Cedar Falls High School - Tiger Yearbook (Cedar Falls, IA)

Text from Pages 1 - 224 of the 1983 volume:

, , , ' ., .. , ,,. 'g -'.,b:La':-.,:f.-,., ,.. f I- 3!.g,.,:,,g. - ,qi7.a,,.... ..-- -f--- x:'.-: ' .-'M 1. .r -,.. 512' i ' Ha-: -' 1 4 -f- - V- '-My ff ---fvvzv rf,--1-:f -:- ,. V1 ,.. '.f.-gffz.,-1'. a W- . . 2-75:-,.....,. ,-. -Y,--. - , .,.,v .V , ,,, A ., A , ' 4- ' - ' 4 A '- 'rniiff '- ' - u'--I-' ff-'-wif-1' Y '--1-ff ze-.5-.-.,1w.?s'5. 'v:,: ' J.. ' ' , L . , ..-.,,:nL4,f1v7::1t,-A-Vasa. ,A . 5 - :T - f- . ., , ,. ., ...xg - V ,.-, -.-V -LY..-.-.nw ,Y -f - -f, . ,MA . ..L .1. . .1v.f.Y,.,,,..--. NT...--, ,T...K,,.w,.,--,Y-YV.-,V . . . . . ,, ,T , 5 L V P i , P 4 ' 11. f.,. I' 2 V I 'IV '. ff! 1 X If r X I , f ff W -JN I. xl I XXX 5- - -5,151 A ' f 6- V.-hawk . , z 3 ---23-ri Y, I if agua? 4 , Q W .2 in if '- 2 4 x - , 33. , 'iv N Q Wie? -1 a . ld 1 S Ex fb 9- '1 A , . K-, 52 , ,M ' -L, s ' Q 'S 4 , , , at W 1 , 1 1 ..- f OFFICE EDUCATION students enter the building, returning from a Held trip Lutheran Mutual Life in Waverly., We fir v e ,A f 'x ft , - ss t 3-. 1 ' ,r w .M ' A A , 1 nw , , ' ' ff:-4 ' , M. Trunnell ROCK ING OUT to lhcirfavorite tune are cheerleaders Lori Henry, Julie Aschoff and Michclle'lKrulI just before a varsity football game. av.. Y 4- 'T in , i,w1l.f.i1vJ'x.1.' I-Q43-F-5? f '3 fi: - IKM ll l ' x .am Q 'rf 3 B, Philips se'-nr-'+ve ' as N -I C 'O fix ,el ' - I ' , P, - A... N ' 3 ,gr T' L. ,, , '--ke'G151,,,, -'fi--w ,. - Y-'M -lezfv i 12. f it at -' 1 iT SI V. -W5'Lvegfgi,i+4-4 V - fs'-' ', v 934.-at 4153- 4211? :,2,:31'T-.x-- 7 '- ' ' -- ff' i 'yJ1H95' ' f ' 'tb A H T. Engels MODELINGVLHIS artistically colored Tiger costume. CliffpMohling chcem the Tigers to a victory over Davenport Central in the 44A playoffs, Trudging through the halls on the first day of school, students greeted familiar faces. i Stories of the summer were the main topic of discussion. The decline in enrollment of 78 students from the previous year's 1,379 was not obvious. This year's enrollment was 1,301. Although National Football League players were on strike for 58 days, there was no strike for the Tigers. i e The Tiger, football team came a long sway, posting a 10-1 -record, winning the Big Eight championship, and becoming state runnersup. While the Tigers were winning, so were the University of Iowa Hawk- eyes, who won the Peach Bowl in Atlanta, Ga. New Year's Eve. Dawn Lentsch won the girls' state cross-country championship for her second consecutive year, M B. Philips AFTER A ROUGH basketball practice Kim Jensen, Deb Svobodny and Mary Hesse entertain themselves by attempting to throw Ann Murray into the shower. 'We've Come a Long Way'f3 ...U .SY ' .K zrslfel' W . . 3' '.,,,-,. ..,, . , ,- un . t . W ...,,...,,. ,e.................. ' ' Ezzimsym... , , 5 ' ,,,,,,, ,M , glsgww ' ,, rt I: Lx . rt 'H-I 45 Lt r. 1 .---an-1 Q ziftiwfw Q fr 'iT'f1'f'L '13 M V-t Hw- fwmzffhqa Q , M. 'llnmnell K I I i T4 'fuxujemany W ROCKING QUT to a portable stereo are Michelle Murplzy and Kelly Stewart. SITTING BY their locker, Monique Paslzby and Kelly Rindles IGNORING L HELEN . KELLER lLiSa Wllitscttj in a dinner scene are Kate A. Keller fStephanie Carlsanj ' and 53Captai13 I-Keller CMark Nickelj during the fall pla y, The Miracle Worker. X 4 1 .', .5, i get some extra studying done. ' QT f, f A4 E. Wheeler K if-f -1-Q V V - -- A . - -Q - Ped! ,V-. -lv Ai 4j'We've Come a Long'Way' fi T. Engels ENJOYING A FUN-FILLED evening at the Homecoming dance at the UNI We've come a long way to a new decade of music. With rock and roll still number one, stereos were filled with a variety of new wave, punk, country and rap music. MTV was also popular. The UNI- Dome was rocked 0ctober 15 by the Who with a sell-out crowd, on the group's last American tour. Fleetwood Mae visted Cedar Falls 0ctober 25. Weekends were made for socializ- ing and relaxing. Popular weekend activities were cruising, going to movies and drive-ins, shopping and Commons are Stephanie Blonigan and Mike Spier. partying. nfifmf E, Wheeler X M, Thompson DR. E. C. VORLAND, a local chiropractor, puts Mike Flagg under hypnotic INVOLVED IN A ping pong tournament during gym class is Sheri Parker. suggestion during 3 presenzazion for psychology students. 'Wave Come a Leng Way'l5 i T. Engels PERFORMING AT the Homecoming dance is the popular band Dusk. Members of the band are, from left, Scott Stackhouse, Phil Woody and Rob Blech. Behind his drums is Jay Ahlman, Dusk also performed at several, other school dances, V V V 7' i .. 1 1 QQ 'r i if 1 0 ' ' r R wi 5 R-so yt W' A , 5 a ' , 1 ' ' Q - Ct' .V 'f ' 3 1- ' . , , P ,f it ' i lg. 7 ' V, - Zi E -v . fi 3 4' ' i N. xi 5 K Q 9, K V J X! XRFX k . f, ' 1, I 0 Q - A O Q - - NY ' ll, ' V - i Av a e 1 e N R 4 , V' be ' - .ig 3 at fx ' 5 D- Il - , fl , ' B A 'ff' T '1 V ,lf 1 ow D ' 3, , R ff Q, s Y VY A ,, D VN or V., .,M. V. H ' Y ON DECEMBER 31, University of Iowa Hawkeye fans cheer the Hawks on to a victory over Tennessee 28-22 in the Peach Bowl at Azlanta, Georgia. , SITTING IN the east hallway is Lisa Danielsen, faking time out to study. B. Philips 'ITS FOR YOU is the message portrayed by Susy Stoll working in Dn Les Huth s office, . University of Iowa V 5. . T. Tangemalr l 6f'Wc've Come a Long Way' X A fake bomb at the Washington Monument and a real bomb at Cedar Falls High School alarmed many. A .homemade time bomb exploded September 22 in the boys' restroom on the third floor, luckily with no injuries. The most popular movie oi' the year was, of course, E.T. People of all ages fell in love with the homely, I yet adorable extra- terrestrial. Ending the first semester with finals, students crammed before their tests. Sophomores were un- willingly confined to the school building while juniors and seniors used the free hours to study or socialize. l M ft? , Fifa X-X'- :fi lf 7 f!ft.5-- ' 1 f 2 u w - aS'a..e,1t9t I up in Q .I I t 'iijzsu L,-Q 1-jg gff f 1, J hefxizix jf, ,A L, g,+n.gQh f,.sg yr 'A j's+.L fififgifizafa lm5i'i -I ii W- 33 if :egg at ' ' lisa F t .,,,., ssssss 'H 1 V1 . --J F7 -' f f? fai a ff 7:25. ' l 5 - ,H - an rv , '- V' 1-'M' s . . fl L Q 4 -get I Wk. 1 ' X :Mila -pl- N m ,I 5 A 7 ' t ' f-: 'jff3 I A f . 'iw T MM ML. 5 'Buda am -'s --4 B, Philips KEVIN WELLMAN runs for cover as Shirley Godsey prepares for her attack. Snowballing became popular in mid-January because in the unusually mild winter there was no measurable snow until then. IN HIS OFFICE, teacher and coach Jerry Slykhuis prepares his lecture notes. 'Wc'vcC eaLogWyj7 i 1. 1 9 I , ai ' f i I i I l a E 1 i l , l -h. Q - -mu-'Q'-,.,r-f BA E. Wheeler DOING HIS chemistry and recording a concert is Russell Bowen. When the weekends came, we hung out at Burger King, Hardees, movies or school activities. Some of ns were working on jobs. We came a long way with astonishing performances by C our football team, which took second in state. and the basketball team, which was undefeated in the Big Eight g Conference. The cheerleaders were cheering their way to the slligh School Cheerleaders National Championships in Dallas, Texas where they y C placed third. .We had the opportunity to find career information at i w I I 4 1 1 I I 1 K I 1 I I M. Tnmnell i K EXPl0l'6 ,82. GOOFING OFF in the band room are Karl Kreb and Mark Olson. 1 i M, ,A AJY, -Ahhh ,hows wr ,Q .haw , . , 1 asia-- 1 uv ,,,.. .., -,., ,A ,,.. , ..- -- I C l W C I Long Way' J l ' x S S S ' S E-...-M..,,.-E,-Q--,,liTd-t,tEmwwfi ,---, --.. -, , g l Student l Life l t It 1 K I K , N W N 1 s f . gg 1 fn I N 5 it I' Ei ,s ,Qt l ' L a E gg E X l l il E 3 ,S 53 Y? 1 I ' I V y 's t 2 l ' I L 4 ' 4 We Q Y it ' E - l w ' ' Tl Q Q w z l l - if x i 3 x ' 1' nj . s fl M. Trunnell I M. Thompson E PUTTING A new lock on a stagecraft tool cabinet is Rick CEDAR FALLS High School football fans cheer on their team during ' 1 3 ' Seres, student assistant. a playoff game. ' ' 1 , it ll , , l Q r W ul , r W X X , U 1 ' lg Y 15, , g. ' X l 1? F 'I k l l f 1' T W 'Q l 1 l , 1 W W , N H t. n r ll f 3 N I w I M. Thompson T. Engels SALLY TROST and Ellen Simpson-gather RETURNING FROM the cheerleading contest in Nebraska are, standing, Stephanie 5 Snyder, Angie Liebbe, Shelli Winkey and Lori Henryg Kneeling, Linda Allard, Julie 1 career information on law enforcement at :Aschvff and Llenny Jordon, 5 E Explore '82. ' , ' 3 1 i 2 1 - - N, M ..- E T LWe've Came a Long Way'j9 T l t 5 5 5 . '1 . f g jh 4 ,X ff ' fy . N 1 4 , X , fist 61' L ,bkA K gl 70 X - , JL 3 C HBQI s 'ix ex. gg 'wiki 1. f. . . . -X .m,.t, .ah ,K 6, , ' ' ir , 31. yt Q55 ,Q i it r T T f if ta had W 'fig' , X 5 W N I filvjti ' '-'-t igNfBt'P,' .,- E.: I -jx., K g Q Fi-4-f ' ' Jr V IL,-1 J' Qi H it-law ,, W iw if wgxiivf Q The Tigers came a long way to produce the best Big Eight Conference record in school history, 6-l. After capturing the Big Eight Confer- ence title outright, the team moved into the post-season playoffs with confidence. The team was matched with Cedar Rapids Washington in the opening round of the playoffs. The Tigers had defeated the Warriors 7-2 in the season opener. Fired up by a red and black locker room filled with balloons, posters, candy and shaving cream and a parade through the halls during the school day, the Tigers showed determination and ability resulting in a 4l-6 victory over Washington in the UNI-Dome. This was the first time in Cedar Falls history that a football team a dvanced to the semifinals in state -,.. g 4 ik IC qw . ? l Q ,, g In .fi - Vlftiybg En t . -' I v , :V . , A .hqq 4 :I ' ug '--1-.N..,,miH W +. Sir ..,.,,,m YI! ' RUNNINGBACA L D BEAN lowers his head and cuts up Hel f , ' ,. . - - ' , Central Davenport in the post-season seniinnal game, The semifinal contest was destined to be tough, pitting the number-two-ranked Tigers against unbeaten number-one-ranked Davenport Central. The crowd's enthusiastic support could be heard outside the Dome as the Tigers upset the highly-touted Blue Devils. CF held Davenport Central scoreless and handed the team its only loss of the season, 28-0. The Tigers' berth in the state cham- pionship game set Cedar Falls on fire. Congratulations, support and encour- agement came from every segment of the community - from business and -service organizations to elementary school students. A Thursday afternoon pep rally exemplified the community's support as a huge crowd filled the Parkade, despite rain. Red and black fans filled the UNI- Dome one final time Nov. 12 to watch their Tigers battle Sioux City Heelan for the state title. Taylor Pine's punt return for a touchdown and Dave Conrads' PAT in the first minute of the game thrilled CF fans, but these were the last points the 1982 Tigers would put on the UNI-Dome scoreboard. Heelan went on to win the contest, 21-7. The championship game was followed by a recognition assembly in the UNI-Dome for the football team. Playoff activities ended with a dance in the gym following the recognition assembly. Players and coaches were honored at an all-school assembly at school on Monday morning. - Lisa Ver Mulm s .4,vS45, N svxnl Q if X: Q lg gn 45 0 wma lik ,f f, If 1:04 x H . Noonan GETTING a break today is Chris Lilly, enjoying a leisurely lunch at McDona1d's. l2fPlnccs to Go wwe C .',, f,' I Q4 N fx! Qu Wu? . 'Q A 1, N kr J'- lg K1 A w A' ! Xl: IL i Prfp H. Noonan LEN DUNCAN checks out the iron-on transfers in the Mark-It in College Square. r E-Q - 0'lv..1,f . ,. 2'?r H. Noonan MUNCHING CHICKEN McNuggets and sipping shakes are Kermit Harless and Brian McCullough. I xii, I..- -4' ,V,f' H. Noonan MALEIA THOMPSON takes an energy break from her studies in the journalism room, her favorite school-time hangout. f N ff' ! W H. Noonan Looking at the current centerl'o1d, Jill Lehman and Becky Whee. I I 1 'er get the giggles. Places I0 Gofll M. Thompson ' M. Thompson SA MPLING SOME cheesfrys, Rod Ca vin relaxes and watches thc action TR YING T0 BEA T the odds, .loan Franke and Beth Foley try to loss rings onto bottle on the midway for awhile, The annual fair is u celebration in junk food necks. Cattle Congress provides plenty of ways to spend money and try to win prizes --M from Tom Thumb donuts lu curmcl corn tu cotton eandv. such as stuffed animals. . ' ' l l4fCnttIe Congress NCC OffBl'S f00do fllI1 and H0165 National Cattle Congress i982 mixed a crowd of 220.000 fpeople with cows. clowns. carnies and kids. Rides and concerts entertained good- sized crowds during the annual eight-day run in September. According to Lyndall Graff, NCC director. the concert by country singer Willie Nelson drew almost l4.000 fans. Q Other big attractions were the Barbara Mandrel! show and the Gatlin Brothers. Only. about 1,500 attended the Boxcar Willie concert, Graff said. Q Abby l-Iagarty said she spent two hours ' x l 1 i i i . l PEERING INTO an animal cage in the poultry building, Maleia Thompson admires an angora rabbit, one of thc NCC displays. Mt Thompson DISPLA YING HIS Tiber Marching Show Band l-shirt, John Gogola ,tries his luck on the midway. Eitioying u day oil' from school. the band, pompon girls and Hag corps gave two NCC shows on Monday. going on all the rides and she thought that the music fest was the most fun of all. Joe Porter worked at all of the concerts. He said all of the concerts were enjoyable except Boxcar Willie's. Joe said he earned 370, but he spent S50 in the NCC arcade. Shelli Bakker thought that Willie Nelson was good and that the best rides were the Zipper, the Snowplow and the Tilt- a-Whirl. ln six hours she said she spent t about 515. p Dipak Patel said he spent S15 in three hours. went on one carnival ride and atc a Wheeler M. Thompson ONLOOKERS MARVEL at the antics of Diane Sund, Diane Clow and Carolyn Madsen. The trio tours the grounds aller performing with the- band .at the NCC. lot. Most students visited the NCC on Friday, which is traditionally Kids' Day and a day off from school. Although it rained, people still found ways to enjoy themselves without the cooperation of the sun. The marching band. pompon squad and flag corps gave two shows on the NCC grounds on Monday and enjoyed a day at the lair. it r Cattle Congress 1982 was a successful events for everyone involved, with the possible B exception of Boxcar Willie. i v N it p C -- Chuck Bradford Cattle Congreulli 4? YY ,Z JA CENTER manager Kurt McDonald discusses the advantages of being involved in JA with Kelli Klammer and James Estess. CHOOSING records for the J.A. dance are Teri Jorgensen and Jean Johnson. J VV ,f ,,VV i ,',y V4 ,L f . A un, isasi Q h' i fiTf'iJunio r Achievemexitf,isfifiifllegiirriijgfglgi5,5355g5Qg5I?herv2fccnij5ahies were governed by' an i l l-1, Safer 'oii the Executive Award and lbusinessby Two representatives ai,IAffSChoI9grSl1i1jat the endfof-the-year 'ffRi5lS?f3lY'iPT6Bf3m1 G0mPanyfRepfe-vi baf1quer,nSenfor,iAngie Mikkelsen-won an Mehilivemeni Ofc wi. p1an JAi awardffasffisigeefipresildenfsefrmarkezing,and of if fl fllil 1, , e llll,v l veSinibr?51K6l1iEF59Kl?!Ii11i1CrlfWaSi flamed PF29 f??2ii3Qi2Wii1Ti5'fhCTlfhC1P'0f1 l5P13Uf1edl lefilllfelifiiidbhle l r is 'l ., T i Obfliiilie ligafmij was outstand- Osilfedifllffkifwfi igliiiiffifeari-iiii Safer i 1 l n me ??W?55ff'fPV?5'dC'??7 iiandl lhglped me vlle -Ciiek i i r l i ir in l6lOrgnni1suons Bonner l M. Bonner WITH ANTICIPATION Terry Daniel and Christy Bess wait for their names to be called during the annual Junior Achievement banquet held at the close of the school year. li! T il ix I 'hxai ,FL . . ,,-,. A-wi xt X X , K ' M, Bonner SHOWING-TEACH OTHER their awards are Sue Syhlman, Andy Hosicr and Laura FrischQ Students in JA received their awards at the annual banquet, Organ11auonsfl7 T. Engels PROUD SMILES beam as the seven-member squad of football Aschofti Stephanie Snyder, Jenny Jordan, Shelli Winkey, Angie cheerleaders surround their trophy. Kneeling are Lori Henry, Julie Liebbe and Linda Allard. Chanting We are the Tigers, a 6 ea d S group of seven cheerleaders shouted and performed their way to a third place in national competition in Dallas, Texas. Q The girls used new routines choreo- ta K I graphed for them by Julie Aschoff. Their i routines had to be performed to chants and to music. To qualify for the national competi- I n tion, the girls won first place in regional competition in Lincoln, Nebraska. The squad included Linda Allard, . . Julie Aschoff, Lori Henry, Jenny Jordan, p I Angie Liebbe, Stephanie Snyder and Shelli Winkey. The trip cost S200 a person. The girls held several fund raisers throughout the year. They sold Brown Bottle tickets athletic programs and shakers. Pompon squad members held a dance and gave all proceeds to the cheerleaders, l8fChu rleaden Ti r l 3. ,gi , f .5 T. Engels IN A PYRAMID formation are, top, Shelli Winkey, Jenny Jordan, Julie Aschofh bottom, Stephanie Snyder, Angie Liebbe, Lori Henryg front, Linda Allard. 1, .H s A .L. 1-'fit L A T. Engels DEMONSTRATING ONE of the routines they used in the Dallas competition are Shelli Winlcey, Jenny Jordan, Stephanie Snyder, Angie Liebbe, Linda Allard, Julie Aschoff and Lori Henry. paying for gas for the trip to Dallas. The girls spent four months preparing for the competition. They won S250 in cheerleading supplies and a trophy. Because of the time the girls invested in practices and fund raisers, the supplies were split between squad members. At nationals 22 other schools competed in the same division with the CFHS girls. Team scores were based on motions, spirit, voice, creativity and jump expertise. The seven-girl squad consisted of members of the football cheerleading squad who had the time and interest to devote to preparing for the regional and national contests. The squad was sponsored by atten- dance clerk Gayle Bruene, who accompan- ied them to Lincoln and to Dallas. - Laura Frisch Cheerleaders! 19 BUYING A CANDY bar from Angie Mikkelsen is Roxanne Henry. Throughout the year, various groups sold candy, ranging from MkMs to Snickers to Cadburys. Calories, carnations, make S for eroun We ,. 1. i . af' f L. ' L.. , ' M, Tmnnell JILL LEHMAN ofthe Audio Visual Club sells a 1983 Men of CFHS calendar to Belva Weber. The original order of 300 calendars sold out within three days of its arrival. The A V Club fundraiser featured 12 male students and received statewide publicity. -wr' -,W A M. Tnmnell ORDERING HIS GRADUATION announcements is Andy Cook. OE coordinator Sue Hahn, right, and Judy Sater complete the paperwork for his order. To raise money for projects, groups sold X flowers, concessions, candy bars, fun kits, and M8cMs, according to Activities Director 1 Larry Munksgaard. 1 The most popular fundraiser every year is the junior class Valentine's Day carnationl sale. l Another major fundraiser was the concession stands. During the winter sports season, seven organizations ran concessions' stands - OE, DE, cheerleaders, pomponl girls, T and I, the senior class and the chessl and Ecology clubs. 5 On an average night, the organizationi could make from S150-200 selling conces- sions. 20j Fundraisers l s CHALKING UP another candy bar sale is O.E. student Laura Frisclz, selling to Steve Obadal. 1 Q, 1 'rm E . BETH PHILIPS sells items from the O.E. fun kits to Linda Allard. The sale of pop increased profits. Cheerleaders and pompon girls also held car washes in the summer to raise money. Raising substantial profits during the year were OE and DE classes. Office Education instructor Sue Hahn said, The fun kits brought in the most money and were the most popular, The fun kits contained 30 itemsg the O.E. students carried them around so prospective buyers could see what they were buying. Hahn said, This really promoted sales and we sold 56,600 worth. Candy bars were also popular items, with 120 cases sold. The profits from O.E. were used to help needy families and to pay for trip expenses. The crest in the gym was donated by the O.E. class. Designed by Peet art teacher Bill Close, the project cost 5700. Distributive Education classes sold M8LM's to raise money. D.E. sold about 51,500 worth of the colored candies, and sales seemed slower than the previous year's, D.E. instructor Gerald Klink said. I am thankful that students buy our products and we appreciate the participa- tion, he said. Candy is sold because it's easy and popular. C.F has not had to have as many fundraisers as other schools because of our good gate receipts, said Munksgaard. Fundraisersf2l A , V i l 1 , Q 4 I 1 , , T I E I 1' 3 P i Q. Q . C I 6 9 5 , s X 4 l I 1 n n v ? i i 4 Duo.- ,I 4 I 5 1 -4 v ,A gb, 'A A T. Engel? DISCUSSING A career in advertising at Explore 82 , are sophomores Beth Jorgense and Julie M umm. 115 O JA, Q. X154-X . ' K . -X T 1 ' 1 4,ySx,25fX,i5xX' 'will , 5 ,, f X f 'ggrXQvN ........w V K., 4 W Aix: i WA. ' , as :rn K ,l CEDAR FALLS students listen to elementary teacher Janet McClain speak on her own teaching career. zafaxplore e-sz lNG EXPLORE 82'2 Mike Molla takes a rest so he can look over material he has received from the many different career stations he attended. 'Nu wa T. Engels CHECKING ON career availability in sales is sophomore Jeff Sorensen. The CISI computer that was available to students at Explore 82 helped students lind careers that had their interests in mind. Explore -'szvzs Edu? , QA 'iff V Y' If ROCKING OUT at one of the school dances in the Commons are Cliff' Mohling and Lora Hughson. S gs M L .Ni so 'K SEQ f-ig 5 gg. if is K-if . 'g..,, o ' flf.-Yin: ' ' ,- if wif? as S. Ripplinger ENJOYING A night of cards at a New YeAar's Eve costume party are Russ Bowen and Maleia Thompson. ce to thin to do eopl to s 26fFriday Nights S. Ripplinger SPENDING A night at an arcade, Lisa Mclnroy places second on the game Galaxia. THE CROWD rises to its feet in the UNI-Dome, one of the best spots to End most Cedar Falls students during the football season. T. -Engels TAKING A break from a dance at the Commons are Shelli Lovell, Sarah Shields and Steve Jensen. FRIDAY NIGHTS It's finally here - Friday night, the time everyone looks forward to all week. You can tell it's Friday by many signs. At 3 p.m. school was just getting out and you could see everyone hurry out of the building to cars or buses. You could see gas stations with 10 cars at every stall waiting to get gas. From 4 to 6 everything was quiet since everyone was eating and getting ready to go out. About 7 you could see your friends again. Many things were available to do on Friday nights - going to arcades, movies, cruising University, attending all-city dances, working or partying. Friday nights were filled with interesting times and people. Some of the best places to meet people were University Avenue, all-city dances and parties. ' These places were always packed with people from other schools and towns. On University you could meet people from different schools and become friends with many of them. Cars changed from Mom and Dad type cars to the souped-up car of today. Going out on Friday night is a good way to release anxiety, said Carlton Stansbury. I go out, but nowhere special. I just like to get out, said Chuck Bradford. Kelli Danner said, I usually have to work. Marlene Kampman said, I usually save my Friday nights for my boyfriend. Asked how she usually spent Friday nights Kelly Berry said, With the gang. - Laura Frisch Friday Nigh!.lf27 Q A! v J 3 1 Q i l x + J . 1 gh' 5 Y ,K 1 ' ! K x 1 4 I i I ll W E E , N.. I-Wr,,,..,E,,4 , n , ' 1 'f' i A Q,,QS,s,,Q,Q. n I 5 5 H I W l it 2 1 l W I I W i N Q ' S, Ripplmgcf V PLAYING THE drums for Euphoria Il's version of Baracuda is Joel Walter, I who played for the group during the Variety Show. - ' Activities whirled by in a suc- cessful year. The Miracle Worker and You Can't Take It With You ll 3 drew large audiences. A snow storm knocked out electricity throughout t the city shortly before the curtain time for You Can't Take It With 3 You. The Variety Show and Jazz fi Show were also successful. Homecoming came in a flurry of 1 color. 0riginal dress-up days were changed to make the week more l ' interesting. Sadie Hawkins aroused 1 r the same enthusiasm throughout 1 the student body. The year was A . topped off with the excitement of i Prom and the anticipation of graduation. T ' M. mm..u 5 ' Plinger SHOWING HOW light on his feet an angel is, Brian r 1 Pedersen plays a game of basketball in gym class on Sadie Hawkins Day. 1 .,.,n.,r. so W H -,gg.,,,.. anim 1 1 A A L S. Ripplinghr , L - I LL I STANDING ON them football field with ber grandfather is queen candidate Lori Cgfzerney, a mexfzber of tb5A cjzieenis court. Actl ltle 'L I Q 1 Y L -tt 1 J' 4:41 i,':.A:. W ' pi-,M I ae' 2 fi-2. 5 W' M,-I I ? 4, . :J ,U I '? .- ,-v Mi? n -Eg s, I 1 -' 5 . 'I Wt A g-HL uQ'5'rL' 'Lf-:Fi 3 I H ' i 1' .: 1 PCM., -o f + 'ta g , 'F ts , wus! 'ft 5 I: CV. L ' X I 1 -:Qld 1 4--+' nj, Lg L D' ' s n'-5 ' gf? tt l -, m7 L 'u tdxfjc ,WJ ,M 00 92 5 I 1 . I t t L LL t b f! 1 x t Q . M A .Vkk. L K L fu' b M K V L L L L, V ,Fitz X L LL i K , K V V W: l L L L L L LL L i Y' ' - f t t t t L L L L L L 11 ,,,L,, K :...k- I K K g, LL ' Y WW4- K ir U I K - H4 -L - -I ' ' A f ff 'T '12, ' , , L L' V 4 L b ' ' ', V N ' ' ' A ' f N L -Activitiesl3l UE EUIBIE BUEUIBIE Most people agreed that the school year was a very successful year for pep rallies. Principal Les Huth said, They were excellent and highly spirited because of competitive yells and cheers. They were basically brief and to the point. He also said There is always room for improvement, and they have been considerably better than in the past. Sophomore football coach Harry Anderson said, They were very good, well organized and well constructed. Thanks to the people who planned them. There should be more. Assistant football and wrestling coach Gene Doyle agreed, saying, They were very successful having good support from students and good student participation. Many felt that the Homecoming assembly was the best assembly of the year. Kelly Berry said, I like the Homecoming the best because it lasted the longest, and it gave the queens the recognition they deserved. Jill Abels agreed, saying, I liked the Homecoming the best because it showed the most spirit, and it was nice to have a change of emcees. Kris Thorson said, I liked the Homecoming assembly the best because it was the longest. It was fun because of the different emcees. Their dumb jokes, the questions, and the responses of the girls were funny. Most people felt that pep rallies do boost spirit. azfrep Anemblid ,,..'f5f '. .M M . Q. , it M. Trunnell IN AN ASSEMBLK cheerleaders demonstrate the routine for which they won third place at national championships in Dallas, Texas. From left, Shelli Winkey, Jenni Jordan, Stephanie Snyder, Angie Liebbe, Linda Allard, Julie Aschofff Lori Henry. l 1 7-ft! 1531 I f ffflf' l . 1, 'f at f A rwm , , K J , ' 1, Q, V .11 rerrf V- M. Tnmnell JUNIOR CHEERLEADER Lori Henry shows her school spirit in a cheerleader-pompon girl routine in the school gym. if 5, LLW, k , ' Q gig. - ex ' , '55 , ' X , 's '32 ' f , 4 - , W - I DURING A WINTER pep assembly, Dave Conrads and Mary Hesse pass an orange between them. MICHELLE PFALZGRAF gets a face full of Hour with Sandy Spray at an assembly. A pan of water was placed between them, and they were told to blow the ball from one side to the other. But when they 4 were blindfolded, the water containers were replaced with pans Iilled with Hour. T. Engels L Y :Lx . . K 1' as J f H ff is VH? ' I it Z . ' iv as I in 'I 4 X Af M. Tnmnell THE SOPHOMORE section rises out of its seats to show their enthusiasm at an assembly. M. Tnmnell Pep Assemblies!!! 34 'T WEEE QUE ft? Erif With a Student Forum-chosen theme, Up Where We Belong, Homecoming week featured new dress-up days. Forum members chose pajama, nerd and punk themes for dress-up days while keeping traditional dress-up and spirit days on the week's schedule. Student participation and enthu- siasm were high, although some teachers suggested that the new costume activities infringed on Sadie Hawkins. In another change from previous Homecoming activities, Forum members organized a single all-school assembly to choose the Homecoming queen from a field of five senior girls nominated by their classmates. The single assembly in the gym replaced three separate class assemblies. Some students and teachers later complained that the 45-minute assembly was too long and that some material was in questionable taste. Queen Karen Davis was crowned at an all-school assembly Thursday morning. She and .leff Mundt sang the Homecoming theme song. Friday's Homecoming parade featured clear, sunny skies. The queen rode along the parade route in a chauffeur-driven limousine. The Tigers defeated Mason City, 28-6, in the Homecoming game Friday night. Dusk, a local band including seniors Phil Woody and .lay Ahlman, played for Saturday's Homecoming dance in the UNI Commons. M. Trunnell ENJOYING A RIDE in a limousine, Homecoming queen Karen Davis and her escort, .lim-Darrow, appear in the Homecoming parade. filomeooming S. sfxmrf ! - 4 ' - RIDING ON THE BACK of an I8-wheeler, members of the football team participate in t the Homecoming parade on the Parkade. i . -. ' ., 1 .'...c -,X . th, . re A 3- m , S iq'-ny. A MW H Q i A . :tw rf MCH, . ra - .- x ' 5 xy..- EYE OF THE TIGER, the seniors' winning lloat entry, moves along the parade route. i Class members won the S25 cash prize with their entry. Mike Grieger and Barb Boorom portray l a Tiger and a Mason City Mohawk on the float. ' 3 i n l i l - 1 M. Trunncf ESCOR TED BY BRAD LYBBER71 Stephanie Snyder, a member of the queens court, rides l along the parade route in a convertible. i 1 l I l l L- 1 adgotu gat. , was Lallin Photography MEMBERS OF THE 1982 Homecoming court are, from lelt, Barb Larkin, Stephanie Snyder, Mae Guillermo, Lori Cherney ' and queen Karen Davis. ., . E .. if if .'r ft! ' f Lx, . S- . I -g ' ' . . , il . S. Ripplingen GA THERING IN THE STADIUM, students await the start of the torchlzght at Holmes Junior High School and featured pep band, cheerleaders and member pep rally. The Thursday night rally was preceded by a snake dance beginning of the football team. t ' 7 aw-+ ' i-N --4-' ' A A . .1 .P .ft . ' i ,Ni-fgjj, italian-S H'3'454't5' S' ' V -'L' F-m,:.:1LJJ Rise' J K w w , r TU J A . .2 ff L ? Wlwvs ,.. - 3 I' 1 'X i .. t A it 7551+ 6' ., 2 21259 fa . E i . s E ff Q ' ' K 331, y . 1 ,-., V , , 'rygi ' ' ,- Z , 1 ., - 2 gt ' , t. f .t 1 Q M . Q 1 s Q fl. 5 4' ' 7 . . Z? .Q 1 x 1 '53, P t 'Q gal X V n v' dj: - lf' 'fa l ., - . 4 i T 'i V ref - 3 L , , f-t ' V 1 1' tx f - X ki It 'F' 2 1 pt 5 . p gg , , sm.1s, if H l'tQf4Q...tt . li' , K V' M' Tm 4' ,JM N-15' 't...1.:' is V 5 5, '51 ' ' ' - . ' 7 --1' ' H A i'f?fT?' 4 Vi 1 5 .. A . bfi f' 2 -,,,, p . . ' 1 . 'gt 1 S. Ripplinger S. Ripplinger M. Trunnell 1 l98l HOMECOMING ESCORT .IIM DARROW congratulates Karen Davis as candidates and MODELING TIGER , QUEEN .lill Stemmerman escorts applaud the announcement of the l982 Homecoming queens name stripes and a CF emblem, Cliff Mohling displays body speaks to students at the at the Thursday Coronation assembly in thc gym. Q coronation assembly. paint for Spirit Day. Homecoming!! 'ERFORMING DURING halftime, Andrea Hopkins wirls her flag with the Tiger Marching Show Band. PRACTICING THE Homecoming theme song, Up Where We Belong, before the coronation assembly are pianist Mary Hesse and Karen Davis. Jeff Mundt and Davis sang a duet at the assembly. --fl-as Q, S Ri lin er THEERLEADERS BARB Hansen and Angie Liebbe open up the corsages presented to cheerleaders bg' the ootball team. The cheerleaders wore the flowers at the Homecoming game in the UNI-Dome, 6 f Homecoming 'ta TIGER FOOTBALL team member Taylor Pine pins Homecoming corsage on cheerleader Lmtha Davenporz sweater. . px! 6 P S. Ripplinger DR UM MAJORETTE Karen Anderson leads the Tiger, Marching Show Band down the Parkade in the Homecoming parade. v-bww.. ww LUMBER C0 S. Ripphnger TIGER JOE BEAN mows down Mohawk Mark Rolinger on the junior class Hoax, S. Ripplinger ESCOR TED BY HER FATHER, Homecoming queen Karen Davis appears at the Homecoming game. FIEUEHTW WELZYZ7 IUUEIUEUEIUF WEDUEEEUUULUE Homecoming week was filled with all sorts of interesting school activities. There was something for almost everyone. The first indication that the week was different was when students roamed the halls Monday showing off their favorite pajamas. On Tuesday the difference was even more evident with the election assembly. The assembly featured a talking computer and lots of embarassing questions for the five nominees. Exchange students Anne Pelzer and Amaia Betelu-Bazo were honorary queens. School spirit was emphasized at the Thursday night snake dance and torch and pep rally. The snake dance started at Holmes Junior High and wound its way to George Hauser Field and the awaiting torches, pep band, coaches and team members. The firey pep rally included music, cheers and speeches by coaches and players. Friday night was the object of all the excitement. The Tigers bowled over Mason City, 28-6. The dance Saturday at the UNI Commons ended the terrific week. Both students and alumni were present to celebrate the previous nightis victory. - Scott Ripplinger Homecoming! 3 7 J EEEFUELU EEEEW IZUUZFLZY LFEEWEIE To express friendship, love or any other feeling they chose, students bought colored carnations for Valentine's Day. The junior class sponsored the carnation sale, and supervisor Bud Nichols said, The flowers sold very well. In fact we ran outf' Nichols said that they ordered and sold 1,200 carnations. Many students enjoyed receiving the flowers and seemed to have a good time giving them, too. Dawn Burke said, I really enjoyed seeing everyone happy. People really seemed like they were having a good time. The flowers were sold for a 31.50 each. Lynn Manley said, I thought the flowers were worth the price. My friends really seemed to enjoy them. Four colors of flowers were offered, each with a different meaning - red, I love youg pink, crush, white, friendship, and blue, anything goes. Students picked the color of their choice, filled out a card with their personal message, and dropped cards off in a box in the guidance office. On February 14, carnations were delivered during first, second and third hours. Saleswoman Marlene Kampman said, It was very successful and a lot of fun. I really enjoyed it. - Karen Budensiek 38 1 Valentines DAWN NIIIM samples a Valentine? Day cupaake made by Scott Ripplinger. T. Engels PRESENTING A red carnation to Spanish teacher Kay Wells is Steve Davis. T. Engels RHONDA MCCULLOCH sorts through her carnations and valentine messages. BALANCING A box full ofcarna tions is Jim Darrow, who helped with the Hower sale and delivery fleftj. Marlene Kampman, center, and Monica Stettler, right, present carnations to Becky Beener lbelowj. T. Engels T. Engels ft, T, Engels 1 MONICA STETTLER presents valentine Howers and cards to Kim Ritter. Valentineaf39 M. Tnmnell CHUCK CHRISTENSEN and Monica Stettler two step their wa y through the final dance. Pl l'L L A ' a ' : 'L , Y if . wif' 'lil P 'gud - Nr JFK 40fDanocs M. Trunnell ENJOYMENT WAS found everywhere at the three extra dances. M. Tnmnell DA WN LENTSCH shows off her stuff while dancing at the last school dance ', gxemq . pw 5? LORI CHERNEY, Kurt Jensen and Gretchen Gogel take a break after dancing. F1567 011732 ULUL? 121017071147 E707 High school dances became a regular happening during the year. Besides the four traditional school-sponsored dances, three extra dances were held. The first of the three was held Friday, November 12, following the football championship game between Cedar Falls and Sioux City Heelan. The dance was held in honor of the football team. The second dance, held February 4, was sponsored by the pompon squad. The pompon squad held the dance to help raise money for the cheerleaders who were going to Dallas to compete. The final of the three dances was held Friday, May 13. It was an end-of-the-year social occasion. All three dances were held in the high school gym and the band Dusk played for each. Lisa Mclnroy said that she really enjoyed the three dances and that they were a nice change from the other dances because they weren't so formal. Darlys Schluetter was impressed with the band Dusk and thought they really played great music. Terry Mohling said it was fun because almost everybody was single and you could dance with whomever you wanted. Lori Tucker said, The dances were a lot of fun. It was neat to have casual dances in the gym. Whitney Lindell said she really liked the last of the three dances and thought it was a good idea to have a dance at the end of the year. - Beth Philips Dnneesjll iw' W Q, , -4 WI., ' . Q 1 'S' K xy X X X Ox V' .mlm A 'K X51 1,253 PF' i .5 df Nw.. ,' 1 94. K fy 1' .K Xa B. Engels THE HAND is quicker than the eye, as illusionist Todd Engels demonstrates. SOLOIS T MIKE Bonner sings Somewhere Down the Road. x ' . 1 A X f , f .X muy .vm ' l l .if f . 