Booker T Washington High School - Graffiti Yearbook (Pensacola, FL)

Text from Pages 1 - 280 of the 1987 volume:

? XQ THEME 3 I s1uoENT una 1 ., XJJW W Q3 V Q 0'G 'x m'5 29 QCii 51 XX J 3 C51 A oxfsses O A9695 'X fix J. QD Q EDF gd? G33 05 as 2,8515 N JG Qgji Xjcfjygy 4 9 555 1 Q06 9 .9 5' gk 'K' -H, ,nf VW, 1 .M my ffm ' -f FFL -, ff H , I Q MV' feng K J gf ,, Jap , X104 . 5533 ,ye W Q- Q xl ,f Q f?2, Q Q, gy .dir L, f ' , 1 15 Ji, J Q- K ' NJ YV wk y . xg ' ' ,. Q, x ' Ls? Lech fu, ' N' 5. -ff, xx f' X M- 3 Q N pf' Y-5 Xxx E 1 If 'Q L Rr Q -. 153: . gg if' QA rc! X , M. N ' 'X 52 x N X , .W X I , Y . Eg 1 ,Swv ' , fav W N Lf ,,,, i ,C,x,U,. y- , , V iEQ?QEUQf1kkk Sv- Af, : '1,f'P u.'f'g,11 S 5 ., 'iv fF g Z?iEl 2f f C fan- ' - - ,,5g9mm.'f jF,arwQv:r-. - - :rx Npm' fy hfu' 5 '3'3:i:.1. . . 12325, 1 , fp ,jyrff -,-- . J., ..x. - . -' 'f'1', 3'Q?4 f3 K ?'7'Xff1?w' 'P'.- 1 17-A xi-f1fE':2Fw5Q f f,ffC!P,ffQ'5''iff-T57 L J.. ' 'QQ - f 1pw1f Qz'1efQ: 1ff5:. .. f ' FwiukffF1... fId--':::1ti:::ff 1 K fH,'?!ffwfWQLff11'7p wjjffllf-7 6527 T. . JYf ,f ff 1, ff i',QV . , ,,,, 11 yi,5i3j,5Ef353gig::,3A 1 Cr,!V.2-tiggjjj,2g34.ji , ,N Nm ,X- , f 'L'J, W- -My-L f,yfx , , pf ' , u hwfmgg 1 - mx, gmc! '.. 2 .ii:l,!r, X .' ?f?'5Q1fl w12f'Fffwf ,W ,!i',g,fNr X 'Inf' :fx Ni QV' I. 'N -gy ug, V ?'m'2:fw'WCffw ,4fC?66fwVfl4,f,, I4 i 4,f,g,p?5ggZEg:rg5.?gF 'f NV' bf WJ4 F '7fW','4f!fwffQf!fF?' , '! 'HC'C'gEiC:!fl' 63 x fgagfn wfffffl Q ,0 JA fm Y 1 ff f f 2F2??cfwiV T fp' ffxpf, mggrf, i',!z,f,vi u Wkfzf F Qfwfw h 1 O ' Vw X 0 Q W CXQHU fy Cm L52 EQ com . V x Q 5 V fw b -N xnxx XX? -tw K., Y X-jy uuvxuwv-J ' . m:,,.ws,u.mA1gl 1, .L ,Li4Q...l......,,A LA Aww-.,- 1 Qi KXQCXU JXQGLQSUS WM aj 'QNKWAJQJX 'VQJQYVN bgcixk 'vffkggaw Tv- Ld vw Q ffm' MVK? MQW Mmkwx. QP, DQQMX SW fwfj XJSLNX QLXVX W0 Wvpvljybb SMX aww KTM- XXCJM ,Qcmml gif, ufv bm WV? 'FXOW WM' HOWWQJ QQ Mm N52 Q Lima MJJQW QQQQJ WWW Jf13 wXf,iw6K MOZOQJ W V UMW gud Q4 ?QM ' 3666! fj VCAJL1. 4335 9527i YVLWA H2fm5CXQCyIqj pf 52505 ,f0'Lf'6f ' X WJ' rafhti '8 Washington High School 6000 College Parkway Pensacola, Florida 32504 Volume 26 f t ww Mwggjf f D V ,D 'Ax ' S we ...L-l.l ,V e . . . J 'N A Y' - .LJ lil eg 5 X I I IJ I' 0' ,as ,t U79 Liam. 1,511 Q W Hake Clark help: Craig Worley adjust lzirpadr before charging bark into the action. .2 Dirguised ax muncbkinr, the Varsity Cheerleaders :bake it up to tbe beat of Twist and Shout. fs. x lil f X , .fs 2 Theme ' ith the rising of the buses and cars, we parking lot before wondered about upcoming tests 3 sun, our day began. Piling into our entered the cafeteria, atrium, and first period. Friends talked and or made plans for Saturday night. Then with a push or pull ofa door, we became OUT OF BOUNDS. We no longer were in Pensacola, Escambia County, or Florida, We were no where, but home. Within the pale yellow, green, and tan walls, we became ourselves. Experiencing the joy of waiting for a ride on the wall outside the art rooms, wading through the inch of water in the student parking lot, or finally cleaning that locker that was the wake of a hurricane called Locker Buddy! We became a family helping, cheering, and aiding our Wildcats to victory. Memories of the summer lasted in the back of our minds while tests, friends, and new romances took our full attention. We were the key to the success of the Wildcats. It was the beginning of a new era . . . a new attitude. The key was in the lock, and in time the door unleashing the power of the Wildcats would come flying open. We were the first to put the f key in . . . we were the ones stepping . . . Elizabeth Thomas QUE QE BQQRQS XX A r mgffi - , Mp- LL fm-1. , Y i':,gxg,ge' 1 4 , ,af Z Y'!1 ' 5 L . QL 4 !KA' . fg.- ...f - F653 NX ASHJM, ro ' H1011 X 'K I Novice .rcientistjennfer Traynom practice: ber graduated cylinder volume measurement: Roderick Parker exemplyies the Senior .rpirit during Homecoming Week. Scott Lee and Sherry Curry take time out after .rcbool to :tart tbeir homework. The Washington H igb Scbool delegates support Mario C uomo at tbe mock Democratic convention beld on the U WF campux. Theme We knew no bounds. We kept reaching and growing for the unattainable. In our quest for recognition, we became one of the top five schools in Florida, won the Girls' Basketball State Championship, and gained a new attitude. We knew no bounds in athletics, academics, and extracurricular activities, Maybe we weren't the best, but we certainly weren't one of the ordinary. Week to week, game to game, sport to sport, the loud and proud Cat Pac cheered on the Wildcats either to victory or defeat. We knew no bounds. On the map, we were halfin and half out ofthe city limits, but when turning on to College Parkway we weren'r in the city or the county. We were the Wildcats. WE WERE OUT OE BOUNDS!!! - Elizabeth Thomas fi' ,fl , . I i iff, 1...-F 2511, I YQ IP , .. Wf- ih- ,NN U 'H x Xl N Tx Alum, diff' , J V -Air-4 ,II N AIQJLJF if Y , ' fn f::::. 1 V ,V x ,, .... , ' ' ' '43 V' A' Q 'H , 'Q 1 , . I 4 Q ' V ifiw ' ,L X' 4YY4 , ' f ' A ,1 G 'ag ar ' Xi, k 4 5 Xxx I xx . w . K X , 3 'x - 1 1? Q 1 1 1 11 Q1 11 1, 1. Fi, . 1 . 515 , : ,e 1 'X 1 ,., 1 , 11 r-1 ' , vf: - 11 f ,Lg , ,1 1 : 11.1 1 fn x 1 ii 1 X ., 11 , ,K , 1 1' A Ei-N I 11 5 1 192 1 ' if Q1 ' 11 1 1 1 .1 X z. 1 1 . 111 , 1-1 1-1 ' mf 331 as 1,3 ini 1 ,. 1 ,, , , .5 , H 5,52 212 x 1, . 'iii ' .111 411 54 s., ,J ,I 51: 2, 1, .1 hat o 1 M 3' 1-ii .fa . 5 111 iii' 3: I d ff 5 ea iz Ewas clofk axgoke fgom agdeegg slugber ou ii Wai? gmd you go scg1oo1.gWh?t mogye wguld go Qyfongg? ggpa11yQ5you1Qday Qnprcgved by Ager 61 .1 11. . - i- ' 1 5 - 4 1' f ' ?zerea1g thegthought df sutpgng clasges sevgfgn hckprs Hgpeen 51n1nL?es aggpeafgd he 1 4 f' mfr rho hts5fYoLvik11e ouw fnegjds Wfauld gae thMre t 1 u . I on everKs of5ghe1rQveekg?r1d. ncegfou gnveg at sghoolgtherg was? t 11? e Z5 to Uhmk Zibouif 1'1owfi1t1reci yougactuglly vfgre. unngpg youiglockgr ang sprgn 'f 'f J fri 1? rd Qbell was yfiur f.I5i'Sf trpg ta you12 firsagpermggd clafs before Que 7315 . Y Z, iipr1cif1ry. urujgg hogiuerogm, ygau rrfgd tcggger lgad sfgraxgkgr an get gn- cci the gouugge of ghmg. Seciond Qenoeg pasggd qgpcklyg the ghou pi t Qiof ogjly mgre clgsses go gc? Thigd pfgfxod ieallyg 141115211 if 1: fe .31 f, - . ' f' kgew lginch Qor s15Qu1dZvve -geatgig at wasg?n Qadyugrmerfx ous? scoriiachsfhad Qtroulgle 1nj1k1ngD yusnigarongjd 1 the corrgjer, bgat wzgunggfor argwe th? har? par? Qen arr1fSg'ed, gverygme rgn togthe gafetcgia fqgr thgr usgal chyleseb r e1'?or 'Q za find fries with m511tt1fggcomg1ersatfon g P . . Zsituffgd betgweerigbneg Flfli, pegiod xgas a1j1me ,lor ygzgur 'Z r',. I-i iZ KZ' 1' T gfood gm segfrle vglule Qour Eiura11Qweng mag OVCIZQIIVQ to Sou tgxrougju rest inf the dai? mggjch pig3ir1od Qu legout ga mggi of g?11efg- dai wagalmgst ofer. if fiff ff 5: 112 - '3. ?,5ERIgDD!!Q1-IO RAZ!! mggle ugh was 01115 a nigar- Q Sfore jiou viere fifee toigo hgme any spfgjid 1'CSEf0f :img 13fpmeQfork.2For ghe njgany gtudegts lfl gx- ?trac11Zrr1cu?r acE1v1t1g, 1103112-wcgrk gave Sggrts Effacugies, sxgn H :f 4 fv - 11 -2 ff Q ' -1 e ' 1' 1' tmgs, ang dug mecffg1ngs?g1emgnder2 anogber cguplegof heiurs cgyoug alrefgdy sgort Vey. A 2, 1 w 11, f 41100 Lifled gout mdskas ent,,red kiato to O . dfeagqlana in the any oufj to 522110012 thegteacljer 1SgC6aC?5?11'lg?i1'16 goldgn ruge . . ff 5 1 Z Q Yu nf .1 f Z Q A Q Z Z 'A 8 .llzrrlfrz Breaking Into The g TiII1Cf The Lady Wildcats obtained the Class 4-A State Champion- ship by defeating Orlando Edgewater 64 to 44 in Winter Park, Orlando. The group of three seniors, seven juniors, and three sophomores put in many afternoons to achieve this honor. Everyone could read the sign on the clofed gym door, Stay out after 3:1S, and they heard the sounds of tennis shoes squeak- ing on the varnished floor along with grunts and cheers of pain and approval. A State Award should only belong to those that deserve it. No one deserves it better than Coach Ronnie Bond and his Lady Cats! The members played with their heart and soul. The Lady Cats took the State Award paws clown. -- Ronda Bond i i 1 l 1 ri., ,,eL.er,,r,m-t.r ,e-t-,.L-,, Coach and Mrs. Bona' proudly accept the State Trophy fiom' the Pregri- dent ofthe Florida High School Sport: Association. ' fl l I y, , EsQ5ega1,,,,,, ,,.. , , , V Second: after winning the State C hampionrhip, the Ladycat: and the original Cat Pac calculate the glorious HUlL'f07jl.'H i l ll ll l X'L 4 l i 1 i-N leir . WA i l i 'i l E i lp-ql 4 'ff 1- ' P V Champs hen we arrived at school, the air had a sense of excitement to it. Grabbing luggage, we loaded the bus for a long ride to Winter Park. Teachers and students cheered Go Ladycatsu and waved goodbye as we pulled out of the parking lot. Arriving eight hours later, we were a tired, but jubilant team. The moment of truth arrived when Coach Bond called us to his room early that fateful day and stressed to us our duties. Block the big girl, she's all they have. Block her out and the title is yours. Last breaths of ease vanished that game night as we quietly loaded the bus, each concentrating on what we knew we had to do. The bus ride to the gym was tortureg each mile brought fear into our minds but confidence soon replaced fear as our anticipation grewl We walked into the gym with an air of superiority and the look on our faces struck fear into the other teams' minds. When the buzzer sounded, our hearts were jumping out of our chestsg but with the encouragement of the original Cat Pac our nerves soon calmed. In the beginning, the game was close and despite some disappointments we recalled Coach Bond's words and continued to drive the big girl clown and get our fast break. The roar of our fans yelling A rope, a tree, hang the referee! compelled us ro forget our pain and exhaustion - everything else except WINNING. Fearlessly, we ran up and down the court with the agility and speed we possessed. As the last buzzer hit, reality struck! All those hard practices and grueling workouts really paid off. Together on the floor oblivious to everything else except our cries of joy, the Cat Pac ran out to the floor surrounding us with cheers of love and approval as sweat mixed with our tears of success. The roar of the gym quieted when the announcer called out, The 1986 Class 4-A State Champions are Pensacola Washington Ladycats! Then and only then did we realize that we had reached our goal: STATE CHAMPS. - Ronda Bond While Uthers Pattied, You Practiced. Now It's Your Turn ,ag To Play. Bafketball 9 5 ilar- . ' -fT+sfw f ' up . ,W ,Y-1-a.,m,, 1: a fa r. ,Lv 4 fy. my. J. . Vi I Q , .- -fr ' ,f.m3vif,v n,,f ,A V vff A , V U 4 1 un. 1, L. .1 Fw - ,WM , W. , . n ' A 4 im- ' VV ' W A 1 ' fi: ,Q , j'Y,9u!Y?V,y,-gn 'TwifT1.,p,-3 Nfngyrlg qy.,nwH ihgwicj- N vw r w mu ,L HN 'W ' 1 '- r V Lv Q 27-N ' 1 Qgwns, H9212 lfwffiffvw Qlndf-N-fs ' f wi! gy ,W 0 H L H f . W N I . Qi ,-, A . A 1a'rff iw ., ' 1 ,4 t bw i , L ,N I ' 7-M Q X ' 1' 'ini - v' 1 4,5 if f' . ff- 7' Q! ' . A ' ' . . A - ' A 5 ' Hr fi f ' ' . JA f - ,V ffw -fi . 2 ff if? 'lb 4' ' if ' 'R K7 ' mf ' A' ' j' . W W, 1 .1 .i ' ' A, , Q 'Af f' , i I fi js Q ni 1 ilf : ffj- 1 ' .-ri atv F D, Z 1 f ' ! ix . ' A-rf I -fe - . 1. X. .Q f ,- -I YE, - n V ' 6. 5 xi fxmml Y' f A N A-1 , 1 - -W ,- 1 f ri,-QV , 45,43 4- A ' X . ' W l 7 ' V. A Wag... 'A-ff -Xi f qnfla X ,Q I , l :VJ vb ., , 4. Wk ir :Y-1--, 5-A X ,K 'IA 'fr il' -x if Y :Ft-I f jpf . ' ' 1 . f , A K ' if ,X X if X 1 ' . , - 4, VI X. - I -1 r 1 1 ,, ,F 5 z 1 , k E f E - A 4:5 A Q , v' w 1 M Y '- 1 Q f' ' r 'M 3. M M, ,ii-4, 5 5 ' f ' x !'- V. Q ' 35 'xxxtsffxr-,,. ' . 'H 1 1 funn! ',,f.., 1 , 'S I 1 . '-'- 'H' K' ' ' N ' v x 1M - Q ggfg 5 5' , , - A: 5- K Y .Q-.MQW 41, Q' k' X I t 1' mf 'ff ' 4 Y W W Y W! A : gf X -a 11- - ua I 9' , H, , 4 ng, . hw., m,, V 1 ,. ff M.-.. WW., ,r .,1f f, .m,,',.Lff, fx U vu wah-C ' L 4 n x .1 X: w L Yr. xg , V .,,, rw- X V w 1 f ik, 1.11. iw H. J fs: ji' 1 5 x it , A gw. F 'JN 1 CMN '13 UV! JI rf 'im wzw WV E . xwg, ,f ,, :Cn 35. mm! , M, .,, .KM-:M lnil U -' V? , Y ., , UL IWW! H'Ux'ff LN YJ ffl! m r Un uv vu 1 V'-'fam mm fs, 'ffm -H.. 1 Um . ,. ,: rx iw H 11 vm ELG FN I., , ,, 41, 'A 11 'Mhifil ,, ,JW ,,,,-n, vw am' ymm fo sw v:gwf1j:Y,U1.-fre , ',sY,,. 5 iw: A1xw'7V'w ,JMU NC wWI!FufvY Y . . 51 M51 ffl? ,. ,, 1'1 v,L'mc,ru mmm .,, , , W 'L Rf :f 1-1 Fi KV-ag: his 21 Q . ,.,, W ,,, , ,, , L, im:-iajzvw .wgrg w v Qqwgxjg we rfiinyififf! I 11,3-G 1 wi yu, 5L1.,uj. y, , - L.. .., 4, U iw, ML, mmvis mg :ff lLfwIi'i,w N 'fmt 23,3 ',1f3si,,img-azyn .. ,. J ,1f,,f Y, , . ,AV ,- Www-J -L xqmlzg I 1, ,iw T AL, ,,., ,., ,5 '1,w.JwJ, wr1'x 'uh , ., -,f, if ,, A, . ,J .-, .qw N91-,J,zQf1w'n :lymu U n 5,,,' ffivz Lmx U ,, A ,J a ,- , 4, ' My Q QM-f 1?4w,rm -.wmv nm M. Bmlix -.ww mx J f - ----J ' W ,- 2 Y 5 '-' 'A- ruff Cv ii-'J 1' -'r 'f N fp ff ri fi -, fir' ff f mf- '- A L LU .f i. Umfiifgi .iiiiillj cf c, Vlilill Arr A 'pr' I- A -Nix ,Ali I, 4, I ,Liiii if ww ii ,.,fii3 il Wi viii i mi in P. H., ,K .. fi' 1 ' i 'N N-IH: ttiiw. .tufLL,,i1.ii.ii.'i4 ,Lv ,Wai 1 o U g'1 .-.fi Aj ,f. ' 'f S --.f fc-fi A fi WLWULI. 5,V'v7 Jliiii AQifiii.iiih.fifC2 'T Ti, ,fT MV- 1. A' -'i ffhfw fx,-7-ef-v ii il il ii VI Muni fi ii wif. -'.1... ..'.-. 'D Pa, c J ri wo boxers stood face to face. Each with the knowledge that they stood among the best in the world. Each knowing that there would be only one victor. Roy jones, Washington's Hghtin' Wildcat, walked away from the contest, a winner. When Roy jones started boxing at the age of ten, he had no idea his hobby would take him as far as the Soviet Union. In relating his overseas experiences, Roy said, I was kind of scared about going over there, not because of fighting, but because of Russia, itself. I was worried when I saw security guards, one on every corner. When asked of his first fight, he said, The first thing that went through my mind when I looked at the other fighter was, 'I-Ie can't whoop me.' Roy also held the title of National Golden Gloves Champion in the junior Welterweight division. I-Ie received a great honor when he was selected to represent the U.S. in the Goodwill Games, held in Moscow during the summer of '86, Roy fought well enough to bring home a bronze medal for his efforts. Roy recently returned to Europe to compete in the 1986 Golden Gloves Championship. I-Ie fought in Finland and Sweden, against two of the world's best and rose victorious. - Dana Musselman and Angela Kyle 12 Sludent LW 31. . ,fn 5511 7-. fail. .. 7 V-Yi he swimmers lined up on the starting blocks. The starting gun fired. The swimmers glided through the water as if it were second nature to them. One swimmer burst into the lead. That swimmer was none other than Washington's own, Andrea I-Iayesg the place, the Goodwill Games in Moscow. An- drea brought home one gold and two silver medals after competing against some of the best swimmers the world had to offer and left her mark on Pensacola as well as the rest of the world. To attain the level of success she reached, An- drea said, You have to enjoy what you are do- ing. You can't compete for someone else. There are sacrifices that have to be made and you will only make them if you are doing the work for yourself. You have to have a positive attitude. You aren't going to always do well, but you have to believe in yourself, you have to really think you can achieve the top in what you are doing, Who knows how far Andrea will go in life? She moved on to swim at the University of Texas, where her coach is also the coach of the U.S. Olympic Swim Team. Maybe someday we'll find ourselves in front ofthe television, on the edge of our seats cheering for Andrea to win an Olympic Gold. - Terry Baker Andrea Hayes Wins One Gold And Two Silver Medals In Swimming At The Goodwill Games In Moscow if r 1 OU I 0 f ,OUNDS .1:g.f:,57r--- . .. . . . -- HK. ! 'f -.1 , 1 yv 'I-7' .,. .21 --efT.:q Nl' 1 ' . 2 . C' . Winneri I 3 l 14 Etsdrnlr LM' M W, T iSS'ill1JJlif le Hmlceljftstdlllio cel Le rmln egoorre lllfry lllll ioe Tln m olto , . or most students, the ringing of the seventh period hell marked the beginning of mother clay. After school, . students spent hours putting together that perfect play, marching with the precision of a marksman, or chanting with the loudness of a wildest! Cheerleaders, bond members, mol athletes spent two to three hours a clay working to teach perfection. Thursdays were the big preparation days. Cat Par members put banners on the lockers of athletes. Did you bring the tape and paints? asks Mrs. Bond. jayettes painted the Lrigt: run rhrough signs for the beginning of the game. 0.K,, What do ya'll wont on the sign this week? shouts Lori '- Fish. Everyone worked hard making the spirit signs to be hung for fthe Pep Rallies. Whren these jobs were done, a brand new spirit became a part of Washington. Not all work was hard. What was a harcl job, tumecl into a fun, enjoyable afternoon. The Friday games provided a good night for everyone It was a time to be with your friends, to cheer on the team, and ro show the pride of the Wildmrs. Many clubs held car washes to raise money for their yearly activities. These fund raisers started at 8:00 a.m. and! ended around 4:00 p m Most club members spent endless, hours washing tires, windows, ond, ofcourse getting wet. Though many of these activities took up a lor of time, students never complained To them it was a time of work that included plenty of laughs and good times with your friends, To all the students, the hours they spent after school were filled with incredible fun? Far Mc darn-owing JIIIMM, Cyatbdajmu md Turin lawunu add' the winning tombs: to their New Yuri dm. Sapiboowrv Mare .Smith plgyx Tqa.ila j9r tbajubiiau ernvd. Thru: Gardner sold Ronda Bm! Jirfribau .piraft button: rw nbc up 75j5rrJ.rberr In the Spirit Rare. . ff w 1' 1 , w I X. .w , 7 . QQIIEIIJ 14 W fl,-.V . YW' . V , gefgkk-Nfxfy ,V f' 572-,f s 3511 - ., W 4155? ,f nf' 1 .4 ,ffl JY, 4..,, ,V af 1 1' ZL-.Q ,A , 1 'K 7' I 1 14' ff my , 'qw N-...J runnrrun: , ,,, ,p.. fm we 9-5- 11 at U: ,lem-, A -uw. N --F Q.. 5 V ii? --.V ' V W M ' wif' ' 1 A f ,. gf' A u . 