23, when Jack Brotzman sunk a short shot in the last second of play. Detroit City won the conference championship and marked up their eighteenth victory the following Friday at the expense of the Maroon cagers. Central State led the way for the first half, but fell before the champs in an eleventh hour rally by a 33'-22 count. Coach Lodewyk's men invaded Ypsilanti the following night to clinch second place in the M. C. C. with a 30-29 victory over the down-staters. Ypsi had a 20-17 margin at the half but lost it as the Maroon and Gold spurted in the last quarter. Both .teams went scorelessin the last four minutes with Central holding to her one point lead. The Bearcats continued their winning streak and registered their eleventh victory of the season at the expense of Alma College. A large home crowd watched Central triumph over their rivals. After leading by a single point at the intermission, the Maroon men stretched it to 32-25, at the final gun. Four hard battles in a week proved to be too much and Northern State came from behind in an erratic contest to win the final game by a 44-33 margin. score. The The Season's Individual Scoring Record I Name Position Baskets Fouls Total Name Position Baskets Fouls Total Mcclutchey Center 7 5 3 1 1 8 1 Stackhouse Guard 7 6 2 0 Plflkmel' Forward Kelly Forward 18 . AHVN' MUHSOI1 Forward Brotzman Forward 9 SL-J Monaghan Forward West Guard 8 l Reek Guard Burnham Guard 2 Q ff7'li1 7 i' Ti,T.ijQ:g: 3 f' 1-11, f, 1 ,.. or p eerie - -s--'----- -----4-TQiZL1.ilT'g11 0 .',. ,,,,, M M ,iw-MM! Mural F nj. W 7 Hmm' 'A' ' 67 Cf9lOl,,-,,lff,,.---...151-ggi-..li-.,.,,,.,,f 1i,Q1jg,,g,,,,.,1.,.,, ,,A , N The Men Behind the Guns: Ten Reasons for Victory Captain Sam McClutchey has completed his second year with the varsity as a crack center. Sam led the Maroon and Gold through a victorious season by playing a strong offensive and defensive game in every battle. He led the season's scoring with 181 points and placed fourth in the M. C. C. with 65 tallies in six games. Eino Pulkiner's one handed shot plus a deadly eye for the basket, made him the main cog in Central's offense. Eino led the conference scoring with 75counters which were made possible by his high class floor work. It would be hard to name his best performance. However 27 points against the Detroit,Y. M. C. A. is a fair example of his work. Chester Stackhouse participated in every one of the sixteen bat- tles. His consistent defensive play was at its best in the Alma game. Stack was most at home when picking the ball off the backboard and another reason why opponents resorted to long shots. A Paul Munson hasn't any particular position. He started the sea- son as a good forward, was shifted to make a better center and finished the schedule as a wonderful running guard. Paul is a Freshman and bids fair to become Central's most valuable basketball man. Cal Reek played a regular guard position with the varsity and did it in such a manner that there was little doubt about it. Always a fighter Cal insisted that opponents hurry their shots orgive him the ball. He was at his best in the Detroit City game. Clare Monaghan, forward, was the kind of man that coaches like to have around. Monte always got his basket. Whether in one minute or ten he could be depended upon to get his bucket. He played a great game at Ypsilanti, even if he did get a wee bit tired. . Alford West has finished his second season as a defensive Bearcat. Al's defensive play was bothersome to opposing forwards. He han- dled the ball with the best of them and could score when necessary. West was in on the victory at Kazoo. H Jack Brotzman resembles a lubricated streak of lightning when playing a forward position. Jack makes spectators dizzy when he tears around the floor. He is the best passer on the squad and does things that count at the right time. For instance the winning basket at Western State. I Jake Burnham is another man that doesn't care where he plays as long as there is a ball and a basket to throw it at. Jake's work at guard or center was equally good. Five field goals from a guard po- sition is not so bad and that is what happened to Jake at Big Rapids. .William Kelly is a fast clever forward and a good shot. Bill plays -the floor better than any other man on the squad and is worth a I I 1 w f 1 l f l 5 f , 1 1 l u l , 1 I I I 1 l l l l l l l e 2 l l l ll ,: l I l l ll I, -l il I, +5 QI li W fl 'l li l ll W lf ll E i l 2 ll 1 1 E l plenty when teamed up with a tall running mate. His over head, hook shot won the game at Alma, consequently Central State is proud of him. ig? Jwfm''flingiigizgiiig3't:iing.....g,.g .giziiii-.3151:f.:'::::::::1'.i---so 'A'-'s M' .Zf f.'Q 'Qfi 1 L ll ...... A . .... .. - -......n,i , ,,,. ig .f X Centrjal Stdaiteisugirstq Frosh Basketball Team f Back Row: Coach Stewart Butle , Reed, Aiken, Hahn, Assistant Coach Sam McClutchey. Front Row: VVhittal, Bastian, Hahn, Captain Milla'- The Freshmen Season Thirty-five enthusiastic freshmen aspired to positions on the yearling basketball team with the announcement of practice by Coach Stewart Butler. After two weeks of strenuous practice this number was cut to twenty and later to a squad of fifteen men. From this select group a powerful Frosh team was developed to initiate Central State's first year under the conference freshmen ruling. Outiitted with the best of playing equipment and receiving thorough training in the fundamentals of basketball under Coach Butler, the team enjoyed a very successful season. From the eight game schedule allowed freshmen basketball teams by the Athletic Board five resulted in victories for the Green-Clads and one was forfeited to the Central State youngsters. The style of play used by the Frosh was identical to the play of the varsity. This should make it very easy for the men on the yearling squad to find themselves when they become candidates for next year's varsity. It is needless to say that the material from this year's squad is of a caliber that should make strong bids for varsity berths in the future. Statistical Summary Jan. 14 Home-Central State Freshmen ..................... ......... 3 8 Mount Pleasant High School ......... .......... 2 3 Jan. 20 Away-Central State Freshmen ............ .......... 1 9 Alma College Freshmen ......,..,.. ....,...................... 4 2 Jan- 21 AW2lY-Central State Freshmen .,..,,.,..., ,,..,...,....,.................. Bay City Junior College ......... fforfeitedj Feb 3 HOIYIG-Central State Freshmen ............ ....................... 4 2 Bay City Junior College ............ Feb 4, Away-Central State Freshmen ............ ......... 4 5 Saginaw Y. M. C. A ...................... ......... 2 6 Feb 17 AWSLY-Central State Freshmen .,,,,,..,,,,,,,,,,,., .......... 3 3 Mount Pleasant High School ......... 22 Feb 18 Home-Central State Freshmen ................. .......... 2 3 Alma College Freshmen ............. ......... 3 6 Mar- 3, Home-Central State Freshmen ........... Saginaw Y. M. C. A .............. 1 Qt ff. W,- 1 in F ll ,V 1 r l 3 ,l o fxiiiQffQiff65LC3fQi E154 ,A f --1- .-1 - ':v--f--A----- --f- --v-!t--Q--L'-..!.- f--' ,.,ff4-n-f--2 ,seem--..-.. Vf -A f Y - Y bd ll I l l if R ll if 1 or ll 9 t ll , ' T t l ll rn ' llll ll or ll In I .. , il . 4 Baseball 2 155 w fl, I 1 : 'W - f 13 s j Q' l .Q 1 In lr ll . A L is if l i' 1 1 l N, all l U, Ii Us gn ,l ,l ll HIM is il. W, l ,l, all :I 1 ll lil 5 l lil ,Mr 5l Ml all lf ll lst W 325 , l 3 ll Captain Eino Pulkiner Q ' l d Captain Eino Pulkiner I proved to be the ideal leader i ' for the twenty-eight varsity. 41 l' Q! fig His perfect Work at second lla base, plus a fine batting average made him a valua- W ble man to the Maroon and Gold. p 1 ,S , ii :L l z- l p l ,li X Sf 1 flu lx, 1' Nl ,ix ll' Y' l ffl' Nl 1, i M ll? A li' l lx F . I I 'XX ffm 1. f ,ji ,r AM! V yr,-J f f-- e--M -, --,1,-.-, H, ,, -rn ,, ..... ,,,. . , ,,F,,.,,,,-.,-.,,,,,,,,,,,,,,,, ,V N -M -,V Y 'Q .E N, ,..-v......-..,..,,..,V WW, N ,- H... .,... .-.Mr , Y , W-, Y.r.-,.-.,,-..-,n i,,,.r,..-.--.,,r Y, Q if ' Wim W ,Y , V4 p ,re, r r r Owritgeeilmelf 1'H1f'effXgF1y?1 ,r Qibliiq 7' - ---M A V .. v...-.f-an..,., 1 2 ,mi .,r, ,,. ..., W-..W,,,M.M,..., ,o,1. W, r.,. .rrr,,.. or fl,:Y,,.,. ,Amo mm , Ip-p-sewn I I I I I I I I I I I I I I I I I I I I I I I I I I I . I I II II I I: II I I I I I I II III II I I II I I I I I II I I II I I III II II II Z I I II I, III II II II II I II III III III II I II IIII IIII I II III II .I II III II I I II II I, I I . I I I I II II II' I III III' I I I II I II ,I II I ,I II YI II II E I II I 'II If n 1 , .. -L ,1I,---.,1I.,,.,...a.-.....,,...-...m,.K.,.,..,-.....,...-- .-3. . IIII . - - -- -----I 15 ,1...--M.......-.-----------N-M I-ff I'-' W-W Iwwjc 1f4 11, I T I I W WW ffffiz' IE Cl1IlF'F'EV'J-5 .1...i.1.w, ,I-' .... -.,-,...,,.,,f'Q. -.M-.f-415 P6-52iQi'f5IIW1-III-Q-Ile-----I i ' - 7' 'I'k T i'T7 fw77INf, I I' ' ' is 'I I ' csv so IIII I I' I Captain Hutchinson fl' I .. I'iIN'i ,T I Captain Larry Hutchinson, I hard hitting catcher, played 'II an important part in the suc- I cessful season of twenty- seven in which the Maroon and Gold won nine games I I from a schedule of thirteen. III II Review of the Season I An early call for varsity baseball by Coach III Dutch Lodewyk resulted in a wealth of material reporting for the first week of prac- .II tice. After a few of the rough spots were I , ironed out, Ferris Institute came here for an I II early game. In fact they made three trips to I Mount Pleasant only to be defeated by a fine I spring rain. The following week Alma was defeated in I a hard fought 2-1 game. Knapp doubled.1n I the last half of the ninth and went to third on an overthrow. Then 'Hubbel singled.to I I left field to score Knapp with the winning I II I run. Bennett pitched a steady game for I Central State. ' f Two new hurlers received their initiation as the Maroon and Gold won a pair III of games from Hope and Adrian. Cliff Magwood was on the mound as Hope fell be- fore a batting attack 11-8. Barden and Zimmerman had an easy job of throwing as Adrian was smothered 25-2. , Western State bunched their hits off Bennett in the first three innings to take II the first M. C. C. game from Coach Lodewyk's men by a 13-6 verdict. The boys re- I turned to top form a week later and scored six runs in the lucky seventh to drop III St. Marys, 6-3. I I II The next baseball trip was an even break with the Centralites winning from St. III Marys 5-4, and taking their second conference defeat from Ypsilanti in a loosely I played game. The hits were well divided but Ypsi made theirs count to annex a 10-1 I II victory. - I II Three triumphs in a week was the record of the sluggers as they took a double I header from Ferris, 7-1, and 1-0. The third scalp was taken at the expense of Grand I II Rapids Junior College as Barden pitched his team to a 14-1 win. I I The best game of the season was lost to Western State at Kazoo by a 6-5 score I II when Kimball, Western State hurler, hit a triple to score two runs and win the game I in the sixth. Hansen and.Hutchinson swung a wicked bat for the Maroon and Gold. I II Only one error was committed in the nine frames. Ypsilanti faltered before a savage batting attack on the part of Central State and the down-staters took an 8-1 drubbing as Coach Lodewyk's men went into a tie for second place in the conference. VEfffIlI'E In a Season mafked by IT1211137 hard spots Coach Lodewyk directed the Maroon and I -I Gold to one' of the best seasons ever experienced by a Central State ball club. Much I of the credit was. due Captain Larry Hutchinson and his team mates for the typical I Central State attitude which they showed throughout the year. I Ix.,,3f,,II In --W Jw W IffI:FQiIf I I . I I ig. ... . 1,.....--11,-.,, W. ,,.. 1. I II ,II I4 I I I' . I. 'rico ' x 5 I5--52-I nc.. . . If ,., 1S......1..1....., i..,,,.-..- , 'I II 'I , ?,i,Tx.7,,' J.-.-f -- h........r ., ,..,-1 ...V .--... , ,,... ..-..... -.. ...Y.-u.1. .....,.. -..... ....,.,....,...- .. ....., N9 ,-- .---. - - .. , . .,, 1 . . , 1 1 ff 'I 1 L 1x 3 l 1 11f ,,,. 1 1'. 11 ,. 1 1', i ,. '1 .11 1 1 fl l l 1 1' i f 1 '1 1 1 1 1 11, 111 11 jr 11's--1 1 .1-.,1,.4 ., W,-,-.--1 .. -. ,g -' - 1 1 '- f' '-- '- - ' 1 1 J ' f . 1 1 f' !... A..-S 21 1. . A ,,. 4' -1 .42 1 ' 1 f. . -V 4 ,f '11, . J , ,. ...Y .V.. . . .., ,V ,MA V1 . ,LJ ' 1 . -, 11 17. if J 1 ,, f , 5 3 Q 1 Twenty-.Seven Varsity Baseball Squad 511 A W1 fi 1 11? YW EM- M1 7773 Back Row: M. Lewis, Coach Lodewyk, Wright, J. Lewis, Bennett, Ba1'den,Magwood, Zimmerman,Knam1. Q Front Row: Melano, B. Lewis, Hubbel, Newell, Pulkiner, Hutchinson, Butler. Hansen, Hursh. 1 111 5M n'm 1 1151 Summary of Twenty-Seven Season A April '16-Defeated Ferris Institute at home by a score of 9-0. April 23-Defeated Alma College at home by a score of 2-0. April 29-Defeated Hope College at home by a score of 11-8. . .ll 1 11 1 1 1 ,W April 30-Defeated Adrian College at home by a score of 25-2. ri? May 6-Lost to Western State at home by a score of 13-6. '-1 il May 13-Defeated St. Marys at home by a score of 6-. YB .1- .11 bl H1 May 20-Lost to Ypsilanti away by a score of 10-1. 1 I May 21-Defeated St. Marys away by a score of 5-4. if MW27 1 112 1 Defeated Grand Rapids Junior away by a score of 14-1. .,, May 28-Defeated Ferris Institute away by scores of 7-13 1-0. 1 1 June 3-Lost to Western State away by a score of 6-5. 1 1' June 11-Defeated Ypsilanti at home by a score of 8-1. 1 1 3 1 11' 1 fi 1 1 1, 1 4 '11 1 ll 1 111 1 1 11 1 1 1,1 , . , . 1 1: I M 1 1 1 1 1 Tl 1 I .1 I l 4 T. I 1 JC--5 1 1 J in 1 .-.fffy lv- ij ll .. 'Ei 1 fn-T' 11 5 1-P151 1 . Vf'?: 1 6 .R .1 1 .1 1 im! 1. 1 1 iff 1'f11,'f1f11ji1121 5 l -g.,,,:1 , if 'ff wr- ff-....: .,v.f,...e.,:..,, Ln.,---4--- - f v H gr... - Y ., 1 it Q 5.- 1 Y . sq 1, -.34-. -,. .4.4..... V..- -..,....,...,...,..,..-.,.f,....-..--.,..,..4,..-..1. 4- 1 June 14-Lost to Alma College away by a score of 6-2. ' 15 The Nine Leading Batters of the Twenty-Seven Squad I 1 AB H Pct. Eino Pulkiner ........ .......... 4 9 18 .367 Jim Lewis ................................... . .... .......... 1 1 4 .364 Sid Hansen ....................................... .......... 4 7 17 .362 Larry Hutchinson fCapt.J ........... .......... 5 0 18 .360 Harold Hursh ................................. .......... 4 5 16 .355 Bob Lewis ...................................... .......... 3 4 12 .353 Melvin Lewis ....... .......... 1 7 6 .353 Russell Newell ......... .......... 3 9 12 .308 bLeslie Barden ............. ...... 8 4 .500 Leading pitcher. 1 1 1,'-N.-.51 --- ---- -------4 --4-. - . .-.. -....,.--...--... l . -li 2.11. ITITN' IDEM 'l 1iIi l'V'-HVIYCIT ' 1 1 1 1 E ir U E E 1 gb 11 1 i lr 1 1 gl 11 1 11 1 1 u fl 1 il 1 Q! 1 l 1 U G1 1 1 E 1 if I ll 1 1 1 1 G 1 1 1 2 5 1 1. 1 1 1 1 1 A 1 1 11 11 1 'A 1 -11. ,.-..,. 1 1 3 lg: 1 Hi: 1 5.11 X5 3 .....,.2.-.,......,.-, ,......,.,.--14A4,.....-,.,....4.,. W.-Y .,-, 1,..v.......s.-.,.-.-.,,..,.1,....Q.......,..,......f,-144.5 .,.-----N27 up-M: -1:4 G ui. ., .....,.. U -.,..,....,... .- ,. . V-.- ...M ,.. 1 5 U 1 1 3 il 11 11 f 1 f fQ.1Lf, 1.111 H L me 'f' - ,JA I I l M ,. II I I E I IE T II l l I Il 5 'I 'Il II If icjiiizfiaqw j..l,3,V- AL?-gwmg' ,f,fs..m...r,s.. I 4.,. f -Pfre---f-W f---Mfrs-' r f'4 www p ,. . f . V V. -- -- I - -- . ...a.I.,s....,,,,,E , s - My LI A IRQ? UI I Twenty-Eight Varsity Baseball Squad G I I Back Row: Butler, Burch, Cowles. W1'ight, Barden, Swanton, Knapp, M. Lewis, Coach Lodewyk. Front Row: B. Lewis, Hutchinson, Hansen, Bremmer, Captain Pulkiner, Melano, McDonald, Zimmerman. I. l I Thirteen lettermen reported for baseball early in April. Every one made the grade and became a member of the varsity. Only three new faces appeared on the team, namely, Cowles, Bremmer and Swanton. I At this I fl li I I Il I Il early date the team looks strong enough to go through a hard season. I The iniield is a Veteran one with Hutchinson behind the plate, Bob Lewis at first, Cap- tain Pulkiner at second, Melano at short and Hansen completing the circle at third. y Zimmerman, Bremmer, Barden and Wright form the hurling squadf Mutt Lewis, I Butler, Knapp, Burch, McDonald and Cowles make a strong crew of ily chasers. A Sid Swanton is a capable understudy for Hutch behind the plate. 1 Summary of Twenty-Eight Season April 27-Defeated Ferris Institute at home by score of 8-2. May May May F May - May May May May April 28-Defeated Adrian College at home by score of 16-2. y May 4-fRainJ Ypsilanti at home. 3-Lost to Ferris Institute, away, by score of 4-2, 5-Defeated Detroit Tech. at home by score of 18-4. 10-Lost to St. Marys at home by score of 2-1. 11-Lost to Ferris Institute away by score of 15-4. 12-Defeated Detroit Tech. away by a score of 21-6, 18-Western State at home. - 25-St. Marys away. 26 -Ypsilanti away. 1-Western State away. June 2-Hope College away. COpenJ-Alma College at home. COpenJ-Alma College away. June 'f -'fflf . an 'IIIa'g'.-pI5,,- I ' we if FL -.-,. L.-sL-.--.aa. .... ..L.-...LI. I,.,.L.,LL-,.,s.......L.,Il 1-NM...--J - ---V +..--.4..e.lgI,.,3l.,..A,3, ,,L,,,L,, 3-A,I.,,3,.,-.12-4-.41 , K x- 7? l l 'ill iii. 5 ,. ,rf rf L X I f I U I I I I I ,I .II I ,I y Il I I I I i I I Il, II H I 1 . A 5 I :I ' II I I I I - I I,I I l I III 1I . Ill I l I I I II. I 'I I., I.. -I 'II I I I .I I II, .1 'I I gfes. c'- il . III I Il I If li I YI II' ll I I. I Ii, - I ll I Sl I I I Il' I II Il II I XIII I liz 3 IIN 'I ll ' Ill Il L II I II ll ' II I I . III I If II . I JI , 5 II Il I III ' ll I If E l ll I I: I II 1 QF Q l lI I ' ffI ' III .H , yj ld II ., . M' 3 Izzf., Uj I .I Vgt if O IA 1 'e..-I-JV as-wt. .,,.. li ,L I 4 E? K rw -.I gxfaf yt: Akbar' s -J K Last Minute Review of Central State's Athletic Program A last glance at athletic activities for the year 1927-28 shows a steady growth on the part of the college program. The schedules, equipment, and enlarged enroll- ment are building for still better athletics. All of this improvement is being reflected in the creditable performances turned in by varsity and intramural teams each season. The varsity football and basketball teams enjoyed successful seasons, with second place in the M. C. C. coming to Cen- tral State in each sport. At the same time Frosh and class teams were enjoying the recreation and good health that comes only from wholesome play. A To date the tennis team has won four matches and suffered only one defeat. Adrian, Ypsilanti, Bay City Junior College and Alma have fallen before Bill Kelly and his team mates. - The baseball team has played consistent ball, although they have lost the two hardest games on the schedule by a hair. ln both the Sb. lVlary's and the Western Slate game, Central had the bases loaded in the last half of the ninth with none down and they failed to hit safely. The Saints won 2-1, and Kazoo came through by a 3-1 score. In spite of two bad breaks in a week's time, Coach Lodewyk's men have a fine chance of tieing for the conference championship. On Tuesday, May 22, Coach Parker's trackmen gave a fine account of themselves when they forced Detroit City College trackmen to the limit to win a close dual meet at Belle Isle by a 72-58 score. Central State scored a first in every field event while the Detroiters finished ahead in all the running events. Two records fell as Jack Quinlan threw the javelin 160 feet to better a Central State record for thesecond time this season. Jake Burnham nosed out Stackhouse in the discus throw when he heaved the weight 113 feet, 1 inch. This bettered the. old mark by an inch. Jack Cline continued his versatile work by winning a first place in the highjump, shot, broad jump and pole vault. The annual regional high school field meet was better than ever with twenty- three high schools entered. I. B. Crane's Caro track team barely won Class B honors with Mt. Pleasant High School less than two points behind. Coopersville ran away with Class C, while Fred Goodell's Middleton boys walked away with the Class D champion- ship. Both Crane and Goodell are former Central State athletes, who with many others are making good in the coaching world. 1 .'Z I f ,.,, 1 . , , LET, V .. ,mf ,. A I Pep all the time from Central Boosters marked the '28 Athletic Season. 1 ll lll Illl 1 i 5'-----.-4-..-----------iff H K 1 1 1 1 1 1 1 1 1 1 1 1 H 11 1 1 1 I I . 1 111 11 1. . 1. l 11 1. 1 1 1 1 1 11 11 11 11 11 11 11 11 11 1 1 1 11 111 11 1 1 1 . A 1 1 1 . 1 1 1 1 11 11 1 1 1 1 1 1 11 11 .1 1 11 11 11 11 11' 1 11 1 1 ,1 1 1,1 1 1 X 1 11 1 1. 11 1 1 x 1 ,XF 1 1 1 1 1 1 1 1 U 11 1 11 1 11 1 111 111 1 11 .11 1 .1 Q1 V1 1 1 1 11 1 1 1 1 1 1 1111 WMM J, WV,,,f.,-... .A gig' ggi if f VY- '- vqvxr E gig-jg? if -?,p1-'e?:':L:eeDM'r T767 vi 7Wo1'C3le1QWf1 1 '1' .1,1 QfD..1C...e..Q..Qgi de- ep 633557. ii! f111111 -1- eye' i it 1' M' it X 1 0 1 11J11 Q Central State's First Frosh Baseball Team 1 1 1 11.1 1 1111 111 1 1 11 1 111 ', 1' 1 11 111 1 1 1' 1 11 1 , f 111 1 111 1 f 111 1 1 1 111 ' 11, 1 11 111 1 1 131 11 1 1 111 111 1 1 1 1 1 1 111 1 111 11 1 1 11 of 1 1 111 Back Row: Tubbs, McNitt, Kraus, Hierlihy, Kenoy, Kniffen, Bastain, Hershberger. 11 11 H Front Row: Blood, Jones, Whittal, Stilgenbauer, Reed, House. 11' 1 111 Q 1 1 1 Review of the Season - 1 11 1 111 1 1 111 Spring found baseball the order of the day. Central State put a freshman team 111 111 in the field for the first time. Coach Stewart Butler was in charge of the yearlings. 21 1 111 There was a large number of willing candidates eager to go at the first call, but the 1 1 111 job of finding a team of valuable men was a problem that would bring grey hairs to 511 1 111 the head of any director. Freshmen teams should give every man a chance to prove 11 1 1 his worth, and that phase of the game has been handled in a splendid manner here at 111 1 Central State. In the games that the youngsters have played, a different lineup has 1 1 started each game. g 1 The first test was a seven inning game played with Clare High School at Clare. 111 1 The Centralites proved their worth by turning back the scholastics, 5-3. Blood and 111 1 1 11 Miller formed the winning battery. On the following week end, Sebewaing high 1 1 1 school brought a snappy team to Mount Pleasant only to lose a tight pitching duel to 1111 ' 1 the Frosh. in a keen 2 to 1 battle. Tubbs pitched winning ball. 1 1 11 Michigan State Freshmen were the next opponents to ,ppose Coach Butler's men. 11 1 111 A batting sgree lil the seventh inning enabled the.dow state team to take a 15-3 511 1 1 11 game rom en ra 's team. .gb , 11 1 1 1 1 1 l The boys came back with .good baseball soon after in running away with Reed f 1 1 11 C1ltydh1ghfscl1cLol in a 20-1 frolic played at Reed City. Two more games are on the 1111 1 1 1 11 sc e u e or e season. H 1 1 I1 Z 1 -.1 1 11 111 1 1 1 Freshmen Schedule Q .vil April 28-Defeated Clare high school away by a score of 5-3. 