5 it ' if i any t Ulf w M ' A LISA LAUGHLIN sings When He Shines. 61715 UF? IZYEW 1350173152 QZLZYEZEQQ LEU UEQ 5117515 The annual Variety Show entertained the largest crowd ever with its mixture of music, magic, puppets, bands and dance. In order to make the show, acts had to try out for the staff sponsors, Merle Picht and Charles Koch. Every act that was put in the show had to have three qualities, variety, audience appeal and talent, said Picht. Some new things were added to this year's show to add to the variety. Five Guys Named Moe was a two-story puppet number with six puppeteers, each running a puppet that sang and played a musical instrument. The newly formed men's chorus, dressed in jeans, tee-shirts and sailor hats, performed two colorful songs. A 4 X 16 foot sign with 160 flashing lights and the name Variety in black letters shined over the show. Its chasing effect was created by sophomore Brian Young. Other acts included the Jazz Band, Jazz Singers, a magician, soloists, duets, piano solos, bands, a violin solo, Pompon Seniors and other dance numbers. Senior Jeff Mundt, one of the three emcees, said that The show was a lot of work, but it was worth the effort. It was probably the high point of my high school career. - Mark Trunnell NORM, A puppet created by Mark Trunnell, performs Five Guys Named Moe with other creations from Puppet Theatre. Variety Show 143 Silk' ,f 44 67 ft tr I 5 A if 6 A f ,ju HOLDING HER new doll, Helen fLisa Whitsettj sits eventually prompt her first word, wah-wah. HELEN CLINGS to her mother IStephanic Carlsonj after a fit of jealousy toward her baby sister. 441 'The Miracle Worker' X Er-4 ,Q if A VVMWY, mn cr x y l f'1f:I'fi wff gg f t 1 f 7' Wwjwisjw gt' , V X , 4 fi V xx , I f Q Q:',' The Braille representation of The Miracle Worker. LJ ANNIE 'S YOUNG friends lKevin Koch, Laurel Whitsett, Lindsey Kem, Shana Tedlie and Samia NUimj say good-bye as she gets ready to leave for her new job. LU 'LV L'il3'LV5 'U EU UEUIE IUI13tU'UUIEIIl I've always wanted to do this show and this year I had the people to do it, said Charles Koch, speech and English teacher who directed the fall play, The Miracle Worker. The play, written by William Gibson, is the story of Helen Keller and her teacher, Annie Sullivan. Doing this show presented many problems including obtaining 1880 period properties and costumes and synchronizing sound, lighting and the actors' movements. The biggest challenge, according to Koch, was bringing it all together to get a unified effect. One of the strangest things about doing The Miracle Worker was realistically portraying a blind, deaf and mute girl. Lisa Whitsett, who played the role of Helen Keller, studied up on Keller and her many frustrations. Whitsett also wore a blindfold during many rehearsals to help her get the feel of the set so that her movements would be realistic. The production of The Miracle Worker was considered a success by everyone involved, Koch said. After the opening night performance, the audience showed its appreciation with a spontaneous ovation. This appreciation was echoed by the excellent review in the Waterloo Courier. However, the most important success was the feeling of pride felt by all of the students involved, Koch said. The show utilized a surrealistic set which represented six different locations. The highlight of the set was the pump which pumped real water. The opening night crowd was so impressed by the pump that they applauded the first time a character used it. Even though the production was overshadowed by football playoffs the same weekend, the students involved felt a great deal of accomplishment and pride in the show. As Whitsett put it, I had a great time. 'The Miracle Worker'f45 i .ya WE A K W' ,A M , 3 F -V 2 cf ' 'J' 1 . KE , 34 ,W - M, 3, 2 X W B 'QQ' aw wah. zlled with home at the skull th W ,g. fi ,g??:,w 1 ...re l YZ 3 1 4 ' I . A 1 I f J' , il its 1 W, NW 191 1 1 I I K A DR UNKEN actress, Gay Wellington fHeidi Noonan J, wraps her boa around Mr. Kirbyis neck during his first visit to the Sycamore house. IIPQP T l C. Koch DONALD UOE BEAN 1 SMILES at his girlfriend Rheba as she offers him a Love Dream, a homemade candy that Essie made. E. Wheeler AUL SYCAMORE Ueff Mundtj uses his erector set to rest his pad as he plays a word ame. Also playing are Essie and Ed I Chris Brad! and Ben Kiefferj. WIEUIUIE WILCUW IfI5fii'LVI3I.iiI35 fiiliilsli IEUJEU The spring play, You Can't Take It With You, is a classic comedy in American theatre, said director Charles Koch. The comedy set in the late 1930s featured the Sycamores, a zany family with interests in everything - from performing ballet to playing the Xylophone to writing plays to keeping snakes as pets and even making fireworks in the basement. The one normal member of the family, Alice, was the only one who had any real contact with the outside world. She worked in a large firm and fell in love with the boss's son. Their relationship brought the high society Kirby family to the Sycamore home. This little get-together end up with a bang as the entire houseful of people was put under arrest. The bizarre story ended with a happy ending with the two families decided that their differences weren't really important, and the young couple went back to planning their wedding. Koch said that he chose this play for its good-sized cast involving many people. The production gave a chance for many newcomers to be in a play. It was the right play at the right time for many students interested in acting, according to Koch. The play did present some problems in production. The size of the cast, 19 actors, made it difficult to keep track of the people. The large number of people also required a large number of costumes. The nature of the Sycamore family made the list of props for the production long and bizarre with a xylophone, a small printing press and a snake solarium being some of the most interesting. Koch termed the show a success, and cast, crews and audience were well satisfied with the end result. - Lisa Mclnroy 'You Can't Take It With You'f47 li, A 1 Q -. ? Af ,3.f' 4sfAv Trip if f 2, 4',f J, TRYING TO figure out how to lire a Civil War cannon is Dawn NUim, who stopped off for sightseeing during the Bayou cruise. efahggw ,gl A V . H-lf' 'WI' Lf L , ,F 1, y 9 1 in ,tl A V, ' 1. V , L v 5 MEMBERS OF the AV Club from top are Ryan Love, .lim Lehman, Dawn Nyim, Dave Pagel, Lori Lohman, Malcia Thompson, Scott Ripplinger, Betsy Wheeler and Becky Wheeler. QW EE E 'WEEE WGN IEIEUQW 'SIP To get away from the Iowa winter and to escape to warmer temperatures, members of the Audio Visual Club headed for New Orleans during spring break. The club left on its annual photo excursion at l a.m. March 15. Club members raised money for the trip by producing and selling the Men of CF calendar, selling concessions at basketball games and taking and selling dance and commencement photos. Members flew south for a four-day break. While in New Orleans, club members saw the Superdome, toured the French Quarter, took a cruise on the Mississippi, went to a flea market and took a carriage ride through the French Quarter. Chaperones for the trip were AV Club sponsor Dave Bullers and his wife Alice. Club members who had contributed the most time and effort to club projects throughout the school year were chosen to make the trip. The students experienced many different cultures and had a chance to try a variety of foods not available in Iowa. They saw street musicians in Jackson Square, street vendors, the river front and various shops specializing in voo-doo supplies, punk rock attire and, of course, souvenirs. The nights were spent walking around the French Quarter and on Bourbon Street. One highlight of the trip was exposure to Dixieland jazz at Preservation Hall. The students traveled in groups of three toward the end of their trip to do some souvenir shopping and to explore things on their own. The trip ended with an early departure from the 68-degree weather of New Orleans Friday, March 18. Arriving in St. Louis the group caught a flight to snowy Minneapolis and drove home. - Scott Ripplinger AV 'rripf49 bf DLVZWULU U UEVDUE IEE QUE LZ? LULZ7 QE 6767172 67151250873 EW 1 Hagge, Michelle Baker and Lori Young. DISGUISED AS the Three Musketeers are seniors Kerrie I... 1' ' -an N - M. Thompson M. Thompson ENTHUSED AT the afternoon assembly on Sadie Hawkins Day are Debbie McDonald, Kim ENTERING THE school in their Sadie Hawkins outfits are Mashek, Mindy Sharp and Lisa Westcott, The king was elected after the assembly. Andy Cook, Dave Jenkins and Steve Lang. . U There was never a dull moment while walking down the halls or sitting in class on Sadie Hawkins Day. Between classes, the original, funny and creative costumes set the mood for a constant uproar in the halls. Students and faculty were amazed by the continually wonderful ideas used for costumes. The 1983 Sadie Hawkins King candidates were Jim Darrow, Steve 1 ,..' ,l ' ' Davis, Mike Llewellyn, Scott Treiber and Mike Flagg. Flagg was named 9 'X E king at the traditional girls-ask-guys dance. Proof provided the music E 3 and the theme song was All Night Long. ' - Kris Spande DRESSED AS Andy, Dawn Sands pulls Raggedy Ann fCindy Gaedej in her wagon. 50fSadie Hawkins 1 ,V -Q3-qv' G M. Thompson DRESSED AS an elegant lady is French teacher Lucille Walter, sitting at her desk. M. Thompwn M. Tnmnell Y -x 1 I V . ,,.-4 - M. Tmnnell LOOKING WISE is English teacher Erik Melberg. 4 HJ . ,f M. Tunnell WALKING TO their classes are seniors Jill Pitsenbarger and Carol Crowe. M. Tnmnell DUMPING PUDDING from a ladder during the assembly is Lisa Petersen fabove, Ieftl. TAKING BALLOTS for king candidates are Wendy Anderson and Monica Stettler Ileftj. GETTING THE crowd enthused are Amy Wilson, Laurie Witzel and Heidi Topliff fabovej. Sadie Hawkins I 51 M. Tnmnell SHOWING enthusiasm in class are Karen Anderson, Anne Pelzer, Dawn Lentsch and Trish Kirkpatrick. M. Tnmnell SHOWING THEIR talents in singing are king candidates Mike Llewellyn and Scott Treiber. DEBBIE BROWN, as one of the escorts, observes the skits. 52lSadie Hawkins an 8.2 SADIE HA WKINS king candidates, from left, Jim Darrow, Scott Treiber, Mike Llewellyn, Steve Davis and Mike Flagg. Mike Flagg was crowned king at the annual girls-ask-guys dance. Wy.. , M TALKING TO friends before class is GETTING THE crowd enthused at the X Laurel Whitsett. assembly are emcees Lisa Danielsen and W Linda Lambert. M, Trunnell CONGRATULA TING King Mike Flagg after his coronation is John Tamisiea Cabovc leftj. AS A MEMBER of the jug band, Barb Hansen watches the assembly Kabovej. TAKING IT lightly, Steve Davis has pudding on his face frightj. HAVING A GOOD time at the dance are Mike Bonner and Lori Titus flower rightj. we we SHOWING HIS opinion of school lunches is Bryan Blonigan lleftj. WALKING TO class, Steve Hill is a Green Beret, and Trip Kilander is a bumble bee. EHQVLULU 'L4L7LClLZ7l:7 ULZYE A Sadie Hnvkinlf 53 ip. TS,-Q vi Howard Jones. are Lori Ward and Sean Alexander. l D. Pagel THE APPRECIATI VE crowd takes advantage of a slow dance as the band plays in the background. D. Page! D. Pagel D. Pagel DA VE GONZALES, a member of the group Prootf plays his A STARR Y-eyed Linda Sadler looks into the eyes of her date Kraig Kramer as they ignore other guitar during a song. The group played to a very appreciative couples and soak up a little bit of romance. group of juniors and seniors and their dates. 54 fPrum X N 1 t I YI l r D. Pagcl D. Pagel ENJOYING a fast dance are Rukku Rao and TAKING A break from the exciting evening 7-ll D. Pagel EVEN IN long dresses and tuxedos couples filled the dance floor during the fast dances as well as the slow dances. D. Pagel DANCING IN a world of their own are Andy Witt and Lori Mickey. In the background a few other couples enjoy the romance too. Prom theme is romance The lights are dim and through the flickering candle light you see long pastel gowns and classy tuxedos floating across the floor as the scent of roses fills the air. On the floor the moonlight is casting shadows of the people standing near the windows. This is the most romantic night of your high school years. Hawaiian decorations tranformed the UNI Commons into A Night in Paradise April 23. The theme song, Just You and I, set the theme of romance for the evening. Prom night brought out the best of everybody as the guys became gentlemen by opening doors for their dates. The girls became ladies by watching their manners and not spilling anything on themselves or their dates. Some of the more popular places to dine before prom were Dillon's, Brinkley's Landing, Broom Factory and The Colony Club. After prom there was a variety of things for people to do. For example prom goers got together with friends and went out for breakfast. There was extra time for couples just have some time alone, to get into something comfortable and perhaps even to go bowling. D. Page! BOOGEYING to the beat of the Proof Alex Azar-Perez, a student from Mexico, creates a dance step of his own. - Laura Frisch - Lisa Mclnroy D. Pagel Pfsmfss FILLING IN the rhythmic background, Joel I Walter keeps the beat moving for Jazz Band. E. Wheeler ENDING THEIR portion of the show with Big Band Sing are Jazz Singers Kathy LOOKING FOR outlaws during South American Getaway are Karen Klinger, Julie Van Der Meer and Heidi Noonan. ln the second row are Jeff Junkins and Davis, Kermit Harless and Julie Van Der Meer. Kermit Harlessg in the last row are Jeff Klepfer and Mike Bonner, H li A H 4 'rt st I 11, U ffatf f l ., - I M ,i,, A t M ' 6 . v I , 9' sz ? dw ,J W ,A ct: 5 'V H394-' . f f if if JAZZ BAND - Back row, from left, Jeff Purk, Jim Stein, Mary Hesse, Kent Bailey, Greg Staut, Angie Mikkelseng front Hugh Eicke, Dale Lewis, Kerry LaCoste, Joel Walter, Satoru row, Tony Staut, Lisa Niedert, Mitch Goetz, Eileen Malm, Baba, middle row, Kurt Schreiber, Terry Durbin, Neil Lewis, Brian Hunck, Rick Seres and Russell Boten. 5611111 Show I 1 I I 1 T E. Wheeler PLA YING THE lead in Something For Shelley, exchange student Satoru Ba ba demonstrates his skill with the electric guitar. i . Tapper JAZZ SINGERS -- Back row, from left, Mike Bonner, Julie Van Der Meer, Jeff Mundt, Karen Davis, Jeff Klepferg middle row, Chris Sorensen, Kathy Klinger, Kim Moe, Kerry LaCoste, Jeff Junkins, Heidi Noonan, Mark Meier, Joel Walter, Neil Lewis, front row, Kendra Koupal, Lisa Laughlin, Jayne Plantan, Scott Ripplinger, Kermit Harless, Barb Hansen. WEEULUEEH LUIE UJI3 'FEW UDULUGJULUIE YFIEKUIE I After a year of practices, performances and contests, Blood, Sweat and Jazz XIV propelled itself through two exciting shows. Enthusiasm ran rampant among the participants of the show which clearly reflected the year of winning events. Kim Moe captured the mood of the event with her rendition of Five Hundred Miles Highv Other soloists were Mary Hesse, piano, and Jeff Mundt, vocal. The Blues Brothers band featured Mundt and Mark Nickel. The year was an exciting one for Jazz Band and Jazz Singers. The band won Division I honors rating at State contest. The saxophone section won outstanding achievement honors, and Satoru Baba, Kerry LaCoste and Eileen Malm won individual awards. Jazz Singers placed first at the Coe College Swing Choir Contest and second at the University of Wisconsin Swing Choir Contest in LaCrosse. The show proved that determination and hard work paid off. - Scott Ripplinger GETTING INTO the mood of her vocal solo, Kim Moe perlbrhzs her version of Five Hundred Miles High. Jnzz Shuwf57 6715? We 15367115 67 If DYFEIWDYUEY IEEE? Starting off a weekend of graduation festivities was the senior breakfast May 27 at Maucker Union. Seniors were provided with breakfast and entertainment by the Swami Brothers, seniors Jeff Mundt and Mark Nickel. The Copacabana was performed by seniors Jim Darrow, Mike Flagg, Steve Davis, Ken Kolthoff, Mike Llewellyn, John Tamisiea and Scott Treiber. After many graduation day open houses, seniors were treated to a graduation party sponsored by their parents. The party included a dance at Maucker Union with Tennyson providing the music for graduates and their guests. A meal at Hardee's in the Union followed the dance. Then it was on to bowling at Maple Lanes or Valley Park Lanes. Many unique bowling techniques were displayed at the two bowling alleys. When bowling ended at 4:30 Monday morning so did the weekend of planned activities for the seniors of 1983. Farewells could be heard everywhere as many exhausted seniors left for home. - Beth Philips RUSSELL BO WEN left, ponders his bowling score as Howard Jones and Anne Pelzer add strikes and spares. S. Ripplinger 58 f Senior breakfast I Party PIGGING OUT on his food and everybody elseis, Steve Davis enjoys the senior breakfast. SINGING A T the senior party at the Union are Jayne Plantan, Jeff Mundt, Julie Van Der Meer and Neil Lewis. PERFORMING AT the Union in front of hungry seniors Mark Nickel and Jeff Mundt on a comedy act. They were the featured entertainment at the senior breakfast 15 bf E .- ' in XV, ff' 51 1 r , . I 'ia-4, 1 L 1 Www .4 V Tf ff ' tg. fglmr , , '1, V 5' V 1 , ' ,-f x 1 . ', ' ffsg REM . ,5 N ', f' , 'ffrx A A N, ,av fri, ' . 'fri' .mf T. Engels LOOKING AT THEIR new diplomas are Tracey Odle and Jodi Nottger. The first thing all graduates seemed to do was to check their diplomas for authenticity, making sure all needed signatures were there. Swim , ., ,.. - ,, 'I I gf 5 T, ' f :'.' 5 , 1 ' -! ,fl ,K ,, I U1 I LP 4-E' .3 ' 'Q A 1- f ee- Ziff! li'--M , e' -r it' 1 A ' ??sf.: 1 rr f ,,. z My-F' ' , '. ., ' ' t,titt 1 'AFQQ' . A g--,.1g, 'if I M E... ..T.....tT.:..,,.,.i1 Q5 gi f.: l J 'r?:5CZ:ff .g. nj , 3 , 15- 'i 4 , 'gel ,, ,L E Q . .is - Q,gj'Q'j vw'g. m.i,..' fain ' j 4 f ..+-nn-1-.....-nun-cal ' I l I .rrr mf T 11325: , 4 - jg.:-Q. --,.'-.-.,vg,,-w- X X, r V I , .L ' ' . M.E,,,m'ww-w-I-i- I A-. I in A 12-.,:.t...,.,,,, --Q -- - -gfia-if ,,.,, ..'-.,. ?,iliML 4, ' . .haffifkl T. Eng LEADING THE PROCESSION of seniors down the steps ofthe UNI-Doi: are junior class officers Terry Mohling and Mark Rolinger. Senior class spons Lee Ver Mulm is at the left. s ' ,Y A ' 1 we i nf. w ,. V - ya qt 'KN-Sf.. lg 5. 'Y 'v 'xi' . 'Args - I. I-, RN Qjitqi ,il F -ln l1.'iwfu:jTfl I. t. If r -vt ,. ff , .1 .. . 2-fs ff... 231 cf-4-,Q ,K ..., 'ff . 4. J. .4 we, - H -'gel 'M I 15- If lu R.: - U, -N 1 1' ' -a V V, 2' Wx .Q 1- Jai f' 4 L.. ' -we 'aa 'ii' Q. me , 1+ H' My fa '31,-4 ' pct . jg, -7- . .af it ,U W,-1 .537 . -t, t . fm Q-19? -I ff. .. , ,WAP ,Q ., gp ir- iff -T V ' ' p . ' '11 Q 'ff We-gf 'f'1f4'f1 . .ff H. , .:n',f.1.ws,9.s1 Q . 'Fu :QU . '4 , L11 q,'g v ' 'Y if is 'TTA' in 'I K1 'V I ff- 'Xi t T' T' :QQ xx.:-1 days in tw wa. it on :Fw I3 Y ,aw L53 in -fv'f'+..L,.ff,, V - . in. 'H' t -r ,J ff. F 'E' 'F e Pwr' Nh Liwtti 3,9 ii is avi f 'lf Lfigi'7'e 'Q T3 ta. liege ' 4 M 'f 3 f 1' 'T , t - 'E .. I ff' .- '-.-' 9 . if S ' We FSI? 15' '5 S2 . 5 f 'T .4 ktllfjlf.-1.'.L.i5'. ...,Jl.QUL.In A fi tl. lk Tl If fs a gli 111 il Ulu T. Enge! PRESENTING THEMSELVES as graduates, 1983 seniors turn around to face the crowd which included their families and friends. A total I of 472 seniors graduated May 29. I ga 6 ,Y-Y--,---nn... V...- Df' -1 tt .,. ,,.Vw.Na, wwei' K s fggfvn 'F 'q 9 l'..',K' ' 'UU rv, Qu. ,yi - , Q tl, ., , i Q 1: f , , z ' ' 4 If M y . t . Q V . 4 ' R L i ' ' ' , . s .- n i 1 1 a 7 . I L , , - , 1 ' 4 A at 1 'V g U I , H' ' , A 1 , , ' ' 4: -. ' ' 5 9 U v 1 s k 5 . 5 Q Q r A Q a , . ' , 'A' - 5 a ,-,.-.4. - A . , . T. Engels ' REJOICING AT its new' freedom, the class -of 1983 throws graduation hats in the air. l J -J , y 5 'jc' 9 J A 'yiiiilkieia V' f-91 , i'!'..- ' -'ffl x i .fs--.g -'H '- ff-g .5 . '-rfr35-.'. '1 '-s.-- , ..'Vv'- 1 ' ., gag' 'D MN 'I wqqgi'-5. io' ..fJ 5A Ni' g 4' g'2'n94.,'-f'. ,d ,Q ' VA, X-, 4r,iv'Q-Xing HQ '-4,31 tw ., U -4, 1,5 uf-4 ' ' . 5 - 5 . Q,,'. 'QQv'x,, D-It-audi., f.'.I'4vvx,'- d 5 4.,,, g. 'avg' -N' up V , .,, , - ft I . N 45- D D ,srbp A 3841 -so--1 as - , ' .1wlanu.w.. ?b4f-4,5 p '04-ight, ' 'l -- ..x 5 hh4 .4 ! Qe'.lQ.,.wf5 'fsg... 1' ' V 4 I . T. Engels ENIORS .WATCH patiently as one of the last rows crosses the stage to receive diplomas. f 'HQ' vw Q o ' -- rev . 7 f l I sf N , fl' il ' Q3 ., -' f ,, - ,' 1 9 -lr 71 uf i 5 4 iii L It N . N h . A I ik' In lr ' , P' 'li , . . l I 1 D. A M qw. it f ' -Mp' V L V - 0 A -5 .f 3 1 :'3rr ,V . . lil. l D A j i r ' .fide ' , ' .Ti - gt . - - I. Engels IZQOUDL Y DISPLA YING their new diplomas are Rick Herman and Randy Herman. Mary Hesse d ,Bill Henning also smile about their accomplishments. A ' A any f 'MEL-55.15155 LUG! 'UKUUL4 As graduation day arrived, the UNI- Dome filled with a blur of red and white, as seniors arrived for commencement ceremonies. The Cedar Falls High School band and i orohestrastarted the ceremonies, by playing March Romaineu and 'lPomp and Circum- stance l during the processional. Seniors were led in by junior class officers Mark Rolinger and Teresa Mohling. Pastor Duane Houston led the invocation and the benediction during the ceremonies. Senior class member Carlton Stansbury gave the senior address, a speech entitled Will Today's Graduates Have a Different American Dream?,' 7 Thespeech outlined themany outlooks on life that graduating seniors had. Diplomas were presented to the class of 1983 by board of education president Joy Corning and board members Richard Vande Kieft and Tom Reisetter. Midway through the ceremony, the .audience was startled by a loud rumble - a downpour hitting the dome's fabric roof. Ceremonies ended with the presentation of the class of 1983 to the general public and seniors tossing their graduation caps. Following the ceremony, crying, handf shakingand hugging could be seen everywhere as class members said their final goodbyes to classmates of the Class of 1983. i R -- Beth Philips e l - I A T. Engels COMMENCEMENT SPEAKER Carlton Stansburyispeaks lo the group. A Graduation 16 I T, Engels ox N x O -1 u a. : E o : I 57 mi 'AV ASSOCIATE PRINCIPAL Dean Dreyer, left, and Principal Les Huth congratulate 1983 graduate Kandi Krullf Clutching their diplomas and waiting for the ceremony to end arc Jim Hein, Jeff Heckroth, Wendy Heath and Brettg Heath lbelowj. 3 L ,5 Q,1 .iQ1tw V , -- , -,,- .t Y .Q - .,V1 ,f,i, ,,.. , ,. tvffa-:f + af, 5 ft - , - VNV - A , - L - .aan V V- f -fafiff-,firff'H::1ifw i 1, 1 ' F3 -.ffrlff if-V --VA V V -V ., J Vw ' ' .V .. 4iip :ff' l7'7 pf: 'Q f1 4f ff Y Dag-. f W ' ff-X-fa -Jyf 1' f 1 1 . X 9-if -'W' f V ' ' V 1 1 ,M .wif V . if-Kf'a?f7?5ffi'T5' V - V '-Q w V V. - 5 'iw VV-Aa., fi., 'ig '57 Aga- ,mf - 5- ' I ' , ' ' I 5253239-1i:,uaV1.,, ,W:ggg'f?q2u3gws . , tkgrgyiiv , - ?iffif'V , xii-1,V'1:: . ' H, .V V P ,ENN - ' 1 .W V, 1,4-.:,1g: Z V wg .R-,3Tr,,. , . X1 VV ' . A P ,.,1'5 vijQ5,jgAL 1 ,, . 1 -. an ' ',',1fggip'f, .,r - ffffffliw VUL-5+'xf.wi Ip' rv' wif' QL' P f P' V V9- V TV ef' - 1 K U , U ., , . - in 4 M W1 V it K awww NA 7g 31, ,lf-Wg. .5 5.Vg'?5 ' 'V A t 1 'V' -: -SP' V -f V L V .-f V ia V . V . ,ft, V W -'Q .V. j I ' ff Q In , V ' 3-tr, .y fy, A t V Bb ., fi , I Q QV , W V Vw-.Q L a . Va - 4- V 'P ' .V V 'Q'-WV V A' -11V..1F V -V . V . 1a - f fi 1 7 Q , ,V . V1 W 5 ' - ' , A r x Q I ,W V' 1 fx V f .3?'-Thx, 1' 45: V Z V' X 5 l V V V . Z V K S , V N' - 1 wgvawffwmgfzffy 1 1' VJ 1 5'..sf4J,VA ' 'f ' ' K -X lffi- x V V V f V- VM - V I V V 4. V Wlggv - r ' L l i V in 1 V 1 V ,,..- V if ' ' 4 . Q V ,,- x - X x nk i. 'E V my p xxx, T A :VX I- X F. V 1 grant!! ' P' 1 ' 1 ' 4 U V' ,gf 1 V, ,Q , A 1 f L I V i I I J I E FWEVWE 'IFF ' IEEE? 4 V ' lv I f V-I n .fff i 'tm Q , M W, aagiy' E ,E ff E 'V if 1 f r QV? 5 ' i' aadpfw ' V ' ,a ,I 9 J - V , .f --5, Y iw 1 1 ,A 2,3 . ,, ' ' ' . - A ' 'I I gym 'ff '71, ' ,T s , - T f . X W ' H si Di lg 1 .5 V E, ' 551 . '. l ' l -4- as 55 , V: V my ' , l 3, . 1 , -VV , A -. , - ,K A , ,. V, Q L ,st - , W , N' . 5: s , ' Q 'V :' H . ar i N, 1 ' ' 41, Q! A E., jr, x i e , , U 1 T -seg. r V- .Q 35, . ku , 1 5 - gia.-Zwix. W' ' 7 1 LEE? 37-'ws' 'M lil-NN' ' 1iQw,iw3,l, S Y' - f' - M' 2' ' w tex :Q V- wtf-5. N A2 Pi- ,r . ,L A ig qs 1 wa HV' - 1, I ' J 11 - 2' era se 'ized f ' , H ' I I' Y N Wx 1 ' ?',Ql.'g21'3 if 4fa3?,,4Xut figuewi Ex g 5 Ne 3 ' 'W wfgq , ff-li. ' M' L ' f gg lv 'ff 1 W , X 55' , 1 ..-, - ,, I -- 3- Q. 3 W -' ,, M - .-'K Y rt , Y 'hy -' - mf- it-.X Jig, a F X , ., Y: 1 1 - ' I , f f' f 'Q-ff: 1,4 - - M1 xg ' we ying v :tim V Y J X t U V fl 1 ff' E. M! . ,, :V s ,.-. ' e K af A , ., .V g ' 3. , f l N ,-- A V I. ' . r W -:ag ,, ,J f . , 4 N .-,W , .,,-, .,,, , f.. ' . v v- ,wx , . , W '-, ' 7 ,N 'la ly, -Ma' ln, - ' 'Ta' -wa ' T. Engels T, Engels RECEIVING HIS diploma from board ul' MEMBERS OF the Class of 1983 await their Hnal dismissal ending IJ-year school careers. The from education president Joy Corning is Alex row of graduates-to-be await the presentation ol' diplomas fbelowl. Azar-Perez. V ?. ' . peg' 4 V V . f ' 1, Thi, 32.4334 ' Y, gf- F' e 4 f'S4Ff'tl '. ., ' V 4- T331-, Sli? , ' ' I ti1f Ye 1 ,ep ' :Q v J X in filf is-.V-.- 1-,M 19, f. 1 gag AW J . . V mx L L 'a gg L' 'wi , a Q M, ' 1 6 it E Sepia 4' ' W.. . ,FF - 'X A .4 ,V -4 V, Wg, , as Graduationfbl , I I If fm., I I I I I I ,,, EI II II II I I I. I II Il I I III 1 I. , I I I- I III 1 .II ' III II, I II III III I Ii I II I H1 I I lx I, I I I f I - I I I I e I I I is Sports Ii ' M. Thompson SHELLIE GREENE congratulates Ann Cutsfortlz at a girls' cross country meet. 1 I' I e o .K A. V R' Chm GOING INTO the air fo? a high pass is Mike Hagg, knocking down iMason Cityis'f44.V Athletes had ffcome a long way to many victories. The s football team won the state runner-up title and the boys' basketball team took the Big Eight title outright. I e I Dawn Lentseh ewas the state girls' cross- country champ for the second consecutive year. g t I The boys' swim team sent seven swim- mers and one diver to state, while the girls sent four to state. ewrestlers Terry 0rth and Mike Lle- wellyn placed third at state. 1 Through hardework and determination, we came a long way. i I - Kris Spande I safspom Y f Q I f fills- f ' 4' ' T ,W 5 'M 5. l'gk,,m A 5 wx -. r l 2 of 1 R, Chase ' DURING THE basketball district playoffs on March 2, Dave Conrads dribbles under a Waverly-Shell Rock player to take control of the ball. ts ' R. cum MIKE LLE WELL YN struggles to pin his opponent: during a wrestling meet against East Waterloo. Q N' . .WM R. Chau FIGHTING FOR a loose ball after a rebound is Amy Huth. ' ' ',Sgqmf65 Lentsch wins 2nd state distance title Team effort of the entire girls, cross country team proved to be vital at every event. The girls worked together and became the one powerful unit that narrowly missed going to state by placing fifth in districts. According to Mary Hesse, Cross country isn't only a team sport. It is also an individual sport. It gives the competitor a chance to improve on her own, but since it is a team, everybody becomes friends? Wanda Bolte believed the success of the team had to deal with time and practice. We're really getting compe- titive and each year we seem to improve. Within a few years we hope to have one of the strongest teams aroundf' Dawn Lentsch, who went un- defeated two years in a row, felt that the reason her running time continued to improve every year was the team was very supportive. Their encour- agement really meant a lot. Kim Moe said, Cross country is really a different sport because everyone on the team is friendly with everyone else, and we're very close. It's a really neat experience. - Kerrie Hagge STATE CHAMPION Dawn Lentsch accepts her award from an Iowa high school official following the state meet. GIRLS' DISTANCE RUNNING VARSITY Waverly Invitational Sth of 12 Marshalltown Invitational ' 3rd of 7 Tiger Invitational 4th of 8 New Hampton Triangular 2nd of 3 Ccliimbus Invitational 4th of 4 Westflnvitational 2nd of 7 Central Invitational 2nd of 5 Newzi-iampton Invitational 3rd of 8 Big Eight ,, A 3rd of 6 Districts ' sm of 13 95,5 Jmvrorz vruesrirv I Central A j g. 3rd of 4 Q Tiger Invitational .,'i Znd of 7 I Cnlumbuslfltjvitational 3rd of 4 'wmmnvicatiohat lst of 7 Central Invitational ty lst of 4 New Hampton Invitational? Y Rnd of 4 66lGirlx' Crou Country ' AT THE TIGER Invitational in Cedar Falls, 0 t Dawn Lentsch charges past Sandy Havlick if from New Hampton. Lentsch finished first, t I and Havlick placed second in the girls' varsity. Lentsch finished with 24 consecutive wins. 1 Q, I ...A FN 1 is-.1-'fs I V-4 . A Q . 2 .v - , X X' In . 5' J i s ,Yi ,Q xiii Y' ' . . -, V tc 1, ,fi , 3, E, Wheeler AT THE WEST Invitational, the girls' JV runners are lleft to rightj Tracy Engel, Karen Anderson, E. Wheeler Cami Rolinger and Shelli Greene. The Tigers placed lst of 7th in the race held at Byrnes Park. GIRLS' CROSS COUNTRY TEAM - Back row, Coach Jane Asimus, Jane Doedcn, Judy Franke, Jill Orr, Missy WalUaspcr, Tammy Lentsch, Tracy Engel, Wanda Bolte, Cami Rolinger, Jenny Henderson, Ann Cutsforthg front row, Joan Franke, Mr. K Dawn Lentsch, Karen Anderson, Sue Hewett, Jean Dowell, Sarah Longnecker, Shelli Greene. Not pictured: Karen Anderson, Kim Moe, Mary Hesse, Michelle Hsher, Lynn Martin. ,f GRAHAM WOOD shows lots ol' determination while finishing the last leg of the two-mile Tiger Invitational. KURT SIMPSON, left, and Tony Yahnke battle in the Tiger Invitational in which the team placed fifth. BOYS' CROSS COUNTRY TEAM - Back row, Eric Handorll Tim Cutsforth, Mike Thomas, Al Vance Ewing, Jeff Brown, Chris Meyers, Kevin Corwin, John Gogolag front row, Chad Asleson, Bart Heins, Trip Kilandcr, Coach Rich Engelg middle row, Huff: Matt Engel, Graham Wood, Kerry LaCoste. Boys almost make state Winning its opening triangular against West and Central Waterloo, the boys cross country team went on to place fifth at districts in Waverly, missing state by one place. Beating West at their seventh meet was the highlight of the year because West went on and placed sixth in state, Coach Rich Engel said. The Big Eight Conference meet was also a good meet, the boys ran real well, said Engel. We placed fourth out of eight teams. Captains for the team were Jeff Brown and Eric Handorf, both of whom lettered. Other lettermen included seniors Mike Swyers, Kurt Simpson and Chris Meyersg juniors Trip Kilander, Tim Cutsforth, Kerry LaCoste and Mike Thomas and sophomores Graham Wood and Dave Nissen. - Jill Bach DAVE NISSEN and Mike Swyers push themselves while running in a junior varsity heat at the Tiger Invitational. BOYS' CROSS COUNTRY VARSITY , West Central Triangular Ist,pf'3 Charles City Invitational 3rd of 9 Mason City Invitational 3rd of 8 Marshalltown Invitational , 4th of 7. Tiger Invitational ifht Sth of 12 Columbiis'lihilitationiilgiggs 4th of 12 West InvitatigftaL.MWh lst of 5 Central Invitational 'Srd of 8 New Hampton Invitational mftltiof ll Big aight -Meet at, - 4th of s Districts fi W Sth of I6 'Qiwtiliiloig VARSITY West Centralffriangulai Qlrst of 3 Mason City Invitational V lst of 8 Marshalltownginvitational 2nd of 7 Tiger Il1Vit8!iQl'Ig.:i' l'i 2nd of L2. West Invitafiighaig Central Invitational New Hamptonffliivitational Qlstwof 5 8 I lit ofiglll Crou Countryj67 Girls volley for state Volleyball Coach Judy Samek, in her first year of coaching, said, We had fun as a team and I enjoyed coaching a good group. Samek said at the beginning of the season the Tigers did not play as a team but later they played more intelligently and listened to the coaches. The players also learned from watching their opponents in other matches, she said. Coach Samek said that the seniors were good leaders. Seniors were Kim Jensen, Carol Crowe, Angie Mikkelsen and Mary Gaffney, all of whom lettered. Next year, a powerful team is expected, with a lot of potential. Letter winners returning will be Lisa Mittelstadt, Sue Noack, Lori Ras- mussen, Michaela Sheehan, Jill Sprague and Dana Tonn. The varsity match record was 14 wins, 12 losses and 2 ties. The game record was 42-35. Team captain was Kim Jensen with Roxanne Henry as co-captain. Henry and Sprague were all Big Five first team, .Iensen was second team and Sheehan was named honorable mention. - Tami Jensen Kris Spande Another successful spike by Kim Jensen. ,Nffl-O'-' 0 fmnth 5- oo-' x dl-no 68lVolleybl1l y, f a Q . e ti if M ,J s .f gg. f 1 ef' IWQ' K K ' Y, is-1 ' 1-we ff 1' , . ,, . ,, f 4 .gh W , f .gg K W' , , A. .fu . ,z ., ? Mg , 3113.-j' -gy JT -1 ROXANNE HENRY and Lori Rasmussen knock down a shot by Don Bosco? Sharon Thoma during VOLLEYBALL TEAM - Back row, Coach Judy Samek, Amy Pfalzgralj Kristi Custer, Jill Sprague, Lisa Willhite, Dana Woodbury, Roxanne Henry, assistant coach Mary Mc Williams: third row, Rachel lweland, Dana Tonn, Michelle Wilmer, Lori Rasmussen, Sandi Peterson, Shelli Spooner: second Y' 1 l- A-H-ve' -P + Q , JS' M' mei' , 'wig an My .- ff '4t7'5Q's' L V Riwfiif 1 ff ' A F'T9,73i'? , ge , , L, X ' , ' Y X 'Jww Qjx c TA the first game. The Tigers eventually came on to win three out of the live matches. +94 Mr. K. row, Beth Pine, Lynell Smith, Michaela Sheehan, Susie Pardoe, Lori Tucker, Monica Stettlerg front row, Mary Gaffney, Angie Mikkelsen, Teresa Tangeman, Kim Jensen, Carol Crowe. Not pictured: Lisa Mittelstadt. was MAWN . , M- . THEIR territory are Dana Tonn and Michaela Sheehan facing Northern University High School opponent Jenny Dells. E. Wheeler 'EAMMATES LISA Mittelstadt and Lori Rasmussen congratulate each other REACHING HIGH to block a shot is 'uring a game time out. senior Mary Gaffney. Volleyballl59 Girls go 7-2 on year Ending the season with a 7-2 mark, coach Dick Marcussen said he was proud of his swimmers and divers. After losing the first two duals of the season, the girls came back to win their last seven. Marcussen said losing to West Waterloo was the most upsetting defeat. It wasn't the swimmers or divers that lost it. It was because I made a mistake with the 400 freestyle relay and we weren't used to the new scoring system. Beating Cedar Rapids Washing- ton 73-53 was the most thrilling victory, he said. We've never beaten them before and they've always been one of the top teams in the state. Tracy Young placed 12th in the 100 yard breaststroke at state, and Kristi Burkholder placed 19th in the 100 yard butterfly. Marcussen's special Dolphin Award went to Terry Mohling for her work as a team captain and for having the best time drop at districts. - Jill Bach JoAnne Bach IN A MEET against East Waterloo, sophomore Val Smith swims a 100 yard freestyle. Cedar Falls won the meet 92-19. GIRLS' SWIMMING CF OPPQIQIENTH' ' 52 Cedar Rapids Kennedy-, , 75 51 Westwazerloo rf: 55 68 fit SS 92 a.E-seg'-rffloa I liti -19. 66 Mlnwqw klg. 1 ,2 t ,GI . 73 Ceditj4f1lapid5'QQ?Vishnngwn 53 72 Fort Dodge ' N '54 68 Columbus K ' rV 53 , 142 A Columbus . , Central ' 7 If Conference meet A Zndi District meet I V Syd , Tiger Invitational, A Q: 55? iz if , ,.,' I A I - 70fGirls' Swimming roi SWIMMING THE FLY leg on the 200 medley is Young and Sandy Spray set a new school record in Kristi Burkholder. Burkholder, Amy Evenson, Tracy the event during the season and placed 14th at state. W4- . wif . Alf . .. ,,, ,, T - ' ?11'3fez.L, gr, f K , 1 , am -rtl f , ,. - . ff l a KZ in - ,.. ax. H' ,ji -fini R. Chase SANDY SPRAK named the swim team 's outstand- fly. She placed 10th in the 200 freestyle and 12th ing performer for the season, competes in the l00 in the 100 freestyle at state. 3 SWIM TEAM - Back row, Coach Dick Marcussen, Kim Craig, Michelle Baker, Sandy Spray, Karen Baxter, Lisa Paulson: third row, Bobbi Kono, Kristi Burkholder, JoAnne Bach, Lori Mickey, Tracy Young, Terri Hundley, Michelle Murphy, Sarah Mr. K Hewett, Terry Mohling: second row, Sheli Ross, Christine Krause, Laura Duncan, Kim Kintzel, Val Smith, first row, Christy Moyer, Yvette Rhoades, Amy Evenson, Linda Shaw. Not pictured: Toni Bean. R. Chase STEVE ERICKSON swims the 400 freestyle against Cedar Rapids Washington. He broke the school record in the 200 freestyle. 