1- '- f' - 2 - -v f, L, --.3 I -2, 1 ' f , .Q f ' - LL- 111.1523 1531 95731271 T .f . -ra-' J I 'L W W' V E, I 1 Q , . .- , mf , ,J I UI' v r . fm 3 2 V 1 ' Ky A ,M j, ' , X 1 717,17 f , , Q - 'Lay X' A' '-eq X ' ' . .- Q JV: 1 Qi 9 VA 5 'V ' I si .V hw.,-V ., K L V ,. , . . . , -f-,L vw LF., ., ' fl- AN W 'VFQF K 3 V-' ' f V' :. 1 1 5 1 ' 'X A 1 ft 'ii' 'I' gf A - ' , . - ZA , K- ., v , N N ,f-, f 1 ' X N f A 1 Y 'V i. 1- ,V , I f. 'ada . 5-U A, -1 Y '- 1 V 521 A 'G A . , X A I' N n -1 f ' 1 1--1111.111 v w 1 11 1,1 11 11: 1 1,,'ff,gL 1 1, , 'fy ' 1 1 1 7 1' 111-.-ff ' 1 1 1 , l 1 1 1 1 1 I 1 110.51 1 1 11 1 a ' , 1 . 111 111 1 :12 fr ffurgwv' 111' 1 1 1 1 , .14 V A , ,, ,, , , . f N, --'- gf 211- 0, M5 ,515 , zgggffflgj ,gpg Qui, 'Riagg 515543,-Ugg-.ggi 'pig 'f,f'gX21gi55gs',U11 givin 1151 -Sly , A , -, , ,A E w I v 'T 1,1 U. iq., - 1? nn,- , 1'Q'3qA,f -1 , Ah ik- 'W ' w Em a , 91wf1 5.525 fiimm '3e+1,E1g13Q a1' v m-Q -,mi iwlfi-21k 5193 MQW 5'fP3U' 2'5'3'2 ax an 5 gms: , ITE LE! W H gwlfir, 53,3545 5.gsu v aifmi eilsguJ'f'iu, swing ilgusm 555219: vi Iifvblv M212 if? iG' W-W gg 5319 vi 511 'IPL-3 L5:f5'Ff'l Q'-i1'.'5,'2 v ,Q 5541 yy? mfs!! 1' 2 J 7? , wr M f F 14 1 w 1M ww M xx X!g-! wXhiJ4V'fi!' Q2o3f:2fmwf1i+i1' Hrfffw Q4 V-VSG f+1ieimfss- fff21 2' VFFfG4fm1E M5035 1visTSQE1mfss HQfifEia in fffaem '..A 2 'ff-20211, H71 2:1 Rim Eiifilfms is eimwmrib We l V y'A l faP?6e'f' fb1fQTk'2 flfslaw Mrs ieff963U, vifve bmw? W3 J 2'2w'u1kQ 1 f,a3 va7Ligi ruin? mimewkni i Lfm'4 2 W?f61512S'Uf5gw5m EGM QW 'Wine QfQia 4iLia mimS 2 f.imaa2rv'2 El5m1f me sfmiw km Em5J'bw31'i1 f f'W'ir' fmlfa wwf 1E,Lm5m1w52imi3Sw E135 W-'2 SWWSI 55 Lum 5f55j4?E1QQ YS '1+1fa isG'2Liw , a 11 amG i'LfS-2ffmSwR ffiww Vwsff ima icky? mm k?1f'i1f?ffi1 h?wuw Qi? L6 Tiff 'W fh'Q'q32L ,PNP WF'Gff41'4W1f5rS'cim . i:T f'em v:1'ewrmuimifaf We 1?iQAU k2f2fI Jimi 'T'7'fl3L93i'?1?vEf5 ,f51gm, z55, E11,hzfs , 'fhzr5 , w5'.gms l ,famgf5 mjgrg gragibirixii CSfI.n-mfg rmQm'am. :lim fillfffw 1fP W'1nf1 fc15111210ib :fsi12,i'MefHS . fwrmii 1 2IEw2 w1Q1uEfafs k2 V Eliffifmw i6Q5Q 1ifiF iii?-2 351igf!md1fE,, 172172, wg' '1f1'zy.': a Fmt' IUIWQYQ fg11i5y5lgmjgQ,7, F.z'5 1 55, Simi izj.e15y?u5 .V5605231 65? Kifbye fgyigg, iQm1?fQf7qjmTl'EjfffEil Lzmiuiikal ASEQQQH mn ave1su?mA ww 11-i im 1 W flEJQ5v5'V'?'7 rv-we fewdliil Qimiil Vw m am 1 1u'me ifW31 V1U'LEf'L2 f: 12J 5vs lfbwf fsmffaari ffi? Slim a2ffQm:a, Iaaifgmifix fihfdiifiewzniwii '1'1 iM2111w Gifaef fwylibifsff V4r2ra1:fai- fiifrmfa a aQaw:ma1sfk1mz1fqvz1:,, Klxs 51512 6IfY'Sgn'E 'smsm .f5f1 .v'5w2'1 mm fmwz' fm-vgirayq, we fqfym' ,gfgg qwhgvgmgg ,gfggjimg eiLfg',a'551j,, 'Waa mmfg fm - az f2w:emr1 zgfsarm Vim? 'EMEJQYRT 1FJQEm119f 'iiiridi ,EGifQ 7'if-i'WI1!5'17J,'G f'f'1zv f?ffd??hG GW 1wi.f mQfS1s3 i ih qmgaQi HEQQ Griavm- sixsiffiibisdii I'i 2fbfGfH16Hamm Wei 'wiivlil' KJA' 351 QffQ'nif Y'I?7iUfl?iGf5ffi lE'EfffEG? ami? Gm fanvemmqq T'1'Bffffm U msmWG mrfrsikiri iemiiiibiusq W2-as bewiwluai when f1f:WW1' 'iv w5w V11imwG 4 We U5fi?f5'oiivS iaxaw Eiummv LfnreNE 1f22DiL Oblfkelnli 6 Cll l'l'l girfif you cwe 0 ream I8 Sludent Life Judy, Michelle, Cathy, and Elizabeth, lo county competition. P..-.........-... Y-.. i 4 .' . 1 . - , 4 ' 1 l we 3 1 W junior Mir: Contextantx: Judy Nock, Dawn 1 Dunlap, Cathy Hufford, Elizabeth Thomas, ' Rebecca Stevenson, Kim Currie, Peggy Clark, i H Andrea Housand, Michelle Carraya, Dawn . . Greene, and Michelle Riera. J as Pageant Director, Tina Blanchard, finally get: a rest ajier :ending the .Eur finalists, During the talent competition, judy Nock wow: the audience with her original music and hand-painted set. I ,ft .ff .a he dream began with an announcement, 'AAll senior girls interested in trying out for junior Miss, please meet in the Chorus room after school. Almost twenty girls showed up. However, after a week, the number dwindled down to eleven. Meeting only four times including dress rehearsal, the girls learned a physical fitness routine, a poise and appearance routine, and the sequence ofthe show. On September 23, the girls lines up anxiously on the stage for the final outcome. First to be announced were the individual awards: Physical Fitness - Dawn Greeneg Talent - judy Nock, Scholastic - Cathy l-Iuffordg Poise and Appearance - Elizabeth Thomasg Spirit ofjunior Miss - Kim Currie. Then came the awaited mo- ment, the winners ofthe pageant announcement: Dawn Greene, Judy Nock, Michelle Cartaya, Elizabeth Thomas, and Cathy Hufford. Due to no participation by Century High School, Dawn Greene, the alternate, became eligible for the county paeant. For these live girls, their dreams became a reality, - Elizabeth Thomas M icbelle Car-taya .vbowr beauty and grace as the dam-ex to Ibe tune of Don Quixote. Master: of Ceremony, Hank Fillingam and Todd Snowden, proudly present the buf finalists to tbe audiencejjudy Nork, Micbelle Cartaya, Elizabeth Thomas, and Cathy Huford. if wi? is ,KW w Us O s ix..-f Marv -junio1'MiH 19 'S s F! - nn 'E UTY na --1 1' 1 55 2 :fu 'r 1 f.'l M IN f' aw ', , '-v If In .5-:I , l f I - I 17? YR 7' ff . li ,l W 952 ippvffeffb Q5'LLHHn,f1:5 6ijQxXS?5XX 6l'::?b1CQX XR, , V , wx N 1 N , , fx ' fQ' xX f4v hw 7 ,fflff 5 'xx f 1s4fzNf LM D is fig? CTXX ' Cf x f NS X' M 1,2 4 LQ f wg, E5 ' VY 'L Q wb 3' N Q X ' 7 i?f?Zf QQQQ Q w jx u A 6 ,. ' V ,r X515 P 'N' ry s ,f 9 3. f5isSv23i,sf,i. Q3-5' Wo ' -A 1 2'-' 1 Lx ffl. , , ' 1 1 , 'N . ,ap X' Y 1 l ' l' ' X Q,1x ' 3 1- l , 'g' , no 4 y. V fr f f A'-g 5 Y-,- A fffk 'X 1 -1 fx , , YY, it -NX ' 'fx - 4 M X Q r 1, X f ' C- T ' X. J fir i ,Q N 'xg X. , -,xii ,K-H, i , 5 fi-1 'wa I' .X , ,QN fm .f f 'rj FX X, 7 .A , , f--, I i N N Q X .,-X' X ff L ,, r x .a-. X XN ,X V Lf ,, , as X4 , ' Xe, xi 'L ' , ,ka f , l,f, ff -.1 Xi, DS f--Y I , , , X- , 7 5 T777 7' , ,f f , J ff f X J' fy' Y, I fjlf , 'Q 1 till-in I . , Q17 . - s u hat on Earth am lp goinglgrgrrafroday How 'bout myf'fiayQifEe'svvefaEfslSEh fx too dressy. Here - my Huey Levvis Ll ll ': concert shirt. Too SMALL?eTlj3lre's gotta be someltblkiiff, else in here . . . my Coca-f !Ola'shXirtlLHot dog! My Crier! shirt and a pair of jeans 4filvelll:'i.'..igmRw'be those bilge? uck Heads would look Degdon ' e . . Levis and . . . m-m-m . . . grind ole w hirt. Now, what else? be my ops or my penny hfinfers? M-m-mi? tu prided themselves riotgionly in their clothes, but a heir automobiles. Trans-Ams, Mustangs, and ,T Vol s were popular, but Datsuns and Toyota'sf-i i 4 and new - ruled the blacktop. Wannapfr drag? lp 'W her Levi or Wrangler, a Porsche ora H2 lil. 'timid' s' threads and treads expressed theirgadividualirvf 'p - ason Carr - l Fafhion ff ,xi Let xTheGames' 71- O '7,-N ,x 4 , uf. 2? Mrs. Bond strikes a pose as she tak ladder back to the gym. Betsy Mathews earns the hard way how to keep quiet for I5 4 24 Studenlw Homecommg. The sophomore float committee poses for a picture before the ride around town. pirit was the word, Washington High School was the place .. .the setting, Homecoming Week. '11 was a week of thrills and spills . . . a week bo ' ed by fierce competition some good natured fu eac class. All c ong ' to the batt spirit rophy. r and Whiskers flew all week in a f ' squabble. T e were halig, de tions, dress days, spirit butto spirit chains, class games, the pep r ly, and the float competition. As e week progressed, a classic battle - 3' Ngi A ,f ,Ji-' .4 - 3:'VI4'Jf',, ' . '-11:5 ' -4: :-my .5 rf f we tween the sophomores and the seniors developed. The freshmen and juniors took their best shots, but could not overcome the rampaging seniors and sophomores, who rema' locked in a spirit standoff. Jhe rs trailed coming into the final e , the pep rQly and the float competition. Everyone screamed their lungs out at the pep rally, all for spirit points. lt was chaosf' Students twisted and shouted in the spirit of Homecoming. Next came the float judging. The judges looked at each float with discerning eyes. After a brief con- 1 I ferQce, they awarded the sophomores first place and the senio second. The seniors won the pep . Anticipation mounted until ' halftime of the game, when the winner of the Spirit Trophy would be unveil- ed. Heather Young's voice ran out above the silence,' declarin the sophomores yictorious. The Class of '89 charged Lonto tithe field, trium- phantly holding up the gleaming trophy chanting. V,,. f 'Sophomores, Sophomores . . .'y'. 3 , iff i Y ,Z XJ I . A Shelley Scotto gives a cry of di her face is covered with lime shaving cream. v ' Kathryn Mitchem, SGA sgent, watches racker whistling contest ' f as she gets balloons fo no er game. , Seniors, Juniors, Soph Freshmen li and cheer for their ' I f. ' class. Q . f , 5 . Honzetoming 25 0 s, Nr . ad'- 'H cfh 'J ' , 'HJ' f - A n 4 M Q n 1 x ,, Q, I. 3 'L . Q X lg! if 5 .Q Angel Cole Homecoming Queen Q .9 1 ' . f Homecoming Queen S Court It's Your Turn To Shine he melody ceased. The crowd hushed with anticipation. All eyes turned toward the twelve members of the 1986 Homecoming Court on the field. Michelle Cartaya, clutching the arm of her escort, Tim Fox, beamed in her ebony dress. Angel Cole at the side of Bruce Vredenberg, her escort, was as ra- diant in her shimmering emerald gown. Cathy Hufford smiled brightly, matching the smile of Geoff Nagel, her escort. Kim McGraw, beside her proud escort, John Gilbert, glowed in her pink dress. Near this couple were Kathryn Mitchem who smiled charmingly at the side of Mark Davis, and Millicent Rembert, soon to be an- nounced the senior sweetheart, radiated in her ivory dress. Which one of these six beautiful girls would be Queen? All held their breath while Heather Young an- nounced, . . . The Washington High School ,Homecom- ing Queen is . . . Angel Cole! Applause burst from the crowd. The band struck up a melody. A smile beamed from Angel Cole's face. Her dress glistened. The crown 'Q on her head glittered. Tonight was the night for her to 4 df' shine! - Linh Truong I f ' 5 A :1- 'Q L qi, I . X ,ll x 1 , Q N L Q X12 ami - l Hamerommg 2 7 ,X 5 iff 54 ki? . li il r Y ,ag x . pg fl if . p if X? iz? 4 . fi F if Q QQ X ' lu 'ii 1:1 fir 2 1 N X-:N S' N 1 . :X :S A if in FE Q1 ww Y , 1 ag: f .V 6: .Qi i 34 L- ' si as 52 253 ay Q55 23 if Q1 ,iii :xi 1 3 4.-w Q 525 '42 v 1 ,R sf? I 1 ,ff 21 5 55? 15 F3 if if? .QQ .33 Ni S 5 as Xi! I4 lf: Q f -si eg ., f is Q '3 n .V -1 15 .1 28 inimip 3 EJ z 4 4. ,f F I ron Nz 'S .J 'A 11 ,ig xi 'QE .1 w L1 x 4,1 5:3 ,:. mi 4? 954 Q z 1 V -e 5 Uv ,, s ui pi , 1 ' 1 . '. Q-1 if 13 ffl 'X Q x gi 1121 W 'gi J up 53 2.3 if 1, 1 s Q' Q. H ,- X IS T71 -, -fa 4 7 3' y Q3 , ...M 4 iii F2 5 A si L1 15 fl ag: ii I .25 rf' sg ' 13 5? 53 li? 214 4 Fi 212 ff if ' 1 xi Z :if A ,Q ff, ga .,,. , . ,.. in 49 N2 24: X 1 A iw V 'P'-nf if .Q --,, . Q, ,., .XA zz xy 2' H z..-A 5,4 LA :sg .5 H1 221- - 41- L' , fi? 1. Wah . W Ei 't' 5:3 5 ffl! '. ' 2' ' 41' :pf 2' 1 I . . S. f ,E in 1: iz. 1- Z? fiii 'q W W- 5 ,f W f f., , ,. 4 ,1 ,-4 .Q Q4 25 1 fg A ru' f- Q 52 K L 7-V 122 v. Sf: :W 'lf - . . A, :fs 5 . 5 riff iff Ka 5? :fa S11 K, 45' sag we 2,-5 ff fa in E1 . If was 2 f 1 Q' ia A be iff' , 4 1: ' ' g ' 5 , if A .. 4 TL. 33 Q ' . f Uv' 'is 95? 1 f ,ig sl 51 4' FE 1 Eli 112 f- - V .ef 1 -N f A 2 EEE if if ,-x .5 xx .- V f ' ,,, 1,3 5 lf? iii :el e ig 2 ni fi S7 fa E2 - . W Y Corp.: merrfberx S'ben1tdjobri.Qon, Veromtiz jordan, and Elm Wdlxer are fi fl ag . 'W 11. ,g Q1 Q dent-gtbat gfzll longfprarixre hours of skzlffful drgll: gqve aggkrowg- p1wfngfpafk1a:f0bagqfmegf Q X4 -,Q -., .1 f f 2.1 Ly M V M? 5 'E ' 1 ' ' ali 5,12 Q6 fy f? 11 :rv J F5 - ' J If EJ ZZ f' I H as fm ., V1 2 1 ff: 7 6 ,Q fff 'f EE 1 :tl gg K2 wi A KSKQS'XwEf Rx S fe 65 H? 1' -! 2' g iii Vi! 153 Ei? I 12:4 N55 123 Q? A Wifi if vii I6 11:2 N ff? ,mf 'Wi Q H Q, g li 53 152.-3 ' o1, r ,4 J ni? ,n s a V 'v1de il? s 4 5-EQ z1 751 M ffl w 4 W '52 F3 C mi, FQ f' Els 4 W 49 w 415 lg '65 15? Eg :ef lf. 921 if if 39 , 45 Z L? 112 as Wi 494 :if 4 1 sand the e hag f W I 24 as aw? P? E ' 2,1 35 QI 211 ,H yr 4 'ati if ,J 5 eq 3. I IQ 1-5' ,.: 2 12, ,fx 4: 51 A. Qyarr E ,Q 5 ag Echo N Qge ccgmpl eijls. Eich 0 Qudl' grew Q? iiflfe f Egld bgggin W im C OQBSI W E .y was r lili il! ,A si l Lf 2 ourfglis lu ,M ? an Q53 ff ful 1,1 v., Yi 5:5 Q13 3 5 af' 2 ff ii Q E 1:4 -v lg ik 5. bl X vf + 1-I gtur gek 5 ew P14 im f 'rfs o cfgigcati ly ki S g, 15 E 2 2 fu 4 du 52 nw if 4,4 , ,. iii E4 s ent 'overig , W5 V-Ewhojgiike 52 ff er igkllfh 1?0theN ig li Pj! E: 13' in! 5 in Q ' 'Q' 2 E 1? ,gs gg sf li' 9 5 - 5 2 iii a 1,3 L, xi 19? 0 ij M1 Rf ' ly '3 if V1 1,21 fe L2 T1 gf: FZ liked dfgg ou F! sr-2 pg xl? ii S, iv Fi iss 1252! 153 i3 3 Ei 5513 fs! 22 :is ,222 3535 iia mi! 2 QX, F ,H L1 5, 'V grnm H OV1 ,1 dr ur iff v?'or ' .Q 11 fit S 13 ei: 55 ii 1 2 Q '25 S E 2 W ., if 7.15 M WEL an r SCI wr .gggza t's I-Iot ff the Press Congratulations! We survived another year. Through all our good times and bad times, we somehow managed to pull together a paper that was not only thorough but good as well. Not that we didn't have our moments. Do you remember the first of the year when ten- sions were high and voice levels tended to be even? higher?'Do you remember the two editors screaming at each other with exacto-k., ives in their hands? How did you cope with those fa ous last minute assignments - You want w.at by when!!! - and surprises byithe ad- ministration - What do you mean the drug survey violates the Hatch Act?!!! and Robin- son okayed it! I can print my censorship story aftier alll! No matter how different we were and how our ideas of journalism varied, we were unified under one common goal: producingj a top- quality publication. We also caught the attitude as foreign terms like left point sizes integrated themselves year has gone Mrs. pro- Sincerely, ' Adri Spain, co-editor Between the Lines The time, 6:55 a.m. The place, Booker T. Washington High School. The scene, Washington High's Parking lot. As I approach the entrance, I hear, Get that piece of junk out of here. and Hey fool, you're in my parking spot. These and more wonderful remarks can be heard daily from our kind fellow students from the Washington High parking lot. Are the students satisfied with the park- ing situation? Evidently not. The general opinion among students that drive to school is that the parking situation is a mess. But is it avoidable? Can it be improved? Have the school authorities done everything in their power to help the parking lot run smoothly? I believe so. It's not the school's fault if the people cannot follow directions. I feel that the school has devised the best plan possible for the parking lot. Confusion? There will be that anyway. With cars going in and out of the parking lot dropping off students, surely there will be foul-ups, but that is why we have deans. Yes, the parking lot area does become a hazard at times, but let us remember if we as students do our part in following directions and realize that the school officials are trying :ir best to maintain a peaceful atmosphere, situation will adjust to a better status. - sta Prince T Arnold Club Rings Death Bell Members of Nope to Dope sponsored Death Day to show students the reality of drug related accidents. They accomplished making students aware of the seriousness of drug abuse by their frequent ringing of the bell and by interrupting classes 49 times during the day. At each sound of the bell a participating student of Nope to Dope hung a tomb around a student's neck to in- dicate thathhe or she has died of an accident involving the use of drugs. These students were chosen to show other students the grim truth of having a close friend or acquaintance killed. Response to Death Day was excellent in that it increased many students' awareness of the serious consequences of drug abuse. - Alexis Gup s Tommy Winn adds some finishing touches to his articli before publication. . v tl ,, if to iii! or t PTT W Vo1ume29 Number 1 Pfenesacola, FL Ocfoben 1986 .J V t QI- Wildcat News 3 f ' BF' - . ' Front Row: Tim O'Brien, David Wimberly, Scott Rezek, Mrs. Morres, Brian Dunson, jeff Babbit, Brent McNeal, 2nd Row: Greg Ayres, Chris McKean, Amy Pittman, Alexis Gup, Heather Young, Adri Spain, Dona Yarborough, Angela Kyleg 3rd Row: Marsha Baris, Patty Hawkins, Teresa Stevens, Donna Hayden, Lee Carol Griffin, Tommy Winn, Buddy Bowden, Chris Williamson, john Common, Charlie Wiggins, Mark Davis, john Hamilton, Geoff Nagel. Washington, We Love Thee What is an alma mater and what exactly is its purpose? Though an alma mater seems like an old fashioned melody telling how much a student should love his or her school, it really is much more. Not only is it a unifer of loyalty between the student and the school, an alma mater is a tradition kept in some schools for over a century. Though the lyrics and music to our alma mater are over 50 years old, this does not mean it's out- dated, instead it makes the song even more meaningful. The age of the song has little to do with its purpose. Washington, We Love Thee was writ- ten in the early 1930's by Miss A. H. jackson, a graduate of Washington High who later became a faculty member here. Many students wonder why this year is the year of the rebirth of the alma mater. Mr. Robinson feels that with the new direction of spirit, this is the best time to rejuvenate the Washington Alma Mater. By bringing the song back, states our principal, it will place em- phasis on loyalty to the school. He hopes that Washington, We Love Thee will become a part of the students like it became a part of him. An alma mater to a school is like a national an- them to a country. - Tommy Winn and jef- frey Babbitt Staff Co-editors ................ Adri Spain Pete Delevett Advisor ..... .... M rs. Pat Morres News Editor . . . . . . Dona Yarbrough Features Editor. . . ........ Angie Kyle Sports Editor ..... ..... -I ohn Hamilton Reviews Editor ..... ...... S cott Rezek Circulation Editor ....... Donna Hayden Business Manager ........ Patty Hawkins Reporters: Laura Angstadt, Terrell Arnold, Greg Ayres, Jeffrey Babbitt, Marcia Baris, Buddy Bowden, john Common, Mark Davis, Brian Dunson, Lee Carol Griffen, Alexis Gup, Patty Hawkins, Christine Kel- ly, Chris McKean, Brent McNeal, Geoff Nagel, Tim O'Brien, Amy Pitman, Teresa Stevens, Charlie Wiggins, Chris William- son, David Wimberly, Tommy Winn, Heather Young Photographers ....,.. Brian Dunson, Tim O'Brien Staff Artists . . . Terrell Arnold, Mark Davis A l ,., ,-- ' wa- is , . if be ' ' fi ,lf ii l is i, fi, fi .1 . 53' 2 gi 1i'T's,. ,jg 9 'l . Mrs, Morres hurridly dresses to join her staff at state competition. Wildcat Newr 31 Tradition ith A Dash Cf The Unexpected ii2T5 .' ' , i , ., ., gat., fgiQQg,g.v.g'-N 7252222 . ' ,. , ,',. r , ' n .- ' via ' , - .. La, I.,3ffp.,i., '1,se.1','fz.,vrckalgzf g. . hw ,f'f -7. ,,,?,34,:N- . ,V I ,, V I 4 3,193 f. .- , .v . . .ftx . nfs ma- 'mmm I N I , I T - K an turns: i lun. xr Literary excellence. The Camenae staff stood for nothing less in their ' ' ' . Th Camemze duction of yet another outstanding literary magazine e pro compiled writings submitted by students and turned them into an b' ' the attractive display of Washington's literary talent, by com ming writings with art from some of the best artists the student body had to ' ' f C l11amde.' ff After the smashing success of the first presentation o 4 o er. An Expat? of Talent, featuring dance, drama, and instrumentals, the ' ' nced staff chose to produce a second version. Under the experie direction of Dr. Jean Harrison, the staff once again contacted the most talented students of the various performing arts and asked them to display their talents in the second presentation of Calwzrade. All ticket ,rcs ' ' h d ction of al ent toward funding for a computer to help in t e pro u 1' ns attentively as Dr. Harrison gives a pep talk. s es w the Camemze. Excellence . . . nothing less. Camenae iste p, -ev, gina.. -ui A-hu. ...ga-audi F' . - xrst Row. julie Nagle Heather Choate Jean L' A Greg Ayres Adr' S ', in . , . 1 , M reale,' Sabrina Millefitisifsrmei Row: Geoffrey 1XIagr:LTJe1??'g1-23516 A15nYlGuthrie, Kindra Morgan A llglarcia Baris, John Hamilton' TlZ1ZnhBrad Duncan, Vanessa Padla, sau New, .David Key, Sugan,E my KruCZYf1Ski, Chris Kelly OCWOI' Harrison. , r OW: Greg Walden Lori Fish, Suzahme Gibson' MfChele Fischgpsg Sherry Curry' Lisa Mor, ' , rep anie Ellis Linh Tm r, cott Br-Own A . ' ' Ong, Wendy Mortiss , ngle Kyle, ' Terry Baker , 4 , V- f -vvv- fs! 1 li Ex' v- ' sfvv' 1 yl'KJ pmfwtftlff M006 EL acc My MQW i Mba Jima, Editor Layout Editor Senior Editor Rachel Smith Elizabeth Thomas Ronda Bond Nxt 'X IP' S S -..l:,.1.g....,MN,,.., E X- QV Members: Terry Baker, Elizabeth Thomas, Rachel Smith, julie Korre, Linh Truong, jenny Des- 'nond, Chris Scegner, Dana Musselman, Stacy Leichner, Billy Pike, jason Carr, Bruce Vredenburg, fviissy Kubosh, Brendan Lee, Cindy Page, jack Suratt. 1 J COLOPHON ullu The 1987 Graffiti was roduced b th Jvl n High School yearbook staff and ublished of Dallas, Texas. The 27 19 3430 boo fi . 4 Ye' ., ' 1,200 copies. The bo t pages WS e -. biz 80 lb. R f .... ,,. . P V Vlof Pu enamel paper stocky: he emb 'issed rain trim - .Q 4, me JW!! Ms Q!fzWVL5cSi'CZ'l MU 2051-0'-' we Af f5Wf7 size 9 x 12 was dzgfgned by Ronli3va,,,Bon nd Thomas with oysger, yellogyi-hgnd blueh 'Q 1 end sheet artw S r duc? lb ' 41, , QE v :QM-. ss: and black and tiirgdits , AQ W2 pf Dwayne , Ronda Tia d and Rachel Mrs. Elaim Thomas direction of ed t W . Fi? ear '-', ,.f, I Yi 22W vigil-s K ' 11 i , . . .5544 X-4254 . . . ,ss '- ,X Q ,,, Graff1t1Advi3ZQr. 3' ,fy y f' writi s u der the wa., We-' ' wks ,,-sg if Q r . ' 'ba . 'em ' 1' 'is - S ,' if ' i f . nm wiv? ff 7 ff A an Mil 5 5 f gli? 6 9 y f Q as ,gi at f i a Eligfigbeth avg, d Bond ,j'mber331ip in the Florida w ilion iw PAD agid the Journalism KJEAJ. the three years, Graffitinfhgigficfiiifgw ihorable mghtgon, tliiigllxplace, and seggoiid from FSPA Wfzr, and J i rch tax- . QR ,QS sql, in V, la Nfl We iff Mx fy 'Q we I A ,gf 1 Ways Q, ,gif XE, ff veg., 4 ?i :3 Yearbook 33 F i-555' Q G-. N p V Y W we Xp s Us , 2 . Qsfff Q is . ' 5 T eT.? lF 5 'Qs is T U29 0 y lf O 'fa I A 76 DUO: QW nf D-I Q7 QQ f ' : D 'H' Du Q71 Ar i f raffiti Makes the Magic Last Forever The Theme, Out of Bounds expressed our school's desire to not be ordinary, to be the best we could be and yet will push toward new goals and dreams. Our students, our parents, our faculty developed a new vision, a new pattern of ex- cellence - to be Out of Bounds, M T Getting ready for yearbook class, Mrs. Thomas prepares to produce another motivation poster of goals and deadline jobs. O.K,, who took MY pencil?! Finding another misspelled name, Billy Pike gripes agitacy Leichner, Whose sloppy handwriting is this? l can't read this! ' :ff ,fy , li f , ,- , , ,,.. V ,V , fr-ffl' if ,. Q a 5,5 ' X f To make delivery of yearbooks easy, members design I.D, card alphabetizes her 50 cards. 4g s. Linh Competitive yearbook members Jenny Desmond and Terry Baker attract fhagglel yearbook sales with their innovative techniques. Mrs, Thomas, Rachel has used a whole bottle of white out on her mistakes on the layout, smiles first-year member Julie Korte. Chris Steigner is being a Noid because he has to redraw his artwork . . . again. To the Graffiti Staff of 1987: We finally made it! Amid all the untimely deadlines and Saturday crunch times, we managed to construct a great yearbook. Do you remember our first day in Mrs. Thomas's class? She told us what was expected of us and what putting a good yearbook together required. We thought surely she was kidding - nobody could do all this in six months! We soon found out she was being very honest. Before each deadline, we crawled into , the room on Saturdays, settled at a table, and pushed our minds and bodies for six hours. Finally someone would mention pizza and our minds were shot for the day. lAt least we kept Crusty's in business during our deadlinesl. Selling yearbooks kept us at each other's throats for one little sale! In the midst of the hard times fa lost picture, no copy, no ideasl we managed to laugh at each other and things were not so bad. When , M N H the proofs arrived, we knew the hard work had been worth the pain. I hope that the staff under my direction, produced a yearbook full of history and memories just for you. Hopefully, you will live these days again when in some distant future, you turn these pages to return to the days of your youth. Rachel Smith, Editor. Yearbook 3 5 SQ-rQl-n 511.335 S SIELLQJQJ1 I 1 5131312 X als X- Q V ly ml it ij! ni aa? .. WWW . Q ,...- S N N A ,VIL-NI IL uw ' 6 C.'L To ignite Homecoming spirit before the game, SGA brightens the cool night sky with a flaming resplendent bonfire while music and student yells echoed across the darkened field. 36 SGA Organizing and managing Club Week activities was the mid-year activity for student government members. Felicia Beadal and Theresa Murphy, SGA sponsors, keep a keen eye on afternoon club volleyball competitions. SGA Officers: CL to RJ: Heather Young, Rec. Sec.g Stephanie Carr, Fund Raising Chairmang Mark Davis, Treas.g Kathryn Mitchem, Pres.g Cathy Hufford, V.-Pres.g Scott Rezek, Corr. Sec. v 2 digg: g mxse-sm W :w-.G?' ' , 9311. : P fi, 5 xtxrflifnqi' if5 2:. 06 Q.-1?QW ' :- i, ' f-- .' ' Z. S ' frl'1lt3fi V V 'Q -. ff V, L g- rr Sw QQ 'W' . . y CDN6611 , fr V, Q, . . 'ww We ta ,X Z, f2:f,Qg3,g,, Q., 4 ,Ml . l '-if Hey Wildcats! It's been a SUPER year! A football District Championship -- WOW!! Football season with the Cat Pac was incredible. How many other schools stand up throughout entire football games yelling and screaming all decked out in bright yellow shirts? Can you name another school that takes Seven buses full of spirited students to Mosley football games? A rope, a tree, hang the referee! To top the sports season off, the boys' swim team won state, and the girls' cross country team won regionals. Oh yes, how can we forget those cute little baby cats who won the freshmen district championships. Right now, the basketball season is just getting started. Our Varsity Girls are still State Champs and are listed No. l. SGA has just bought presents for all the winter sports. I really hope you enjoyed Homecoming - the Seniors who won eight of ten games on Tuesday afternoon but couldn't untie the knot, the spontaneous fireworks at the bonfire, Coach Humphreys with a pie in his face during the pep rally, the Sophomore's First Place float in the parade, the Homecoming game, Homecoming Queen Angel Cole, and the bid dance after the game. Were there actually two nuns presiding over the Halloween pep tally? During Halloween, the true personalities of many of our teachers emerged. Not mentioning any names, some of our faculty members were replaced by ducks, witches, clowns, and bumblebees! Club Week was held to promote club participation and to direct spirit toward the basketball teams. We honored Chris Davis and Mark jones as the '86 Mr. and Miss Basketball. Hopefully the Spring will be just as memorable with the Valentine and Sadie Hawkins dances. I've had a great year, and I'm really going to miss all of you. Thanks for everything! Love, Kathryn Mitchem SG 37 Officers: Barbie Replogle, Rebecca Stevenson, Dawn Green, Cathy Huf- ford, Garland Borowski, Stephen Mitchell. Be Ili Num Efnnwn: Qlhnrua Glreateia ailrigzll illeazte An unforgettable evening, All the regal pageantry of Merri Olde England will be splendidly brought to life The Procession of the Singers through the Hall The Procession of Candlelight The Hoisting of Sparkling Toasts The Procession ofthe Boar's Head The Serenading ofthe Minstrels The Procession of the Flaming Christmas Pudding D FAM-fi r in is fr: :QQ The Royal Court, posed by several singers, sing and talk ofthe history of the feaste. The Washington High Singers created the Madrigal Feaste in the Jane C. N00 - Activities Center ofthe First Presbyterian Church promptly at half past six on M Angela Fennel and Alan Peacock sing by candlelight during the procession day and Tuesday evenings, December 15 and I6- ofsingers at the Feaste. Robin Lowe and Tony O'Bannon sing about the Wassail Bowl as they proceed into the dining hall. From a corner, Ms. Tina Blanchard sees that the singing and the feasting go smoothly. -Q1 Singers: Row 1: Karen Holifield, Nyashajunior, Tracie Lester,jeff Guy, Kevin Tillman, Stephen Mitchell, Rob McConkey, Kimberly III, Robin Abram, Vicki Nelson, Rebecca Stevenson, Amy Scruggs, Row 2: Angela Fennell, Felicia Moffett, Simerly T, Saacke, Wesley S. Hardy, Richard Reid, Chad Overman, Timothy M. O'Brien Moore, Alan Peacock, Aimee McMullen, Robin Lowe, Leslie Gore, Third Row: Kelly McClure, Lori Fish, Darla Brewton, Meredith Lewis, Angela Ballenger, Aaron jenkins, A Hunter Pfeiffer,jason i Harness, David Lacy, Matthew Rasmussen, Todd Snowden, jill McAfee, Ce Ce Boone, Kim Moniz, Patricia Williams, Mindijones, Row 4: Barbie Replogle, Dawn Green, Cathy Hufford, Peggy Clark, Michelle Phillips, Carrie Houck, Baret Rasbery, Antony O'Bannon, Garland Borowski, Joey Williamson, Ross Williamson, Hank Fillingim, Curtis Dawkins, Mike Armstrong, Melanie Rand, Holly Gash, Lorie Sisco, Carmen Rivers, Wendy Morris, Not Pictured: Mike Campbell, james Dennis, Andrea Housand, Yvette McConnico, Philip Moffatt,judy Nock, Robin Sanders, Nancy Watson. Orgunizuliom 39 It's Hard Being a LIVING DOLL Fro ,MMTNX ,,,,..a....,,N ff!! L,....-i-.axl , 'T EN e Q .fffl 1 X ,f'f,,af'l' tt f .1 Teal' ' D 'AAA I N f z. r ., W. ., W . . 32 i X , ff 'af' r 7 4 25 ea sea-22X f ,Sf 1 r ,,..-.,,,.a Y X fda---via, Nl-. X! 1,92 ,ff ff-W 'eea.7:QQeQex I r ,ft es. E f N 1 ,s at if Q ff K A 1 ,f vgxn fl My XTNNXX X iYxxxigL WV, f 5 f Xxlry if A X ,f W3 he week before school started students relaxed in the summer sho lffped for clothes, or worked the last few hours of their summer job, me , bers of the Fla Cor s worked at school from 9:00 'till ZIQO- B they SX ere back practicing until 8:00 learning the routine to Shine Do an!-,x 1 Can't Stop Loving You. Spinning in sequence, flag anglesyfgiilst strenglsltqb and body posture were drills that strained muscles, caused and malllegflqands rough and callous. The guard began Monday full o spirit, b i'AA Friday no one could walk without wincing in pairyfg I Lmscles ached fro? Ngrqours of overuse. The practice paid off, sai yr'i 1 'n Ken Curtis, gil good on the field. Captain Tonya H , iffdled and shouted, Nwe have an instructor this year! e guards luck in having aEMl.Qd instructor ran out. Aft game, Todd Horton quit. The respwlwgaof perfecting, tea A1 Vigp in leadership fell on the shoulders of the cgtqgfxslgtain Elizabqrh ecided, Let's do it - H!! for ourselves. We know th we oar35.doit4,QVe1-owing such problems called for hard work and deternminiiikyhfflilvf-fiiffgpard came through with flying . Nc XS f . T ' - colors. The new adlustmentsxtoftljvunrforms, and the new flags, and equipment added to their wonderfulhgf-time shows. - Elizabeth Thomas N, IH Head to Toe 40 Flag Corpf Members: lst Row: Tonya Howell, Ken Curtis, Elizabeth Thomas, 2nd Row: Veronica jordan, Tracy Rodgers, Tina Wild, 3rd Row: Clorissti johnson, Renee Finkley, Elin Weiser, Katrina Longmire, Alyssa Hunter, 4th Row: Kim Goggans, Shenitajohnson, Vette Burnette. I hope I get this move with the pink hoop correct, wishes Tina Wild as the dl solo delights the crowd. It's been a wild, wonderful, and wacky season, says Flag Corps Captains Tr Howell, Ken Curtis, and Elizabeth Thomas ziggy ' . N .t 5 Sy, While Marybeth Wright shows Sandi Trehern some new moves before the Veterans Day Parade, Ken Curtis wonders why they are still talking after being called to attention. Y- is crowd. Dancing to I Can't Stop Loving You the Guard receives cheers and screams from the af Q. 173313-fe,70lr O Gr GS aorqg 43nd IG Oper Q6 afe W . taboo? 156 tl, 61- tb c- fir 17241 . '70 slca '?Jet0h Gd 5 173 gt 'V U76 Outlbe 5' Flag Corpx 41 x veg af l 4 7 B11 mf Assistant Director Mr. Monzingo listens along with rookie Matt Rasmussen to Mr. Tipton's instructions before the Veteran's Day Parade. The harmony of Tequila echoes through the gym as Paul and David watch the Drum Major for the cut-off signal. Bart Edwards checks his step during the playing of Shine Down, the band's opening number. Chris Curry shows the true spirit of Homecoming before he begins to play the fight song. I- Fha FQWQ PEQQQE, 'TIM-B Q Q Q W 'I-ii LUUEUIE UDUEIDIEGJU A DRUM MAJORS: TARIK DAWKINS AND SHONNIE CAPS What are you doing after school? I have to go to band practice 'til 4:3O! The band members always had practice rain or shine - practicing with scales and out to the range to learn the show or work on a marching problem. The first weeks went by slow, the hours long. Learning where to go, when to go, and when to mark time and when not to, all had to be perfected before adding anything to the show. Friday nights were a blast with people running around trying to get uniforms, gloves, or shoe polish together. Laughter and talk filled the band room as everyone silently wished for a great half-time and a win for the team. The first three games came and went. Finally, the attitude changed. There will be no third quarter break, said Mr. Tipton, the team needs us. Cheer and play for them the entire game. The section with the most spirit will load first and get the football for a week! That sent the band on its way, They played and played and played. The chaperons handed out drinks as voices became hoarsegmouths dry from screaming and playing. The hours at practice slipped by as minor adjustments came and other numbers perfected. The best A reward the band received 3 all season was the sound of . Mr. Tipton's voice echoing, Bring me 2510 on Monday for We're going with the football , ' f your motel room in Gainesville. ,X team to sectionals. Now, play for your team! This was great news. Marching in a college stadium where the music sounds great. For the seniors it meant an extra game to march and great memories. We did it, Mr. Tipton! We showed them what we've got . . . the Best! - Elizabeth Thomas I gig Band 43 'U fig, I ,VWVW VV f ' M704 , V V V, 4 f,,5V,, 1, ,, ' VuMfVW.,, , , ,V , ,V ,V ,V ffl VV, f if 'ffi Vf' ., f V , ,K:'l.4u , , fffff V '1 I , 1 ,ffm , fy, f WW fy, ,1JV'ffj4'gg iff Q Small 5 cl , .. Before lining up on the field for their first performance Wendyjones, Carol Farrugia and Lisa Clarke smile hoping they will remember the show. The tuba section marches in last as the drum cadence echoes through PHS' stadium. The flutes exit the field after performing a long Homecoming half-time show. While the other band members march during the show, Amy and Kara have a permanent spot . , . in the front! Let's show them what we've got, Mr. Tipton says before the beginning of the Veterans' Day Parade. ORCHESTRA An Experience Beyond All thers A soft melody flowed out from the open door of the P-IC music building. The tune intensified. Faster, faster the bows flew across the strings of violins, violas, and other string instruments. Then the music stopped ending Saturday mor- ning practice of the Escambia County Youth Orchestra. High school students who took orchestra belonged in this or- chestra. Besides learning how to play in- struments these students practiced for many functions in the community. In ad- dition, they participated in state contests held in Florida. Members took trips and played in the Governor's mansion, at Disney World, and hopefully the Grand Ole Opry. The old saying 'Practice makes Perfect' has proven to be true because We've scored consecutive l's Qsuperior ratingsb in the past years and we are striving to do it again this year, com- mented freshman Cathy McCarvey. CECIL CLARK - Conductor of Escambia's Youth Orchestra i l'i..,-L,.fv.