1 1 1f,TQ,.11 M9-Y 5-Defeated Sebewaing high school at home by a score of 2-1. 1 1 lgwgpy 15,1 May 8-Lost to Michigan State Frosh at home by a score of 17-3. 1116?-Y 11-Defeated Reed City high school away by a score of 20-1. 1 fm , 1 V ay 19-Michigan State Frosh, away. 11' 1 IH COpen1-fOpponent not scheduled.J 151. 1 1 ,f'1 11 ' .D -1 '11. if ., , ,... 1 --- .-.. Ls----.-.-,- Hmm.-. 1' 411 1 eeea or gfiiii. ..,. . , T ff ffl if ffmfiiifildv-El 1 ' K' W WL 'A ' vb 'TA' 'L' ' ' --Q-W :--- --....---.---.--. ...- - ---,Lb-lr Y.. , , . A , ,,,, W., ,,,,,,,.,,,,.,..,...,.....-J. -----'- ' 1 1 1 1 1 1 1 111 1 1 1 1 1 I1 ,1 1 1 1 1 1 1 1 1 1 1 11 111 1 1 1 1 1 1 1 E I 1 1 A 'Lal' ' ,Ll '- fr 'TTTU TQLLg1IggQ'i'L1 gjg ,gg tgigljkj tm QM Wg, 14- ' 1 1 gQ1?iQ,f51..11,11AC..- b- . ff X113 1 fa 11.141 119 491111 P 13 QW 1, 1, ,rm no 11-,N 'X f F7 7 Y A- -- --- ---..-.-.W.4.....,2....,-T,.- .Ai,,,,,, H, Y -mikug V M W 1 1 1-fe - 1 1 1 .f Q1 1 1 11211 1 111 1 15 11 1 1 .byw Q1 1 ee- 1 1 1,111 1, , 1 1 1 1 1 I 1 111 1 1 1 1 11 - 11 1 1 1 11 1 111 1 1 111 11 1 111 A ' I 01,-511501-111 ' 1 1 1 1 1 111 TRACK 11 111 1 1 I 1 1 L 1 1 1 ' A 1 1 111 1 1 1 1 1 1 1 1 511 1 '1 111 1 1' 1 1 1 1' 1 1 1 1 1 1 11 1 11 1 1 11 11 1 1 11 1 1 11 11 1 1 1 1 1 1 1 1 1 1! 1 1 Captain John Cline 11 4 1 .-. 111 1 11 . 1 . . 11 1 Captaln Jonn Chne 1S eas- 11 1 1 . . 11 1 1ly the outstanohng track 1 1 1 man in the stateof Michi- 1 I 1 gan. H1s all-round prowess 111 1 , - 1 1 makes him the best track man in the history of Central State. It will probably be' 111 years before another man of. 1 11 . . . 1 1 11 h1s ablllty runs under the 1 1 1 1 1 ' 1. 1 1 Maroon and Gold colors. 1 1 1 1 1 1 1 11 1 1 1 1 1 1 .1 1 -1 1 1 1 1 11 ? 1 1 1 11 1 1-'QQ 1 jk 1 'fa' 1 ELL? 1 X, 1 ' f 1 1 1 1 511 1 1 1? Q 1 C?i1 1 Q11 1 Q 1-. 1 1 1 1, 5 --1-'W- 't '1 1'-jf-1 11311111 1131-1f1Z1C'9Ei1,1.31 1 1111 11 4,-,W 1 We 1 if 1 ' 1 ,,..,., .f ,',.,..,'--y , .... 1 , . , MMWJ, K, .... ..W----- ---- '-ag -TT, ,f T1 ,,-- - 1. 1' ' f ff ' ' fl ' .J , J. f L li f.,1 'N ,J H -' 1 - A V ,., ,: X. ,- J-'iw kkfin ,tx if I 'qlfffff J lfy I m ff,W, ff----------fff 'cv' A 'f f!f f' M 'TfMfU A A 'M 'M' Vjg sf--W-----lr'-B1-fgfgjfggigxifitii --fe M' ' r el 5441 AMW., A,,, ,,.,.. ..-,.' -------Af--'M- r Qgj 4 j' A l To i 6 n l TWenty,Seven Varsity Track Team , . Sk- ,, B, 1313, Pulkiner, Selby, Madison,-McKenzie, Coach Parker. BaC'fFf?g,j1- RlcfvlgfppfpincijifigSWitZ:31xleiDugu?dTleNVhite, Walters, Davis, Corwin, Lauer, Hegeberg. Review of the Season The twenty-seven track team has the distinction of equaling or bet- tering two-thirds ofall the college track records made by Central State athletes. Asa whole the team was Well balanced in both track and field events. Track is va comparatively new sport at Central State, but it is rap- idly coming into its own. The size of the school and the fact that Cen- tral puts three varsity teams into the field every spring prevents the Maroon and Gold from having as large a squad as is desirable. In the past, a lack of second and third place Winners has kept the score down considerably. The fact that only one dual meet was lost by the Park- ermen speaks Well for their year's labors. The Michigan State fresh- men. nosed out the thin clads ina fine meet by a 71-60 count. Cline was high point man with 19 points. Nine firsts Were Won by the Cen- tralites with five going to the yearlings. a Victofies OVQT Alma, Adrian, Kalamazoo and Albion colleges, plus a fine Showing in the conference and open meets made the season a de- cided success. il., ,,- ,fr X i -Q 7' Mx? ,. fl li . I l i I all F 2 l . l l i i il W1 il' Di , F , it ill A f l 1 E. i ii i A i, ll HKFLJI ill iii sl! Ti? all V1 lil lM ml !1l ,lx all is gig il ..l lit la lf! ill Us elf ll si Eli ,l ll li f il' ii. ,y l ill g I ap, gl! lil nl, E y qi ggi ill lil EE? il E Q L lf, i ii' E2 '- iii ii, N l Hg., ix :ag ilwi lliwl -si if L-i 'TT' ,- ,i .1 13' 1 I -- 1- . f 1 I -f-.-,.,,-,- za.-1 ...., V-...K Track Records .,..,,. -A .... ..,. - . .. I. . . A II I I,I 'I I 1 I I I I I I I I V I I I I I I I I I I I I I I I I I I I I I I V I V V V I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I II. .- I K...- J ,., :.X-V . I ,A-, Ii- I. I Twenty-Eight Varsity Track Team I ' P .II II V ,-. 4 IR, II I I I V I I IV II I I I I V V II I II -I II .I II II EI I V II :I i. II :II II II I I II II I I I I I I I. II ,I II I1 II II II I1 I I II II I I Ii II H. I II II II I I I II II I ,I I I I ,I II I I I .I I IGI' II' 'I . s,....-. ., A 1 uw N ,,,,,,, -,,,,,...,..-.f..-f..,.s-an -If ,nw H 1, - H---.-...,.4..1-..-.---.,.- ,...,,,,- ,Mum ,,,A A -mv UM I A mv dm A Nr '+t-I II ,-.:VI,.1I',f' fffp ,. F-I 4 F T T., ,.. -I 4 . I ' V - N A' NIJ. I I'-41 Il II- e .-.III14 I ' I. Is, , fywhf-, -I V I,,Z,I,V Ik Irlif, I,,,,jII , 1, ,- I1-LU. I Ve -. I III X I JJ' 'I'-L-'QI-JI' 4 -X ..z--V Ili...-.. I X , lu, -1 ....,..f - - -f ------.I W- H..----N .. A. , Ahh, , W ,HW Nw 4 ' Y V ,Y f ' Iy is Ir' I . Ifffvi .wr Io .If s. Back Row: Coach Parker, Sutton, Quinlan, Stackhouse, Burnham, Brown, McDa'1iels, Kenney, White. Front Row: Simpson, Robbins, Captain Cline, I-Ietzman, Furman, Hartman. Review of the Season A Track activities received their first momentum during the winter season when Corwin, Cline, Duguid, Furman, Switzer and Hetzman represented Central State at a pair of meets held at Michigan State College. Although the squad was small they came through with a satisfactory performance. Captain Jack Cline established him- self as one of the best high jumpers in the middle west by clearing the bar at 6 feet 454 inches at Notre Dame. The spring season found everyone busy with practice. Ineligibility of Corwin and Selby dimmed the hopes for a successful season, but the Maroon and Gold came through as usual and defeated Alma and Adrian in a dual meet at Mount Pleasant. Central State amassed 62 points to Alma's 523, with Adrian finishing last with 4316 tallies. Captain Cline registered four first places and three seconds for a total of 29 points. A dual meet with Alma College and Detroit City College, the state meet at Lan- sing, the Michigan Collegiate Conference Meet at Kalamazoo, and the A. A. U. Meet at Grand Rapids loom ahead of the Parkermen. They have a fine chance of winning a majority of their contests. .jx EVENT 100 yd. dash RECORD 10.4 sec. .... . HELD BY .Milford Finch .... YEAR MADE 220 yd, dash ,,,,,.,,,,, ,,,,...,,, 2 3.7 sec. .,... .Milford Finch ........... ............................ 1 927 440 yd, dash ,,,,,,.,, ,,.,...,., 5 1.5 sec. ...,,..... .Percy Munson ........ .......... 1 926 880 yd, run ,,,,,,,., ,,.,.,..., 2 m. 6 sec ..,....................... Lynn Corwin ............................................................ 1927 Mile run ,,,,,,,,,,, ,,,,.,,,,, 4 m. 58 sec ...................... Leneau Davis ............................................................ 1927 Mile relay ,,,,,,,,,,.. ..,,,,,,,, 3 m. 56.1 sec ................. C Lauer, Kimball, Whittall HartmanJ 1925 High hurdles 16.7 sec. ............................ Lyle Bennett ..............,............................................. 1927 Low hurdles High Jump ......... ........ Discus ...................... .......... 26.7 sec. ........................... . ..6 feet 42 inches... 113 feet 1 inch .......... George Lauer .... .Jack Cline ......... .Jake Burnham ........ ..........1928 ..........1928 ,IG Pole Vault ............ .......... 1 2 feet 3 inches ........., Jack Cl1ne ............. .......... 1 925 fjtii Shot Put ............. .......... 3 9 feet V. inch ............ Jack Cline. .......... .......... 1 927 In K3 I Broad Jum ,,,,,,,,, ,,,,,,,,,, 2 2 feet SML iI1Cl'1eS .... Jack Cline ........... .......... 1 923 I P , I KI Javelin ,,,,,,,,,,.,,..,,., ,,,,,.,,,. 1 60 feet ............................. Jack Quinlan ...... .......... 1 928 , II - ......... . I--- ..,.. .. N , H- -1-f I.-. .A-4---1 I - - A gif' I3,I2W'Ij 5 m I 'W' i'i'i: 'V'i 5''7 m 'i W I 'ff , . TT'I77Tm 'W'W'I lvmmmm 'MiI9iiI, I34g Q4l'eI -I If- we A I- VI-meet It 5 IIII It 6 'Ali i.. figs tiiTicTf..i1..-1.ff K 3' .,,.-.--....., ,A V ..,.,.. , 2-1' I 2 ' ,aff 'A'Q7 T 'v2 ul' --1513121111 A ix as fp , ,1Ci.Q5,CL'f:53 K fr MrM.,,-.,1-W-A.-f-- --- ' - -- - AM ' - -1-- :kj Q Q 5 02 fl is X D .5 I N ' , LJ,ft,,,,1.... V, ,Imam , f M-,M J 1.1. -...W--N---r , 1 -LL L+- 'W' X .AM,- .1.a1.Mee-- , 1 lla? '1 lflgf Many Capable MSN 'Found on Freshmen Track Squad B l' Row' Coach Butler Miller, Lenhaft, Hayden, BHCOX, Kraus' Chaffee, Curtis' Mole, Clark' Kelly' acl ' , Jones, Beamish, Monaghan, Trainer. Front Row: Bastian, VVhittal, Reed, Johnson, Black. Review of Freshmen Track Although the yearling track team has only broken even in the two meets they have had this spring, many likely looking men are included in the group. The first meet with Mt. Pleasant high school was taken by the college runners in easy fashion. Injuries and sickness prevented the team from making as strong a showing against the Alma College Frosh. They suffered a reverse at College field on Saturday, May 12, when Alma Freshmen won by a '73-54 score and then paid a visit to the Almanians the following Friday and gave them a decisive defeat in .a great battle. Many credit- able performances were turned in by the Central Freshmen in defeating their future rivals in sport. 1 A ' In Bastian Central State has a promising man in the high jump and pole vault, Whittal looks like a good man in the short dashes, Kraus should develop into a valua- ble discus thrower, Miller is the class of the distance men. Lenhart is a consistent broad jumper. Sumera, Johnson and Mole look good in the shorter distances. Jones has all round ability if he can develop. In general the squad is one that can be made strong in the future by hard hours of persistent practice. Below is printed a list of the achievements of the Frosh men made at the date of bl' t' - -- pu ica ion. In many cases they could be better, but competition did not extend lf fl I . the winner. 1 'Ti ,sl X1 Q11 aj 1 l 1 1 4 E v 1 l l l V 1 E r I V 1 4 I 1 l l P 1 l l l E T ll - M 100 yd- dash Whittal 10.6 sec. V Pole Vault Bastian 9 ft., 9 in. 440 yd. dash Johnson 57 sec. Shot Put C12 lb.JReed 40 ft., 4 in. 4,5 220 yd. dash Whittal 23.4 Sec. shot Put f16 lb.jReed 34 ft., 11 in. 830 yd fun Miller 2 m- 13 SGC- High Jump Whittal 5 ft., -232, in. 21, J Mile run Mole 5 m., 26.3 sec. Discus Reed 103 ft., 2 in. 120 high hurdles Curtis 17.6 sec. Javelin Slack 136 ft. 'rg 220 low hurdles Critchell 29.8 sec. ', yr ex 7 2 ,,f,11.,, .' ,s..,1. 5 i i X g .-fr xl 5 M W Xi so I is--fe:--geese gigs I S I I I L i V ' via. T ' .. enms - and Mmor Sports CAPTAIN BILL KELLY of the twenty-eight tennis team is a three-letter man at Cen- Y 5 z , tral State. Bill won his spurs it V ' ' as a high class tennis man L I as a freshman and continued le his work by' being a good 3, leader in the season of '28. .s t. 'e t, . ' al.. lt 0 ,S Central State Turns Out Strong Tennis Teams le . No sport is better liked or played by more people at Central State than tennis. With an large number of tennis courts and large classes in beginning and advanced t tennis it is little wonder that good tennis teams have represented the Maroon and 9 Gold for many years. With the coming of Coach Wallace C. Parker to Central's ld campus, tennis received a new impetus. Coach Parker is a great tennis player him- self, and in addition, has therknack of passing his ability along to his proteges. The , twenty-seven team was no exception to the general rule. I To .date the twenty-eight squad has taken a flying start. The first match with the.Adr1an college racketeers resulted in a clean sweep for Central State. The fol- li . 10W1Dg week the boys took Ypsilanti into camp when they won two singles and two doubles matches to annex a victory. I J' One reverse has been suffered at the hands of the Olivet college team. The n. down-staters played brilliant tennis in winning the match by a narrow margin. U, The twenty-seven season was all that could be expected. The Parkermen won from Adrian, Alma, Ypsilanti and Hope, and tied Ferris Institute. Bill Kelly went thruithe conference meet to the semi-final round where he was eliminated in a great tennis battle. , rf' ,Q n y N e . .... - ..... ..,. 1 I '9 A' ,,'. 5 ,-.ig QF I , V I I ii ii' IN , : i TTT I'iii WWW'iT 'pT i 'T i'w wmW q v 5. ,... ..,,. l ,.,,-, -W4 L5 F. --....-.,,L,.,. J f I f OVQA A 'rr-5 -uw..--..-...-,,-.. .LI .-. full ii .Acc Lnggii 'eee i s m:1-.........- ,T I fr . 5' I 4 w 1 I i , r 1 1, ,, 4 I n WN , . w r 1 1 I I , L i I w M1 1. F r W v H i + P I 1 IL L B, K L. JH. l, Hr 1'--1- f gl I V I 1 1 n V Twenty-Seven Tennis Varsity Robinson, Hood, Wooley qfjaptainb, Woodruff, Kelly, Coach Parker Twenty-Eight Tennis Varsity Robinson, Archer, Kell y fCaDtaiUJ. WOOCl1'UfT:, Stevens, Coach Parker 1 l v l 1 Xi X Qi ' LQ. 5, 6' El. V , EE Central State Student In Athletics - XL. OLYMPIAS V RICE'S WINNERS IN INDEPENDENT LEAGUE WINNERS IN HOUSE LEAGUE Bert Stevens Murray Youngs Mel Johnson, Harold Curtis, Bill Corwin, Jack Cline, Harper Archer Maynard Allyn Lee Lambert, Sid Swanton, Pal , Mascott, Richard Potter Hubert Archer Russ Lundquist, Glenn McDonald. An effort is made to have every man on Central State's campus participate in some form of athletics. Intramural teams in basketball and baseball reach a large number. The annual indoor inter-class track and basketball competition is a big event. Fifteen tennis courts are none too many for the hundreds that play the game in the spring and summer. Large classes in seasonal sports make it possible for everyone to learn the game as Well as play it. With the opportunities now open, no one should ever get a degree from Central State without having felt the thrill of vic- tory or the 'regret of defeat which can come only in athletics. The 1927-28 intramural basket ball series was the- most extensive and enthus- iastic ever conducted. The fifteen teams were divided into two leagues, one was com- posed of rooming and boarding house teams and was called the House league. The other was made of independent teams. A HOUSE LEAGUE INDEPENDENT LEAGUE Riceg Olympics Hay-ts Northwestern Rice Eaters Celtics Pirates ' Night Hawks Midway Scoreless Wonders 1100 s. Main Manual Arts Cafeteria Newtons Walk-Overs 17,3 053.55 9510 fl-IF CHEPPFWA T928 fewer, C61 A T tstandmg teams led the race for honors 111 the house league It was not wo ou until the final game that the RICSS and Harts met to fight for their league champlon h1 Then it took a great fight for the RICGS to win a close victory on a pa1r of S P free throws after the score had been t1ed on six different occas1ons A feature of the 14-12 victory was that neltheir team scored twice 1n success1on A The 'Olympics last years intramural champs won their second crown when they won their league championship with a clean sweep and then defeated the RISQS 1n the world s series after playing three hect1c overtime periods The final score was 30-29. The Olympics jumped into a 10-1 lead in the first period and continued to have their own way for the first three quarters. In the final stanza Corwin, Lund- quist, and Swanton got hot and tied the score as the final seconds ticked by. The ,game went three extra periods before Potter and the Archer brothers aided by Young and Allen broke through to a narrow winning margin. OLYMPICS S1301 RICES 1295 FT. FG. T. FT. FG. T. Hu Archer ........ ............. 1 4 9 McDonald ....... ................. 0 0 0 Ha Archer ........ ............. 1 1 3 Curtis ............ ............ 0 1 2 Potter ........... ............. 2 5 12 Corwin ......... ............ 1 6 13 Youngs ........ ............. 0 3 6 Swanton .......... ............. 3 2 7 Allen ........ ......... Q ...0 0 0 Lundquist ...... ............ 1 3 7 4 13 30 4 12 29 The Juniors won the annual inter-class basket ball series by' defeating the all- Freshman team in the final game by a 35-28 count. The yearlings had previously knocked the props out from under the Seniors in a 48-28 frolic, while the Sophs were being sunk by the Juniors by a 42-14 count. It did not take long for the veterans to upset the dope after the Junior-Frosh game got under way. A 9-3 advantage earned in the first period was stretched to 21-9 at half time, and from there the champs coasted home to an easy victory. JUNIOKS 4353 ' FRESHMEN C281 FT- J FG- T- FT. FG. T. Brotzman ....... ............. 0 0 0 Reed .................... ..., 0 1 2 Stackhouse ........ .........,,,, 1 ' 5 11 P. Manson 4 11 McClutchey .......... ............. 1 9 19 Hahn --...---.----'.'-- 3 9 West ....................... ............. 0 2 4 .-..'.-..-.' ---nu-nu-2 0 2 Anderson ....... ............. 1 0 1 Johnson 0 1 2 Robinson ' '---'-------- 0 0 0 C. ..... 1 2 V016 f 1 ------------- 0 0 0 Aiken ............ ,,,,,,,,,,,, 0 0 0 3 16 35 8 10 28 recorghe tannual inter-class track meet was run off in the gym on February 14. A balanceintlgzimist macile the meet a closely contested affair. The Sophomores' well- Won e honors by grabblng' 34 Points. The small Senior team was d 'th 1 ' - ZTSZU8 VI:':Jint36 Aa, while the Junlors added 21M to take third over the yearlings with f 1- ---has 1.2. r:ii'g,54-133 ,ml up A l...... l 1 . 11,111 ,Y L- 'X . ..r e s S -S O l. 41 ll V e 1 J I v 4 l 13 152 1 V fbi 1g 1 ffl v -gm 1 X lf 1 i i as so ff ,A C ,. , R ,,i,,,,-m,-,- A .A -,-,..,?gw 4- eg- vis- .ee is at C . be . ,TATA TY-. , . agua i .jig Q 1 J T zsgfgw l 4 1 fl I I il 1 f 1 f . I Vg Wif i' M1-ef ff, ,A U -h t 5 xx xx HIE Je.,-X 9 lklfv .4 Xlfj fig,-',l,2l lg '- l ill 5- fri-1, ff, rw' 2 y 1 11 f L ,1 l ill X Nl ' I1 1 l 'C lf! ll ,- if ll g ll , - 'K ', , l ill ' ' I ' U J r l - gli' ' li l Q1 . ll 1 ' ' ,X 'N' 1 51 1! l1 li fl 1 Q l ll 1 ll 1 'I lll ll, l 5 ill W ? S 1 4 1211 omen s l 15 l lg ll 0 1 1 1 1 gl Athletics ll 1 ll 11 ll l lil ll all l, l Ill z JU 11 W 11' ill' A' J Clip gll 1 1 Il, ' Ll 'Il ill ' 1 1 1 ,lt 1l li , MI: A ,t' Tl 1 , 5 ll: gl ll M1 l 1l!l , L y 11 , 131 cg TEAM for every girl and every girl on a team is the ideal for Women's athletics at Central. The Physical Education Club, ilk J ,1 1 Whose members in the college are girls of the department, became an 1 N11 1 w 1 P 1 , 1 , 4, active member of the National Amateur Athletic Federation on March ,V s l I . . . . . . . ,il il 5, 19.28. This 1S an organization of several hundred 1nd1v1dual organ- l 51 l 1 vl 1 lk ll 3, izations and institutions Which acts as a standard setting agency With l El ,lf 1 V 3 a broad educational program. , 11 2 ll l 1 Instructors give the co-eds at Central lots of Wholesome, satisfying g 2 1 11 X 3 recreation, games, and sports adapted to her age, her-ability, and her Hal 1 l 'E fi Z , 152 physical condition. Activities such as archery, soccer, volleyball, bat lm , 1951 ball, horse-back riding, basketball, indoor baseball, golf, tennis, ping- llg l , X 1 V1 1 4, 3 ll pong, deck tennis, shuffle-board, stunts, and numerous other games ill l El ll ll lla . in which make it possible for every girl to know how to play. ' Having in lvl 3141 11, 1 fl learned to play at least one group game, she may experience the joy 21 I' I A 1 1 11 of belonging in a team and derive all the benefits, social and otherwise, 1 ll ,if ,g 1 ll 1 ill Which such participation brings. They teach her an individual game H, 1 il L El. 1:1 l l 5 that Will carry over after school hours and school days are over. ull ' 1 3 lr Women's athletics at Central State Teachers college are not meas- 1 tv l l l Q, . . a ' fl ured 1n terms of championships, scores, and records, but 1n terms of Slrkuli n fel - . a i morale, character development, play spirit, progress, and lmprovement. 1 , Tl n , . . . Success comes 1n health, happiness and good c1t1zensh1p. 53 1 ,JQTQ y gifjmwl Q l ' . ..., .... .,-, . --Y Y,.Y gr -,W --.y---1--.4..f------Lm- -1 15 fda 1 W Q.g13'Tf ?Qf','! H'Qi,Q' pig 1A'e T at W e . -A-1-1-A -1--M-P--A f-lm-H--A-A -f -7 A W ' Sophomores Win Basketball Tourney Sophomores were the winning team in two out of three games played with the Freshmen during the winter term. Early in the year, Miss Grace Ryan organized bas k e tb al l groups to play off matches in a series of competitions. Practice was held every Monday night in the gym- nasium. Besides the sport of class athletics, the co- Back Row- Evelyn Johnson, Marie Jepson, Marie Patterson, eds Were taught self-Con? Helen .MacDonalcl. Front. Row: Mariewell Schindler, trol, SpOI'tS1'f1a1'lSl'l.1p, alld Dorothy Martin, Lula Dargitz. Cooperation. A plcture of the winning team is shown here. Line-ups are given below: SOPHOMORES POSITION FRESHMEN Marie Jepson Jumping Center Lenore Wilson Betty Luek Side Center Helen Kates Lula Dargitz Forward Ella Solem t Petroah Camp Forward Marion Bowers Evelyn Johnson Guard Margaret Erwin Dorothy Martin Guard Ella Solem CCapt.J - Mariewell Schindler Substitute x . ll Large Classes Enjoy Volleybally Volleyball is an essential sport where large classefsj gm girls demand recreation. The game offers a continual challen igfbrlfhe development of greater skill and better team play, yet it piiqiifidles satisfaction in competition to unskilled players. Volleyballsiskbefcoming increasingly popular among the phys. eds of the colle0feH.,jvVB'eEause it is not spectac- lar, it is a game more in- 390 - teresting to those who play it than to watching fans The physical edu- cation department, whose aim is to give athletics to all, flnds volleyball a val- uable game. ! . A class tournament was run off during the winter term in which Miss Ruth Wyckoff's team were win- ni h From left to right: Agnes Prout, Vera Bowman, Olive Fisher, HQFS, 133213, Webster, Norma Gustofsen, Esther Van Holt, Maude lVl1C, Anna Brakora, Floretta Egbert, Hazel Van Etten. XX f 1 ,xx .. 