'li A.. BOYS SWIM TEAM - Back row, from left, Tom Bullers, Brad McCunniflQ Steve Erickson, Sean Abbas, Steve King, Cliff Mohling, Jeff Meyers, Scott Davis, Mike Bogatin, Brad Lybbertg third row, Ron Way, Kermit Harless, Dan VanDuyn, Tony Yanke, Marc Long, John Shephard, Allen Corwing second row, Kevin Jergens, Mike Niedert, Dan Harless, Chris Nanke, Curt Franklin, Bob Way, Chris Sorensen: front row, Don Lawson, John Wood, Curt Stansbury, Tom Moore, Jeff Purk. Improving throughout the season, the boys' swim team finished with a 7-2-1 record. The senior leadership and the togetherness of the team pulled us through many difficult meets, said Coach Dick Marcussen. The turning point of the season was the West Waterloo meet, he said. From that meet on, we continued to improve all the way to state. The team sent seven swimmers and one diver to state. Dropping three seconds off its time, the 200 medley relay placed 10th in state. The relay consisted of Sean Abbas, Marc Long, Mike Bogatin and Steve Erickson. The free relay of Cliff Mohling, Steve King, Brad McCunniff and Erickson also dropped three seconds and broke a school record, placing 14th at state. Jeff Meyers also broke a school record and placed 7th at state. The team placed 14th. The outlook for next year looks good, Marcussen said. With all the experienced swimmers coming back, Ild like to win the conference and place in the top 10 at state. Letterwinners included seniors Bogatin, Scott Davis, King, Brad Lybbert, Mohling and Meyers, juniors Abbas, Erickson, McCunniff, Jeff Purk and Don VanDuyng sophomores Curt Franklin, Chris Sorensen and Bob Way and freshmen Mike Niedert, Chris Nanke and Curt Stansbury. PERFORMING AN inward dive at a home meet at Holmes Junior High is Jeff Meyers, who set a school record in diving. A MA, Aur-Perez t f?Wwmf? WW'W'lNMlff,s.. if gr OPPONENT Charles City ,Q 68 Cf.R. Kennw TXJUHS r Q 4? g Central W 32 59 ' worry 66 67 str 60 81 ' East! 43 j 191, C. rs w shin lon 78 A E -n is L-Gills , ' A t , fl' a vital' V . ,L A ,U b ,..,N,,...a.,,.,., .f?'f..s.s--5, , V 'fi P, , ,W .9-e Swimmingf 7l fd , 'Z Y 4-di .fra X xt! 3' F- HEAD COACH Pat Mitchell and jubilant Tiger team members celebrate the teams Homecoming victory over Big Eight Conference rival Mason City. The team avenged their 1981 loss to the Mohawks. R. Chase TAYLOR PINE runs behind a solid wall of Tiger blockers in the 4-A championship game. Pines punt return was the Tigers' only score in the final game. vzfrombm E. Li 3, ,4 4 1 ...t I R. Chase MARK PETERSON rejoices after intercepting a Cedar Rapids Washington pass in the playoffs. MIKE FLAGG TOWERS over a Mason City defensive end as he attempts to grab a pass, R. Chase R. Chase L. D. BEAN and Nick Winkey react with enthusiasm after combining their efforts for the Tigers' fourth touchdown in the West game. The team won the contest 48-23. Tigers roll into 4-A playoffs Finishing 8-1 in the regular season, the Tiger football team captured the Big Eight Conference title outright. Ranked second in the state in preseason polls, the Tigers opened with a 7-2 victory over Cedar Rapids Washington. The Warriors, ranked sixth in the state, were unable to score on the Tiger defense and only reached the scoreboard with a safety. To highlight the Fort Dodge game, Dave Conrads kicked a 44-yard field goal, only one yard short of the school record. The Tigers won the contest, 10-0. After consecutive 28-0 victories over Central and East, the Tigers faced West Waterloo. Against West the Tiger defense was scored upon for the first time all season. But by capitalizing on several fumbles, the Tigers made a strong showing with a 48-23 win. Against Ames, adverse weather was the deciding factor, as the Tigers lost 3-0 in a downpour. With a scoreless game at halftime, the decision to continue was made. The constant rain made the playing field a mudbowl. The Tigers came back from their only regular season loss to defeat Marshalltown, 14-3. The Tiger revenge effort was successful as the team beat Mason City 28-6 in the Homecoming contest. The previous year, the Tigers had been edged out by the Mohawks and lost their shot at the playoffs. The team's final regular season game was a 42-18 win over Cedar Rapids Kennedy. Nick Winkey hit the 1,000-yard mark for total yards rushing on the season. - Lisa Ver Mulm 2 0 0 0 , 1 , , f ......,t-,t ,. ,K W f 2 -4 R. Chase NICEL Y POSITIONED in the end zone, Dave Conrads hauls in a touchdown pass in the Kennedy game. Fwtbuwn fi' S i Qi PQ K an 5 5 i F R. Chase L. D. BEAN and Nick Winkey share their excitement after combining their efforts to score R. Chase IN THE SECOND round of the state 4-A playoffs, Jeff Heckroth grabs the pass despite the defensive attempts of Davenport Central. another Tiger touchdown against West. Winkey led the team in rushing and Bun was second for the season. VARSITY FOOTBALL TEAM - Back row, from left, student coach Scott Eggleston, offensive line coach Don Erusha, defensive coordinator Mark ODonnell, head coach Pat Mitchell, Paul Dunbar, Dale Lewis, Mark Rolinger, Mike Poe, Bry Pierson, Chuck Bradford, Scott Rogers, linebacker coach Max Berryhill, assistant sophomore coach Dave Welter, sophomore coach Harry Anderson, fourth row, Tom Weires, Frank Lewis, Pat Doyle, Dan Christensen, Doug Clark, Chuck Christensen, Mark Egner, Bill Shinstine, Kevin Kelly, Andy Seichter, Rick Majerus, Troy Jacobsen, Sari Muammar, Greg Larson: third row, wrwmu Mr, K offensive coach Gene Doyle, Pat Phalen, Kevin Woodward, Robin Roberts, Mike Sash, Jeff Klepfer, Brett Walker, Doyle Hanson, Randy Kibbee, Jeff Nielsen, x Gary Minikus, Rick Marsh, Greg Weigel, Marty Elbert, Kurt Jensen, Mark Peterson, Mike Howard, Rick Herman, Ray Chan, Brian Walton, Jim Darrow, Mike Flagg, L.D. Bean, Rex Terry, Scott Smith, Todd Letny, Ken Kolthoft, Bruce James, Sean Alexander: front row, Scott Treiber, Dave Youngblut, Bob Bisbee, 4 John Tamisiea, Troy Stedman, Terry Orth, Taylor Pine, Scott Engen, Mike Llewellyn, Scott Davis, Jeff Heckroth, Greg Cowell, Dave Conrads. fi,'S9fi75'f2Tf57?'f?fflliffti' J M ., R. Chau: ELUDING DEFENDERS, runningback Nick Winkey dashes downfield. Winkey led the team in rushing 1 nd Bean was second for the season. i , , ,A ? +1-J 'A ' 4, . , 4 1' vi ,Q 6- M I 'A if' .,,' 'avi' QI' in -AJ, mf- . V .- I 's 'Qi 5 . , iv' ,A - J , , - ,I-Q.. . ' ' 594 -L . ' ,W .1 V 'A ' 3' 'fs ' ' , ,., l. ': :f r i J H' fi' 'J i A ,gl iff 1 K - i ' A will-iii I i, , L I .M F A u , lumix, g ., , Lp.. V: f' .Qi he ,Q x , .f 'LX' -f ,gf 'Q' 4 , rp' W l 8 VI F3 Q W L .V ,LII , . mtv, keg, Vw Vw - . t, fa i 4 f , r W, - .' ,, A 5 ' aw , H ,neg , ' .f f m ls ij' ,719 ' ', ' ti Q. Y ' , - 1 W' ,, 4. L, 1 , f e, L. l V- ' 1 , ' ,f W K - MLK ' SOPHOMORE FOOTBALL TEAM - Back row, from left, student coach Max Berryhill, student coach Dave Grifl7th, student coach Mike Griffith, Tom Ridder, David Hinz, Dan Mallin, Kurt Eichelberger, John Phalen, Doug Rippe, Kevin Orth, Steve Smalley, student coach Jim Efting, offensive coach Dave Welter, head coach Harry Anderson: fourth row, A. J. Davis, Doug Lawson, Tracy Swingen, Andy Hazen, Mike ' Molla, Doug Matthias, Larry Eastman, Tom Thode, Phil Clow, Brad Nichols, Kelly Kolthoff? third rowg Kurt McCunnif!Q Ty Schuler, Troy Graen, Dan VerSteeg, Bob Frohn, Greg Dietz, Kevin Champoux, Steve Collum, Bob Way, Mark Winter, Tom Settle, Mitch Goetz, Mike Jerkeg second row, manager Paul Woodward, Kurt Pedersen, Marc Long, Ross Juhl, Grant Wheeler, Dave Pardoe, David Jordan, Cam Robinson, Mark Bohr, Jim Janssen, Kerwin Brandt, Eddie Bennett, lirst row, Rob Mudd, Ron Pope, Lee Petersen, Matt Hundley, Craig Lowe, Kelly Grant, Mike Koepke, Troy Zimmerman, Sam Anderson, Joel Snell. Tigers win all-state team honors History was made in the fall of '82 as the Tiger football team compiled its best record ever. The Tigers, finishing with an 8-1 regular season mark, captured the Big Eight Conference title and had an unusually large number of individuals selected to honorary teams. Three seniors, Mike Flagg, Ken Kolthoff and Taylor Pine, were selected for the All-State first team. The All-State third team con- tained senior Terry Orth, and honor- able mention was given to seniors Scott Treiber and Nick Winkey. First team Big Eight players were Flagg, Kolthoff, Orth, Pine, senior Troy Stedman and Winkey. Seniors Sean Alexander, L. D. Bean, Ray Chan, Greg Cowell, Scott Engen and Kurt Jensen were chosen for Big Eight second team awards. Selected for Big Five honors were Cowell, Engen, Flagg, Kolthoff, Orth, senior Mark Peterson, Pine and Winkey. Alexander, Bean, Chan, senior Dennis Freeland, senior Rick Herman, Jensen, Stedman, senior John Tamisiea, Treiber and senior Dave Youngblut received honorable mention. Coach Pat Mitchell and his assistants, Gene Doyle, Don Erusha and Mark O'Donnell, were named Big Eight Coaches of the Year. At the team's banquet, juniors Rick Majerus and Andy Seichter were selected JV Players of the year. Herman was honored as a three-year letterman and Mitchell and senior Mike Llewellyn were named Comebacks of the Year. There are so many highlights in a season like this, but I'd have to say my favorite was the victory over Mason City, said Mitchell. - Lisa Ver Mulm Foctballf75 Beginning the year with no returning letterwinners, the girls' basketball team finished 3-16. Coach Bert Harris said, The girls did not have a successful season from a win-and-loss standpoint. However, they steadily improved throughout the campaign, he said. They benefited from the leader- ship of a group of dedicated seniors and developed a reservor of returning lettermen that will provide a sound basis for an improved program in the coming years, Harris said. Junior Amy Huth was named to the Big Eight second team and senior Mary Gaffney received honorable mention. Harris said, The well-played five-point loss to state tournament bound Columbus and the big victory over Waterloo Central to kick off the sectional tournaments were season highlights. He said, Scoring 81 points in the second round loss to a fine West team added to a memorable season. - Kerrie Hagge AS CAMI ROLINGER covers the Waverly- Shell Rock guard, Michaela Sheehan tries to make a long shot. l vafsumml l x l .4 E. wheeleip I I i meetings, L 1 E CAUGHT UP in the intensity of the game, Michaela Sheehan tries to rack up some points as she up against Central in an exciting game in the CFHS gymnasium. The Chargers and Tigers split in Q fL,v.3 c l l l 4 l i 7 w l 4 GIRLS' BASKETBALL TEAM-Back row, from left, Assistant Coach Judy Samek, Tami Jensen, Anne' Pelzer, Shelli Shogren, Judy Franke, Amy Huth, Kathy Klinger, Coach Bert Harrisp middle row, Amaial Betelu, Clarice Slick, Lori Buser, Michelle Wilmer, Michelle Murphy, Michaela Sheehan, Carol Doeden,3 Linda Sadler, front row, Debbie Svabodny, Kim Jensen, Penny Gardner, Ann Murray, Mary Hesse, Maryi Gaffney, Kandi Krull, Beth Philips. l l 3 I E. Wheeler Y - R. Chase AMES GETS control after a mad dash for the ball at the end of the second quarter of a Big Eight Conference game, From lelt, Ann Murray, Judy Franke and Michaela Sheehan fight it out with Ames players. 'iIRLS' SOPHOMORE TEAM-Back row, from left, Assistant Coach Julie Burger, Heidi Engen, Denise Urak, Jo Johnson, Mindy Sharp, Coach Craig Criswellg middle row, Ann Cutsforth, Michelle Fisher, Beth ingels, Dana Tonn, Jill Orr, Julie Fiddick, Mary Paulson, front row, Tasha Kneppe, Sally Trost, Lisa Vlittelstadt, Joan Franke, Cami Rolinger, Rachel Hanson, Melissa Ellis. BETH PHILIPS AND Deb Svobodny watch Kandi Krull search for someone to pass to in a game against Marshalltown fleftj. Krull tries to avoid Cami Rolingerls elbow as Rolinger steals the ball from Mason City in a home game fhelowj. R. Chase 4. x sa, Will!! than DURING AN exciting game against Waterloo Columbus, Dana Tonn has to jump to make the shot. Baskelballf77 Boys win Big 8 title outright Finishing the basketball season 19-2, Coach Jerry Slykhuis said the high points of the season were beating Fort Dodge there and defeating Marshalltown in the Round House. The Tigers became the second team in the history of the Big Eight Conference to finish undefeated in the league. The team was upset in the second game of the district meet by Waverly- Shell Rock, a team that went on to state for the second year in a row. The team set two team and three individual records for the season. The 19-2 overall record was a school record. The defensive average of 52.6 was also a new school mark. Individual records were set by Mike Flagg, most points in a season, 445, and most free throws in a season, 103, and by Andy Seichter, most assists in a season, 91. Five players received awards at the post-season banquet for their improvement during the season - Bruce James, Todd Olson, Mark Rolinger and Jeff Ubben. Letter winners were L. D. Bean, Dave Conrads, Flagg, Jeff Heckroth, James, Olson, Mark Peterson, Rolinger, Seichter, Troy Swallow and Ubben. TRYING TO GRAB the ball away from two Charles City players is senior Todd Olson. SECOND TEAM all-stater Mike Flagg puts a shot over the heads of West Waterloo players. H' 'ni x L2 Qt 5 A 1- dv. ' fQ....f tXX W, an-ww. V I H R. Chase IN THE FIRST half of the Cedar Falls-East game Jeff Heckroth drives toward the basket. JEFF UBBEN gets set to throw an inbounds pass to Mark Rolinger. R. Chase 1 2.1. 'L W' 'll 'li llWftifit 'f'?i' ' it ' I w54f2'm F, N f 'C V'PraiHE 'V ' as l 'ht rimzvnoage. Sl .ttyl I Waverly ' 49' . Central 1 ' if 45 Mt , Easy, , k 53 ,,, ,gg . . cniumsus 1 if l 60lt ttsvi Ames ss .t 66 West 58 43 Mason City 32., it 64 Marshalltown V0 61 59 . A Fm Dodge j 47 65 ' ' Central , 52 'rf Columbus 63 50 W' Q East tb ., 59 42 ttyl? Qimes f I gg 81 5 est t it gil'l l 74 J-viii. X 7 Minn City , ef ,57 O failllff fb Marshalltown' 59 ' eww l Districd R, ' '63 UW! ' Mason City. '49 63 Waverly? ' ' 1 1 266 gov 78fBoys Basketball l , BASKETBALL TEAM - Back row, from left, Coach Jerry Slykhuis, Scott Peterson, L. D. Bean, Mike Flagg, Todd Olson, Mark Rolinger, Mike Poe, Jeff Heckroth, Kevin Seichterg third row, .Iodee Jacobson, Barb Hansen, Michelle Krull, Lisa Danielsen, Linda Allard, Diane Madsen, second row, wil - N , at . f 4.3 I- ' , . . .uw s Mr Assistant coach Scott Eggleston, Leo Manahl, Mike Scarbrough, Brett Walker, Kyron Brimmer, Bruce James, Troy Jacobsen, Jon Conradig front row, Satoru Baba, Troy Swallow, Mark Peterson, Jeff Ubben, Andy Seichter, Dave Conrads, Paul Leahy. R. Chase XFI' ER DRIVING down the base line, L. D. Bean tries 1 turning layup under the basket during the game :gainst Mason City. R. Chase IN THE FIRST quarter against West Waterloo, Mark Rolinger gets in a shot under the arms of West player Kelly Nash. IOPHOMORE BASKETBALL TEAM - Back row, rom left, Brian Barron, Ed Bennett, Lee Peterson, Franz Wheeler, Jim Sadler, Jim Janssen, Graham Wood, Rob Mudd, Dan Bergeson, Coach Tom Sellersg niddle row, Coach Kent John, A. J. Davis, John Lynch, Mr. K Mike Koeppke, Karl Kreb, Mark Winter, Brad Nichols, Greg Tollefson, Coach Phil Steyer, front row, Mark Rappaport, Ty Schuler, Paul Woodward, Jim Anderson, Troy Graen, Ross Juhl. SOPHOMORE SCORES CF OPPONENT 54 Fort Dodge 32 Waverly 6l V' Central 44 M East 49 'S Columbus 57 K Ames 55 S Wcsl 31 , A Mason City i SQ, , Marshalltown I 1 A f Fon Dodge . X 2 Central 3 fl ' -L Columbnih 42 s' Amggi , 64 .. L Q..L4,9,. . 42 a ..,. Qlllifibklllbwn 73 43 66 60 60m A 1 6 .. 47 vo 66 as , so 66 61 79 51 41 so LR. Chase NEAR THE sidelines, senior Jeff Heckroth and senior Dave Conrads box in an Ames player. Boys Buketballf79 Lf,1 ' W . , A F OPPONENT l , 32 Columbus ' ff 61 Central 4 , 30 East A Q 'E 36 Ames ' , l7 24 vvesf ,ag is 30 30 Wa verly-SR ' 0 I 9 24 Mason City' 36 15 Charles City 29 I I Marshalltown 36 24 Fort Dodge 33 28 CR Jefferson 19 X sofwmning 185 POUND SENIOR Sean Alexander tries to unwrap his opponents hands. frightj 105-POUND WRESTLER junior Jeff Stych concentrates on pinning a West High School wrestler 1' 4 t1,, B. Wheeler We -.. Wrestling Team - Back row, left, Coach Rich Engel, Curt Diemer, Jim Ca yton, Les Penick, Keith Young, fifth row, Mike Smith, Tom Dickinson, Brad Wctoria, Shane Franklin, Troy Zars, Steve Rains, Rob Hamilton, John Thorsong fourth row, Craig Haan, Jeff Hartman, Eric Dowell, Brian Beenik, Todd Eastmann, Tim White, Bob Buhrmaster, Matt Engel, Darrick Dorn, Mike Bertholh third row, Bart Huff, Dave Pardoe, Jerry Ingham, Scot Handberg, Travis Hildebrandt, Pat Ala, Tim Ostendorf Doug Trueg, Dave Barton, second row, Paul Huffman, Mark Bohr, Jeff Stych, Kelly Grant, Doug Clark, Doug Mathias, Nick Miller, Mike Rains, Dave Jordan, Tad Ries, Mike Krammerg front row, Mike Ostendorf, Ilya Volfson, Mitch Goetz, Mike Llewellyn, Sean Alexander, Jeff Klepfer, Tyrone Sutherland, Pat Doyle, Troy Love, Tim Woods. Not pictured: Mike Doyle, Joe Ka tcher, Terry Orth, Stan Swingen, Paul Hagner, Steve Skiles, Ken Kolthofti Kelly Kolthofl, Mike Sash, Coach Gene Doyle. S 4 'is in R. cum 1 I HEA VYWEIGHT wrestler Terry Orth is on top of Cedar Rapids ABOUT TO PIN Tim Miller from East High School is Sean Alexander, I Jeffersonls Kevin Dochterman on his way to a victory. who wrestled at 185 pounds during the season. . Mmm., W5 R. Chile TRYING T0 manipulate his opponent on the mat for a future pin is Mike Llewellyn. At l67 pounds, Llewellyn went to state, where he placed third. Wrutlingfll Lisa Hilpipre goes to state With injuries and sickness hitting the girls' gymnastics team, the squad ended the season with a 6-4 record. I am quite happy with the season as a whole, said first year coach Jill Knox. Starting with a young team, the girls came a long way. Knox said the first meet against Ankeny brought high hopes for the rest of the season. Knox said freshman Lisa Hil- pipre and junior Jenny Betz were the team's top performers. s'Hilpipre with her dance experience and Betz with her coaching experience were very helpful to the team, said Knox. Freshman Dawn Knief was the most improved of the team, Knox said. Next year, I think the girls will work a lot harder, because they were real disappointed when it came to tournament time, said Knox. Betz and Hilpipre advanced to regionals at Hoover High School in Des Moines. Betz qualified in tumbling and Hilpipre in floor, beam, bars, tum- bling and all-around. Hilpipre then went on to state placing 10th in tumbling. Letter winners included seniors Kathy Bates, Mae Guillermo and Pauline Odekirkg juniors JoAnne Bach, Betz and Karla Meyerg so- phomores Christine Krause and Shelli Rossg freshmen Lisa Hilpipre, Knief and Jamie Patten. - JoAnne Bach LANDING AFTER her last vault is Christine Krause. J. Bunting . PAGE82 A ttt, . -1 . 1 2 A ttste 1 'SGYMNASTICSI cr OPPONENT ' 146.85 Anlreny 141.55 140.1 Mason City f 153.4 142.85 Ames 160.3 ' 151.35 Regis 61.9 148 Newton 104.05 ww 96.25 146.0 Marshalltown 163.9 141.55 cn wns11i1.gz.mfg. 91 143.3 CR Kennedy 127.25 Waverly-SR zu: K 1268 Z2lGymn.ul.ie1 Big Eight meet' 1411: District meet 5th Ssiggsa ,gags ' N. 9-3 5 1 sei an- ' H . J. Bunting DOING A SIDE scale on the beam during a home meet is Dawn Knieif as Coach Marv Dirks looks on. I Mr. K GIRLS GYMNASTICS TEAM-Back row, Kathy Bach, Pauline Odelcirk, Karla Meyerg second row, Bates, Coach Marv Dirks, Jamie Patten, Coach Jill Guillermo, Jenny Betz, Shelli Rossg front, Chrrstrn Knox, Dawn Knief third row, Lisa Hilpipre, JoAnne Krause. J . Bunting AS TEAM members look on, Clzristine Krause performs a layout somersault during l1er second EXECUTING A double-full off the vault in a home meet tumbling pass in a dual meet. The meet was with Cedar Rapids Kennedy. is Jenny Betz. S 96519, 1 ' ' 7 ., A X, I ff , We-4 'sa fig .4 ' 8 J Bunting J. Bunung . COMPLETING A HALF-ON lzandspring for her first va ult in a meet SHO WING HER flexibility during a meet against Cedar Rapids Kennedy is Mae Guillermo against West Waterloo is Karla Meyer. doing a back lzandspring. Gymnutiuf83 Johnson wins Tigers' meet The girls' tennis team finished the season with a 6-4 dual record. Coach Phyllis Ver Ploeg said she was very pleased with her team this year, but she looks for her returning lettermen to improve their play next year. The tennis team will have five returning lettermen for the 1984 season. Coach Ver Ploeg said that some of the team highlights this season were when Kathy Klinger and Gina Cervetti became consolation runners- up in the Big Eight meet, and Jo Johnson won the Tiger Invitational. Ver Ploeg was pleased with this year's season and said she is looking forward to next year. Varsity letterwinners included seniors Teresa Tangeman, Gayle Jasper and Sarah Teaford, juniors Klinger, Cervetti, Amy Huth and Lori Mickey and sophomore Johnson. - JoAnne Bach RETURNING THE ball from the courts baseline is senior Teresa Tangeman, woim' 'rmnu V, gy 5 'ff . fl, A A J' , 1. W I .IAV k,,,kK e'-'e 1 13:66 t W X4 1 t 3 A 'E 'K ,f , ,age 1, f H if My if if , 24 s 'hit 7 A TM rf, s e 'veg-fha.. . ,.e,w.. A .M , Mu, ,Q W in as imma . '- if it f , .Mtg yn , in JF ,W i , or - 1 J. Bunting VOLLEYING WITH a two-handed backhand is sophomore .lo Johnson. Johnson played the number-one seed throughout the year. Mr. K. GIRLS' TENNIS TEAM - Back row, from left, JoAnne Bach, Stephanie Olsen, Kim Kintzel, Kristi Custer, Claudia Kratzenstein, Sarah Teafordg front row, Gina Cervetti, Kathy Klinger, Teresa Tangeman, Amy Huth, Lori Mickey, Jo Johnson. -4 oval-'n5 LVA'b 'L'- VA '15'5Sf'f?W T'F'2ZS9Q- fl. Ql?1:Ef.1r5.iLL W 2 xi-lf'h T Ili! 1 x XJ A. Amr i, 5iff72h,p?f ., '41 C561 roe. A ' I ' ff e 1. of 7,11 1- A.Aur i A.Aur FTE VE HAL VERSON defeats Dick Lang, 6-l, 6-1, 'topj. Kevin Ahrenholz concentrates on serving. JA Y VAN VARK serves the ball to his opponent, Dean Sboner from Columbus. . Mr. K. BOYS' TENNIS TEAM - Back row, from left, Todd Richard, Darin Sanders, Ja y Van Vark, Tim Majerus, Benji Ball, Steve Halversong front row, Mitch Goetz, Kevin Ahrenholz, Stan Shollenbarger, Carl Andersen, Coach Chuck Frazier. With no returning lettermen from last year, the boys' tennis team had a dual record of 3 wins-8 losses. Coach Chuck Frazier said, We had a very young team. Out of the top six players, three were ninth graders. Highlights of the season were placing second in districts, qualifying the entire team for state team playoffs and qualifying the doubles team of Kevin Ahrenholz and Carl Andersen for the state tournament. He said, The outlook for next year looks good. Four out of the top six players will be returning. This year's team was close to having a winning record. The next three years Cedar Falls will have a strong tennis team. Letter winners included Satoru Baba, Steve Halverson, Jay Van Vark, Todd Richard, Ahrenholz, Andersen and Benji Ball. - JoAnne Bach HITTING THE ball during a home meet against Columbus is Todd Richard, A. Amr ' T ' - Bovs TENNIS,f'z1fg2lllf?'7'1' OPPONENT, , ,sms -jf gy Central , as 3 'wa . as tMarshalll.owni 'HG 9 NUHSWZQQ 0 l WGS! .. 8 2 Fort Dodge 7 3 East' 6 9 Grundy Center 0 I Columbus 8 Wahawk Invitational Sth Tiger Invitational ' 2nd Big Eight Meettifi 7th District if i 2nd reimufss Golfers field young team The girls' golf team overcame many obstacles during their 1983 season. The team was basically made up of younger girls, including only two seniors and four freshmen. Coach Jerry Slykhuis said it was a real asset to have Stephanie Snyder, a four-year letterwin- ner, on the team to help lead the way and to help the four underclassmen. Rain and poor weather were other obstacles for the team to overcome. Rain hindered both practices and meets. Six of the girls received varsity letters - seniors Stephanie Snyder and Lisa Laughlin and freshmen Kristi Trask, Mindi Doerr, Deanne Jirak and Amy Evenson. The girls finished their 1983 season with a l-7 dual meet record. - Beth Philips COMPETING IN a golf meet at Birdsall is senior Lisa Laughlin. .l. Bunting 1 we-fi. 5'- ., VDLK, 5 T A i in L ...tb 24S ta, - A' x SF 222 '1TT' ' W X Zllhl k z Tif t' 2 ' mein ss. E .. 3mif f.'5' e. .. j s. H is sei. gs m .isls I f I B6fGirl.l' Golf s alum ... s.... , . ...Nw DURING A GOLF meet at Pheasant ridge golf course, senior Stephanie Snyder gets set to hit the golf ball. GIRLS' GOLF TEAM - From left, Amy Evenson, Deanne Jirak,l Kristi Trask, Stephanie Snyder, Lisa Laughlin. Boys go 7-2 in golf duals The boys, golf team was faced with many ups and downs during the 1983 season. Coach Dick Marcussen replaced Pat Mitchell as coach for the 1983 season. The weather disrupted many of the boys' practices and meets. The first four golf meets were postponed due to rain with many other meets being hindered by the weather. Coach Marcussen felt one of the few downfalls of the season was that players had mental weaknesses, but he was pleased to see that his golfers worked on these weaknesses through- out the year. Twelve golfers received varsity letters. Golfers receiving letters were seniors Troy Creery, Scott Engen, Greg Miller, Tim Nedoba, John Sutula, Kevin Wellman and Dave Wileyg juniors Paul Leahy and Monte Meyer and freshmen Chris Runyan, Mike Thomas, and Doug Trueg. Coach Marcussen's overall feel- ing about the season was that he was happy with his team and he was glad to see that everyone gave his best effort. The team finished the season with a 6-2 dual record. - Beth Philips PREPARING TO drive the golf ball is freshman Chris Runyan. Mr. K. R. .f s. Bw my ttgwrfgwaf. ii 155 iss g h.a2'r3+ Miggljialltcwn Shtvsflx 310 sos ' 327 312 ,. 334 317 W Big Five pf., f . 5f2Zf1?5QfMirih5lltown weft , ,Q ' I sig Eigh1,.champiQQiuhip K Seetikfhils 1. , . , ,lfqpgf onyx. 7? l 2.1, ., 4 of , f Columbus was ll Len tsch wins 3 state titles Girls set six school track records, and Dawn Lentsch won three state championships. The Tigers won both triangulars in which they competed. They were also Big Five champions for the first time since the meet began. Seniors Mary Gaffney, Lentsch and Tracy Odle and sophomore Jill Sprague established new school records. Gaffney set her record in the discusg Lentsch in the 800, 1500 and 3000 meter runsg Odle in the 100 meter hurdles and Sprague in the high jump. Coach Bert Harris said, The Tigers return a fine group of 19 underclassmen for the 1984 cam- paign. The squad showed depth and improved steadily as the season progressedf' he said. With the influence of a fine group of new sophomores coming from the junior highs, the future for Cedar Falls track is bright. - Tami Jensen WANDA BOL TE strides toward the finish line in the 800 meter run, M. Tnmnell ' , :.. ,ew .. A lastest Sa fri El lst 2nd 4th Isl 3rd 61h 3rd meet Sth Sme meet Sth 88fGirll' Truck f Agere , 'M . lf--f.-A X I , wnfifehcw sz. - 'ag' 'eggyggnfigrl , . -nazi S 2 . We ' '4 Ak . 0 5 'li 1 'Q' If ' ' . , ' k w 0' 'vw lx .ut 3, A. X, ' 'K . J. ,xi K . ' ' . ' Wi' ' 'il' 4 i M. Trunnell FLYING THROUGH the air in the long jump is Lori Henry Cabovej. Kim Doty and Kim Jensen compete against each other in the 100-meter hurdles Irightj in a Tiger home meet. I . fl!l'...,, - F I... :,..,..ffi'1 ik 1- 51, 2' 'X ,WA I A - '. 'ift'..vff 1, JIUJX5 l I' ll .tells-:X I . i v '5 ' ' 5. y . V V '. ' 1 Jes i f,iF s ' X ' Q53 , 'us gk, e A' 'if I 'si' K . 4 M . ' J,,.,,, W K Q , . va . L2 -E , 1 5- 3 ,W -f A A ,V xi: ,.,,.,.s5.1ss1sv-S3579 .A .gg N . my X' .f ' A Arr .af v'635e-w ' 'N A Q I A M. Tnxnnell MICHELLE LAIPPLE hands off to Ann Cutsforth in the girls' Tiger Invitational. , l I - L U I 'ef I L J! 1. t jj we .. A , . . l',,t , T ff'Z '1 e wzmcsffsl ' ' uf' N t 4 NS .o qs-,Q ffi. 1 . 5 J- I ,...... - , .. ip.'. L If Swv, .. .. Mr. K GIRLS' TRACK TEAM - Back row, from left, Kim Doty, Shawn Slobe, Michelle Greene, Lynn Martin, .loan Franke, Lisa Mittelstadt, Jill Sprague, Cami Rolinger, Sue Noack, Ann Cutsforth, Michelle Laipple, Beth Engels, .Ioan Lawson, Michelle Hsher, middle row, Laurel Whitsett, Joni Minikus, Michaela Sheehan, Beth Foley, Lori Henry Tami Jensen, Wanda Bolte, Mindy Sharpg front row, Dawn Len tsch, Angie Milckelsen, Mary Gaffney, Kim Jensen, Carolyn Madsen, Tracy Odle. e --f vw CLEARING THE high jump bar is Christine Krause, competing ' in a home track meet. fl i T . A.- 1 . E. F44 sc e v 2 , ' e Q 9 wh- X Q ' 4 - .Q ,., '4 '99 J 5-. . f . gl ' I, J I L..L VV K fi iuflf of W' 5 w K 1 . - IIQJRM, . ..f . -. E Th Emitg-tQfJ..f,., A . - ' h ' ' K' ,f 4,3 ii 5 A ,N A I K A if A my A Q MANHQQ. f. -1 n ,sq .71 .Y Q , . V. . U aff.. ,' e A L M. Trunnell ia t L ley? ' Mg. ,, Q S' Lffe HEHQHEQQQ , , nauaununnvl -W sw ' Q 0 it .lj A m GER ' , ef: ,ry-xc ,t , Q e , Q. ,t .iffy ii? eff? U-seen gilt? 4 gaming LEADING THE field, state champion ALISON BRIGHT gives in all she has in the 100-yard dash. DSW' Lmffcf' CMMS the finish 'fm' fo' . a victory in the 800 meter run. Lentsch .au ,4 SA rf' . ll' il! .sq , e is .Mnaf?S': - 3 M. Tmnnell won state titles in the 800, 1500 and 3000 meter runs at the state meet in Des Moines May 20-21. Girls' Trlckf89 Track team wins 6 meets The boys' varsity track team had a very successful season. The team never finished below second in a total of eight outdoor meets. The junior varsity and sophomore teams also had a good season, Coach Rich Engel said. Many meets were held on the new all-weather track which cost the school Sl20,000. Engel said the new track was like moving from night to day. Six athletes qualified for the Drake Relays. Mike Flagg placed first in the shot put and second in discus. At the state track meet in Des Moines, Cedar Falls took eleventh place. Flagg earned first place in the shot and Drew Waseskuk took third in the 400 meter and fifth in the 200 meter. Individual state qualifiers were Joel Snell, Jeff Meyers and Waseskuk for the 100, Meyers and Waseskuk for the 2004 Waseskuk for the 4003 Flagg and Terry Orth for the shot putg and Flagg and Bob Bisbee for the discus. Four relay teams also qualified. Engel felt that the team had a successful season because of key individuals and team depth. He said he would like to thank the assistants, the parents for their support and mothers for the banquet. -f - Kris Spande KEEPING HIS pace during a meet in the dome is Todd Letney. H - H 90lBoyl' Truck 'N I tiff l si- l I l M. Tmnnell , BREAKING THE tape to take lirst place at a track meet in the UNI-Dome is sophomore Joel Snell. I l E i 4 4 l l l l 1 1 l E K ' M, 'rn-mtl LEADING THE pack in the two-mile run at a track meet in the UNI-Dome is Trip Kilander. W L Mr K I BOYS' TRACK TEAM - Back row, from left, Allen Corwin, Bob Bisbee, Taylor Pine, Mike Flagg, Steve Obadal, Brad Willhite, Lee Peterson, Jeff Klepfer, Graham Wood, Gerald Sorensen, Scott Rogersg third row, Jeff Smith, Dan Hanson, Mark Winter, Dave Nissen, Tim Cutsforth, Kerry LaCoste, Mike Sash, Tom Kirk, Troy Case, Andy Hazen, Jason Pierce, Dave Wilson, Coach Rich Engel, Assistant Coach Harry Andersong second row, Bob Way, Trip Kilander, Doug Clark, Vance Ewing, Randy Kibbee, John Gogola, Tony Curtis, Todd Case, Dan VerSteeg, Sam Anderson, Gordy Sorensen, Ernie Castro, Ross Juhlg front row, Eric Handartl Jeff Brown, Rich Young, Jeff Meyers, Joel Snell, Dan Mallin, Dave Hinz, Bruce James, and Magnus Anderson. V ' Q . 43211-1 . ffix eva. s r . q 'gi L i F if , . 1 Q , - s up reii 1 1f -N s .Af f V si. i prie 5 ' -5 .gf E 1 ' 'g g i , T W , ,..., , Y., N- N - 4 e 2-2. i if-'f . in e , 5, ik'-N ii x X R X x' X' gb 33 MA. R iw Q, f g k . ' . X Q3 k x 1 'l in 4 Ag 5 i figs ,gk in Zti efiy.- fe ,X Q Z 1 gl wg - 'fi-.tffwgi- ' 5 'Rf' 3 1, H ke 4 es .3 eg. ., JK H, . W? SQ 5 s Q 0 ., F 3 .Q W . ff X I ' f fi .fx 5 a a 4, f 'K Nw gg ' 5 G Q ggi 1 is .L e nw Ya A A H ws. Q Q 5 Y ' ' ' .3 'weli M3 S an - 3 -W, ze-W!-+ -' , ,sid-1 9 X W' W it 1 7 k'i Q . 'S ' - N A ,..- . -V , R fi L 'S rf- 1,41 11 M e ' .,., M. Tmmeu if few' APPROACHING THE pole mn bar is vaulter Jeff Nielsen. , if X Y- ff '52, . , eg-N31 , , . ' of r 5 . Y. K :elf Ne w fe xx A f e - fm,-as-wue iw. - . Hifi! v 2 if we. .HEY-f ,- 1- ' S Y ' X L - pf E' W. ' - A ,,,,, .4 , ... Wei, Q... V or L:,l wi f - .Q . .5 4 , 513,51 K. lx. .kL. K W ..,, k,Q??.Wi,5x K., f 4 'Q 1' ' .Ig ,D ,eg 51' iv- Quxix . .13 jx fiwfqw K .. I , . ' ' ..-- Q .--' 9 ',5'gg1ef-.iyerfs ' - 'X' A K' A ' 'K' pw.. .. e x . gk ,,-1 x K e 11 .. . . ,Xa A S .555 gave., 2.25 K X uw W1 . 4 W W. 1 , K K eg ' if QI. wwf? K .X ,gmexwi an 7 -A 'wi 5333-' ' XAQ11- 5' 'T . ki., Wx.-. ,V M. Tnmnell ' M. Tnmnell PREPARING T0 throw the slzotput is state qualifier Terry Ortb at a meet. Il. Chue STRIVING TO cut in for the lead is senior Rich Young. ATTEMPT ING THE high jump is Neil Lewis, slipping over the bar to clear 6 feet. Boys' Trlckf9l Girls begin with 4 letterwinners As the school year ended, Coach Rich Baumann had an optimistic attitude about the rest of the season. We are a young team and all we need is a little experience, he said. Our offensive batting is our strong point. We just have to be more assertive in the outfield. There were only four returning starters on the team, Angie Mikkelsen at catcher and Mary Gaffney, Kathy Shinstine and Teresa Tangeman, outfield. Last year the team ended with 23 wins and 7 losses for the season. The team set a new record for most wins in a season. Returning letterwinners for the 1983 season were Mikkelsen, Shin- stine, Gaffney, Tangeman, Debbie Svobodny and Julie Fiddick. When school was dismissed, the girls had a 2-2 record. Their two wins were against NU High School and East Waterloo, 14-4 and 14-13, respectively. 92fGirl.l' Softball M. Tnxnnel SLIDING INTO home plate is Kandi Krull. NUZS Christie Dillon .awaits the ball to tag Krull out. Ceda. Falls had I8 hits during the game. JUST ABOUT to swing is Mary Gaffney. Against NU High the Tigers wan, I4-4. L A-ur ,, .,, , . MJ., , - A , A -.th thx. ,L 'Ah ,A I- 4 ,A Q., ,, M. Trunne M. Tnmne GIRLS ' SOFTBALL TEAM - Back row, from left, Shawna Baumann, Beth Foley, Carlene Schecl, Michael Sheehan, Beth Pine, Coach Rich Baumann, Lisa Mittelstadt, Julie Hddick, Tami Jensen, front row, Angi Mikkelsen. Marv Gaffney, Kathy Shinstine, Kandi Krull, Debbie Svobodny, Teresa Tangeman. CATCHING a ball at first base for the out is sophomore Lisa Mittelstadt, -Q' - Wil , rf,-'I' ' ' A -- s yy ..- 1- J, .4 W r . 1. .- .- , K C 0 Q . 4 , . 4 -I 3 9 W' K, as .7 ,. -- , A. X ,W h, I ,. -Mit , A . ,Wyre ,. mi - - M. fs- wt- -'fig' ...' - wi-is ,yy X' M . uf, . M. WAITING A pitch from N. U., senior Teresa Tangeman is ready to hit thc ball. Against N.U. High School, angeman Went 4-4 with two triples. RUNNING IN to catch a ball in centertield is Teresa Tangeman. Girls' Softball f 93 Tigers win openers Varsity baseball team opened the season with a 5-4 win over St. Ansgar in the Charles City tour- nament. The Charles City tournament kicked off a 50-game schedule for the Tigers. They were scheduled to play 35 high school contests and another 15 contests of American Legion baseball. Highlights of the season were to include an Urbandale tour- nament and a Legion trip to Minneapolis. In Minnesota the team was scheduled to play a double header against Albert Lea. Against St. Ansgar in the Charles City tournament, Phil Woody finished the game two- for-three RBIs. Rick Majerus also had two hits for the Tigers. Todd Letney pitched five innings in the tournament getting two strikeouts and six walks. He was then relieved by Jeff Ubben, who struck out three in two innings. Before school ended, the number-10 ranked Tigers were undefeated Q3-0 recordj beating Columbus both times in a double header. It took until the last inning for the Tigers to pull off a 4-3 victory over Columbus in the first game, but the Tigers led from start to win the second game 5-2. - Todd Engels oqambui T. Engels RICK MAJERUS gets rwdy to swing at the ball during the first game of the Tigers' double header with Columbus at the UNI diamond. GETTING READY to pitch the ball to a Columbus Sailor in the second game of the season' is Tiger Jeff Ubben. Ubben had only two errors in the game. In 3:1 itll 5 I A li? 1-5 lil to . VARSITY BASEBALL TEAM - Back row, from left, Assistant Coach Steve Doeden, Scott Smith Obadal, Mike Flagg, Neil Lewis, Brad Reifstek, Coach Dave Welterg middle row, Brian Walters, Jeff Troy Rhode, Scott Engen, John Tamisiea, Rick Majerusg front row, Aaron Lubbert, Todd Letney, Phil Jim Mudd, Mr. K. as T. Engels RUNNING TO home base is Taylor Pine in the Columbus double header. The Tigers won both games with scores of 4-3 and 5-2. SOPHOMORE BASEBALL TEAM - Back row, from left, Jeff Smith, Cam Robinson, Shawn Courtnage, Tad Mozena, Coach Chuck Riehle, Jeff Sorensen, Randy Schultz, Matt Smiley, Phil Clow, middle row, Greg Tollefson, Tom Ritter. Mark Rappaport, Jim Anderson, Ty Schuler, Craig Lowe, Ross Juhl, Tom Settle, Kurt Jeffrey: front row, Paul Woodward, Rob Mudd, Mark Bohr, Sam Anderson, Mike Ubben. Sophs lose tough games The Tigers' sophomore baseball team was scheduled to play 36 games with new head coach Chuck Riehle. The sophomores opened the season with two setbacks in a double header with Central. The Tigers dropped the first game 8-7. Getting five hits and all of its runs in the third inning, Central won the second game 4-1 in five innings. The Tigers led only once in the first game when Randy Schultz made the score 2-1. Scoring CF's only run of the second game was Matt Smiley, who got a double, stole third and came home on a passed ball. Sophomores were 0-2 when the school year ended. -Todd Engels Baseball f 95 Savage Seniors win 12-6 Seniors and underclass girls met for the annual powderpuff game October 27. In spite of chilly weather and rough competition, seniors walked away with a 6-point victory over their opponents. Before the game there was some major disappointment over the fact that jerseys for the sophomores and juniors did not arrive. Fortunately, the football players lent the girls jerseys for the game. Another problem that came up was the senior hit list of underclass girls they wanted to take out early in the game. By game time, however, girls' spirits were up and they were ready for a good game. There were no major injuries. During the game, to help cheer on the players, a special group of cheerleaders showed up. On the sidelines, dressed in skirts and sweaters, were several boys ready to lend their spirit to the game. At the end of the game there were over 100 tired and sore players. The underclass girls departed with groans and the seniors left the field with chants of We're going to state! -Karen Budensiek 7 ssfrwam-puff M. Tmnnell CHEERLEADERS RANDY Futch, Cliff Mohling and Mark Meier hold up cheerleading coach Wendy Holland just minutes after the seniors won the game. B? 