-,, i ! I I I Sophomore Mike Gibson between orchestra practice and community concerts still finds time to maintain his honor society membership. Members: Mike Gibson, Brad Duncan, Melissa Ortega, jennifer Newth, Kevin Raymond, Joyce Railshack, Erin Halford, M Elebash, jason Tanner, Cathy McCarvey, Ricky Norris, Kelly Cusing, Regina Price, Ginger Colley, jenny Loar, Tamatha Monica Waters, Brett Moylan, Tina Culp, Louis Dessommes, Angie Slay, Aaron Pennington, David Klingaman. . 'W ,. N .. viii Performance Counts in DCT Distributive Cooperative Training CDCTJ offered education and ex- perience on the job. Under the direction of Glenda Davis, students learned how to work with people and earned money for spending. Juniors and Seniors with good academic standing and a good attitude lined up to fill out an application a year before class begins. Students in the program had a 2-hour time block of consumer math and economics. Students found that regular homework assignments, tests, and classwork was demanded by the requirements. Every student had a job. While some students worked in the cafeteria, others worked in the main office of the school. In one word, Alecia Anderson described DCT as an experience in the adult world. All the DCT students agreed that the job experience, the wages, and new friends greatly im- proved their education. - Stacy Leichner U ef s :EF as i sau. J l. Melody Torro, the school office assistant, does typing, answers phones, distributes mail, and performs various office tasks as part of her DCT participation. 2. Besides being a varsity cheerleader, Kim Chew enjoys her job and finds time to Hnish her academic work, Members lst Row Yvette Long Maggie Thompson Melody Toro 2nd Row Alecia Anderson Tabatha Stills, Chelesa Collins, Mirnam Nelson Lynn Settimio Heidi Duncan Pam Young Leigh Ann Sowell Wendy Aston 5rd Row Mrs, Glenda Davis, William Wirth, Leslie Hynes Patricia Herrington Darlene Saulsberry Carrie Dwyer Deena Cassiano Kim Lucey, Laura Allen, Mark Anderson. Not DCT 47 TO H0 GR AD The sharp marching of feet echoed across the parking lot as Commander Norton watched with a sharp eye. Friday night his NJROTC members would be marching the pre-game show with colors flying. The small squad would get no second chances, everything had to be snappy and perfect. Representing the USA was an important job. Naval junior Reserve Officer Training Corps CNJROTCJ offered students exciting opportunities to learn about the military without actually having to join the armed forces. Students got a chance to learn leadership skills and discipline. NJROTC members got to take a trip to Maine to learn more about the history and workings of our government and military. Scholarship, discipline, and details added strength to each student's character. 0 AY lDfYT'f' 44 . 4.4- I A an 4 WASHINETUN H, S, NJRUTC ?ENShLZUl,A FLORIDA aa9ff,f,gfzi ag The drill team under the direction of Bobby Dale perform for the crowd at the pre-game ghowl V' f-'- f Patiently holding the banner, Executive Ofhcer Earnestine Middleton and Cynthia Turner wait for the parade to Start' Getting ready to march in the Veterans Day parade, the platoon files into formation OFFICERS: Cannon, George Michael Middleton, Earnestine L, Mitchell, Reed C. McCormack, Willow M. Serwack, Reef L. mg i , Commanding Ofhccr Michael Cannon leads the platoon marching down 1'1 OSA!- L' 1' 'R 21063 aiidhe 06504 e Up Vq 'W sh a'ffs O '6f?:0A!a1m, paw O ,IGF tba!! pres Ofgl 'OWU' gem en' 0 04- 0. fy pfoded Varsity Cheerleaders are ecstatic over the two weeks of no practice between football and basketball seasons. To the Wildcat's triumphant touchdown over arch-rival Woodham, Eve Riera, Denise Carredu, and Amy Scruggs explode with spirit. F 'x ll A 1 V l 'mt 'X , I ffl 5 v 'klllll '- J W W lam? pp f ,aff ffgwx if w, r rf Disguising their true identities, Varsity Cheerleaders go wild to the beat of Twist and Shout. Tiffany Vandemark, Betsy Matthews, and Kim Chew borrow their partners' legs in a rousing rendition ofa student favorite U. B. Illinf' vfpfrrlprr W WW' They'll Knock Your Socks Off. Have you got that spirit? was a question often asked by the Varsity Cheerleaders. lt was also a question which always received an enthusiastic Hell yeah! from the students. The Varsity Cheerleaders were not just a cheerleading squad. They were true supporters of the Wildcat football and basketball teams. The twelve girls focused directly upon generating school spirit. With a great deal of support from the Cat Pac, the girls accomplished their goals. The cheerleaders attended a summer camp at U.W.F. for the National Cheerleaders Association, during which they received superior ratings and captured three spirit sticks. They also qualified as Award of Excellence finalists. Kim McGraw competed as an All American Cheerleader. Led by Captain Angel Cole and Co- Captains Kim Chew and Kim McGraw The Varsity Cheerleaders cheered the teams to successful seasons. 'W M3 si. JW, ,f ll ,n. t'i LESLIE CARLIN Sponsor To PR 407 0144. Iiscruggaenlkaj C1,eW ons D S3466 aqgson E , T- e ' dl , lf. zilgekl. 15317 lu-Seca GROW Lim MCG 6121- 1' If f -' :SIC-ole: Bono aI1de Dfdul. Sta Une ra . gersy'DROW.Qr43Julf1qZ7gA Ati!-tb Dau, lesja R207 EWS QC!-6 'Moll . G06 , X 'K Vanity Cheerleader: 51 Kneeling: Kerry Stichweh, Beth Elliottg Standing: Vicky Miller, Alison Warren, ' 1 Richard Crabtree, Stephanie Sandars, Dawn Worleyg Top Row: Heather Reed, Christa Starr, Laurie Snowden. The J.V. Cheerleaders prepare to catch their airborne squad member as they complete another exciting routine. E f l : 3 --Q V. I , A I 4 r A .'2, '7 ..?. 111 f'wnna..... tif k 52 j, V, Cbeerleaderf J -f 3 I Q pu ,M sg V1 1:-. - N2 ., ' , -g - ' .. ' j.V. Cheerleaders warm up the crowd on a cool autumn night. Richard Crabtree poses the question Have you got that spirit? .f , f Mfr 1 'V 4 Audacious Electrif ing Even Adventurous Spirit ran high and the-I,V. Cheerleaders sponsored by Ms. Evans were in the midst of it all. Beginning with the summer N.C.A. camp and continuing through football and basketball season, these ten cheerleaders enthusiastically worked to support the school. At camp, co-captain Richard Crabtree was nominated for All American Cheerleader and the squad was awarded superior ribbons and a spirit stick. On Thursday nights throughout football season, the junior Varsity cheered for the winning j.V. football team who finished the year with an outstanding record of 5-l. Then on to basketball season where they cheered for both the boys' J.V. team and the Varsity Lady Cats. Often hundreds of Cat Pac members and other Wildcat fans showed up to cheer the 3661 Lady Cats on to victory. It's great to see that students of Washington are beginning to take pride in the school and show their Wildcat spirit, said captain Laurie Snowden. DONNA EVANS Sponsor IQ-r CVS A 'Warren QQITWQI7 I erfgrm , andc , 4050 Our' 3 C 121-1' 17 1116 flee 4 'VG S me 6 fend. d ance U1-,bg f H r .tj Ol' tb Hg d 312- V. Cheerleader: 53 Pyramid Style: julie Cohen, jenna Parks, Kaye Robinson, Terri Nock, Denise Stewart, Elizabeth Chapman, Maggie Hartley, Marnie Allen, Holly Tunn,ell, Melody Vandemark. Holly Tunnell, jenna Parks, andje-nna's mother dish up coleslaw for the Quarterback Club rw.-v.. lan - e. Fund raiser. , - . C .f' '1'r - 5 J 2- jenna Parks and her fellow squad members delight the crowd with their soul cheer. 54 916 Cbeerleaderf 7,1 X.- J Freshmen Cheerleaders: Terri Nock, Kaye Robinson, Maggie Hartley, Marnie Allen, Elizabeth Chapman jenna Parl Denise Stewart, Melody Vandemark, julie Cohen, Holly Tunnell. i Yesterda . . . Great Today . . . Sensational Tomorrow . . . ow! Memories of a freshman cheerleader . . . Tryouts ended and about two hours later the news was posted. Ten of the 38 eight grade girls had been selected to be on the Freshmen Cheerleading Squad. Feelings of excitement along with feelings of disappointment filled the A.trium at Washington High. It thrilled me to discover that my name was on the list. Our sponsor, Mrs. Moore, informed us of the practice schedules and other responsibilities. Coming from four different middle schools, we knew that we would be working hard to come together as a squad that would be worthy to represent our school during NCA Camp in july. When the school year started, the pace picked up. Football season was just around the corner. I had no idea of what to expect at our first Pep Rally. I had heard tales of pie, tomato and paper throwing that would be directed at the Freshman Squad. Nevertheless we were still determined to impress the football team with our support and enthusiasm. We sold programs at home games and cheered the Baby Cats on to a District Championship. Although it was very time consuming, and getting along with each other had its ups and downs, all in all being a Freshman Cheerleader was an enjoyable experience that I will never forget. ll Vi WINNIE MOORE Sponsor LL? I6 8665 C' pane ffcllaplh .3 1. E17 Ive and W C' dtfyk ude H ta S031- ' Q' 3 UQ, to 9th Cheerleader: 55 5 56 2 E4 15' si KN XJ W . 51 29 N ' K1 32 13151 N' 11: W E L. 455 J S F55 1' if its L. ii ,Q 2 5 5 S if 3 3 w 31 '21 X1 51 E1 1 321 Q Z2 XYZ ' X7 MQW 21 S S s s XYZ us' ,Y Q. 11 W 'Sl 3 sf 51 53' 51 1 s is N S 54 KWH 229 ' if Z3 Q Z , -1 , 2 1 a Kg fi 1 J X-if I 1 1 1! 1511 12 E11 X 1? . 5111 ,JE 1 111 X2 21, , f 611 1 Y 1 21 1-f . V mfg? g fs- 1 141 X21 ,151 'ixgif hi Tx iff 1 TE 1 X-si' W Q L 1 W1 sl TH1 Rl-Q XX Q1 1,2 ,ff 4 1 X ,Li , xiii X125 ,H 4 Q MK sw! , .xi 41 51,74 A f 2 Q51 Z2 '1 1 XJ: 1 1,1 Q11 C7111 fy N11 1 21111 f 1 X -. 511 Ki F11 1 ,X 5 QW , TNI IN- . f 1 IXV NN? 1 Q1 LJ rd , FY A -5 1 fs, Q1 X1. 11' s 7 .-., , W -fa, 1,1 1 111. X1 1 1 FN IQ? Q11-1 JI11 -fx X1 MJ 411 KU 1' 'Q' fX411 'Ni' ' -11 ,411 41 1 1 ' 1 gf' 'X-1 1 1 511111 L11 53 S1 11 5 Q u N bi Q! 1 E21 1 '1 .1 si? 5 6 : 'Q s R S 1 '51 X 1 xv , 1,1 1 FT! 5-Q 1 LM 1 , 51 J' 1 FN! if f ' 1 61 V sl 1 ,A'1 Q 151 --V V1 1 7? 1'-31 191 1' ig fd sv, , 1 1' ' 1 ,X 1 1 1 fx 14 45, F 11 XX-111 fix 1 'Q - as 11 id E155 FC en 2 Z W f 5 '-Eplon F11 Vx, 1 1 .1 1 93 -ii 1-Q1 ,. .. 1 1141 S RQ 'Q t 1 11 11f C1511 , .sv -H ,4 i. 1 1+ ,-1 51 cigars r f nior, E .Neff FQ stucgg 1? it Www: tif 154 ei1 1521 6321 254 5 , . as 233 if 51 3 121 1 1 E 155 rvgw ienrl se.. was 130 Vgfilclcgt rggil 110O1s1f1g JH E1 Qlow ig 2. Nhles 1 1 an JAH 125 E1 S1 wifi, lzfxfli N QJ1111 11,15 lfxxl U C E1 f M., f 1 2, ! 1 Q-iz Kxrixkii 521 YX11 X'-15 I 1? F 7151 X251 K1 6 X A ' Ji x1 QU: X111 Avi iz, gmg exci hz 1 is lg X. 4:1 - +1 x . S . Ji Fx f-s 1 1 1 1 15? 1913 353 121 E I9 ,,1 5 122 E1 121 F1 Q 51 vs Eilea X11 A 1 V 1 1,1 1 L. 1 . xx .J ii , 1 1 ,111 iii Qi 1551 21 1? R21 1. 1s ff 21 1 'E N1 gl 5 ents 1521 45 iz- Z FL ng S 1 L F31 1? GQ! Mesrl 21 .I E 1 X431 F 11 ,1 I. 1 , U? fxggx 2,2 1 1111? 1s 12 1 . 1 X-1? 1 Jg 1 XL ,V 5. -23 w fax 0 , X 7 x 1g ,Q ,5 15 122 1 ij r fi falls 12 . HCCS4 X15 51 61 U17 '-4 1' Zi hi L55 151 He :gf 12 151 141' Q E . 15 if .gi Caggfe S 121 igrhe iq vga 2 A-121 1? 2 ew Qgrud 1, IT . Qc:-W fgl Z,-, 0 5 10 Qool. 'f gre t V Sh 11: de sigh 2 A Eg N11 1 Ns' '51 Ni if 'Q s 1,9 E12 11, W1 'Z XXV? 15, 151 X,-J ,S 31:11 LRE? A-XJ :G Y- 2 1-A 11411 :N Xk 1 11 ---'gp-N 2 E9 iz' ' Q-E1 f- QL? , I? E Q if kida ble oc 12X 1 4 ff ,, , ,, V f , , W V, W,g4Q,f:2'p1 , , , , , 1 f , LO, f Q45 f,iff,, ff , M7252 yi-z:p:zsf,p mf I W????r fe'tNf-'V Z+?:i'1.i1 f' ' 7 X ' ' A f' ,f 1:,'f-452' mmf? 1.564-'Mfg My 6 J-f-22,141 :in-'fx-'v :zz-v'.-fffi .1 C , wwf. ff fy'if fi, fxfff ' -iff?- 1-271 'ii-QQ-179 iayfzg 1ffz,1fz'5'.g M -g..f f-pgyar, Lfffj Q , Hwfe ' yn ,J ,f W4 ' ' f 4. 1'if f?Q'f2 Mifvff-iff W 'MM'Q'w.'1rfMM':fw-. f,W'Z 9:ff1-w-PMQLUf-W... wU lM' -W-Q'-F' if-,...,. sf w'W MWf.f. ' V, V , , , 5 ,v nw , fx .-mvff WS' ':v,j?,- gf 5f2f56'f 14 1:6513 Q-434371-. wg-va ' Kfwk.-if 'xgfyj :jf ' lfzvifzgr, V 210.3 'ff7Qf?Z 5.3-I3-5.2.4 , f ' 1 , W ,. ,MV .. ,.v, ,. . 1 051,044 . ,.,,. .1 nf, ,W Aww. ,Q Qu. ,wwf r'.-UMM! ALJQQQ. KWJ-4' YL.f!,f,,1 ,nnuifxzf MQ. N421 . Q . Y C . V A g 7 fl 2l 0 QlflCH'l Z 8011! Ol -f I At 5:5 rf Q J P U ., 0 , , ,,., . , , , , 0 0 A - H I f v rv fl '4 , 'a w V :, v I I V -v fn 1 2 6 .I any . an ermar. apr: Wil lams Q . , B Odf f- fb fe QC fbi Cl A 0 W v3 ,qy , , A 4. M Q Z W Q 0 , ., ., .. v 0 Q m Q. , ,. 0 Q w ' Q fa UFICBTI II1 Q fU0'l1 9 0 .4 Q , ., f W , . , Q , . 0 Q , , i . I o 4 Q ., . ,,y'n nuff' . .. f is 'Y , 1 Q v , Q I ea! .im or 0 7 F Kathfyll Milchem' 813 'Odd SIIOWUEII 7 ' ' ., if A 0 4, 4, A K . , 4 c L 1- A 0 0 1- A Y Q 1 0 W Q Q +1 Q Q 1 4 6 W re L Z5 III. I 2 , , , , 1 ,,W0 M , . V 0 Q 0 ., Q I 7 J 4 E n' e n u I 6 0 9 ., 7 . W G , 0 ., . . 3 , U ,gr , ,, . ., , U , ,,,w Q Q W V Q 4 . . . , . . . . W 4 . 1 1 W ' G i T ' ' ' Q . ' ,, ' ' ,, ,.-rf , - 0 as if . I nw nz Q Q .5 4 Q W ef n E . 4 4 X V 2 . ,, 0 A 4 f 5 S 0 Q N av:-Y' ' A 4 7 Q 0 4- ,X 6 'Z ' X Q 3 A 4 D .1 , ,, . 9 , , -v fl n ,-.. . . M ,wk-W. mv Fmf-X F? 'V' 1 .pf we-3:3 fp... .4 L-.Xxx 1,2 gig-wi .5 mf.. .51 N i, - 4 I.--V. Q .g2z..1f.f.fs xi fi-1134? will?-iff? f . X izvfii Qggfiifr V WmvgaamqwsWg.J,wWg..S.f.:VXmT9...,. J lY,:,,...,.,Nw!..-.. .FMTw,..,.,.,,W7m,, WW Cist.,Li,k,N,Wg-i,11Q,,..,. Yi.-s..:4,w WQAQQX ,....7,w-iQ-w.Tfn.1A-+--f- W ff- -Xgiggsg M - ,veyq vw fm suv. .. 1-f.-'fs-.X -wr-1. av 1.2 f--.TNQ 1. 1 , in ini 5' 0 ,. A. Wy 2' ff- ,, WN WW ' 2 X Wm mm viml. -X ff: ' -f+bfxWvf9Mx-Mw-v- Mfr ww' ' .v,., X WU, ,rv 1 X 4 3' fx :Q Q -3 Q-xv: I. ff- .WN-rf .1 N: J. 6. .,.. --'H yr. -51: -, f. -'A nf J ,ff .V ,- 58.- fS'Hf0f51fFf' A . '! .. ' ' ' E W2 N X x Y , ., , - , A . R mx .. ,M .....,, ,, .,., , W V9 am .. ' f Z ff - ' -' Xf--'fm N, .5 w , fn 521'-Ns rfffxfmr :ww ' ww-:f .+fuf,,:vf wzfff-3 1-i-afqiff f- W W 7 'X . ' ' X fi-3 f f H- N s 4 If-4 M H -mam W N x A,,. K Q 'gm mm' V- x f mm ,W f ff i l ffd . ,.,,. Q N , , , , , A 0 Z 1- z 0 vc 8 al H 0 V A , 9 . ,, . , I f , , .,.. , . x Q Q I' Cl E U 8 if ' ' x ' f P Q 1 ., . . . . , . ., . . L 0 , I , , 6 M 0 , , X , , . 1 Q . 4 I W . . .f Q . ,, 4 N Q 2 0 A 1 v b , Z .1 V ff 4 . f 6 . 0 Q Q , X 4 Y O , , v ,v . Q Q , , Q v 0 , 0 W , . , 1 ,, 0 Q 0 h Q , 0 Q 4 , Q , Q ., , , J 4 Q ,, , I 0 , Q 1 V 'r v 12 e a L W A 4? 0 , , Z Q Q . , 0 . a , 0 a , 0 ., . , , , . Q W 5 , . , 0 1 6 , A 0 4 Q f 0 2 Q 0 Q . Q 0 Q ff 9 40 W 0 1 , , L .K , . W Q . 1 0 4 9 Y z e af 4. 0 4 fs Q J I My Q L Q , , f, H , . cg dim X x .7 A, f. . A . . N glwi? QQ 9 0 , 2 Z f an Q 12 :JG 0 Q 4 1. . 1 N Q X, V 4 4 f . Q , Q' Q A . Q Q V W , , , , , Q 9 , , 1 , M 4 8 , Y 5. , , 0 4 , W 1 1 1 Q ,, , , Z , , Q 0 . , Q , , , Q K Q . ., . f Q W L , 0 4 , Q 4 A A 5 Q , 4 , W , 4,44 , , 7, , , A A , 4 . Q ., v, 4 4 Q , , , . 0 A v 4 .4 4 ., , 0 , Q 4444 4 K Q 4 , L , W U ,. , Q , 1 .. N 7 . . .. Z v M 4. 4 . 2 , 4 , . 9 . , 0 Q 1 a Z , , Q Q , ., Q 0 , Y . . . . . 6 Q Q Q W . 4 . . , . ., 7 444444 4 ., , y A , 4 ., 4 . . . . . 4 . 0 , . .0 , .E 4 , , ., a 2 , . . 4 , , 4 . , Q, ., 4444 z 0 , , Q 0 4. . . ., , . . 4 Q , P . Q 4 1, , 6 1 , ,, Q . Q , , , ,il 5 4, Q 4 Q 4 Q 1 0 4 1 4. 5, W v N f. , 05 , E LC 0 Q . , 0 Q , .. , ,. 6 . , . . , , ., . . 6 . .. 4 .4 4 , , 4 ,, . . 44.44 . . , . K 4 . 4 , Q L 4 , V Q x G, , , l , , p , ,, I ,, , ,, Q 4, Q .w 0 4 Q 1, Q Q 4' Q Q o hflS DHVIS 81 TIS olbert Q f 'A Q 2 ff 2 Q H 4 i M Q Q 3 Q U 'Q 1 1 A 41 A f. k 1 B 'f' 0 4' ' 5 49 4' . . . . . . . , 444. . , Q 5 W ,. Q G ., Q 6 4 , , ,, Q Q 0 Q Q M . , . , ., , a K 1 Q M 4 0 , 1 ., w , ., . Q ., v , Q , , . Q Q , Q . . , Q , . Q B . Q 1 . , 9 Q , . . G G . 4, ,, . r . , . . . . , , Q . , ,, . ,, A , ., , . . . Q Q ., Q, , . . ,..... , ., . . .. , w Q .... .. . . ., . 0 Q ., . . , . , . Q . . Q 4, .1 K, ., . .. .. . ., Q . ., . 0 . . . . . . . Q . ., , . . S. , . . . . .. , . . . .. Q , . . . . . 0 , . . . . .-. , ., . . . . . . . Q, . , . ., . . 0 .. . . 0 ., . . . , . . Q . . . . . . ., . .. . . . . .. 0 . . , Q . . . ., . . . . , 1 Q . 4. . . . ,, . . Q . 