Booker T Washington High School - Graffiti Yearbook (Pensacola, FL)

 - Class of 1987

Page 43 of 280

 

Booker T Washington High School - Graffiti Yearbook (Pensacola, FL) online collection, 1987 Edition, Page 43 of 280
Page 43 of 280



Booker T Washington High School - Graffiti Yearbook (Pensacola, FL) online collection, 1987 Edition, Page 42
Previous Page

Booker T Washington High School - Graffiti Yearbook (Pensacola, FL) online collection, 1987 Edition, Page 44
Next Page

Search for Classmates, Friends, and Family in one
of the Largest Collections of Online Yearbooks!



Your membership with e-Yearbook.com provides these benefits:
  • Instant access to millions of yearbook pictures
  • High-resolution, full color images available online
  • Search, browse, read, and print yearbook pages
  • View college, high school, and military yearbooks
  • Browse our digital annual library spanning centuries
  • Support the schools in our program by subscribing
  • Privacy, as we do not track users or sell information

Page 43 text:

Robin Lowe and Tony O'Bannon sing about the Wassail Bowl as they proceed into the dining hall. From a corner, Ms. Tina Blanchard sees that the singing and the feasting go smoothly. -Q1 Singers: Row 1: Karen Holifield, Nyashajunior, Tracie Lester,jeff Guy, Kevin Tillman, Stephen Mitchell, Rob McConkey, Kimberly III, Robin Abram, Vicki Nelson, Rebecca Stevenson, Amy Scruggs, Row 2: Angela Fennell, Felicia Moffett, Simerly T, Saacke, Wesley S. Hardy, Richard Reid, Chad Overman, Timothy M. O'Brien Moore, Alan Peacock, Aimee McMullen, Robin Lowe, Leslie Gore, Third Row: Kelly McClure, Lori Fish, Darla Brewton, Meredith Lewis, Angela Ballenger, Aaron jenkins, A Hunter Pfeiffer,jason i Harness, David Lacy, Matthew Rasmussen, Todd Snowden, jill McAfee, Ce Ce Boone, Kim Moniz, Patricia Williams, Mindijones, Row 4: Barbie Replogle, Dawn Green, Cathy Hufford, Peggy Clark, Michelle Phillips, Carrie Houck, Baret Rasbery, Antony O'Bannon, Garland Borowski, Joey Williamson, Ross Williamson, Hank Fillingim, Curtis Dawkins, Mike Armstrong, Melanie Rand, Holly Gash, Lorie Sisco, Carmen Rivers, Wendy Morris, Not Pictured: Mike Campbell, james Dennis, Andrea Housand, Yvette McConnico, Philip Moffatt,judy Nock, Robin Sanders, Nancy Watson. Orgunizuliom 39

Page 42 text:

Officers: Barbie Replogle, Rebecca Stevenson, Dawn Green, Cathy Huf- ford, Garland Borowski, Stephen Mitchell. Be Ili Num Efnnwn: Qlhnrua Glreateia ailrigzll illeazte An unforgettable evening, All the regal pageantry of Merri Olde England will be splendidly brought to life The Procession of the Singers through the Hall The Procession of Candlelight The Hoisting of Sparkling Toasts The Procession ofthe Boar's Head The Serenading ofthe Minstrels The Procession of the Flaming Christmas Pudding D FAM-fi r in is fr: :QQ The Royal Court, posed by several singers, sing and talk ofthe history of the feaste. The Washington High Singers created the Madrigal Feaste in the Jane C. N00 - Activities Center ofthe First Presbyterian Church promptly at half past six on M Angela Fennel and Alan Peacock sing by candlelight during the procession day and Tuesday evenings, December 15 and I6- ofsingers at the Feaste.



Page 44 text:

It's Hard Being a LIVING DOLL Fro ,MMTNX ,,,,..a....,,N ff!! L,....-i-.axl , 'T EN e Q .fffl 1 X ,f'f,,af'l' tt f .1 Teal' ' D 'AAA I N f z. r ., W. ., W . . 32 i X , ff 'af' r 7 4 25 ea sea-22X f ,Sf 1 r ,,..-.,,,.a Y X fda---via, Nl-. X! 1,92 ,ff ff-W 'eea.7:QQeQex I r ,ft es. E f N 1 ,s at if Q ff K A 1 ,f vgxn fl My XTNNXX X iYxxxigL WV, f 5 f Xxlry if A X ,f W3 he week before school started students relaxed in the summer sho lffped for clothes, or worked the last few hours of their summer job, me , bers of the Fla Cor s worked at school from 9:00 'till ZIQO- B they SX ere back practicing until 8:00 learning the routine to Shine Do an!-,x 1 Can't Stop Loving You. Spinning in sequence, flag anglesyfgiilst strenglsltqb and body posture were drills that strained muscles, caused and malllegflqands rough and callous. The guard began Monday full o spirit, b i'AA Friday no one could walk without wincing in pairyfg I Lmscles ached fro? Ngrqours of overuse. The practice paid off, sai yr'i 1 'n Ken Curtis, gil good on the field. Captain Tonya H , iffdled and shouted, Nwe have an instructor this year! e guards luck in having aEMl.Qd instructor ran out. Aft game, Todd Horton quit. The respwlwgaof perfecting, tea A1 Vigp in leadership fell on the shoulders of the cgtqgfxslgtain Elizabqrh ecided, Let's do it - H!! for ourselves. We know th we oar35.doit4,QVe1-owing such problems called for hard work and deternminiiikyhfflilvf-fiiffgpard came through with flying . Nc XS f . T ' - colors. The new adlustmentsxtoftljvunrforms, and the new flags, and equipment added to their wonderfulhgf-time shows. - Elizabeth Thomas N, IH Head to Toe 40 Flag Corpf Members: lst Row: Tonya Howell, Ken Curtis, Elizabeth Thomas, 2nd Row: Veronica jordan, Tracy Rodgers, Tina Wild, 3rd Row: Clorissti johnson, Renee Finkley, Elin Weiser, Katrina Longmire, Alyssa Hunter, 4th Row: Kim Goggans, Shenitajohnson, Vette Burnette. I hope I get this move with the pink hoop correct, wishes Tina Wild as the dl solo delights the crowd. It's been a wild, wonderful, and wacky season, says Flag Corps Captains Tr Howell, Ken Curtis, and Elizabeth Thomas

Suggestions in the Booker T Washington High School - Graffiti Yearbook (Pensacola, FL) collection:

Booker T Washington High School - Graffiti Yearbook (Pensacola, FL) online collection, 1987 Edition, Page 272

1987, pg 272

Booker T Washington High School - Graffiti Yearbook (Pensacola, FL) online collection, 1987 Edition, Page 8

1987, pg 8

Booker T Washington High School - Graffiti Yearbook (Pensacola, FL) online collection, 1987 Edition, Page 261

1987, pg 261

Booker T Washington High School - Graffiti Yearbook (Pensacola, FL) online collection, 1987 Edition, Page 121

1987, pg 121

Booker T Washington High School - Graffiti Yearbook (Pensacola, FL) online collection, 1987 Edition, Page 80

1987, pg 80

Booker T Washington High School - Graffiti Yearbook (Pensacola, FL) online collection, 1987 Edition, Page 134

1987, pg 134


Searching for more yearbooks in Florida?
Try looking in the e-Yearbook.com online Florida yearbook catalog.



1985 Edition online 1970 Edition online 1972 Edition online 1965 Edition online 1983 Edition online 1983 Edition online
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.