'i 4 -- ' Y - J. Bunting THE WINNING team, Savage Seniors, poses in the gym with their coaches. The seniors enjoyed their victory over the sophomores and juniors, but the underclassmen vowed to make a comeback next year. M. Trunnell THE SOPHOMORE-JUNIOR team assembles in the gym for a team picture. Showing that they are good sports, some ol' the players hold up their linger to show We're number one. ' 1 A l J-Www 1+ Q IAT THE END of the game the proud and excited seniors gather around their senior coaches Ken Kolthoff Mike Llewellyn e -,. .455 , WDURING THE game seniors Leatha Davenport and Penny Gardner do their best to ward off their opponent as they head for another touchdown. w Bob Bisbee. The seniors ended the night with a 6-point victory over the sophomores and juniors. T. Engels GIVING SOME consolation to the Sophomore-Junior team after the game is coach Mark Rolinger. The tired team was disappointed by its loss to the senior team. Pwaf.-purffov Arkansas 'Pit' champions Open Pit, the intramural basket- ball tournament opened just before spring break, with about 8O students involved. Open Pit was originally supposed to be played between football and basketball seasons. But because of the extended football season, Open Pit was postponed. Because of more conflicts, open- ing games were moved up to before spring break, Phyllis Ver Ploeg, faculty sponsor for the event, said. Teams were divided into two divisions, the Kindergarten Division and the Preschool Division. Winners of each division met in an Open Pit championship. Arkansas won the Open Pit championship, defeating Sam Hous- ton Institute of Technology in the final game of the annual intramural basketball tournament. The remainder of the field included the Vegas Raiders, thirdg Athletic supporters, fourthg Boom- town Rats, fifth, Hawaiian Punch, sixthg Flintstones, seventhg Sparta U., eighthg Goodwill Industries, ninth, and Generic, tenth. Ty Schuler of the championship Arkansas team said he liked the fun and excitement of playing in the Open Pit tournament. It was fun because people were in it you knew, Schuler said. You didn't have to be good to play, and it gave everyone a chance to play . Dan Trotter of the Arkansas team claimed Pit was fun, more than just the average basketball tournament. Everyone was out to have fun. Trotter said, It didn't matter if you won or lost, it was just a lot of fun. Captains of the Open Pit teams were Dave Conrads - Boomtown Rats, Mike Flagg - Sam Houston Institute of Technology, Mark Petersen - Sparta U., Mark Rolinger - The Flintstones and Jeff Ubben - Hawaiian Punch. Other captains were Todd Olson - Goodwill Industries, L. D. Bean - Generic, Bruce James - Athletic Supporters, Jeff Heckroth - Arkansas and Andy Seichter - Vegas Raiders. - Todd Engels 98j0pen Pit M. Thompsonj SCOTT PETERSEN of The Flintstones takes the ball down the court in an Open Pit tournament. The Flintstones placed seventh in the tournament ARKANSAS OPEN Pit champs - From left, Tom Ty Schuler. Not pictured: Shaun Topliftl John Lyn Moore, Rick Majerus, Jeff Heckroth, Dan Trotter and and Graham Wggd, l l I l ' N l-wir - M. Thompson I AFTER KEEPING Open Pit statistics all night, Diane Sund seems to have had enough. Timekeeper Diane Clow, however, appears to be ready for more basketball action. I W P X , ,. Y y, 1? W I fm -fa if I f M fr - , u f ,. ' . -P Y K Y V Y' av A sf W- f ,. ,,g'3..5 . H' 4 ' W 1: , I WS-wg, - N M ,QQQQ , ,A mp ' Q14 wt '1' ' , A .5 1 fgmtgd' -.YS-. 2, X' ,Ffa ff? X. H :if , ii I I W, ,V . ,W Q , KL , t , gs 4 53 K ,Q F f Thompson KS TODD OLSON of Goodwill Industries and Scott Petersen look on, Steve King of Goodwill Industries attempts o release the ball as he maneuvers his way toward the basket. Mike Scarbrough of the Flintstones waits in he background in an attempt to get his hands on a rebound. WITH A little help from Mike Grieger, Mike Llewellyn of Generic goes for a two-paint, one-handed slam dunk. Open PM99 Castro tops all bowlers Eighteen students participated in intramural, forming six three-member teams. Intramural bowlers competed from Nov. 29 - Feb. 7. A post-season awards party was held at Godfather's to conclude the activity. Team 5 - Dean Fix, Angie Mikkelsen and Diane Sund - finished first. In second place was Team 3 - Kevin Heins, Mark Love and Susan Shaw. Team six - Ernie Castro, Heidi Coleman and Lisa Willhite - finished third. Team two - Kendra Koupal, Penni Schlimmer and Jill Wiederanders - finished fourth. Tied for fifth place were team one - Troy Creery, Dori Fouts and Jon Franklin - and team four - Claude Miller, Pat Phalen and Jim Trangsrud. - Jill Lehman , ,,,. . , J 'SH' sffwfffavwr iw tt' it 'S ' if 13216 'N' K A , ,,.t - 5' . . kg . . ln Qjmral Bowling series Ergljejggastro C6161 jiiigyi Clubfg- Maggiggge 45863, .mr Wiederanders 653211 A Dori FdulsQ'fS431. Kevin Heins 15283, Dean2ffE'nk asm, site gsm, Mike shsw may 1 200LCIubgf Marlg Higve 12353, Ernie Castro 12341, Jill ax. Wisqeganderst 251 evin 121, Mike f Shaiwrlwcalra-wri vf ifil?i.sM shaggtgoapzig A A . K Kimi, a , 'L W ettt l it 1 - fi' -5 M n.'ii1inkkw A MEMBER of the H500 Club, Dean Fix asks the soorekeeper for his score. 1001 Bowling ' D. Lilleskov MARK LOVE, a member ol' the second-place intramural bowling team, tries to pick up a spare. X M' 1 Y. 7 gal it l it 1 ,5 5 J l 3 W 1 j gona . I 0 ' fm : i ,,.-, , A p ' . p J Q' , D. Lilleskov KEEPING SCORE for her team is Penni Schlimmer. She was a member of Team Two, which finished fourth in the three-month tournament. Her high game for the season was 191. M. Tnxnnell INTRAMURAL BOWLING TEAM - Back row, from left, Kevin Heins, Anne Boerschel ffaculty sponsorj, Mark Love, Dean Hx, third row, Heidi Coleman, Diane Sund, Dori Fouts, Lisa Willhite: second row, Jill Wiederanders, Penni Schlimmer, Kendra! Koupal, front row, Ernie Castro, Susan Shaw. M. Tnlnnell ATTEMPT ING TO BUN71 Amy Pfalzgrai, captain ofthe Jammin' Rats, the intramural softball tournament champions, takes a vicious swing at the ball. Pfalzgrafs team got four forfeits. M . Tnmnell SWINGING AT at a pitch, Mary Paulson of the Jammin' Rats attempts to get an base. X Mlaani if ,,f- S . 1, l . Q4 - Ft .n.... np., t. .xy iQlif '3' 'iv I . . , L-, ,,,,.,,,,, ,,,, . Wswagpwwwmam. 5,433 f A if'f9f5:jfi ?i'?.' '5.If7i5:f'f 1 ,Q , f wg.. Swsrf ' t x-,Z , , Q , .. .. F is ' aff - m y Qin. 1' - ' - tikzwsm 'Y,'H .tLf.,f- , , . - n, . J- ,- liz' ' Aff-j.. fa- 1 . - lA2'i.,fv4c,3 X'-J Stagrs --8, 1 ' Eff , . 5 ,Q . , K m- .,f,-,Q--1,.,1f.. , 221 . ?l?a4. 5Hf15M ,A fx, -:wat ls a 1 - -' 1 f v 1.9 f .'i5c :'. ..! -, ., ,,t. , , M M r. ' be l ear .aajibishz A W. Q if miaeaerimrf is GT, 2 f' 1,-aw flifs, af 4:5- 'rfae .5 iifiwlf' 314+ 'i g - V A i,i.i'?l ,3 f3'?s3,,f 5, , s it lf? it as 1' . . ft Mia. ttrt F , J' 5' ' ,. vfrfj-ff.' 5tH,6 . ,1 , it-' . r g., uk, -Q . ,pr ,. ,- -, 1 W , 1' hh rr? W, -i is , , arf or e--'rg i w g. , t , v r f f' .'-fe,seffW mfr .. ' Q ' Y ff Q 'Q ,:E',1:,,' .gfgzf ' f I' 44154 ' K .mf is l M. Tmnnell PITCHER RACHEL WIELAND of The Lords sizes up a batter. 'Ra ts ' win in tramurals Intramural softball started off well, but ended in a strange way. Sophomore Amy Pfalzgraf's team, the Jammin' Rats, won all four games by forfeit and went on to win the championship game 10-5. It's a Cinderella Story. We never practiced much, but when we did, we practiced hard. We'll be back next year, Pfalzgraf said. A total of ten teams entered the tournament, but two were forced to drop out because of scheduling difficulties. There were two divisions to make scheduling easier, since there were so many teams. Sponsor Anne Boerschel said that there would be some major changes for next year. The teams will be condensed, so there will be fewer forfeits, and more people who want to play will be able to, she said. Overall, the tournament went very well, she said. HAH the teams had a good time playing, and that's what intramural's are about. - Jill Lehman J. Lehman INTRAMURAL SOFTBALL CHAMPS - Back row, from left, Kirsten Gregory, Laura Duncan, Tracy Bandlield, Julie Hddick, Amy Pfalzgrali front row, Brenda Carney, Shelli Ross, Denise Jiralc, Beth Pine. Intramural Softball! 101 .,........---f --mv'-sqy....,.,, s 'S 3 :ali I E, Wheeler TRYING TO keep warm during the winter, John Shephard does his school work while w g mittens, - -N, f -gp-.Jo,,..,,.f -R drive' 'lhh' M. Tmnnell SHOWING THE proper procedure for a slam dunk are Mike Grieger, bottom and Mike Llewellyn, who participated in open pit. We've come a long way with some outstanding accomplish- ments by students. Karen Davis was named Homecoming queen and Mike Flagg reigned as Sadie Hawkins king. e Every other month during the school year, one senior had the honor of being chosen student of the month. Students were chosen by Student Senate. We had seven foreign ex- change students - Magnus An- dersson from Sweden, Amaia Betelu Bazo from Spain, Caesar fE1'nieD Castro from the Philip- pines, Anne Pelzer from Ger- many, Sartoru Baba from Japan, Alejandro QAlexJ Azar-Perez from Mexico and Daochoompoo CYingD Chinwala from Thailand. - Tami Jensen of 1 A. Pl alzgraf ON VALENTINES DA Y, Phil Woody and April Dallm watch Steve Obadal inspect a flower. M. Thompson SHOWING OFF their brilliant costumes on 'punk day during Homecoming week are Jill Lehman, Scot! Ripplinger and Kim Moe. Peopl -l 5 s 4 w , I , .f M. Thompsc ENJOYING THE popular Tom Thumb donuts a Cattle Congress is Jeff Purlr. n I People! 103 Theron Adams Michael Agness Patrick Ala Michelle Alberts Christine Allen Rebecca Allen Devon Anderson James Anderson Samuel Anderson Wendy Anderson David Appleby Judy Archer Randy Aschbrenner Kurt Aschenbrenner Farah Azeem Sheryl Bader George Bairnson John Baker Traci Bandfield Marie Barnholtz Brian Barron Douglas Bartels Scott Bartling Jeffrey Bast Colleen Beatty Joel Beener Eddie Bennett Daniel Bergeson Michael Bergmann Brooke Bixby Randall Blackford Stephanie Blonigan Andrea Boesen Mark Bohr Russell Boten Ilona Botton John Brandt Kerwin Brandt Alison Bright Stasi Brown Tom Bullers James Burke 104fSophomores L-Ja. 4 Sth v V '5 NT, K. Spand SOPHOMORE CLASS OFFICERS - From left, Cam Robinson, Cami Rolinge. Gordy Sorensen and Monica Stettler. The four were elected during their ninth grae year by their respective junior high classmates. Robinson and Rolinger came fror Peet, and Sorensen and Stettler, from Holmes. I x.J l JULIE WILLIAMS executes a set in her sixth hour physical education class as Lora McKee and Pam Van Deest watch, TRYING T0 LI VEN up a dull cafeteria study hall, Beth Pine has music to help her with her assignment. fficers enjoy leadership roles One of the main objectives of the sophomore class officers was to attempt to secure a bulletin sign to post weekly school activities. Another goal was to obtain one more dance a year. Officers were elected during their freshman year by their classmates. All said they planned to stay involved in student government throughout high school. Stettler said she was interested in student council because I like to do things for people and work with them, and you can make yourself a better person. Rolinger said, The school has social benefits because the students are satisfied with an active school. Sorensen thought that the school benefited from school government because the students have a voice in what's going on.', Robinson enjoyed school government because it's interesting to see progress, thinking up ideas and seeing them be carried out. - Kris Spande fe 2 2, ' .- , Lora Burton Kathleen Butler Brenda Carney Kevin Carroll ' Todd Case . Troy Case Kevin Champoux 52' haw ' x if X NSN Wg , A' l . r ,5- 'si' fu, 1 , Q 7 ' p 3 . ' ' lklnlbzca. .J is ' V , a Z, f 5 ff- Julie Chokos Ruth Chokos Denise Clark Jeffrey Clements Philip Clow Angelique Coffin Steve Collum Noelle Congdon Allen Corwin Shawn Courtnage Jennifer Cranston Pamela Culbertson Aaron Curtis Anthony Curtis Sophomoresj 105 ' Daochoompoo Chinwala Christopher Congdon Michele Cunningham Stephanie Curtis Kristan Custer Ann Cutsforth April Dahm Andrew Davis Debra Deibler John DeLavergne Vicki DeWalt Yvonne Deyo Curtis Dietz Gregory Dietz Heather Dion Dean Dirksen Glen Dix Michael Dix Tammela Dixon Stephen Doerr Amy Dorman Kimberley Doty Teresa Dumer June Duncan Laura Duncan Larry Eastman Steven Eastman Kurt Eichelberger Michele Elin Melissa Ellis Beth Engels Heidi Engen Nancy Etringer Desia Evans Merlin Feckers Melissa Feldpouch Brenda Felts Mary Ferris Julie Fiddick Michelle Fisher Steve Fisher Bryan Fobian Joan Franke 106 1 Sophomores vw S., HS f iff in-2 --Nf In spite of increasing costs, about 85 percent of high school students continue to buy class rings, according to Marge Schilling of Schilling Jewelers in Cedar Falls. Schilling said college-type rings were selling best. She said that in spite of the recession, she has seen a slight increase in ring sales. The ring style was chosen by the sophomore class officers, and the class got a commission on ring sales, Associate Principal Dean Dreyer said. Although ring orders were all placed with one company, other jewelers got some business because some people bought birthstones costing half as much, Richard Christi of Richard's Jewelers said. According to Schilling's estimate, about 8596 of the people that went to high school did get class rings. Some reasons for getting class rings were To show my kids when I have some, said Brenda Felts. The most common reasons students gave were to remember what sports they were in, and the good times they had in school. Some of the most common reasons cited for not buying class rings were summed up by Andy Nicholas. He said, It was not economically feasible on my budget. Susy Stoll said that the reason she didn't buy a ring was because she was going to buy a birth stone ring instead of a class ring because she didn't think she would wear her ring after she graduated. - Chuck Bradford mills, H. Noonan ON RINGS in their sophomore English class are Karl Kreb, Kathy Krough and Julie Mumm. representative of Josten 's visited each sophomore class in February to discuss class rings and help students their orders. ff' .. 4.1 if C. Bradford OMPARING CLASS ring styles at Schilling Jewelry is Richard Hathaway. Senior Laura Driscoll, a chilling employee, assists him in making a selection from the styles on display. -Q ' -,4 ff W , A . N, J ,, Y . 1 A - Traditions 'ring' true as-wr 5 MAKING THE BIG decision as she examines a class ring display near the guidance office is Sue Klemp. Curtis Franklin Robert Frohn Renee Futch Jennifer Gadow ' Angie Gaffney -, Susan Gardiner Michelle Gatewood . Karla Gavlock a . Sophomoresj 107 Kary Gavlock Julie Godsey Mitchell Goetz John Gogola Mark Goodman Randy Goodson Troy Graen Kelly Grant Michele Gray Pamela Gray Suzette Gray Michelle Greene Scott Greenwood Kirsten Gregory Richard Gronowski Lisa Haberkamp Abigail Hagarty James Hammer Scot Handberg Stephen Handorf Mette Hanson Rachel Hanson Valerie Hanson Tina Hart Angela Hatcher Andrew Hazen Meagan Hazzard Dawn Heath Heidi Henning Lisa Henry Mary Hess Travis Hildebrandt Tammy Hilmer David Hinz Dennis Hoer Kendra Holler Todd Holmes Renee Hoppenworth Paul Huffman Matthew Hundley Gerald Ingham Monica Izer Debra Jacobsmeier James Janssen Leslie Janssen Shannon Jensen Michael Jerke Caren .leys Denise Jirak Jeffrey Johnson Jeffrey Johnson Jo Johnson Kreg Johnson Gina Jones David Jordan Beth Jorgensen Brock Juhl Ross Juhl Sheila Keeling Robin Keigan Kristine Kelly Kimberly Kintzel William Kirchmann Laurie Klages Kurt Klammer Susan Klemp Sarah Klemuk Nancy Klocke Tasha Kneppe Michael Koepke Kelly Kolthoff Bryan Korte 108 fSophomores sie ,ta to ,,, I f aff' Beginning in 1980, certain phrases crept into our vocabulary and dominated our speech with amazing regularity, such as Take off, hoserll' and G'day, eh?,' The creators of these catchy lines were as popular as the lines themselves. They were Rick Moranis and Dave Thomas, who portrayed two Canadian brothers otherwise known as Bob and Doug McKenzie. Their talk show, known as The Great White North, began as a joke in response to the Canadian T.V. regulations demanding that all homegrown shows had to contain some original Canadian material. Their joke backfired, however, when the show became a success. Their first album disappeared from the stores, while other fans showed their support in various waysg from Bob and Doug parades, to backbacon festivals. The hosts of The Great White North basically concerned themselves with the trivial problems of the world, such as the lack of parking space at Doughnutworld, what to do with a flat tire, or even how to scare beer manufac- turers into a free case of beer by raising baby mice in empty beer bottles and returning them to the company. Yet here, in our very own school, we had a duplicate set of McKenzie Brothers, otherwise known as Jeff Mundt and Mark Nickel. In answer to why they began their compulsive hoseheading, Nickel replied, We started doing it just for the fun of it for the announcements. Their act caught on and they began performing for Offbeat humor gets laughs LIKE GDAK eh? says Bob McKenzie Ueff Mundtj, right, as he and Doug fMark Nickelj read the old activity calender , part of the schools daily announcements. school assemblies. The costumes were easy to find. We just used old boots and parkas that we found around the house, but the hats we got at Goodwill. As to their favorite part of the routine, they both favored the melodic bird call used as their introduc- tion. Both Mundt and Nickel agreed that they themselves were nothing like the real Bob and Doug. No way, hoser, said Nickel. Like those guys are too crazy and naive even for me! Yet Mundt concerned himself with the facts. First off, we're not Canadian, and secondly, we don't drink that much beer! - Kerrie Hagge .saw get BAK ti Ui.. ra uf I ...f Patricia Kozak Kathleen Kramer Mike Kramer Christine Krause Karl Kreb Kathryn Krogh Michele Laipple Douglas Lawson Snphomcrcsf IO9 Joan Lawson Cathy Lee Steve Leider David Lein Michelle Lemons Grant Leverenz Ray Lewis Whitney Lindell Kristen Lindholm Nancy Liu Chad Livingston Christopher Lonergan Marc Long Craig Lowe John Lynch Angela Madson Scott Magers Shelley Malam Daniel Mallin John Markey Lynnette Martin Christopher Martinson Kimberly Mashek Harlan Mathes Jeffrey Mathes Doug Matthias Denise McCann Leslie McCulloch Kurt McCunniff Deborah McDonald l 10 1 Sophomores 11' wm,,-QSM? IIA, 1 M. Trunnell AIMING FOR the highest branches of the tree, Rick Seres shows off his favoite TPing techniqul .a me ...uw THE TREES, bushes and basketball hoop m thrs yard are adorned with streaming toilet paper. The victim in this use is Troy Denkinger. 1 ...- ...- Students take on exterior decorating TPing has become a favorite tradition among Cedar Falls students. Throughout the year, various coaches, team members and other students spent hours removing toilet paper from their trees, bushes, cars and anything else that happened to be in their yards. Asked why they TPed swim team members and coaches, swimmer Lori Mickey said, It's fun and it promotes team spirit. Cheerleader Jenny Jordan commented, It's fun to do on certain occasions, but I donit like to be the one who gets TPed, because it's a mess to clean upf, Students said that they usually spend about 20 minutes TPing one house. Football player Steve Obadal said, lt takes about 20 minutes to clean up. But others asked replied with answers from 15 minutes to two or three months if it's left in the trees. The most notorious TP job was the annual TPing of swim coach Dick Marcussen. For the past 13 years the swim team members have gotten together to TP their coach after big meets. At one time Marcussen had 106 rolls of toilet paper strung from tree to tree in his front yard. Asked if he minded being TPed, he replied, 'Sometimes it gets aggravating when it'd done too much, but the team has fun and it keeps them togetherf' Although TPing could be messy to clean up and dangerous if the TPers get caught, students had fun spicing up boring nights by decorating houses with toilet paper. Because it was enjoyed by many students and even alumni it will probably be around for many years to come. - JoAnn Bach Wm- , , 1' . Y L1's.'f5XQ 4 la-.fl 9,4 X s . S i ---1 x t Laura McKee Scott McRoberts Adam Michels Kim Mickens Christopher Miller Mary Miller Paul Miller Scott Miller Brenda Minikus Lisa Mittelstadt Scott Moehlis Michael Molla John Morse Robert Mudd Jennie Muller Julie Mumm Kerry Nance Brian Neal Phillip Nelson Bradley Nichols Samia Nijim David Nissen Susan Noack Julie Nottger Scott Ochsner Mark Olejniczak Kristie Olsen Mark Olsen Jon Olson Jill Orr Snphomoreaf l I l vt Kevin Orth Aw if Melissa Osborn ' 12 6 i ' K -- Xiflkflfs X . r .,,.-...--, Kelly Otten vw. iifygx 1' f I ' I fha- . In 1 DARCY CANB Y obviously gets the hang of it as she races Scott Pagel towards the Iinislz line at the end of a long hour. During Taking advantage of the winter's only snow, juniors went cross country skiing February 15. As part of the physical education class, the Iowa National Guard supplied all the necessary equipment as well as instructors for the day. Physical education teacher Jim Renning, coordinator of the program, said, The weather was terrible. The snow was slushy and very difficult to ski in, but overall I think everyone did very well. For several of the students it was their first experience on skis. The skiing session was held at the Fairview Cemetary because of lack of buses to take the Angela Pape - ' 5 Ray Paquin David Pardoe Sheri Parker James Pashby Mary Paulson Kurt Pedersen Chad Petersen Christine Petersen Lee Petersen 'tr is Amy Pfalzgraf John Phalcn Elizabeth Pine Kenneth Polk Joseph Porter Troy Powell Alisha Quinn Mark Rappaport Kurt Rasmussen Quint Reelfs Lara Richardson Thomas Ridder Douglas Rippe Nicholas Roberts Troy Roberts Cameron Robinson ll2jSophomoree the hour, and how student purpos student in thei Cr live in facilitie This w helped sport t h of lack 'li Q i I V l r A l X l ' 8 A, l J umors tr slopes on skis S0 '-u-...M . fi '- J Nwr,,,,, N T. Engels 'WHAT DO you mean 'move your feet? ' asks Rick Majerus as lie gets My Tf ' a taste of cross country skiing and hits the snow in full force. He said standing was 'Tairly easy, but trying to move at the same time was another SHOWING EXTREME concentration, Karla Meyer demonstrates her newly acquired 'tory! skill on skis to ber fellow skiers, some of whom were also on unfamiliar ground. wg BFA Camilyn Rolinger Michele Ross Michael Rube Jennifer Ryan Michael Ryen James Sadler Shirley Saeger Shelly Sands Tammie Schmidt Kurt Schreiber Ty Schuler David Schwantes Barbara Seavey Richard Secor Sandra Secor Tom Settle Tammy Sevey Michelle Sharp Mindy Sharp Thomas Sherman Robert Silverson Tracy Simon Ellen Simpson Steven Skiles sopmmmf na Paul Slick Shawna Slobe Steve Smalley Ann Smith Kevin Smith Lisa Smith Valerie Smith Lori Smock Joel Snell Chris Sorensen Gerald Sorensen Gordon Sorensen Jeffrey Sorensen Michael South Kristin Spake Michael Spier Jill Sprague Linda Stachovic Clint Stainbrook Anthony Staut Jeffrey Stealy Pamela Steele Monica Stettler Terry Stevens Timothy Stevens Lisa Stilwell Mickey Stokes Barbara Streeter Stephanie Swallow Roberta Swan Darryl Sweeney Tracy Swingen Michelle Tangen Phillip Teaford Thomas Thode Jeffrey Thomas Mark Thompson Darrin Thran Gerald Tiller Timothy Timmer Gregory Tollefson Dana Tonn Laura Tramontin Gary Treichel Brian Tressler Sally Trost Shelly Tunwall Dawn Ulrich Marcia Unruh Pamela Van Deest Daniel Ver Steeg Susan Vognsen Steve Walljasper Dawn Warnke Sheri Wasserfort Robert Way Heidi Wedemeier Tenney Weekley Lisa Westcott Timothy Wetrich Grant Wheeler Laurel Whitsett Lisa Whitsett Craig Wiegardt Rachel Wieland Julie Williams David Wilson Mark Winter Graham Wood Paul Woodward Bryan Young Troy Zimmerman l l 4fSophomnres i Q :- Ns U ,. 5 S PM 'Q if Il 4 ,, a.: T N folk I Y V My ' All-X juz' K 'YT was x l' Mer f ff mcgifsa 2 egg Ngwigfsagsflg M M vuawylwlwggw N A M Dtgfggiw A .s,b 2 Qty anime www ,E-Q. 'NL do ws r5'98 5hx',,NvS5ax5f3s?s3 Ha wk REQ' 53,533 xt 'ity-Tfw 1,-c sigma 1 Q ww Qt.. 100TB 1 T lwrso ut Pi uv U' 'IMS' ,FQ 'Qt '31 B' q it 'Q' hw' utpj -1 all P 6 f,3-4-'f3'nQ ' 55' Jlfffgin QAM' at Q7 'iffy 'Mg 'tier ji., ,rf sg , M , Y ar J A S any ON THEIR WAYto a football practrce at George Hauser Freld two members of the football team prepare to cross the carpet covermg a sectron of the newly mstalled all weather track To protect the track surface cleats are outlawed there A new all weather track to keep athletes and the entrre commumty on the1r toes was completed rn September Rrch Engel, head track coach, sard the sprmg track team w1ll be able to start earher and w1ll be able to work out on the new track rather than m the street or gym The last year's track team was hurt by havmg only 10 practlces on the track the f1rst month and a half of the season, Engel sand Th1s was a great drsadvantage to our team because most of the opposmg teams were able to hold therr practrces on a track Engel explamed that lanes on the new track are w1der allowrng hurdles to be set ln the lanes It has a rubberrzed, all weather surface whlch IS easter on legs when runmng It has permanent lane llnes and marklngs v'5 'f Track gets new if fain!! ig D R Chase rubberlzed surface K Budensrek DURING A SIXTH HOUR gym class grrls play soccer on the football freld as gurls track coach Bert l-Iarns and physrcal educatron department head ,hm Rennmg rnspect the new all weather track surface Besrdes belng used by track teams the new track was used by physrcal educatron classes and was avarlable to the commumty All of th1s means less marntenance because the surface of the track won t have to be prepared or marked before every meet he sand Another major beneflt of th1s track IS that we now have a h1gh jump rather than uslng the parkrng lot Th1s track has a common fmrsh l1ne whrch makes a meet easter to watch and trme races One of the major advantages of th1s track IS that the tlmes w1ll be faster than they were on the clnder track we had before, Engel Sald Rules for the new track prohlbrt Sp1kCS, roller skates, b1kCS or hrgh heeled shoes because they can p1erce the rubberrzed surface, he sa1d The track w1ll not be used just for the track part1c1pants Engel sard It rs for PE classes and the general publlc The new track ' na' , 'ry ,,,t. 4 A A l , ,, , Q 5 s ff 'jf ' t if fn - ,' t Q ,, M 5 5 3 ' V ' , , ' vt .jf ,S A ., , , A 5 1, 4, ' . A . , , Q, . J, 4-W ' A ' ' gtg ww l -1 , 1 g ,..l.,,. - , ,rj M t - - el ,,-.. cbfiilvvlwv, .wr A-. V . ' 4. f X: -1' K ' x it , - 'Sf 'Era 'Q 1 Qt ' v - . A Nt .. M ,, .t-.t.tt .t .rc ,.tt 1 1 w ,- w 2 s-...iid N x .. sk:-. Q . ik. , , 5-r ...- r . K 1: N-,g J - ' ' - .... a .c,...sv-s ' .-If'-e'F'iQA-:eQQEfQk' X t . ' iiisvt ..,,, Wg- Vk .,b'g',kso,.s,X nqt , Y.-. . . I, V ff 5195 .pl - we gym iff' M . sms.: ,hint , A . . '. v jr ,, ' K rp Q x All xg? o .a , rfrc 4 - ,A . I-ff? ' with i -4 W,,...,LAw -'tr' I J 1 , t. 'gf-of , -ts 1 A 'JS ' :ji st , o ' V X J lff'1:,f,v?l - dh' -E -ff i .5 ' 1 . - ' , , 'Q A 5., ,, . 1, , . M., .L - W 'NVQ' g. . - ra x ' ,ag ,fy i ,l -- my k . 85' gig' ' - wtf. Q9 ..,' ' Q ' A., -' A ? gf ' 'Q X. ffl '- 5, 1', Q P-E M SQ. . - - - 1 . 2 t .- . ,.- ,nf 'gif lhfh . . fl I J , Q of s-u ' K. '-.l5f5'.2 -4 4 .hi, ' 'viLY 'f-'ui M . , , 2. .53 1 I X 1 tl W xi ,, aw. I ' gdfftt -,,-ggi. j ,gt , as . . . -t ,, f 1 ,, , ,, . , k ,Ads -..l , tl A-. 1 rt nf t, any '.' ' ,,,-1 ,Q -'-1 Q ,G V, In 5, 1, I 'T 1'3 ' fl: . ' U is '- ' , 5 ' -,'f'..,r.1i tv' ' I-Eff ,A , t g , A . . 5, of eps v.t5f,ggf1' . - , af .. , . 5 S' i gg rv '. t . I ' 1 , f Q 1 , , kt3l'!:i.,lUT A ..s . M Q Q L , X, . - i .lftfwa lr, U 1. ug .' 'f' ' ,' tw - if 'A . A J AJ' I -, 3 .ft A rf, y,..,e'. W. fi f'r'7Jf 1 Tk?-'23 N JL, J APY-it .Lgofe9,'. iz ali . 3? 'R' wi-3 J, , J . oth Q ' fr . 4 1 4.2 in-f,i.l'l. t A . -1 , -f 1.51, . , . X ay, A 1 e In V, ,iq 4 V.. eyavygql V ,V U ., M 7.53, tal' 15 L., in 5 I , 1 , K. fA,'y7-al, btw A - .lg H., ,Q ll.: ,W tytl g.'gf,,Q HQ f fr, is ' ,...-A -is 'H , ftfff at A A 2' 'lm f ' EN- , 1 f f , 1 , 'lftfa ' ' . , 4 x -K t kEAbM,,L H :,,'. Y., yr ,ga Mi .. u Q Angus! c u w,,, .M ' f yr twat K lt, v fry.. , K .S Q,Qf:g,,' A ,ada mg 1,19 . Rfk, ' K. Ts- K , ,pw .,: 1' ,Qj ' k,' nil tr tg. i ff ' 14. --SAYS r ,, , , , ' , l ' . . A 9 , . . tt - - . . . . . . . , ' 19 I . . . 7 w1ll also be used for junror hrgh and college track meets Another large advantage of the new track lS that rt was not pald for by taxes Floyd Wmter, drrector of secondary educatron, sard the new track cost approxlmately Sl20,000 All of th1s money came from the school house srte fund whrch can only be used for lmprovrng school grounds or burldmgs Furthermore, the track used only the rnterest on the prlnclpal 1n th1s fund Wtnter also stressed the fact that the new track ts for the ent1re commumty Bert Harrls, grrls' track coach, satd, Our track IS the best all weather track 1n the state of Iowa ' Karen Budensrek Sophomoresf l 15 Bobbi Aarons Sean Abbas Sabrena Abben Jill Abels Gary Adams Eva Aelmans Gregory Allen Michael Allen Sandra Allen David Anderson Gary Anderson Janelle Anderson Jayne Anderson Rod Aneweer Julie Aschoff Tara Babcock Jill Bach JoAnne Bach George Bailey Scott Baker Shelli Bakker Joseph Bean Toneane Bean Robin Beebe Steven Bennett Debra Bergeson Kelly Berry Kirk Besh Christine Bess Jennifer Betz Bradley Bigelow Roger Blakesley Deborah Blassl Dan Bliton Bryan Blonigan Doris Bockoven Wanda Bolte Teresa Borshein Russell Bowen Charles Bradford Christine Bradt David Brandt Melissa Brandt Lincoln Brant Rodney Brewster Robert Brimacomb Jacki Brown Tammy Brown Todd Brown Paul Buchholz James Budensiek Karen Budensiek Kent Burbridge Russell Burgin ll6f.lunion YT' ,W 5: l A . f' 2 'T f 'f' fr U X I ' -1 lg, -fr if N. s ,rt ,, K is Q . if t ggi ,lptjirniorjjclassf officers arranged. and put, oni' Hornecomitig, ta 'Valentine's. Dayfflower isalegiijuniorfsenior prom andfother events., X AClass' members received -a S15 second B place award on their Homecoming float. n Secretary-treasurer Kris Meyer felt her job was necessary and said she liked to keep things organized. Vice-president Mark Rolinger said, I feel pretty lucky to have this job. Student officers do a lot more than people give them credit for. Junior class officers worked together thinking up new ideas and dealing ,with problems or situations whengthey arose. B - President Terry Mohling said- she liked l1er,job,,but she felt itiwassia lot of gstrespegsibgliryg she gasoil said she triedlftoljkeepnfhe, juniors' 'spirit up throughoutjytheiyear.. a . p e tty iie' -- iMarIene Kampman ffiCSI'S 0lI'g'a.I1iZ6 fund raisiers H .IVY I C ' M Kampman 'hd PAINTING A SIGN for me junior hallway during Homecoming prelparations are Laura feldpouclz, left, and Lori Henry. Students from each of the three classes, decorated? one of tlze first floor balls for the annual, ficgnzpetitiari ' during ' Homecoming week, GQ Ei xl S W .f .,,,- ---....--X.-V j- 'x . - M. Tnmnell' JUNIOR CLASS .OFFICERS -A From left, Terry Mohling, president: Kris Meyer, isecretary-treasurer, and Mark Rolinger, vice president. Thetliree, elected in May 1982, had charge of planninglactivitiesyfor tbeirielass during the year and represented juniors on Student Senate. l I N Karla Burkhardt Kristi Burkholder Lori Buser Cheryl Byerly David Cable Darcy Canby Michael Canby Thomas Carley , A-f l .-:I Q we X. i 4 Kimberly Carmichael X 59' Kimberly Carney a- f- 5 Roderick Cavin Gina Cerveui of X! ix Q X Tracy Cherney i Charles Christensen Daniel Christensen M l Anne Cizek Robin Cizek Douglas Clark Beth Clute Monique Coffin Heidi Coleman Jon Conradi David Coonradt Laura Cornell Junionfl I7 Sharon Cornwell Renee Crandall Timothy Crawford Denise Cronin Kimberly Culbertson Pamela Curren Timothy Cutsforth Anthony Dalrymple Terry Daniel Brenda Jo Daniels Jennifer Day Barbara DeBerg Robert DeGroote Troy Denkinger Cheryl DeSmidt Christopher Dietz Thomas Dobson Carol Doeden Matthew Dolan Jean Dowell Patrick Doyle Lisa Driscoll Joseph Dumer Stephen Dunbar Leonard Duncan Deborah Eastman Mark Egner Kenneth Elliott Diane Engel Todd Engels Steven Erickson Angela Erne John Evenson Vance Ewing Laura Feldpouch Amy Fimreite Dean Fix Shelly Fix Christopher Fleming Elizabeth Foley Judith Franke Angela Freeland Paul Froehner Christine Fuller Nicole Fulton Linda Gamble Lenny Gard Tim Gardner Renee Genolous Tim Gerholdt Heidi Geving Tammy Gjere Jeanette Gloviak Shirley Godsey Ty Graham Tracy Granneman Keith Grant Darren Grapp Karen Gray Todd Gray Troy Greenwood Todd Gutknecht Kelly Haes Paul Hagner Carolyn Hahn Tony Halterman Penny Halupnik .Ion Halverson Jeffrey Hammer Julie Hammer David L. Hansen David W. Hansen llBfJuniors lr E. R I I 4 fr ' 'Q Q 2 X' ' .. .. , a ,Q t... t Y Q t, wwf ' P I at ii X X f X I 3 'A 5 x 5 ' I li 3 flax, ' l fi ' I K G 9. he .TDMA SN'-af as ft v -- gf at f Q? 1 , fX,. 1 Lil NN 7 1 mm 'xxx ' X f N , 4 I K Q 1 I f nu? N S. Ripplinger EXAMINING THE CONTENTS of a Tylenol capsule are Rhonda McCulloch, left, and Dawne Slzeibley. Tylenol scare affects packaging After seven people in the Chicago area died from taking cyanide laced Extra Strength Tylenol in early October, Tylenol packages were pulled off store shelves across Amer- ica. Everyone seemed to be ask- ing the same question, What can people do to protect themselves from using unsafe over the counter drugs such as aspirins, vitamins, or even eye drops? After the Tylenol scare someone even put acid in eye drops. Even if we seal the con- tainers like prescription drugs, some person will find a way to outsmart the seal, replied Bob Wagner, pharmacist at Medical Arts Pharmacy in Waterloo. Pressure from consumers will force manufacturers to change their packaging pro- cedures, said Scott Sanford, a pharmacist at Osco Drug, Thunder Ridge Shopping Center. Both pharmacists said con- sumers should check packages to see that medicines have not been tampered with. After the Tylenol scare in Chicago, there were other scares around the world like threatening to inject insectide in gallons of milk in Iowa and injecting other types of poisons in mouth wash in Florida. Within weeks of the Tylenol To promote the new Tylenol, scare, new packaging pro- the company offered free pack- cedures for over-the-counter ages to consumers. 'drugs were instituted. - Laura Frisch Juniorsfl 19 Doyle Hansen Daniel Hanson Kermit Harless Betty Harmon Valeria Haugebak William Heath Kim Heckroth Kevin Heins Kyle Helland Jennifer Henderson Lori Henry Roxanne Henry David Herbsleb Sarah Hewett Susan Hewett Darrin Hildebrand Henry Hilmer Matthew Hoffey Michael Hogan Andrea Hopkins Bradley Horstman Elizabeth Howard Gayle Howard Larry Howard Brian Huisman Christopher Hull Terri Hundley Jody Husome Amy Huth Edward Ihde JoDee Jacobson Troy Jacobson Constance Janssen Thomas Jenkins Tamara Jensen Jean Johnson 120jJuniors Y T. Engels REVEALING HER personality and hobbies, Dianna Maytum decorates her locker with posters and stickers. 'Wilt 1 Q - I . t .eff ,Q TO SA TISF Y her hunger, Kelly Berry said she chose a collection of food photos to adorn the inside of her locker. i u T. Engel Locker art enlivens halls To make their lockers more exciting, many ,students chose to decorate them. Heidi Noonan said she decorated her locker to provide laughter in the middle of an ordinary day. When I open my locker, I laugh because the things I have in my locker are extremely humorous. I need some inspiration to get me going in the morning, said Catherine Wilcox. Decorating lockers didn't take long and wasn't rdifficult. Most students said they got their ideas from magazines, newspapers and friends. Monica Stettler made her locker interesting using volleyball posters. After the team put their time and effort into the posters, I don't want to throw them away, she said. Dianna Maytum said, Anything dirty we put us up. Some of the more unique decorations were mirrors, wrapping paper and comic strips. Custodian Dorothy Payne said she didn't really mind people putting things up in their ,lockers and that lockers required minimum clean up. ' Since students retained the same lockers from one year to the next she said, Usually the stick-on stuff like bumper stickers we just leave over the summer, but if the decorations are put up with l tape, we take them down at the end of the year. Belva Weber said she didn't decorate her locker. I was planning on it, she said, but I ,couldn't find the time with all the homework the teachers give out. We did last year, though. Most students who didn't decorate their lockers said they couldn't find the time or the materials for decorations. Decorating lockers was one way to brighten the school day and add a little excitement, many students said. - JoAnne Bach .I-Q I 'li I l s., fu WL Cr 1' .:'f ' faf f gt. 1 . 