0 Q. . . . . ., , , . . . Q . . . . , . . ..... . , . . ., 4 . . . . . . . . ., . Q . Q , . ., . H . , . . . ., . . W ., . ., . . . . . . -, ., . . . Q . . . , . . . . . . . , Q , , . . ., . . . . . . Q ., W ,, . Q Q . . E!! . H:-5 ,,,,,,,, ,,,,,, ' 9 ,Wm VVVVVV 5 MM -iff-W1 if HW , ' 1 2 ' f .wa M ' ,, vlilw nam: fr 11121-1 W ,B W .W fw ffw' ,,,., Q f-'- - .mmm 23:2 111: IMQ 211:32 ,,,,, l ..,. iq 51,5 1 f'ff'-'- f --:-:Q f-f-f-f I A- ,, -. EEE' gg:- 2 'gf ,Aw , i M! gmwj WM E 555555 ? f:1iw E51 WW ZZ? 5 T MIM mm 5 . - -we 311- -m ,,,, 2 W A Av J 'm' -- ,7 , 'M f I Q Jwef 'MQ 07 4 f ,, -V L -'f'f 1- :HS ' 4'S 'M M pi.,-ms 11246 w b Msfiw - M, M-, wwf VVYVV ,- V V, ,A-mf - .M-A,-MM , Kamp A I H : H - - dw VYVYYYYV L, TT23 Wim? 52717755 Kyiifffii slip? Iii: 3 .J , W- E Qgnfkoffucirig e ni0r ufjeffafideaf , , 6,ffzQgJ 4A N gary? 75- M U ,. x . 5 .2 ,, f. f V 4 ,, Z 7 v v T Q 5P3l'k'eU !iW0 5z fa 2 iPE16f Ddlieititi X i ' f Dhrtrlihe Holland' , f, M A Q Q ., 4 Q Q 11 Q 4 Z y Q 4 , ,, - Q -1 0 2 z .1 Q ff 7 Z 2 U -9 4 h'Ue Wvj' 1 ,,,- WT 5 4- cy g ,NW ,,,,,, Z I . G ,,A,. ,,.,.., , W. 1 - of if ,X K. 1 mf- 54,1 ,W W A KM. 4, ,Z '4 , M1 i , , , , K - L H 1 'mf wif ffv f 2 F174 X , 1 . . ' aww fr WW aw fmff eo Senror Superlatwef I , x V x xxx -Q S55 sqwxw 5 XXL N. gt M, A ,x , . , Q' 1 1 -Xks ' ' 3 X , X' Twlili M iii? A-51.Q if X X XR. xi Xxx-X fxwsi., QQLQS R-QS Q mx . -- - - f x- x Q, . yi .xX.xx... X Y QS. W X xxxx YQS.-x X: 1 5 mb 55 -XS xQY.xQxf.x X? AW ' x W . QQXQQ axfsatf Q M ff xi Qws R NX gixi- Q 5 Kmkk is ipgzfss 25512 ixssfgs lgzfi.-iff -S ye auorc-P e :jeac em' V argaret Harris , Mr.Ma rsh a II 81 Mrs . SheIhy . Q , ,, , . ..,-L.,, m.,. . X.,, . , .. ., 4. 1. , V, , V 1 U V. f Q 4 1 ' S Y 2 VV . 4 Q A ' W D f 0 , 5,n,,00h, ,, n Q ,,,. . A A ., ,, ,, , ,, ,. z 1 4 Wwin jamafzue V95 09 mg ' A, n m 0 av 7 L v 4 1 f ' 7 I A ' , BradDuncanQ 8fJeanette Mogg Rohm Mo re 81 M1chelIe Cartaya , , f , f ,,,, Y, WZ, fkf, 7,fff46fvWW :VM'L-fW,wwgf.fA11imix U I L , of if .21 aw ', Q' X fi ??,2wT'3 Qin , f':11si'z f , 'li W 5 V K ,,,f 7 ggi ggi: ,V,, x T C , 2 'mA' -I gy , ,,,,, A, ,,AAAA,. ,A,f 1 ,V,V,, A VAVL ,,,' Y f f f 1 , f Y W., ff 1 277 '--' 1 Ziififi ' 2'1lT732'f . WWMWWM ' 1 2 1, f, 1 L, ,,X,L , ., z.1if.g,a3 141 f-1, al 1514 ii, N Q35 in RE , we ffm-'N L-fe? 5. wx 'P g if? E'L':?e2-QQ 25:g,giE5i Q-1 , ,X X J DNA iw. x Q., Aklb M , J ' i' e e C ' ff 3 A 1 e ee X eggnfrocfllciieg ? elefofe e eeefwf1a4fyll9f14 e Q U H HankQFilIihgiiITi 8i AIIQBIQCOIE e Q e , Juidy N1oecQke 810 P8165 DBIBMBII f' Q 9 - Q Q . , D f A :- ,, Q 1 Q K V vw 4 4 , A iffy., 447' , ' Q 1 I 'I 3 HAZ Q - ,, ' U, e ll? we f, A y la WZ 'I' 5 4 5 Z 4' K X e ., R P 1 I ,Q .hx , . Q 4 Q ., ,, ., ., ,- ,f . e- Q ,. M 2 0 1, G- 4 4 Q Q 4 Q 44 G W .V Z m e Q fe . N i 4 .3 ff 4 4 .- . , I X , e If e J e Parrmzs 1 , .f ,,,.- 1 Q es 6 ,. , ., .. ., . 4 4 - e ,f Q 1 0 4 4 Q 1, v M Q W Q 9 3fmfl Seffef LZDQPWZQLLQ Rebecca Stevenson 81 Ken Curtis? e A Wllham Wlr4the8LStephanle Carr. N 'ee' eeeve e--' e 'ef e eeef'e ' 'f' W ' W A ie Q WW 5l Q R eeeee i eeee eeee , f62' W ' W W W Nw N X Q Q . . X A ' f f , Aww 1 , X 1 1 ' Blawg -sf-iv ks ggi A 4-421,11 24,44 my-1.-,N dw W1 X-4' - IW' WV - '-.---'- 'L -f f -Q f Lf QW' f f XX W X I S ,',L S XXQSN P NN Qqw SQXN S9xQ :QQ XQQ5 xxx A X :vw , Q.-1 Q! -f f-,f. 7 1 mf-,f:, , Jyfvg A xxxxsf NwsamxkwwmXX wwmM.Nw-- Ax'- X X 1 , ,,,.f ,., f -' f x . X, ky Xymx KAN . Xxk kv AAR 'xxx XX xk.x. N. , ,,,, ff , .f , f.,, , ,. f. , jf., , ,mfm , ' ff ' f 1 4 msggwsmmxwvsmmgwwxwxwv mksxs ,Q K X M x , V fufa , My V,,! w 1 m'-. ' 4-,- f . .. X mViL,N ,VVA Z .LVA 7 1 is ,,,. ,,,,L, , ..,. ,. xX,X X vLXxL, x , , ,f W VLVI .K .XE X, Q 1- X 1 2. zz. Q wif xwxfs Wie? x ,-.- ,s V-1' 1-ffm -V ' g,u,.,, -pf-..5 ,pygvq 3,55 tw we ak nm Q St ly Wim ya?-'Q , f. , , , X I W .4 ' L4 1 Q 11 Q I 44, , 0 , g , rl M . - 'Ni X-.wW ' fy 2 Q 4 7 X K N x A ,x N , 0 ' 1 - - A 'A .f W 1 1 wifi X ' 2 1 Q , , A ' 1 . ,3 C , 3 1 n , , Q , , ' 9 ., , x ' v 1 4' 0 . V , , , , , G 4 1 ' ' Q 4 , 1 4 4' z Q K 0 , , , g 4. 4 . 4 1 , , , , W 1 5 g , I 0 f, A A V I 4 Z A Q 2 4 Q f, V 1 A A ., 4, Z ,, 0 ,, , , f A :f WMM ,f . . , W V f ' 7 Ziff Wffff ,H Z77' 'TQT?Ei'f :'ic14 ' Wi' ww-,fi M--'W , l y .A ,,., .. ,,L, ,..,., 0 ,,,. ,L ,L.. ,,,L,A ,,,, A ,,,,,,, ,. , . , , , f , W ' W f W 2 W , 1 ,WA V 7 - yfw QA V ,X Mg ,fc MM ww! ffm- wf,v'9 ww-fu 'ff -H ' Y' ' ' ' ' V' A 7',A'f fff- ff ,-f M.. ,A I M,-gb, It 2I? 52f'Ff F7232 ff? k T W - , f f V f kim, ,V M57WMMWy,M,y 7 ,,,, 2 V, ,,,' , . ff f W A gm f A , , , ' H 1 ,,,, , Lnffi' QWW WWW WW , 7, ff! ,f W .A ww! Q. 0 ,,.f, f gf f 'If KP! Aw ww gm 54 C lan M1987 6 X ,133 A xc! i 1 Xeme Bookex Y exei v out 'nom xewm. Pss sexixois gm e' oi ous ixqoe and oo: Q1 ekerxd aciwkixes . Becoqiimg Kegxofbd Y awe: , Vice. 5, M X CX1wAXe1 fixeas xfrxw e 'Y 5. Oifxceisz OCXCYJ eu, Sec, Coed ,fax X r i, l A ' X tr ,r , , I l . , F , , .,. g sin, ll , ,fr 1- F' ,rl Llf A, I ' 3 , 'f ,- fl r 'J fl -l' xp Ar' if fn fri l' l. V r it ll f Sf ' K., K , r LVL, L Q., Q..f afvdq.-s, L., ,lr i ,A , w ill J ,s Kim Hlrnoerly Donold Louro Jenifer Aleclo Aorom Alexonder Allen Allen Allen Anderson Morls Louro Prince Robyn Wendy Demetri Anderson Angstodt Arnold Arnold Aston Atkins Robert Greg Beth Timothy Ernest Borboro Aye Ayres Doggett Boldwin Boncrott Borge Morcio Dole rrrr Eugene Alicio Mike James Boris Bornes Bartholomew Botes Botes Beeson l 'xv' r 'l fr f f Y- i r KOH rnoy oe on top or rlle lnleop -M lodl rernernber, l youre still port oi it. i l l l Senior! 65 V X l l O if 4 fr of ex-Ji rarfwom 'Ze Lfmrlidi QT lqfolf Q. . l l 1 , l , l W Noelle Melyndo Down Roger Jeff Donny Bennerf Besclw Blockburn Bloke Blonchord Blevins l Ben' Donno Rondo Gorlond Kevin Scotr K Bogon Boling Bond Borowski Brodley Broslow oo, B l 1 l Neil Condy Dorlo Benito John Dovid Breirenboch Brewer Brewfon Brison Brockner Brooks Jornes Kent Julio Koren Miclwoel Trocy Brough Broussord Brown Brown Brown Brgwn r ll A 1 ' 1 ex, f-K, fe . . I 'C r , Q-ANI, . , V A I L l Vg SlTlQlgl roieoole Qoeolhr lrom omoerlence -E snnlorler roeorole, l r exoerienfoe, olon'r soeol-fr, r f - l l 1 il l lr 06 Sc off ,M f -- 3, .A an bf yn r, ,f i l ' 'VIP' Arthur Brye 'fc Shonnle Copps sie . in, X C . ,ref ,T C, Jody Bryson J X. ,J John Cormouche , gg- ri, ,..,, r GV .N ',,, ,wwe W A Q. ,iii , , :IR Chris Chrisflon an my LQ von Burghord il' Mt iii Aw It R 'i ' g ,-.p,q.:H. i ,, 'nw ,.,. i..,5?f wfw ' i 'f.5i',y Srephonie Corr X W , K P i 15 W., ' Abu-a.. A , year ' N . Emory Choo L- , Jw 5 571 2 21.15 , iq fra G I ,. , . ,, iiiiimi Clinton Byrd . L. . il 1 - i 1 si VP' 1 ,.. Michelle Corfoyo 'Fi , if ,. .41 mi . 91 l - 1 A ' J, im Chew gi , C N Q! .. v ' Frederick Correr .W 2 ---- , 5 , .,', lf- .: -J -any , -,:1i'3if1 i ii eeyy f- 1, 'H JN , J ,rg 53 'Prim-? T 11. nz Amy Childers M' Fr .9 'Q 1 -, qi- ' ' u - . A X ,MQ in ' jig eq vw. . ,L-' ,L :jf i' A Q. yefe ,TZ-V-rf sf ffiiri . ' 'x 1 eririirfiaisfw v 1 ' aff.: 4 if ' '. , Q37 W. , 1 ,,, avEf5'E.1 Y ' . ,, 'JH' 1, .ff QP, , .r-. fi M,-1, ,- L., x :f 14 H , Y' -sf . , -y ',i 'o Dovies .Ti . 4 . ,A M1 . I .. E, Q 1 in 2:3 ,.-ggi' , x . f-Z , 'AF wif' fc i V Vi TV?-V, ' ' :f?1::u,Eg,Tr , w g ' f-- ' - f- :swam .pw -1 1354 1 11'::2 '51'!f'1i1-F . .. V ve, 9,5 V - as-Vlidvyu ' rj Dovies M 41 V in Y 4-,, X, l I N ' Q' Dovis - I Dovis Iossom Lech Christe-io Goylier , Q, .w,,f - . A Y' . X 2 W , :fi frf Q?-,gs ' ' AQ: ft .L f ,,,,, , , 95? Q ,wav , Je' ' 5-4 A-J ,F V ., L v if A'AKf f 'L 4 ' 1. Y' L W f ..,. H 1 uw: ' Q EMI Ill: if gd A 1,41?2 if .' - A ff ' Qs' 5, , ' Qafjczi, ,lf j V , A, ,,Sc,. wg mmvi gtg P uv, 5.1: , . ,. - - V M-fr ,qfu Ea! 5- A.. I N a Q K lE M Y '?E E EE WEE 'T l Tl Swallawina angry wards isunnliclsi easier sl'han liaviricji FG l l earrhenn. l F' 'Fl i Heidi Dawn Brian Carrie Jeff Andrea uncan A E I D Dunson Dwyer ar Earle Trina Melanie Melissa Ho e Stephanie Lisa Eddins Plaeanne Ervans F3 Edwards A' Elebash Ellis Ellis Richard Mary Jeff Terri Alan Euaanks Ezelle Fairchild Falzone Farrugia Jeanne l-lanls Fernira Michele Lori Srephe Fields Fillingirn Finlsley Fischer Fish Fisher I ,M Q K7 M X79 Q7 se-F-J mmm ef-2 cc, will 0, few i l l i l l l i l i l Sezziorf 69 Be thonkful you re living I0 o lond you con soy whot you think without thinking 1 . 0 . . . . . Cindi Denise Liso Cynthio Tim Chorlotte Flonders Foroie Foster Fountoin FOX Frederickso Suzonne John Gibson 'lbert Noncy Thereso Kelly Holly Gonder Gordner Gorrison Gosh G1 Louro Rondy Vivion Cqlvin lzobelo Greg Gill Gill Gillord Gillis Giusco Golovko Michoel Henrik Kothy Mlchoel Down Philip Goodln Gorbow Groy Groy Green Gregson enioru - arid 0 70 Seniorf V .IL . S 1, ff.- .I . W l J. , ., ll i 1 ...- ,. l ,, f, 5-A , 1 X... 12' ndo ,s il .ELF l A -if wig? f M' .,. X , 1-sg qy,,,,,f'vlH sl ' ,lf 'q l' : Rachel V A ,, J ,N , A , 1 - Qi Q.. il I, ' .. Mork Griplao 'J '-..- ' Qllfl ', fi , ,L ' :lu '- M ,r 4, V - , MF. 'ed' , f '. ,MW ' .s,w,,,,, Q '-fzgxwrfl, ,.,,1,.,gjT x., 'l , .. ,,,14,, , . u '-f,, 'ff s. 'W JJ' A,. f IR X..-f 5? J vm, ,X ,, .,,k, 1 'l Corolyn I Kimberly Horrls Mo M .wmv . I 1 ' P, ,--alfa 4? , ff H 9 3 M uf: .,f Q 1 'lm 15 1 1 ' Jn- , K ,,,,,.,.- 1' x f: A ,vI, l , V, ,L ,, ww - l K E, . -W .rf-lg 1:f.,,,f, r - li K, 4 l l, A' ,, ' ,:,5 , I 1'3u,l,,v-f' A: .N . ,, lf ' VH e 'k '14 6 793,-8, -1 , lfx ,I ul.. ir J? , J J I , ff -.1 F' A I V V -.Ra 2 3 f XJ vn wifi? 1, 4.,.,, . - Q., , .J f 7. -sf , ,W ,,, --f2fl,,,:: . Vw... - , -1 J AE ,Y , i 1, , tw 1: 133, 45 ,AQ - , c,, A ie J e H . ps 1 e f .k, , 344.5 .. N E .QM 1' KJ - b ,. nw, 54 vfff L , fx , ,A Zffglfg Q , YV ,MJ Vg- , . env we 4' ,qw -.f A , ,ggirm-f . -1 8 P 1 ar 554, Y e 'li -if - - ful-' z, , . 4 , I - J-ff ffl ae : em., 1, ve , Sa ,gl . ,,,.s, V ern 5 N 5 Q' f 4 -3 V, I wa M-veg, , 411' , 1 47, - 'fgfi ' ' , . V- A , - f-1,,, 4 .,.A,,, ',, ' :WA ' HL , th 1, V. :- J wg, V. fj Leslie Q' ,X Af ,1.,, , V ,,-,fl f Howord vvzl ' 4, 4-fa , . 1 1- , .9 I.. '-'f ii ,,,, '.l - , '?'-' .2 3' , ' I , , Jew? ' qi : We A-Jr. ,F Q 'W' 'f34fi595ff Hynes -'TS'f?s '-EJ X iff' P7 fe- E J . e- if 4, 'af' If Koren Jones Y '-T ' , ,'v 4: 'E' , 1 K K ,. i L L , i i N X i KW if i K Mx If i Q i, ii if , , fr jo Q 57 i M'- ' if i Clair Amy Angie Jimmie David Glen if- ' - -' f LaFiamme Kruczinslsi Kyle Angela Scarf Shanay Frederick Scoir Kaihy Lasiey Lavine Laurence Lee Lee Lee Lem Tyler Susanne Avererr Myra Kim Angela ' ' L L I'TiOI'i Gif err Levin Lewis James Becky Amanda Ciiia Yvefre Lena Lichorowicz Lisman Livingston Lombardo Long Longmire been fl Wrinkles siwouid mereiy indicaie vvinere riie smiies navel I Swriorr 7 r l 3 i l ll l sg l A if? ' RQ' ,- if , O f Cf f L ,W Q-ff Qfilililliflb 2 627455 Q f ffl? f i if Roh Cliff Cheryl George Kim Lohno Looney Lowe Lowery Lowry Lucy Monwore V Jill Vicror Williom Dono Micolo Aho Morsdeh Morsh Morsholl Morrih Morfih Mortinez Chrisry Bersy l-leorher Jill Kevin Kelly Mosoh lvlorhews Moroloy McAfee McClommy McClure Chip Shohrdo Kim Chris Morrhew JoAnne McDohiel McDohold . McGrow McKeoh McKinney Mqwillioms e . A I - gn: . 6 V Keol sllojess is lRlQl ouiword show L31Lil oh lhword leellhg. L l Serziorf 4 x. '-:L 'EQ , , if xx V ' ' ie. , , i , r L- if ii v P 'T,,?,:q:-V Qi Gyn- r ., , ' 1 'Mx we LM' 22 X. X 2.5 , -EFL 45 i r M , ' Q f Corhlee rl Sobrino Merwdo r Miller -. A ' A , . N 1 ri ii ' H ,Q ina , , . , M W wif L I , ,, V A hryn Jeonerre hem Mogg ' 'Z 1 M e f i r . M M M ir ' ? ifjff ii. 'xi '-' ii f M ' i . B! ' i.,-i,i,1?iEi:wL1i:,jig 5 ff 1: ii' lm Y ii Debbie Horrierr Liberry Robin Lis Moore Moore Moore Moore Morr I V Y xx ' , is if i ' 1 r rr ' 3 ' iii 1 ii J Mellsso Wendy O ' C r Morris Morris o Q ' '- Q 2 if . if M f , kg f' bl? ,hwy ., V -in 1 W, I Ja, . E .1 ri f He who is noi' Qrci'l'e'lUl 'lol' lhe Ql0QCll il'lRlllRlQS he lolos Wollld noi' be H'RlClQf3Y wilh Wlhloli he Wlslwies he hcldc Hex-'in John Millicenr Norhon Non Kelly Reose Reinelxe Remoerr Renoud Rich Riddle Michelle Michoel Cormen i Eddie Morny Troci Riero Rivero Rivers Robinson Roche Rodgers l l Poulo John Arny Becky Roymer Comelio Roe Roeder Rosenberger Rush Sole Somuel l l Jeff Dovid Dorlene Amy Ed Jerry Sonders Sopio Soulsberry Schnupp Scholz Schroeder l KZ l l V emiomi ff-If lgC,flQz5.5 of l l l-lope is unwinding o piece of knotted string thot you suspect will not be long enough onywoy ' Amy Richord Lynne Stephen Louro Lourie Scruggs Seely Settimio Sheo Shepherd Simmons Lorie Julie Trocy Aleitho Down Leigh Sisco Sloyton Smiley Smith Smith ' Smith Roche! Stephonie Todd Leigh Ann Adri Penny Smith Smith Snowden Sowell Spoin Spurigo Troci Chris Psebecco Cynthio Tobotho ' Shelley Stollworth Stegner Stevenson Still Stills guorez eniom - cmd 0 4 'ff . , Q X ,w.r4,F. '. W., A , -wr fn- fr :SW D XL! Vince Sullivon Thompson Moggie To Tn K 3 .mme Q QC -...J 1 f : u' , , r f 1+ 1 . ,,,. 1:-are W tj ,, if N M ,- . A ,, Q, f -:L ,e ,-wig. , wa 7 N Toylor, yn Michoglg ls f aq. hsvxs i . 11.3 I HE' lf nw. - MY - I WN L ii, M I Je. , gf fi LQ..... , QW, A-ffkwfiw ,jeff Melo O . J n :: ' , ,V -. H- . , ,'!' 1 ,x r will , 1 W L.N! ' - 'Q P wfmwnf . - , , Chris Linh Tuff Truirf Truong Vond War' I ' 'lik X pi 5 qi' 1. ,, W. 3 Bruce Vredenbur 3 A sw. 1, Q,- A U .,r'HW'W' l 'H-mv? SIM 1:11 n1 nn , x 1 A ,. 4 , V' j 4 f 1 . W l Dawn Bret Christine Scott Ayer Chorlie West Whigham White Whiteman Whitley Wiggins Bridgette Capri Carlos Chandro Darlene Everett Williams Williams Williams Williams Williams Williams John Ross Denny Bonnie William William Williams Williamson Wilson Winn Winterberry Wirth Curtis Michael Craig Kelly Paul Allyson Wolfe Wood Worley Wright Wright Yorbfough eniom - 7 Pom Todd Young Zuleger ,egg-2-1. l 5 4 I , v Fi' 7. ix ,H x H XX Oni ff nf 9 1. , H3 .V EJ gt- y T w l ll lwl. ps, will 11 pw . ,S 1-ff I,,,.',,plll m,1,,,! fl- 'W 'li fn' . W- , V Q., 1 ,V ' 1, nw . M . i T 'l fwlfllmf . ' '1::.,w. , , 7 Q W ,X L. 54 I :it ur Q K., ,,, F ' L : f - X ', u I V Av 1, , ' VV., X. s 4 -Siva, ve.. 'K , :fwfr-'Sf 4' i.5g2'U'i? , 1,:'.,igr4QQQ.1Gii??f . ,, X,k, 5 if ..,, XM. 44u.'.fizexz4,N,.- ,153 Few of us remember the world when we were babies. The memories of our childhood began somewhere around five or six years of age. Our parents documented our lives by recording our historic events. This is the reason for these funny little baby pictures! All the pictures of us stuffing food in our mouth - and hair as well -, playing in the bathtub, or just being our naturally charm- ing selves were taken for that purpose. They were taken with the thought in mind that someday we would want to remember and laugh at our baby pictures. We were great looking even in 1969! We are entering into a new era of our lives. All of us will be leaving the shelter and routine of school that we have known all our lives. In essence, we are babies transforming into adults headed for the 'real' world. The protection and guidance of our parents will no longer be there for those going off to college. For the ones who are go- ing to work, the daily tests and trials that we heard our parents talk of so very often will become a part of our lives, too. But no matter how much our lives change, these pictures will always be here to remind us of the time not so long ago + when we were babies - small, but wonderful. - Rachel Smith A . W ,W f W uf if ,f , , ,ff 'ffaw W.,,,,..,f-f , N W ' It H ., 'ol f . 1 , f - I M253 at Faces Going Places wifarv W 1' X ' J , ff, 1.2 '19 , wi ' i all fwjywfyl ., ff '-'H ,fy MQW? Senior Baby Pirturex 81 . , - 0 0 1, 9? W ' , f X V 4 1 1 if l 'V' ,fy 'if .V ,D W I ' 1 If f x X - Q f 1 -vi fpA'sg -9 f' af-'T-F -,ew Q: . Ei 26 fi: My A :,,,ff 1 5- y 'V Ffiif' 4? ' ' 'fwnf ff QE ,f ff 'Q 32 f, 7s v ,f 'nnm. t.,.4f,,4 ' ,f 4'M4H2,,,, 'H' rv. 7 , V ,. ,g.,,5 V' ' J ? Z, 29,1 70' 1 I 3' , ,W f , ' I ff' 'Wulf' . r . f:'f17f.fg,f: -f i ' k Own. , 4' , .. I 4 f i 1 ' , E73 5- 'ii 'Q X 1 X I' , Q 2 , ' . f ' . P 8 ' ': 5 , ,. 4 ,v ,- 4' 'V L , J , y I f 4 ' v. ' 0 Q 1 5152.222 A 'f f f fm A' L 'K IV, , ,fs 'M 'www , W if rig' I' 0, 4' J ,,,wf, 1 li' . 4 351' AM .5 ,WW F ' My H ,,., 1 ,,.,v,,,,, W, va--wf,,M1n1s 'Lyn ,mu.,,,, my I jjfr -ss 4 1 , 43 5 J ' I 5' Q, mhfw f 'kv A 52 ' +,m4 91, Q:-2 ' 7 815' 'nr' Ns 'Nm' I if' ku U: vii ,, l .Suk 'V X. YH- ff' , ' 5 141' I f p.:, K , .f:4,,,., , , f J sf 6 i Q , 1 f f ' an 'Z' 1. 1 6 ri? 9 7' , 4 ' 5 ' ff 1 V ., f 5 4,1 ' 4 ' 3 'LZ 1 'f 2' W if 'ii ZZ fn? 1 f W 2 sf? iw gf I '-www. ,- y , ' '- In A 'f 'ey 27' W, f f5r,5fj5,v :Q W 1 1437 489 ,JU . .eral V l 1 rf 'msg , W , dv W' -4-1 4, , , v 'S M Q I f I 2 I fm , if, f f i , ,M , '-,' ' QW , , ,f5 . I ,, ,' ,J JET. , 6 j , ' Mp ? K Q7 A f , ,,. , 2,1 W , ,f7f+s'ff, , A my , - ' f I Q, , W iff' ', ,M A V '- 774' if ,rw 1 ' E H f, I zgwwz , I f ., t ' 1- V f , V. 4 V , , ' ' fs ' V , fi 1 X rr ' ' ' I 1 7 . W 5 4 0' 5 vw - 'P ' f , 33, wi W i fi' ' -f Q , 1 ': ,ff! X ' 23 3 VIVV ....- ' :Q1,QEil,i, ,F WN, w ifi iff. 4 , U ' V' W ffm '- 4 y .7 4' Q V , 2f' A. l , 4 1!' :,' '51 V 'ff' H Li ii i, if A 5 KV 5 Z P J I X x 4. ff, I 'Q hh ?,, J, . ,I ...,-Q 1 , :if Axawdgu.. ,f l Z 'R rn Senior Baby Pzfluref 83 A s df ' ish-ye 3 ' f ' f f ff K I if ,A 1 fx, ., A I ...ANL 84 Senior Baby Piffllffj' lima 4 1 W., 5, A1 fi' in ' E til' Q ft :i.. :f'5f?Q2: H ,7 3 1 4 7 7 , 1 1 Z7 7 ' 11 F 1 P Q , , , f C7 4 ff Q 'W' ' ff L wi f ,,- , Q , 'iafjzg 4 ' ' ,241 . f.. ,, 1, , I MZ -1 45, W3 4 J if 4 ' My , , 4 5? 1 0 ff 2 W 1 Na., ' X, ' -:wg , , 2 'qi' fjlifi' 71 1 ff fy , , , , 5 f H W v, , Mfg 2 X f 5 f f , I , I I , E ,f , 4 ll SJ f 1 1 . 5 4 5 1 4. ' , Zi' we 1 1' Gldzfaef f- 2' Huff,-:kg 444.11 ' 1 1 f f 'T 7 ,i ,f,L, , ,Q ,,,,, QMWA -jan- 'ilb .. f . J J,- .A,1 was Laura Allen Tina DuBose Kelly Garrison Greg Walden Mirriam Nelson Kim Lucey Kim Chew Michele Fischer Kathy Gray Penny Spurigo Theresa Gardner john Reineke Michelle Cartaya Aleitha Smith Wendy Aston Bridgette Williams Matt Vinson Cathy Hufford Sydney Decker Denise Kilcrease Mindi jones Lori Fish r n l. 1 l refs N. .Q77f fT 735 ,ne-4 ,al . 