'Qx 'M fr: 1 I4 s.,M,qgpJ., .y X ...V Ury? l l ' l. Sli GW li lt the Ti Out ated nl rlng ly in Yan lil al 1 Ches H ions. very ym- ffl port .I 1 00- -con- and ' 4, ll, w 'ill .Q l l 'll lu' tw Qi ,I ll ls I l ll. I l lf feof ll. lfl il iff ll If iand nent nin gl ugly 5. ztac- ,li ll l. ll l .rl A ll! Ql ill ,M .I ll ll ll 4 li new l glide neu. 0 Jil l K ga.: Q h 21,25 l 1 r . . K ml Twelve Candidates For Life Saving Badges Swimming is one of the outstand- ing activities of the spring term. Classes for beginners and advanced swimmers are given and the demand for life-saving work has been so great that a special class was organized for MISS JOSEPHINE ROGERS me Sam., Em.a.... those people. Girls have become dissatisfied with just being able to stay on top and want to learn to do everything in correct form. They are eager to know how to save their own lives in water, and if necessary, how to save the life of someone else. The effect of such an enthusiastic group upon their associates draws still more candidates to tank classes. The college does not have facilities for water games or swim events, but girls are trained to swim well by every known stroke which will be practical to them. There's a great carry-over into one's everyday ac- tivities in learning how to swim. The summer months become a long holiday to enjoy around and on the water without fear. It is a sport open to everyone, no matter how she may think herself handicapped. Miss Josephine Rogers and Miss Ruth Wyckoff have acted as examiners to candidates for Life- Saving badges this spring term. The Red Cross seal and the words Life Sav- ing on a badge are hon- ors that the successful ones may well prize. Ten students won them last . year. A rigorous test must Q gg ggggg l be passed to prove One,S' 'Back Row: Dorothy Swift, Emma Doerr, Evelyn Chrysler, ' ' C c'l Allchin, Agnes Kirchner, Lois McMacken. to Save a hulnan Front Rdwlz Gladys Hess, Gertrude Shovar, Mariewell Schindler, hfe- Helen Robinson, Margaret Belyou. Senior badge: Virginia Hatch. .N , - . nf... .-...,.s-...:.fL::Je..L.I....-,.,:.f..ung. V ,4- 1 . 1 '1 1 1 1 1 1 1 '1 11 11 1 1 11 '1 111 1 1 1 1 1 1 1 11 1 1 11 1 1 1 1 11 1 1 1 1 1 111 11 114 S. 1 1 1 V A ,Q VAMJA,-,k . Y,,g,,..... .- .. . ... ,-, . 1 i A 11 1 1 11 1 1 1111 1 '11 11, 11 :11 1 111 1 :1 11 1 11 1 1 1 ' 1 1 1 i I 1 1 1 1 1 11 11 11 17X 1 1 11 '1 i 1 1 1 1:1 11 1 1 1. 1 1 ,. i .f..1gl..LiQ Afi'i' 1 11 j4.:pg4gg.cn,4g,,,, is ' f212+-eigcffci' 'f'TWif'f MW 't '1 WJ' il 1 1,1 iii 'rw''awrymmmvm m':'mw'ml':i'm'mm'W'Iq: IIn '1'1 CW fi 1115 1 1 f N 1 1 1 1 11 Intramural Games and Sports of im 1,l3'q'3i 1 I' 11, . Soccer 111 1 1'1 . ' . . l1 In the fall term, phys. ed. girls put on their old gym suits and sweat shirts to 1 play soccer. Regardless of the mud or stormy weather, here s a game of rough and ,M tumble that all enjoy. Two teams were made up last fall and Played matches 9fga11lSt Q1 each other. The Redskins were captained by NCVZ1 Flelgel, pf Sebewafng, Whllfi' V11 the1Greenbacks led by Frances French of Kalkaska furnished stlff competltlon. 111 A tournament had been arranged and promised to be close but lt was never 1 '11 finished because of snow which covered the field early 1n the year. i W'- 111 111 111 I Baseball 4, ' . 111 1111 Baseball, the national game, has a prominent place in the program of Central's 111 women's athletics. A class in baseball was divided into two teams. Keen' competi- 111 tion was shown in the games that followed. The girls of the physical education de- 11 11 partment organized a nine with Prof. Grace Ryan as coach and arranged a series of N. 1 1 1 three games to be played with the girls' team at the United States Indian School. In , I the first game, played on May 25, the phys. ed. girls won, 14-2. Theda Cline drove in Q1 1 a home run. 1 1 M I . 11 1 1 1 1 C 1 1 12 - 1 1,1 Track 1 1 Track for girls is still a new activity. It was started about twenty years ago at 1 V1 Vassar and Bryn Mawr but not until 1915 did it interest the public. ' Central's women t 111 are interested in track as a spring sport and committees are now working out an 1511 approved list of events. It is to be carried on for its educational values and for the great opportunity which the different activities present for self-testing. 13 In a class for freshmen girls during the spring term, Theda Cline of Croswell 111 put the shot over 39 feet one day in practice, which is 7 or 8 feet above the record given for colleges. 1i 1 1 +R- 1 11 11 , 211 Tennis ,11 Tennis .still remains the popular game for spring. Classes in beginning and ad- 1i vanced tennis are oifered. Tennis is a game well worth learning, since it has been I played under the same standard rules as it was fifty years ago. It is a game that f parries .over into. whatever work one goes into, providing recreation for spare hours. tfefflulres 'fhlnkmg to SGFVG, return, cut, and lob. There is just as much strategy in Wlnnlng a singles match as there is in the world's knottiest problems. Teaching girls 3-'11e T2 to think qulckly with their minds and bodies is accomplished with tennis. q gi .Ed. Note.: .Because of ram and wet courts, we were unable to get pictures of 11 1 K. 1 tennis matches in action as intended. . ', 1 1 f1 1 11. 1 'I 1.-. in T1 iw 1 -x v 1 ,gig X. 1753 'ITN 14595 2 he -fe1 '111' ifigf j,1 ifi1 fagfjg .... . '4d,,.I,,u.. .Wo ' 'ef 0 +1 11U 'rf1'0 EJ ....m:.m1.1.-s.:.:.:-1.-P-1-1'-v -- Q-ae--.- ,.,..Y.. 1 1, V xl .t .Vx ,.mVfI,3 W.-- .. . , . , ., A .. VMI! -X I sb ,JN N lb 4. , i '-N I P V 2, ll ,A , if , I. ll. Ill ll! lj lla ll? lv lg ll 1, Qlsi lr 'l il ll If li .ix M ll ,H li al I ll S fl la l Iii ,V ll sl, A l iff? fl! Iij .ll I. I l, ll ll il ll il ll I l .fl I! ll i P I I 6 lx 1 SH lj'-I A fl tr O A f,-f SX Every Kind Occupy Central Co-Eds Miss Ruth Wyckoff joined Central's faculty as instructor in the women's physical education department at the beginning of the winter term this year. She has directed win- ning teams in volley ball, classes in tennis, and with Miss Rogers, has acted as examiner for girls working toward Life Saving badges. Rrdmg Anyone who has read the Highwayman has surely thrilled to the sound of hoof-beats. Girls at Central have been imitating the bold rider of fiction in their afternoon and evening canters about town. Instruction in horse-back riding is being offered by the Physical education department beginning this spring term, with thecooperation of a local riding academy. Miss Rogers or Prof. Ryan rides with the girls during late afternoon hours or on Saturdays, offering pointers on how to stay on. Next year the class will be more fully organized. Co-eds may earn credit by riding a required numberof hours. WEST- Golf, the most universal game played today for recreation, was introduced into the curriculum of physical education for women at Central in the fall of 1927. While cynics decrie the game as feeble, it is in reality one requiring great skill in balance indlprecision in shots. It is subtle, yet it takes the player into the out-of-doors where ea th is. For a brain-developer, ten girls enrolled in a class for golf. After 'practicing the technique at home and on the campus for weeks, they were given a chance to actually play when the city course was open to them. Instruction in golf promises to be pop- ular at Central State when more facilities are open for playing. Archery Archery was introduced at Central in the summer of '27, It is a splendid activity for girls. Not only does it give recreational and postural values to the archer, but it also trains the hand and eye. In Mt. Pleasant, the original home of the Chippe- wa Indian, an added thrill of using his weapon as a plaything enhances the sport. Some of the irls have become fair marksmen but its use here is so new that no g opportunity for competition has been offered. ,.,.,,..,...,,. -4-- -r-y-W -' -' ,wi-,H GX 4 m W N-I ,M W X -. 1 H - xl' ,fr h .Q L.,-5, ,f I 'Wifi wi- Q f wwf' -4 ,. ., u . ,-in-' , , ', - ' ' iw ,, - iw pew., -. . -fm, fi, KN - -'-'-' ' ' H ,V ,,,.M My -..,,,,,g. 1.4. 4- .f S :ly g V ,F W.-as-W-fa e , 4 gm Try? ,,,iii1'f a, -- as ewes 1 rf, f r V- ' walt lie l rg 3 0 cc 97 ' . P Eg Phvslcal Ed G1rls Sponsor Pageant, l l Back Row: Miss Wilma Schearer, Miss Irma Sundling, Miss Ruth Wyckoff, Miss Josephine Rogers. Third Row: Neva Fleigel, Margaret Galloway, Betty Somerville, Cora Lane, Mildred MacRae, Ella Mae Johnson, Emma Doerr. Second row: Agnes Kirchner, Alice LaRue, Helen Smith, Thelma Eaton, Rosalie Morrison, Helen Mills, Helen Robinson, Lois McMacken. First row: Gertrude Shovar, Dorothy Larrabee, Frances French, Rhea Curtis, Helen Hass, Gladys Hess, Zona Duncan. ff! 1 ,QS Ufficers g President ........... -'-'---- E mma Doerr Vice-president ...... .................. A lice LaRue Secretary ........ Margaret Galloway Treasurer ............. ....,..Frances French LIFE Reporter ......... - I ............ Neva Fleigel Adviser --'--- ....... M iss Grace Ryan . U I f K,,.l.y 1, 1: if ,f r as l 1 If li fl il 5 I 1 .l i El ll i i l I 6 K i i l i V ll Q. i A 2 l i w 4 l 5. L I x S il l 4 M gl I 1 is 5, F, in r 1 if in G , 2 1 fr gf ii -'l J, ii if is ,E F! fl if if ,7 .v sexe ,mfr il s J. limi ...,.., . -..va li fri x Wit gg AE I up N , l 1 I 1 l 1 6' 5 Li like Stress Advanced Work in Department The Physical Education club was organized for the purpose fur- thering the cause and aims of physical activities, and for the study of certain phases of work in the department which could not otherwise be stressed. Through these activities, students and faculty come to know each other more intimately, thereby giving a social fellowship and unity which is desirable. ' Membership in the club is limited to those girls specializing in physical education. The faculty, alumni, and Dora Silver, because of her many services to the club, are honorary members.. Meetings are held the second and fourth Thursday of each month. There have been a variety of activities occuring at the meetings this year, such as skat- ing parties, hikes along the Chippewa, social gatherings at Miss Ryan's house, and exciting games of basketball. A close tilt was played with the Indian School girls on their floor, the club team winning by one point. Student members have also played the phys. ed. faculty several times and won each game. ' Theclub has sponsored several all-college affairs, namely g-the annual Hallowe'en party, the first part consisting 'of relays and con- tests, the latter of social dancing. A beginners' dancing class on Wed- nesday evenings was inaugurated at which many C. S. T. C. students, men and women alike, learned to trip the light fantastic for the first time. All of the girls took part in the spring pageant as part of the dedication of the new Administration building. A A number of activities recently introduced at the college by the department of physical education have been enjoyed during the spring term by girls of the club. Horseback riding and golf are pastimes to fill leisure hours. The climax in club affairs came at the end of the year when the girls forgot their studies and spent a week at one of the nearby lakes. Here they enjoyed hiking, swimming, baseball, treasure hunts, and rowing. Special attention was paid to camp craft and llature 10106- Wr. .,.,,. .A+ g in A- ---,Y L.. .- 'Iii . - a , - ' 1 I Nl. I . . 5 I! Km. gifffanflf Growth of Central Is Pageant Theme ' s if 1 I . 9 1 4 5 i r l l ' w l l ,fi rig i U! S ' v 3 r P l .Al P , l i K ,'i 4 1 ,. A r g The Spirit of Central'7, the largest and best pageant ever to be . . . ' ' iii Q ' given here, was to be presented this spring on Alumni Home-Coming day, June 16, in the auditorium by the physical education department. It will be a fanciful portrayal of the background, past, present, and If q ,E . future, of the life on Central's campus. Dance of the Woodland Spirits , the first scene takes us back to the time when nature had full . . . . - - ll 5 reign in this region. Scene two shows the coming of the Indians and M , . A 3 l their territory conquered by the white man. The pioneers, who were 3 l Woodsmen and settlers, established the first school. f R . sal Part Il- The Building shows the establishment of the normal, ' the' effects of the world war, and the factors that contribute to life at A . . M Central. The final scene portrays The Spirit of Central. ,Ei 1 The program was outlined by Prof. Grace Ryan. The physical education faculty and students worked it out in detail and nearly 500 fp P E college students and boys and girls from the Training School aided in ' l the presentation. I I Running through the complete program was the theme of natural H and interpreted dancing with the colored lighting. , . e . . . . . ll! Miss Gertrude Friedrich, who directed the orchestra, is to be given much credit for the music. ' El f . Sl A . The Builders ' il l' H PM . lay li PART I-FOUNDATIONS Scene 4-The Forest Fire. V if All are 91'Chit9C'CS Of F3139 They fell--those lordly pines! ii Working in these walls of Time. ' ft Scene 1-Dance of the Woodland Spirits. PART H'-THE BUILDING 5 Scene 2-indian Life Scene l-The Establishment of the Nor- Coming of the Hunters. mal, Reception and Dance. The Portrayal of the Hunt. Scene 2-The World War. The Coming of the White Man. Scene 3-Factors contributing to life of Ceremonial Dance. Central. ji' H Scene 3-The Pioneer. Art. E Woodsmen's Dance. Music. 11' , The Party. Physical Education. Q T 4 P Cicillian Circle. History, Language and Litera- Q, il SN, Guadrille. ture. ' 'B Schottische. Science. tea-3 Virginia Reel. Vocational Education. G H The Pioneer School. ' Scene 4-The Spirit of Central. ' 4. or Q R JT' ii'i i7Sn-T 7 ? 'T'i s1ig'Li1 ,jjQijj' C --M R- -- -eee W 1- Y- ii , P in W... ne.-,....-,-..,,,..,,m.,n.,,.-.- M.. We .V 5 1 ..,....-1 1 A w i ' BRGANIZATIGNS f W Q J x T 1 A 4 I i 'P f ' I W M 1 L14 L di 1 1 1 2 P l r W l ug I l I 1 .Q l ,l ,L M- -'ll J, , lftif igpxcykel' iii il my all ml A 1 F l, ami sl lll lx N5 gl, id l l Il a 1 l ll ,li lm 'il ,jr lg? l :l1 ll, 2.13: z gpg ll, um Vi M xg: la , E W ,r' W 11 1 1 M pl ll 33,1 'fl lgj Ill al AE I, ll Wi rl M ill ,ll lla .ll ll M all lil 5 51,1 all Eli ml lil' ,,., 1 ? 1 rv 'f f V L K ' -, A 7 ,C ,e-Q .,.,-,i ,, L Q...L'.'lQ.Q,....'f'i iiffwll- me A X, - F f?f?',f HI' ' 'w' H Mr W a ff ' A EQmLfALL,AQmg,eiiiefwwiewinwage , , , , , ,A,.4 4 W Ibsen7s Plays Lead List of Dramas Back Row: Irma Sundling, Helen Estee, Nell Jane Damon, Muriel Trask, Sarah Lewis, Helen Wilbui Second Row: Betty Curtis, Vera Cutting, Beatrice McCarthy, Miss Amy Wold, Betty Fox, Marian Bowers, Emma Doerr. Front.Row: Leah Eaton, Ir1naLefler, Dorothy Botsford, Virginia Hatch, Helen Kates. President ................ Vice-president ....... Secretary ........... Officers 1927-1928 Treasurer .......................................... Women's League Board Re LIFE Reporter ................... Parliamentary Critic Faculty Adviser ............ President ............ Vice-president .... Secretary ......... Treasurer ......................... LIFE Reporter .............. Parliamentary Critic ....... g gi 'lf , V, presentative 1928-1929 TQ LU Ulf ..........Dorothy Botsford ...................Sarah Lewis .........Irma Lefler .......Isabelle Lewis .........I-Ielen Kates ..........Helen Wilbur .............Lottie Everden .........Miss Amy Wold ......,..Muriel Trask ..,.........Betty Curtis .........Marion Bowers ..........Irma Sundling ..........,........Helen Kates Nell Jane Damon HS UP. I I! I III 9 , I I II II I . I I I I I I I I I I I I I 1 I I I I I I I I I ,fy I.,,,,,!g ,,.,,....--- r'f1a-.f'-'fa . I- -I ,, ,, f , 4 if l I I f I .I 'V .-.-Y II, SVI, .-Y 1 .It .A V L VJ LJ U . .A .Q - N. Y -----A 15, I N . ,--L lvl w,,. 'I I tudied in arriner Spring Program The Warriner Literary society was organized in 1918 andnamed in honor of President E. C. Warriner. It was the second organization of its kind on the campus. Active membership is limited to twentyefive girls. New members are admitted by vote. Mrs. E. C. Warriner,-Mrs. Harry Miller, Mrs. Orlie Bishop, and Mrs. D. W..Frear are patronesses of the society. Mrs. Bourke Lodewyk and Miss Margaret Koopman are honorary members. - The aim of the society is to acquaint its members with literature of Whatever type they may choose. This year, Professor I. A. Beddow launched a study of modern plays by giving an interesting general resume in this field. Reports have been given by various members on such modern dramatists as Barrie, Ibsen, and Shaw. ' In accordance with the old tradition, the society sponsored its annual February party combining the several patriotic days of the month With St. Valentine's. The dance was unusually successful with original features including'Leap Year and robber dances, and a special- ty number by Irma Sundling and Virginia Hatch. Besides regular meetings, several social gatherings were held dur- ing the year to enable the members to become better acquainted. Stunts by new members furnished entertainment. The highlight of the season was a formal party tendered by the Senate and Forum to the Warriner A. Sloan Literary society. It Was held Literary society and the Lucy' in the kindergarten room of the Training School, the music was fine, and everyone had a good time. I IMI I ,I I T ,I za , ,A W.- Y..-. Y IAJI I2....L..L,i . , . A ..i--..L.--.-v...Mfg-.AQ-.A--Mme2---JB,,.-,,: i':3iL. -. II......, .L -. ,,,, i 'c swf- -we--M-'--gf fig-ffff'f'Wi ' 'i . l EI iw I I If 'INfIfI'-ff I' o ,lolo WI 1. Ns ,-3'fx x I I' L,-..Lg-mx-M. A-f -f-f -f--4-M 4 M Ayr.-A12-wL9,,,442uu' 1 II I - i Y, 4 :LY .,,, . i'I 1 ' ,..-...-f,.. ...H , ,,,,,4hn rv 3 -,,, pr M 7,,V w:.,,,.,...- A-a:f4--- Q i lb FEET , al, Activities of Senate Revealed T , rw p Wil lk l ig. 3 Ji it f in, HU hI1ff'L3f' 1 I I iii fra F li ,, H! i 'E 1 , H F F! I ,'5 i fx H will ' 1 I 1 . sw' fl Max Mattison, Jake Burnham, Lynn Corwin, Virgil Rowland, Henry Baumgarten, Mr. Ronald Maybee, ' Faculty Advisor, Jack Cline, Harvey Essenberg, Howard Woodruff, Harvey Thompson, ill r Arthur Thompson, Raymond Nash, A1 West, Ross Mattison, John French r President ............ Vice-president ..... Secretary ........... Treasurer ....... President ................ Vice-president Secretary ........ Treasurer ....... .H-,HN 1 al a 'V , , ,.,f 5 5, .5 X, en..M.,ra..-.i Q, r Cflicers 1 9 2 7-2 8 1928-29 .,.Arthur Thompson .............Raymond Nash ..........I-Iarveyi Thompson ..........Howard Woodruff Henry Baumgarten ..............Raymond Nash .........I-Iarvey Thompson Mattison EE, 3' 'E 1' All T x ,Y w ' ii 1 H ll 1 ig, iii W mi W 5 i i 55, 2,3 irf F Mil ww I,3g fi T I l lip, lla . ,,, rf? l ll! ESV' jgli Jygi Elle AY 451 M, iz, Hr! V l iw 1 if' l if R fl? 5 2'- 1 i 5: , ill 13 1 sv T 4? T xl N ff V li ll V, ml ji ! li, T , ii E Mg Q 1 Lfxj di 1 Elphwgl 1 Eff 1 Ei l fl,-, i l I l infrxv l A I I ' iuwnwggn J-, 1 'Xi ,..g.--. ,,,,, , - , as I , Q if fini' a Q 9 Vxxwjigl' A 1-'A-EQ0vgv, R5-V U flu! f- 1 Q Z Va is 7' 1 N Q I 0 fl IQ1 K w Q i Qi lf 1 g I Y Harm Q ' 1 sw 6' fl A Q, W f, 1 ' ' 1 ,s M1 ff' ,x lllldfg ,...,..,.-...Z.1.x.-.,:.m: ...awe 1 .,,v-YA ...R-W.. A , 1,-A-fe .., .wtf ww.,,T::.:..gT,: A N- N1 lc is 1l, I 1 11 l 1 l I l 1 l , 1 E 1 11 1 al lg 1 1 1 l l1 ll H l l ll E i R 1 Q1 l ml 113 , A ,W ,.1- -1'- 1 -We 1111 W--A 1-1-11feMe-mmm-em.e..4.412Z?.1iiiTg,g::i:efeeW'mf--V--M--M--if--wM.-WN., i7C'5l,,e f 1 1'4?3'lf'?flg5 'TL 14? Tl , -T ,-iii DT: f. 1 m t1l3+iTTm 'i k 'ki Vf'r'Wfif1f-ery'--A 3 le .1 t 1 1 r rarer 11'1 ef, l Q A l lil , ' Q fill l 5 ,T ,dl 111 Letter to Former Advisor 1 .l 1 'K' 1 f7 fa . 'iizyrhig 5 ,H Professor E. H. Webster, l Head of the English Department, 'Q E y 1 Montclair Normal School, L 1 1 Montclair, New Jersey. , , A l Dear Mr. Webster: Because you were our faculty advisor last year and because , t you have always taken such a genuine interest in us, we, The Senate, have been want- l 1 ll li ing to write to you for a long time. ll, T1 s T ll - , ll 5 T We have a feeling, Mr. Webster, that your ears must be burning terribly as we 1 V Al write this, and, if they are, you know what that means. That is a sure sign that 1 y somebody is .talking about you. Well, we have just finished doing that very thing, for, we were just wondering whether you still are giving those pesky old grammar l l V drills to the Montclair Normalites the same as you used to give them to us when you , H were head of Central's English department. Q ll ,Q We were indeed .sorry to lose you so unexpectedly and we were filled with much 3 fear and apprehension when we faced the new ear without ou but we have come il 1 A , W y Y 1 yy through with colors flying high. We were able to do so because a new member of li 7 l Central's faculty came to our rescue. His name is Mr. Rolland Maybee, and he surely 1 has been splendid. 1 g I 1 We began last fall with exactly seven old members. Then through that dark and H A Syl mysterious method of selection and initiation known only to you and to the inner circle of all good Senators, before the close of the fall term we had reached our max- f Elf imum membership. All of them are fine fellows. 1 ll ' ' f ' 15 lx 'lj Weare proud of the success with which we have followed our motto- Accomp- I 1 V TU .... . . - - l llshment diluted with recreation. As for accomplishment, we have attained it ln two N 5 i gh ways: First, inthe splendid scholarship of our members, and, second, in the work done in our meetings. l Y ll .1 l We studied Greek philosophy during the fall term. For the remainder of the 'gl college year, we became interested in a series of discussions, by such men as Bertram Russell and Haldane, upon world problems. 1 111 1 1 1 ll As for recreation, we have had plenty. Henry Baumgarten 1HV1'CGd US t0 21 l ll bridge party in his home at the Indian School. Also, the Forum invited us to Join 3 N . . - ' E with its members in giving a dancing party in honor of the Lucy A. Sloan Literary Society and the Warriner Literary Society. Finally, we had our own customary l HS -, , . - - - 1 l i lg? Senate Formal as a climax to the year s good times. Many minor social affairs were I l ? lf . . 1 sandwiched in among these major activities. .li 1 Some of our old veteran Senators, whom you knew, Will Continue next fallen l their degree work., Both they and the rest of the society are already eagerly 10019113 , 5 forward to next year's good times. - Q 1 Au revoir, Mr. Webster, and remember that there is always a welcome to YOU and J RN, . 2 1 A QL a wish of good luck for you. L M' I From every member of THE SENATE. 55, 11 F63 9 7 MN Veil il Ci H EP il 'xl LWW ,,,,W,m,,.1 ..---..JM-1 we A 1 3 5- ::::'i,. , 4,1 ff'- gef ef fQ17f,ff TZQITi'ii1f:f :jggg6313:ZifiZ.i'TT1lIZfiliT7'N W -2--H-ef-A fe c F U ff lQ,XQ'jgQQC2i kk I YU 1 UNM 3' l'lllll'l?2lJ 'Pr,Xi'?2M' Y- --U4 , W-'gr l Y f K 'Y kggln-qrnfl Jlflfwu. Row: Jean Brown, Fern Edmonds, Petroah Camp, Ersel Brotzman, Myrtle Barton. gl ee cafe- BBi--'f-- ?gTTi':gi'f 5144 -7 e-',e as e L L W are ' VG C Faffkf e PP A-JI Alffiwsilil w WA Aol 3 , e ee e C Annan--- - - - M--W r ee --- hw-1-e .2-ALL., jf' Ronan Round Table I0 . PM be I II II ,. II I I . I I I I i I II 1 I I I III I' I Fourth Row: Bernice Cole, Helen Dersnah, Cassie Gibson, Mary Ann Piechowiak, Marjorie Case. I Thlrd Row: Bernice Brondstetter, Cecil Allchin, Marjorie Ovenden, Donna Barnes. Second Row Marguerite Belyou, Lulu Dargitz, Beatrice Laney, Lorena Vibber, Margaret Larsen. First I III IT QT I . II Q G III 0 CD I 0690 II I I4 I U Oflicers III I Donna Barnes .................. -,---.