9- I fr' , 9-.L '1 Kevin Johnson Steve Johnson Dawn Jones Laureen Jones Scott Jones Terry Jones Jennifer Jordan Marlene Kampman Jon Kao Joel Katcher Kevin Kelly Wendy Kent Dawn Kibbee Randy Kibbee Trip Kilander Juanita Kimpston Anne King Tom Kirk Chad Kleinmeyer Jeffrey Klepfer Katrina Klingenberg Kathryn Klinger Lea Kloster Dorothy Knapp Christopher Knief Linda Knoll Perry Kohls Christopher Kohn Bobbi Kono Andrew Koopman Kendra Koupal Trudy Kratz Claudia Kratzenstein Steve Krause Daniel Krejchi Donald Kriens Juniors! l 21 1 Ewa 3 iw.. WORKING WITH the schools computerized attendance program Associate into the computer The new program implemented at the beginning of the secon Principal Dean Dreyer and attendance secretary Carol Olsson enter information semester was written by a math teacher at Clinton High School Michelle Krull Kerry LaCoste Susan Lang Greg Larson Ken Lawson Mark Laylin Paul Leahy Jill Lehman Dale Lewis Frank Lewis Angela Liebbe Christopher Lilly Lori Lohman Khin Long Rodney Long Sarah Longnecker Grant Lorsung Melinda Lourie Troy Love Shelli Lovell A. Dieter A. Dieter Lubbert Diane Madsen Richard Majerus Timothy Majerus Eileen Malm Leo Manahl Lynn Manley Richard Marsh Timothy Matthews Dianna Maytum Pat McCarthy Brian McCullough l 22f.lunion Eumputerized att ndarn: begins Seniors were the first of the three classes to be reduced to four-digit numbers by the attendance office. Beginning with second semester, seniors' absences and tardies were tabulated by an Apple II computer in the attendance office. Three weeks later, the whole student body was under the computerized attendance system. Associate Principal Dean Dreyer introduced the computerized attendance system at the beginning of the second semester. The system helped save time and made attendance records more readily accessible to parents. The computer program kept a running tally of students' absences and tardies. It notified the computer operator when a student had three tardies during the semester. After six tardies in a semester, students' privileges were sus- pended by administrators. Daily attendance was taken in each class and reported to the attendance office hourly and keyed into the computer sixth hour. A printout was made listing all students who were unaccounted for during any period of the day. Copies were distributed and posted so students could check the lists for their names and clear any absences listed with the attendance office. If a parent had called in for the student, the student's name did not appear on the absentee lists. Dreyer said the goal was if a parent calls in for a student, the student will not have to report to the attendance office for an admit. Dreyer said the new procedure saved time, simplified bookkeeping and fostered better home-school communications. Because of the program's speed, it makes it more difficult for students to skip class, Dreyer said. It does make the students more accountable, but that's not our purpose. - Teresa Tangcman lf' Lisa McFarlane Dale Mclnroy Mark Meier Jacqueline Meyer Karla Meyer Kristen Meyer 5 Monte Meyer Lori Mickey Gary Minikus Joni Minikus Robert Minnick Patricia Mitchell Teresa Mohling Dawn Monaghan - it f Thomas Moore Sarah Morrow Patrick Morse James Mudd Todd Mueller Lori Munson Michelle Murphy Jennifer Neessen Angela Nelson Michelle Nelson Michael Nesvik Hao Ngo Andrew Nicholas Merle Niehaus Jeffrey Nielsen Heidi Noonan Autumn North Ward Northrup Steven Obadal Stephanie Olsen Richard Olsson f Celeste Oson Pamela Page Jtmamfiza Bradley McCunni'f f Michele McCunmff Chris Niederhauser David Pagel Susan Pardoe Michelle Parker Monique Pashby Julie Pech Jennifer Pershing Steven Petersen Ann Peterson , , t t, C ' K RXXSK X. X M. Trunnell SURROUNDED BY AVID admirers, Joe Roderick stops just finished a session of Mousercise as Pluto at College to shake hands and have his picture taken. Roderick had Square Mall, part of a shopping center promotion. Junior joins Mickey and friends Have you ever wanted to make money by dressing up like an animal? That's what Joe Roderick did for about 13 days. Roderick played the part of Pluto during College Square's October Mousercise campaign. He, three other characters and two Mouseketeers performed at the mall, at area hospitals, and at the National Cattle Congress. The characters gave a special performance for the United Way. The annual campaign was kicked off with a parade in and around the mall. Theater director Charles Koch was informed of the Pluto job by Liz Coogan, advertising marketing manager at College Square. Coogan explained that Rowse on stage Co., owners of College Square Mall, owns exclusive rights to all Walt Disney creations. Their aim in bringing the characters to Cedar Falls was to build loyal consumer traffic, make shopping an experience and to create goodwill in the community, she said. I like the fun of being up there and not being recognized as mef' said Roderick. I can act crazy and I've always liked being around kids. Some of the more feisty children get in the way. They pull on my tongue and tail. Others try to see what they can get away with. - Lisa Mclnroy I 241 Junion ra Sandi Peterson Scott Peterson Patrick Phillips Janelle Pierce Jason Pierce William Pierce Bryant Pierson David Pietan Kurt Pietsch Jerald Pilcher Liza Pinsonneault Monique Pint Michael Poe Shaun Powell Laurie Power Jeffrey Purk Michael Rains Steven Randall Conrad Randell Gary Randels Lori Rasmussen Bradley Rekward Dawn Ressler Todd Richard Tom Ridder Tad Ries Sean Riley Kelly Rindels Catherine Ripplinger Jamie Ritter Michelle Roberts Robin Roberts Christine Robinett Joe Roderick Scott Rogers Troy Rohde Mark Rolinger Phillip Ruhlmann Michael Rusch Darin Sanders Kris Sands Galen Sankey Michael Sash Michael Scarbrough Renee Schachterle Teresa Schiller Laura Schlais Darlys Schluetter Angela Schmidt Dawn Schoneman William Schwantes Jennifer Seavey Andrew Seichter Connie Seidel Richard Seres Kirsten Seyffer Susan Shaw Michaela Sheehan John Shephard Mira Sheth Sara Shields David Shin William Shinstine Shelli Shogren Tracey Siems Pam Simmons .lohn Sims Clarice Slick Jeffery Smith Shanan Smith Troy Smith Joel Snodgrass Juniorifl25 Kristen Spande Jerry Speakar Michelle Spooner Gregory Staut Jim Stein Kelly Stewart Jaryl Stickfort Vicki Stroud Jeffrey Stych Cheryl Suggs Tyrone Sutherland Stanley Swingen Ken Syhlman Suzanne Syhlman Mary Tamisiea Michelle Teeters David Tegtmeier Deanne Terry Michael Thomas Kristine Thorson Shawn Topliff Julie Trowbridge Lori Tucker Melanie VandeKieft Melanie Vandekieft Donald Van Duyn Robert Vaughn Tony Wagner William Wahner Brett Walker Melissa Walljasper Laura Walz Lori Ward Candace Warner Tammy Way l26fJunion Ward orthrup Juniors lose classmate Ward Northrup, 18, a member of the class of 1984, died November 18, 1982, in a one-car accident on West 27th and Union Road. Friends said he was a very understanding person who was really open. Many people respected him. He enjoyed hunting and the outdoors. One friend said, I never knew how close we were until he died. He made your day feel brighter, said guidance counselor John Nero. He had a winning smile. Teachers and friends said Ward was quiet, friendly and good natured. 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2-1 Nr X 1 1 A i , we fi TI sg. 5, Vr,, 1175 Le: tg. .lv I' . 12,3 ly 1 2155 t 1 I X, X S ai , new 1, J f.- xg'-f' James Weatherly Melinda Weber Greg Weigel ,- David Wendland -rg' Jeffery Whitaker Matthew White Charles Whitlatch Cynthia Wieland Laurie Wiener Michelle Wikner A Katherine Wiley Y Brad Willhite Lisa Willhite Troy Williams Diane Wilson ' T Stephen Wilson .1 o Denise Winkey Danette Wohlert Dana Woodbury Timothy Woods Kevin Woodward John Wright Chris Young Tracy Young N J. Bunting Friendship pins: Cheap, fun Friendship pins were one of the fads that began with elementary kids and worked up to the high schoolers. The pins consisted of colorful beads on safety pins which could be worn on shoe laces. One could give and receive them from friends, relatives and teachers. Kids really took them seriously and they were a status symbol for them. I think they're just for fun, said junior Laurie Power. I think they're pretty neat. They're a simple reminder of your friends, a junior said. Other people felt that they were kids' stuff. Interviewed in January, a spokesman for I-Iarrison's on the parkade said, sales of supplies were slowing down. Spokesmen for Woolworth and the Craft Shoppe at College Square said there was no decline in sales. Sophomore Michele Laipple said, I don't think the fad has passed. - Marlene Kampman Juniors! l 27 ' ..' , Q, I ' f ile, K K ess: K A R . ,. i LV . . .- , . b.V, 1 H- ' ' . fi . - T: .A 47-ei I I .15 Q i' :eg , ,., ,,, ,,. I filth if -I A ' ' 4. W Q 1. ,kV, ,,..V 4 fi X Q . .I ..k. N 1 Ja' ' r , I Q.'. - 1 Q l I - fl5sQgL-..Q1 as I f Semors complete a A . p s M. Trunnell ' SENIOR CLASS ff , f l ft, K d' K ll, ' 'd tj St D ' , 'd t, and Shelley gs J Pfalzgran secremrjlhtizrjurgpm e an 1 ru viccpresr en eve avis presi en W IN HIS FAMOUS Tiger body paint, Cliff Mohling cheers at a home football game in the dome. S. Ripplinger PRESIDING AT the Homecoming coronation assembly, Rich Young introduces a candidate. I 28 f Seniors We 'N -iimfe 95 wr 5 1. . 52 3 if A 4 'fi' Q 21:2 -fry? r. '9 ff .1 ' -2 't' 111. 4-. 3. SQ 'E . 1 . 1 'i 4-- --1 '..-- A K . - Q'-. 5- ' 1 X ,:- -sr.. , wif. 'fe Q: gif' . 5: :III V3.2 ':.:p:.f'f:f!, '-' .- IPP? ' 555 5 gaze fgef-Q.-fs. . ' T2 f E' 4 Usa. - ,- ,.., ,Ag . . 7,2 w su., fa. wafer, .f 'M' 4 v,..,, fc., 7- -,' 3 -- iii?-' it. 'Lg 3341. 4 732 7' lf.-, .:f.1- 1 ' Aq ,3L1g3. , :PV Ye -' 12 ' eq.. iff. f I r I if53:i.,,i .A : f. -r,v?. 'C 'YR 'JJ' fv A is A-1 S ,M I ' . I .W I , fr L. Mclnroy Coming a long way to graduate May 29, seniors finally completed their years at CFHS. Class members excelled in athletics, academics, music, drama, speech and journalism. After a controversial vote in which class members originally chose tan and brown as their class colors, rose and ivory were selected in a new election. The class flower was the red rose and the class motto was I will not go where the path may lead, but I will go where there is no path and I will leave a trail. RELAXING ON some wrestling mats in the gym before heading for track practice is Bob Bisbee. T. Eng: PHIL WOODY of the band Dusk plays his bass during the Homecoming dance. Xa 'uv' Y-ef jc? ' ,of-. fi j f K-V Lisa Ackerman James Adams Jay Ahlman Mark Albright Ronald Alexander Sean Alexander Linda Allard Karen Anderson Karen Lynn Anderson Magnus Andersson Michael Anderson Mark Aneweer Jerold Aperans Cory Aschbrenner Alex Azar-Perez Satoru Baba Michelle Baker Kathleen Bates Karen Baxter Lionel Bean Lori Bean Rhonda Beckman Robyn Beebe Becky Beener Tamara Beener Mary Bennett Scott Bergmann Tracy Berry Amaia Betelu Tammy Bigelow Senionj I 29 Speakers stress drug' awareness In the tradition of anti-drug crusader David Toma, who spoke in Cedar Falls in 1981, two other speakers came to Cedar Falls High School in 1982-1983 to speak to the student body about drugs and alcohol. Carl Eller, a former Minnesota Viking, spoke November 8 on drugs and drug abuse within the National Football League. Eller, a former drug addict, said, I felt I was a worthless human being. I added up all my assets and ended up with a zero. Trooper Michael Gilbert of the Iowa State Patrol spoke to the students about the SADD CStudents Against Drunk Drivingj program on February 21. He said that the program stresses ufriends taking care of friends. True friend- ship is not getting a friend drunk and then letting him drive home. The program also involved sign- ing a contract between parents and students, stating that the parents would pick up their kids if they were too drunk to drive. Eller said, We have a great bunch of kids in America. They're our resource for tomorrow. We do owe them something to hang on tof' - Heidi Noonan .V . -W v W , --A 1 TQ' A ' . m: 'g'.' 4, ' 1152? - . Y ,sa .-2. fi1f.1:1.3E HF SPEAKING A T an all-school assembly in the gym, former NFL player Carl Eller discusses his experiences with drug abuse. He told students that drug dependency is a progressive disease. , p V A Lla M 'bg r Lisa Bisbee iiii 3 Robert Bisbee af' -Q. Bobbie Blum ' W , Judy Boehmke .rf Angela Boelman Mike Bogatin A Dennis Bolte Michael Bonner Kelly Boos Laurie Boyer Denise Brewster Kyron Brimmer Brenda Brinkman Debra Brown Jeff Brown l30fSeniors , 1, ,4 'g's,,..,,.-1-f '4f'3'r Q34-.?f'4 5i'i ,.-Q.-o f , nnhiawufzi N L, C E y . y i -is X 112: f' ,vz4,,,,, , fi Q X Mark Brown Tom Burke Faith Burks Craig Byall Larry Byvank Kara Cahill David Carlson Stephanie Carlson Lisa Case Caesar Castro Ray Chan Michael Charley Lori Cherney Greg Chilcote Douglas Clark Rhonda Clark Scott Clark Mark Clay Diane Clow Mark Collum Aaron Connor David Conrads Andrew Cook Adam Corwin LeRoy Corwin Penny Corwin Connie Cowell Gregory Cowell Kimberly Craig Troy Creery Seniors! I 31 David Crooks Carol Crowe Cheryl Curtis Lisa Danielsen Kelli Danner James Darrow Leatha Davenport Karen Davis Scott Davis Steven Davis Jeffery Dawson Douglas Decker Donald Dettbarn Janet Dickson Charles Dix Mary Dotzler Jon Dowler Laura Driscoll Deanna Duncan Terry Durbin Georgene Eastman Timothy Eckert Jon Ehlert Kraig Eichelberger Martin Elbert Scott Engen John Everman Cynthia Faris Barbara Farrell Michelle Felts 13 2fSeniors Sick. gl' Teresa Ferson Corrina Finch Gary Fisher Jodee Fisher Michael Flagg CT? V121- n 51'- Bruce Folchert Carrie Folkers Dori Fouts .Ion Franklin Michael Friedel EDUCATKJN Z DISCUSSING FUTURE job opportunities are, from left, Brenda Trangsrud, Office Education coordinator Sue Hahn, University of Northern Iowa career counselor, Ken Jacobsen, Penni Sclzlimmer, Lora Wetzel and UNI Liberal Arts Placement Director Pat Bassett. Business seminar discusses career opportunities, trends Business seminars were offered to students for the first time November 16. All students were allowed to sign up for various sessions. Speakers came to the business department to discuss future career opportunities and help students consider careers for the future. Some of the speakers were John Cardos, Viking Pumpg Dr. Larry Routh, Ken Jacobsen and Dr. Patricia Bassett, University of Northern Iowag Diane Kupferschmidt, Waterloo Savings Bankg Tim Raymond, Younkersg Claudia Hov- den, J. S. Latta and Company, and a panel of recent Cedar Falls High School graduates. Sue l-lahn, Office Education coordin- ator, felt that the seminars were very successful and that the response from students was positive. Business education department chair Elayne Blumhagen said that the seminars are being planned for next year, but with different speakers and topics. Seniors! 133 Movin' to the beat Always on mv mind is the way that most -eople felt about music when they went cruisin' down University. This must be the way most people felt about Willie Nelson's song since he got the top male vocalist award for country music. The top female vocalist award for country music went to Juice Newton. Country music was grow- ing more and more popular among the teenagers every day. The Grammy award went to the rock group Toto, who had the year's top single named Rosanna Some of the most popular groups of the year were Loverboy, Alabama, 38 Special, John Cougar, Oak Ridge Boys and Def Lepperd. Another kind of rock music that hit the charts again this year was new wave or punk. These groups included Adam Ant and his song Goody Two Shoes, The Go-Go's with their hit song We Got the Beat, and Stray Cats with their Stray Cat Strut. Asked whether she bought albums or cassettes, Lori Williams, replied, I donlt buy any. I usually borrow them from my friends and record them myself? Eight-track tapes went out of the market and everything went to cassettes. Kids seemed to buy more records and tapes than they did before. Asked how many tapes or records she bought in a month, Kris Tegtmeier said, I usually buy between one and three tapes every month-w - Laura Frisch Laura Frisch Carmen Fullbright Randy Futch Cindy Gaede Mary Gaffney Warren Goodman David Goodwin Dean Grandon Tracy Grandy Todd Grapp Mark Gray Mike Grieger Teresa Gronowski Mae Guillermo John Haes Kerrie Hagge Steve Halverson Eric Handorf Tena Hankins Barbara Hansen mfsenim 3 ix' K Q -eta.. l X ff., . , . ' J f . . FQEM att, , 2 In i 2 - 1 V+ ,, 5 4 , le .- June Hardwick Julie Harmon Richard Hathaway Jodi Havlik Sara Hawkins Brad Hazlett Bradley Heath Brett Heath Wendy Heath Jeff Heckroth Jim Hein Amy Hendrickson Bill Henning Cindy Henninger Randy Herman Rick Herman Jill Hertle Mary Hesse Linda Hileman Trent Hill sClli0l'lflJ5 Janet Hines Jon Hochgesang Wendy Holland Devin Holley Theresa Holmes Paul Holst Sandra Houston Michael Howard Robert Howard Lora Hughson Brian Hunck Sheila Hurd Sondra Hyberger Connie Ingersoll Robert lzer Bruce James Gayle Jasper Dave Jenkins Brian Jensen Daniel Jensen Kimberly Jensen Kurt Jensen Steven Jensen Teresa Jerke Howard Jones Keith Jones Mark Jordan Teresa Jorgensen Jeffrey Junkins Timothy Kammeyer l36fSeniors Q.. J f X P . xv S si , F J Q .a a vw tw' ,ar 'J , 4 'E R faevr4 V X is xx. Q A fl Q ,gy '7 ? f it I-t 'l',9'!44-fiat 9 N P' 1 UG Q f N., I , Sf? 53 'X K E -N.- 'I at if A-ff-Q an f' f xiii- I AV' .7 fi if 'SPS' f xy, M. Weber SMILING FOR the camera, Darrin Klapprodt poses for photographers Jill Lehman and Dawn Nyim for the Men of CF Calendar. Fund-raiser raises eyebrows The AV Club, as its major fundraising project, put together The 1983 Men of C.F. Pin-Up Calendar. The group got the idea from calendars done of the men of UCLA and the men of the Big Ten Conference.Vot- ing for models was opened to all girls of the school so the choice would be impartial. Senior Becky Wheeler, committee chairperson, said, We figured if we got the guys who were really wanted, more girls would buy the calendar. There was a wide variety of settings in the picturesg some were indoors, and some were outdoors. We wanted the backgrounds and the guys' outfits to correspond with the month and season they were in, said Wheeler. The calendar men, in the order they appeared, were seniors Ken Kolthoff, Darrin Klapprodt, Nick Winkey, Troy Stedman, Scott Treiber, Rick Herman, Taylor Pine and Dennis Freeland and juniors Greg Larsen, Doyle Hansen, Mark Laylin and Kevin Kelly. Calendar models filled out personal questionnaires which included their vital statistics, hobbies and future plans. These were included in the calendars with the pictures. Most of the guys were very cooperative. Some were a little embar- rassed about it, but I imagine they were flattered to be chosen as one of the twelve sexiest guys in the school, Wheeler said. Social studies teacher John Mullan received five votes, and was a candidate for the cover, but lost to the traditional CF emblem. I was flattered of course, said Mullan. Somebody must have owed me a favor and stuffed the ballot box! With the profits from the calendar and other club fundraisers, nine members, club sponsor David Bullers and his wife Alice flew to New Orleans over spring break. X. Seniors! 137 Camie Kemp Thomas Kerr Jason Ketter Benjamin Kieffer Steve King Kathleen Kirkle Trisha Kirkpatrick Karla Kittelson Steven Klages Kelli Klammer Timothy Kleinmeyer Stacy Klotz Judy Kofron Dawn Kolpek Ken Kolthoff Barry Kramer Scott Kratchmer Kandi Krull Laurie Kuepker Tamara Kuehl if l X 'f 5 . as S . bfi. ,V t 'fin B f t g ' ,. My , g ' Al '- ,. if ' as lf? ' 'T or I, .1 MXAXSXH steps down from eleven-year reign Hawkeye, B. J., Hot Li Colonel Potter, Klinger a. Father Mulcahy - all wel members of the often watche and much adored television serin M A 'S 'H. J The program left the ai forever in February 1983, Tl show began its eleven-year run September 1972. Chuck Bradford said, Tl program was a realistic depicti of life during war-time. It became apparent that t nation also felt the same way Stores soon became stuffed wit various items bearing thi M 'A 'S 'H insignia. Several area groups, such a Amvets, Young Life and Thi issfsgniun 'Z' bl' 7 x i 2 Xx X rr ul 5-may K .-L I Victoria Kuehl Linda Lambert Barbara Larkin Lisa Laughlin Michelle Laylin Cindy Lee Dawn Lentsch Todd Letney Lance Leverenz Neil Lewis Mitchell Lindberg Brenda Little Mike Llewellyn Pat Lonergan Stephen Long Roger Loomis Mark Love Ryan Love Brad Lybbert Carolyn Madsen 'econd Base Lounge, sponsored fI 'A 'S 'H bashes to watch the lnal show. People dressed up as heir favorite M 'A S 'H char- cters for contests in hopes of 'inning prizes. It seemed that the last pisode of M 'A 'S 'H was more ublicized than the Korean War self. Members of the cast and ew appeared on numerous 'iagazine covers as well as ewspapers to say tearful good- yes. y Major companies parted with thousands of dollars just to ir a short, 30 second commercial the final show, watched by illions of families across Amer- a. In the final episode of M 'A S H, Hawkeye was in an institution because he had had a nervous breakdown. Charles Win- chester put together a band in which he grew close to a member who was killed in a bombing raid. B.J. had the opportunity to go home, but declined to leave until all his buddies left and withstood the bitter end. The biggest surprise was that Klinger decided to stay and marry a Korean girl who refused to leave until her mother was found. The final quote from the M'A 'S 'H series said it all to most of the fans of their beloved program: So long, farewell, Amen. - Heidi Noonan E I DECIDING TO buy a U.N.I. takeoff on the M 'A 'S'H insignia printed on an army green T-shirt is Janet Sickles, an avid viewer of the war time hospital series. Senionf I 39 Exchange students get involved Seven exchange students attended classes at Cedar Falls High School during the school year. From Europe, South America, North America and Asia, the seven were active in the high schools sports and activities. Magnus Andersson from Sweden participat- ed in track, soccer and Varsity Choir. He said the thing he most enjoyed about life in the United States was peanut butter. Alex Azar-Perez of Mexico said, The most fun I had during my stay in Cedar Falls was snow skiing. I had never seen snow before I came heref, Azar-Perez took photos for the yearbook and drew cartoons for the Tiger Hi-Line during his year at CFHS. Satoru Baba of Japan participated in basketball, Jazz Band, tennis and Varsity Choir. I wanted to learn English better and to live on my own, said Amaia Betelu-Bazo from Spain. She was active in band, Ecology Club, Gateway Club, Model United Nations and United Stagecraft Workers. Ernie Castro from the Philippines went out for bowling, cross country, band and track at CFHS. He also worked on set construction crews for plays. Ying Chinwala from Thailand was the only sophomore foreign student. She spent the year living with relatives in Cedar Falls, returned home for the summer and planned to return to CFHS in the fall. Anne Pelzer of West Germany said she thought football was destructive I can't see what they enjoy about trying to knock their opponents down, she said. Pelzer was active in Ecology Club, Gateway, Model UN, orchestra, United Stagecraft Workers and varsity choir. Pelzer said she wanted to say thanks to everyone that made my stay most enjoyable. -JoAnne Bach EXCHANGE STUDENTS - Back row, from left, Ying Chinwala, Satoru Baba and Ernie Castrog front row, Alex Azar-Perez, Anne Pelzer, Magnus Andersson, Amaia Betelu-Bazo. STARING DOWN the barrel of an antique rifle held by modeling a Nazi helmet. Satoru Baba 'bounds the charge. ' ,QW i Magnus Andersson is Ernie Castro, ,, ., ig I A. Au! DINING ON traditional cafeteria food are Amaia Betelu, Anne Pelzer and Ying Chinwala, eating fish fillets. , 1 ,C 3 g , , I 1 I 5129 'E C- .fl TW: , M7 ' , W f , Q, . 1 ..-r H. ,U V -' . L., 4 'wx-W, we I V K ,ii m s, J - ,,,, ,. . ,j,,.k 3 .M ' ! - ' Jw ' . ' ..s.. Q -1, . ..LJ2.1ViWQR D f . ,W 1 Q .. f I , . Q' ' 'aaa f tif 4' Q' ' qv at ' 'KIA . gf' l 401 Seniors QI? Qu ' In l h If 'P u.-. 1' gy , exif aff' -4 'S 'L 'L rg K. 114 If sas. it .L.: 3 I .Qt y , ,.--X 3 C N - ef .kL',A m1xX Ken Madson Jerome Magee Laura Maughan Linda Maughan Teresa Mayne Rhonda McCulloch Todd McDowell Lisa Mclnroy Mary Mclnroy Ronda Meyer Christopher Meyers Jeffrey Meyers Elizabeth Michalek Angela Mikkelsen Claude Miller Gregory Miller Melanie Miller Theresa Miller David Minehart Sheri Minikus Kimberly Moe Margaret Moes Clifford Mohling Kory Moyer Sari Muammar Jeffrey Mundt Robert Munoz Thomas Murdock Ann Murray Kendall Naber Seniors! 141 Janet Natvig Timothy Neboda Rachael Nelson Mark Nickel Terri Nicol Teresa Niederhauser Lisa Niedert Kristin Nielsen Dawn Nijim Jodi Nottger Pauline Odekirk Tracy Odle Steve Oehler Jeffrey Ohrt Todd Olson Ross Oltmann Terry Orth Lisa Paulson Brian Pech Brian Pedersen Anne Pelzer Emily Perry Lisa Petersen Michelle Petersen Mark Peterson Michelle Pfalzgraf Pat Phalen Elizabeth Philips Tim Pietan Taylor Pine l42fSeniors A 1 as Q 1 L lx, . .xtN.. , , S. Ripplinger LOOKING THROUGH all of the mail that different colleges sent her, Betlz Philips tries to decide on what college has the most to offer. College junk mail: a waste of time One of the burdens of being a senior is opening and reading vast amounts of mail. Mail is sent by colleges, trade schools, the military, and other institutions, all interested in having the future graduates enroll in their institutions. The onslaught of cards, brochures and letters usually begins just before the start of the senior year. Lora Hughson felt that most of the college mail was a waste, but that some of it was worth reading. Penni Schlimmer said she stacked all of her mail up to see how much she received, but she didn't read much of it. The general opinion of most seniors was is that if you are really interested in a particular institution, you'l1 seek that institution out. - Scott Ripplinger .ee sat Rad Jill Pitsenbarger Jayne Plantan Carolyn Pope Nuf' ...Jef Rebecca Price Keith Probert F., fir. More Rukku Rao Duane Rapp Robert Rasmussen Gary Reed Brad Reifsteck Q . he t stave is T, . , 7 , Q ' F ,ll zz , Q X et 'V '.i. Te :ES ff fi R? ' 5 ei ' 5154-V' 'I t Q' . , ' ii ii ., .. '53 7 Mona Rhoalds Q 1 ' A Joseph Ric :LL , an 1.4 J, Lisa Richtsmeier A 'gg' . O fr I Dave Rider -IA A f .i Q - Linette Riley , shams. a. - 'Z---Q, t 'ii: ' :if. iii Seniors! 143 Scott Ripplinger Kimberly Ritter Valerie Robinson Brian Rosteck James Rule Paul Runkle Linda Sadler Eric Salmons Dawn Sands Loren Sandvik Judy Sater Penni Schlimmer April Schneider Jennifer Scholz Scott Schultz Daniel Secor Penny Seufferlein Michael Shaw Dawne Sheibley John Shin Kathleen Shinstine Janet Sickles Carman Siems Kip Siems Melissa Simon Kurt Simpson Todd Skaine Caterina Skiles Kimberly Smith Lori Smith l44fScniors 41 , J . ' 4.f1f13ff,f PF K J 1A ,.'z ' Paula Smith Steffany Smith Monte Smock Holly Snyder Stephanie Snyder R. Chase SHAKING HANDS as they leave the field after the Tigers received the Class 4-A runnerup trophy in football are Mike Flagg, all-state tight end, and Kurt Jensen. R. Chase IN A PUDDING PLOP contest during the Sadie Hawkins Day assembly, Karen Davis tries to hit king candidate Scott Treiberls open mouth. Memories of '82-'83 Seniors experienced many different emotions during the 1982-1983 school year. The atmosphere of the year ranged from the somberness of the football team playoff loss in the 4-A final to the wild and crazy times of Sadie Hawkins. The fall of the year brought excitement as the varsity football team won the conference outright. Dawn Lentsch brought home three medals after winning the 800, 1500 and 3000 meter runs at the state track meet in May. The year was filled with memories and emotions for the class of 1983. -Beth Philips Seniorsf 145 r llllw, A r K I L H O Y W A S H E Fl E Fans rock in Dome Styx Kilroy Was Here tour performed to 11,000 fans May 15 in the UNI-Dome. The formula that Styx wanted to get across was just one statement: Kilroy Was Here!,' The Kilroy Was Here tour combined cuts from the group's newest album on which the concert was based, withi songs from the albums, Equinox,,' Grand Illusion and Paradise Theater. Kilroy Was Here, was a story based on the near future, when rock and roll is banned by a group called the MMM CMajority for Musical Moralityj. Before Styx went on stage for the two-and-a-half hour show, a 10-minute film entitled Kilroy Was Here was shown. After the film, Styx went on stage with their top-ten smash hit, Mr. Roboto from their newest album Kilroy Was Here. As Styx was playing the first song, Japanese robots walked on stage as a sign flashed Kilroy.', , Members of the group Styx - Tommy Shaw Qguitarj, Dennis DeYoung Ckeyboards and vocalsj, James Young Qguitarj, Chuck Panozzo fbassj and John Panozzo Qdrumsj - showed their talent on everything they played. J Dennis DeYoung showed his skill at playing the song Come Sail Away on the piano. Tommy Shaw and James Young showed their stuff strutting and dancing about the stage with such songs as Too Much Time On My Hands and Cold War. Styx fans left the UNI-Dome with the feeling Kilroy Was Here. l - Todd Steve Soldwisch Erik Spande Wendy Spier Sandra Spray Kirk Stainbrook Carlton Stansbury Ann Stark Troy Stedman Troy Steffy Susan Stoll Pauli Sukovaty Dorothy Sullivan Diane Sund Jon Sutula Deborah Svobodny l 46 I Seniors ty, tg, ll fl! 15. is just one of the talents Dennis De Young has besides playing T. Engels and uiano about 11,000 fans watched Styx perform in the UNI-Dome TOMMY SHA WKS' flawless work is shown as he plays guitar on one of Styx's hits, Too Much Time on My Hands. 'kia 'fin el' MK In :Q ls - l ififi 4-V. ' , ?i:, 55Qf3 . kQ,v,1. zriszzfsx K ,mr xxx Troy Swallow Mike Swyers John Syhlman John Tamisiea Teresa Tangeman Sarah Teaford Margaret Tedlie Kristy Tegtmeier Rex Terry Michael Thode John Thomas Maleia Thompson Kari Thorson Lori Titus Heidi Topliff Seniors f l 47 Brenda Trangsrud Jim Trangsrud Rebecca Trebon Scott Treiber Daniel Trotter Susan Truax Ronald Trumbauer Mark Trunnell Jeffrey Ubben Cathy Uhlenhopp Mary Vander Berg Julie Van Der Meer Jay Van Vark Troy Vaughn Lisa Ver Mulm Anita Voigt Ilya Volfson Kelly Voss Sara Walker Jim Walljasper Brian Walter Joel Walter Brian Walton Drew Waseskuk Belva Weber Kevin Wellman Lora Wetzel Wendy Wetzel Scott Weydert Elizabeth Wheeler 148 1 Seniors 9 1 ar X .B XX , 1, .Q -3 .--Y ' 5 ? 2 lam ! lin ff SX Q 4 qw X., S 3 X Q U, hr 2: K X 5 ,eq Yagi if ,- 1 '!t ftnf' pf:-. + T'-a ..+ W 'K 'ig-,: ar ,' , ,ww xl T? 1 Rebecca Wheeler Jill Wiederanders Kristin Wielenga Aaron Wikner Catherine Wilcox 5.3 I , H anna 5 W, . 'wif U s o f A Q V . says, - M x K T. Engels IDENTICAL TWINS Rebecca fBeckyj, left, and Elizabeth fBetsyj Wheeler pose in the high school library. The Wheelers were one of I0 sets of twins enrolled at CFHS. -,r-?g......Ir.x ' igmxgb, ' X LAUREL, left, and Lisa Whitsett show their cheerleader smiles. M. Trunnell CAMOUFLAGED as crayons, Sarah, left, and Susie Hewett participate in Sadie Hawkins Day activities. Double Vision Ten special sibling pairs were members of the year's Double Vision Fan Club. Twins included Rebecca and Elizabeth Wheeler, Lisa and Laurel Whitsett, Laura and Linda Manghan, Susan and Sarah Hewitt, Karen and Steve Davis, Michelle and Melanie Vande Kieft, Chris and Noel Congdon, Gerald and Gordy Sorensen, Todd and Troy Case and Kary and Karla Gavlock. Twins occur once in every 96 births, although identical twins are much rarer. Seniors f l 49 David Wiley Lori Williams Amy Wilson Nick Winkey Shelli Winkey Michael Wise Andrew Witt Laurie Witzel Philip Woody Carl Yokem Lori Young Michael Young Richard Young Todd Young David Youngblut Paul Zeschke Eric Zucker Maryjane Cunningham Steve Hill Brad Himebaugh Melissa Huffman Jolene Klingenborg Don McNair l50fSeniors INS K- fr, i in ,AJ U: Y? i 4 iff 43. Aiuixizziliw f A e 5129 rail A' 'ii X rcflf f 1 'clk 1-' MN 'X . , , 1' A' f L f 3 had to sy A N K if DN ,KQV fwik Rii- Ev- Q. f jf f- .fffffpf V. n ' Loren Sandvik ff 'ifvm 42' , .V . '1 Luv! m .. N :Q ,. if wit' -- P .. - W 4 , AL.. M Q- , 5' f Y, 'fl : 'I x X Zf ., x L 4r 'Q -1 R 'b it 'cf NW , 'f tw, 'iv cl 1 45 in 'Q YZ n , ffjgyv , 4 , -fqzfail I 6 52 5' ,ff 7 Hilcman V by qs: iff v 'Q' Q .V-,upvfff -'.,-13.4-,-- ,'x.1, -'flung-'xx . A . ' . f HT5'Y- , - ' n P 1 sf n ., 7' 'Lf'IF,3gj,'-'i,.E1 'f QQ ' if ., .gi::f4Q?f' 'fha , -v - v . ::v.,..,.n, f ,1Ef 1iQ g3i '-'RP , 4543 Rom - A ,..,JE,f.n' f,f.?W: :f:: g:1i'?uvfgW, . I-Qaxzf. .f '3!,5fAl31fgx 'lgwwxfhg xi J,-. X n n f lf g'.zg.j',Q-ja rx ,.,,Qf?Q n, i 7 Q, Eg gl . Vw qifrflw. fvgQ.',,I:tV,'-ix Zi, .Jw ,K . Qwq x ,,,.,. .. , ,W 'rjgffq ,jawn gy- EH V' .1 - ,k.1VvAn' V 'Af is 11 wxq- . Q - 3 -, s 1 Pio. -gf' : 51 , , ' 'F' . ..': 1-N5 ., . NL f T' fi .LI X- .- K .-' Linda Hileman Dan Jensen Seniors! 