Booker T Washington High School - Graffiti Yearbook (Pensacola, FL)

Page 44 text:

It's Hard Being a LIVING DOLL Fro ,MMTNX ,,,,..a....,,N ff!! L,....-i-.axl , 'T EN e Q .fffl 1 X ,f'f,,af'l' tt f .1 Teal' ' D 'AAA I N f z. r ., W. ., W . . 32 i X , ff 'af' r 7 4 25 ea sea-22X f ,Sf 1 r ,,..-.,,,.a Y X fda---via, Nl-. X! 1,92 ,ff ff-W 'eea.7:QQeQex I r ,ft es. E f N 1 ,s at if Q ff K A 1 ,f vgxn fl My XTNNXX X iYxxxigL WV, f 5 f Xxlry if A X ,f W3 he week before school started students relaxed in the summer sho lffped for clothes, or worked the last few hours of their summer job, me , bers of the Fla Cor s worked at school from 9:00 'till ZIQO- B they SX ere back practicing until 8:00 learning the routine to Shine Do an!-,x 1 Can't Stop Loving You. Spinning in sequence, flag anglesyfgiilst strenglsltqb and body posture were drills that strained muscles, caused and malllegflqands rough and callous. The guard began Monday full o spirit, b i'AA Friday no one could walk without wincing in pairyfg I Lmscles ached fro? Ngrqours of overuse. The practice paid off, sai yr'i 1 'n Ken Curtis, gil good on the field. Captain Tonya H , iffdled and shouted, Nwe have an instructor this year! e guards luck in having aEMl.Qd instructor ran out. Aft game, Todd Horton quit. The respwlwgaof perfecting, tea A1 Vigp in leadership fell on the shoulders of the cgtqgfxslgtain Elizabqrh ecided, Let's do it - H!! for ourselves. We know th we oar35.doit4,QVe1-owing such problems called for hard work and deternminiiikyhfflilvf-fiiffgpard came through with flying . Nc XS f . T ' - colors. The new adlustmentsxtoftljvunrforms, and the new flags, and equipment added to their wonderfulhgf-time shows. - Elizabeth Thomas N, IH Head to Toe 40 Flag Corpf Members: lst Row: Tonya Howell, Ken Curtis, Elizabeth Thomas, 2nd Row: Veronica jordan, Tracy Rodgers, Tina Wild, 3rd Row: Clorissti johnson, Renee Finkley, Elin Weiser, Katrina Longmire, Alyssa Hunter, 4th Row: Kim Goggans, Shenitajohnson, Vette Burnette. I hope I get this move with the pink hoop correct, wishes Tina Wild as the dl solo delights the crowd. It's been a wild, wonderful, and wacky season, says Flag Corps Captains Tr Howell, Ken Curtis, and Elizabeth Thomas

Page 43 text:

Robin Lowe and Tony O'Bannon sing about the Wassail Bowl as they proceed into the dining hall. From a corner, Ms. Tina Blanchard sees that the singing and the feasting go smoothly. -Q1 Singers: Row 1: Karen Holifield, Nyashajunior, Tracie Lester,jeff Guy, Kevin Tillman, Stephen Mitchell, Rob McConkey, Kimberly III, Robin Abram, Vicki Nelson, Rebecca Stevenson, Amy Scruggs, Row 2: Angela Fennell, Felicia Moffett, Simerly T, Saacke, Wesley S. Hardy, Richard Reid, Chad Overman, Timothy M. O'Brien Moore, Alan Peacock, Aimee McMullen, Robin Lowe, Leslie Gore, Third Row: Kelly McClure, Lori Fish, Darla Brewton, Meredith Lewis, Angela Ballenger, Aaron jenkins, A Hunter Pfeiffer,jason i Harness, David Lacy, Matthew Rasmussen, Todd Snowden, jill McAfee, Ce Ce Boone, Kim Moniz, Patricia Williams, Mindijones, Row 4: Barbie Replogle, Dawn Green, Cathy Hufford, Peggy Clark, Michelle Phillips, Carrie Houck, Baret Rasbery, Antony O'Bannon, Garland Borowski, Joey Williamson, Ross Williamson, Hank Fillingim, Curtis Dawkins, Mike Armstrong, Melanie Rand, Holly Gash, Lorie Sisco, Carmen Rivers, Wendy Morris, Not Pictured: Mike Campbell, james Dennis, Andrea Housand, Yvette McConnico, Philip Moffatt,judy Nock, Robin Sanders, Nancy Watson. Orgunizuliom 39

Page 45 text:

ziggy ' . N .t 5 Sy, While Marybeth Wright shows Sandi Trehern some new moves before the Veterans Day Parade, Ken Curtis wonders why they are still talking after being called to attention. Y- is crowd. Dancing to I Can't Stop Loving You the Guard receives cheers and screams from the af Q. 173313-fe,70lr O Gr GS aorqg 43nd IG Oper Q6 afe W . taboo? 156 tl, 61- tb c- fir 17241 . '70 slca '?Jet0h Gd 5 173 gt 'V U76 Outlbe 5' Flag Corpx 41