-- P resident III , . I l BQTHICG Brondstetter .,,,.,,,.,,.,., H .-l-.--- Secretary I Ig A Ercell MCGF6gOI Brgtzman in------'- --.--------'-.--.---.--.-.. Treasurer E Donna Barnes ------------- --WOTHGHIS League Representative I I I . Jean Brown ----------- ---------------- -------------- ---------....... ......... L I F E Reporter . . Z I Marmrle Ovenden --------- -----.. P Fogram Chairman I Mrs. Cassie Gibson ...,,.,,, uulunulnuu F aculty Advisor n Mlss Bertha M. Ronan ....... ,.,,,,, H onorary Member II Ml :I C THQ' L initif-lCi'i'77i'mR5'm 'iA :'i Q 'fee' H'f M'ffM A 'TI , ,, LX -E 3:5 1-11-www, ,Yr ,Mx '- 'F Cerro ' .va Irv 41 Q BgLC'Bg'4i'fJ 'i35i4iH'33fi'f'T'l I I I I I I 'I I I5 II I I I I I I Q I 2 I I I I , I I 5. I. Ii I, II HI il II 'I 'I I I I II Ill :If III ,II I'fy ,I, If :I IMI IIII III EMI IPI IFS It IW IIN I. If I In I I I I . M 9 E 0 Studies Modern Poetry At the beginning of the year the Ronan Round Table found that most of its members had graduated last year. They set about to find the girls that would fit in with the group and make a most congenial circle. Now at the end of the year we feel that the girls of the society were made to work and play together. Marjorie Ovenden arranged' an unique program for the year. The nationalities of the world represented in the club were determined and the nations who have given to the worldlthe most important literature were chosen to have a place on our program. Thesenations were Ire- land, Scotland, England, Norway and Italy. The committees selected for each nation were formed of girls most closely related to that nation. As the year drew to a close the meetings grew more interesting for each group felt that they must outdo all the preceding groups. As a result of the complete program, we obtained a broader and more varied knowledge of the literature of the world than 'we have in previous years. Instead of knowing one type of literature such as the modern poetry of all nations, or one nation's literature, we have touched, rather briefly it is true, but vividly nevertheless, all the kinds of litera- ture of several different nations. Our study was not deep but it was such that many of us have had our interest in literature aroused or heightened by this study. Our social activities were rather distinctive this year. Beginning with the social evening for the scanning of prospective members, we proceeded with another for the initiation of the members elected to our society. Our next entrance into society was February twelfth when we entertained ourselves at a child's Valentine party. Later in the winter term we decided we wanted some money. As a consequence we decided to have a social meeting at the home of Evelyn VanDyne and make some candy to sell the next day. In the spring term we had two very enjoyable meetings out-of-doors. i I - , , .,,,,.. .,.,-.,.. ....,.-r-..-W-... ,...-.-.m-...WW--H----M away Jr ,ir A A s -'H E so ' - E - H M-M as A' H ee E ra 4 H o o if Q, 925' O Informal Essays Entertain H Y , w Y l l w M Back Row: Avis Larson, Evelyn Chrysler, Evelyn Fry, Reva Derby, Virginia Myer, Margaret Galloway, Josephine Roe. Third Row: Thelma Eaton, Irma St. John, Dorothy Larrabee, June Goodell, Evelyn Trogah, Berniece McLean. Second Row: Ellen Cookingham, Zeta Thomas, Ruth Ranney, Frances Jackson, Monica McConnell, Thelma Barker, Gladys Hess. Front Row: Helen Hass, Kathryn Wilber, Frances French, Miss Josephine Rogers, Helen Bennett, Isabell Kress. u 0 v r ll 5 o I l l , Gflicers l 1? T Mi X - f T SS JOS913l'11He Rogers ,.,.,,., . um-uAdV1Ser I Q Ruth - rl I Banner ------------ ....... P resident T .5 Ellen Cook' J J Ingham ------- ....... S ecretary -3 Frances Fren l Q1 ch ------- ......... T reasurer O 5 91 as as P9 ew 3 5 E a a r so r J 5,63 L L?-YAX f - YP-X-GE UNE llljylymqil ZY'iYx,,y-:LI-,Iii H in H ' Zn ' E AJ E E -an E ZWQQ, ' 'ii, Q ll H--Y - e -A Q-M fe!-ffl A fyfil 176 I S l A 0 4 Q, kr Q lin L.. lloway, 'elyn 293 A glaei1ff-,-. it Q, I Q Rachel Tate Society The purpose of the Rachel Tate Literary Society is not only to bring the members into more intimate association by social meeting, but really to present something which will be of value. Its aim is a better appreciation of literature and high scholarship. It was organ- ized in 1924, and was named in honor of Rachel Tate, a former dean of women at Central State. The Society chose to study for the year of 1927-1928 the medieval story and informal essay. One of the most enjoyable programs was the medieval story Tristan and Isolde. Three versions of the story were given: Wagnerian's, Tennyson's and Arnold's. After the story was told, selections from Wagner's opera of Tristan and Isolde were played. ' As all work and no play makes Jack a dull boy , the society had several social gatherings. The year was started by having a dinner party for the new members, so all would get better acquainted. Miss Josephine Rogers, faculty -adviser, invited the society to her home. A very enjoyable evening of games and dancing was had by all. , In the winter term a theatre party was given and all were re- freshed at the Spoon and Straw afterwards. To prove that traditions hold true, Rachel Tate Society gave the annual Christmas party in the gym. A novel and appropriate program for Yuletide was carried out by eight girls dressed as skaters, who gave several special dances. Even good old Saint Nick was there with many varieties of favors for the guests. In 1926-1927 the society went to Crystal Lake for the week-end. Such a delightful time was had by all that they are looking forward to another such outing this spring. A cottage full of Rachel Taters spent the week-end of May 20 at Crystal Lake. Before leaving Mt. Pleasant, the girls invited others to drop in during the week-end. Since the weather was nice, about thirty or more dropped in on them. It was a congenial crowd who went to the pavilion to dance. Since their club advisor, Miss Rogers, was un- able to go, the club invited Miss Margaret Patterson and Miss Alice Mclntire to sponsor the expedition. They proved to be chaperons de luxe and good companions. J lpil CI --e --ge If-ef ---A-- Zlflv-4'w'j'N ' -,QgpQ,,1QQQ,f IgT 9444 -- T v A ' W In R: I Tl -U C A I 1 l l Y Cldest Soclety bn Campus Back Row MISS Myrtle Rownt1ee LOIS McMacl en Lolene Flancls Shlrley Smith, Gaynell Emely Betty Somelvxlle Second Row Retha Blookens Helen Robmson Kathryn Lewis, Genevleve Naumes Janette Adams Ethel Duby Malv Loux e Kane Front Row: Helen Smlth Aona Duncan Iosephme Buxd1ck Janet Mulphy V1r mia Bluem. Fall Term .President .Secretary Treasurer ......AdVisor I 0,1 S1 i 1 ' 1 1 I I Y l 0 IQ V11 V 4'7?'q7 if N-1 fl 7'??'f'i ima Lil-l!P?ES5! 1 f-fx. l 'LQ'IOfff'i25'ffiTZTTTlTIl'Qif.'i?ilgl '1fi'ZiTgif1i '?T1f'ifjTijf:ffff:'gf-7-l?fZ?3-ffg---Zbllffil -3 -.-.g-flag. - -1-r-'-I-'W-'- '-Q - -9. 4-A-.-..L:.-....n..,.-.--f:nm..,q . -,.--H., -.-AA ' ., .1 1- al- 1 - ' I Y '--- ..-.,...L- L-,T v Y -. ..-. . . M-L....,s , . Q eff-Q-is Studies World Literature The Lucy A. Sloan Literary Society was the first organization of its kind to appear on the campus. lt was founded in 1912 by a group of English students who felt the need of an organization in whose meet- ings women who were interested could gather for the discussion and better understanding of literature. It was named after Miss Lucy A. Sloan who at the time was head of the English department, and who later became dean of women at Central. Miss Sloan did a great deal to aid the young society and the members have tried to carry on the high standards which she set for them. The purpose of the organiza- tion is to encourage the literary and social development of its members in every way possible. Any girl in school is eligible for membership although the club is limited to twenty members. The work of the club this year, which has proven particularly in- teresting, has been a review of modern poetry. The life and works of a number of modern poets, including Amy Lowell, Robert Frost, Rud- yard Kipling and several others, were studied. One of the most enjoyable evenings of the year was spent at the Brooks' home where our president, Janette Adams, told us of a number of interesting and amusing experiences which occurred during her trip to Europe the preceeding summer. The society had several other charming social affairs during the year including a Russian tea for rushing the new girls, an evening of bridge at the home of Miss Gaynell Emery, an honorary member of L. A. S., and a dancing party at which the Senate and Forum enter- tained the Warriner Literary Society and The Lucy A. Sloan Literary Society. b The members of L. A. S. feel very much indebted to their faculty advisor, Miss Rowntree, for the interest which she has taken in the society, and for the many things which she has done to make the year more pleasant and worthwhile for them. 1 Y 7 1 1 S S JQ J f gels? L W- . . :-.r..b'.....ae..f..,......a.m..g,:L:.f.:la-. 533 The Forum Upholds Speech li 255 . , T ll, , 1 i Sl gl 2 1' 1 IV ll E l 5 is Q l l lig ,. ., Va ll l K1 ' a x w 2 ,. ,, ,..,,.,, ,.f.............1 X. .,..,,,.,......,..........-........a.a,..,...,,...E,,- ...,. ............ -...-i..-...- 1 ,J . Q 4 1 ! l ii W gi l Q I , l 1 l 1 , 1 1 i i . if l :il if Ii 1 , we if i 'il 35? i W T .N It f lf? T 3 lg i .L T iii , 1 3 a 2 T J 5.5 IEE X, Back Row: Winifred Judd, C. A. Wellington, Lester Wilkinson, Clarence Gregg, Ray Brainerd, Ray Cooper, Frank Gardner, David Snyder, Leon Snyder, and Prof. Herbert E. Marshall. Second Row: E Sydney Disbrow, Frank Lewis, Kenneth NVilson, Lloyd Cartwright, Kenneth Bisbee, Richard 113 5 Potter, Douglas Selby, and Paul Sutton. Third Row: Wilbur McMath, George Moore, Gerald Reinsmith, Maynard Allyn, Clayton Walker, Arthur' Stinson and Aldie Long. Not in picture: Kenneth Tinker. l Q ll fl f ll rl it ! l ll fl 59 1 ' l 'W if T A ' 9' if 1 il Ei: gil ill is aa s fl 1 F 2 if I I if if i ll 1 N H - tal E2 l if my i T- ll? 1 i 'Il 4 1 5? Officers of the Forum for the College Year EH I T I Nj FALL TERM 55 5 T X W . . :E l Pfesldellt ------------- ...................................... ...,..... R a y Brainerd i 5 Li V1C9'Pres1dent ......... Maynard Allyn Secretary ......... ..,....... W iibur McMath 5 Treasurer ...............,.........................,......... Lester Wilkinson I e li' ll 5 g iff WINTER TERM ' - ' . . -ll I 5 4,4 President ............ ............................................. ....... S 1 dney Disbrow 1' ' - ' - - f T + lil V109 Presldent ....... Gerald Relnsmlth li 1 Secretary ............. ......... R ichard Potter Treasurer ..... .................................................... C layton Walker if T 1 ' 3: X 'l SPRING TERM E! A 3 fx Eresident. ......... ......................................... ............ F r ank Lewis 3 l 'f - . . N, lx S1439 Izresldent ........S1dney Disbrow 3 1 ,Wy l TQCFG2 ary ......... ....... K enneth Bisbee if be 1 5 I' . , ? 5 fm T easurer '-'-' ......... E lmer Wllson .5 f 2 igvif , isis? Q li ', l fltfx 5 2. .... , L. J if 5 .E ..,. ,, it eeee LNHHM ..... -.-.,..--.Lio,-.1 E A .Sw V C -1. 'N H ' A-'ee--m--e-emefe- '14iZITf:1f:':1:'QiT::C' 1jjjjiijQ,i , i1ii fQQ.,. THQ 4 -,f,'1,, T, Nl Www wxm f f l W Iiflnsiuff HI, 1 f 1 lf fm f i.Q3.','l' A f xa. :ALW- , , ., J. -. 'end A ' 4 1 l lx E l 6 l t ii i i. Qi? I3 4 Q o o I s Y I ft' .....,..h..v,....................................,..,.,...L,..- NLR.. . ..1,a........,..,.,V ,,,,-....L...,-.g.H-,....,...... ,A Y, is V ,I M , -H '7- -- 71 -Lx - . --e -:.i.......,,..,. .., PA, . ..-L - .. .. .... . . in Mi I V, as II II g,5iiQia.c.-J.f.e- .. L ..... I QQ .... - .Q.lCoLQTQ,5?'l . 5,214 .Yf- -Aw -V --ff'M-'V-- - t wr -or - ' '-'-'---'W-----'------'----- ---H -.-vwv ..-.-,Y ,,.M ..w,.,,,., on-mm --'QW' www -iggtvwwgz-fiwwm-el Ib 41 xi Q N by Trial and Un Stage raft - With about a dozen active members as a nucleus, the Forum started out last fall, September, 1927, to make this one of the best I I years in its history. Several new members were ad'ded each term, un- til the organization numbered twenty-seven at the end of the year. Professor Herbert E. Marshall continued as faculty advisor for the II If . . . . . , I I III - organization, in spite of his added Y duties occasioned by Prof. I5 I Merrill's leave of absence. Much of the success of the For-um is due I III .II II ,II to his efforts. I A Many of the regular programs during the year have been unusually I interesting, and have followed out the purpose of the organization by , .III permitting members to make speeches,.either in debates, or in a mock I I I I III trial, as happened again this year. Lloyd Cartwright was put on trial VI, for stealing gas from Gover's. He was defended by Harry Cooper. Frank Gardner acted as prosecutor in the case. Leon Snyder mas- I II' I I I -1 .I I I i I 2 Ir W. pI 1, queraded as the girl in the case, whom Lloyd was taking to the Lyceum Ili course. p I III O Tempora, O Mores , a Roman burlesque upon prominent mem- bers of the faculty, won first place in the Campus Comedy, and posses- . sion of the beautiful loving cup for one year. This plan had been M partly worked out during 1926 and some credit must be given to those I members who are now out teaching. Frank Gardiner upon Richard E Potter's shoulders made a satisfactory Dean Barnes. David Snider as III Claudius Larzelerius and C. P. Wellington as Calkinius won applause, I I while Leon Snyder vamped them all as Cleopatra. The Sculptured I III Chorus furnished the setting and finished the act with real harmony. I I According to the tradition introduced last year, a banquet was held t at the close of each term. At the close of the winter term the Forum II III was admirably entertained at the home of Prof. and Mrs. Marshall. In Q I I addition to a regular feed, a program of music completed an enjoyable I evening. Ir I I l ' . - . I' I I II The Senate and Forum cooperated in putting on a dancing party fi I . A 'I I to which the Lucy A. Sloan and the Warriner Literary Societies were invited. President E. C. Warriner, Dean Bertha M. Ronan, Prof. and I Mrs. Rolland Maybee and Prof. Herbert E. Marshall were in the receiv- I I I ing line and the party was a success in every way. I Members of the Forum realize the need of a man's being able to QQ speak convincingly before a large or small group and for this reason SI they are Forum members. I I I I I I l I I I I I . ,Qi ' lr F -.- .,.. - L- .... W4 -g-- gg- C go X! '57 T M-it in L t W-..,-:-.,...-, 'oi if Qi6:T..6.Q'.l I .-......-- ,L 2-im D as as .1 1 1 1 A 1 1 as 1 ee 1 11+'1f1-ef, ,,1,5,,,,1,,g if 1 ' 111.1 1 . Iiflefg 1 11 Central Triangle Learns -,,,n,.'g,1 in 1 fins? Y L md., . , ,A 1. M1 W., iv, 1 1 J 1 KV1 V ll '15111 1 51 1 11 f. 11: 11 1 , i I 1 -1 1 ,1 1 1 1 1 1 - 11 S 111 1 1 111 1 .'1 ,1 i 11 111 11 1 1 1 1: 11 1 I V1 1. 11 1, 11 1 1 1, . 1 1 1 1 11 11' 1 111 1 1 '11 1, 11 '11 11 1 1 1 111 ' 11 1, 11 11 x 11 13 1 1 11 11 11 111 1, ' 11 11 , 111 1 15 ,1 1 , 1 1 1 1 1 1 11 11 1 111 11 1 11 11 ' 1 1 11 Y 1 115 I X1 1 1 1 1 1 11 1 1 F 11 '11 1 1 11 1, 1 W 11 111 Back Row: Guyla Hewlitt, Elleda Dexter, Miss Etta Paulson, Eileen Waterman, Gertrude Bishop, Ben 1 Louise Jones. Second Row: Ethelwyn Livingstone, Betty Luck, Ma1'y Lou Rockwell, ,1 1 Mildred Bodfish, Jeanette Ewing, Helen'Rose. Third Row: Jessie Sharp, Lucille 11: Blair, Martha Chambers, Lillian Morford, Mary Banton, Dorothy Duvall. 1 111 .1 1 1 11 11 1 1 11 1 17' f 1 1 : 111 1 , T 11 1 1 1111 1 11 .s W 11. 3 111 ' 1? 1 ' 115 1 11 A 111 5 7 Q. 1 1 1 1f Z7 1 1 ,1 1 1 11 1 1 11 -1 1 I lf 1 31 Officers 1 1 3' Q 1, 11 H1 . ' ' 11 1 1 Presldent -------------- ...... L llllan Morford 1 1 1 . , 11 1 1 li Vlcgpresldent ---- ....... M ary Banton 1 1 T 11 1 1 Secretary ------ s................ L ucille Blair 11 1 1 1 11 1 Treasurer -------------- ------ Martha Chambers 1- -A Program Chairman E1 151 1 ------ ....... 1 een Waterman 1, QQN 1 1 ,O rf' 1 X , VJUII-I M1111 11111v1d11:i111 ,,s., ssssss so ssss 1 .Mn .-,,-Nm.,-,,:,1,x,..K,, ,... , --ei . .LLL ,.,, n,...,,.i 'f,,.,.L.ICiErA I ,Q f,.....,.v.e-.sms 1 1 'lk-1-1r::,.'fe f' '1 U 'R 'Jn ' ff.-id 51,1 Aj ,-1. . -J, -, FT All gg. 0 v l s l l n To Produce Une-Act Plays A The Central Triangle club was organized with a nucleus of twelve girls, under the supervision of Dean Bertha M. Ronan, on June 11, 1925. The name chosen for the club has an embodiment of its motto in the Triangle , the three sides of which stand for: Tragedy, Comedy and Tragi-Comedy, or for Good plays, Good acting and Good fellowship. The club has as the basis of its work the study of the drama and its production. The club's main aim is toward a better appreciation of this form of literature, although it has a secondary aim of forming social contact and friendship among college girls brought together on this basis. ' I - i The program for the year 1927-1928 is devoted to the one-act . play, as it was in 1926-1927. However, this year the program was divided into three parts, according to terms, each term to be devoted to one playwright. This plan enables the girls to become thoroughly , i 41,3 acquainted with the author studied and the characteristics of his work. if 1 .1 3 The first writer considered under this plan was Arthur Schnitzler and id 2 the second author was Percival Wilde. 2 E - 51' x f in : il 3 1: The first meeting of the fall term was held at the home of the fit f 1 E club's adviser, Miss Etta Paulson, and the first meeting of the winter term was held at the home of the club's president, Lillian Morford and l vice-president, Mary Banton. Other social meetings were held in the E ' if l :,, Women's Commons at which two or more members acted as hostesses lt iii l to the other members, and an interesting entertainment was had, gen- 3: 1 l i erally consisting of the reading and discussion of a one-act play. 5 1 2 5 The program planned for the spring term is to consist of many in- 2 l n WE it 2 fr' 1 s K lin 1 lf...-.'-. f teresting activities including a tea, the entertaining of some other liter- ary club, and the staging of a delightful one-act comedy, entitled Mrs, Oakley's Telephone , the cast of which is as follows: 1 5 in Q MRS. OAKLEY Ca bridep ..........,... ............... G ertrude Bishop V. CONSTANCE fa friendj ............ ......,..... M artha Chambers E MARY fthe cooky ..................... ................. H elen Rose EMMA fthe maidb ........... ............ B etty Luek so ..,.,. l ' 'A 1 .Qffffl :.pi:11ii1: L.1 ..'.T tiiilfgggliillgg-5155 ee-Vf1 3555,-133, , iff'--NW'-WM'r'c W MW 1 V 1. ,, ,.,--.:.....-2..........-,,1 ,...6-,--....f 1 M- 3 .,.,.....L...,2.n. ,..,..,.f,,,.a...s..,--.g-,,a,,r. .1.n.. M- - f in 'U ml. Wm--V., T.: ,. 1 Fiqh jQ fgffg 'rm QIIIPPIWA 1918 QNMSD QL QQ' W Departmental Club Joms 1 I ml '1 l nl! ll i, ll il' l l I 4 I T 5 Q L Q 3 l 5 Quia I' 3 1, R 1 R W , w I 1 i :I W I . I i 3 1 l rl i aar R ng w l A Carrie Trombley, Margaret Kellogg, Francis Hodgkins, Joe Ryan, Zelma Fox, Vivian Sowle, Letha Wal- i l dorf, Marceline Shinker, Mabel Close, Florence Beltinck, Mary Larson, Gerald Reinsmith, Irma I 1 X Lefler, Opal Lamphierd, Marjory Tow, Josephine Donohue, Hilda Hill, Irma Car1'o1l, Prof. Q Q Barnard, Miss Loughridge, Evaleen MacDonald, Helen Bennett, Alice Morrow. N w 1 f 'I l 1 4 , 1 li Officers Q 3 T 1 ,LY 3 FIRST SEMESTER H 2 i 1 , .,, l l . J? l T President ............. ............................................................ J osephine Donohue WI? Vice-president ................. .................... R oland Hass T T Secretary-Tireasurer ..................................................... ........... L eatha Waldorf j ll W0m9n,S League Beard R9pI'9S91'1t3tlVS ......... ........... M argaret Kellogg 7 R9p0I'l-791' ....,................................,,,,, ,,,,,,.,,,,,,,,,,,,,,-,,.,,.--.--,,,,,- E Valeen MacDonald 4 T . fl I i SECOND SEMESTER President -------------- ------------------............ .........................,,. ,,,,,,,, I 1' m 3 Carroll V1ce-president .................. ....-- ..-..-.' R Gland Hass Il l S9CT9t3-TY-TI'82IS1J.I'Gr ..........,.,,,,,,,,,,,,,,, ,,,,..,.,,,,-,,,,----- --.---.-.- 0 p al Lamphieird lif i ll Women League Beard Representative .......... ...................... V ivian Sowle iii 1 N Reporter ............................................................................. ........ E valeen MacDonald T M E22 l P 1 i 3 i H1 1 1, is if 5? 1 9 M Q L RT 4-iirfeei-Tfilf!I .e T7 as gQ,,gj,jjj -as H -if-ee ee, ee., ee .aa..-,M,-,,. A -e-Me - 5 R Zi A fr , . X! A,A, 45' Y cn N Jr . Cajki F Ln '54 so FQ- F ig , nil 0 Poi! l L'All1ance Francis l 3 P iq Le Cercle Francais, an organization for students who have 'had one i I year or more of French, has been active on the campus for many years. The purpose of this club is to promote interest in France-the country, its people, and its customs. It also serves as a means of social contact as there are several social meetings during the year, among them is the traditional picnic which takes place in the spring. l This year each meeting has been devoted to the study of some par- ticular French province. The club also procured several speakers to talk to the members about France. Miss Bertha Lefler told about her trip in Europe last summer and Professor Minor discussed the govern- ment and the educational system of France. The club has also enjoyed singing French chansons and playing French games. One of the out- standing accomplishments of the club, this year, was the joining of the L'Alliance Francaise. i In the Campus Comedy given in the new auditorium this spring, Cercle Francais presented an act entitled Centralites in Paris which won the club third honorable mention. The rude manners of' four Americans in the little side-walk cafe in Paris furnished a comedy sit- uation which amused the many spectators at the show. Meetings of the club are real get-togethers. Members speak in French only and their ability to converse in a foreign language adds to the enjoyment of the occasion. Social meetings are held two or three times each term. Many of the club members are carrying on corres- pondence with international students in other countries. Their letters bring an atmosphere of Old France direct to us. ' I Y,-I gn. I - - M Wrrmyhw g ,,,,,,,,,,- , . Q s'W ,-'T 'I --f A 'M 'N' flZfwiIf'PrW-igjf U 3 fi I It , ' ,fii11,.II' f RI IT? tj, Ilffa' JI ILI. L Iva .