151 lXfe've come along way YO11,I,f.SQl1lQI,M year is a year to remember.:Q'Itfsii2.,fthe,l,1,,last year of public educationgandi'iafter.4thirteen years of it, not havingit isa big change. The memories of the year range from academic, to extracurricular to social. Academic memories include memor- ies of big tests, great teachers, rotten teachers, field trips and many other things. Kris Tegtmeier's favorite memory was being in OEA fOffice Education Associationj. It was the best decision I have ever made in high school. It has given me a lot of courage to meet new challenges, and best of all, meet new l52fSeniors friends, she remarked. Extracurricular memories 'cover sports, clubs, theatre, speech, debate, cheerleading, pompon and flag twirling. One of Kerrie Hagge's favorite memories was getting involved in flag twirling. She was especially glad she got to see the football team go to state. Many of the other extracurricular groups had outstanding years. A group of cheerleaders fwcnt to, a national competition. Many outstanding athletes went to state in a Variety of sports. Speech sent a state finalist to the nationalf competition and theatre put on two excellent plays and the Variety Show. Other clubs and groups came a long way too. Social memories include the dances and personal memories. The most memor- able dance by far was Prom. With the prom things just seemed to flow together naturally and made things all the more fun for my date and me, commented Mark Gray. Common personal memories had to do with friends, family and especially boyfriends and girlfriends. I found someone really special who made this year best of all, said Hagge. - Lisa Mclnroy - Laura Frisch l I l I Don't dwell on the past, but look forward to your dreams for the future. - Kerrie Hagge I've enjoyed my lrollol ihighigfschool years. It's somethingfl' will 'always remember. A big thanks to all my friends who I will miss very much. - Denise Brewster P Through classes we have known many people and have made many friends. Now looking back, the time we shared was so short and the time ahead needs to be spent by making the best of each day. - Linda Sadler ! Boy, if my teachers only knew the stuff I put over them! Be good the first two years and live it up the last! I Opportunity knocks dnly once The man Who Says he'll meet but temptation leans on the YOU !1E1!fWaYUSU21!1yihiDkShC'S doorbell, the dividing line. - Mary Gaffney 2'if757 - Angie Milclcelsen -- Dawn L. Nhim GRA DU The hours pass, 4 T10 and soon I realize I may never see these faces again. One by one, all discard school life p and move on to the outside world. ,Clutching ia simple folder called a diploma, They pass old friends and make new ones. . :1Good luck to everyone in the I A warning to sophomores: ! Beware of teachers: they're out . to help you. - Lance Leverenz iluniors, only one year to go! Q Make it your best! Sophomores, ! you're stuck for two more years, I hang in there. Sorry, the best l class is leaving. The class of '83 rules all. - Dawn Kolpek I u Push, pull, or get out of the way! - Linda Maughan -Dawn K olpek I feel sorry for incoming sophomores with all of these schedule revisals and new required courses. Have Fun! Keep studying 8a he good. - Krisfgtlfegtmeier Thanks i teachers for imaldng my lsenioif year fun andspecial. I'll always' remember you! , V -- Judy Kofron of .Senior class. I am really going to miss all of my friends in the future. I just hope that we can stay in touch.. Myffriends really helped make my senior year the best for me. Thanks a lot to all of my friends and teachers. , - Laura Frisch Make the most out of each day for it could be your last. Time is too precious for us to merely make today a rehearsal for tomorrow. - Rachael Nelson Well, itls been great here at CF but it's terrific to finally get out. I hope that you sophomores and juniors will make the best of these years! - Lisa Mclnroy Senionfl53 l A K - tt f - 1 if W my .N . s , T if S s V A. Amr DIRECTING MIXED CHORUS during his linal concert Vocal Music PRESENTING JOHN EVENSON with a plaque from Varsity Choir, Mixed Director John Evenson puts all he has into bis directing. Chorus and Pops Singers is senior Varsity Choir member Jeff Mundt, Evenson was honored by former students and colleagues at his final choral concert in May. Hazel Alter, aide, individualized reading Harry Anderson, social studies Norman Anderson, science and mathematics Bill Bader, mathematics Julie Bailey, librarian Katherine Beebe, reading laboratory Velma Biclcner, laundry W Cindy Billard, foreign language Charles Blair-Broeker, social studies Elayne Blumhagen, business education ' 1 i Anne Boerschel, physical education Kristine Brimm, learning disabilities Marilyn Bruce, clerk-typist, library Gayle Bruene, clerk-typist, attendance Frank Buxton, science .MQ Q 1 54fFlcul!y 29-year vocal music director makes his final appearance Vocal music director John Evenson, who had been with the high school since it opened in 1954, retired at the end of the school year. I came with the package, laughed Evenson, who had been teaching vocal music at CFHS since the school moved from the Main Street location almost 30 years ago. When I started, there were three main groupsf' he said, acappella choir, which was the men's and women's chorus, and boys' and girls' glee clubs. There were various small groups also. Evenson added groups such as Jazz Singers, Madrigal Singers, Varsity Choir, Mixed Chorus and Pops Singers. Pops Singers was a girls' glee club, but was changed in 1977 because of the specialization of the popular music. A men's and a women's chorus were also added this year. Chamber Singers was one of the small groups existing from the beginning of Evenson's teaching career. This group was removed from the curriculum 13 years ago and revived during the '81-82 school year. Acappella choir was also dropped from the curriculum. Evenson also started a chorus clinic along with Director Allen Hagen of Waverly-Shell Rock High School. The two mixed choruses commuted between schools every other year to present a program for the other school's chorus and to present a concert of the combined choruses. In a combined effort with band director Hugh Eicke, Evenson also formed the Blood, Sweat and Jazz concerts that featured Jazz Singers, Jazz Band and selected soloists. Evenson was also state choral chairman for three years and directed all-state summer camp chorus. Some of Evenson's other accomplishments included having Varsity Choir be the guest choir at the Dorian Festival at Luther College in Decorah and at the Tallcorn Festival at UNI. His Varsity Choir was chosen for the record of the month by the Iowa Choral Educators Association and was featured in the Iowa Choral Directors Magazine, Choral Journal. Jazz Singers were the only featured group at the Schmitt Music Company and were featured in the regional convention of American Choral Directors. Jazz Singers were also runners up in the National Association of Jazz Educators contest for the '80-81 school year and were third for the 81-82 school year. - Scott Ripplinger 1 X - f f 5 , 5 1' ' .VX kt . Robert Carter, social studies Craig Criswell, mathematics Jeanine Davidson, home economics Marianna Delafield, art , 1 Linda Demsky, foreign language -. wc., i ' Afffl ' . -. .1 - W N . . , ,-'s..a,', Karen Dotseth, mathematics Dennis Downs, orchestra Gene Doyle, driver education Dean Dreyer, associate principal ' Ann Eades, home economics Oliver Eason, science Hugh Eicke, instrumental music Diane Engel, social studies Richard Engel, driver education John Evenson, vocal music Faculty! 155 Marlys Folkers, home economics Mary Franke, teacher aide Audrey Freitag, facilitator, English Judith Funk, journalism Larry Gruis, English Cora Guillermo, learning disabilities Helen Hahn, secretary, music Sue Hahn, business education Olive Hambly, social studies Da vid Harris, mathematics David Heeney, business education Margaret Juhl, English Rebecca Kemming, business education Susan Kimball, English Barbara Klein, business education Gerald Klink, business education Barbara Koble, mathematics Charles Koch, English and speech Robert Loslo, English 1561 Faculty Young' retires from coaching Cedar Falls head wrestling coach Keith Young decided to retire after 32 years of dedicated service to Cedar Falls High School wrestlers. Coach Young said he had been thinking about retiring the past couple years and decided to step down following the '83 season to make room for a newer, younger coach. Coach Young said he had many highlights during his coaching career at Cedar Falls. He took many of his wrestlers to the state tournaments and had them walk away with victories. Mike Llewellyn said that he was shocked when he found out about Young's retirement but was not really surprised since Coach Young had talked about retiring for a while. Llewellyn also said that the new coach would have a hard time following in Young's footsteps. Larry Munskgaard, Cedar Falls High activities director, said that Coach Young is truly a legend in Iowa High School Athletics, with tremendous skills and examples to pass on to young athletes. He said Young has been a real asset to the school wrestling program. Among Coach Young's other honors are memberships in four wrestling halls of fame, including the National Wrestling Hall of Fame. He was a three-time national wrestling champion in college and is a widely known wrestling official. - Chuck Bradford .iff VA' x 1 ' 'i'l11.' 5.7-T-T517 ' --TI, 3'-'. ,-G'J.'L'2'-'.7.?.f',- 'Q-1-T'J '.Q-TL -.T-T'-'l ---T.'--'.'--L , -.- . -..... ..- .., -..N -3-::.r.r.:7 QA-'-11-:.1e.-:.1-5-'-.-?-.- - --..- ':.-.-T' X 15.2.32-'E':':-:fa 9755? K P' Q- ...-...-..-.-J..-..-.f , f.-.-L-.-..-:-:--.-.-.-.-.avQ 1-4-4- '.. E:'I5- 2'g'Q1Z153'3:5Z:I?:2 'Ne-1 I-:F Q 12e::a.a::4::e:L::E:E:E:3 'fgfllill E1 K. nwvr: mm x. .144 x S K aj if Q , 8 1. f in - K V , 3' N 3? k xv' 5 2 , as 5 E Ng. , W t , .,-Q- Q-2 , . Q'-rf, x . ' Q wt 4 lg ts ., Q A. , - t f :fmt , ' f wff' ,U 1, 9. . 5 ' ,, H? 13 A , f. . like if ' ., J 1 gtg ' N16 ' few! ii.Ivff45 'Fa 'VS' ,-. fm- s QF? f ,gfgiii i 5, Qt . 'g je, ?'jg, 2. .. 1, iii, ,, ,, . , , ,5 ' ,RJ HZQ 'f Hkriilg 37. Qnnng bk , 1 WRESTLING HALL of Fame member Keith Young COACH KEITH Young signals to a wrestler to stand up during a 1962 home meet. displays the plaque awarded to him by the National Wrestling Hall of Fame. Q , I , f,, it wing f r 'x .10u,hx,w h. William McKinley, industrial arts Richard Marcussen, art Erik Melberg, English James Meyer, science Mlliam Morgan, English John Mullan, social studies Larry Munksgaard, associate principal Robert Nelson, science John Nero, guidance Nancy Newton, guidance Raymond Nichols, guidance Jerry Nissen, art Carol Olsson, attendance Karen Orr, learning disabilities William Paup, industrial arts Facultyj l 57 Hambly retires after 20 years After 20 years of teaching at Cedar Falls High School, social studies teacher Olive Hambly retired at the close of the school year. Before joining the faculty at Cedar Falls, Mrs. Hambly taught at Jewett in Waterloo for four years. Mrs. Hambly said one of the greatest satisfactions of working at Cedar Falls High School was the contact with a great variety of students. Mrs. Hambly said she really enjoyed Cedar Falls High because most of her students were so education-oriented. Mrs. Hambly said she often enjoyed seeing former students and finding out what they had done with their lives. Mrs. Hambly is planning to do some traveling and local volunteer work in her retirement. She also added she will miss the faculty and students at Cedar Falls High School very much. -Beth Philips Q . ,, 'iv-X, Q.. OLIVE HAMBLY gives instructions while her sixth hour global history class takes notes. .wg , ..-.e gf P. 'LL ., ..x,,,, .F B Phill Lloyd Peterson, mathematics Merle Picht, speech Jo Pries, guidance Jeanne Proctor, secretary, English Jerry Purcell, guidance 2 Ruth Ratelcin, business education Elizabeth Rath, home economics Robert Rellihan, social studies Charles Riehle, special education Kelvin Schuchart, social studies John Scott, head custodian Jim Seeley, special education Tom Shepherd, science Jerry Slykhuis, science Mary Smart, English 158 f Faculty J Q , N, s . , .3 N jj, School - a family matter i i f1.Yf3!'s P we i N l I l I it I 5 .mfg ia x E fe ' L' B . Philips lSTUDENT-TEACHER duo Cora and Mae Guillermo take time out for a family portrait. There were 13 teaching families at the high school. They included Principal Les Huth and his daughter Amyg science teacher Robert Nelson and his daughter Rachael, art teacher Jerry Nissen, offset operator Marjorie Nissen and their son David, math teacher Lloyd Peterson and his son Scott, and home economics teacher Elizabeth Rath and her son Barry. Also English department head Lee Ver Mulm and his daughter Lisa, math teacher Frank Walter, foreign language department head Lucille Walter, and their son Joel, social studies teacher Leo Walton and his son Briang social studies teacher Harry Anderson and his son Samg social studies teacher William Ferris and his daughter Mary, special needs teacher Cora Guillermo and her daughter Mae, and driver education teacher Gene Doyle and his son Pat. The general feeling about being a teacher, student family was it was great. Principal Les Huth said that he enjoyed being in the same school as his daughter Amy because it gave him a chance to see his daughter more often and it gave them something in common to talk about. Rachael Nelson said that it was neat because she was able to see the true parent behind the teacher. -Beth Philips ' . i Y X Q . 1 .rixiiw , N '95 ,- Mary S taniger, mathematics Judy Timmins, English Marguerite Vance, English Deb Vanderwerf business education Lee Ver Mulm, English Phyllis Ver Ploeg, physical education Linda Waddle, librarian Frank Walter, mathematics Lucille Walter, foreign language Leo Walton, social studies Catherine Wells, foreign language Nell Wilson, nurse Keith Young, driver education Fncultyf l 59 Velda Timmerman, secretary, guidance Vivian Virden, facilitator, social studies Acad mic S, Ripplingcr PRACTICING FOR the variety show is Diane Madsen, who did a solo dance, R. Wheeler PREPARING for ber All-State flute audition at Independence is Renee Crandall. Ml ' K . swf 5 N .f ,...-W M. Thumps WILLY THOMAS, artist in residence, plays wi the band. Students' surviven the dreaded .tests am homework. Cedar Fall High School had an ex cellent academic record The majority of sen iors graduated witl more credits than re quired, because of thei: desire to take classe for college prep aration and because o the great variety o electives, guidancl counselor Jerry Purcel said. The drop-out ratf and attendance rate ar' far 'better than Blacl Hawk County and th- state records. Student are held better by Ceda: Falls High School, saif Purcell. An estimated 65071, o our seniors go on te some sort of furthe: education. About three fourths of those stu dents are planning on a four year college. Cedar Falls student have come a long way ti becoming highly re spected for our higl academic abilities. - Kris Spandl 1sofA-magma.: 'Y 4 ,.,.,.,r',.,':, 'H .-fZg,.'f'11'4 f2ffiv , ' ' 4 P' ff .,!- .1 - M, . ,MX X EXPRESSING HER artistic talent in art class, Linda Hilcman draws a skull. Q t E. Wheels 7 OB VIOUSLY UNH URT after a fall while roller skating in gym is Kelly Boas. Seniurs had the opportunity to skate during live class periods, following, 'instruction on the Hrs! session. E. Wheeler X. fx I M. Trunnell STUDYING HER linaf for the play is Lisa Whitsett. Academia! I 6 l U L g .A ,saw-f M. Tnmnell If ERASING A MISLAID line on lzcr drafting project is Kim Moe. 3' ' 51 if 1 A gil I K M.Tnmnell FILLING IN the detail on a drawing for his art class is Robin Roberts. an 1 . I K ,,.-A wr aww? s -' at sa, C- Bfldfofd TROY VAUGHN grinds down a piece of steel for a metals shop project, LAURIE BOYER pulls some misplaced clay strings from her clay mat, working in a sculpture class. l62fArK. lndlutrill Arts I ,rr it DON DETTBARN examines an electronic car built by electronics students. l Art, industriol orts teoch technical skills Students prepared for possi- e careers and for hobbies in eir arts and industrial arts asses. While students in both ppartments obtained technical ills to help them in careers, ey also learned to express emselves in clay, ceramics, ood, metal and paint. Industrial arts enabled dents to learn skills like lding, soldering, glueing and sembling. Students learned to repair trs, to build cabinets and to do ectrical repair. 'Industrial arts classes al- l lowed students to perfect their basic skills and acquire tech- nical expertise. Department head Paul Hess said he would like to see more girls enroll in all industrial arts courses. He said a new indus- trial arts club formed this year was affiliated with the Amer- ican Industrial Arts Student Association. Club members had one night a week to use the school's shop during the evening hours. Hess said some of the projects students completed in his industrial arts classes in- cluded tachometers and radio controlled cars. Brian Young even built his own computer, Hess said. The art department offered a wide choice of electives, ranging from jewelry making to sculp- ture, painting and drawing. Instructors said they would like to offer courses in photo- graphy, graphics and possibly welding art. Instructor Marianna Dela- field said she would like to see graphic arts offered. She com- mented that she would also like to see an art requirement added. Instructor Jerry Nissen said, We are short in photography, along with graphics and de- sign. Among the students enrolled in art classes, there seemed to be a common feeling that art offered a means to vent feelings and show creativity. Art lets you show your creativity and express your- self, Loren Sandvik said. Laurie Boyer said, Working with clay can be fun because it lets you get frustrated and still come out with a good project in the end. - Chuck Bradford An, Industrial Aruf 163 s is ,f. ,V 7 of Courses helo students prepare for jobs Many students took business courses to further their chances of getting jobs in the future. There were many classes available such as Accounting, Oftice Machines, World of Work and Sales, to name a few. Walking through the business education department, one would see an increasing number of computers and notice that computers were being used in more business classes each year. In addition to learning the fundamentals of computer pro- gramming, the students were learning word processing skills in advanced typing, office education and ofHce machines. As software becomes avail- able, computers will be used more in the accounting and distributive education classes as well, department chair Elayne Blumhagen said. Classes in business should be included in every student's high school curriculum, she said whether they go on to college or go directly into the job market. 'A mqority of people, at some time in their life will be involved in a business or profession that requires some knowledge of business, she said. Many students find an interest in some type of business career as a result of taking high school business classes. 'Students need a back- ground in the technical Hnan- cial and organizational aspects of business, Blumhagen said. This will help them in dealing more effectively with their personal business affairs even if they don't use it directly in their jobs. The business department offers courses that will be of benefit to every student. she said. - Karen Budensiek 1641 Business 5 5 1 LORI BUSER answers the telephone at the reception desk in the business education department where she was employed, T tr 'QV -'ff' A WVk!.., fa .AZ DIANE CLOW programs a new Apple computer in the guidance office where she was employed with the 0fHce Education program. 'Ulu-. L. Lohman CHER YL DeSMIDT checks her lesson book before typing another assignment. Businessf l65 PARTICIPATING IN a volleyball game, L. D. Bean gets ready for a set. Looking on are Brian Walton and Dave Youngblut. FLT M. Tnmnell GIVING THE ping pong ball a menacing look is Brian Pedersen as he prepare to give the ball all hes got. i A an M. Tnmnel ROLLING AROUND the rubber gym during the rollerskating unit are Karel Anderson and Dawn Lentsch. PE, driver ed. moke changes Students saw two changes in the l physical education department, physical fitness tests and a new early bird gym format. During the first few weeks of school, I students in all gym classes had to participate in physical fitness tests. These tests included the 40-yard dash, the shuttle run, the bench press, the bend box, the vertical jump, the 12-minute run l and sit ups. According to department head Jim Renning, We wanted to get an indication of the strengths and weaknesses of the student body and try to improve these areas through the year. resins. fi ,Ye ' . ploy., am,,., W . Ni' . fm, .Q . f' . Y .,.,,L,, . f t Z l GETTING READY to drive their simulators into the horizon are Chris Sorensen, Whitney Lindell, Kurt Ras- mussen, Lisa Westcott and Gary Treichel. DRIVER EDUCATION TEACHER Keith Young gives a few last-minute tips to Stephanie Blonigan and Robin Keegan before getting into the car. Along with the semester change came a major change in the format for early bird gym. Students who pulled cards for second semester early bird were informed that they were going to be used as guinea pigs for a new schedule that was adopted for all gym classes for next year. The semester was divided into three six-week segments. Each class was assigned one of the segments, with the seniors taking the first, juniors the second and sophomores the final six weeks of the program. We try to stress defensive driving concepts, said driver education department head Keith Young. It is important to have figured out what to do to avoid potential accidents and problems, he said. Students also studied everything from starting a car to the drunk driving epidemic. This is the first year that the department purchased cars for use in class. In the past the cars were rented from car lots. The change is cheaper for us, according to Young. Prices for using new cars were increasing every year, he said. In the future, the cars for the class will be cars that the school has already used for other things. - Lisa Mclnroy Driver Ed.f 167 vw' g GETTING DOWN to some serious schoolwork before her finals on the last few days of school is Susan Noack working in the English Resource Cen ter. DURING AN INDI VIDUALIZED Reading conference, Darcy Canby discusses a book she recently read W and answers questions from teacher Margaret Juhl, K . assi -L i ., . A ,,,.,. ., - W 'Y -9l.1,, K. .M ts,-5 T' ff ' f I' KZ. r a E -s. 'E was ,ibkf K ,f,,a ii 'V' 'X . I Wise E x s- , ,aww . A Nw L. Lohman TAKING A BREAK from studying by reading an intriguing magazine is Mark Long, reading in the library. The library provided a necessary break in the routine for many students. English deporrmenr sruole-s electives English department staff members began a study of course registrations. Teachers discovered a strong shift to writing courses and to courses that placed rigorous demands on students preparing for college, department chair- man Lee Ver Mulm said. We discovered some students - more than in recent years - taking advanced level courses for which they were not fully prepared. The department will begin using some prerequisites and competency examinations next year to help place students in proper courses. He said that while examining whether students were correctly placed in elective courses, teachers realized that some advanced level students lacked course opportunities for their senior year. New courses in advanced writing and advanced great books will be taught beginning next year to ac- l 1 comodate these students. Also beginning next year, the English department will begin using its own achievementfcom- petency exam. All incoming sophomores will take the test before they enter high school. The results of these exams, along with other data, will be used to identify skill deficiencies that need immediate attention in high study the changing pattern of student enrollment in elective courses, to see if the students were appropriately placed in their own ability level. He said English teachers are working to evaluate the course offerings and see if they reflect what students want and need. He said teachers will operate an w English department that meets SChO01- the needs of students with ' reading disabilities. - Kerrie Hagge Ver Mulm said the goals of the English department were to 168 f English .xg ' A Q X A: , y 5 fs. N4 I ,I , - . ,,., I E as K A. Amr A. Azar TAKING THE NATIONAL Spanish Exam is Michelle Murphy, In the Spanish division SPANISH TEACHER Kay Wells battles it out with an extension cord three finalists placed in national competition. In the French division there were also three during one of those days. This was Wells' Hrst year of teaching at CFHS finalists, including Howard Jones, who placed sixth in the nation. and also her first year teaching high school students. Language students study Cultures Throughout the year, foreign language teachers emphasized speaking, reading and writing skills. According to Spanish teacher Kay Wells, the goals of the language teachers were to get students to use their foreign language as much as possible in daily classroom activities and to make students feel comfortable using the language. To add excitement to classes, students had occasional cultural experiences with authentic for- eign food, music and games. To practice using their lan- guage, students were required to write and perform their own skits. Students performed for other foreign language classes at the high school and junior high schools. Spanish students went to Des Moines in February to see the Mexican Ballet Folklorico. The dance troup performed authentic dances from various provinces of Mexico, wearing colorful, tradi- tionalcostumes from the regions, The dance troup performed the deer dance, a wedding dance from Veracruz and the Mexican hat dance, among many other dances. During the year, teachers worked to inform students about the history, geography, politics and economics of the countries they studied. Wells said, We try to give them as much cultural back- ground as possible. In national foreign language competition, senior Howard Jones placed first in the state in level IV French, second in the region and sixth in the nation. Stephen Handorf, a soph- omore, placed first in the state in Level II and sixth in the region in French. Sophomore Christopher Sor- ensen placed seventh in the state in Level II French. In Spanish, seniors Tracy Grandy and Trish Kirkpatrick were finalists in the state in Level IV. Junior Dana Wood- bury was an alternate in Level III. Sophomore Tammie Schmidt was an alternate in Level II and senior Dawn Nijim was third in the state in Level Il. Senior Melissa Walljasper was an alternate in Level I Spanish. - Kerrie Hagge Foreign Languagel I69 WN ,si ggi vr lf., bww. :gy - - Q XA.., 'lm , in J 'ii at W' it 5 W4 -aa plum isnt: ia' bf B. Philips MAKING APPLE crisp in his food and nutrition class, Chris Kohn stirs a sauce fabovej. A group of students passes the hour in their cafeteria study hall . hmm H-1 .R ,. fp -. Iabove, rightj. Chopping apples for their apple crisp For 95 cents, students could purchase a school lunch each day in the cafeteria. Government requirements specified that each lunch con- tain two ounces of protein, M cups of vegetable and fruit, a serving of bread and a one-cup serving of milk. The cafeteria staff spent about two hours daily preparing the lunches for the high school and for other school buildings to which lunches were also sent. Hermina Secor, who had charge of the high school cafeteria, said, The favorite foods are pizza, hot dogs and spaghetti. A salad bar, added in the fall, was a popular lunch feature. For the price of a daily lunch ticket, students and staff members could help themselves to lettuce, relishes, meat, cheese, jello and other makings for salads. - Lynn Manley in food and nutrition Ibelowj. K, Budemiek are Larry Byvank and Emily Gill frightj. Jean .1 e - Tim Johnson measures ingredients for a cooking project K' B d '5i ' K. Budensie l70fCafeteria and Home Economics fa,-nl' 4-f 'i J9i1 fy., gt . . fy My ' , . , ...sfbvt ,-, .,. . .. I I . 1 i . I : ' K ' 1 .. ' fi ezs f-V..-J. -I .if A , . -M s. We N.. asus .xsane Y ff Y' ..4 sf P mlb' IN HER beginning sewing class, Marlene Kampman receives help from teacher Marlys Folkers. .Srudenrs learn life skills Almost 400 students en- rolled in home economics xclasses during the school lyear. ' Courses ranging from food 'and nutrition to adult living, kchild development, housing iand textiles and clothing were loffered. The main goal of home . economics courses was to help lstudents learn skills to help them live better, department chair Marlys Folkers said. lCourses were designed to ihelp both girls and guys lprepare for the years ahead. l E Food and nutrition remained the most popular course in the department. Folkers commented, The kids are looking nicer. They seem to wear a wider variety of clothing. Sewing has become more challenging with the ruffles on the new styles. Angie Nelson, who took child development first semester, said, I liked nur- sery school best and the term paper I had to turn in the least. Darlys Schluetter, who was also in child development, said, There's nothing about child development that I didn't like. It was an okay class. Jeanine Davidson, who taught housing, said, There is a noticeable change in students. They are far more intelligent, not just in home ec. courses. I've been teaching 17 years now, Davidson said. There has been a change in what students want to learn. They seem more interested in how to go about furnishing an le -My B. Wheeler WORKING ON a sewing project is Lori Tucker. apartment now. In the past, students were just interested in learning how to make a house look good, she said. Kelly Berry said, Food and nutrition was a fun class. I really felt that it helped me. Marlene Kampman said, I think it's great that they try to teach you so many things. It's too bad that there's not enough time for more things. - Trudy Kratz Home Economics! l 71 IN COMPUTER programming, a very popular class, Kristin Spake and Jerry Aperans program a computer in the math department fabovej. WORKING ON the Apple II computer in the math room, Jerry Ingham attempts to get the computer to answer his question fupper rightj. W.---1 'L WRITING AN equation on the board, ma th teacher Lloyd Peterson teaches his sixth hour math class. l B. Philips programming. l. Aange READING INFORMATION printed on the computer is John Evenson in computef Computer emphasis grows in morh, science Science and math departments put increased emphasis on computers. In the science department, biology was the most basic science class offered. Science teacher Jerry Slykhuis said most students took biology some time during their high school years. More students are getting into complicated and more advanced science classes, such as advanced chemistry and physical biology, Slykhuis said. The science department added its own computer this school year. The computer was kept in the department office on the second floor. Class offerings did not change, but since the students interest went to more complex classes, science teachers said they wanted to add classes so students would have more electives from which to choose. Enrollment for math classes contin- ued to grow as colleges began to require more math for incoming students. UNI changed requirements to three years of math, so more students began taking Algebra I, Algebra IIB and geometry. The department is rapidly chang- ing, said Dave Harris, math department chair. We got more involved with computers, and they have readily become more available for home and school use. The math department had eight ivzfmm ,. 'vs . 1, t - .a M. Tmnnell USING A MACHINE which checks the veins in the back of eyes, Karen Baxter participates in a demonstration in a physics class Ileftj, Steve Long checks the curvature of Andy Cooks eyes using a machine demonstrated by Dr. K. R. Brost, a Cedar Falls optometrist, who spoke to physics classes lbottom, leftj. With a little help from biology teacher James Meyer, Laura Tramontin tries to find microscopic organisms. L i computers for class use. In addition, some of the teachers owned their own com- puters, which they used for classes at school. All math department instruction was on the Apple ll. Harris commented that the trend of computers had been developing since the '70's and increases steadily every year. Because of the popularity of com- puters, computer classes grew in enroll- ment. For the '83-'84 school year, computer classes enrollment increased 59 students, Harris said. The most popular math classes were computer programming and computer math. A new class, computer literacy, was added as a graduation requirement for sophomores. Tenth graders must meet this requirement by taking four and a half weeks of computer literacy or by taking another computer class. All of these math requirements involved more students and strained the math system tremendously, Harris said, In total, the math department will handle approximately 300-350 students for the upcoming year, he said. Craig Criswell, one of the math teachers, said most students enjoyed math classes. He added, This credit is largely due to an excellent teaching staff. Seiencef173 ON SADIE HA WKINS Day, Monica Stettler makes an Velda Timmerman 's help. appointment to see her counselor, with guidance office secretary Counselors ossisr srudenrs, reochers - Helping students to schedule their classes con- sumed much of the guidance counselors' time. During the fall and winter months, counselors also helped seniors to make post- high school plans. Many seniors had their guidance counselors write letters of recommendation for college scholarships and financial aid. Students also went to their guidance counselors for help with various personal prob- lems. Guidance department chair Jerry Purcell said that studies showed students felt hopeful about their problems after discussing them with their counselors. Although students were a major concern for counselors, teachers also called upon counselors for help. Purcell said counselors helped teachers locate past grades for students and to decide whether particular courses were appropriate for individual students' abilities and needs. Purcell said counselors tried to become acquainted with each student assigned to them. Purcell said he tried to talk to each of his counselees at least once a year, aside from discussing personal problems. A counselor's day, Purcell said, could be exciting. All days were different, and he said counselors found it challenging to be ready for whatever came next. - Kristi Zierke l74fGuidAnee WHILE LOOKING for information about careers, Beth Philips and Tami Jensen use the new guidance office computer. BOARD OF EDUCATION AND SCHOOL ADMINISTRATORS - Standing, from left, Fred Wessendorlf director of business affairs and secretary to board of educa tion,' Dr. Clair E. Brooks, director of personnelg Dr. Ervin Dennis, board mem berg Richard N ystuen, director of pupil services: Marlene Behn, board member, John Baker, director of elementary education, Charles Officer, board r,,,a, t , xx is 'tt , ' -swim 5 .vmat mvrm-.umm Bhimsinwwlbn , is M. Kampman ATTENDANCE OFFICE secretary Carol Olsson records the attendance on a daily basis. Using an Apple II microcomputer, attendance records were computerized for second semester. -9 rev la if lil tilt , .,. r member: Gene Scheel, board member, Floyd Winter, director of secondary education, seated, Dr. James L. Robinson, superintendent of schoolsg Joy Corning, board of education president, Richard Vande Kieft, board of education vice president. School focuses on drug oworeness, needs ossessmenr Students, parents and teachers in the school district participated in a needs assess- ment program. In the project, participants discussed school system goals and ranked them in impor- tance, The format used was developed by Phi Delta Kap- pa, an association of profes- sional educators. To help students become more aware of the problem of drug and alcohol abuse, two speakers appeared at the high school during the school year. Carl Eller, a former profes- sional football player, spoke to the student body in the fall. Trooper Michael Gilbert of the Iowa State Patrol spoke to students at assemb- lies in February. He discussed the nationwide SADD CStudents Against Driving Drunkj effort, aimed at reducing accidents and injur- ies on the highways. Early in the second semes- ter, the attendance office entered the computer age. Using a program written by a Clinton High School teacher, the office assigned a number to each student and began keeping attendance and tardy records on an Apple II microcomputer. The new system provided faster access to students' attendance records, Associate Principal Dean Dreyer said. - Kristi Zierke Admininmionf l 75 PLAYING THE staple game to earn Cheerios in a psychology experiment, Mark Rolinger and Charles Blair-Broeker demonstrate classical conditioning. Social studies feature voriery Social studies classes prepared students for the future by teaching them about the past. The department offered a wide variety of classes, rang- ing from psychology to sociology to political science and history. Although it was a varied field, social studies courses helped students learn more about human behavior so they could understand other nations and cultures. Shelli Ross said she learned a lot about govern- ment and that she enjoyed learning about World War II. Darin Klapprodt added that he thought it was a good idea to have sophomores take history and government as a graduation requirement. Darrin, who transferred from an Illinois school, said he liked the fact that Cedar Falls High School put such a strong emphasis on the social studies department. - Chuck Bradford A , ' sl ,J l76fSociAl Studies and Speech IN THE BROADCASTING studio, Deanna Duncan prepares a tape to tu in for her radio production class. H1 C. Bradford DOING RESEARCH in the social studies resource center, Shelly Lemons gathers information for her American history class studies. C. Bradford DISCUSSING WORLD geography with her sixth hour students is Diane Engel. Z 5 Em. 6,50-f.. , X - xxx ' c. Bradford JOHN MULLAN discusses American history with his sixth hour class. Speech srresses communicorions The speech department helped students acquire skills in oral communication, act- ing, technical theatre and even in building and perform- ing with puppets. The variety of opportuni- ties available in the depart- ment attracted many differ- ent types of students. Both outgoing and shy people alike could find something to suit them. For the more outgoing per- son, there was the beginning acting class which expanded the students' acting abilities. The students who were un- comfortable in even small groups could get help through person-to-person communica- tion. In between there were choices ranging from stage- craft, for those interested in the behind-the-scenes part of theatre, to puppet theatre for those interested in the con- struction and performance of puppets. There were courses in speech for those who wished to improve their ability to speak in front of large groups of people, and even radio broadcasting for people who were interested in becoming disc jockeys for at least a semester. The speech department had a lot to offer by helping students to communicate bet- ter and giving them activities to do in their leisure time, according to Merle Picht, department head. - Chuck Bradford Social Studies and Spenchfl77 O , DE offer DSW 9XpG'l'lGf7C9S Office education and Dis- tributive education came a long way. Both groups had two state officers - Jeff Junkins and Kari Thorson in Office Education and Jeff Heckroth and Janet Sickles in Distributive Education. Both groups held similar events such as parties, guest speakers, field trips and the employer-employee break- fast. Some of the highlights of the year were the national contest for OE in Chicago and the national DE confer- ence in New Orleans. The employer-employee banquet was held in April at the UNI Commons to enable all co-op groups to get together and take their bosses out for dinner and entertainment. DE taught me how to handle customers, new exper- iences, and how to run a business successfully, Janet Caballero said. Kelli Klammer said OE gave her work experience, new friends and was a lot of fun. According to OE coordina- tor Sue Hahn, OE offers work on the latest office equipment. DE coordinator Jerry Klink said, DE offers students the experience to develop new business skills and to become productive employees. - Laura Frisch M. Tnxnnell DISTRIBUTI VE EDUCATION students take notes during a presentation in the school auditorium. M. Tnmnell CONNIE INGERSOLL sorts clothes for the needy, for a Christmas Education project. AFTERNOON OFFICE EDUCATION - Back row, from left, Mary Gaffney, Penni Schlimmer, Laura Frisch, Judy Sater, Linda Sadler, Beth Philips, Sue Hahn, middle row, Teresa Holmes, Kandi Krull, Kris Tegtmeier, Lora Wetzel, Kelli Klammer, Lora Hughson, Diane Clow, fron! row, Mae Guillermo, Lisa Petersen , Lori Smith, Terri Miller, Gayle Jasper, Brenda Trangsrud, Lori Williams. l73fDE, OE MORNING OFFICE EDUCATION - Back row, from left, Denise Brewster, Paula Smith, Jefflunkins, Kari Thorson, Brenda Brinkman, Kelly Voss, middle row, Cindy Gaede, Anita Voigt, Barb Farrell, Michelle Baker, Lisa Case, Julie Harmon, Jolene Klingenborgg front row, Sheila Hurd, Lisa Bisbee, Margaret Moes, Connie Ingersoll. DISTRIBUTI VE EDUCATION student Lisa Richtsmeier helps a customer while working at her co-op job at Younkers. AFTERNOON DISTRIBUTIVE EDUCATION - Back row, from left, Mitch Lindberg, Mike Bonner, Vicky Kuehl, Scott Engen, Teresa Ferson, Janet Sickles, Robert Howard: middle row, Gary Reed, Jennifer Scholz, Steffany Smith, Heidi Topliffl Sheri Minikus, Lisa Richtsmeier, Kris Nielsen, Doug Decker: front row, Deb Vanderwerlf Wendy Wetzel, Carrie Folkers. lg.