Booker T Washington High School - Graffiti Yearbook (Pensacola, FL)

Page 45 text:

ziggy ' . N .t 5 Sy, While Marybeth Wright shows Sandi Trehern some new moves before the Veterans Day Parade, Ken Curtis wonders why they are still talking after being called to attention. Y- is crowd. Dancing to I Can't Stop Loving You the Guard receives cheers and screams from the af Q. 173313-fe,70lr O Gr GS aorqg 43nd IG Oper Q6 afe W . taboo? 156 tl, 61- tb c- fir 17241 . '70 slca '?Jet0h Gd 5 173 gt 'V U76 Outlbe 5' Flag Corpx 41

Page 44 text:

It's Hard Being a LIVING DOLL Fro ,MMTNX ,,,,..a....,,N ff!! L,....-i-.axl , 'T EN e Q .fffl 1 X ,f'f,,af'l' tt f .1 Teal' ' D 'AAA I N f z. r ., W. ., W . . 32 i X , ff 'af' r 7 4 25 ea sea-22X f ,Sf 1 r ,,..-.,,,.a Y X fda---via, Nl-. X! 1,92 ,ff ff-W 'eea.7:QQeQex I r ,ft es. E f N 1 ,s at if Q ff K A 1 ,f vgxn fl My XTNNXX X iYxxxigL WV, f 5 f Xxlry if A X ,f W3 he week before school started students relaxed in the summer sho lffped for clothes, or worked the last few hours of their summer job, me , bers of the Fla Cor s worked at school from 9:00 'till ZIQO- B they SX ere back practicing until 8:00 learning the routine to Shine Do an!-,x 1 Can't Stop Loving You. Spinning in sequence, flag anglesyfgiilst strenglsltqb and body posture were drills that strained muscles, caused and malllegflqands rough and callous. The guard began Monday full o spirit, b i'AA Friday no one could walk without wincing in pairyfg I Lmscles ached fro? Ngrqours of overuse. The practice paid off, sai yr'i 1 'n Ken Curtis, gil good on the field. Captain Tonya H , iffdled and shouted, Nwe have an instructor this year! e guards luck in having aEMl.Qd instructor ran out. Aft game, Todd Horton quit. The respwlwgaof perfecting, tea A1 Vigp in leadership fell on the shoulders of the cgtqgfxslgtain Elizabqrh ecided, Let's do it - H!! for ourselves. We know th we oar35.doit4,QVe1-owing such problems called for hard work and deternminiiikyhfflilvf-fiiffgpard came through with flying . Nc XS f . T ' - colors. The new adlustmentsxtoftljvunrforms, and the new flags, and equipment added to their wonderfulhgf-time shows. - Elizabeth Thomas N, IH Head to Toe 40 Flag Corpf Members: lst Row: Tonya Howell, Ken Curtis, Elizabeth Thomas, 2nd Row: Veronica jordan, Tracy Rodgers, Tina Wild, 3rd Row: Clorissti johnson, Renee Finkley, Elin Weiser, Katrina Longmire, Alyssa Hunter, 4th Row: Kim Goggans, Shenitajohnson, Vette Burnette. I hope I get this move with the pink hoop correct, wishes Tina Wild as the dl solo delights the crowd. It's been a wild, wonderful, and wacky season, says Flag Corps Captains Tr Howell, Ken Curtis, and Elizabeth Thomas

Page 46 text:

x veg af l 4 7 B11 mf Assistant Director Mr. Monzingo listens along with rookie Matt Rasmussen to Mr. Tipton's instructions before the Veteran's Day Parade. The harmony of Tequila echoes through the gym as Paul and David watch the Drum Major for the cut-off signal. Bart Edwards checks his step during the playing of Shine Down, the band's opening number. Chris Curry shows the true spirit of Homecoming before he begins to play the fight song. I-