- .' A I. .A IJ 1- -- uf ,' Iv 5 . , . Lg: L, In 4, vm, ...,.L.,,L,.,W.,.,..,.- H .......v..,. V Y Helen R. Emmons Club Boasts FRESHMAN GROUP Fourth Row: Helene Bennett, June Goodell, Falice Day, Evelyn Sovereen, Lorene Francis, Beatrice McCarthy, Vera Cutting, Adaline Bobo, Helen Miller, Marian Bowers. Third Row: Ida Mary Murphy, Ruth Sauder, Janet King, Nadine Delling, Annie Clark, Esther Lax, Ruth Stone, Laverne Latham, Retha Brookens, Velma Williams. Second Row: Helen Kates, Margaret Schartow, Etta Nieman, Katherine Tumath, Eleanor Mork, Nina Meier, Julia Brinton, Gladys Shepard, Zelma Basler. First Row: Marie Larriman, Lenore Wilson, Betty Curtis, Miss Emmons, Miss Wold, Arlene Shammon, Emma Rogers , Uflicers President ..........,... ......... E lizabethl Plumb Vice-president ...... ...,.......... B etty Curtis Secretary ............ ........ B ernice McLean Treasurer ............................................................ ..... Vera Belding WOmeH'S League Representative ............... Vera Cutting Life Reporter ......................................................... Retha Brookens Faculty Advisor ....... ......... P rof. Helen R. Emmons When the kindergarten curriculum Was changed to early elemen- tary, it was necessary to re-name the Kindergarten club. The name yyas changed to the Helen R. Emmons club in honor of our faculty ad- visor. Throughout the successful school year of 1927-28, our organi- zation was the largest departmental organization on the campus, mem- bers numbering 157. The Fegulalf PT0gr3m policy was carried on through the year, with -- , I 1 I' X ' 'II' I'-VX I '- 'l'4III It if 75.11111 If WI- I I I I I I I I I I I I I I I II I I I I I 3 fi . ,f,.. ., .. V ui . F' 7-2 If ,,, I -- . .....- .,.. ..- .. x... bg xg VI ,l as A , A- 5 llfxs 4. I U bo I , lui 1y1, ' V l li i, l I 1, al l .l lx i l i r I L it ball Qui ,,, L l i Ll l I l I W A -i ' 1 I .li lil! I 'nl 4, 94. One Hundred Fifty-Seven Members SOPHOMORE GROUP Fourth Row: Mary Ward, Katherine Lewis, Margaret McLeese, Vera Belcling, Mrs. Smith, Marjorie Case Dorothy Thomas, Eula Cleary, Ida May Willison, Leona Swinglc, Josephine Roe, Irene Bowden, Virginia Myers. Third Row: Willene VerDuin, Olga Ginter, Eva Irwin, Lulu Dargitz, Bernice Madison, Ruth Ranny, Mildred Hinds, Caroline Richardson, Arvilla Fahner, Helen Weiss, Grace Joseph, Lillian Kuhn, Ethel Duby, Dorothy Botsford, Maud Mary McBride. Second Row: Marguerite Rogers, Beulah Voss, Viola Leonall, Geraldine Friedli, Marion Luxton, Naomi Goodwin, Mariewill Schindler, Shirley Smith, Helen Wilbur, Esther Logan, Avis Lyons, Erma Robinson, Bernice McLean, Evelyn Trogan, Irma St. John. First Row: Erma Allen, Eleanor Wilson, Ramona Shackson, Mable Lamb, Betty Curtis, Miss Emmons, Miss Wold, Bertha Fenner, Phyllis Hutchinson, Harriet Niggeman, Helen Blucher reports given by members on such topics as Laziness and Obedience in Children , Answering Children's Questions , and The Quarrelsome Child. The club was fortunate in securing such outside speakers as Miss Amy Burt, head of the North Carolina mountain school, and Miss Nelle Haley, primary supervisor at Saginaw. Social activities of the club were begun with a mixer for the incoming Freshmen. At Christmas time the traditional carol program was enjoyed by a specially invited group. Later a ukiddies' party much enjoyed by the members. The International Kindergarten Union, with which the Helen R. Emmons club is affiliated, convened at Grand Rapids, Michigan, April 16, 1928. Nearly 50 delegates from the club took advantage of this opportunity and attended the convention on Delegates' day, Wednes- day, April 19. Speeches by the former presidents of International Kin- dergarten Union and representatives of countries all over the World Were heard. ll lmffl 'W A f gray ,Mg Av .MHMWWW -W mmWmwA,,,,,,-,,,,,,.-m..,L.-.-.....--....-w--W..-W .-X--M., -- --PM------1 ii HJ ' OX' i' il ri r' H 4 I fan tu ' '1 'n-1 1 X mfg,- gm-1.4.5. :,m-,M, ,,,,,,w: ,s,.---L-.-.. .--Ls If -M-ff-Mf------i--------1-A -M---A------' r-be--M--M bf f ,QL 2:23. -?.,-L,-f1:, f:',i1:2gf: -'2? 3:'1.'r.. L.. J -,,.,,M,,,U, Walfwi F Q1 U51 f l 0 0 ls V l l Kelley Club Earns Reputation A v A, ssss l lll H ll lil H ll W ll w lil ll ,fl ll 5x1 , kt, l', 1 w li ,yi 'l' .Wg l, l l l F i Ml' Htl ll l ,. uw l f QL 1 I , g I 1 l 1' Cyrilla Kelley Bernice Patterson ,E Margaret Armitage Elna Aurand Charlotte Anderson Edna Brooks Vera Bowman Alice Brown Vera Bowen Eveline Barber Mina Bensteel Petraoh. Camp Mary Cook Gertrude Challis Agnes Crout Helen Drushal Helen Dersnah Ruth Davis Irene Diffen Leon Dilts Joyce Disbrow Jeannette Ewing Gwendolyn Evans F. E. Eddy Gladys Fox Margaret Finch Marian Fuller Florence Frances Irene Fiske Helen Frazier Avis Guldenzoph Joyce Glynn Caroline Garety Norma Gustafson Katherine Haller Mary Holcomb L1tll.ldG Hcinze Ga - - .x Gwendolyn Harrison Marjorie Hillman Ursula Holowinska Ruth Ireland Winferd Judd Jack Kelley Rosabella Kiessel Bernice LaFrance Anna Lawrence Mayme Lindell Margaret Larson Donald Miller Greta Merrick Hugo Martin Edith Miller Louise Monteith Kathleen McFarlane Katherine McFarlane Florence Nelson Agnes Nixon Joy Ostrander Mae Olger Helen O'Donnel Lucy Patterson Erma Powell G. G. Quinlan Tersa Randall Eva Rayburn Gladys Rockett Mary Lou Rockwell Cleon Rumbough ' Eva Snyder Prof. M. L. Smith Maude Shivlie VVinfred Schaar Sylvia Schank Cadwell Spitler Sara Vance Myrtle Vance Esther VanHolt Hazel Warren Maxine Zimmerman 1 L li All 1 ,qv lla lf' I lil: ll 1 E l1 qi , ,l 'l ai e l li u l lll 1 , 11 ll lf lil Us Ml lf ll 1 A l 1 Cflicers ll lg Eg Y Q l 2 11 l 4 l ig Q E ll l a it . . . x Presldent --------------- ........ L ouise Monte1th EM ll All VlCe-president --uyu -iulln--..'--..------------ J ack Kelley 1 Secretary -------------- ........ M rs. Joyce Dislorow A Treasurer ......,,,,,,,,, .-.--E---.--------.-.--...---.. Irene Flske K7 l F l - i 35253 Faculty Advlsof -------- ....... P rofessor M, L, Smith 1 el il A l , 'V TY 4 me-mewflsllTILlLggllgii,g,,TgjLgjjjiggi-ifHA efae 5-Aff-A-fM---.............,e,.....--...-.,W--.QM--Pfee'iv f Eg is s gQigi,g1iQgig4iTsgig3L,.lifWil Qiifrilmf ffmiiifelfi L- K NY. ill gd. Q: I . l 1 l l 1 F 5 4 I . 'l w. 1. i1 V i l . l 1 l i , 5 l ' z l l s T F. or n up E 2 ,V --g l .n, .1, I.. 'r 5 L ll V l 1 El il' f 'rl . 1 w l l l l lx l i l l l 1 I l i . i A, ' , 3-I gg mR mi A ' 'y Ki'Aimfi'?i 'ffl Sfmt-as-f P M-A WW-W-1---W -f - -M ijyflji ' ffl w 555122 I f . 1 I -O O . . 5:5 1 5 , ' l , As Entertainers in Rural Districts ,, A siel . 1 I V 1 E . li C The Kelley Club, composed of all students interested in Rural Education, is one of the most active organizati-ons on the campus. Every one of the seventy-five mem- il! bers tries to the best of his abillity to carry out the purpose of the club. The consoli- E dated school is advocated, and the small country one-room school is shown to be a ill ll thing of the past. gl 5 l Q . ' I' . . ' W gil At -the beginning of the fall term, oiiicers were elected and the club divided into l l i two committees. The music committee was headed by Ruth .Benedict and the program and dramatic committee by Margaret Armitage. The music committee organized a A , fine nine-piece orchestra. The club has presented four different-plays, Window to l 1 Silt the South, The Unseen, and Pot Luck directed by Margaret Armitage. Peggy , lg . . . li , li was directed by Lou-1se M-onteith. W l . . ll The rural sociology classes, of which Professor Smith is teacher and which are Q largely composed of Kelley Cflub members, took the problem of a portable stage as a l l class project. They divided in-to groups and started to work. As a result the Kelley lt K 5 Club now owns its own back-drops made from burlap sacks sewed together, stage cur- 5 ll-' tains made from white sugar sacks sewed up, and portable stage lights. Now, the . lg reader is probably asking, What are they going to do with all this paraphernalia? ,F l From September until January, Professor Smith -made sixty-three trips to various 'li rural schools. Here, he was asked to talk on Consolidation of Schools. On the ma- I jority of these trips, Kelley Club members presented a play, rendered solos, led in 1 community singing, and performed various stunts. Although the return trips were not W T made, fin many casesj un-til the wee s-ma' hours , an enjoyable time was had. l l I . p ' V i ll The Kelley Club is especially grateful to Miss Ryan and her assistants who spent ,T one whole evening in the gymnasium teaching the Kelley Club folk dances from Ire- E la land, Poland and Holland. Native costumes have been made and now the Kelley Club A V has a new interest to add to its pro.grams. A f Regular meetings were held every two weeks. At one session, Professor Smith l l spoke on The Rural Schools of the Upper Peninsula. Miss Paulson, of the speech department, gave several readings. That meeting which will .stay by every member the H, E l' longes-t is when the Kelley Club held open-night. Every student 011 the Campus WHS if li invited to share the evening with us. On this night the Training School auditorium 1 5 was packed with students eager to hear Professor Cornelius Hosmer of Tuskegee In- l stitute, Tuskegee, Alabama. He told very interesting stories concerning the negro 5 school which Booker T. Was-hington founded. ' q K iii- A plan is being made whereby the members of the Kell-GY Club engaged in teach' at - z ' l ing will be kept in touch with each other and the Rural Department. It is hoped that a gen., ........w Small publication will be the result of this. U f--ll A splendid spirit has been shown an the year- pi? as 1 . mMMWw ,..,..,-.f E5 X f 5 V d.lj'3gggfgggggj-:gg41fg:,gg,ae,,,,e,ggg:.r.g4,:.:::.gfr1::''14lllllllelflli'flilfiff m'T'W' wif i i CW'l1Q'QgVQfQ 19? ' -f 4 -,.g-- r-1 -. T Y gg ge.. f to U l .- g A k QAO A as e o ' E 61 Home Ee Girls Lay Plans For A r sf ll: 1 1 U ' l l ' l it i W . X 5 l M .. X.., , . . , s . Back Row: Lucille Smith, Rhea Watson, Hanna Cuthbert, Edith Millarch, Virginia Mulvey, Loretta MacDonald Mildred Milarch. Second Row: Gladys Dickson, Helen Racignal, Lorena Vibber, Helen If Donohue, Genevieve Naumes, Dorothy Brader, Esther Reid, Pauline Burke, Marjorie Scott. ill Front Row: Erma Bufford, Pro-fessor Rose J. Hogue, Zeta Thomas, Miss Louise Larrabee, Alice Wolcott, Inez Fox. CNot in picture? Elaine Robinson, I 1 1' l 1. il 1 1 z .l I i l A I l 3. I qi .el if ll Ji ill I.. l iw i is f N li. Y Officers 1927-28 Plfesident- ' -------------- ------------ - - ----.... Z eta Thomas Vice-President ...... .... V irginia Mulvey . M Secretary -------- ...... L ucile smith . Treasurer ' '-- -------- -.............. I n e z Fox if W0m9H'S League Representative ------ ------- D Orothy Brader S Af LIFE Reporter ------ ------...... - - - Alice Wolcott Fawlty Advisers ....... -----.... P rof. Rose J, l-Iogue l J t Q1 ....... Miss Louise Larrabee lg Q1 ifgg L l'1l-GE UNE llU5'lllIED gztgy-lqsivr-5,356HT.'EmH'7x 'Fii ': ', T 5 ' Vclfg 1. . . -. a QQU ,gf in 55 E if g.M..g..1.j.:g:,j., .- Af if-A V A 'N 1, Q 4 C2 YQ J 7' 1 l 'l 1 il S gil gl lHome Management House Cn Campus The purpose of the Home Economics club is to bring the girls en- rolled on the course close together and to take part in the affairs of in- terest to the department. Membership has been continued in the state and national home economics' associations. Various projects have been taken up by the club. At Home Coming the girls Wrote letters to the alumni asking them 'to come back for the Week-end activities. The club was hostess at the George Washington Tea for the Women's League. And at Christmas time, fruit cakesivvere made and sold at the annual bazaar along with the usual candy and handkerchiefs, etc. Several of the meetings Were turned over to sewing for the Child's Welfare Work. Miss Nelson spent an evening with us and gave us an interesting talk. . One of our first social activities Was a Get Acquaintedn party held in the Women's Commons for the freshmen girls. Prof. Rose J. Hogue invited the club to her home for a HalloWe'en party. Another time Alice Wolcott entertained the club at her home With a Valentine party. Of course We can not forget the part taken in the Campus Comedy. The activities of the Club have been the means of strengthening the splendid feeling of comradeship existing among the girls and bring- ing them into a closer cooperation with the faculty. One could not have attended these meetings Without a deeper interest in the depart- ment and all that it stands for. Jr D733?5f51PP2f4f ll il, '1i5E8lliQo25?eo,r A A li 4 W 7 A L Q- V 'N. at Scholarship and Recreation ' r Q l V A ll Back Bow: Helen Estee, Amos Butler, Frank Gardner, Wager Clunis, Palmer Kern, Audrey Wille, Carrie Trombley. Third Row: Erma Jensen, Ruth Williams, Allie Davis, Warren Koopman, Earl Hill, Vivian Sowle, Creta Lamphierd. Second Row: Virginia Hatch, Elleda Dexter, Letha Waldorf, Mildred ' Bodfish, Bernice Russell, Alice Seddon, Leah Eaton, Isabell Kress. Front Row: Lula Goodwin, Helen Rose, Eunice Crothers, Prof. Van Lieu Minor, Mr. Rolland Maybee, Lottie Everden, Helen Bennett, Not in picture: Mable Close, Lila Gardner, Donald Wilson, Marion Shackson. .J X I l ,. WWW E Officers Presldent ' ..... F rank Gardner ' ----.- -------Lottie ., Tecretary ' ..... Audrey Wille A t I'6aS ..,,,,, .-- , J urer ' ----- -------- - - - ............ Helen Rose Q Women's League Re resent t' - LIFE R p 9' We ----- ....... C reta Lamphierd 1 e o t ...,,, , . F It Edr er ' '- '-- ------- - ---------- - . . ........... Wvager Clunis 0 3,Cl.1 ' ' , , G1 y Vlser ---- ..... P rofessor Van L1eu Minor 0 M P to id ew Nl A A A A A M M f W - ivurr Y N TMM 'UNE llUNlllYf,'iCLl g1qNgiyil'fH Zz, V 'M' W W F B'Mh'? 'm 5 157237 A--'iffiiegill,gLL-.,,gLr,Yjii,mm,,,,r ego, gi Lg'--1--I 1 'C c 7' Y 1 1 l f 1 'I l - 1 - ' ' '- '- nw - --H - ---- ------- , -- Av- --pq., - -- -1- -- -- ,L----Q 1,.k,,Y E... . , Y As- lr' Two. .. ... LC. ... - . . as Q1o'?2.sf2vf,a eSf2L-,-s,,2l53?X.,,, v, g g g yi, ,iq 'Q 4 :'f H' --f .- - . . V Are Cliophiles' Aims During 1928 the Cliophiles continued to be one of the leading or- ganizations on the campus. Since-its founding in 1924, the Cliophiles has ranked unusually high among the other campus organizations in scholarship. . I The membership of this club is composed of those students who are especially interested in the study of history. Its objects are: To aid students in historical research, to increase interest in the subject, and to promote friendliness among those who are majoring or minoring in history. h Miss Edna Gray, who was one of the charter members of the club, was president during the fall term, at the end of Which she graduated with an A. B. degree. There are about thirty members of the organization. They find the club to be of social as well as intellectual value. The subjects which have been discussed by members this year are: British Imperial- ism, the World War and money. Each member has the privilege of selecting a subject which particularly appeals to him. Two meetings of the club, which were held at the home of Pro- fessor and Mrs. C. S. Larzelere, were given over to social activity. Af- ter both meetings Mrs. Larzelere served delightful luncheons. These meetings were the occasions of the initiation of new members. They brought into view the originality, inventiveness, and sense of humor of the entire group. Professor Larzelere said, They sure are some bunch, orators, dramatists, musicians, and circus acrobats-everything. Pro- fessor Van Lieu Minor and Mr. Rolland Maybee acted as judges to de- cide if applicants for entrance to the club were worthy of membership. Prof. Claude S. Larzelere assumed the duties of immigration inspector. His duties were to decide if the prospective members brought enough knowledge with them to be worthy of admission. The most important question asked by Prof. Van Lieu Minor was, Whom do you love best? The judges were very doubtful of the authenticity of the answers and threatened the culprits with fines for contempt of court. One quiver- ing apphcant shocked his auditors by proposing to a modern Cleopatra. Six of the new members gave a play entitled, A Leap-Year Evening in the Dormitory Drawing Room It was considered a great success be- cause of its originality and naturalness If present conditions are any 1nd1cat1on of the future the Cliophiles should enjoy greater success because of the growing interest 1n the club and the fact that many present members will be students at Central next year ,org nf If tsclii 7 , l 'rio' 1 H gggg are ilghii ..-ggiii 111 lit' 'i'l'd 'T7W 'i,Q' 1. . g 'A 0- -' . 4 -UN K-AML wg dn, WH, ., , N., ..,...-. .,,, .- my,,,,.,,:W,,,hif.i,U fn. . ,,,L,,,,,..E .,.f l ,.,, .. - - .,,. ..-.-...,--,.-.,?-em' W S If 7 9 3 if ' f ' ff- 1 ' ' ,YQ-12, if mf' , if . 1 , , , .4 A X EJ c1'i.2Se1if'l'w in wiirerat ii .. .M a rqfw, ...A -.--. ,- ...A .., .,.,,,. . V -M . -.. . -- Paint-Slingers Plan Trip Third Row: Thelma Duby, Edith Hintz, Myrtle Cobb, Miriam Mienzer, Vivian Fo-x, Margaret Kelly. Second Row: Gladys Knight, Monica McConnell, Ethel Duby, Florence Daud, Vernon Maschke. First Row Miss Garrison, Janette Adams, Evelyn Fry, Willis Lane, Doris Minor, Miss Wightman. Retiring President-- New President ........ Vice-President ........ Secretary-Treasurer ...... Social Committee ,,,,, LIFE Reporter ..... ! ,psf Y f Xl I U ,eH:,,,i,YvTv:,Q Ethel Duby Willis Lane Evelyn Fry Vivian Fox -Evelyn Fry -----.Thelma Duby -----------Willis Lane ---.-Francis Jackson Af' Ve V. 6 V' Y it V 1 L 45 1' . ,, In ,. ' ' ' i- '-We-'I- w'-W f-ffzfng..-.1.Y. Y. -H.--.U .A ,,,, -,.f...,.., -f . ,-A-...F-J. Y - ..-.-nu-r,-,,,,f ,V Jig: -AL:-els.. , -. W., xv- A Y ' 'U ' f - , - - Y . 6' -Q--'-'-fn Y -. . .. .elm- 5 i?E3'iieQ t 9 Qaojg , v' 12f 4 ip 0 gif? .' 1 9:1 O ,l to Detroit Art Museum C i 5 f it 11 fl iv 9 E-gy 1-' . if l S fl l 'I pl X ' li gl . W 1, 1 l . 41, .1 A l 111 1-, l! 5 a X l l 1 I .1 ll x w ! l 1. ' l .ly l y . , 1 ii ll. 111 u 1 l l is L l l J! Ez W ll w .sf The Art Club of the Central State Teachers college dates from the dj year 1920. The purpose of the organization is to make possible a closer acquaintanceship among the students on the art course and to study the lives and Works of the artists omitted in the classroom discussions. gt This is the eighth year of the club's existence. During these eight years the Art Club has held many pleasant social meetings, offered its annual bazaar at Christmas time, and has' participated in the Campus Q ill Comedy three times. l Elf ' J The first meeting of the Art Club for this school year took place at the home of Miss Elizabeth Wightman on High street. The club at 3 lit this time elected officers and planned Work for the fall term. The mem- : oers of the organization decided to make articles for the Christmas foazaar. At the time of the bazaar many beautiful articles were on display in the corridor of the Science building, and were soon purchased 'oy eager buyers. These beautiful gifts included enameled shoe-trees, Q hangers, candlestick holders, batik handkerchiefs, and hand-painted Christmas cards. The last meeting of the term was a Christmas party held in the Women's Commons. Refreshments were served, and the lg Club members enjoyed a Christmas tree and gifts, and even had a ' Santa Claus who added much to the occasion. A After the Winter term had started, the club elected new oflicers U and began its study of American Women painters. Some of the Women studied Were Mary Cassalt, painter of mothers and childreng Violet Oakley, Whose mural paintings are Well known, and Cecelia Beaux, a g 3 portrait artist. One of the social meetings of this term thoroughly en- ll joyed by the members was the lovely card party given them by Miss gl Bessie Garrison at her home. During the Winter term Miss Janette A T Adams, one of the members of the club, gave an interesting report of y her trip to Europe in the previous summer. T .L The Work planned for the spring term was a detailed study of the l Detroit Art Museum. The Club members became so interested in this museum that they decided to visit it sometime during the spring quarter. 5 i'f'3: i-' - e -Aee -We fvfe fe 'fee A '- -A eh- ee -ef' W 'ccc c 'i W -T hi 2, M iiiii l H ffl-C-91 ' 1 .1117- 1 1 1 1 1 1 - '-Ar . '- '- ' ' ' 1 1 H .,, , Jia 4 W,,,V,,,Tjj,,W,,,,,,w,,,,,,s,11,,1s ,,,, ,1 .,,. ,,., .. 11 A as as -1 -Hef-M-- ' 'W e ' n nW-H- 'm '-'-' MW-re'1f--ees 1,5 4, 011 ' 1 ' ' 1 Commerclals Desert Pens 11 11 ' r 1 1 Q 'Y 1 1 1 I 1 11 1 11 1 1 1 V1 1 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 I 1 W1 1 1 1 1 1 1 1 1 1 11 1 11.1 111 111 ' F1 W1 1 1 1 1 1 1 1 1 1 1 'f V 1,1 G 64 ri I 1l 11 1 11 11 1 111 1 1 1 1 I 1 1 1 Back Row: Merton Wilson, Prof. Frank E. Robinson, Leonard Barnes, Joseph Ryan. Third Row: Avery 1 1 Peavy, Ralph Wo1nders,' Doyle Paxton, Hazel Sloan, Eldon Johnson, Ross Matteson, Henry 1 1 Baumgarten. Secomd' Row : Miss Gaynell Emery, Lucille Callahan, Ida May Willison, 1 1 Dorothy Martin, Bernice Russell, -Veda. MoHett,4 Sherley Dalton. Front row: Edwina 1 1 1 McArthur, Donna Barnes, Betty Luek, Elizabeth Rhode, Katie Schewe, Rhea Curtis. 1 f 1 1 1 11 1 9 1 1 1 1 1 1 1 11 1' 1 11 1 1 1 11 1 E 1 . 1 1 F S 11 1 1 11 ' r B fl 1 X V' N 1 1111 s wwf ' I 11' X 1 11 1 11 5 - 4 1, L 11' 11 11 1 1 1' 1 1 11 111 1 1 1 '1 1, 111 1 111 1 1 1 1 1 Q. I 1 1 1 111 ' Q 1 1 1 Odicers 111 1- ' 411 1 1 Q1 Efesldentj --------- ---- ...... H e nry Baumgarten 11 S lcefresldent '----- ........ B ernice Russell 1 1 1 11 Tecra dry '- ..... E ldon Johnson g 1 1' Ligfguifr - ' ...... J oseph Ryan Fei W0 ,elf er ' - '---- ----------- ------ .-....... J e a n Br-own 1 1 ' 'U 1 H1611 1 ' . ff ' 1 s eague Representative ...,.. ,,,,,,,. ,Dorothy Martm E1iE1t1 q 1 Advisers ,,-----,----- 1 -----. Prof. F. E. Robinson grill 1 1 ...... Miss Gayne111 Emery 1 ' 1 11,1 11911, 11,415.1 , li? 0 firm D' X 'A'W 'u'AJe'me-H-we-:W-1 ,s,.m...1um,-,,,,, www ,Www V , 1fJ:flg1jTwj5TfjTw 'x1 awwWsv-' w g'fSA'n1:ehgQZlQf-ivf!L.,,S,s,-Y,r,, QA-Q .,,,,4 A L--Y-e e,'-- e -1 es- ,.11. , 11,, 1,,1 G1 tin92135--efL'f,lIQ,,m1sQ 1xw:,, - WVU? UN 15 1113111121131 1-1111 Q- yi it ut 'm i 'M iW M , f '1'1T,Q'?'5,f? -W-,Ng-M-,-.m...1,.41g41g.fi11T2f1'KMe-e - -eee 1-eemwm-2, 1-.1 ,.11 .,,1 1 is WU' f sl-frisjn 1 A M ' f ---x'-1 f-7.1, .,,. .Y-,1- Y A- ' - - -4- - -W-1,i1::,-,,:..-J., +.e1:.1ger.,-.4 ner, ME.--.1 f.,,.-.,E-11 -f Y.-...s.L ,..eu1,....g In-s. ' 'ff- ru:-f --ev 115-.mm - - 1, Y-Ygfwn ,a.,,,g,, -.1 v Y. b 4 gl 0 ,.. V., nw, ...