- M. Trunncll MORNING DISTRIBUTIVE EDUCATION - Back row, from left, Jay Arries, Mary Mclnroy, Deb Brown, Jeff Dawson, Devin Holley: middle row, Mark Brown, Holly Snyder, Camie Kemp, Carmen Fullbright, Jodie Fisher, Laura Driscoll, Susie Truax, Tina Hankins, front row, Catherine Wilcox, Leslie Schaper, Janet Caballero, Deanna Duncan. DE, OE!! 79 AN EMPLOYEE of Happy Chef, LeRoy Corwin prepares french fries for a customer. Corwin worked at the restaurant through the food service pI'Ogf3l'l1. B. Phila . FOOD SER VICES CL UB - Back row, from left, Troy Vaughn, Leroy Corwin, Sara Fulton, Sondra Hyberger, Wendy Spier, Rhonda Clark, Wendy Heath, Janet 3 Cory Aschbrenner, faculty sponsor Marlys Folkers, Kevin Hosea, Kim Ritter, Dickson: front row, Carolyn Pope, Todd McDowell, Don McNair, Rhonda Scott Kratchmer, Ross Oltmann, Teresa Gronowskig middle row, Tom Murdock, Beckman, Sandra Houston, Mary Dotzler, Lisa Ackerman. Srudenrs eom, learn in co-op In the vocational education program the school worked together with local businesses for specific training objectives. The Food Services program provided instruction and train- ing in industries such as restaurants, drive-ins, nursing homes, hotels, hospitals and other business operated to provide eating facilities. Health Occupations offered a program of instruction anc training helping to prepare students for the wide variety 0 jobs in health-related fields. Trades and Industry offeref students on the job training i1 construction, production, stor age, maintenance and repair o products of the constructioi and manufacturing industriesi Vocational education helpec develop good attitudes towarc l naofrwa swim HEALTH OCCUPATIONS AND TRADES AND INDUSTRIES -Back row, Smock, Jim Hein, Gary Fisher, Kip Siems, .lon Hochgesang, Kyron Brimmerg from left, Mark Aneweer, Mark Albright, Dave Youngblut, Steve Jensen, Mike front row, Troy Steffy, Becky Trebon, Kelly Boos, Lance White, Mike Charley. Barney, Scott Clark, Mike Wise, Scott Schultz, Jeff Minikusg middle row, Monte work and helped students develop a good personalities for the world of work. Co-op gave students an opportunity to apply their skills and know- ledges that they have learned in school on the job. It also provided a supervised instruction for students on demands of the business and industrial world. Each student gained credit toward graduation, earning money while learning con- fidence though learning and job experience. Marlys Folkers, Food Service supervisor, commented, It's a very unique program and we are very fortunate that this school offers an opportunity to work while still getting credits toward graduation. - Lynn Manley Trldu and lndlutriesl l 81 A .1 Hn l 'tm p if M. STEVE WILSON breaks ground at Hansen Elementary School for the Ecology Club Arbor Day presentation to third grade students there. vfswxl dp, gi? ' v xr, ,., ROASTING HOT DOGS at an Ecology Club picnic are Becky Wheeler, Anne Pelzer and Lisa Nieder The three had just participated with other club members in gathering prairie seeds. W 9' qw 4. r ... E-4l I RYAN LOVE, left, and Jim Stein pack soil around a spruce tree in a ceremony at Hansen Sclzoo. l Club focuses on outdoors Ecology Club began the ye with a picnic and horseba riding at Camp Ingawanis nea Waverly. l A few of the other clu activities during the year ir cluded a winter camping trip ti Ingawanis in December. Clu members went camping a Backbone State Park nea Strawberry Point in early Maj At Backbone they rappelle 1B2fEoology Club - r4tiWf'2v lg lil. 2 LQ RYAN LOVE and Russ Bowen shovel dirt while Jim Stein holds a tree in place. The tree was planted at Hansen Elementary School in observance of Arbor Day. ix . ' six l s L' N , . . . , l If M. Tnmnell GA THERING SEEDS from bluestem grass along COLOGY CLUB - Back row, from left, Russell Bob Nelson, Jill Lehman, Steve Wilson: front row, Lori Dunlcerton Road, Lisa Niedert participates in Bowen, Ryan Love, Rebecca Wheeler, Rachael Nelson, Lohman, Carol Crowe, Elizabeth Wheeler. maia Betelu, club sponsor Erik Melberg, club sponsor Project Prairie Pride, a program sponsored by the Black Hawk County Conservation Board. anoed and hiked. Ecology Club members also orked on Project Prairie ride, sponsored by the Black awk County Conservation oard. Members gathered seeds rom prairie grasses to re- rairie county land. Ecology Club also sponsored eminars on backpacking, prair- 'es and nature photography. Club sponsor Erik Melberg and his wife Joann conducted the seminar on backpacking. Dr. Darrell Smith of UNI presented the seminar on prair- ies and Mildred Pierce, a local photographer, discussed nature photography. Ecology Club sponsored a nature photography contest. Junior Lori Lohman won first place, faculty member Bud Eason, second, and senior Carol Crowe, third. Melberg said the purpose of the club is to promote ap- preciation of man's place on the earth. Ecology Club was started in 1970 as a result of the Earth Day celebrations. Funds for projects were raised by selling concessions at winter sports events. - Lori Lohman Ecology Clubfl83 Y' , X. v 1 . 0 'uv 'F ATTACHING NEW seat cushions to auditorium seats QQ' is Rhonda McCulloch Irightj. Samia Nijim has her hair put into place by Pam Denkinger as she prepares for a production fbelowj. Lighting director Rod Ca vin focuses the beam lighting before a show fbelow rightj. . 5 The United Stagecraft Workers, USW, was a name picked out by the students of CFI-IS about 12 years ago, according to Merle Picht of the theater department. USW was composed of a large number of people who helped with the plays and anything else that went on in the auditorium. The Miracle Worker and You Can't take It With You',. Both were well done, according to Charles Koch of the speech department. Along with the plays were the variety show and the numerous musical perfor- mances engineered by the people known as 'stechiesfi behind the scenes with the lights and sound to put shows on. Looking back on his years of theater, Picht said the only noticeable changes that could be detected were the in- creasing number of kids working. But that's easy enough to work around, the kids need the experience of a If there was anything that could be changed about the USW people what would Mr. Picht change? If there would be some- thing that needed to be changed, I would have changed them, he said. Seriously, though, I wouldn't change anything about them. They're all a Srogecrofr workers perfect shows This year's plays were These people worked job too. great group of people. lB4fStngecrxft M. Tm UNITED STAGECRAFI' WORKERS - Back row, from left, Ryan Love, Kirk Besh, Bryan Blonigan, Mark Trunnell, Rod Cavin, Brian Pedersen, Mark Gray: third row, Ben Kieffer, Rich Young, Leonard Duncan, Russ Bowen, Tony Staut, Anne Pelzer, Gina Cervetti, Joe Bean, Mark Nickel, Don Dettbarn, Jeff Mundt, Heidi Noonan, Rick Seres, Greg Staut, Laura Maughan, Kevin Heins, Linda Maughan, Jenny Pershing, Scott Ripplinger, Lisa Mclnroy, Bryan Young, Troy Denkinger, Phil Clow, faculty sponsor Merle Picht, Brian Jensen, faculty sponsor PUTTING THE final touches on her makeup, Lisa Whitsett prepares to become Alice in the spring play, You Can't Take It With You. Charles Koch: second row, Andrea Boesen, Michelle Elin, Kathy Bates, Pauline Odekirkg front row, Monique Pint, Jenny Day, Jean Johnson, Cheryl DeSchmidt, Andrea Hopkins, Karen Anderson, Chris Bradt, Lisa Whitsett, Laurel Whitsett, Tenny Weeldey, Laurie Power, Sue Shaw, Nancy Etringer, Samia NUim, Kathy Krough, Stephanie Carlson, Janet Sickles, Diane Clow, Anne Cizek, Danl Weiland, Leslie McCulloch, Jayne Anderson, Rhonda McCulloch, Mike Bonner. Sugecnfll I B5 VA RSI TY CHOIR-Back row, from left, Brian McCullough, Jeff Klepfer, Lisa Danielsen, Mark Meier, Heidi Noonan, Jeff Mundt, Julie Van Der Meer, Neil Lewis, Bryan Blonigan, Sarah Longnecker, Kendra Koupal, Leonard Duncan, Lisa McFarlane, third row, Lisa Ver Mulm, Mark Nickel, Jayne Plantan, Lori Rasmussen, Jenny Scholz, Jack Bethke, Barb Hansen, Brian Jensen, Mary Hesse, Kermit Harless, Connie Ingersoll, Janet Sicklesg second row, Kathy Klinger, Lori B. Tapper Young, Satoru Baba, Wendy Heath, Laura Cornell, Kim Carney, Kerrie Hagge, Magnus Andersson, Michaela Sheehan, Joe Bean, Kim Moeg front row Director John Evenson, Lisa Laughlin, Scott Ripplinger, Kitty Kirkle, Tamie Kuehl, Rhonda McCulloch, Steve Randall, Connie Janssen, Jeff Junkins, Lori Tieqe, Jenni Day. MADRIGAL SINGERS- Back row, from left, Brian McCullough, Leonard Duncan, Steve Randall, Mark Winterg third row, Connie Janssen, Michaela Sheehan, Val Smith, Lynn Martmg second row, Cam Robinson, Samia NUim, Dave Pardoeg front row, Connie Ingersoll, Sarah Longnecker. B. Tapper Top rorings highlight year I Vocal musicians received mostly Is and IIs in various contests and competitions. Jeff Klepfer received a per- fect score of 40 out of 40 on his vocal solo at contest. Other Division I contest ratings included the chamber choir, madigral, girls quartet and girls trio. Seniors Wendy Heath and Kelli Klammer, and soph- omores Heidi Wedemeier and John Baker received Is for their vocal duets. Vocal soloists receiving I's were seniors Jeff Junkins, Lisa Laughlin, Kim Moe and Janet Sickles and junior Bryan Blon- igan. Division II ratings were received by girls triple trio, vocal duet unlike junior Leon- ard Duncan and Heidi Noonan. Soloists receiving IIs were Mike Bonner, Heath, Linda Maughan and Scott Ripplingerg juniors Joe Bean, Steve Randall and Deanne Terry and sophomores John Baker and Val Smith. Division I piano ratings went to Mette Hanson, Mary Hesse, Sarah Kiemuk and Lori Titus. Denise Brewster received a I for her harp solo. All Staters were seniors Bonner, Barb Hansen, Heath, Moe, Jeff Mundt, Mark Nickel, Jayne Plantan and Julie Van Der Meer, and juniors Dave Brandt, Klepfer, Mark Meier and Heidi Noonan. Hesse was chosen district finalist for All-State piano accompanist. The highlight of the year was the spring concert. In atten- dance were Phil Carver and Gary Fry, former music students whose arrangements were performed. There were a couple chan- ges in the vocal department. For the first time, a girls choir was formed and per- formed at the Christmas concert. An all-boys choir performed at the Variety Show. Vocal director John Even- son retired at the end of the school year, ending a 29-year career at the high school. - Marlene Kampman lB6fVooal Music MIXED CHORUS - Back row, from left, Chris Allen, Laura Tramonth Michelle Gatewood, Tim Wetrich, Mike Koepke, Dave Hinz, Graham Wooi Dave Pardoe, Grant Wheeler, John Baker, Scott Davis, Kevin Carroll, Monic Stettler, Mette Hanson, Denise Cronin, Michelle Laippleg third row, Sheri Parke Ruth Chokos, Melissa Osborn, Brenda Carney, Jay Bunting, Matt Hundley, Kell , Grant, Cam Robinson, Mark Winter, Tom Sherman, Sarah Klemuk, Mary Ferris, Julie Chokos, Devon Anderson, second row, Caren Jeys, Pam Steele, Yvonne B. Tapper Deyo, Stephanie Blonigan, Ellen Simpson, Sally Trost, Laurie Klages, Heidi Henning, Beth Jorgensen, Sheri Wasserfort, Sheryl Bader, Alisha Quinn, Leslie McCulloch, front row, Director John Evenson, Terri Miller, Susan Vognsen, Debbie Jacobsmeier, Shelly Tunwall, Debbie McDonald, Heather Dion, Val Smith, Rachel Wieland, Lynn Martin, Kirsten Gregory, Heidi Wedemeier, Stephanie Curtis. CHAMBER SINGERS - Back row, from left, Grant Wheeler, Joe Bean, Jeff Junkins, John Baker, Brad Nichols, Brian Jensen, middle row, Stephanie Blonigan, Rachel VWeland, Beth Jorgensen, Heidi Wedemeier, Kris Thorsong front row, Heidi Noonan, Caren Jeys, Laurel Whitsett, Kerrie Hagge, Deanne Terry. B. Tapper .F ,.1- FFr N, 1 fg,,'3'g .. - -f 1 a lah-ff-vb m:e.1f's'f'v--ASL' u., t'iLg 5 59577 SINGERS -- Back row, from left, Kim Director John Evenson, Barb Crook, Corrina Finch, Wendy Heath, Wilson, Knapp, Patti Mitchell, Odekirk, Kris Thorson. Terry, Lisa middle row, Marlene J ' af- Kampman, Lea Kloster, Dorothy Sullivan, Shelli Spooner, Michelle Murph yy front row, Diane Madsen, Laurie Power, Kathy Bates, Kris Sands, Pauline Vocal Mulicf IB7 M. nmpwn WITH THEIR NEW flags, Jill Wiederanders, Andrea Hopkins and Dawn Nyim practice a routine. .X . ' M. Thompson A NEW TWIRL is rehearsed by Kelly Rindels a flag corps member, preparing for a upcoming game, ig, SYMPHONIC BAND - Back row, from left, director Hugh Eicke, Randy Futch, Joel Walter, Kerry LaCoste, Paul Woodward, Travis Hildebrandt, Mark Olsen, Karl Kreb, Randy Goodson, Kerry Nance, Jeff Smith, Jim Stein, fourth row, Tom Jenkins, Dave Nissen, Chris Congdon, Mark Goodman, Rick Seres, Terry Durbin, Greg Staut, Neil Lewis, Rod Cavin, Russell Bowen, Tony Staut, Kurt Schreiber, Beth Foley, Kent Bailey, Russell Boten, Chris Dietz, Brian Hunck, third row, Warren Goodman, Maleia Thompson, Kristi Zierke, Dave Shin, 1881 Band, Orchulrn Engels Judy Franke, Meg Russell, Jeffrey Purk, Lori Lohman, Angie Mikkelsen, Karen Anderson, Joan Franke, Denise Jirak, Allen Corwin, Dale Lewis, Lisa Niedert: second row: Jenny Pershing, Cathy Junkman, Lara Richardson, Mary Hesse, Elizabeth Wheeler, Denise Clark, Kristin Spake, Amaia Betelu, Chris Sorensen, Mitchell Goetz, John Gogola, Eileen Malmg front row, Renee Crandall, Rebecca Wheeler, Amy Pfalzgral, Lori Titus, Robin Keigan, Anne Cizek, Alison Bright, if w RCHESTRA - Back row, from left, Doug Clark, Kerry LaCoste, Randy Futch, oel Walter, David Nissen, Greg Staut, Neil Lewis, Russell Boten, Kent Bailey, om Carley, Jim Stein, third rowg Karen Anderson, Terri Jerke, Linda Ma ughan, aura Maughan, Noelle Congdon, Sue Syhlman, Curtis Dietz, Maleia Thompson, eg Russell, Warren Goodman, Carlton Stansburyg Chris Sorensen, Kristen pake, Lisa Niedert, Angie Mikkelsen, Karen Anderson, Michelle Elin, Scott Mr. K. Smith, second row, Rukku Rao, Erik Spande, Heidi Engen, Mindy Sharp, Ann Cutsforth, Rachel Hanson, Becky Wheeler, Jenny Neessen, Renee Crandall, Mary Hesse, Betsy Wheeler, Denise Jirak, Dale Lewis, Denise Brewster, Anne Pelzerg front row, Rachael Nelson, John Shin, Anne King, Ann Peterson, Kelly Otten, Dori Bockoven, Margaret Tedlie, Katrina Klingenberg, Kara Cahill, director Dennis Downs. Tours highhghr instrumenrolisrs ' year Instrumental musicians were on the move throughout the year, beginning with marching band and ending at Adventureland Park in May. A colorful new 16-member flag corps was added to march- ing band in the fall. The band, along with pompon girls and flag corps, marched at four home football games in the UNI-Dome. The group also performed for a United Way kickoff at College Square mall. Warren Goodman, clarinet- ist, made All State Band for the fourth consecutive year. Renee Crandall, a flutist, was chosen an All State Band alternate for the outstanding senior band member. Goodman and Mary Hesse both received the Freder- ick Chopin Outstanding Pianist Award. V A two-day goodwill tour highlighted the orchestra's ac- tivities. They performed in Cedar Rapids, Marion and Ames on tour. Orchestra members also pre- Orchestra members received seven Division I ratings at state contest. The chamber orchestra received its fourth consecutive Division I rating. Five ensembles also received Division I's. Orchestra members had three guest conductors during the year - Jack Graham, Lathan Jer- nigan and Martha Holvik, all of the University of Northern Iowa School of Music. -Kristi Zierke sented concerts at local junior high schools and gave evening concerts in October, December, February and April. Orchestra members earned their third consecutive Division I rating at the state orchestra contest. Five orchestra members were chosen for the All State Orches- tra. They included Denise Brew- ster, harp, James Carroll, clarin- etg Kelly Otten, viola, Erik Spande, violin, and Margaret Tedlie, viola. Band. Orchestral l 89 git bf J. Bunting PREPARING HIS notes for an upcoming debate HELPING SARAH Schmidt with a front somersault is Ann Murray, a cadet teacher at Cedar Heights tournament is Steve Krause, a two-year member of the Elementary School. 11617816 team- Speech, coder reaching program offer srudenrs 'success ' experiences Qualifying for nationals in dramatic interpretation was Heidi Noonan. Noonan qualified through the Nation- al Forensics League competi- tion in March. Coach Marguerite Vance said, The first two tour- naments were the most excit- ing season beginning I've had. It was a thrill for me to see people win who had not won previously. It was good to see our new people get to finals or win trophies, she said. Vance said individual speech competition offers students poise and con- fidence under any circum- stances. That is a good prepara- tion for any career. We are one of the top two schools on the Iowa circuit in individual events. Vance said. Our enthusiasm has always been tops. We have a very good competitive team. DEBATE COACH Kevin Castor said, Debate gives students the ability to think critically. They learn to interact with students with similar backgrounds. They learn a little bit about a lot of stufff' he said. The debate team won the first meet in which it competed at Waverly. The rest of the year, Castor said, We fared pretty well. We were ninth at Ottumwa and we are certainly in the top ten schools at most of the tournaments. Our team is very enthusias- tic. We have a lot of hard workers. We have some inexperience at two-man debate, which is made up for in enthusiasm, he said. CADE'I' TEACHING lets students know whether they want to go into teaching or not, said Elayne Blumhagen, cadet teaching supervisor. A total of 26 seniors were in the cadet teaching program, about 13 a semester. Of the cadet teachers, about half usually choose teaching as a profession, Blumhagen said. The students are usually very enthusiastic about the program. They become friends with the teachers because it is a one- on-one relationship. - Heidi Noonan 190 f Speech and Debate R. Wheeler LISTENING TO music to pass the time between rounds of individual events competition at a tournament N.. in Oelwein are Leonard Duncan and Betsy Wheeler. The meet was Iowa High School Speech M' Association-sponsored. at 3 rms l fl A ' L :ST V Q f . -.-i . A-Q-Q' '- t V , . VW! l I 79 twf' L-,va yt Q' 9 . ff, K Y I ai, rpilll .2 at E I1. NOOIIBII AMID THE clutter ofa speech team table camp, Coach Marguerite Vance makes good use of her time to grade papers from her great books classes. ,gin .. , .. J fl NATIONAL FORENSICS LEAGUE-Back row, from John Shin, Steve Wilson, Dave Nissen, Lance Leverenz, left, Russell Boten, Betsy Wheeler, Erik Spande, Coach Dave Shing front row, Rebecca Wheeler, Jennifer Sea vey, Marguerite Vance, Joe Bean, Steven Krause, Chuck Dix, Heidi Noonan, Dawn NUim. FOR TIFYING HERSELF with food, Heidi Noonan, who qualified for the nationals in dramatic interpretation, awaits her next round at Cedar Rapids. Speech and Debatef19l Show bond odds new flag corps A 20-member flag corps was added to the marching band to add extra color and flair. The corps performed along with the pompon girls during all football halftime shows in the UNI-Dome. The flag corps' premiere perfor- mance took place Friday, September 17, at the CF-Central game. Eighteen flag twirlers and two alternates were chosen following tryouts in May. At tryouts the girls were required to do an original routine and a marching routine. The corps members were required to attend a camp during the summer. The Booster Club paid for half the camp expenses and purchased hats, skirts, vests, flags, and poles for the girls. The girls bought their own boots and blouses. To raise money, the girls worked in concession stands and sold pro- grams at football games. Sponsor Gayle Bruene said, The turnout for the tryouts was really good. We really didn't know how this new thing would go over. We were really happy it turned out so well. Pompon girls took fourth place in the dance division and sixth place in the pompon division at state competi- tion in December. Carolyn Madsen placed 18th and Shelley Pfalzgraf placed 24th in the individual competition. The squad won first place in competition at Pocahontas. The pompon squad performed at a UNI basketball game in January, their first UNI appearance. At their tryouts pompon girls were required to do a high kick routine, splits, a marching routine and a dance routine. In the finals they had to do Loyalty with pompon and a one-minute dance. They were required to maintain at least a C+ average, Bruene said. l92fPompon mi PERFORMING BEFORE the Homecoming game crowd are pompon squad members Jodee Hsher, Mary Tamisiea, Michelle Pfalzgraf and Karen Davis. ...ln LEADING THE Homecoming parade past Simpsons Furniture are Jodce Fisher, Kim Heckroth, Carolyn Madsen and Lisa Ver Mulm. The landmark burned in a spectacular January fire. 955 ' ' I 5.23 . , gig . . - ,f WW . f Sl . .t 71:53, ,pgs-Q . T V rv N . . e... f . , 7... POMPON SQUAD -- Back row, from left, Julie Williams, Penny Seufferlein, Kris Olsen, Jeannette Gloviak, Laurie Kueplcer, Lisa Ver Mulm, Meagan Hazzard, Sheryl Bader, Sarah Klemulcg middle row, Tracy Odle, ' Jodee Fisher, Kim Heckroth, Mary Tamisiea, Dawn Ressler, Tracy Siems,' front row, Wendy Holland Icocaptainj, Shelley Pfalzgraf fcaptainj, Barb Larkin, Karen Davis fcaptainj, Carolyn Madsen Icocaptainj. APPEARING AT a home football game, the new flag corps performs for an enthusiastic crowd. ,-nv X .-25' 1-'Y Y--Q Y S, Ripplinger AT ORDER, members of the Hag corps march up the Parkade in the Homecoming parade. Mr. K. FLAG CORPS - Back row, from left, Heidi Noonan, Kerrie Hagge, Mira Sheth, Linette Riley, Jamie Ritter, Diane Sund Icaptainj, Jill Wiederanders, Monique Pashby, Cheryl DeSmidt, Kelly Rindels, Andrea Hopkins: front row, Dawn NUim, Susan Shaw, Diane Clow Icaptainj, Mae Guillermo Ico-captainl, Laurie Power loo-captainj, Chris Fuller, Barb DeBerg. M. Tnlnncll EXECUTING A HROWBOA I1 Diane Sund twh-ls as the band plays Home in halftime of the Homecoming game. Flag Corps! 193 VARSITY FOOTBALL CHEERLEADERS-Back row, alternate Penny Halupnik, Lisa Danielsen, Linda Allard, captain Stephanie Snyder, alternate Jodee Jacobsen, middle row, Shelli Winkey, Angie Liebbe, Barb Hansen, Lori Henry, front row, Julie Aschoff, Jenny Jordan, Heidi Topliftf Michelle Krull, Leatha Davenport. L BOYS' BASKETBALL CHEERLEADERS-Back row, captain Linda Allard, Diane Madsen, Lisa Danielseng front row, Barb Hansen, Michelle Krull, .Iadee Jacobsen. - ef? at -C 1 GIRLS' BASKETBALL CHEERLEADERS-Back row, Penni Schlimmer Jamr Ritter, captain Susie Stoll, front row, Susan Shaw, Mira Sheth, Laurie Power Cheerleaders win notional honors Cheerleaders helped to get audiences enthused at games. Football cheerleaders said they preferred to cheer in the UNI-Dome. Cheerleaders were required to have at least C+ grade averages. They had to be able to cheer in groups, chant alone, and do a cheer called rah yea' using gymnastics at tryouts. The cheerleaders raised money by working in conces- sion stands, having a car wash and selling football programs. All cheerleaders agreed that the junior year was the hardest in cheering. One reason, Angie Liebbe said, was Even if you are as good as a senior, the senior will get the position because of senior- ity. The cheerleaders took first place in the regional competi- tion. Then they went on to place third in national compe- tition in Dallas, Texas. - Trudy Kra tz l94fCheerleading M ' i f 'ff W Ly, H X, . f T-'1fS.52w......a...tA. as E' WRESTLING CHEERLEADERS-Back row, Leatha Davenport, Penny Halupnik, Angie Liebbe,' front row, Kris Meyer, Jenny Jordan, captain Heidi Toplifli 33 1 Mr. K SOPHOMORE FOOTBALL CHEERLEADERS- Top, Laurel Whitsettg Lisa Whitsett, middle, Ellen Simpson, Beth Jorgensen, Laura McKee, front, captain Wendy McKee: front, captain Wendy Anderson, Brenda Carney, captain Heidi Henning. IN THE STATE championship game against Sioux City Heelan, Jenny Jordan fforegroundj and Lea tha Davenport cheer the Tigers. R. Chase :ef . ' H ' ,. ' Z V '- ff - Mr. K. BOYS' SOPHOMORE BASKETBALL-Back row, Laurel Whitsett, Beth Jorgensen, captain Heidi Henning, Samia Nnim, Brenda Carney, Desia Evans, front row, Wendy Anderson, Lisa Whitsett, Lona Bolton, Stephanie Blonigan, Laura McKee, Ellen Simpson. Chmludingfm in Q3 gm 05 BEFORE BEGINNING a pasteup of the fourth page of the Tiger Hi-Line, page editor Lori Lohman checks available copy. FINISHING HIS story to meet a deadline, Mike Llewellyn types in the journalism room. i C i J. Buntin TIGER HI-LINE STAFF- Back row, from left, Becky Wheeler, Howard Jones, Russell Bowe Mark Trunnell, Scott Ripplinger, Heidi Noonan, Maleia Thompson: middle row, Jayne Andersoil Dawn Kibbee, Beth Foley, John Shephard, Anne Cizek, Danl Weiland, Pam Page, faculty advis Judith Funk, Lori Christensong front row, Steve Krause, Troy Denkinger, Steve Obadal, Phil Woodfl Todd Engels. Y T. Engels 1 To give students a means of expre sion, the high school offered t A publications, the Tiger Hi-Line newspaper and the yearbook. Students in journalism classes pulh lished the Tiger Hi-Line each Friday i I The Cedar Falls Record. Students in tli classes completed individual assignment for publication in the newspaper. , Elizabeth. Wheeler and Tim Majef us won gold keys in the Quill and Scro national writing competition for storiv they wrote for the Hi-Line. Elizabet Wheeler and Maleia Thompson edited tl newspaper and were responsible for pap Writers, photographers get Work published l96jTiger Hi-Line R H h K. Zierke WRITING COPY FOR a sports spread, Teresa Tangeman, copy editor, works on the yearbook during a free hour. at - sr.s , .X , ,, ,. ,W V 3' sr il YEARBOOK STAFF-Back row, from left, Tami Jensen, Mark Gray, Marlene Kampman, Lynn Manley, Jill Lehman, Mark Trunnell, Heidi Noonan, front row, Trudy Kratz, faculty adviser Judith Funk, Kristi Zierke, Kris Spande, Teresa Tangeman, Scott Ripplinger, Laura Frisch, Lisa Mclnroy, Chuck Bradford. K. Zierke USING A scaleograph, Kerrie Hagge crops photos for her spread on girls' basketball. Yearbook Slafffl97 1 981Ay1Qrds Lon E, ' . .- .f?fW3gif:EQg-W 11221: .1EiffE' ff 'f?'fZf2? f 'i:: 1'1 'fl 1,132-sf Sw ,-,- - ,. I1 ,WMf,x-ww Yf,f, .N ,. , .- . -..,4 .f .v,f .,U.,,,.W fy .,'. ..,,,f,.. ,,,i ,L ,I .1- ,f.. ?i,f..,5,53.3 ,,,X, -.f.. . . M ,,WA. .,. , f ., , . ,. . ,,,. .,. .. X . 5. Q. -2 H . irf f-ni ri: ST Q ' 'izipr --far 1l M 1 i fQ l . . : . 1 f. YYJ' ,V': VI., 'Lm, V. ' f 1 .A . R 1-gggsyzj wry: :4x f5.1Qa.zwggl- ge-' 1- 1- rf 4. N. W 1' - s W. f f - 1 V,,,,,, W , .557 555. LW V -L I 4.1,yL,i.k E.. ' 'ir 2:1 k:z:3.::,g-ffgfv ,. ,.,, - 1 ' M f 1 i A 1 . ,.. ..1. . 1 ' l 1 ll f1f .. 4 4 4W . .l . .f i 1 eff 1' J ..fl . . J .'A. . .Q l. ' J' i ' n ' ..f i .. 1 . J5 . ' ' W .4 .... .. .. - -, Li - ' :,z':ff.za.-,sw-zez,' iz .ie 45, ,zu-.,g...gn J: wp :xi fg1..:k' :W xv- f' 'kg-:eg grep ga.5'Yfff?'f499 NATIONAL MERIT SCHOLARSHIP FINALISTS - Mike Flagg, Trish Kirkpatrick, Lisa Ver Mulm, Ilya Volfson, Elizabeth Wheeler ALPHA DELTA KAPPA HONORARY EDUCATION Scholarship - Ann Murray AMERICAN LEGION AUXILIARY SCHOLARSHIP - Jon Ehlert CEDAR FALLS EDUCATION ASSOCIATION SCHOLAR- SHIP - Kelli Klammer MCELROY SCHOLARSHIPS - Kelli Klammer, Carlton Stansbury, Maleia Thompson MASONIC SCHOLARSHIP - Sandy Spray CEDAR FALLS WOMEN'S CLUB MUSIC Camp Scholar- ships - Joe Bean, Sarah Klemuk and Tom Rose TOP FIVE PERCENT OF CLASS SOPHOMORES FIRST PLACE PINS - Russell Boten, Deborah McDonald, David Pardoe, Steve Smalley, Monica Stettler SECOND PLACE PIN - Ellen Simpson CERTIFICATES - Michael Agness, Jim Anderson, Mark Bohr, June Duncan, Lisa Haberkamp, Stephen Handorf, Heidi Henning, Sarah Klemuk, Scott Ochsner, Jon Olson, Tammie Schmidt, Jill Sprague, Sally Trost JUNIORS FIRST PLACE TROPHY - Leonard Duncan, Lori Mickey, Jeffrey Purk SECOND PLACE TROPHY - Russell Bowen CERTIFICATES - Steven Bennett, Lori Buser, David Cable, Renee Crandall, Sarah Hewett, Connie Jansen, Anne King, Jeffrey Klepfer, Shelli Lovell, Brian McCullough, Kristen Meyer, Stephanie Olsen, Julie Pech, Kirsten Seyffer, Michaela Sheehan, Michelle Vandekieft, Dana Woodbury SENIORS FIRST PLACE TROPHY - David Conrads, Scott Treiber, Cathy Uhlenhopp, Lisa Ver Mulm SECOND PLACE TROPHY - Carolyn Madsen CERTIFICATES - Karen Anderson, Michael Flagg, Tracy Grandy, Barbara Hansen, Jeffrey Heckroth, Bruce James, Benjamin Kieffer, Trisha Kirkpatrick, Kelli Klammer, Kimberly Moe, Rachael Nelson, Lisa Niedert, Dawn Nijim, Judy Sater, Penelope Schlimmer, Margaret Tedlie, Rebecca Wheeler, Richard Young Vocal Music A wards SECOND PIN WITH GUARD - Mike Bonner, Jeff Mundt, Scott Ripplinger SECOND PIN - Wendy Heath, Jeff Junkins, Lisa Laughlin, Neil Lewis, Kim Moe, Jayne Plantan, Julie Van Der Meer FIRST PIN - Karen Davis, Barb Hansen, Mary Hesse, Kitty 200f Awards Kirkle, Rhonda McCulloch, Pauline Odekirk, Janet Sickles, Lisa Ver Mulm, Joe Bean, Bryan Blonigan, Jeff Klepfer, Kathy Klinger, Sarah Longnecker, Mark Meier, Heidi Noonan LETTERS - Magnus Andersson, Satoru Baba, Kathy Bates, Jack Bethke, Lisa Bisbee, Barb Crook, Corrina Finch, Steve Greenwood, Kerrie Hagge, Connie Ingersoll, Mark Nickel, Anne Pelzer, Dorothy Sullivan, Lori Young, Laura Cornell, Leonard Duncan, Vance Ewing, Connie Janssen, Kermit Harless, Marlene Kampman, Juanita Kimpston, Kathy Klinger, Kendra Koupal, Diane Madsen, Brian McCul- lough, Mark Meier, Lisa McFarlane, Michele Murphy, Laurie Power, Steve Randall, Lori Rasmusson, Michaela Sheehan, Deanne Terry, Kris Thorson, John Baker, Beth Jorgensen, Cam Robinson, Heidi Wedemeier Orchestra A wards NOSA HONOR CERTIFICATES - Karen Anderson, Kara Cahill, Warren Goodman, Mary Hesse, Neil Lewis, Angie Mikkelsen, Rukku Rao, John Shin, Erik Spande and Joel Walter SECOND PIN - Karen Anderson, Kara Cahill, Rukku Rao, John Shin, Terri Jerke, Scott Smith, Dori Bockoven FIRST PIN AND LETTERS - Laura Maughan, Erik Spande, Anne King, Katrina Klingenberg, Anne Peterson, Ann Cutsforth, Curtis Dietz and Kelly Otten Band Awards THIRD YEAR LETTERS - Terry Durbin, Warren Goodman, Neil Lewis, Angie Mikkelsen, Lisa Niedert, Joel Walter SECOND YEAR LETTERS - Mary Hesse, Brian I-lunck, Maleia Thompson, Rebecca Wheeler, Elizabeth Wheeler, Russell Bowen, Renee Crandall, Kerry LaCoste, Greg Staut, Jim Stein FIRST YEAR LETTERS - Karen Anderson, Randy Futch, Meghan Russell, Lori Titus, Kent Bailey, Chris Dietz, Dale Lewis, Eileen Malm, Jeff Purk, Rick Seres, Kristi Zierke, Russell Boten, Mitchell Goetz, Kurt Schreiber,Tony Staut BEST BEST BEST Theatre Awards DOG AWARDS ACTOR - Ben Kieffer ACTRESS - Margaret Tedlie CHARACTER ACTOR - Mark Nickel BEST CHARACTER ACTRESS - Heidi Noonan MICE AWARDS PRODUCTION WORKERS - Mark Trunnell, Rod Cavin CONTRIBUTED MOST TO THEATRE - Mark Trunnell BEST CONTRIBUTION TO LIGHT CREW - Rod Cavin BEST BEST CONTRIBUTION TO SOUND CREW - Rick Seres BEST CONTRIBUTION TO PROP CREW - Lisa Mclnroy BEST CONTRIBUTION TO COSTUME CREW - Sue Shaw BEST CONTRIBUTION TO MAKEUP CREW - Laurie Power THIRD PIN - Rod Cavin, Troy Denkinger, Ben Kieffer, Laura Maughan, Linda Maughan, Mark Nickel, Brian Pedersen, Rick Seres SECOND PIN - Jayne Anderson, Karen Anderson, Bryan Blonigan, Andrea Boesen, Russ Bowen, Diane Clow, Troy Denkinger, Brian Jensen, Ryan Love, Rhonda McCulloch, Heidi Noonan, Jenny Pershing, Scott Ripplinger, Rick Seres, Sue Shaw, Janet Sickles, Greg Staut, David Tegtmeier, Lisa Whitsett FIRST PIN -- Joe Bean, Kirk Besh, Amaia Betelu, Andrea Boesen, Chris Bradt, Stephanie Carlson, Gina Cervetti, Anne Cizek, Heather Dion, Leonard Duncan, Nancy Etringer, Kevin Heins, Kathy Krogh, Leslie McCulloch, Rhonda McCulloch, Sarah Morrow, Jeff Mundt, Samia Nijim, Anne Pelzer, Laurie Power, Joe Roderick, Janet Sickles, Greg Staut, Tony Staut, David Tegtmeier, Steve Walljasper, Laurel Whitsett, Lisa Whitsett, Dan'l Wieland, Brian Young, Rich Young Journalism A wards YEARBOOK AWARDS MOST PROMISING JUNIOR - Kris Spande MOST PROMISING SENIOR - Scott Ripplinger MOST CONTRIBUTED PHOTOGRAPHER - Mark Trunnell MOST CONTRIBUTED EDITOR - Scott Ripplinger HI-LINE AWARDS MOST PROMISING SOPHOMORE - Steve Smalley MOST PROMISING JUNIOR - Troy Denkinger MOST PROMISING SENIOR - Betsy Wheeler MOST CONTRIBUTED PHOTOGRAPHER - Maleia Thompson MOST CONTRIBUTED WRITER - Betsy Wheeler PRESENTING GREG and Tony Staut with the Loving Brothers Award at the annual theatre banquet is senior Mark Trunnell, master Of ceremonies Award DI A I . A..-1' 1 as Wm V , X221 , . -ikxwit-F . ,ww z, Lf' - - 52-21 Ygx 4? ' b 'KVI x,-Qfvmfq 2 Wifi i 5 I V 1 4 ? D. Pagel ALL SMILES at prom are Susie Truax and Mike Nesvik. K. Spande X STUDYING OUTSIDE is Dorothy Sullivan. N K. Spande WATCHING THEIR softball team in gym class are Mark Rolinger, Lori Mickey, Linda Gamble, Jason Pierce and Steve Randall. T. Jensen SITTING ON THEIR motorcycles are Mike Grieger and Ken Koltlloff during release. 1 OBVIOUSLY HAVING a good time at the Friday the l3th dance, dancers 'get down to the beat of Dusk. M. Tnxnnell Closing! 203 5,-1' BX A , Ls? 1 141' U I W M, . ri ,E Q M. Thompson Gandhi won the 0scar for the best picture of the year. Ben Kingsley and Meryl Streep won 0scars for best actor and actress, re- spectively. The song from An Dfficer and a Gentle- man, Up Where We Belong, won an 0scar for the year's best movie song. Iowa Hawkeye fans were shocked when yCoach Lute 0lson left the' University 0f lowa to coach basketball at Arizona University. Coach George Ilaveling from Wash- ington U State was hired to replace 0lson. j y 2041 We e Came. a Long Way N W W by G 'enct ' ,.,,W,.... ,,.,-,,., --W--v mph, awww-N ' ---Y ' ffalf' M. Thompsnn AFTER KEEPING Open Pit statistics all night, Diane Sund seems' tot have enough. Umekecper Diane Clow, howeven appears ready for more basketball action Iabovc Iefzj. SHOWING WHAT they have learned lrom self-defense insmictor ,Cora Guillermo are Linda Maughan and Terri Jerlcc in early bird plzysicalceducation classes Cabovej. . X X X ' ' uv? 1 tg iff 4-r' ' M. Thompson MARL YS FOLKERS offers sewing advise to Marlene Kampman. Marlene, a student in Textiles and Clothing L is making a spring dress. 'ls Q 2... AY QNQA i 'I WW 1- 5 51-,, f , 1, I f 'z ft Av f iff ,,x' ,J s'i'7'W, 2 1 gv,y7gwfs,,9 31 5- 'lg' - f -1 ' M. Tmnneli KEEPING HIS stride is Trip Kilandery running the two- mfle at an invitational in the UNI-Dome. 'sf at E l ws- ,if E L f-??i'f 3 ll b 1 ii' 'T at A PENNY lKaren AndersonQ tells Mr. DePinna lMark Trunnellj how to pose during the performance of You Can't Take it ,With Yah. , N M. Thompson We've Come a bong Way l205 2061'We've Come a Lung Way' The eountry was devasted by the bomb- ing of the Anneriean Embassy in Beruit in April. Seventeen Americans died in the incident. As the year came to a close, seniors pre- pared for their graduation and every- one looked forward to the awaited summer. - Kris Spande - Tami Jensen K. Spmnde K. Spmnde COUNSELOR JOHN NERO advises one of his students in his office. Anderson, Kim Smith and Tracy Grandy. There was an ' abundance of good' weather during the spring. - K. Spande ' ENJOYING the nice weather outside are Karen' 1 I , w PREPARING TO type in the guidance office is secretary Q Velda Timmerman, Schedules were hectic as juniors and 3 sophomores prepared for nexgt year. 4 K L K. Spande TALLKING IN the hall are Julie Williams and Laurie Power. 