'Q' A -.J.- . . f Q. 142. 1f ?'g .H 5 .L . P 6 - f 99 an ff- av.. 3 1 . 2 e ' ...aa . R 49 l ., .:, .1 f:.-' 1 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38, Dawn West Ruen Castillo Peter Delevett Ronda Bond Heather Matolay Paula Roe Alecia Anderson Dawn Dunlap Brian Hay Rebecca Stevenson Scott Whiteman Melanie Rand Latonya Neal Tonya Howell Michelle Riera Amanda Livingston 39. Melisa Holmes 40. Greg Golovko 41 Elizabeth Thomas 42. jeffrey Hawkins 43, Tracy Newth 44.john Williams 45. Melody Toro 46, Tiffany VanDeMark 47. Dana Mussleman' 48. Lisa Foster 49. jill Marsden 50. Billy Beason 51, Kimberly Kelly 52. Darlene Saulsberry 'realli --ares! 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 Cilia Lombardo Tyler Lemmon Becky Rush Kim Currie Sabrina Miller Sonya Oehler Margaret Harris Stacey Nuetzel Dana Couture Peggy Clark Adri Spain Noelle Bennett Chris Stegner Amy Rosenberger Tina Hamm Kit Kievit Andrea Housand Vanessa Padla ,judy Nock Kim Levin Raymond Grier Mark Anderson 1 Shonnie Capps Hunter Pfeiffer Chris McKean Laurie Simmons Chris Ezellc Kim McGraw Michelle Parks Christine Kelly .john Hamilton . Todd Snowden Frank M urphy Liane Olmstead 1 Trina Edwards Charlotte Frederickson m1,,,,M Krlliwuu-.1 -. K 89. David Morris 90. Brad Newman 91. Suzanne Gibson 92. Cathy Morrison 93. Rachel Smith- 94. Leigh Ann Sowell 95. Parry Hawkins 96. Lorie Sisco 97. Amy Childers 98, Ayer Whitley 99. Rachel Halpern 100, Betsy Mathews 101 102 103 104 105 106 107 108 109 110 111 112 113 114 . Gindy Brewer . Nancy Watson . Lisa Hicks . Holly Gash . Donna Hayden , Bruce Vredenburg . Cindi Flanders .jeanette Mogg . Carrie Dwyer . Lisa Eddins . Robert Moses . Cherrie Myers . Kathy Lee . Wendy Morris 1 15. Reginald and Roderick Parker 116. jack Surratt 117. William Winh l 18. Lisa Oberro 119. Allison Cobb 120. Denise Forgie 121. GeoffNage1 122. Dana Martin 123. Leah and Blossom Davies 124. Robin Moore 125. Cheryl Lowery 126. Donna Boling 127. Chandra Hill 128. Caroline Hartnett 129- Allyson Yarbrough 130. john Gilbert 131. Mark Davis Senior Baby Picturer 85 36 J,,,,,0U , P 22, 't 3 I qooie iespecx X: Q1 'Asn 1 - eouwce camo Kees. vocdoohvi :Mid 1-XDCXXXAC 91616 Coe Qivweged Kew . . . Cnc ' Sxexl e Coo30, Sec .',yKeYxssa Omega, eos, p,X3XJoYXa1ixs. Y ies . , bkmeoe Coos -Y Ot 6 Hcp Q-af Q-v ,415 V- Donald Abbott Richard Abercrombie janaRae Abram Michael Acton Timothy Adams Wendy Adams Greg Allerellie Toren Anderson Tracy Andrade Michael Armstrong Robert Arnold jeffrey Babbitt Brian Baker Susanne Baker Terry Baker Andrea Baldwin Jim Balcom Alysia Bartholomew Tom Bedics Al Bednar Ines Benitez Albert Berry Charlie Berchem Laura Berube Craig Blackmon Deborah Bogard Mike Bolling CeCe Boone Shad Borgen Buddy Bowden Kingsley Boyle Melanie Boyd Teri Boyd Geoffrey Bray Trey Breault jason Brewster Paris Brierley Brian Broadwater David Brogan Darrell Brooks Corby Brown jeff Brown Nicole Bunch Richard Buran Todd Burrus Marcie Bryant Melanie Bryant Courtney Bryson jennifer Campbell Mike Campbell Denise Careddu joseph Carlson Kristin Carlson Laura Carlisle Lisa Carnley jason Carr Stacey Carr Billy Carroll Rodrick Carson Acquelyn Chow LaShawn Chow Hoke Clark jamie Clay jennifer Clay Leonardo Clemmons Mickey Clinard Scott Colello Angela Colley john Common Michelle Cork Shannon Cork Rochele Cornell Stephen Couch Mike Crawford Edna Crenshaw Angelia Cumbie Bobby Dale Bryan Dalton Sang Dang joey Davidson Betty Davies Tarik Dawkins Sheila Dean Catherine Deason Michael Denton jenny Desmond Brian DeWeese Erin DiBlasi Barry Dickson Tammy Disney Randy Dixon Kathleen Donahue Sheila Downs Steve Driver William Dufner Carolyn Duke Tammy Dully Bill Dunbar Allison Duncan Colin Dwyer Terea Easterday Michael Eddins Todd Edmiston Alan Edmunds Karla Edvenson Brian Eggerton Kimberly Eggleton Christer Einvik Beth Elliott Cassandra Ellis Lisa Ellis Andy Erbacher Kelly Esala Eric Espersen Scott Eubanks Karen Farrugia Roy Faulkner Angela Fennell Jason Fiveash Scott Fisher Clan of 1988 89 Vinita Ford Dara Frady David Frazier Natalee Frenkel Sylvia Galloway jesse Gans Laura Geigel Kevin Gentzel Cindi Gerdeman Andy Gilbert Tracy Gill Anton Giusca Michael Glover DeeDee Goble Michelle Godwin Zane Godwin Hillard Goldsmith Francine Gomes Paul Goodrum Leslie Gore Wade Gough Greg Grandison jennifer Gray Alicia Green Michelle Grier Sharlotte Grier Clark Griffin Roderick Gulley Amy Guthrie Alexis Gup Shelia Hamblin Scott Hameroff Richard Hanson Shawn Hardy Michael Harmon jason Harness Tim Harris Willie Harris Craig Hawkins James Hayden Robert Heck Dickie Heckler Bobby Helton Eric Hicks Larnce Hicks Leila Hicks Philip Hicks Kathi Hill x Kent Ho Nancy Ho Thanh Hoang Elizabeth Hobgood Michelle Hodser Heather Hoffman Karen Holifield James Holmes Travis Holtrey tl 1- William Hooper xx, -S XQNL at f I ,.,g,g,,-- ZWWWW ,gf ,, ,, j I Jamezetta Horne Carrie Houck Edward House Troy Howard Ben Howze David Hoyt Heather Hudson Rhonda Hurd 11-' David Isler Benita jackson Theresa Jacbos Sven Jacobsen Keith jenkins Tanya jiles uniors o Bottom Locker Blues Ahoy! Look out below! cries your locker neighbor as the entire contents of his locker crashes down around you. What a way to start the day, you groan gloomily, as you stifled a scream of pain. No problem, I'm fine, you comment, sprawled out on the floor in a dazed state, your head throbbing, and the world spinning around you. As your locker neighbor bent down to gather his belongings, he laughed saying, Hey, I'm sorry, but you should watch out for falling objects next time! You bite back the urge to ask if you could knock him over the head with a few of your books, just to show him that it didn't hurt a bit! As you recover your wits, you remember that this guy is a friend of yours, and you couldn't tell him what you were really thinking ifyou wanted to stay friends. You decide to forget it for the time being, and just as you stand up, he closes his locker door, whacking you in the head for the second time in three minutes. You let out a shriek, catch your balance, and think, Why in the world dicln't I stay home today!! To Ben Vaughn, having a top locker means no more Bottom Locker blues. -Jenny Desmond Clan ofI988 91 Jonathan john Randy johns Dewayne Johnson jim Johnson Kaderon johnson Cynthia jones Fred jones Larry jones Michael jones Mici jones Nyasha Junior Carol Kahn Sherry Kaminski David Key Kelly Kievit Rob Killen Liz Kintner Tonette Kitt Samantha Knapp Kim Koehler Kenneth Kyles Ernie Lansford Tonia Lawrence Daryl Lassen juniors FOOD F Th h You heard your stomach growl, and in your head you visualized the bustling crowd. You could no longer keep your concentration on the clauses and phrases your teacher was explaining. You could hear the noise of talking and munching. That little voice in your head said, Feed me! That clock on the wall became your worst enemy as it slowly ticked off the minutes. Finally, as you were pulling out the last hair on your head, the bell rang! It was LUNCH TIME! Your thoughts became a reality. - Sarabeth Thomas ,fa K 435129. .AL , gf f,--1 LAW, 1 I ? ,A Nicole Lauer Scott Lauter Rhoda Lea Brian Lee Brendan Lee Terri Lee Stacy Leichner Leigh Leidner Tracie Lester Cathy Lett Latina Lett Yulander Lewis Anthony Lewis Stacey Lewis Shavonnda Lewis Heather Lindsay Cindy Liu james Long Katrina Longmire Scott Lores Catherine Louy jack Love Elise Lovelace Kelvin Lovely Mark Lunsford Pamela Lyons Kris Lysejko Maureen Mack Scott Maltby Sean Maltby Lori Mann Carter Mansfield Stacey Martin Audra Masiarczyk Rick Mathews Sherman Matthews Patricia Maughan Lawrence McCall Rodrick McClure Yvette McConnico Willow McCormack Kelly McCormick Jada McCraney Tami McCullough Kim McCully Brian McElhiney jay McElroy Nathan McFarland Clan of1988 93 Richard McLeod Robby McLeod Tiffany McNally Brent McNeal Kelly Meacham Tom Meehan Richard Merritt Earnestine Middleton Angela Millender Nita Miller Douglas Mitchell Reed Mitchell Stephen Mitchell Kristi Mitchem Karen Mock Kim Moniz Debra Montgomery Yolonda Montgomery Heather Moore Willie Moorer Kendra Morgan Baron Morris Rodrick Morgan Tony Moultrie Corey Moultry Cindy Mueller Grant Murray Shannon Murphy Frankie Myers jennifer Myers Scott Nash Daphne Nelson Viki Nelson Jason Nettles Roderick Nettles Paul New Michelle Newland john Newton Melissa Ngo julia Nickson Stephanie Noel Lisa Norris Anthony O'Bannon Tim O'Brien Kevin O'Hare Craig Oldham Melissa Ortega Debbie Orth The Good, The Bad, and M Friends You remember those days when everything seemed to go wrong? You woke up late, had to change clothes because you spilt breakfast on yourself and were almost attacked by the killer dog next door when you tried to leave your house. Arriving at school, you were yelled at by your teacher for being late and forgetting your homework. just when you thought you were going to lose your sanity you saw a friendly face - your best friend. All ofa sudden, there was sunshine. Most of us, at one time or another depended on our friends. We asked them to help us cram for tests and for rides to football games. When we were feeling down, we got a bearhug. Memories were made with our friends especially through the hard times. Other memories were made when friends gave us hard times! Being the friend he is, Coach Erwin offers Cathy Hufford a drink of water! -Julie Korte juniors Lorrie O'Sullivan Steve Overton Beth Padgett Lois Padla Cindy Page Timen Pallin Christy Palmer Kenneth Palmertree Charlie Parker Ashley Partridge Alan Peacock Shelly Peaden Aaron Pennington Lenetha Perkins David Perry - Diane Perry Mary Petruska ,- Tarina Pettiway Al Petway Lora Phillips Christine Pierre Billy Pike Michael Pike , Kay Pinnix Clan of 1988 95 96 juniorf So You Say You ant a Car ou're tired of riding the bus or catching a ride with your friends and now you're ready for a car of your own. So, how were you going to afford it? Parents you think. Finally, after weeks of bothering them, your parents relented You can have a car. We'll buy one for you tonight. Before they've finished talking, you're on the phone to your friends. I've got a car! Can I have a ride? they all asked. Sure! you said, unbeknowingly setting yourself up. The next morning you drove to school with six other people crammed in your two seated car. But hey, you had a car, who needed comfort. You run into school, jangling your keys to let everyone know I drove to school. Finally, after a long, long day of telling people about your car, it was your first chance to drive home. You walked to your car and noticed thirty or so people standing around it, all the friends you offered a ride to. You finally got home at 5:00 and offered your Dad the car. I can't take it! What a day! - Billy Pike Juniors Amy Pitman Michele Plant Neil Postlewaite Paul Powell David Presley Mike Prince Curt Purcell Melissa Pursell Ingrid Quinn joe Quinones Joyce Railsback julie Ramirez Heather Reed jean Reid Richard Reid Abbey Rembert Barbie Replogle Scott Rezek Tavara Richard William Riehm Eve Riera Eddie Riley Sean Roark Keri Roberts Regina Robertson Grover Robinson Ronald Robinson Gina Roche Ted Rosenau Sid Rosenthal Ron Ross Pat Ross Rachel Ruckman Pam Ruckstuhl Ernest Rudolph james Rudolph Mike Ruffin Angela Rupp Louis Ricard Simerly Saacke Michael Samala jen Sands Mike Sanford Arturo Saulsberry Tarra Savage Tammy Schneck Danny Schwartz Lauren Scott Melissa Seay Erin Sebelius Roger Serwack Ashley Sherrell Margaret Shippey Kawanza Simmons Tracie Simmons Marzett Simpkins jason Sims Christen Smith Lorraine Snow Nicole Snowden Everett Spain Eddie Spears Michelle Spivey Jennifer Spiwak Marsha Stallworth Scott Stanton Tonia Steele Rosevelest Stegall Teresa Stevens Joyce Stokes Teresa Stokes jason Struck 98 junior! Tommy Stubbs Maricres Suela Pat Taylor Rachel Templeman Chris Thomas jonathan Thomas Seqwana Thomas Tammie Thomas Brian Thompson Tim Thompson Trina Thrower Carsten Thuma Daniel Tice Justin Toche Barry Tomlin Jennifer Traynom Cheri Turlington Mike Turner Murray Turner Hiroyuki Ueda Mason VanHouweling Ben Vaughn jennifer Veasey Brad Vucovich Mike VonBodungen Douglass Waits jason Wallace Elin Walser Jena Watson Sara Warner Derrick Warren Rhonda Washam Sabrina Washington jennifer Watson Ashley Weaver jeff West Tiffany West Cassandra Westbrooks Cass White Charlie White DeAnna White Horace White Miranda White Monica White Russell White Cathy Williams Pamela Williams Patricia Williams '-'AJ 'li' - fi GV Stephanie Williams Chris Williamson joey Williamson Terry Wilson David Wimberly Danny Wimer Michael Wise Robert Wood Steve Wood Stephanie Woods Dawn Woody Chris Work Lance Wright Pam Wright Beau Wyatt Cheryl Wynn Dona Yarbrough Christian Yots li if Heather Young ri is if Q y X h sl ro isfsdw ., 'il Q il?f2iQ.JjfllQUw Lyv T j3 u MCYWJ, o 5, N i MRJJW Rene Young K Claire Zorn Elizabeth Zorn ' Bill Zwermann 'fy UHF .K aura-Ml? W VLMA ll W A if fi We if-J at i . 'A Juniors Life Is Not the football players burst through the sign. a Spectator Sport Practicing from 2:45 until 4:30 prepared the Flag Corps for Friday performances. The guard warmed up before each game by parts of their routines. As the tension and nervousness mounted before Mr. Tipton's cue, we gathered in a circle and whispered a prayer, Please let us have a good show. Let us win. In your name we pray. Amen. With heads held high, we marched towards the sidelines for the halftime show. As the music began, the worries and nervousness faded from our minds, because we knew how far we had come. Now, we were molded into a tightly knit group with precision movements. When we took to the stands, we became a cheering for players and fans alike. We encouraged everyone to get involved in the game and the famous oom pa-pa brou ht the crowd to its feet time and time a ain. g Tarik, Tina, Ken, jennifer, Renee and Katrina pose for a shot before Clan of 1988 99 I 00 Clarref The Thmgs That Kept You Drowsy Today Do you groan and growl at your alarm clock when you wake up rn the mormng for school? Do you pump our of bed fresh and chrrpmg hke a happy bud? Have you ever wondered why? Your body actrvrtres have a schedule of when to work and when to rest If you rdentrfy wrth the first type lrke Dana Musselman your body probably does not reach tts peak untrl afternoon and evenrng I get physrcally 111 rn the mornmg I learn more after lunch says Dana If you fall rn the second descrrptron lxke Terry Baker your body rs on the GO rn the mormng and Slows down by afternoon My average wake up trme rs from 6 to 7 o clock I usually feel nred about 4 o clock rn the afternoon Wakrng up rn the mornrng IS a crnch for thrs type of person Those of you who fall rn the other category Cmany of us dob have a hard rrme draggmg yourself out of bed rn the mornrng Your body rs normally set for sleep at mrdmght and for gettmg up at 10 or 11 the next day You feel lrstless on school days because your sleep rs off schedule and because of the drasttc change rn the trme you set for bed On weekends you go to bed at your regular schedule Then on Sunday mght you make yourself go to bed early for school You toss and turn rn bed untrl forever When you finally drrft off to the land of beaurrful rest your alarm clock screams and msrsts that you get up' Mamc Mon day begrns wrth your grumpy feelrng and gettmg late to school By Frrday you feel less resty rn the rnornrng and make rt to school before the rardy bell rmgs Weekend cornes and the cycle starts agarn Your sleepmg mme on school mghts confhcts wrth your normal sleepmg trme so that you feel awful the whole week long untrl the weekend Ah' Accordrng to Natural Huzorj' You can change your actual sleeprng tune by sleeprng an hour later each week untrl you go to bed at the trme you want Then suck ro the sleeprng schedule and you won t have any mormng blues' Lrnh T ruong Bobby Dale cl scovers that twnrlmg a rrfle somet mes really grves you a headache' 'X X In the gloomy hours of First Period, Tonya Howell recreates a typical cave paintin T ww to Do warn Youn BRAIN BREAKS DDWN With hours of practice, julie Korte can now reproduce layouts in her sleep! I've read this play 3 times and I can't believe anyone would die for a girl. Michelle jiles dreams of taking notes while others listen to Coach Erwin's lecture on gold. Dreaming of baseball practice, Mike Daniels takes an early morning CAT nap. Clarrer 101 X9 'COC V was non .. sogboh, ' 'xo we J! Qlexe mn, iced, . Kivced. ., Wag xv, od sC0ooX Qiogfgbox we QU ebea: me seoxots booze .When Coe Qlkooeis a Acad ' 'Voc ies: oi os sciefa. ooisebl es NU ebecaqoe Coe 5005: SQ Oiixceisz 'Reef' . Savzioeio 'Y0og0as', Sec. . ocg,eYxqoeYXaXiex',?se4xcXeo:X'XoXXq Sens ' osciao, C1XeoAa9a11'xs. X1 Rs Sgoosoxsh 1 Y es Ps QMS XX P wr Ricky Aldridge Chris Alexander john Allen johnny Allen joseph Andrews Nikki Andrews Jerry Andrion Tammi Arnold Michael Bailey Liz Baisden Scott Bales Braden Ball Angela Ballenger john Bancroft Jenny Bama Chris Barfield joshua Barlow Heleem Barnes Bryan Barnett julie Barrineau Alysia Bartholomew Laura Baxley Tanya Beck Tracy Bell Andrella Benjamin Ira Benjamin Holly Benson jeff Bice Jason Black Sheryl Blackmon Dow Blue Michael Bloski Alicia Blum Allen Bond Tracy Bond Greg Boyd Kimberly Boyd David Branum Mat: Brewton Gina Bridges Becky Brock Chris Brock Cassandra Brooks Diane Brooks Greg Broxson Scott Bruce Chad Bundrick Shannon Burke Clan of1989 103 I 04 Sopbofnoref Ll ,, Lisa Burnett Wyvette Bumett Ginger Cade Kim Caldwell Heather Calhoun Amy Carroll William Carson Woody Carter Harland Cason Ramon Castillo Steven Chandler Royce Chitty Heather Choat Michael Choron Kin Christian James Clark Michelle Clawson Mike Clay Kelvin Clemons Shawn Clemons Christopher Cobb Trina Coleman Destra Colley Kimberly Colliet Mastering the Wild Things No more lazy days on the beach, no more sleeping until noon, and no more fun. It's time to get serious and start working again. Trying to get our brains into gear was a task each of us faced as we sat in our first period class. In the back of our minds we though WHY do I have to be here? Deciding what to wear became a problem again. No more shorts and T-shirts. Finally, we decided it doesn't really matter what we wore as long as we got to school before 7: 15. Carrying home books and folders once again became a pain. Studying entered our lives and many discovered that our brains do not work before the sun comes up. CFor us, the sun came up precisely at noon!D Yet, as the days turned into weeks, school became school and for a while we were happy. Otis jones smiles as he wonders why lockers were created since he seems to carry all his books home every night. - ET, RS, JD Sophomores 'Wm-av i fo Sums' 'Qs' ' K , ,XR . J 0 S ' a ,ya . n' L . ' In. , , ' 1 -' I ?'lst .ui 5 n' s ,' . 