--....,...............-.............,r..,1.A,,,.,, , H... ...QM V , .-I . ,.s....mzLTW,.- . -. -..MW ,-,..,.,,-.ith ... A 'a 1 a . lf , . , l' H ll -z 1 W' yi lr p ,I- ,w vi, l 1 1 ' V 1 . ll. , Ili I l' l v,l A ll l ,l,a il L Ah . Z. V E1 fl lic , . 1 L . I 4 i ul l 1 fl y. tl . ?Q35fC32si..-.J...C - .-.. iii. THF9 C.H!PfiEl.PifC-M, C1 .ff ClKfQ5fl.Q GQ? 4 EN In ws..ir,.-. , , T C. ,M K L . , ,Q All and Keys for Dramatics T -l S Dramatics Club might be an appropriate name for the Com- pu, mercial Club--if its most popular meetings were considered in an at- S tempt to re-name it. Dramatics may seem rather out of place in an organization composed of such staid, practical-thinking persons as com- l, mercial students, but with an explanation of the content and purpose Of such a program, the situation may be clarified. Plays have been given pertaining to business life and ofiice occur- 5 ll rences, and have not lacked entirely in the romantic element. The l if knowledge gained from such presentations may not be 'directly put to M use by C. S. T. C. commercial students themselves, but the majority of H students they will teach in high school will use their knowledge and lf skill as stenographers, clerks, and the like, without further training. l M Therefore, the more the teacher of bookkeeping, typewriting, short- l i hand, and arithmetic knows of office-procedure, etiquette, and so forth, , 1 the more competently and easily will his students meet the business 'g world and its representatives. - l ll Hooks and Crooks , featuring Gregg shorthand, and A Lotta by ly Speed were two plays presented by Roselle Curtiss, Ralph Wonders, ll l Katie Schewe, Lucille Callihan, Jean Brown, Henry Baumgarten and li? Joe Ryan. ll' The organization is composed of nearly forty students, the most of l whom are on the special commercial course, the rest minoring in the department. The semi-monthly meetings and social gatherings are l il, well attended. The group, led .by its officers and advised by Professor l lil' Frank E. Robinson and Miss Gaynell Emery, has become quite a happy l ,E family. .4 Speedwriting , the new shorthand, was the title of the talk and ll lin, discussion presented at one meeting during the winter term. Stenog- Q, raphy students were very much impressed when the characteristics of other shorthand systems were lined up with the advantageous features T ll 5 of the newer method. V Advertising, including a review of quaint and curious types, and i a very interesting talk by Mr. Harry G. Gover were the features of A T another meeting. 5 A commercial teacher cannot be classed with the .oft-imagined - gum-chewing stenographer or dumb file clerk, for he aims to repre- 7 f sent all the favorable characteristics that are developed in a first-class l iii business-training education-especially those that enable one to deal more efficiently with fellow workers and competitors in life. It 1S with ' Page this end in view that the Commercial Club functions. 4 A 'Ol ii? i lH,As..MagmM,r,,WW ,mm ..,,.,. M, fizm - -A----'fjeljffj-jst-Wjgjttifij''t'ii:iTiT wi' . RV . --- - -----f-----fff J- .3 ij. 5 ,,.,,, ,.qm1w-1 1- -. ' V5 I ll hQlQZQ.., ' ivf3.i:32gg' 'til I if iI.W..1':i1:g,.,.Hi.151..1 -ig:pg:3,,,..QW.,..d.C..4.wi- J A Us 1 7' , lgii . -QL, X f A..-.1,,, 1 , f A 1 1 .M..--..W.. f-.-14 ---We-11..1,1 1-P-gf---in-1' 'Q- - A 4A' '-'4 7 H' 'f ' N '1 j1'f- i'ffff:1 1 1 'sffr-J1 '1'1A1 ' C'1w1111'J1ff 111111 1-we ,9Jj1'11.r1J L1 f35.f1?1f 1 1. 152111 . 1 1 1 ,,-'N 1,- 1 1 f 1 1 1 1 1 '11 ,1 1 1 V 1 11 11 11 11 1'x':Lif'f1 1. 1,111 1,2 1 1' 111 11 jj 1 1,51 f !.' 21116 111 ,111 111 131 311 11 111 111 115 111 111 1 111 111 111 115 S 11 11 11. 111 111 it 111 111: 1 111 1 vb 1111 -11 151 111 11111 115 1'1 1... 11111 111 111 111 1,1 21 11 11, 11' 111 1 1 11 1 1, 1 11 1 11 1 111 I . 1 1 1 1 1, 1 11. 11 11 1 ' 1 ,1 lg 1 . 1 ,.,f 1 ' X . .-v.. 1 1 . '11, ,.V. 1 .1 1 1 V v X 11 yi . 1 i .1 1 . . . I 5 1. QXZ ' K L -Lil ,,,.1. 4. ,. J.. fx , 1.111 W U ,Am v ...L P b U l 11, 'W' N ,Amr-,fi M gf-- K -N 9 Q55 -QALH-i J IIQ- r,,1?,LxA 1,1,w-,mm im 1L,,,,,,Q1-N.,,,,, ,,,.. ..,L,.,,, ,.,-S.-G., . f.'i ff - - -W or-1-we--ff:-1 f few- -- W' - A f 'f -in Y: 'i -W W fr Qi -3 .,, ,V Y ,zY. . ., ,. ., -- K ,NNN 'Q 11.3 B 1 ibm-'fi Ag Men Carry On With Dwidends 1 -1 I -JJ - 1 - 1.3-f-f P 1 91 1 11 1 1 11 1 111 11 1 1 11 11 1 111 1 11 1. 11 In 1 11 1 11 11 1 1 1 1 '11 1 11 1 111 P 11 F 11' 11 111' 1 1113 31 1 .1 -111 11 11 1 li 1 '11 ' 1 11 1 111 1 1,11 1 1 1 . I 1 1 11 1,11 1 1 1 1 1 1 1'3 1 11 -1 1 1 11 ,1 111 1 11 1 1 11 ,1 -41 1 11 1 11211 1111 Back Row: Prof. M. A. Cobb, Glenn McDaniels, Wilbur McMath, Owen Wolverton. 11111 Middle Row: Neil Lindquist, Gilbert Locke, Clayton Demo, Vernon Johnson, John Day. Front Row: Keith XVillison, Adam Werle, Clifford Cawthorne. 1 Members not in picture: Winfred Judd, LaVern Leslie, Joseph Donoghue, Clare Kidder. 11 1 11 1 11 1111 111 1 1 .-1 1 11 11 1 111 1 11 ' 11 1 111 1 1111 11 111 11 1 1 1 11 1 111 1 1 1 Offi .1 1 11 ' . 1. ffesldenf ---------- ----- .... 1 K eith E. Willison 1 1 .. 3 . '11 Sm PfeS1deHt---- --'-- ---- W 11101111 MCMath 1 eC1'e'CaI'y-Treasury' .------ -----Adam Werle 1,1 1 1 1 1 lflcfgv J A 1 V 'Y -, . 1r .711 me ,i,. ,V --Y W:-1' - .f ,W-r,.,l,e1.--.L -f-f .,. ,AY,, .-,M Lg, 1 Y Y V .f 1 1 .- 1, .. ., L --A-W-11,3421-+ --LLLTLLL L , ,, MAA V, , A ,,,,,,, ,,L,,,- K, , 1 '-1 1f1 111 1 .1 i'AL ' A -2 M--+kf1------1+L1-e-- ---emi ' .,llL,.Qf1 fL,l.L,Q,TTlT.,,,' V N11 7 1' 1 '1 1'i1'?-' 011111 11 111-1111-1111 E1f'11'1'y.f-5s1,f ,- 551 'G-J1'1f 1 1 1 J .1 , 11 -. , - .. 1.1 111 1 11. 1 I 11 - 1 . . 1, ,7, - . ,ru ,.,,,,. ., , LV f - 1 ,,,'1 x , .1 -1 be -4 +ve 1-1f1 Ke- ertee JA LL ..., L-, -dwg , 1 1 Y ,4, . ,-,,- ,- Y-,1---1---,eu--J L- , u..1u:1. 1, 1 ' .,,,,,L-,um-,hwi 1 . i X 1 13451 7? 141 1.211 1 11' 11 111 I 1 1 1 I 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 . , 1 1 .2 1 11 0 1 Q1 1 V N 11 Yo' Q 1 1 1 1 i I A 1 l l I I I , ' T From Project As Thirst Caterers One of the most prominent features of the year was the Cider Sale which was held during the first half of the fall term Although the ralny Weather Which seemed to occur during the days of the sale de creased the amount sold the project was very successful The del1c1ous sweet cider found a ready market on the campus and the returns made an excellent addition to the treasury fund The regular meetings Which vvereiheld twice each month were composed of various interesting talks stunts and other novel programs both lnteresting and educational At one meeting Mr Cobb gave us an account of his trip to Michigan State College during the Farmers Week At a later date Mr Kidder one of the older members of the club gave a report on the 'Rodeo which Was held at Chicago a short time ago He showed pictures of the various events which were staged and thus rendered a clearer idea of What a real Western rodeo 1S One of the trips which the club made during the year was made through the local sugar factory The visitors were conducted through the plant by members of the club who explained the process as they proceeded from one operation to the next The pr1nc1pal aims of the Agriculture Club are To train the men in the technique of organizing and conducting boys and girls club y Work to develop the spirit of good fellowship among 1tS members and r to foster an interest in such topics as pertain to agriculture Every 5 effort 1S made to keep cogmzant of the modern trend of agricultural r investigation This is accomplished by means of reports given by mem- bers at club meetings M Among the numerous act1v1t1es which the Agr1culture Club assist- , ed during the year the most important Was the Judgmg contest which it lncluded the majority of high school judging teams in this section of A, the state Due to the great number o people who were enrolled 1n v the various contests it Was very difficult to keep proper organlzation , butdue to an eflicient system the meet Went over in a far more satls- 2 factory manner than ever before All i A T Durm the s ring term the Campus Comedy Was the chief function u g I3 T w in Whlch the club partlcipated Although plans have not been made H l ' complete the annual picnic Will probably be held later 1n the term ' 31 l i, ., Q 1 1 . 1 T The Agricultural club Wishes to take this opportumty to thank I l Prof M A Cobb the faculty adviser for his assistance which Wastof f l f 1nfin1te value to the club throughout the year L 3 :K Q UT 4 L ,I 1 , ' . ,A, ,,r,L,-,,,, ,,-,,.,-,-,.m,Hw----H------b-W f , X. 1' A . Y -f Wen 1' 'iii'-t,lVr:'Lm ,TFT-W, -ww-, Y Y Y ,1,,,,,..,.,,,,, l-,.,.,N,.-....m-1--L-7.2,-Ach 4,--4-'--'ff--xg-,j ,Ln-'zjf' ,pf-fri-1 , 1 9 '-' ,, ' inf '4 ' Mi' 5' iv, ,,f: N ' if 'I jj, F 5' l,,j ,fi , X . ' 1 'A'-1142 fkfii 1 ,,,,,,.i, ML -fr.-f-.,Qff-M A -M-'ff-few im 'r'sM m A ,s Ima, i rw c 411+ wa 1 3 e , 3 i 1 ii: .Fi al ,f w i ri ,w. 3 Yi ll' pl 1 il P nl TI! ,z 1 r l il if , 1 X5,,7fi,imr'fri'ji'fiimjgjiimiui is .K llll is g g A - -A Wi N Eli ' S J ig Cosmopohtans ponsor A - ' Ni 'lf , ,li . li lil l ll l il lil 1 'lil ., mg , ug 2 yi f l 1 T i 1, W lf, BACK ROW: Creta Lamphierd, French Club representative, Dorothy Brader, Home Economics representa- ll tive, Nell Jane Damon, Social Vice-presidentg Vera Cutting, Helen R. Emmons representativcg Isabellci Lewis, Literary Vice-president, Evaleen McDonald, Mercier Club representative. il SECOND ROW: Monica McConnell, Art Club representative, Virginia Hatch, Deylartniental Vice-presi- dent, Bernice Brondstetter, Treasurerg Jannette Adams, Lucy A. Sloan representative, Gaynell Emery, Religious Vice-president, Irma Lefler, Vice-president, Doris Abbey, 1V11acDowell representative. FIRST ROW: Rhea Curtis, Physical Education representativeg Mary Banton, Central Triangle representa- l L' tive, Dora Silver, Presidentg Helen Kates, Warriner Literary representative and Edwinea Eckfeld, 5 Secretary. Those not in picture: Cora Lane, Physical Education Viccvpresiclentg Donna Barnes, Ronan Round Table representative, Doris Musser, Y. W. C. A. representative. Those clubs unrepresented are Rachel Tate, Cliophiles, and Commercial. lil ,y - lil The Women's League Board of 1927-28 had a full and happy year jj in trying to make college life for all girls on the campus one of pleasure and fun With a taste of social training. J il - - . . . f gli Dora S1lver, president of the Board, filled that difficult position ad- mirably and all her efforts were heartily appreciated by the ofiicers, 3 l representatwes, as Well as each girl on the campus. Board of ofiicers E Were: Vice-president, Irma Leflerg social Vice-president, Nell Jane 4 U Damon, literary v1ce-president, Isabelle Lewis, physical education Vice- pres1dent,. Cora Lane, rel1g1ous vice-president, Gaynell Emery, secre- C, tary, Edwmea Eckfeld, and treasurer, Bernice Brondstetter. ,1 if - . ,lg The rest of the Board IS made up of representat1ves of all the , i clubs or organizations 1n college. Those clubs and their representatives are: Lucy A. Sloan L1terary Society, Janette Adams, Warriner Liter- fv-,i ary Society, Helen Katesg Ronan Round Table, Donna Barnes, Central ik 5 Trlangle, Mary Bantong French Club, Creta Lanphierdg Art Club, Mon- : 1ca McConnell, Physical Educatlon Club, Rhea Curtis, Home Economics I 4144: T L, C. Mlm qvg, Y xgggmn gggg NMMA at gg g I 'i X 1 ill' g BJ-CBM' J into ', 'JN -Eiga-B -.ffs ffl.Tj,,, 7, l f l 1 1 il 1 1 l 4 l ,F if l ! l A lr ll I f F l l l I l l ,f if ,I l A 0 il 91 l V N l V NCD 5 J Q THE cnnnrnwwl T 1 'Fiji Q 'W' A' of g ,A ' YQ mfljj W Aj f-fe J-5' ---1-.lfmsgl -Q..k,-J.OiQQ, Numerous Affairs Cn Campus Club, Dorothy Brader, MacDowell Club, Doris Abbey, Helen R. Em- mons Club, Vera Cutting, Mercier, Evaleen McDonald, and Y. W. C. A., Doris Musser. ' ' Under the Board's direction, a number of teas were given in the' provised Women's Commons in the Science Building during the year. With the exception of the Freshman Tea in the early fall, and a few others, the various organizations acted as host or hostess at the tea each sponsored. The purpose of these teas and coffees is to bring the stu- dents together to enjoy one another's company and acquaintanceship in a friendly and social way that cannot be obtained in a classroom. The annual Co-Ed Prom that is given yearly for all the girls of the college and no men allowed, took place on the evening of December 2, 1927. The social vice-president was general chairman, and her com- mittee heads were: Decorations and music, Janette Adams, program and tickets, Retha Brookens and Betty Curtis, refreshments, Virginia Mulvey, finance, Bernice Brondstetter, and advertising, Doris Minor. Another portion of the Chippewa will tell of the general hilarious time an evening without the men can make. ' The Big Sister Movement started in the year 1925, was continued last year and this, with high hopes of becoming a part of the League's program. This movement is conducted for the aid and purpose of the Freshman girls whose first year away from home, or on a campus of this size makes them homesick and lonesome. The Big Sisters each take some Freshman girl on registration day, to help all through the year if her aid is needed. ' Each year the VVomen's League tries to bring on the campus, some person of note, charm and worthiness to address the girls. This year we were very fortunate in being able to have Miss Selma Ekrem, of Turkey, with us on February third. Miss Ekrem's charm and delight- fulness was decided. She is a modern daughter of Turkey and her address was Discarding the Veil in Turkey. After her lecture, the Women's League entertained the girls .of the college, the women's clubs of the city, and extended an invitation to the girls of Alma college, at a tea given in Miss Ekrem's honor. The lecture and tea took place in the gymnasium and never before has a tea had the interested, interesting crowd of ladies present as did this one. April 19, 20, 1928, Mrs. Margaret Story, noted authority on dress spoke to the girls on that subject. Her 1O0Pl113YitY Was S0 pronounced that she wasn't allowed to return to her home in Pittsburgh the twen- tieth, but was asked to hold open forum in the new Women'S COmII1011S that day. - V ,Q, i1 ',i'T: iif'11:'7cg':Til'r 'T' M' M ivMhdl?MEiQJ CQ, LEXSDACDJQY an .... A A fe-A 57' A ' f A I 3 -,, or rms., --..--,---Mw as C -jj l ig-34 A 1 47:9 A 1 . ,-.Y,.-.,.- ...M ,.... .. .,..,.,-,.f .,,, .,... ,I VZ I-X.. - A .,.,.. .. . ,,, . N V i A ,Y 1 V .4 3, ' fre: , 'F W' gn, L H, Ly , I. , e 1 I l NX,,,X li V ,lf ii, g gl l ff, il, vvffi lr 5 I- 2414! ,,-, , ff! 2, , ,f . 17- 4 X , ' 'C ' S ' C ' ,,,.d,,e,,.,, ,L1,,...J U, Q 2 os , mm w,,e,.,,-.v,,e-,W,.e...VQ 1 5. 2 ,.... ,,,- M- .,-., H ...,..-........,...-- 4 1 A -f I ' p F 0 O O League Wakens C1t1ZCHSh1p Back Row: Isabel Kress, Mrs. Julian Spenser, Miss Sherritt fFaculty Adviserl, Cecile Reusch, Mrs. Howell. Front Row: Jessie Sharp CPresidentJ, Irma Lefler, Rachel Cook QTreasu1'erJ, Janette Adams. Members not in picture: Marie Schneider, Edna Gray, Arlena Gurden, Gurden Christensen, Dora Silver. Officers President ---------- i ........ Jessie Sharp ..... ------ A Secretary ------ - ...... Mabel Brown Treasurer ..... .... R achel Cook 1 Q p4 fi I I 1 is E 1 l l 1 C l l il la ll I ilgn fl Qi Vw kQQ5r Q i YI I I I f II' I II II -I I I III I I ' I I I I II I I I I I I , I I I II I I I! lt. I I I I II 'I I I I I II I II I, I I II III I I It ,I II II I I ,I ,Ii XMI I sl I 4 IQ A-fy A ' em IA-I I--, .1'f1lffTjL-1i'j' ft1lfQ.Qfjj'fi 'i A'I'.l:III I I Attitude Among Students I I . III I' I The League of Women Voters is one of the newer organizations of I the campus. In the fall of 1926, two coeds were sent to SaginaW 'to attend the annual State convention of the League of Women Voters. I I Having learned at this convention that other colleges were supporting active branches of this State division, the Women's League and certain I of the faculty members began Working up interest and securing mem- I bers for a similar organization on Central's campus. A membership drive was conducted and resulted in a small but exceptionally alert membership, and by the fall of 19274 the organization was definitely established. I - IH 5 The League's Work began when it took charge of the annual Stu- II dent Council Election early in the fall term. This election was con- I I I ducted according to the Australian ballot system. A check was made Ii I for each person Who voted which made possible the posting of the per- I 1 centage of people voting from each class every hour. When the polls I closed at five p. m. 56 per cent of the student body had voted. This I was a 20 per cent increase over any election previously held on the campus. A Week later the voters conducted the election for president of Student Council With equally good success. I During Winter term the Women voters took charge of a tea for the Women's League. A great many students and faculty members at- I tended, and there Was an unusually large number of men present. The 'I' organization also conducted the annual Y. W. C. A. election during I Winter term. - 1 The aim of the League is not to train politicians nor to establish I a Women's party. It is to train girls to realize the importance of their l I ballot and to teach them to cast it intelligently. I I I It is the earnest Wish of this year's League that next year may Wit- I ness a stronger interest in citizenship and the League than ever before. all .,.,,,, Li.- .,.. , .,.L .... --.IWW We Mei-eff-'g1nQig.iei'fi115L. . f II IQi'e'3QfrI . . . QF 1- 'f . I V Awww A .I T35 X, . In ,, . Y, ': ' ' I I.: W lvlkr ,,n,,, ,ee - .- I X. as 'fff ,ig'fiifQfQf.gifi, ,ff If ' . 464' ,til i bfi 5 li Y Maintains Traditions U Back Row: Prof. Herbert E. Marshall, Max Matteson, Russell Lundquist, Lynn Corwin, Kenneth Bisbee, Jack Cline. Front Row: Maynard Allen, Hubert Archer, Frank Lewis, Paul Sutton, Winferd Judd. Early in the year, the Y. M. C. A. Board enjoyed a feast at the home of its adviser, Professor H. E. Marshall. That chicken dinner started off the year's program with lots of pep. Besides managing the Men's Union, which is the recreational center on the campus for men of the college, the Y instituted a membership drive during the winter term which brought in a number of new men. A men's mixer was held in the gymnasium during the opening weeks of school sponsored by the Y , at which all new students were acquainted with campus celebrities. Doughnuts like mother used to make and sweet cider were refreshments of the evening. At the close of the fall term, the Y held its annual football banquet in honor of Central's gridmen. Coach Tad Wieman of the University of Mich- igan was principal speaker. ' More than 200 attended the affair, given in the Masonic hall in the business district downtown. Local business men helped to make the banquet a big success. ' During the winter term, too numerous activities occupied the time of many of the members and not much was accomplished. At a late meeting of the Y Board in the spring term, no definite plan had been accepted for a 1929 program, but several new activities were dis- cussed. It was decided that Russell Lundquist, new president of the college Y , should attend the national conference at Geneva, Wiscon- sin, June 12-16. in ll in M 1'! p QEE fl? 1 ll i l I I I r Q M be zlii iiii lv Elti -- 1 'iv Eilef L ls tit 1 re f th ' da 1 is 1 . hel ser KKSIS holi ' N V 5 Som, I l , : if f.f I U , 1 Ing' C, i l the C4 f sr Work ja teees. ' was D clit nlefnlw ffl 'Nl01Jer 1 12 vided. .,5iQ tive in' Mil' i y elf. - ,t i bk Egixix N .ill W TNQ, H , .X '-.wx K s O ,V QM 2 P i Q v Y ' K H Vi L' Q' H fIf'Big Sister Movement Finds Y. W. Co-operation Eileen Waterman, Under-graduate Representative, Jewel Stirling, Social-Service Chairmafn, Edna M. Heilbronn, Adviser, Donna Barnes, Treasurerg Lois McMacken, Presidentg Jeanette Ewing: Finance Chairman, Helen Rose, Cottage Chairman, Rachel Cook, Secretaryg Jessie Sharp, Bible Study Chairman, Nell Jane Damon, Program Chairman, Olga Ginter, Social Service Chairman. CThese people do not appear in the picturel: Ethelwyn Livingstone, Vice-president, Irma Leflei' World Fellowshii Chairfma ' i An ' ' i r- , I n, M ss na B. Heiiig, Adv se , V Miss Mary J. Meek, Social Service Adviser. The girls' Y is one of the most prominent and active organiza- tions on the campus. Having a membership of about 115 girls, it Well represents the study body and various other campus societiies. The Y. W. C. A. is not simply a bi-Weekly organization-though there are regular meetings every two Weeks. Its Work goes on each day and each Week, along several lines. Perhaps the biggest feature is the cooperation With the girls of the government Indian School- helping them plan programs, and supervising their Y. W. and Girl Re- serve meetings, Which are held every Saturday afternoon. The Indian sisters are also entertained at parties, the movies, and sent gifts at holiday seasons. ' Representatives are sent to mid-year and summer conferences. Some girls are planning on attending the summer session at Lake Ge- neva, Wisconsin, this year. Other activities consist of earning money for the purpose of financ- ing conference trips, social service Work, and general business, besides the campaign to raise money for a Y. W. house on the campus, which Work is supervised by the chairman of the finance and cottage commit- teees. A student directory, With addresses and telephone numbers, Was published in the Winter. A banquet for girl students and faculty members Was given in April, which did much to help strengthen the cooperative spirit Which the Y stands for. The organization is di- vided into ten departments, the chairman of each being a representa- tive in the Cabinet. ' e ' 1.2 S 1' ' r r' 'Xll I X -fr -'lrI'l'-' I if 4, ,-I :I II 'I I. IQ In Il I ,I .V li ,I If fi 'I IN. E7 ,I II I I I I . I I . . I, II T I I I , I I I ,,I I1 I , I I I I I KI I I I I I , I I I - A i......M 1 J y' , 1 n 6, 1 - -R.- A MMT- ,A,, ..,,, x ,W A ,, -,..,,, , .. A, Z .2 1 ,,,A , .MNMW , - N, , ,MM A ,wqmjar W, ,, Mrnww A A, ,U Lf, A M A - ,M -x.,.A f'wI 2, Jr, -' -Q -- V 7 , - I , 1 .- I X A-I A ---A 44- . - A I 1 - . U-- I-, ,M A . A . V. A . .. n.. UV----A ,. M.- ..,.,,.,m.,,,.,,ax,,,,, 1 -.,..,A-,, -...:,::g AA, ,T -Af Q M my-A 4M-L-Au-41'-W. . I ff- ,IC Aj, It , IQ,Q.,f fd QKJLMQEIHQI I I'Hjf QI Iiitij I 513.1-ji mg I W I Q I 5?f 555 WJI . 'TJ 5 I I L Lwff I O Q Q Pd If I Iq,,,,,, - U1 24 '- AT O btw-.: I I I 5 II 2 . cn 'S 2 - I III p,vem4+-U If Q. H CD H-wk S-'-'g,5-U3 'I ,g . I 4 CD C5 Q CD CD O O ' , , I II H- ff LE 'P fa. mFE?:.,.,:.5 99 I I I 2 Q C+ I-U Q. S2 ri. 