1 yn? Ag Ai Aarhus, Larry Aarons, Bobbi 116 Abbas, Sean 71, 116 Ahben, Sabrena 116 Abels, Jill 32, 116 Ackerman. Lisa 129, 181 Adams, Gary 116 Adams, James 129 Adams, Theron 104 Aelmans, Eva 116 Agness, Michael. 104 Ahlman, .lay 6, 34, 129, 202 Ala, Patrick 80, 104 Albert, Tony Alberts, Michelle 104 Albright, Mark 129, 181 Alexander, Ron 59, 129 Alexander, Sean 54, 74, 75, 80, 81, 129 Allard, Linda 9, 18, 19, 21, 32, 129, 194, 199 Allen, Christine 104. 187 Allen, Gregory 115 Allen. Michael 116 Allen, Rebecca 104 Allen, Sandra 116 , Alter. Hazel 154 Anderson, David 116 Anderson, Devon 104, 154, 187 Anderson, Gary 116 Anderson, Harry 32, 75, 90, 159 Anderson, James '79, 95, 104 Anderson, Janelle 116 Anderson, Jayne 116, 185, 196 Anderson, Karen 36, 46, 66, 129, 185, 188, 189, 199, 206 Anderton, Karen Lynn 52, 129, 166, 189, 199, 205 Andersson, Magnus 90, 129. 140, 186 Anderron, Michael Anderson, Norm 154 Anderson, Samuel 75, 90. 95, 104, 159 Anderson, Wendy 104, 195 Aneweer, Mark 129, 181 Aneweer. Rod 116 Aperans, Jerald 129, 172 Appleby, David 104 Archer, Judy 104 Arries, Jay 179 Aschhrenner, Cory 129, 181 Aschhrenner, Randy 104 Aschenbrenner, Kurt 104 Aschoff, Julie 2, 18, 19, 32, 116, 194 Asimus, Jane 66 Asleson, Chad 67 AV Club 48, 49 Azar-Perez, Alex 55, 63, 129, 140 Bentley, Walley Bergeson, Daniel 79, 104 Bergeson. Debra 116 Bergmann, Michael 104 Bergmann, Scott 129 Bergman, Todd Berry, Kelly 27, 32, 116, 120, 171 Berry, Tracy 129 Berryhill. Max 74, 75 Bertram, Ronald Bean, Kirk 116, 185, 199 Bess, Christine 116 Betelu, Axnaia 37, 76, 129, 140, 183, 188 Bethke, Jack 186 - Betz, Jennifer 116 Bickner. Velma 154 . Bigelow, Bradley Bigelow, Tamra 129 Billard, Cindy 154 Bisbee, Lisa 130, 178, 187 Bisbee, Rnbert 74, 90. 97, 128. 130 Bixby, Brooke 104 Blackford, Randall 104 Blair-Broeker. Charles 154 Blakesley, Roger 116 Blassl, Deborah 116 Bliton, Dan 116 Blonigan, Bryan 44, 53. 116, 185, 186 Blunigan, Stephanie 5, 104. 167, 187, 195 Blum. Bobbie 130 . Blumhagen, Elayne 154, 164 Bockhoven, Doris 116, 189 Boehmke, Judy 130 Boelman. Angela 130 Boerschel, Anne 100. 101, 154 Boesen, Andrea 104, 185 Bugalin, Mike 71, 130 Bohr, Mark 75, SO, 95, 104 Bolle, Dennis 130 Bolts. Wanda 66. 88, 116 Bommart, Michele Bond, Cynthia Bonner, Michael 43, 53, 56, 57, 130, 179, 185, 186 Boorom, Barbara 34, 198 Bona, Kelly 130, 181 Burshein, Teresa 116 Bolen, Russell 56, 104, 188, 189, 191 Bolton, Ilona 104, 195 Bowen, Russell 8, 26, 58, 116, 183, 185, 188, 196, 198 Boyer, Laurie 130, 162 Bradford, Charles 27. 74, 116, 197 Bradl, Christine 47, 116, 185 Brandt, David 116, 186 Brandt, John 104 Brandt, Kerwin 75, 104 Brandt, Melissa 116 Brandt, Lincoln 116 Brewster, Denise 130, 153, 178, 186, 189, 198. 199 Brewster, Rodney 116 Bright, Alison 89, 104, 188 Brimaccmb, Robert 116 Brimm, Kristine 154 Brimmer, Kyron 78, 130, 181 Brinkman, Brenda 130, 178 Carlson, Stephanie 4, 44, 46, 131, 185 Carmichael, Kimberly 1 17 Carney. Brenda 101. 105, 187, 195 Carney, Kimberly 117, 186 Carroll, Kevin 105. 187 Case, Lisa 131, 178 Case, Todd 90, 105, 149 Case, Troy 90, 105, 149 Castro, Caesar 90, 100, 131, 140 Carter, Robert 155 Cavin, Roderick 14, 117, 184, 185, 188 Cervetti, Gina 46, 84, 117, 185 Chamber Choir 186 Champoux. Kevin 75, 105 Chan, Ray 74, 75, 131, 199 Charley, Michael 131, 181 Cherney, Lori 31, 35, 37, 40, 131 Cherney, Tracy 117 Chilcote, Greg 131 Chinwala, Daochoompoo 105. 140 Chokos, Julie 105, 187 Chokos, Ruth 105. 187 Christensen, Charles 40, 74, 117 Christensen. Daniel 74, 117 Christiansen, Lori 196 Cizek, Anne 117, 185, 188, 196 Cizek, Robin 117 Clark, Denise 74. 105, 138 Clark, Douglas 90, 186 Clark. Douglas 80, 117, 131, 189 Clark, Rhonda 131, 181 Clark, Scott 131. 181 Clay, Mark 131 Clements, Jefferey 105 Clements. Susan Clow, Diane 15, 75, 99, 131, 193. 204 Clow, Philip 95, 105, 185 Clutc, Beth 117 Coffin. Angelique 105 Coffin, Monique 117 Coleman. Heidi 100, 117 Collom, Slew: 75, 105 Collum, Mark 131 165, 178, 185, Congdon, Christopher 105, 149, 188 Congdon, Noelle 189 Conner, Aaron 131 Conradi, Jon 74, 78. 117 Conrads, David 33, 65, 73, 74, 78, 79, 98, 110, 131, 198, 199, 200 Cook, Andy 20, 50, 131, 173 Cook, James Coonradt, David 117 Cornell, Laura 117, 186 Cornwell. Sharon 118 Corwin, Adam 131 Corwin, Allen 67, 71, 90, 105, 188 Corwin, LeRoy 131, 181 Corwin, Penny 131 Cowell, Connie 131 Cowell, Gregory 74, 75, 131 Counnage, Shawn 95, 105 Craig, Kimberly 70, 131 Crandall, Renee 118, 146, 188, 189, 202 Cranston. Jennifer 105 Crawford, Timothy 118 Creery, Troy 86. 100, 131 Azeem. Farah 104 1 Baba, Saloru 56, 78, 85, 129, 140. 186 Babcock. Tara 116 K Bach, Jill 116 Bach, JoAnne 70, 84, 116 Bader, Sheryl 104, 187, 192 Bader, William 154 Bailey, George ss, 116, ras. 189 Bailey, Julie 154 Bairnaon. George 104 Baker, John 104, 186, 187 Baker, Michelle 50, 56, 70, 129, 178 Baker, S0011 116 Bakker, Shelli 14, 116 Bandfield, Traeci 101, 104 Bane. Brent Barney. Michael 181 Barnholtz, Marie 104 Barron, Brian 79, 104 Barrels, Douglas 104 ' Bmlmg. sam 104 But, Jeffrey 104 Ball. Will 74 Bates, Kathleen 129,-185. 183' - Baxter, Karen 70, 129, 173 Bean, Joseph 37, 116, 147. 185, 186, 187, A 191, 198, 200 Bean, Lionel 10, 73. 74. 75. 73, 98. 129. 166 am, Lori 129 ' g Bean, Toneaae 70, 116 ' Beatty. Colleen 104 Beckman, Rhonda 129, 181 Beebe. Katherine 154 seem, Robin ire, 129 Beener, Becky 30. 129 . Benner, Joel 104 Beener. Tamara 129 Bennett, Eddie 75. 79, 104 Bennett. Mary 129 V I Bennett, Steven 116 zosfniaa 1 Braun, Brown, Brown, Brown, Brown, Brown, Brown, Brown, Bmce, Debra 52. 130. 179 Jaeki 116 Jeff 67, 90, 130 Jane Mark 131. 179 Stasi 104 Tammy 116 Todd 116 Marilyn 154 Bruene, Gayle 18, 19, 154, 192 Buchholz, Paul 116 Budensiek, James 74, 116 Budensiek, Karen 96, 116 Bullers, David 49, 137 y Bullersg Jonathan Ballon. Tom 71, 104 Bunting, Jay 187, 212 Burbridge. Kent 116 Burgin, Burke. Burke, Burlcel, Russell 116 James 104 Tam 131 Judy Burkhardt, Karla 117 Burkhoider, Kristi 70. 117 Burke, Burton, Euler, Butler, Faith,131 Lora 105, 173 Lori 76, 117, 165 Kathleen 105 Buxton. Frank 154 B all Cra' 131 199 Y , Byerly, is , Cheryl in -ayvank, Larry 131, no Caballero, Janet 179 - Cable, David 74, 117, Cahill, Kara 131, 189 1 Caley, Alicia Canby, Darcy 112, uv, rea Canby Michael 117 1 Carley,-Thomas 117, 189 Carlson, David 131 Crinwell, Craig 77, 155. 173 Cronin, Denise 118, 187 Crook. Barb 187 Crooks, David 131 Crowe, Caml 51, 68, 136, 183 Culbertson, Kimberly 118 Culbertson, Pamela 105 Cunningham, Maryjane 150 Cunningham, Michele 105 Curren, Pamela 118 Curtis, Aaron 105 Curtis, Anthony 90, 105 Curtis, Cheryl 132 Curtis, Stephanie 106, 187 Custer, Kristan 68, 84, 106 Cutsfonh, Ann 64, 66, 77, 88, 106, 189 Cutsforth, Timothy 67, 90, 118, 202 Dahm, April 106 Dalrymplc, Antheny 118 Daniel, Terry 118 Danielaen, Lila 6, 52, 132, 186, 194 -Danner, Kelli 27,1 132 Darrow, James 34, 35, 39, 50, 52, 74, 132, 198 Davenport, Leatha 36, 97, 132, 194, 195 Davidson, Jeanine 155, 171 Davis, Andrew 75, 79, 106 Davis, Karen 34, 35, 36, 37, 56, 57, 132, 145, 149, 152, 192 Davis, Soon 187 Davis, Soon 71, 132, 202 Davis, Steven 38, 50, 52, 53, 59, 74, 128, 132. 149 Dawson. Jeffery 132, 179 Day, Jennifer 118, 185, 186 DeBerg, Barbara 118, 193 Decker, Douglas 132, 179' DeGto0te, Robert 74, 118 Deiblet, Debra 106 Delafield, Marianna 155 Dehvergne. John 106 , Demsky, Linda 155 Denkinger. Troy 46, 74, 118, 196, 199, 20 DeSmidt. Cheryl 118, 165, 185, 193 Denham, Donald 132, 163. 185 DeWalt, Vicki 106 Deyu, Yvonne 106, 187 Dickson, Janet 132, 181 Dietz, Christopher 118, 188 Dietz, Curtis 106, 189 Dietz, Gregory 75, 106 Dion. Heather 106, 187 Dirksen, Dean 106 Dix, Charles 132, 191, 198 Dix, Glen 106 Dix. Michael' 106 Dixon, Tammela 106 Dobson. Thomas 118 Dodge, Jennifer Doeden, Carol 76, 118 Doeden, Jane 66 Doeden, Steve 94 Doerr, Stephen 106 Dolan. Matthew 118 Donald. Dorman Dorman, Amy 106' Duty, Kimberley Doueth, Karen 155 Dolzler, Mary 132, 181 Dowell, Jean 66. 118 Dowler, Jonathan 132 Downs, Dennis 155, 189 Doyle, Gene 32, 74, 75, 155, 159, Doyle, Patrick 74, 80. 118. 159 Dreyer, Dean 62, 122, 123, 155, 175 Driscoll, Laura 107, 132, 179 Driscoll, Lisa 118 Dumer, Joseph 118 Dumer, Teresa 106 Dunbar, Stephen 118 Duncan. Deanna 23, 132, 179 Duncan, June 106 Duncan, Laura 70, 101, 106 ' Duncan, Leonard 12, 13, 118, 185, 186,-1 Durbin, Terry 56, 132, 188 Baden, Ann 155 Eason, Oliver 155, 183 Eastman, Deborah 118 Eastman, Georgene 132 Eastman, Larry 75, 106 Eastman, Steven 106 Eckert. Timothy 132 Efting, Jim 75 Egglenon, Soon 74 Egner, Mark 74, 118 Ehlert, Jon 132, 200 Eichelberger, Kraig 132 Eichelberger, Kurt 75, 106 Eicke, Hugh 56. 155, 188 Eidie, Ed 74 Elbert, Martin 74, 132 Elin, Michele 106, 185, 189 Eller, Carl 130 Elliott, Kenneth 118 Ellis, Melissa 77, 106 Engel. Dian 177 Engel, Diane 118, 155, 159 Engel, Mau 67, 80 Engel, Richard 67, 80, 90, 115, 155, 159 Engel, Tracy 66 I Engels, Beth 77, 88, 106 . Engels, Todd 43, 118, 196 . Eugen, Heidi 77, 106. 189 Engen, Scott 74, 75. 86. 94, 132, 179 Engle. Rich 115 I , Erickson, Steven 71, 118 Erne. Angela 118 Erusha, Don' 74, 75 Etringer. Nancy 106, 185 A Evans, Desia 106, 195 ' Evenson, Amy 70, 86 V Evenson, John 154, 155, 186, 187 Evemon. John 118, 172 Everman, John 132 , Ewing, Vance 67, 90, 118 Faris. Cynthia 132 Farrell, Barbara 132, 178 Feckeu, Merlin 106 Feldpouch, Laura 117, 118 Feldpouch. Melissa 106 Felts, Brenda ,106 Felts. Michele 132 Ferguson, Mary Ferria,'Mary 106, 139 Ferris, William 159 Fereon. Teresa 133, 179 Fiddick, Julie 77, 92, 101, 106 Fimreite, Amy 118 Finch, Corrina 133, 187 Fisher, Gary 133, 181 Fisher, Jodee 133, 179, 192 Fisher, Michelle 66, 77, 88, 106 Fisher, Steve 106 Fix, Dean 100. 118 Fix, Shelly 118 agg, Michael 5, 50, 52, 53, 64, 72, 74, 75 78, 90, 94, 133, 145, 198, 199 Fleming, Christopher 118 Fohian, Bryan 106 Folchert. Bruce 133, 152 Foley, Elizabeth 14, 88, 118, 188, 196 Folkers, Carrie 133, 179 Folkers, Marlya 156, 171, 181, 205 Forrester, Grant Fouts, Dori 100, 133 Franke, Joan 14, 66, 77, 88, 106, 135, 188 Franke, Judith 66, 76, 77, 118, 188 Franklin, Curtis 71, 107 Franklin, Jon 74, 100, 133 Freeland. Angela 118 Freeland, Dennis 74, 75, 137 Freitag. Audrey 156 Friedel, Michael 133 Frisch, Laura 17, 21, 134, 153, 179, 197 Froehner, Paul 118 ,Fruhn, Robert 75, 107 Fullbright, Cannen 134, 179 Fuller, Christine 118, 193 Fulton, Nicole 118 Haas, Petra Haberkamp, Lisa 108 Haes, John 134 1-tm, Kelly 118 1-Iagarty. Abigail 14, 108 Hagge, Kerrie 50, 134, 152, 153, 186, 181, 193, 197 Hagner, Paul 80, 118 Hahn, Carolyn 118 Hahn. Helen 156 Hahn, Sue 20, 21 156, 178 Halligan, Lila 1-lalterman, Tony 118 Halupnik. Penny us, 194, 195 Halverson, Jon 118 Halverson, Steven 85, 134 Hambly. Olive 156 Hammer, James 108 Hammer, Jeffery 118 Hammer, Julie 118 Handberg, Scot 80, 108 Handorf, Eric 67, 90, 134 Handorf, Stephen 108, 198 S Hanktn Tina 134, 179 HR1'1SUI1,,B8Ib31'21 36, sa, 51, 124, iss, 194, 199 Hansen, David 118 Hansen, Dolye 74, 120, 137 Hanson. Daniel 90, 120 Hanson, Mette 108, 186 Hanson, Rachel 77, 108, 189 Hanson, Valerie 108 Hardwick, June 135 ulton, Sara 181 Funk, Judy 1, 155, 196, 197 Futch, Tina 107 Harless, Kermit 13, 56, 57, 71, 120, 186 Harmon, Betty 120 Harmon. Julie 135, 178 Futch, William 96, 134, 188, 1 89 adow, Jennifer 107 Gaede, Cindy 50, 134, 178, 202 affney. Angie 107 affney, Mary sa, ve, ss. 92. 134. 153. ns 198 Gamble, Linda 118, 203 ard, Lenny 118 ardiner, Susan 107 ardner, Penny 76, 97 ardner, Tim 118 atcwood, Michelle 107, 187 avlock. Karla 107, 108, 149 avlock, Kary 149 Genulous, Renee 118 Cverholdt, Tim 118 Geving, Heidi 41, 59, 118, 207 Gjere, Tammy 118 Gill, Emily 170 Gluviak, Jeanette 118, 192 Godsey, Julie 108 Godsey, Shirley 7, 118 Goetsclx, Christopher Goetz, Mitchell 56, 75, 80, 85, 108, 188 gala, John 15, 61, 90, 108, 188 oodman, Mark 108, 188 Goodman, Warren 13, 134, 188, 189, 198, 199 Goodson, Randy 108, 188 Goodwin, David 134 raen, Troy 75. 79, 108 raham, Ty 118 Grahm, Jack 187 Grandon, Dean 134 ranneman, Tracy 118 rant, Keith 118 Grant, Kelly 75, 80, 108, 187 randon, Dean rand Trac 134 198, 199, 206 Harris, Burt 76, 115 Hurd, Sheila 136, 178 Husome, Jody 120 Huth, Amy 65, 76, 84, 120 Huth, Les 10, 32, 62, 159 Hyberger, Sondra 136, 181 Ihdc, Edward 120 Ingersoll, Connie 135, 178, 186 lngham, Gerald 80, 108, 172 Izer, Monica 108 Izer, Robert 136 Jacobsmeicr, Debra 108, 187 Jacobsen, JoDee 120, 194 Jacobsen. Troy 74, 78, 120 James, Bruce 74, 78, 90, 98, 136, 199 , Y- Y Y GrAPP, Darren 118 G1-aPP. Todd 134 Gray. ,Gray, Gray, Gray. Gray, 'Gray, lGreen 'Green Green reen Karen 118 Mark 134, 152, 185, 197 Michele 108 Pamela 108 Suzette 108 Todd 118 C, Michelle 64, 66, 88, 108, 135 wood, Troy 118 wood, Scott 108 wood, Steven Gregory, Kirsten 101, 108. 187 Grieger, Michael 34, 134, 199, 203 Griffith, Dave 75 Grimth, Mike 75 Harris, David 156, 173 Hart, Tina 108 Hatcher, Angela 108 Hathaway, Richard 107, 135 Haugebak, Valerie 120 Havlik, Jodi 135 Hawkins, Sara 135 Hazen, Andrew 75, 90, 108 Hazlctt, Bradley 135 Hazzard, Meagan 108, 192 Heath, Bradley 135 Heath, Brett 62, 135 Heath, Dawn 108 Heath, Wendy 62, 135, 181, 186, 187, 198 Heath, William 120 Heckrorh, Jeffrey, 62, 14, vs, 79, 98, 135, 199 Heclcroth, Kim 120, 187, 192 Heaney, David 156 Hein, James 62, 135, 181 Heins, Kevin 46, 67, 100, 120, 185 Holland, Kyle 120 Henderson, Jennifer 66, 120 Hendrickson, Arny 135 Henning, Heidi 12, 108, 187, 194 Henning, William 61, 135 Henninger, Cynthia 135 Henry, Lisa 108 Henry, Lori 2, 18, 19, 32, 88, 120 Henry, Roxanne 20, 68, 120 Herbsleb, David 120 Herman, Randall 61, 135 Herman, Rick 61, 74, 75, 135, 137 Henle, Jill 135 Hesse, Mary 3, 7, 61, 66, 135, 188, 198, 199 Hess, Mary 36, 108 Hess, Paul Hesse, Mary 7, 33, 42, 56, 66, 76, 188, 189 Hewett, Sarah 70. 120, 149 Hcwett, Susan 66, 120, 149 Hildebrand, Darrin 120 Hildebrandt, Travis 80, 108, 188 I-lileman, Linda 135, 150, 151 1-101, Stephen 42, 53, 150 Hill, Trent 56, 135 Hills, John Hilmer, Henry 120 Hilmer, Tammy 108 Himebaugh, Bradley 150 Hines, Janet 10, 136 Hinz, David 75, 90, 108, 187 Hipple, Anthony Hochesang, Jon 136, 181, 199 Hoer, Dennis 108 Hoffey, Matthew 120 Hogan, Micheal Holland, Wendy 96, 136, 192 Holler, Kendra 108 Holley, Devon 136, 179 Holmes, Teresa 136, 178 Holmes, Todd 108 Hoist, Paul 136 Hulvik, Martha 187 Hopkins, Andrea 36, 120, 185, 186, 193 Hoppenworth, Renee 108 Harstman. Bradley 120 .1 anssen, Constance 120, 186 Janssen, James 75, 79, 108 Janssen, Leslie 108 Jasper, Gayle 84, 136, 178 Jeffrey, Kurt 95 Jenkins, Dave 50, 136 Jenkins, Thomas 120, 188 Jensen, Brian 46, 136, 185, 186, 187 Jensen, Jermen, J ensen, Jensen, Jensen, Daniel 136, 150, 151 Kimberly 3, as. 16, ss, 136 Kun 41, 14, 15, 135, 145 Shannon 108 Steven 27, 136, 181 Tamara 76, 88, 92, 120, 174, 197 Jerke, Michael 75, 108 Jensen, Jerke, Teresa 136, 189, Jernigan, Lathan 187 Jeys, Caren 108, 187 Jirak, Denise 77, 86, 101, 108, 188, 189 Jirak, Michael Johnson. Johnson, Jeffrey 108 Johnson. Jo 77, 84, 108 Johnson, Kevin 121 Johnson, Kreg 108 Johnson, Steve 121 Johnson, Teresa Jones, Dawn 121 Jones, Gina 108 Jones, Howard 54, 58, 136, 169, 196, 198 Jones, Keith 136 Jones, Lam-een 121 Jones, Rick Jones, Scott 121 Jones, Terry 121 Jordan, David 75, 80, 108 199. 204 Jean 16, 120, 170, 185 Gronowski, Richard 108 Gronnwski. Teresa 134, 181 Gruis, Larry 156 Guillermo, Cora 156, 159, 204 Guillermo, Mae 22, 35, 37, 134, 159, 173, 193 pmtneetn, Todd us l Hosea, Kevin 181 Houston, Sandra 136, 181 Howard, Elizabeth 120 Howard, Gayle 120 Howard, Larry 120 Howard, Michael 74, 136 Howard, Robert 136, 179 Huff, Bart 67 180 Huffman, Melissa 150 Hufftnan, Paul 80. 108 Hughson, Lora 26, 136, 143, 178 Huisman, Brian 120 1-11111, Christopher 120 1 Hunck, Brian 56, 136, 188 Hundley, Matthew 75, 108, 187 Handley, Terri 70, 120, 202 Jordan, Jennifer 9, 18, 19, 32, 111, 121, 194, 195 Jordan. Mark 136 Jorgensen, Beth 24, 108, 187, 195 Jorgensen, Teresa 16, 136 Juhl, Brock 108 Juhl, Margaret 156, 168 Juhl, Ross 75, 79, 90, 108 Junkins, Jeffery 56, 57, 136, 178, 198, 186, 187 Junkman, Cathy 188 Kammeyer, Timothy 136 Kampman, Marlene 27, 39, 121, 171, 187, 197, 205 Kao, Jon 121 Katchcr, Joel 80, 121 Keeling. Sheila 108 Keeling, Thomas Keigan, Robin 108, 167, 188 Kelly, Kevin 14, 121, 137 Kelly, Kristine 108 t Kemming, Becky 156 Kemp, Mary 138, 179 Kent, Wendy 121 Kerr,Thomas 138 Kecpke, Mike 75 Ketter, Jason 138 Kibbee, Dawn 121, 146 Kihbee, Randy 74, 90, 121 Kieffer, Benjamin 47, 138, 185, 199 Kilander, trip 53, 67, 90, 121, 205 Kimball, Sue 156 Kimpston, Juanita 121, 187 King, Anne 121, 189 King, Steve 71, 138, 199 Kintzel, Kimberly 70, 84, 108 Kirchmann, William 108 Kirk, Tom 90, 121 Kirkle, Kathleen 138, 186 Kirkpatrick, Trisha 52, 138, 198, 199 Kittelson, Karla 138 Klages, Laurie 108, 187 Klages, Steven 138 Klammer, Kelli 16, 138, 178, 186. 199, 200 Klammer, Kurt 108 Klapprodt, Darin 137, 176 Klein, Barbara 156 Klemp, Susan 108, 187 Kleinmeyer, Chad 121 Kleinmeyer, Timothy 138 Klemuk, Sarah 108, 186, 187, 192, 200 Klepfer, Jeffrey 56, 57, 74. 80, 90, 121, 186 Klink, Gerald 21, 156 Klingenberg, Katrina 121, 189 Klingenborg, Jolene 150, 178 Klinger, Kathryn 56, 57, 76, 84, 121, 186 Klocke. Nancy 108 Kloster, Lea 121, 187 Klotz, Stacy 138 Knapp, Dorothy 121, 187 Kneppc, Tasha 77, 108 Knief, Christopher 121 Knoll, Linda 121 Koble. Barbara 156 Koch, Charles 43, 45, 47, 156, 184, 185 Koepkc, Michael 79, 108, 187 Kofron, Judy 138, 153 Kohls, Perry 121 Kohn, Christopher 74, 121, 170 Kolpek, Dawn 138, 153 Kolthoff, Kelly 75, 80, 108 Kolthoff, Ken 74, 75, so, 91, 137, 138, 203 Kono, Bobbi 70, 120 Koopman, Andrew 120 Korte, Bryan 108 Kozak. Patricia 108 Koupal, Kendra 57, 100, 120, 186 Kramer, Barry 138 Kramer, Kathleen 108 Kramer, Mike 80, 108 Kratchmer. Scott 138, 181 Kratz, Trudy 120, 197 Kratnenstein, Claudia 84. 120 Krause, Christine 70, 89, 108, 199 Krause, Steve 120, 190, 191, 196 Kreb, Karl 8, 79, 107, 108, 188 Krejchi, Daniel 120 Kriens, Donald 120 Krough, Kathrym 107, 108, 185 noun, Kandi 62, 76, 77, az, 129, ua, tvs Krttll, Michelle 2, 41, 122, 194 Kuehl, Tamara 138, 186, 199 , Kuchl, Victoria 139, 179 Kuepker, Laurie 10. 192 1,aCoste, Kerry 56, 57, 67, 90, 122, 186, 189 Laipple, Michele 88, 108, 127, 187 Lambert. Linda 52, 139 Lang, Susan 122 Larkin, Barbara 35, 37, 139, 192 Larson, Greg 74, 122, 137 Laughlin, Lisa 43, 51, 86. 139, 186 Laylin, Mark 122, 137 Laylin, Michelle 10, 139 Lawson, Douglas 75, 108 Lawson. Joan 88, 110 Lawson, Ken 74, 122 Leahy, Paul 7s, ss, 122 Lee, Cathy 110 Lehman, Jill 12, 20, 48, 49, 122, 137, 183, 197 Leider, Steve 110 Lein, David 110 Lemons, Michelle 110, 177 Lentsch, Dawn 3, 40, 52, 64, 66, 88, 89, 139, 145, 166, 198 Lentsch, Tammy 66 Letney, Todd 74, 90, 94, 139, 199 Lcvercnz, Grant 110 Levercnz, Lance 139, 153, 191, 199 Lewis, Dale 56, 74, 122, 188, 189 Lewis, Frank 74, 122 Lewis, Neil 56, 57, 58, 91, 94, 139, 188, 189, 199 Lewis, Ray 110 Liebbe, Angela 9, 18, 19, 32, 36, 122, 194, 195 Lindell, Whitney 110, 167 Lindholm, Kristen 110 Lilly, Christnpher 12, 74, 122 Lindberg, Mitchell 139, 179 Little, Brenda 139 Liu. Nancy 110 Livingston, Chad 110 Llewellyn, Michael 50, 52, 64, 65, 74, 75, 80 81, 97, 99, 139, 196 Lohman, Lori 48, 122, 183, 188, 196, 198 Lonergan, Christopher 110 Lonergan. Pat 139 Long, Khin 122 Long, Marc 71, 75, 110, 168 Long, Rodney 122 Long, Stephen 50, 139, 173 Indexf209 199 Robert 157, 159, 183 Longnecker, Joshua Longnexzker, Sarah 66, 122. 186 Loomis. Roger 139 Lorsung, Grant 122 Lnslc, Robert 156 Laurie, Melinda 112 Love. Mark 100, 139 Love. Ryan 46, 48, 139, 182, IB3, 185 Love, Troy 80, 122, 199 Lovell, Shelli 27, 122 Lowe, Craig 75, 95, 110 Lubbert, Aaron 94, 122 Lundeen, Charles Lybbert, Brad 34, 71, 139 Lynch, John 79. 110 Madsen, Carolyn 15, 88, 139, 192, 199, 200 Madsen, Diane 15, 122, 187, 194 Madsen, Angela 110 Madsen. Ken 141 Magee, Jerome 141 Magers, Bruce Magers, Scott 110 Majerus, Richard 11, 74, 75, 94, 98, 122 Majerus, Timothy 85, 122, 196 Malam, Shelley 110 Mallin, Daniel 75, 90, 110 Malm, Eileen 56, 122, 188 Manahl, Leo 78, 122 Manley, Lynn 38, 122, 197 Manley, Tom Marcussen, Richard 70, 71. 87, lll, 157 Markey, John 110 Marsh, Richard 74, 122 Martin, Lynnette 66, BB, Il0, 186, 187 Martinaon, Christopher l 10 Mashek, Kim 50, 110 Mathes, Harlan 110 Mathes. Jeffrey 110 Mathes, Kiana Matthews, Timothy 112 I Matthias, Doug 75, 80, 110 Maughan, Laura 141, 185, 187 Maughan Linda 141. 153, 185. 186, 187, 204 Mayne, Teresa 141 Maytum, Diana 120, 121, 122 McCann Denise 110 McCarthy, Pat 123 McClain, Janet 24 McCulloch, Leslie 110, 185, 187 1 McCulloch, Rhonda 38, 139, 141, 184, 195, 196 86 McCullough, Brian 13, 123, McCunniff, Bradley 71, 123, 186 McCunniff, Kurt '75, 110 McCunniff, Michele 123 McCuniff, Tracy McDonald, Deborah 50, 110, 187 McDowell, Todd 141, 181 McEnroe, Tim McFarlane, Lisa 123. 186 Mclnroy. Dale 123 Mclnroy, Lisa 27, 141, 153, 185, 197, l99 Mclnroy, Mary 141, 179 McKee, Laura 105, 111. 194 McKee, Wendy 195 McKinley, William 157 McNair, Don 74, 150. 181 Mckobem, Soon 111 McWilliams, Mary 68 Meier, Mark 42, 56, 96, 123, 186 Melberg, Erik 51. 157, 183 Meyer, Jacqueline 123 Meyer, James 157, 173 Meyer, Karla 112, 123 Meyer. Kristen 116, 1117, 123, 195 Meyer. Monte 86, 123 Meyer, Ronda 141 Meyerhoff, Katy Meyers. Christopher 67, 141 Meyers. Jeffrey 71, 90, 141 Michalek. Elizaabeth 141 Michels. Adam lll Mickens. Kim 111 Mickey, Lori 55, 84, 111, 123, 203 Mikkelsen, Angela 16, 20, 56, 68, 88, 92, 100, 141, 153, 188, 189, 199 Miller, Christopher lll Miller, Claude 100, 141 Miller, Gregnry 86, 141 Miller. Mary 111 Miller, Melanie 141 Miller, Nick 80 Miller. Paul lll Miller, Scott lll Miller, Theresa 141, 178, 187 Minehart, David 141 Minikus. Brenda lll Minilws. Gary 74, 123 Mnikus, Jeff 181. Minikus, Joni 88, 123 Minikus, Sheri 12, 141, 179 Minnick. Robert 123 Mitchell, Patricia' 123, 187 Mtchcll, Patrick 72. 75, 87 Miltelstadl, Lisa 67. 77, 88, 92, 93, Ill Moe. Kimberly 7, 57, 66, 141, 162, 186. 199, zoo, 202 Moehlls, Soon 111 Z10flndex Moes, Margaret 141, 178 Mohling. Teresa 61. 70, 116, 117, Molla, Michael 25, 75, lll Mondry, Leo Monaghan. Dawn 123 Moon, Linda Moore, Thomas 71, 74, 98, 123 Moran, Scott Morgan, William 157 Mork, Suzanne Morrow, Sarah 123 Mohling, Clifford 3, 26, 35, 71, 96, 128, 141 123 Morse, Morse, Moyer, Moyer, John 111 Patrick 123 Christy 70 Kory 141 Mauna, Tad 95 Osborn, Melissa 112, 187 Ostendorf, Michael 80 Oson, Celeste 123 Ouen, Kelly 112, 189 Page, Kenneth Muammar, Sari, 74, 141 Mudd. James 94, 123 Mudd, Robert 75, 79, 95, 111 Mueller, Todd 123 Mullen, John 137, 157, 177 Muller, Jennie 111 Mumm, Julie 24, 107, 111 Mundi, Jeffrey 34, 36, 43, 47, 57, 141, 154, 186, 199 Munksgaard, Larry 20. 157 Munson, Lori l23 Murdock, Thomas 141, 181 Murphy, Michelle 4, 70, 76, 123, Murray. Ann 3, 76, 77, 141, 190, Naber, Kendall 141 Nance, Kerry 111, 188 Nalvig, Janet 142, 199 Neal, Brian 111 Nedoba, Timothy 86, 142 Neessen, Jennifer 123. 189 Nelson, Angela 123, 171, 245 ss, iss, 200 109 187 Page, Pamela 123, 196 Pagel, David 48, 124 Pagel, Scott 112 Pape, Angela 112 Paquin, Ray 112 David 41, 75, 80, 112, 186, 137 Pardoe, Susan 68, 124 Parker, Michelle 124 Parker, Sheri 5, 112, 187 Pardee. Pashhy, James' 112 Pashhy, Monique4. 124, 193 Patel, Dipalc 15 Paulson, Lisa 70. 142 Paulson, Mary 77, 101, 112 Paup, William 157 Payne, Dorothy 121 Peclx, Brian 142 Pedersen, Brian 30, 46, 59, 142, 166, 185, 199 Pedersen, Kurt 75, 112 Pelzer, Anne 37, 52, 58, 76. 140, 142. 182, 185, 189 Perry, Emily 142 Pershing, Petersen, Chad A112 Petersen, Christine 112 Petersen, bee 75, 79, 90, Petersen. Petersen Michelle 142 Petersen, Steven 124 Peterson, Ann 124, 189 Peterson , Lloyd 159, 172 Peterson, Mark 72, 74, 7 Peterson Peterson , Sandi 68, 125 Jennifer 124. 185, 188 112 Lisa 51, 59, 142, 178 5, 78, 98, 142 Scott 74 98 99 125 159 Nelson. Nelson. Nelson, 1 98, Nelson. Michelle 123 Phillip 111 Rachael 142, iss, 159, 1 83, 189, Pfalzgraf, Amy 68, 101, 112, 188 Pfalzgraf, Michelle 33. 128, 143, 192 Phalen, John 75, 112 Plialen, Pa! 74, 100, 143 Philips, Elizabeth 1, 21, 76, 77, 143, 174, Nero, John 156. 157, 206 Nesvik, Michael 74, 123, 203 Newton, Nancy 157 Ngo, Hao 123 Nicholas. Andrew 106. 123 Nichols, Bradley 75, 79. 187 Nichols, Bud 38, 157 Nickel, Mark 4, 42, 46, 58, 105, 198 Nicol. Terri 142 Niederhauser, Chris 123 Niederhauser, Teresa 142 142, 185, Niederl, Lisa 56, 142, 182, 183, 188, 189, 199 Niehuas, Merle 123 178 Phillips, Patrick 125 Pichl, Merle 43, 158, 184, 185 Pierce, Janelle 125 Pierce, Jason 90, 125 Pierce, Teresa Pierce. William 125 Pierson, Bryant 125 Pietan. David 175 Pietan, Timothy 143 Piecsch, Pilcher. Kun 86, 125 Jerald 125 Pine, Elizabeth 68, 92, 101. 105, 112 Pine. D. Taylor 10. 36, 74, 75, 90. 143, 198 Pinsonneault, Liza 125 Nielsen, Jeffrey 74. 91, 123 Nielsen, Kristin 142, 179 Nijim, Dawn 38, 48, 137, 142, l 198, 199, 200 Nijim, Samia 45, 184, 185, 186. Nimrod. Kate Nissen, David 67, 90 159. 188, 1 Nissen, Jerry 157, 159 Noack. Susan 68, 168 Noonan, Heidi 47, 56, 57, 121, 1 186. 187, 190, 191, 193, 196, North, Autumn 123 Ncrthrup, Ward 123, 126 Nollger, Jodi 60, 142 Nottger, Julie Obadal, Steven 21, 74, 90, 94. 1 Ochsner. Scot! Odekirk, Pauline 142. 185. 187 Odlc, Traey 60, 88,7141 192 O'Donnell, Mark 74. 75 Ohler. Steve 142 Ohrt, Jeffrey 142 Olejnicuk. Mark Olsen. Kristie 192 Olsen, Mark 8. 188 Olsen, Stephanie 84. 123 Olson. Jon Olson, Todd 79. 98, 99, 142 OISSQI1. Carol 122, 157, 175, 203 Olsson, Richard 113 - Oltmann, Ross 142, 181 Orth, Kevin 75. 112 Orth, Terry 64, 74, 75, 80, 81. 90, 142 Orr. Jill 66, 77 Orr. Karen 157 53, 188, 193, 195 89, 191 23, 185. 197 ll, 123, 196 Pint, Monique 125, 185, 202 Pitsenharger. Jill 51, 143 Plantan, Jayne 57, 59, 143, 152, 186 Poe, Michael 74, 78, 125 Polk, Kenneth 112 Pope, Carolyn 143. 181 Pope, Ronald 75 Porter, Joseph 14. 112 Powder Puff 96, 97 Powell, Shaun 125 Powell, Troy 112 Power, Laurie 125, 127, 185, 187, 193, 194. 206 Price. Rebecm 143 Prics. Josephine 158 Probert. Keith 143 Proctor. Jeanne 158 Purcell, Gerald 24, 25, 158, 174 Purk, Jeffrey 56, 71. 125, 188 Quinn, Alisha 112, 187 Rains. Michael 80. 125 Randall. Steven 125, 186, 203 Randall, Conrad 125 Randels, Gary 125 Rao, Rukko 54, 143, 189, 199 Rapp. Duane 143 Rappaport, Mark 79, 95, 112 Rasmussen, Kurt 112, 167 Rasmussen, Lori 68, 125, 186 Rasmussen, Robert 143 Ratekin, Ruth 158 Rath, Elizabeth 158, 159 Reed, Gary 143, 179 Reifsteck, Brad 94, 143 Rekward, Bradley 125 Reelfs, Quint 112 Rellihan, Robert 158 Renning, Jim 112, 115 Ressler, Dawn 38. 125, 192 Reysack. Rhonda 125 Rhoades, Yveue 70 Rhonda, Mona 143 Rich, Joseph 143 Richard, Todd 85. 125 Richardson, Lara 112, 188 Ridder, Torn 75, 112, 125 Ridder, Thomas 125 Richtsmeier, Lisa 143, 179 Rider, Dave 143 - Richle, Charles 95, 159 Ries, Tad 80, 125 Riley, Linexte 143, 193 Riley, Sean 125 Rindels, Kelly 4, 125, 188, 193 Rippe, Douglas 75, 112 Ripplinger. Catherine 125 Ripplinger, soon ss, 48, sv, 144, iss, iss, 196, 197, 199, 201 Ritter, Jamie 125, 193, 194 Ritter, Kimberly 39, 144, 181 Roberts, Michelle 125 Roberts, Nicholas 112 Roberts, Robin 74, 125. 162 Roberts, Troy 112 Robineu, Christine 125 Robinson, T. Cameron 75, 95, 104, 105, 112, 113, 186, 187 Robinson, Valerie 144, 186, 187 Roderick, Joe 124, 125 Rogers, Scott 90, 125 Rohde, Troy 125 Rolinger, Camilyn 66, 76, 77, 88, 104, 105. 113 Rolingcr, Mark 61, 74, 78, 97, 98, 116, 117, 125, 198, 203 Romthram, Dave 74 Ross, Michele 70, 101, 113, 116 Rosteck, Brian 144 Rube, Michael 113 Rubicam. Cliff Ruhlmann, Phillip 125 Rule, James 74, 144 Runldc, Paul 144 Rusch. Michael 125 Russell, Meghan 188, 189 Ryan, Jennifer 113 Ryen, Michael 113 Sadler, James 79, 113 Sadler, Linda 54, 76, 144, 153, 178 Sanger. Shirley 113 Sagert, David Salmons, Eric 144 Samek. Judy 68, 76 Sanders. Darin 85, 125 Sands, Dawn 50, 144, 203 Sands. Kris 125, 187 Sands, Shelly 113 Sandvik, Loren 144, 150, 151 Samkey, Galen 125 Sash, Michael 13, 74, 80, 90, 125 Sater, Judy 16, 20, 144, 178, 198, 200 Scarbrough, Michael 78, 99, 125 Schachterle, Renee 125 Schaper, Leslie 179 Schiller, Teresa 125 Schipper, Dan 125 Schlais, Laura 125 Schlirnmer, Penelope 100, 133, 143, 144, 178 194, 199 Schluetter, Darlys 125. 171 Schmidt, Angela 125 Schmidt, Tammi 113, 198 Schmnll, Michael Schneider, April 144, 198 Scholz, Jennifer 144, 179, 186 Schoneman, Dawn 125 Schreiber. Kurt 56, 113, 188 Schuler, Ty 79, 95, 93, 113 Schultz, Saou 144, 181 Schwantes, David 113 Schwames. William 125 Smit, John 158 Seavey, Barbara 113 Seavey, Jennifer 81, 96, 125, 127 Sooor, Daniel 144 Seeor. Richard 74, 113 Seoor, Sandra 113 Seeley, Jim Seichter, Andrew 74, 75, 78, 98, 125 Seidel, Connie 125 Seres, Richard 56, 110, 125, 185, 188 Settle, Tom 95. 113 Sevey, Tammy 113 Seufferlein, Penny 10, 144, 192, 199 Seyffer, Kirsten 125 Sharp, Michelle 113 harp, Mindy 23, 50, 77, 88, 113, 189 Shaw, Linda 70 Shaw, Michael 144 Shaw, Susan 16, 100, 125, 185, 193 Sheehan, Michaela ss, 16, 71, ss, 92, 125, 186 Sheibley, Dawn: 119, 144 Shields, Timothy hephard, John 71, 125, 196 Shepherd, Tom 158 Sherman, Thomas 113, 187 Sheth, Mira 125, 193, 194 Shields, Sara 27, 125 hin, David 125, 188, 191, 198 hin, John 144, 168, 189, 191, 199 Shinstine, Kathleen 92, 144 hinstine, William 74, 125 Shcgren, Shelli 76, 125 Schuchart, Kelvin 158 ickles, Janet 139, 144, 179, 185, 186 Siems. Kip 144, 181 Siems. Tracey 125, 192 Silverson, Robert 113 immons, Pam 125 imon, Melissa 156, 145 imon, Traey 113 impson, Ellen 113, 187. 195 impson, Kurt 67, 145 Sims, John 125' Skaine, F. Todd 145 ltiles, Caterina 145 Skiles, Steven 80, 113, 114 Slick, Clarice 76, 125 Slick. Paul 114 Slobe, Shawna 88, 114 siyknnis. Jerry 7, sa, iss, 172 Smalley, sim vs, 114, 201 mart, Mary 158 mith. Ann 114 mith, Jeffrey 90, 95, 114, 125, 188 mith, Kevin 114 Smith, Kimberly 145, 199, 206 mith, Lisa 114 mith, Lori 145, 178 mith, Lynell 68 mith, Paula 178 mith, Scott 74, 94, 189 mith, Shanan 125 rnith, Steffany 59, 145, 179 mith, Troy 125 mith, Valerie 70, 114, 186, 187 mock, Lori 114 mock, Monte 145, 181 nell, Joel 75, 90, 114 nodgrass, Joel 74, 125 nyder, Holly 145, 179 nyder, Stephanie 9, 18, 19, 32, 34, 35, 37, 86, 145, 194 ial Studies 176 ldwisch, Steve 146 Sorensen, Chris 57, 71, 167, 188, 189, 198 orensen, Gerald 90, 114, 149 orensen, Gordon 90, 104, 105, 114, 149 rensen, Jeffrey 25, 95, 114 outh, Michael 114 pake, Kristin 114. 172. 188, 189, 197, 201 pande, Erik 146, 189, 191, 198, 199 pande, Kris 126 peaker, Jerry 126 'peach Department 177 pier. Michael 5, 114 pier, Wendy 146, 181 pooner, Michelle 68, 126. 187 pooner, Mike 10 , prague. Jill 68, 88, 114 PNY. Sandra 33, 70, 146, 198, 199, 200 ' uires, Sandra 10 tachovic, Linda 114 tainbroolt, Clint 114 Stainbrook, Kirlt 146 taniger, Mary 159 Stansbury, Carlton 27, 61, 146, 189, 198, 199 tarit, Ann 146 'taut, Antony 56, 114, 185, 188. 189 taut, Gregory 56, 126, 185, 188, 189 Steely, Jeffrey 114 tedman, Troy 74, 75, 137, 146 teele, Pamela 114, 187 teffy, Troy 146. 181 'tein, Jim 56, 126, 183, 188, 189 temmerman, Jill 35 1 1 1 Stettler, Monica '39, 40, 68, 104, 105, 114. 121, 174, 187 Stevens, Terry 114 Stevens, Timothy 114 Stewart, Kelly 4, 126 Stickfort, Jaryl 126 Stillwell, Lisa 114 Stokes, Matthew Stokes, Mickey 114 Stoll, Susan 6, 106, 146, 194 Strabala, Greg 74 Streeter, Barbara 74 Stroud, Vicki 126 Stum, Brandt Stych, Jeffrey 80, 126 Suggs. Cheryl 126 Sukovaty, Pauli 146 Sullivan, Dorothy 146, 187, 203 Sund, Diane 12, 99, 100, 146, 193, 204 Sutherland, Tyrone 80, 126 Sutula, .lon 86, 146, 199 Svobodny, Deborah 3, 76, 77, 92, 146 , Swallow, Stephanie 114 Swallow, Troy 78, 146 Swan, Roberta 114 Sweeney. Darryl 114 Swingen, Stanley 74, 80, 126 Swingen, Tracy 75, 114 Swyers, Mike 67, 146 Syhlman, John 59, 146 Syhlman, Ken 126 Syhlman, Kim Syhlman, Suzanne 117, 126, 189 Tamisiea, John 53, 74, 75, 94,,146, 199 Tamiaiea, Mary 126, 192 Taugeman, Teresa 68, 84, 92, 93, 146, 197 Tangen, Michelle 114 Teaford, Phillip 114 Teaford, Sarah 84, 146 Tedlie, Margaret 146, 189, 199 Teeters, Michelle 126 Tegtmeier, David 126 Tegtmeier, Kristy 134, 146, 152, 153, 178 Terrones, James 199 Terry, .Deanne 126, 186, 187 Terry, Rex 146 Thode, Michael 146 Thode, Thomas 75, 114 Thomas, Jeffrey 114 Thomas, John 146 Thomas, Mike 67, 86 Thompson, Maleia 13, 15, 48, 126, 147, 188, 189, 200, 201. 212 Thompson, Mark 114, Thomas. Michael 126 Thorson, Kari 147 Therson, Kristine 32, 126, 147, 178 Thran, Darrin 1-14 Tietje, Lori 42, 186, 207 Tiller, Gerald 114 Timmer, Timothy 114 Tirnmerman, Velda 159, 174,206 Timmins, Judy 159 Titus, Lori 53, 147, 188 f Tollefson, Gregory 79, 95. 114 Tonn. Dana 68,-, 77, 114 Topliff, Heidi 51, 58, 147, 179, 194, 195 Toplilf, Shawn 126 ' Tramontin, Laura 114, 173, 187 - Trangsrud, Brenda 133, 148, 178 Trangsrud, Jim 148 Trebon, Rebecca 148, 181 1 rreibef, seen so, sz, 14, 15, 137, 145, 148, 'J 198, 199 Treichel, Gary 114, 167 ' Tressler, Brian 114 ' Trost, Sally 77, 114, 187 Trotter, Daniel,98, 148 Trowbridge, ,Julie 126 Truax. Susan 148, 179, 203 Trumbauer, Ronald 148 Tnrnnen, Mark 46, las, iss, 196, 191, 199, 201, 205, 2121 Tucker, Lori 68 Tucker, Lori 126 Tunvlall, Shelly 114, 187 Ubben, Jeffrey 78. 94, 98, 148 Unlenaoap, Cathy 148, 199, zoo Ulrich, Dawn 114 Unruh, Marcia 114 Vance, Marguerite 159, 191 VanDeest, Pamela 105, 114 Vandeltieft, Melanie 126, 149 Vandelcieft, Michelle 126, 149 Vanderberg, Mary 148 Van Der Meer, Julie 56, 57, 58, 148, 151, 186 Vanderwerf, Deb 179 Van Duyn, Donald 71, 126 Van Home, Marie Van Vark, Jay 85, 148 Vaughn, LuAr1ne Vaughn, Robert 126 Vaughn, Troy 148, 162, 181 VerMulm, LeRoy James 60, 159 VerMu1m, Lisa 42, 148, 152, 159, 186, 192, 198, 199 VerPloeg. Phyllis 84, 98, 159 VerSteeg, Daniel 75, 90, 114 Virden, Vivan 159 Vognsen, Susan 114, 187 Voight. Anita 148, 178 Volfson, Ilya 80, 148, 199 Voss, Kelly 148, 178 Waddle, Linda Lou -159 Wagner, Tony 126 Wahner. William 126 Walker, 74, 78, 126 Walker. Sara 148 Walljasper, Melissa 66. 126, 198 Walljasper, Jim 148 Walljasper, Steve 114 Walter, Brian 148 Walter, Frank 159 Walter, Joel so, 56, 51, 1411, 152, 159, iss, 198, 199 Walter. Wilma Lucille 51, 159 Walton, Brian 74, 148, 159 Walton. Leo Harry 159 Walz, Laura 126 Ward, Lori 54, 126 Wamer, Candace 126 Warnke. Dawn 114 Wasesltuk, Drew 90, 148 Wasserfort, Sheri 114, 187 Way, Tammy 126 Way, Robert 71, 74, 90, 114 Weatherly, James 127 ' Weber, Belva 20, 121, 148 Weber, Melinda 127 Wedemeier, Heidi 114, 186. 187 Weeltley, Tenney 114, 185 Weigel, Greg 74, 127 Weiland, Danl 185, 196 Weires, Tom 74 Wellman, Kevin 7, 74, 86, 148 Wells, Catherine 38. 159. 169 Welter, Dave 75, 94 Wendland, David 127 Westcott, Lisa 50, 114, 167 Wetrich, Timothy 114, 187 Wetzel, Lora 133, 148, 178, 198 Wetzel, Wendy 148, 179 Weydert, Swtt 148 Wheeler, Elizabeth 48, 148, 149, 183, 188, 189, 191. 196, 197, 199, 201, 212 Wheeler, Grant 75, 79, 114, 187 Wheeler, Rebecca 48, 49, 137, 149, 183, 188 189, 196, 198, 199, 212 Whitaker, Jeffery 126 White, Kevin White, Lanoe 181 White, Matthew 74, 127 Whitlatch, Charles 127 Whitsett, Laurel 45, 52, 88, 112, 149, 185, 187, 195 Whitten, Lisa 4, 44, 45, 46, 114, 149, 195 Wiederanders, Jill 100, 149, 188, 193 Wiegardt, Craig 114 Wielenga, Kristin 149 Wieland, Dan'l 127 Wleland, Rachel 68, 101, 114, 187 Wiener, Laurie 127 Wilmer, Aaron 149 Wilmer, Michelle 68, 76, 127 Wilcox, Catherine 121, 149, 179 1 Wiley, David 86, 150 Wiley, Katherine 127 Willhite, Brad 90, 127 Willhlte, Lisa 68, 100, 127 William. Troy 127 Williams, David Williams, Julie 105, 114, 192, 206 Williams, Lori 134, 150, 178 Wilson, Amy 51, 150 Wilson, Diane 127, 187 Wilson. David 90, 114 Wilson, Nell 159 Wilson, Stephen 121, 112, 183, 191 Winkey, Winltey, Winkey, Winter, Denise 127 Nick 10, 73, 74, Shelli 9, 18, 19, Floyd 10, 115 75. 137. 150 32, 150, 194 Winter.. Mark 75, 79, 90, 114, 186, 187 Wise, Michael 150, 181 Witt, Andrew 55, 150 Witzel, Laurie 51, 150 Wohlert. Danette 127 Wood, Graham 67, 79, 114, 187 Wood, Grant Woodbury, Dana 68, 127, 198 Woods, Timothy 80, 127 Woodward, Kevin 74, 127 Woodward, Paul 75, 79, 95, 114, 188 Woody, Philip 6, 34, 94, 128, 150. 196, 202. 207, Wrestling 80, 81 Wright. John 127 Young. Bryan 43, 114, 185 Yokem, Carl 150 Young. Chris 127 Young. Keith 80. 156, 157 Young. Keith Fay 159, 167 Young, Lori 50, 150, 186 Young, Michael 150 Young. Richard 46, 90, 128, 150. 185, 199 Young, Todd 150 Young, Tracy 70, 127 Youngblut, David 74, 75, 150, 181 Zeschke. Paul 150 Zierke. Kristi 188, 189, 197, 207 Zrmmennan, Troy 75, 114 Zucker. Erie 150 1ndexf2ll 1 N 1 4 f 4 1 WALSWORTH PUBLISHING COM PANY MARCELINE, MISSOURI, U s A b.:..f...Af.gx3 'mf ....m:tLf.u ... :WE . 14-!3?!1! '! xiflruvr his-namruu qu-vs .wr -uv 'gnu ' 1 -' gf- 1.4-A,-A-1:-W ., ..- A., .4- L --1:f g.-:, ,- 1 V:--P :n.,, , fl u-0.1 ' '45 ' 649' '., ,K V .1y43f'QH1' ,93. -'ygg-gg. :F fy-.qqfff-? t3j,, Q-, .,'1,,fg-'t ,I- wu.rn,.v:-n-nrm- fury,-xgf -