1 al as ,- Dg. ,s N1 Jai--'- '.. Jamie Conn Larry Cook Shadonna Cook Geoff Cope Renee Cork David Cornwell Richard Crabtree Doug Crenshaw jeff Crigler Yulanda Crocker Andrea Cross Chris Cummings Michelle Curry Mike Curry Terron Darby Mark Darling Matt Davidson Darlene Davis - Matt Decker James Dennis Ashley Depew Kevin Diamond Sergio Diaz Kelly Dickson Charles Dismore Alexandra Doerrer Eric Doggett jennifer Dolgow Krystal Donald Gabe Donofrio Kevin Doolittle Lia Dorion Mindy Dubry Michael Dunmore james Edmonds Otis English Susan Epps Pam Espersen Lisa Eubanks Shauna Eubanks Dawn Everett Audra Ewing jennifer Fell Richard Fennell Stephen Ferguson Chris Fillingim Tim Fillingim Todd Fisher Clan ofI989 105 Laura Flaherty Benny Flournoy Steven Flowers Eric Fountain Leah Fowler Martin Fowler jake Fox Crystal Fraser Sandra Galloway Rob Galvin Timothy Gamble Stephen Gampher john Gander Vanessa Gardner Stephanie Garland David Gaut Sean Gavin Angelia Gay Brett Gerdeman Brenda Gibson Mike Gibson Marybeth Gilbert Alicia Gillman Casey Gilmore Damon Givehand Jeron Glass Lisa Glover Rodney Godwin Kimberly Goggans Cari Goldstein Kim Golson Melissa Goodin Sherri Gordon Latonya Grandison jackie Grant Derrick Green Pamela Grier Lee Carol Griffin jack Grimes LaShann Gross Dung Ha Angelique Hafler Ronnie Hale Erin Halford Kristal Hall Scott Hall Michael Halstead Michael Halstead -s Kevin Hamblin Gayle Hardin Donnie Harper Lee Harris Melba Harris Daniel Hart Wes Haskew Scott Hawk Chris Hawkins Mauri Hawkins Susan Hayden kx v1 Anthony Hayes Renee Hayes Rochelle Hayes Ross Hayes Kristin Haynes Paige Heath 5' D Dickie Heckler if-me PM Chris Heidt jon Hemming Amy Hicks Lucy Ho john Holcombe LeAnn Holifield Sophomores l f h W'1d t .W 0 I 6 1 81 . ' f, ,,,' M iz , 1. 4,9 r ., .., a T . s'sas gt .3 7 fa. . V! Mi, ,i2,?f2Zki56.pw, ' .xg ,Q wffffy ff . . fi V 'f i fzgf' 'V Weird And they were off! Four students ran frantically down the field. Each one represented a different class: Freshmen, sophomores, juniors, and seniors. They were all participating in the spirited and crazy games! In the cracker whistling game, students ran toward their sponsors to stuff as many crackers as would fit into their mouths. Easy? Not when the students had to whistle with their mouths full. Protests came from the teachers as the cracker crumbs fell into their laps. ln the balloon toss each student chose a partner to whom he tossed a water balloon. The object was to keep the balloons from bursting. The most popular game was Dizzy Bat. The object of this game was to hold a bat to your head, and run around while getting dizzy, then get back to the line. The enthusiastic crowd clapped and yelled wildly for their class, and everyone had fun. jennifer Traynom chews the crackers in the Cracker whistling contest as Mrs. Bond holds them. Clan ofI989 107 Victoria Holt Cheryl Hopkins Brent Hoskins Bridgett House Renee Howell Shane Howerton Bill Hoynacki jennifer Hudson Paul Hughes Chris Hunter Robin Irwin Michael lshee Mike Isler Chris Ito Ouida Jarman Aaron Jenkins Meke jenkins Michelle -Iiles Ben johns Clorissiti johnson Duane Johnson Elizabeth johnson Santoria johnson Sedric johnson it I V 5 if l i x ,-'J ophomores SN a Song of Love Oh, no! we groaned as Dr. Harrison, our English teacher, began passing out another paper. Our minds ran wild with the possibilities of its content. Was it another essay to write? Was it that quiz on the literature we were supposed to have read? Sighs of relief rose when we realized that it contained an Alma Mater, an old school song we were reviving to show our new spirit. Everywhere - in the atrium, in other classes, and in the lunchroom -- we could hear one of our friends reciting Washington, We Love Thee to one another for an upcoming test of the Alma Mater. Those tests were worth it for at our first pep rally we all could proudly sing Washington, We Love Thee. Washington fans shouted Number one! after the band performed the Alma Mater during the PHS game. -Julie Korte and Linh Truong 4 Tonya johnson Daniel jones David jones Katrell jones Leslie jones Clifford jordan Kimberlai jordan Veronica jordan Laura Josephs Brian Keigley Adrienne Kelly Colleen Kelly john Kelly Adam Kendig Stacy Kennedy Tina Kerouac Donna Kerr Kristi Key Amy Kicklighter Lara Kiefer Michael Kienzler Adrian King Kristin King Christine Kinsella Angela Kitchens Richard Knutson julie Korte Georgianna Krippes Cyndi Krueger Melissa Kubosh Angela Landers Susannah Lane Cheri Lang Cathy Largue' Michael Leach Felicia Lee Cindy Levi Ellen Lewallen Meredith Lewis jean Lin Leon Linkey Brian Lockwood Dean Louisiana Kenny Louviere Robin Lowe Mike Mabire Troy Mabire Chris Majors Clan ofl989 109 Robin Malden Kristin Marsh joseph Marshall Amy Martin Stacey Martin Trent Martin Vicki Martin jermanze Marvin Danette Massengale Traci Matolay David Matos Anne McBrayer Marilyn McClain Darrell McClammy Rob McConkey Mark McCuiston Danny McDonald jessica McDonald Suzette McGee Ericka McGill Buddy McGraw john Mclntyre Mary McLeod Aimee McMullen Tammie Meador Tim Messier Roger Milhouse Victoria Miller Clarinda Mitchell Dia Mitchell Frances Mitchell john Moates Shon Montgomery Setrina Moorer Maureen Morgan Frank Morreale Susan Morris Michelle Moss Summer Moss Mary Moulton Maureen Murphy Brian Murray julie Nagle Keisha Nelson Colin Nesbitt Andrew Nettles john Newlin Tina Newton 'W ffl ' ',f:rf L vga' flllf.-1r,, 4 '92 ff f' f 5 ff 'l HOT ROCKS at Booker T. Turn that music down! Sound familiar? Wasn't that what your mom said to you every night all through your high school years? That was the only way to study! Did your study habits go anything like this Walls thumping and papers vibrating, only you could study for economics in between verses. With pencils drumming and potato chips crunching to the beat you studied with a friend on the phone. You learned the test material while singing to Rick Dees Count Down But, if anyone walked in you yelled at them for disturbing your concentration. This is a big test. I need to study. Please leave me alone. The only problem was, Rick Dees wasn't the teacher and the test wasn't on the new song by OMD. On special occasions, our favorite songs could be heard as Razohne and his DJ. prepare to put on the hits at a Friday night dance, - Ronda Bond and Stacy Leichner S o p h o m o res Dawn Nolen Adam Nolton Slade Nooney Scott Novota Angie Oberto Shannon O'Brien Mare Oldenburg Jacqui Overbey Wendy Palmertree Marvin Parker Michelle Parker Sharon Parker ,,-4 Stephen Pate jeff Payne Christine Pennington Ashley Perry Lori Phillips Paula Phillips Tina Pimentel Amgie Pope Scott Porter William Posnett David Pote Dawn Potter Clan of1989 111 'H ,R UYE: Shades of Spirit Homecoming week brought anticipation and excitement as each class competed with the others to win the spirit trophy. In front of the glass display of trophies, students eagerly crowded around the table demanding to purchase sunglasses and a class button. The blue or black rimmed shades with a personalized gold paw and the word CATS on one ofthe arms was a new addition to the new attitudel' '... and was it ever in popular demand! All were sold out by Thursday of Homecoming week! Buttons with a blue paw and one of the numbers '87, '88, '89 or '90 were another out of bounds way for each student to show his classspirit. Saraheth, Brent, Shelly, and Alison smile as they prepare to cheer on the Sophomores to victory. - Linh Truong Sophomores H ',L,1 - -425 3 David Powell fi - 5 i Leigh Precise i I ' , 3 LeRoy Pruitt ' Cameron Pyle 4, I ' Scott Ragan 'V jeff Rainer Z 'V Kevin Raines Michael Raines Antonio Rancifer Baret Rasberry Turieshia Rashied Matt Rasmussen Yancey Ream Derek Reid Jonas Rejda Merrir Renfroe Nathaniel Rich Ashley Richard jill Richburg Melissa Rickard Ben Ridlehoover Erika Rivera Karen Robbins Kathryn Roberts I 12 Saphoworer '57 X S ' ff Q wg 'WJ ' r Q.. 3' jeff Robinson Kim Robinson jennifer Rodgerson Vencent Rodriguez Misi Rogers Adrian Roulhac Helen Ruckstuhl Kevin Rudowski Darriss Ruffin Latasha Ruffin Nathan Rutland Kim Salter Chris Sanders Linda Sanders Robin Sanders Stephanie Sanders justin Satterwhite jay Sauls Vince Scapecchi Lana Schmidt Sheri Schmitt janel Scott Shelly Scotto Brian Seaver David Seuzeneau John Shippey Charles Shoemo Dagan Short justin Sidwell Pat Siegle joel Smith Lee Smith Marc Smith Tommy Smith Laurie Snowden Chuck Snyder Garret Southworth Jennifer Stallworth Sean Stallworth Yulonda Stallworth Christa Starr Wendy Stevens Beth Stillwagon Edwin Stokes julie Strickland Stacey Suarez Katie Sweeney Gunnar Tande Clan af1989 113 Eric Tanksley jason Tanner April Tavella Sarabeth Thomas Fred Thornton Phillip Towles Vince Traweek Chris Turner Cynthia A. Turner Meg Turnipseed Tip Tyler Robby Underwood Trey Urquhart Cliff Uzdevenes Anne Vail jason Van Matre Chris Van Surksum Cinnamon Vincent Floyd Walker Mike Wall Kimberly Wallace Kim Ward Karena Warr Alison Warren Gerald Washington Monica Waters Daniel Watters Keith Weathers Doug Weatherspoon Susan Weber Aaron West Whitney Westbrooks Anthony White Chanin White Rachel White Stephanie White Ronnie Whitfield Ethan Whiting Kim Whitley Earl Williams Faith Williams Tammy Williams Tara Williams Tracey Williams Wendy Williams jason Wilson Michael Wilson Michael Wilson ,n Sophomores Shannon Wilson Todd Wilson Dennis Wingate Tommy Winn Jay Wirth Darrell Womack jennifer Wood Sylvia Wood Audrey Woodson Sally Woodyard Dawn Worley Evelyn Worsnop Marybeth Wright Chris Wu Vincent Wynne james Yoder Ericka Young Shannon Young David Zam jailbirds Jump to Jailhouse Rock jailbirclsi so the sheriff can arrest the dude. Did you come to the Halloween carnival? Did you get arrested? Well, many people spent their quarters and dollars to get friends or enemies arrested. The Sophomores charged fifty cents for a five minute jail term and another fifty cents for every five minutes after the first term. Most criminals took their term lightly and found a seat in a corner of the jail, Jay Wirth found his 20 minute stay a little disagreeable. The 86 criminals came out with blackened thumbs from getting prints and questions like, How could you do this to me? No matter what, everyone enjoyed themselves, both jailer and Adrienne Kelly checks to see where her jailbird is located, Clan of1989 115 16 Doing Your Best n THAT TEST! Studying for that history test, Knowing that I'll do my best. Staying up until ll at night, Keeping me awake, was my fright. Sitting there at my desk, Thinking, Why must I take this test? Giving us, Five Minutes to study, Before the test, should I use my buddy? Here it comes, the paper I dread, What color ink? Blue or Red? Where should I start? Maybe with my name, Maybe l'll pass, What am I, Insane? But I really studied, so how can I fail? I studied really hard, so why am I pale? Here I am, with palms all sweaty, Pen in hand, Am I really ready? Students working hard, I'm just sitting here, I am so nervous, can't control my fear. Take a deep breath, everything is all right, If I don't start soon, I'll be here all night. Here I go, starting my big test, I hope I pass, I'll try my best. The only thing I can do, is really try, ' But ifI don't pass, I'm going to cry. On No. 10, this is pretty easy, Hopefully next time, I won't be so queasy. The teacher is looking, with that dumb look, Looking at me, Like I'm some crook. She must think, I am using my buddy, Little does she know, I really did study! I am on No. 30, the last question on the test, I'm not worried anymore, because I did my best. Cindy Page umm., , fh ax' .fl Q Q 0 .df 441' Q ,,-vw! ,uw . 'hr hi,....A!',-L Robyn I-lusted diligently tries to finish her reading test. Some sad, some glad as Coach Humphreys hands out science test papers. Emily Burnett makes an attempt to distinguish the different business cycles, +'4nu....,w f '-A f-s, ., i A ,ff,,,J:3 ...,,,,, ,,f,, , V dag ga,,...f..k,...-di-d bezel,-,dh Mark Myers practices his accounting and booking skills. Anthony White finishes his weekly skerchbook assignments. Will Riehm searches hard for that right answer on his reading test. Clauef 1 I 7 ,,, is oi doe dass xo cas .' e Q. ga e 'xx xo 61 ,Ts Coeasc, Spoo becaw wk, and gow Oiixcexs-. Susan Xlfeooe X1 .12 ies.-,Eked Niwgus, Ss:-I ee SOCS K. Xixosgs . QA Ysxxoq Cams , 00 fr' 4 ' I W f 1 I fga,.. ,g JQVLC., .Q , , LA., -A VT'-. . , ,tml Sharnell Adams Nikki Addison Thomas Aliff Lakita Allen Marnie Allen Chris Anderson jeff Anderson Kevin Anderson Sherry Artman Michael Augustine Scott Baird Alton Baldwin Nahshon Baldwin Tanita Baldwin Shawn Ballard janet Bancroft Ryan Barchett Angelisa Barge Brandon Barge Kimberly Barrett Renee Barwick jennifer Baxley Richard Beal Robert Beasley james Beaulieu Kristin Beeman Megan Benson Nicole Bernard Andrea Berube Megan Bevins Beryl Black Leonard Black Thomas Blackmon Ealithan Blaine Lacotia Blue Web Bond Ivey Booner Scott Boone Allison Bourne Charles Bowman Ellen Boyd Stephen Boyd Kiala Boykin Rhonda Brewton Semonne Brinkley Aaron Brown Erika Brown Heidi Brown Clan 0f1990 119 120 Freflzmen Kerry Brown Steve Brownson Sabrina Brunson Jaquita Brye Paul Bullington Brian Burch Audrey Busbee Terry Busbee jessica Bush Rod Bush Louis Butler Bobby Byrd Daniel Byrd Lanita Byrd Tara Calhoun Fred Callier Angela Calliert james Carlisle Jeffrey Carroll Ricky Carroll Toby Cassiano Monica Chamness Gabriel Chandler Elizabeth Chapman G et Your Feet Wet Surf s up dude, so like, catch a wave! A pair of fashionable jams an Innerlight T shirt, zinc oxide, shades and of course the trusty old surfboard were among the most common items needed for a trip to the beach. So on Malibu Day one of the dress-up themes for Homecoming week, Wildcats used their imagination to carry the surf theme as far as possible. While most students chose the traditional style of shorts, a T-shirt, sunglasses, and a little zinc oxide on their noses a few others took a turn toward the outrageous by opting for blond long haired wigs to symbolize the true California surfer dudes! The day s events brought back memories of lazy summer afternoons spent enjoying Pensacola s beachers. Michelle, john and Bruce are ready to catch a wave' Freshmen ,Jn :df wtf' 'dui Wim? 's,.,,,.y if fo gr! ' l fe f , 5 ,. 4, , f ' in Q Q ' K X 4- Lisa Clarke Cassandra Cohen julie Cohen Ginger Colley Monique Collins Rod Collinsworth Eric Company Dawn Cook Melanie Cooper Jeff Copeland Eddie Costner Chris Countryman jeff Coy Skip Creary Katie Creighton Robin Crowdus Casey Crutcher Kelly Curry Kelly Cushing jon Davies Jesse Davis Mike Davis Shawn Davis Chieu Dang Sherman Daniels Aimee Delevett Brad Delorme Renee Delorme Louis Dessommes Michelle Deuvall Ladonna Dewindt Michelle Dopson Shoni Downs Danielle Dungas Sang Dung Tracy Dumas Stephen Dunmore Joanie Dye Carri Earl Elizabeth Eastwood Bart Edwards jeff Eggen Kevin Eggleton Barry Elder Chris Elliott Joann Elliott Leanclra Ellis Mark Ellis Clan of1990 121 Norman Ellis Celeste Elms Walter Embich Ryan Erbacher Tracey Eswine Karen Fairchild Pat Fairhurst Carol Farrugia Matthew Ferguson James Fields Dianna Fischer jason Fitch Tyrone Flournoy Carlo Floyd joe Flumerfelt Todd Ford Gesse Fournaris Jerald Franklin Angelina Fxanzone Frankie Frasier Lois Freeman Nikki Gadson Kenny Garner Alex Gavin jeffrey Gilbert Avis Gillis Scott Gazebrook Kevin Glenn Andrew Glover Phillip Glover Barry Goggans Raina Goldberg jean Graves Kristina Gray jennifer Greenfield David Grimm Christina Grove Melanie Gulledge Shawn Hacker Billy Hale Fredrick Hall Kathy Hall Shai Hall Stephanie Hamilton Kevin Hamm Ryan Hardin Holley Harielson may Amy Harris Maggie Hartley Teresa Harvell Richard Hawkins Toni Hayes Shawn Heath Jerald Helm Tammie Henderson Naycole Henry 'gg 7 Vanessa Herman Anthony Hidlebaugh Lily Ho Valerie Hoffman Amy Holcombe John Hollie Eric Hollinhead I Kristin Homrighausen Jaime Horan 1 X ' Gina Howard Allison Howell Jamie Hoyt Clifford Huffman Alyssa Hunter Charles lshee Freshmen Some People Really Know spirit by appearing in class in her overalls and pigtails. realized that this week was going to be one big party. How to Celebrate Walking into school on October 6th was just another Monday decked the students. just that was enough to catch us off guard. But when we strolled into first period, the person who normally was our teacher looked like Old McDonald. Even Mrs. jordan showed her five homecoming spirit days. Once second period rolled around, we morning to some of us - then we noticed something different. People were wearing overalls and straw hats. Freckles, pigtails, and plaid shirts Finally, it clicked: Homecoming!! It was Two-Egg day, the first of - Julie Korte and Sarabeth Thomas Clan of 1990 123 Scott Jancy James Jenkins Renee Jenkins Cate Jennings David Jernigan David Johnson Keith Johnson Lacrisia Johnson Sarah Johnson Shenita Johnson Christopher Jones Michelle Jones Raymond Jones Latochia Jones Wendi Jones Marne Jovanovich Kelly Juneau Patrick Keller Heather Kelly Prakab Kern Amy Kennedy Susan Kennedy Suzanne Kennedy Cheryl Kenney !.' 