'D If U' If I 'zz 9: cn H 'TJ m U' O - I ' ff ads: 2: wie , I1 I ww fn ff Q-QIDQISEE wg? I! I ' 2 : rrfgwom 51452552 - 2' I I - Q- - 'TI 2:4 - 4+ o H .Q 1 I , . CD . Opdm - 3- -IXQ, I ' ' 5 I 2 O Q4 ,, O I I LI I Q td III M ' I 1 I ff' . 'D '1 o 4 .' V. I '22 : 1 E5 '11,i2?5a I ' tb H E 2, 5 31, 'Q I I I 5 ' - : 11- ' fb Z 5 'I ' Q- FD U1 : I I H55-'3:'2f?:j V If I- ' I 4 fl o 4 '4 71' I I I , Q Q I- O U' Q. I, V ' - gi 0 9: CD Q- F I2 IFF I I 2, 9 'F O I 22: I I I5 5 I 4 Q I T A QQ 9' pg U 5 I ek' ' 2 CD 'I fwoigiw C ' H. I 'H-1 5 . E255-9.3303 D-I : EQ I Qggwsgg IIYQIII . H- D-I N 1- A ro ml 23' EIEQQ, U3 I H guna Qty?-UFEPS Fr IISII - - :: ' :ff , 2 1 I ' sm-g2z Hg 99 I , agggsrs 23 III ' 1 ' ff' H' I I rl' Ps W IF-9 . , E: Hia, gm: IIIIw1 ie : ' 5 I :s E' :T 5- ' 2 3 'N I I ' 1 ff? I Z :D rf -- :s 'N I I I 3 : : 9, g P E - l 3 I I pq 5 : H 9, 'sd pu 3 'H 4 ' I ? E 5: 5 '4 QQHFQQQQ' ,': Q P-L11 F' mvfiifsinr I fb O - H fb FD ' E 4 r-I Q 5 J- Q' m :U ff' Pg Q Q.. E QI C? 8 C: c.,4 O , 'I P1 14 co U2 S1 5 2' sw SI 5 H- tg FD sw H fb Q - I I 2 L 'D sw 5 9' '31 5 '11 W 9' ' I I I I 3 H L-I av: g2 3 gb, Q H 3 3, II ,I II H. W'-ij O an N'-w5':w H- A If Q o fp +1 ::S 5 5+ B 3- ' 3 W I I I I I 7 Sl If Q4 UQ CD 5 Q Pd g 5. E N , , JI ' 25 E ' F 5 P4 99 I I ' '4 ff: f I - z U 4 3 Q-A 3, 1 I O H. F4 ggi , L, Q I H E. 0 Q I 1 I I I 97 N pf S. 5 L I 5 5. 3 , , I , 5 I CD 5 Q E VVZIT, I 2 ' ' 4 Ai 9. I Qggfhgi I I, Avqimuw-7' v0 i I KX , ig , . . ' I fit'-,,,,h,-,M MI N is M -2 If i1ij Ql ff1 f , . M,XV'A 5' 7f9 A A 'AMA'-54' A 4'A' f f 1'A47Af 57?hifi?-'i'1Ti '1'1 'TZi:ziL-.i..fg .1 '1::gi:.'-f1ii.:' ::fgA:Lf4:151:5-tffigm-.,-,.-ffii Afzffzrzfg-gfw f-Wiffwgfy-5-qgf 1-L A-gvfw-.,-x,1f. 'XTI I M. V, , , I MfQQ,fu:jjj'i'i bI Q '4'n i-'h w'N '4'- W 'I A'f'A '- '--'I A 44--44- MI A- M- -'W -Iv V - fwu -A-F-W - A4 A 444 AYAA AA X AM-- W 4, ,g,..-A,-444- ,.,. v.v,x-ffl,Q.--.Q1-ME, I Im f fa 'E 7 I I I I I I I I I f II IQ II I1 1' II l II I I iI I I I I I VN: If if MI EI F! III :JI II: Iji II II I If III :III III III? E iw Isl III III I 'I L14 1 I 'I Ima I!,.,u,i Ix P' VK? EW :GLX Q.: I W l III- 43 Rs ay 0 0-3 U Q YJ s .fi 1 E l ' N l tteson, louise vian a 3? 19 Q New Plan Admits Men to Membership - The outstanding achievement of the MacDowell Club members this -year was the sponsoring of The lXTikado , Gilbert and Sullivan's most popular opera. The Mikado wasbthe first musical production to be presented by students of Central in the new auditorium. Among the guests at the first presentation, Thursday, May 25, were more than 600 delegates to the county normal conference here. I The opera was staged again Saturday evening for another large audience. Nearly all the members of the cast and chorus were members of the MacDowell Club. The Mikado was considered one of the most colorful and entertain- ing productions ever given by Central students. The program of the club affords opportunity to become, better acquainted with the lives of famous composers and artists. The club has thirty-five members. Officers this year were: Mary Louise Kane, president, Aldie Long, vice-president, Thelma Barker, treasurer, Eve- lyn Fry, secretary. Miss Gertrude Friedrich is faculty adviser. Frances Jackson has acted as LIFE reporter for the past two terms. The MacDowell Club changed its policy during the past year to admit students who are interested in music but who are not enrolled on music courses. Eight young men- were asked to share in the activities of the club because of musical interest shown on previous occasions. During the fall term, the club held several social meetings. At one time, Mrs. Harry Thiers entertained the'club at her home. The pres- ident, Mary Louise Kane entertained, as also did the Misses Maclntire, Friedrich, and Patterson at their home. The winter term program in- cluded the study of Bach, Beethoven, Mozart, Haydn, Handel, and Wagner.. The spring term was devoted to rehearsals for the Mikado. Before a MacDowell Club pin is received by any member, he must perform according to his musical ability at one meeting of the club. ,I Q. E 6 I 1 I I 1 4 1 l l 1 ' 1 I 1 I P I 1 1 1 5 ' ' or F, 'A-' Q Q-n'jQgQiijggj,jiQ fl ,,,, ji? ff,11llTTTiji,Iff i 'i'fLf i1 A as L1111 fa A-1f esfLi M'e r-H-1-2-f ' l' .1 4 o Qi 0 , 0 l E1 Catholic-Students Have Busy Program for Committees VC l 7 l 1, , 1 E 11 J ii ' ly 5 Back Row: Arden McNeil, John Day, Joseph Dondero, Joseph Ryan. Center Row: Mildred MacRae, 9 l Evaleen MacDonald, Mary Ann Piechowiak. Front Row: Margaret Kirschner, Margaret Forster, 11 E Elizabeth McConnell, Janet Murphy, Frances Jackson, Monica McConnell. N l N Q l T 1 Gificers 2 1927-28 1928-29 f President ....,..,.................. Mildred MacRae President .................... .. .......... Joseph Ryan i ViC9'P1'9Sid9Ut ------------------ -Joseph Donflefo Vice-President ........... .... M argaret Forster 1 i'iifEt?y'TrEaSurer Mongjigmlwliflcgillifeg Secretary-Treasurer ............. Arden McNeil Q 1 epor er .................... 1 e e , , ,S l Women's League Representative ............ Faculty Advlser 'A ' MISS Irene 'Tome K Q ......,................................ Evaleen MacDonald i Faculty Adviser .......... Miss Helen Johnson .. Honorary Members-Miss Grace Ryan, Miss Mayme Smith, Miss Irene J orae, Mr. Jos- li eph Carey, Miss Mary McGuire, Miss Helen Johnson, Miss Helen Naumes. ' Every Catholic student in Central State Teachers College is a member of the il, E Mercier Club, which was organized eight years ago. lf T-his y-ear, the club presented 1a series of programs that were of interest to college J l students religiously, educationally and socially. At the first meeting in the fall the 215 students met for a. potluclg supper 1n -order to get acquainted. An enjoyable evening . J V stimulated special interest 1n making the rest of the meetings a success. ,, ' 1 . Other programs which prov-ed to be very enjoyable. vvere an educational program E j a tvalli by Mrci .g1oselpIhICare1yi- severgllgnteigesttng religious rlneetings with addresselsl lj , r. u vey an r. c aug in, an r. Ka a ar. t anot er meeting Mr. Josep '21 1 1 Schnitzler gave a fin-e address. I There were a number of social evenings, the programs of which were arranged by li T the students who also sponsored a dance. T I ' A clause in the constitution was changed to the effect that th officer for the 5 ' 3n1151,112Kg'0?1ff:511isevniJoe1ilCE1rbKei. Zgcgcegldaut tile l'asttmeeti1fig.of thi vfcfinter teIrm,ein order? that the ,, z o egm 1 s Wor lmme ia e y in t e fall. The new comm'tt l h 1 l cl 1 A ' . 3- A them are plans.for rrloriaeextc?3'n1Siv?a1:f?Jrl5i ag:Thaelciiclilaiiugclligldlgllinfabdlditibiisi 275126 aihrpllileli fr custom of playmg Santa Claus to the Indian children. ltr? , Lf Q MH ggggggg?--A 6199 ggi ui v s ae, ran ter Ieil rae OS' the age the ing 'am :ses sph bY the I the ' D112 rt6d 6' M 2101 f V 1 ,F X ,uk E ,.+. X ,N 1 X1-, . fs. A Vwuv Mzmx QLCJJU I 5-W' L+. f..,..v. 1'---J' Q'--7. .Q-v----riff- ....,.,,,,, ,Q T, 1? V v kr V s x! A X 1' X I X N V . n f i K w 3 l ,Aff K H W -it E2 it H 3 L wi Q V! IV ' It 1 l 1 E H 11 E 5 1 V fu ii ii ? f M f-N Y' LQ. 4.1 fy' fff4 L QM V X A i I1 O E F E AT U R E S E XJ! , i L-v--M--0...--....,.,-.-..- .-.-,.-.., , , ., ..., H., W-, ,, H My , I X QV fM,S2lmg, , i c Q 1 1 5 1.12.4 4' lg Ax-, ,H Foreword In conclusion, this section of the Chippewa is a collection of mis- cellany. The hang-over of an editor's work-table contains the sort of curios that people look for first. In these pages are those pictures and stories. Our recipe for satisfactory features was not complete without a dash of campus humor. So here 'tisl ' As an afterthought, the 1928 Chippewa aims to be a better annual than its predecessor. Yet in its publication, many items have been omitted which were formerly traditional material for yearbooks. The usual snapshot album is supplanted by other campus pictures. The lengthy calendar of events will not be missed. We Are Proud Cf- Mr. A. L. Trout, chief architect for Mal- colmson Sz Higginbotham, Detroit firm, who conceived and drew plans for Central's beau- tiful new Administration Building. His vision has made the huge library a study hall for stu- dents to enjoy and a fitting home for a treas- ury of books. Sunlight and Shadows would be an appro- priate caption for this view of the east library windows. Their tall Gothic grandeur adds that during afternoon hours which the long chandeliers denote at evening. As proud as students are of every nook and enchanting corner of the Administration Building, they are equally proud of the man who conceived it all. it . .-..a,,,,,,,.,n rf' 1 l l Q l l i ,,. if .pl l l . 1 , . v , r ,- .1 5, fa 9 ll, il 1. 5? V will ill 1 5, iw l !. li' I l. it la l. in l ll 'a I s s gl il 1V li l l ., l li ug. ii li. 11 I. I lil ,. I. ll l Ian: ljll nl '1 lgil lill , 1 ifi1 l. 34: i-Q ,l, .Vi 2557 Q13-Tn f Ls.. rg .K QN Li R4 ir T I I QU 'F I L if 454 'V Q-J .A ,gi 5. '. 1 . : .I .1 L-.' f,43 ' K x l r w Dining-hall of the new cafeteria, located 'at the west end of the Administration Building on the third floor. Tables are arranged for four, six, or a dozen. Whether one eats alone or banquets his friends here, it is safe to say that the cafeteria is the most popular spot on the campus at dinner-time. Webster Pearce used to say, The best part of a plenty of time is the first part. The popularity of some people is due to the things they don't say. The meanest professor is the one who borrows a student's pencil and gives him a zero. Helmer: So Lee and Reva are keeping their engagement a secret? Mossman: Well, that's what they're telling everybody. ' Auto ,Suggestion . Helen Kates: Can you drive with one hand? Deak Bellinger: You bet I can. Helen: Have an apple. Reclpath Bureau? Prof. Larzelere: Tell me something new about Washington. Lloyd Simonds: He crossed the Del'- aware. Professor C. S.: But that isn't new! Name something else. Poor Lloyd: I suppose he went home and lectured about it. Dr. Pringle: Open wider, please - Wider yet-more-a-ah! QThen inserting rubber gag, towel, and elbowj : Howis school getting on? End of the line. Checks, please! A 58- foot tray line leads the cafeteria Patron past steam tables and counters laden with good food. Kitchens and serving-room are a thing apart from the dining hall of Central's cafeteria. P A sei-- ..,. .... s.-..., A-f. - l 'a 4 1 6. 1 i V ' w I . ye-.. f lf it .gl lt, 1 .fl fC'j 5. III II I., II ll I II III I I II I V I .Il 'I I I' , , I III 41, I II: I , . I I: I 1 I It I II If A V My V W Y YHA' , 5 ,ul V Y, , ,, . . ,, .. ,..- .----nfl-:,fg1-f -v- ..-.. Q Y Y 0 :Mn J- gg-F'-Nu-bl Aiif-ii :gr-wav Kyr-w,w-OizwrnrvpniA,7,nQ,x,A,,Y,,.T:a,.,,B ,,,-- -. ,-.faaf ,--f. - ---::---- ff., irqyjifr--'-- Mf ' 5, Y'-21 . I- Q M' I:-.51 I y P5554 mf I I ...af I IQWSFQ I I gg., I I I I I :I I I III I III J I II I II I I Visitors have wandered the corridors and then gasped at the beauty of this spacious foyer on the second I floor of the Administration Building. As one climbs the wide staircase from the lobby below, there are I II pillars, curves, and arches both big and small tocatch and bewilder the eye. Memories of this spot hold one. ,II Harry fGover: What made you late Frosh football candidate: Just think, I for work this morning? I promised mother that I'd never be a Duaine Bastian: T-here's eight in the football player. I' house, but the clock was only set for Monty: Don't worry, kid. You've ,I 5, seven. kept your promise. , II II, I Varsity Drag Home Management III, You're: Where've you been during Prexy: I won't have it! Who told I I the last four dances? . you to plant all this frumpery stuff in , ,A Not: Jimmy was showing me some my front lawn? u III new steps. Day Laborer: The lady -in this big So: Were they very hard? white house ordered it. Hot: Oh, no. He took cushions along. Prexyz P-f-fff! Nice, isn't it? Brush 'eml Brush 'eml Twenty-Two Ceints' Worth '30's girl: Aren't those football men sLenore Wilson fdashing out of E I I just awful dirty? How do they ever get Dormj : How long have you been wait- , clean? ing? 5 '30 Ccalmlybz What do you think the By Brown: To be accurate-Just , If scrub team is for, my dear? 27 cigarets. A A college graduate, who has confident Bertie Stevens glanced at the beauti- ' II ideas concerning his abilities, went into ful woman beside him, his ilook heavy I -I a broker's oHice. While Waiting for the with anxiety and humble pleading, but . manager, he questioned the office boy: she was unconscious of his appeal. For II Do you suppose there is any opening long he watched her, struggling with his . here for a college graduate? emotion, desiring, yet afraid to ask the Well, I can't say right away, replied question that trembled on his lips. At the lad, but if the boss don't raise my last he spoke, wistfully, yearningly: salary to five bucks a Week by tomorrow Ma, c'n I have the little pi-ece of pie Hlght, there W111 be. that was left over from dinner? Lucille MacDonaugh: Meet me at the Stein : Do you know how to make 1, library tonight at 7 o'clock. 9, peach cordial? pp Winn Judd: All right, what time will Al West: Sure, send her a box of you be there? candy. , 'fur I . I I K , fu. X -- 1 . . fa,--lg .-1.1,-?f-.,..,.-.1Yeaafff,W., ,.,,. HL.: , :YY ,I rf 1 4 '.l',,I, U Isl.L 5 I 1' ' ' Y . I-. AAL 'I l ,K I bl' I Y I I I nl N 0 II s The Chippewa is indebted to Prof. Frank E. Rob' f th' h t h f h faculty of Central Michigan Normal School, taken i1inSi,d1SJ'7lun gi.0g1gjlblanO ind Rachel Tate, after whom two women's literary societies on the campus are named, are seen in this group. Others still teaching on Central's faculty may also recognized. From left to right: Standing-Gertrude Robinson, Mary Jane Jordan, Estella Whitten, Margaret Wakelee, Charles F. Tambling, Gertrude Dobson, George W. Loomis, Carrie Simpson, Elizabeth R. Wightman, Mae K. Woldt, Lois B. Wilson, Anna M. Barnard. Seated in chairs: John Kelley, William Bc-llis, Lucy Adellla Sloan, Charles lVlcKenny, Rachel Tate, Carl Pray, Fred L. Keeler. Seated on floor: T. Bath Glasson, Bertha I. Howe, Irene Getty, lVIyrta 'Wilsey. Tournamentor: Nice statue you have here. It's alabaster, isn't it? Passing co-ed: Oh-Oh! That's the Discus Thrower! Absence makes the marks grow rounder. Swen Johnson: I saw your picture today. Luke Lundquist: Where? Swen: On a salmon can. Dudley: Have you seen our Catskill Mountains? Mary: No, but I've seen them kill rats. Have you a cigarette lighter? Yes. but he's at college now. Visitor to building: What is all this bunch in the deanfs office? Wise student: They're just waiting to see if they're still collegiate PM A V Miss Meek' Did you ever read the Pickwick Papers? Rowland: 'No, we don't exchange with any of these hick towns. k. 1 -Q i'gm----.-Wg, s.. A-AA ' wf- QVA MM----31 If , 1 liIll'I'I'3 fg1111f1:11.11J.f 1 .fs J,1Ds:'f1.,, II. 111' III 'YA Q 1 I..- I 'As ' .Al 4 ,-Q-,cf-xa , . II Q.-,gf sv 1 I I! I I I I I I 1'I I I 1 II 1 Il I I I I 1! 1 II I I 1 F 1 1 I , 1 1 1 I 1 II1 I 1 I I 1. . 11 HI 1 V.. ffl W 1 V I 1 1 U Rainbow Diagnosis ' T. 1S. pupil: Miss Smith, my sister can'.t come to school today because she's got the color. . - Critic Teacher: Color? You mean cholera. Pupil: Nope. It begins with a color. Critic: Yellow jaundice? Red meas- les? Black smallpox? 1 -Pupil: Nope, I got it. It's brown- kitus! Ross Matteson: Did you go to the Women's League Formal? Gordon B-liss:-I Why, my aunt was sick and .... Ross: I didn't get a bid either. An alumnus of Central recently en- tered the Administration 'Building and saw -a mighty array of books and maga- zines for sale. He paused. ' Do you remember of a man in Jerusa- lem who once said Ye have turned my temples into a place of merchandise ? i13mwg,I,gI.W,,,,1,,,,A. ..,, 1.-v....5--....l ,.., ,.j,.,.,:g..'.Q'Qggi1... -,.b, . These three students too-k a prize as theufun- niest group at the Co-Ed Prom. Do you 'agree with the judges? Bill Corwin: What is the name of the magazine you want to buy? Nell Jane: I don't know, but there's a picture of a girl on the cover. p Telephone Operator: I have your party. Deposit 5 cents, please. Ray -Kniffen Che thought the Ad. Bldg. booth was freejz What did you say? . Operator: Please deposit your money. Ray: Listen, girlie, what I want is conversation with a friend, not financial advice from a stranger. . Motor Cop to Mr. Richmeyer: So you saw that accident? What was the number of the car that knocked this man down? ' Pat: I'm afraid that I've forgotten it. But I remember noticing that if it were multiplied by fifty, the cube root of the product would be equal to the sum of the digits reversed. The Webster Cup HEN Prof. Edward Harlan Web- ster left Teachers College here to teach in the East, he left funds to purchase a silver loving cup which was intended as an award to that so- ciety on the campus rating highest in scholarship. Here's the cup. It has been waiting covetous clubs for near-' ly a year. Faculty committees are trying to decide the terms of competi- tion. X..- Q,--1 Q71 ,,,, , ,,.. .,,. l i.L2'.-,,..,r..,., ,,,. H- ...., 1 ...,,.'-1.5. . ,IJ ...., - ...... . .. . ...-. .... .-. HT.. . K 1-N f 1- to ---Q------1----A--..V---as-.m.---i-I .Tariff is to c 1 'Ig i'1'3IC'y I ,,f J x, -.1 I 1 II 1 1- 1 Q If for ..,,,,A1 1 ffIf1i JK., II I I III I i 1 I I I I I I I 3 . I 1 I I 1 1 1 Q fo L Q1 Q lvq xi PX fi if ga r l s Q Q h 15 ff The theatre is all dark. Then, suddenly-lights up! 'AWhat a magnificient auditorium those students have at Mt. Pleasant is heard on every side. A projection room at the rear, fourth floor, makes mo-tion pictures possible on any scale. The stage will accommodate any large operatic production. The house seats 1600 people. Gold-diggers' version: To the victor belong the poils. Polling Clerk: Your name? Harold Bentley: Yes, sir, we're very Professor Minor: Prof. Minor. up-to-date. Most everything here is Clerk: Your profession? cooked by electricity. - Prof. Minor: Why, I'm a Teachers Warren Clark: I wonder if you College professor. would give this toasted sandwich another Clerk: Can you read and write? shock. Helen Smith: Say, you should have been here a few minutes ago. I nearly broke my neck. Nina Meier: How? i Helen: I fell down stairs and skinned up both my legs. Versa. Visa Democratic? Helen Donohue: Were you hurt while Vera Cutting: Who is the cleverest o in our 'ournalism class? on the eleven? b y y J . l Bill Miller: No, while the eleven Laura Thompson: Wager Clunis-he can wiggle -his ears. W6I'C-3 OH II16. Mooie Trask: How many can ride comfortably in your car? Ray Nash: None. Prof. -Calkins: Your recitation re- Miss Woldt: When. do leaves begin to minds me of Quebec. turn? . Marion Bowers: The night before Horace Hodge: Why? Prof. rCalkins: Built on a bluff. ' exams. Wisdom and ignorance go hand in hand. especially at a teachers college. Q 1 Hr, ls .. ll 4 HJR k . - l ll ,4 E i ' A ! i ' I I1 n . . I Ill!! if Zigi . u I il al? lil ,ii Un .pi I. 1. l , 1 ,J. I i rw, 1 1 v W HW W Wm ,,,,,,, W,,,,,,,. ,M .fA---- Y-f, Wage.- M--ML--7-f---H w if-ge-W -W f '-Y '7-'Ta P- v o o ' 'f'f'? I E A was 'ICO e QAQEQ ALn--..I. ...I I 4 in,Y-T:-vh,,,Af,q,,-,..-,.:..Lf::wf f-Y-' -fr' ' ' ? :': T L ' ' ' y ri. O. - P ' I . . I km 1 ill fl l . A U J I il l l iff . gf? . ii Q ll 5 .1 s li qi lj . .li p l w if 1 N l ' l gi . ig K, Adjoining the dining hall is a recreation center known as the,Women's Commons. Meetings of literary i ' societies are often held here, or afternoon teas, or-sh-h, dances sometimes! Like an old English parlla- 5' l I ment room, the Commons caters to the cultural tastes of Central's social groups. 1' . L, I 5 , ,: l lb. I xl 1 Miss Jorae: What is the first thing to Mr. Rice fin a hurryj: I Wa.nt a 5 turn green in the spring? checkbook for a lady that folds in the fy Margaret Erwin: Christmas jewelry. middle. ' il I 1 2 Q What a whale of a difference a few cents make-to a studentat I 1 Central State. ' fll I 1 Stuffed Macaroni Response to Environment .L I Prof. Powers to sweet young co-ed: P. Munson: Seventeen students stood Flip E 2 How did you like the Barcarolle at the under one umbrella in front of the Sci- . I I musical last night? ence Building, and not one got wet. 5 S. Y. C.: I didn't stay for the re- Nell Jane Damon: Why not? My 1 fres-hments. Munson: It wasn't raining. - E l 1 The person who wrote Where Is My Wandering Boy Tonight 5 l d1dn't look in the library. CNor in the Normal Woods.D li S A U5 it i Over Inflated Yet She Drives a Chevrolet! I I Prof. Beddow: Remember the wheel. Miss Paulson: Why don't you answer I i CThe class did not seem to under- me? till 3 5 Stand-D Student: I did shake my head. i li Prof. Beddow.: The longer the spoke, . Miss P-aulson: Did you expect me to ' the longer the tire. hear it rattle- way up here? 4 .l l ,. V wif it Miss Rogers: Cin swimming classb Act your age, but don't crawl. ?1 V7 Bee.L8.I1GYf what makes you insist Student teacher at Training School iii i P Q that his heart is in the rlght place? Qhelping lad take off coatjz Did your jim.. X43 Marjorie Ovenden: He laid it at my mother hook this coat for you? if' Y feet Y9S'CG1'd2Y- . Bright Farm Lad: No, she bought it. 1 mg Most people seem to think that the Chippewa Board is a raft. iw Q ro . 1 -CJ., F ffra W , QL 5 QPQLLLZTTJ 'P Q3JL1Iif'L-.w:.1 f1ii1Tg'.. if i' tr ' :: ' -Arr-QL:- M:'M'x'f1 Zeit .... .. ,. mm Im 'R A 94 Q 5' H 1 Qi I I Q V k . A vs 4 I I K I 1 4 v l K 1 ' I I, V+ l l 1 l F J w MMV y Ab 4 l M273 H Vgqipg F4.1irg1gPi.i.ig,.gnwiiiiiii. 3,4,.Qf.-.g.,i1i4.ggg..... -..1...Q1.jjig, I -M' gg, Q ew-M-M Q' 5 ff.I'Ief?if-:'+?Jil 2W..-..J.f.l........l,.,,,i.2z11:i,,ge.,.,. Well Qlilppilfw T929 1 dl iw-Tffligg I'f2':'il bg I 2 I I ' M IWHI4 w'Hf i V H A - f e if fT'iif7fflif? 'ffQff 1 ,lx l lifll i ' ' ffj. ll ', l . l Sei . p i I 1 2 1 I li s li l il' l l I gi I l I ll Q 3 fl? l r I El I . li l I I2 1 F all N Students at work! Honestly this picture wasn't porsed. It is a typical scene in Central's new library. ll l 5 Lights above and all around make this study hall a beauty spot of the building. Oak paneling and wide I I book-cases surround the walls. I' I 'w . Helen Jefferson: Doesn't'it upset you Frosh Cat first dinner partyl : May I 'l H When you run over a pedestrian? sit on your right hand at dinner? lg Mildred -Durfee: No, I've never hit His Hostess: I may need it to eat il: E one as big as all that. with, but you may hold it a while. ' i 1 - .l I Hundred-yard dash men are in great demand at 9:59 every night. l p l Dutch Treat- Precaution Evelyn Trogan: Let's do something Mildred Fisher: Did you observe Fire il , unusual this evening. Prevention Week? il I l Tommy Corner: I have a good sug- Vera Hendricks: Yes, I got to the E I gestion. You buy the tickets. office a little earlier. I It is hard for a wise man to write jokes because so many people gn laugh at dumb remarks. . . I . w I ' Paul Sutton: That fight you had with Mildred Hinds has the bad habit. of f I Kermit Wickham in the Dormitory arriving at school late every morning. gli S kitchen last night sure made me laugh. Prof. Marshall, angered at the constant it s I Clarence Gregg: Wasn't that funny' tardiness, a.sked:- Is there any reason I , And when he threw that cleaver at me I for your not getting here on time? 5 f thought Pd Split! Mildred: I do not choose to run. QI . The Dormitory Serenaders will now sing a touching little ballad fer J entitled, You May' Have Been a School Teacher, but Gal, You've No I E Class Now. li l Doctor? Northway had forgotten his Hi.: These Indians have a blood- L patient's name: but, not willing to admit curdling yell. it, said: Is you name spelled with i Y: They are college graduates. l Of Hen? Q , Froshz' I'd like to see Dean Barnes. I . The astonished patient answered: Soph: Try Skipping chapel next Fri- IL I Why, doctor, my name is Earl Hill. day. g agp 0 5 wr V0 l l he 4 - wha ees'--W A ,HHFIUA 1'17I-HfQ : ' l1llQf' H252 .Q pq .M E. I D' I I . . if S ' p p lfgigiiigsgi L A f.,,,...-- ..,.,l, ,, ,,.,,,,,,- ,.,, ,-,,,,,....n,a.. A-.wa--------L-A-L--A ---H' if 1.1.1-1 ., , , . '- 'U' Q r ' 1 - Ny , 1 . 4 1 Win A fr. tl I I it ' A 3 i : a cv Y. Ap .v : - U - 'L - HA. ,, ,.,,,........W.-.. .W -mm- rl , t ' Alphabetical Index THE COLLEGE ................,.. ......... 7 THE CAMPUS ............,.......................... 8-13 Administration Building ............ V9 Gymnasium ........................................... -... 10 Training School ...................... ......... 1 1 Science Building ................................. 12 Women's Dormitory ........................ 13 Campus Forget-Me-Nots ............ 14 THE ADMINISTRATION ..................... 15 President E. C. Warriner ......... 16 Address ......................................................... 17 Two Deans ....................... 1 ........................ 1 8 T1-IE FACULTY ........ ...,......... 1 9-48 Agriculture .......... .............. 2 9 Art ............................ ......... 2 2 Biology ........... .............. 4 1 Commerce .................... ................... 3 6 English .............................. .......... Early Elementary ....... Dormitory ................................ Foreign Language ........... Geography ........................... ....20-21 40 43 35 42 23 History ............................... ......... Home Economics ......... ......... 3 4 Manual Arts ................ ......... 3 7 28 Mathematics ........................... ............. Music ............................................................ 31-32 Physics and Chemistry ............... 24 Physical Education ................ 1.25-27 Psychology ................................. ............. 3 0 Speech ................................... ........ 3 8 Rural ................................. ............. 3 3 Training School ....... ............. 4 4-48 Library .......................................... ............. 3 9 ACTIVITIES .................................. Campus Organizations ......... FORENSIC 85 96-103 Debating Teams ................................. 102 GOVERNMENT Student Council .................... ........ 9 6 MUSIC . Band ..... . ..................................... ............. 1 03 Men's Gleee Club ............. ............. 1 01 Or ch estra ........... 1 .............. ............. Philharmonic ........................ ..... Phoenix ............................................ PUBLICATIONS Central State Life ................. Chippewa Board .................... CAMPUS TRADITIONS ................ Basketball Tournament' .... 1 03 1 00 99 Campus Comedy ................................. County Normal Day ........................... Commencement Program ......... Flag Rush ..............,.................................... Home-Coming ................ ,.. Mikado .......................................... ............, Music Contest .......................................... So This Is London ..................... SOCIAL ACTIVITIES ............ ............. Scholastic Contest ....... ..... Christmas Dance .......... Co-Ed Prom ..,...................... 98 97 97 106 109 107 112 104 ........105 108 107 111 86 ........110 89 88 93 Dormitory Formal .............. ,....... Freshman Flurry ................................. 91, Geo. Washington Party. .............. 90 Hallowe'een Dance ........................... 87 Wanderers' Ball ...............,................. 92 Women's League Formal ............ 94 ATHLETICS ......,................................... 113 FOREWORD ................ ....................... 1 14 FOOTBALL .......... ............ 1 15-128 The Coach ........ .................. 1 16 The Team .................. ,,,,,,,.,,,,, The Season .................... Line-Coach Butler ......... ............. 117 118 Conference Men .......... ............. 1 18 ' 119 119 Captain-elect ..................... .............. .ll- Adrian Game ...................... .......... 1 20 Home-Coming Game ........................ 121 Ypsilanti ............................... Q ......................... 122 Northern Game ......,.. 1 .............. 122-123 Alma Game .................... ,L ...... ............... 1 23 Olivet Game ............................................. 123 Detroit City College The Men of the Team ......... 125-127 Freshman Football ........................... 128 BASKETBALL .................................... 129-134 THE COACH ....................... .................... 1 30 The Team ...................................................... 131 The Season in Brief .........1..... 131-132 Ten Reasons for Victory ............ 133 Frosh Cagers ' .......................................... 134 BASEBALL ......,................................... 135-140 Captain Hutchinson ......................., 136 1927 Season ............................. ............... 1 36 1927 Varsity Squad ......,................. 137 1928 Baseball Team ........................ 138 1928 Season and Summary ...... 138 Athletic Program .............................. 139 Frosh Baseball Squad ..,.................. 140 TRACK ................................................... 141-144 Captain Cline .......................................... 141 1927 Track Squad ...11 .........,.... 142 1928 Track Team ........................ . ...'.. 143 Summary of Season ............... J ........ 143 Freshman Track Team .................. 144 TENNIS AND MINOR SPORTS Captain Bill Kelly ................................. 145 1928 Season ..................... .............. 1 45 1928 Tennis Team ........ H ......... 146 1927 Tennis Squad ..... . ........................ 146 Rices and Olympias ........................... 147 Intramural Sports .............................. 148 WOMEN'S ATHLETICS ............ 1-49-157 ORGANIZATIONS ......................,.... 157 LITERARY SOCIETIES .................. 158-171 Central Triangle .............. , ...... 170-171 Forum ................................. ............. 1. 68-169 Lucy A. Sloan ................................. 166-167 Rachel Tate .................................... 164-165 Ronan Round Table ............... 162-163 Senate ........... . ...................................... .160-161 Warriner Lit ...........................,..... 158-159 DEPARTMENTAL CLUBS- ......172-187 Agriculture Club ........................ 186-187 Art Club .............,............................... 182-183 Cercle Francais ...... .....,....... 1 72-173 Cliophiles .......................................... Commercial Club ..,.................. Emmons Club, Helen R .... Home Economics Club ......... Kelley Club ....................................... MacDowell Club ..................... 180-181 184-185 174-175 178-179 176-177 198-199 CIVIC AND RELIGIOUS ORGANIZATIONS League of Women Voters ..,..................... ........,...,........ 1 90-191 Mercier Club ..................... ................... 1 96 Y. M. C. A. Board .........................,.... 194 Y. W. C. A. Cabinet ........................ 195 Women's League Board...192-193 CLASSES ...................................................... 49 If oreword ..........................................,........... 50 54 SENIORS .......................... Baker, Ralph B .......... Banton, Mary ................... Bellinger, Roland ....... Burch, Isabella ........... Best, Oakley .q ............,...... Burdick, Josephine ..... Burnham, Jake ............ Butler, Amos ............. Cline, John .......... - 54 52 53 53 51 52 52 51 53 1 K 1 lll'.,Il1...,l Corey, Lyman ........... DePuy, George ........ Dexter, Elleda ........ Disbrow, Sydney ....... ......... - Estee, Helen ................... ........,.. Everden, Lottie .......... ........... Gardner, Frank .......... Gray, Edna .2 ............... Gibson, Cassie ..........,.. ........... Hatchew, Josie S ..,..... Higbee, .Eva .............. Hlle, Hilda ...................... ........... Holcomb, William ......... ........... Jackson, Frances ......... ........... Lefler, Irma ................. Lewis, Frank ............ Lewis, Melvin .............. MacDonald, Glenn .. McConnell, Thomas Morford, Lillian ..... Pulkiner, Eino' ........... Relnsmith, Gerald ......... .... - ..... Reusch, Cecile ............. ........... Silver, Dora ......................... ........... Stackhouse, Chester Thompson, Harvey Wllle, Audrey .............. Wilson, Donald .....,..... ........... Wilson, Dorothy ..... Woodruff, Howard J UNIORS .................,........... .... , .... .,55 Adams, Janette ........ - ..... ........... Brainerd, Raymond Cartwright, Lloyd .. Cobb, Myrtle ................. Cole, Ivan ..................... Curtis, Rhea ............... DeLoach, Duane ........ .......... Dickson, Gladys ........ Dilts, Leon ...................... ....... Durfee, Mildred ................ ........... Eclfiield, Edwinea .......... .......... Gardner, Percy ........... Gregg, Clarence ........... .......... Halcin, ,Thomas ........... .......... Hass, Rowland .............. ........... Holstead, Clarence. Kane, Mary Louise Lamphierd, Creta .......... ........... Laney, Beatrice ................ .......... Maschke, Vernone .......... .......... Milano, Mack .................. ......... Ostrander, Jay ......... .......... Reek, Harley ...................... .......... Rochester, Donald Robinson, Lawrence Shelley, Ernest ................ .......... Snyder, Leon ................. .......... Stickle, Lila .......... ...... - .. Stinson, Arthur ...... .......... Struble, Floy ............... .......... Swift, Dorothy ........ ...... 1 Thomas, Dorothy ............. .......... Thompson, Arthur ....... .......... Trombley, Carrie ........ .......... Tow, Margy ............... ..........- Walker, Clayton ......,. .......... Wate1'man, Eileen Willison, Keith .......... ........... Wolcott, Alice ........ I SOPHOMORES ............. Abbey, Doris ....... Aldrich, John ....... Allen, Erma- ............... Allchin, Cecil M ........... .......... Barnes, Donna ......... Barton, Myrtle ......... Bates, Marvel ....... E hw W Q3 I 5 rf' M A, ,, an if ' ,fu li. Q -of-' L , , , ,f nf M. , L. ,K ......., ,.i-Q4--.i..,-..L .,..-.......-...W . - ...., . , ,.,...... .- , , , ..,,.-,,-......v, ...we-T---W - -- -are er- :-fn: ---f J' .ii f YI ,Mgt ,, I i l if ri-ii ' , my yn , LV. : . C.,-f ll li 3 J,f':if-,ly T Qi 'ff , i :wzh ,.--. , -,K JJ? I 1 ji 1 .ff-4.9 K-ex ,, xv-gi, ,,..N I 1, f ,, ' vp-s..1 . ,TT L L ... ,.,-.,,, ,,-L- . ...e...-...e...,.-..-.,,,. . ,- .--ef , ge-1 W, ,gm X. A-X-I - Q 1 , ,LW A- , , xl .Hail mia, 1 E-H.. r 4 : me, 3 P,--,g IM' 5 , ll . ls., 1 A Indices Continued M , c .,,, . BG21Cl111I1'l, Nina --.----- Johnson, Evelyn .................................... Smith, Monica ........... .......... 6 3 blirell Beach, William --.---.------ Johnson, Melburne .......... .......... S mith, Mrs. Carrie .......... ....... .. 77 Beltifleky Fl0ref1Ce ----------- Joseph. Grace -------.---.-.--. Snyder, David ................. .......... 6 0 if Beekman, Beatrice -...-.... Judd, Winferd ......... Sowle, Vivian ................. .......... 6 3 li Belyou, Marguerite ......... Kaiser, Estella ............ Spencer, Julian ,.,,..,..,,,,,, ,,,,,,,,,, 7 4 M Belding, Vera J ..,..... - ......,.... - .., .... Kelly, Cyrilla ............................ .......... S prague, Margaret ....... ....,... , . 69 Bensteel, Mina .................................... Kiessel, Rosabelle .......... - ' St. Johns, Irma ................ ., ....... 72 ll Bennington, Russell C ........... - ....... Kirschner, Agnes .......... .......... S terling, Jewel A ............. .......... 7 5 il Bennett, Helen ....................................... Kuhn, Lillian .................... Stineman, Gladez ,,,,,,,,,, ,,,,.,,,,, 7 4 ll Besaw, Alta M .......................... ........ K raus, Willis ............ Swanton, Sidney ............. .......... 7 9 lf Bigelow, Irma .......... Kuehn, Marjorie ........ Swarthout, Ruth M .......,.... .......... 7 0 l Bisbee, Kenneth ....i.. Landon, Ila ......................... Sweet, Otis .,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,,,, 7 3 1 Blair, Lucile ................. Langley, Ralph .............. Swingle, Leona ,.,,, , ,,,, ,,.,,,,,,,, 6 2 ,l Bohlinger, Ula ............... Larson, Mary ........................ ........... T aylor, Lester ,,,,,,.,.,,,, ,.,.,,.,,,, 7 8 ' if Bollinger, Robert ...... Larsen, Margaret ............ ........... T aylor, Mildred ........... ........... 6 3 l Botsford, Dorothy ........... Larrabee, Dorothy ......... ........... T homas, Dorothy ....... .......... 5 9 Bowden, Irene ................ Laundra, Ambrose .............. ........... T hompson, Clinnie ,.,,,, ,,,,,,,,,,, 7 4 ll Bowman, Vera .'........... Loughren, Helen ............... ........... T rogan, Evelyn ............... .....,.,.,, 6 4 ll Brader, Dorothy .............. Lawrence, Dana ........ Uhan, Pauline ..............,........................ 76 ll Buchanan, Vo Wyla .......... ......... L eismer, Mildred ........ VanMaren, Elizabeth ..................... 61 li Brown, Mabel ............................ ......... L eonall, Viola ................. VanSickle, Edmond ........ ........... 6 2 Burch, Carrol .....,.................................... Lesley, LaVerne ........ VerDuin, Willene ......... ........... '7 9 Brondstetter, Bernice Lewis, Sarah ............... Voss, Beulah ................... ........... 7 6 fi Callihan, Lucile ..,........... - ...... ......... L ewis, Kathryn .......... Wahr, Anna .............. ........... 7 5 li CH1'I'0ll, Irma ------...----------- -- Lindell, Mayme ...... Waldorf, Letha .......... ........... 7 7 li Case, Marjorie .................... Lindroos, Ailie ...... Walter, Ethel ................ ........... 8 0 ll Cawthorne, Clifford .......... Logan, Esther ,..... Walte, Marguerite .......... .. ........... 80 'l Cook, Rachel .................... Locker, E. Ruth .......... Weatherhead, Edith ........ ........... 6 0 Cowles, Claude ....... Luek, Bertha ............ Webster, Dorothy ........ ........... 6 5 U Conway, Ruth ....... Luxton, Marian ....... Warren, Hazel L ,......... ........... 6 9 li Clark, Ethel -------- Madison, Bernice ........, Werle, Adam ............ .......... 6 7 is Clute, Ellen ........... Madison, Flora ........... Wickham, Kermit ..... .......... 6 0 , Cleary, Eula ............. MacDonald, Anita ,..... VVeiss, Helen ......................... .......... 6 0 Coffey, Maud .,.................. MacLean, Bernice ........... ......... W ierman, Irene ...........,......... .......... 7 0 i Collicker, Ella B .................. Martin, Dorothy ...........'. Wilbur, Helen .......,............................... 77 Crippo, Mrs. Doris ............ Martin, Hugo ............. Willison, Ida Frances .................. 65 , C0011, Opal ,,,.,,-,,,,,,,,,-,,,,,,,, May-ks, Willard ,,,,,,, WilllS0n, Ida May ................. ........... 7 8 C1'others, Eunice .......... Matteson, Max .......... Wilson, Eleanor ................ .......... 8 0 5 Close, Mable ,,,,,,,,,,,,,,,,, Mattgsgn, ROSS ,,,,,,,,, VVinters, Allcf-2 ....,.............. ........... 6 9 l Corwin, Lynn ......... Maynard, Louise ........ Vlfalworth, NVard J .............. ........... 7 0 -Q Dalton, Sherley ......... . McArthur, Edwina ............ .......... W hite. Mary E ................... ..... I I Damon, Nell Jane ....... McConnell, Elizabeth Wonders, Ralph J .,............ ........... 6 9 3 Dargitz, Lulu .............. McConnell, Mon-ica ........ .......... W right, Kenneth A ........... ........... 7 6 N Davis, Allie N ................,.. McDaniel, Glenn ............. .......... W ood, Georgian ............... ........... 6 7 I Dawe, Dorothy ..................... McDonald, Evaleen Yale, Jennie ------------------- ----------- 7 5 'Dawson, Margaret ......... McLeese, Margaret ....... .......... Y orks, Vera ................. ................ 7 2 Day, Beverly ...................... McMath, Wilbur ........ FRESHMEN .......... 1 ............. 81-84 , Dersnah, Helen .................. McMacken, Lois ........ Ackerman, David ......... - .............. 84A Donohue, Josephine .......... ......... M urphy, Anna M .............. .......... A iken, Lee ......... 2 ..................... ............ 8 4A Dittmer, Clara ..................... Moffatt, Veda ..........,...... Arbogast, Carrie' ................................. 81A DuVall, Dorothy ............... .Morse, Jesse .............,. Armitage, Margaret ..................... 82B Duby, Thelma Maria ........... ........ M urphy, Janet ......... Aui-and, Elna ......... , ............ .............. 8 1A Duby, Ethel Lee ..................... Musser, Doris .......,.... Baker, Evelyn .....,......... .... 8 2A Edmonds, Fern ............. Myers, Virginia ........... Baker, Eva .............. .............. 8 3A A Ewing, Jeannette .......... Nash, Raymond ............. 3 ......... Barber, Evelyn .., ........ .......... 8 1B l Fahner, Arvilla ................. Niggeman, Harriet .....,. .......... B arker, Thelma ........... .......... 8 3B Fairchild, Ruth M ............. Nielson, Sadie ........,............. .......... B astian, Duame ............. .......... 8 4A Fenner, John ......,............ Oldenburg, Verna ......... ........... B eamish, Cleland .......... ........ , ..... 8 4B French, John ................... Orcutt, Myrtle B ....... J ..... ........... B eamlsh, Evelyn ........ ............... 8 1A Friedli, Geraldine .............. Ovenden, Marjorie ......... ........... B eltmck, Florence ........ .............. 8 1A Fritchie, Pearl ............,,..... Parmalee, Vera , ........ B1lCOX, R1Cl19-Pd -------- ---------- 3 4A Fox, Ethel Louise ............ Peterson, Gretchen ...... ........... B llssl, Gordon ............ .......... 8 4B Furman, Francis .................. Plumb, Elizabeth ....... Blevins, If0UlSe ........... .......... 8 3A , Gager, Donald ,,,,,,,,,,,,.,,,,,,.....,... ......... R anneyg- Ruth .................. ........... B luem, Virginia ........ .......... 8 12. Galloway, Almon F ............ ......... R eagan, Grace L .....,....... ........... B owers, Marion .- ..... .......... 8 1A Giles, Mable ........ Q ..................... Rhode, Elizabeth I ................. ........... B radford, Opal ........... .......... 8 2 Ginter, Olga .............................. Richardson, Caroline B1'lk01'3-1 Anna, -'--'- ' 3 1 Greenway, Genevieve ....... ......... R obmson, Francis .... , .......... .......... B riggs, Katiierrlne .......... .... I ..... 8 4B X ' inson, Erm .......... Bremmer, rc ie' ......... ........... I Hesls' GladI5ZS'l 112326 Helen Lal ,,,,,,,,,,,, Bristol, Kenneth , ................ ........... 8 4B El Henman' - 0357 fl d V 'l .............. ....... B ristol, Gwendolyn ........ ........... 8 2A l Hatch, Virginia ............ ROW-lan . 1131 , , 83B I Howe, Irene -.....-'...,,-.,... Saville, June ......... 5 .............. ....... B r ltton, Julia .................. ........... 8 4B , Henman, Lowell .,,,,,,,, Schindler, M?,TlCWlll Brown, Lawience ........, ........... 8 2A 5 H' d kms Frances ,,...,,,,,, Schank, Sylvia ................. ....... B rookens, Retha ........ ........... 0 g ' h Katie . Bufford, Irma ............. ........... 8 2B l Huggett, Grace ................... Sc eiyvels ts k .............. Burke, Pauline WWSZB Hurd, Helen ,................................ .......... S cot , a IIC 1 ............... . C d H d Leone 82B Hurshburger, H. H .......... .......... S hackson, Marion ............. ....... a wa a er, -'------ ----------- A ?4 - ' ,,,,,, Shackson -Ramona .......... ....... C adwallader, Lena ........... ........... 8 34 Hutchinson, Phyllis ............. .... , C n Mar aret 82A Hunn, Homer ..,....,.................. Sharp, JESSE E ----------------- ------- C affaefo M liartha ------------------------ 83A m , Irwin Eva ......,........,.............. Skinner, Mary E ----------- ------- 9' I fir' rs' ' B l ' ' Sloan Hazel .................. Chellls, Gertrude ............ - ................ 81 Jepson, Marie ............. I , Ch . t nsen Gudrud 81A I Jensen, Erma ...-'--. Snfntlzl, Sherley ............ Clr11seAn ie .............,....... SIA i px Johnson, Eldon .,-,-.,,,,, Shivlie, Maude B .............. ....... V ar , n .......................... ........... E 9 l . 6 7, we ,,,.,i--,,.--,.-..,1 b il lPQ-Qi l '4' 7 u F 'l:1lfff'fA'J'A 'i'A'f T ' H F 'F 'WC V V' H-'ref H' ' Ov VCE? CRW rio 1-wig run 1nl'x1i1:l-ill SIZWZN ' A Q.,-in N,X,,,,Aff f if H 7 , , ,, L, 'W - Y i- x -V , ,, ,,,,,5aau' l 1 1 84 B 1B .-.V 81B ....,...83B , .....,, 81B ,.....,.81B ....,..83A ......84A .....,,81B ......83B ......81B ..,...84B ,.....82B ..,...83B .-...82B ....84A ....s3A ....81B ..,.83B ...81A ...84B ..83A ..82B 84A .81B .81B 82B 83A .84B .84B 82B 82A 83A 83A .82B .82A .82A .SZA ..82B ..81B ..83B ..84B ..84A ...8'4B ...83B ..83A ..81A ...83B ...81B ...83B ...81B ..83A ...84A ....84B ....81B ...82B ...,.82B 83A ....81B ...84A ...84A ....82B .....83B ....82B ....82A ....81A ......84A .,....83A ....82A ....,.83B Q x'- 1 3. 'Z 'i :. QQ if I .- - .1 4. Va- M ,n . .1- v ., Y J ' . 1 ., -z , 4- .Mx 11 :fri el A. QW. .f:y ' 'c,w',.. , X, . .K ' 1 'T 141 .-. -. .. ,Q - - ig. ,AQ - 1- ,J. .,.', ,N , ILA.. . , .4