1' 7 S513 51:7 . M. 1142 mc: 'ffl Freshmen The Perfect Recess 42 124 Frexhmen ff' , fy 2' . pf N. .gjx ,W-1:2 i'- 'X a V ii5',L,., -1 Each morning, just as the sun was rising over Wildcat Country, people got out of their cars or off their buses to meet in the Atrium. Some say the Atrium resembles a mall. Well, in a sense it is - it's the meeting place of Washington High. The Atrium served as a place to finish last minute homework, pass notes-and complain about teachers. P.E. teachers used the Atrium as a track for their students when it rained. Freshmen used it as a starting point to find some of their classes. Cheerleaders and the Flag Corps used it to practice in and SGA used it to hold dances. For nine months the Atrium was a passage way for many students. As Kris Gray put it, I like the Atrium - it sure beats the main hall which can get a bit squishy at times! The skylights also attracted us to the Atrium. Whoever said Washington High School doesn't have windows hasn't seen the atrium. These three openings in the ceiling were sometimes the only connection we had with the outside world. The Atrium gave us a small break before we started into our eight hour day again. The few minutes we had there revitalized us to make it through the day . . . hopefully! 4 5 n 'ig X Ol xxwl 0 ms-M' 'tv' 'iv-ff x., ,pe 'af Melissa Key Branclie Kidd Danny Killingsworth Nedrena King Christy Kirk Brian Kleidon Stacy Knock Tina Kowalski Jolynn Krehling Owen Kuder Chasity Kutzer Chad Laird Kim Lamar Nicole Lamarche Alexa Larson Nicole Larson Michelle Law Tara Leidner Cameron Leslie jeneria Lett Asa Lewis Scott Lewis Shawn Lewis Tad Lindsay jenny Loar Andy Locklear jeff Lohmeyer Kirk Love Brek Lovelace Giffney Lovelace Robert Lovelace Molly Lupton Billy Malden Amy Malone Ellery Mangas Cedric Manning Dineen Mansfield Charles Martin Claudia Martin Hope Martin Katie Mashburn Scott Mashburn Andy Matteson Chris Maucher Kevin McArthur Cathy McCarvey Renee McCleary Kelly McCollum Cluff of1990 125 Mike McCollum Heather McConkey Danetta MCC1-ary Heather McDermott April McFarlin Dan McFaul Mike McGee Leah McMillan Todd McNab Amy H. Meadows Amy Meadows Julie Meehan Gaby Melton Mary Melton Jennifer Miller Mike Miller Kenyatta Mims Elizabeth Mitchell Michelle Mitchell Thad Mitchell Lisa Mixon Michelle Monroe Kathleen Moody Contina Moore jennifer Moore Renaldo Moorer Chuck Morgan Lori Moultry Brett Moylan jimmy Mudler Tricia Mudler Greg Munro Shane Murphy Brad Murrell Chris Majiy Heather Nanni Andrea Nelson Heather Nelson jennifer Newth Alphonso Nobles Casey Nobles Teri Nock Wesley Norman Ricky Norris Susan Oreskovich jennifer Orlando Dawn Orth Mort O'Sullivan I ursuit As the morning fog dissipated, a lone figure appeared at a street corner. Wide-eyed, shaking, pacing back and forth - a first day freshman. Minutes ticked away - one by one - until it appeared. Hurdling down the street at a break-neck speed of 39 miles an hour, it seemed as though it would not -- could not - stop. But, with a hiss of air and a loud moan, the bus Ca.k.a. the cheese wagon D came to a halt at the cor- ner. As each of its 62 bright red lights flashed, the horrified rookie passenger boarded the hulking mass of yellow and black steel. Behind him, the doors slammed shut. All was quiet. Only the hum of the engine and the stench of cleaning fluid and gas disturbed the air. As he moved down the aisle, manuevering in out of feet, legs, and book bags, the newcomer could feel the curious stare of the other passengers burning his face. Finally making it through the sea of immobility, the student sat down in a rare vacant seat. He was now a veteran. -jason Carr Freshmen Chad Overman Marvin Palmer Beth Parker i Gavin Parks Jenna Parks Frank Parrish III Frederick Patterson - Yolanda Pea A A Tammie Peagler it Vanetta Peasant f f,,- i i Anthony Perry ,- ff' If Gasper Persio George Pfeiffer . James Pfeiffer 'W' Kostaki Pfeiffer Hoa Pham Alesha Pierce Conrad Pike .fr ' I Holly Pilcher A -we Robert Pitts jacob Plack f james Pokrant ,fn 3 in , Marie Pokrant uf, 2 xx, 2 ' 1 j Amanda Pope iz? f x , , 1 . as -H. ,, ,,,. ,, 45 ,K Clary of 1990 12 7 128 Frexlamen There was an old history teacher who lived in Room 41 1. She Don't Let had so many class characters, she knew they weren't from heaven! They drew on the walls and looked at ole fossils ' and rocks and . made up stories about historical events. On Halloween, they decided to r surprise dear teacher. They'd all dress normal and answer the test! She loved them and hugged them . . . and gave each a big B e smile. I'm glad to see you here on time! o rdinar Cena, jennifer, Kristin, Michelle Contina, Delena T o d d , R i c k y , Prakab, Megan, Natasha, Rich CThe Tall Boyj, Christie, Carol, and Lisa celebrate Halloween with the Wildcats! L , 1:1 . J? are A ,Lew .. Freshmen Phil Porterfield Phillis Porterfield Amy Pore Zannetta Potter Wendee Pou David Powell Robert Prewitt Gina Price Lee Price Loletha Prim Tom Pruett joe Ragan -I 52- rx X PM v. r yt I Terri Raines 0 Kristin Raymond -. H Greg Reed Y Rosalind Reese jf I Q Chance Regina KW K X Robert Reid X itat X a f ity, 'r' 'V I ', Darnell Richardson Donda Ricks Robin Roach Chris Robinson Kaye Robinson 5 Monique Robinson 'N 5 ia T- .A ,, If ' l N. S 5 Q , ,... if Lg. I Y 4 .ll Vw' Q-,. 5' Q! ,ny 'Z 1 'X 49 , 'Q Q s s i Q 1 l 'I X Lx Reginald Robinson Stephen Robinson Tasha Robinson Tabatha Roddenberry Kathy Roseback Katherine Ross Susan Rowland Clyde Rudolph Shurnita Ruffin Chris Runyon Shaharn Rushton Laura Samala julie Sanford Katy Sapio Kelly Sargent Andre Savage Mike Schenning Mike Schukar Kurstin Scott Deidre Sermon Alan Sheaffer Stephanie Shepherd Ken Shipley Anthony Shoemo Terry Shoemore Paul Shuman Allison Sightler Iesha Simms Natasha Sims Cedric Singer Gregory Singleton jeff Singleton Kara Slade Angie Slay Stephanie Slorahn Andrea K. Smith Andrea Smith Andrea Smith Heather Smith Cindy Sockwell Michelle Stallworth Tammy Stallworth Tracie Stallworth Jason Standifer Tamatha Stecz Shawn Steele Katrina Steene Greg Steverson Clan afI99O 129 Denise Stewart Kerry Stichweh David Stillwagon jason Stimis Rafael Streeter Travis Striblin Chris Stromberg Tammie Struggs Dewalt Sullivan Heather Swindell Chitema Taylor Lori Taylor Craig Tedorski Jay Thedford Lapage Thompson Yvonne Thurston Roger Tice Ken Tillman Christie Tomlin Christopher Torres Sandi Trehern Delena Tremper jennifer Troxel Bill Truett Holly Tunnell Deanie Turberville Martin Turner Tony Turner Cena Underwood Chris Vail james Valentine Melodi VanDemark Chris Varnadore Todd Vinson Steven Von Bodungen Taralea Walden Lester Walker Robin Walker james Wallace Amy Walters Pretoria Warren Tracey Warren Christi Warrington Gwen Washington Tara Wasko Brandon Watson Brien Watson Robyn Watson Bryant Watts Arthurene Weatherspoon Andrea Webster jennifer West Beverly Whatley Patrick White Tokie White Kimberly Wiggins Tina Wild Casey Williams jason Williams 3 Quincy Williams Richard Williams Ronald Williams Kathy Williamson Kurt Williamson Amy Wilson Judd Wilson Tommy Wimer Nikki Wingate Chris Winterberry Angela Witherspoon Jeanette Womack jon Worsham Kenay Wright Stephanie Wynn Adrian Yots Tiffany Zuleger Rick Zwermann Freshmen Vital Signs Signs, signs, signs, everywhere you looked - SIGNS! No matter which hall you were in at the time, you could always find a sign. Someone was selling something, a club was welcoming new members, someone was running for office. Legal graffiti! That was what it was - legal graffiti. Had you ever seen such an array of color? You saw them a mile away. But that was the whole idea, to be seen a mile away. Everyone showed their creativity when they painted signs. The Pep Rally signs were outrageous! Everywhere you looked - another sign. Clan of199O 131 W 33:5 TT! we E if W S XFN ' 135 Er' 4 55 N K. wr - Ra -Q 11, s Qi '58 53 N 1 1? 155 lk Q an l 25 E15 KZ us an K2 4' if 2 is as-L ' is 1 ' 'i Qi 4: 1 1 N Ps P4 11:1 si ff Q, 1: 'j kg fix: a: Af fi ff Fi if E Ei 2 fe? Es: E5 gg x 'f' VY ' x 1,1 li., Eg 51 11 'fs :ff Eli A :vi r' Kale if if ?vif Sr- ii? Qi gf: E 'A ff Fig qi' ri wi ,K ,xg YF? fi EE! 35 .R E3 ii! ff? if Eg isfi xv: ' ,Q SQ 'ii A2 wg, fl sw Q x g w D. 223 . 4 sf ' 4, ,, Ffg , -5 I cf-1 iff Q 1, it ?' 11. E313 wb fe.: 3:5 ' 2 9' Q . l - ,iz is H- Us kf V ff. .W 5, i ,. f X gt V f if EL ' fu V 55 gy 1 K-1 5.1: K 2' 2 if fi: Y , Homecommg p Q Q ' argizle X! f, gigs f L if X i v S4 132 Amdeluim E or Fqfsr Plage. 4 Q , '15 1 ni' 'fi ze-1. -1 is Q ,., A A.,. in X f. P ' W r - E-E 43? gg, 9 ' Fi 3? L-if Y if 5: ale .fb as .2 fa: is I5 12 if' :as fp N ' Eu if wi 22 3 -xx 222 Tk 5 W N -- '22 if lv fi ,.: gy f. 315 4' HE 1 ',' 'Q L3 'f , a ' if C 'K' if, eg.: 4. N zu: T M F V . 55 S2 i E41 U, EE' 1 gg, ef-5 f ' , F I T ng. 1 lf - 2 .1 4 27 V31 - ,Lf I ew e-,Q .. X, -'- 5,2 f' J -'Y' L' 192 1 iz: arf if: 3,4 31: z 2. ,X R21 if! 4 1 lx .. 5 - 1 f . , Y I f X Q Q: f 1 i ' ,L.. A 92 add . 5 5? V.-: cf '55 E552 A-5 if' if if 29, Z if 2? if ff' ii? Yi 1: z'? ILL eff 17:2 is ir! h QP Y eg? A 3 1 L 1. ij 3 I-g gi, E. i , V . , v 5 v X oinr 81, , vw, ,wg W '6 I 1 111 1 1515 1 1, 1 111 P rih 1 A, -2 1- if S QD xg I a 151- ave 9 522: Stu Q? 213 . e ru rs e ein ho ores res em .A ' EXE H OU nc rmn nio ui us rsa a ' an Thi - ter i tof OH I 1 P . ' 1 l 1 1 1 1 S 1 d ra .jg ed tj 1 Cl I M en H . gr rn , 4 , xx k If .Q th cl E E 'TK wi' 1 , m th uf 3 P 8fe. 1. 1 5 i in S 1,51 flue ces 6 I 31 C ang soc1 y. 111 1 S 13, j 5, 1 if 13? 1 1 1 45 312 the: ! I 1 1! 1:1 1 i 1 ms. m W e I 1 3 1 rr Th 3 , 1 s . h x P d l fh ff e Q , i n . f 1 d C1 110 115f1d 1 , 'hil 1 11 -1 s, 1 1? L h y 1.4 X f' dx mic l 1 ' h 1 115 . Ac eve' 1?1 W1 'a .1 1 3 121 lg 11 1 9 1113 1331 C KSX 0 5 ii .. 3,11 111 y pmg he f e 6151 11 31 St 1 gand 1 cre ff' t ed h I1 Q or , udy 1 e ' of of i 'Z 151 42 W? 11, El 1 51 I 1 41 11 Y, 5 ki' t? . 1 d O 1? 11 11 X551 ii 251 1 335 111 51 ly 151 I 11 1 1 if e E1 1 I 11:1 1115 11511 -123' 11 5311? '5111 .251 51131 I 31 r keg 3 Ll'Wf1OI1 1 1 fhesfuq Land gf e sc 5 001 s 'red Q11 n U f ' tha U11 Z ts vw '15 req the eig i tera 1 e a ouq me fork arg A1 Nli, 3 b ax , N ach s, a de' hrke assrq omf d 1 ZEZ istr t ' oa sffor tlg cir s en e se i s s to lpig ny lffer i i s fere ce tl d ng - ricu s, e abli reedi rn amd sei -det r s. 1rhe 1 ' che rude? lhh 1t . . the 1 5 , 1 911 11 11 113 1 1 il' 1111 111 I' 13 1 1? 111 111 1,1 '11 . 1 1 5' L 1 119 1 i 1 1 11 1 V1 1 11111 111, 111 1l,, 1 1, 1 1 '- 1 F1 15: if 1 11 1 ' I . -1.1 lg ff E52 1 C gl' s d . gt cl h E1 Ei 11, 11 1 3 1? f l '1 I .1 '55 1115! 1131 111 1 hzke mfor L' C 111 s to N HC 1. an vo b lik ll S111 ii 11:5 411 1131 553 1141 ,amt inv :yu ew gk V., fl.134 4, .Q f f f f f ji, 7 f .v,.- 7 0 ff . ., f 'Z f ,., , ,.,,,. ,. Sy. 4 Y . X f f f f ,L,L -gf , f f , Lf 151 '4-'Z lv ' '.f,, 'Y' Yggfl understand but . . . replges assistant prmcxpal 4 . f M , . rw,-p 1, ,va f .en , Roberts as he discusses the P.E:geacher's schedules with , ' :Q Q jadiepond. Mr. Roberts is in chgrge of curriculum and '- , Q be z '27 4 f ' 5 f ffwi 1 xfiifx' 2, schedules. , , f ' 5 ! K , ' ' f Assistant principal Daniel Ward talks wgh Mr. Robinson 1 ff it and the deans hibout building problems. because of lunch f duty, principaliifgnd deans eat lunch duriifgfifth period. ff X if , Following a victoity over Choctaw, princ1p:i2Sherman - V71 ' ' . ,W .,.,, ,,.,,,, ,. ,,,, ,,,,, This was an exciting year foifglrir. Robinson since no 6536 had broken his record when he was the football Coach. 1 f , .f. V on llll 'iff 'f f f f f 177 f f 'jf x , :Rx YQ' , l -X 5 V, f z, XX' X Y 'R X Tu Q. T.. ,. M1 Ylgx 'xxx if fx X gg, 1-ff , .,,,.QQ?fN X Lg.sNifir:.44,Q .ecsi .-3: - sg..-,:t,-'ge Nix we .X ., 5 ,X el Y-if Wilx, -iii: , X.-fr, Xils, X X X .sfix-reef? , X - wfgfw X X film A M f -1 '12-3112122 1 -tcfvfvr N :e.,.4,,.f, M e,7!,M-0,-,,.-.,,4.4,- 'ug' X . 's x X . as ' , . cliff... , Y f . f W ,fjfiflf X V V,,V-fmf?-'Z V I x .V 'Q' ll 55.3223 51 1 fr. Qi1jQg5figjf'5q3 'WZ 2 A! 41-use Z 1 2 Z 4 5 s W N ,,, W --ff 'VR V J 1 x. ' JVM my Q' A' jg my w X N V? 5 fy iw Q . ,gy V V' 12' - f- 1' if 3 gi S if ' X ff: Aff af 's ' , Af V V eV- NV ' V W? - -16 , S mf 1: -- V, Aw' ,, xr ' i- 9 V' -. A . ' -in N , fl V 1 - 1 -4? , A V ,,,, ,xg A-,nf Lf' ff 5? r JV I , fr ' f' 47 1' K, , 4V A , f ,f 1 X, , , ,d g f? z ' fl' 233' ,fb W W I J 4 , AY f ,fy 1 ,ff V I4 , ff f, W A ' 'fx V , .Z l ,g gQfgiiT1i,,,,,QQ1zfV ,W , A A . A , AV ,,,. V AVA A A VV V - 9 ' -f A0 ,JW ' V' Ai' ,ZW A V 3' V.,-V. AA A ' ,Vsfb V A I JV, 1,0 V A, ' , ' V ' V ' A S. . V .... V :Vw .,., V ' - W , A . - My ' , , , , ..,. , I A A AA ..,, N, ..,... - ,,.: ,,.,, ,VV , V VV f T mornings . an earl wi f y e feveris M974 of rin ' V A , V - f '6 :'L V V V I zesty, c1ous stu ' s - all W the att of ,Aww office. pes of 1OI'1S r great ex ab111 V V - V - - V - - -V ' c Q X V V' r , Pd ln 011 and C, but al wlth 9. elmg 0 u well ' ORC. I . A. A A VV --, , AAA AAAAAAAAAAAAAAAAA AAA, .V ' A - V -V VA A' ..,.,, 1 - V VQA Wei: V, .- A V V ---- ---- ' ' VV V V V ,yd ,,,, WM-.- ,......,. .,.,.,,, A ,,,,, ,AAA WWWH A A1 ' A.VV.fa7?1'f' . ,V V , . ,,,, ,, A -VVV 3 A AA W VA ! A, 1 ,- ! , ' V , Jia? --:IW 5 ,wv 1 -,fy V .-M? bmrf 4.0 ' N .,.,:f'bZ95 , , V ' A ,,,,,, . ,, ,,,, A V T V ' ' A ' V -f '- I ' V VV M- -V'-fff V f 'z::: f V V f A-.- A721-5 H n:- VV A A . ,..,, 1 A. N 1 V A A A ,A A A A A 1 AA ..A, ,, J' ' . V I A .af ' - ..,, .. ,J A ' 'W ' V ' V ' V- ' A ,,A ., ,.. , , , A, AAA,AA A . ,,w.,. ,, A, A , u 'A V I ' ' ' ' AAA,4 wV' M ' 'Vu' ' W ' 'f ' UA ' 1': yW WWW! 4' fd f f! ff ww, ' Q ' - , ' A .12 ,ffl ,A,- , V ' ' J V ,V-F A f' 4, Af ' - , f A, A 4 5 ' ,V,7 5 ' A V A' ' AAAA A A AA ' VVVI- ' AAAAA AAAA : V,,, MA A V 'fiV4.,, W, .,, M , MQ ' A, A ' 4' WW 2 ' V . ' V A V V V -V , , f' V ' . f . ,,: VV ,V A .V-V4 Vf -'VV' -f -,V, - MV V V- VV . .. .uf-f V- ., J V If ! .A I J! 'I V' X ' A. Agwff' f 'W' W A 1 A ,341 I ,V f, ,,. -V V A, - A W M iw V H A A V V V V V V V VVVVV -4- .-1 V .V.V VVV V ,..1Y, ,,.,,,,A , ,- I R, A J ' pl V V if ' - ' , , 4 A I a n-VV -Aw AZ. A ' A Ay. an-Q V A V VVVV VV f ,Q 4. 27, V VV A V VV A V VV V. .,..A , AAAA AAAAA , ,, , ,A A,A,,,A,, V V ,AAA -Q AAAAA A VV ' ,fray V' A A P ' ' L1 V VVV--AVVVVV'VzefafQQngV::g:::g,1, mm - A w V ' ' A, . V 'f f ,V.ff?fii'fJ'i' ,,,. X k AA ,VV 'V'5 ' A uw. A . ,, .fig-.-,Vf ff .gm Qgfzhg, , Faro WEUID U IIUELULE WEE SM? Q Q QW The man with a new idea is a Crank until the idea succeeds. l Mark Twain You have to study a long time to know anything at all. Emil Louis Racine Kay Anderson, A.B.-I Elda Antunez, B.S Rose Arnold, M.Ed Mary Baker, M.B VX Beverly Barbari, B.S.g M.A The very ink with which all history is written is merely fluid prejudice. Mark Twain When we do not get what we like, we must like what we get. Ninon Lenlos Berh Barham, B.S Linda Barker, B.S Dennise Beachem, B.S Ted Bennerr, B.S.g M.S Cynthia Billy, B.A., M.A Bradley Bish, B.A.g M.A jeffrey Bishop, B.S.g M.A Tina Blanchard, B.S Ladelle Blevins, B.A Janis Bond, B.S K Ronnie Bond, B.S. UW S Shirley Bordelon, B.S. Kay Bortone, B.A. james Broughton, B.S., B.S. 7 an , B S Marc Brown, B.A.g . . f 1 J, , fy W ' V, 5: Qyj' ' f l g I 3 4 x Marilyn Brown, B.A., M.A. Leslie Carlin, B.A. Mauldin Carter, B.A.g M.Ed. Elsie Chandler, B.A. Quincy Clements, B.A. 02 1 ' S i 0 1' ' ,amd 1 ULU I-U IDI? IEEQEE , 0.0 Ls! Q47 W7 777 My '5 my x E ' 04V Marlene Cousens, B.A.g M.A. William Coward, B.A.g M.A, Glenda Davis, B.S. ' TQ 5 ,fi VH U1 Mike Davis, B.S. V Robert Devries, B,S. Anita Doggett, B.S., M.Ed. Peggy Doherty, B.S., M.Ed. Nettie Eaton, B.S. Richard Erwin, B.S., M.E. Gil Escalante, B.S., M.Ed. Carolyn Estrup, B.S., M.Ed. Billie Evans, B.S. Donna Evans, B.A. Joyce Evans, B.S., M.Ed. - Mary Gene Fleming, B.S. iw QYXLQ, Georgette Floyd, B.S. Robert Gaines, B.S. Linda Gamble, B.S., M.A.g Ed.S. Gayle Greeley, B.S. William Grinstead, B,S. Walter Gulley, jr., B.S. Richard Hardcastle, B.A.g M.A. Allyn Harris, B.A.g M.S. jean Harrison, Ph.D. Charles Haynes, B.S. Bill Hemming, B.S.g B.S. Jane Hermann, B.S. Kathleen Heubach, B.A.g M.A. Jane Holman, B.A.g M.Ed. Mark Humphreys, B.S. Susan lngebretson, B.A. Easter jackson, B.A., M.Ed. Fran jones, A.B.g M.L.S.g Adv.M. Linda Jordan, B.S. Evelyn Kelker, B.S. Stephen Kuhar, B.A.g B.S. Frank Kyle, B.S.g M.Ed. Claudette Lamy, B.A. Doris Law, B.S. VU 5 'tfli 1 Ora Lee, B.A.g M.A. f' l Faculty 13 7 Winfred Lewis, B.S. Cleveland Malden, B.S., M.Ed. Willy Marshall, B.S., M.S. Glenda Marshman, B.S., M.S. Tawana Martin, B.S. Annette Massicotte, B.S. Karen McAferty, B.S., M.A. Karla McClain, B.A. Sonny McDonald, B.A., M.A. Gloria McLeod, B.A. Lynda Meisen, B.A. Charlie Merrill, B.A., M.A Robert Monzingo, B.S., M.Ed Lamar Moore, B.S Gregory Moore, B.S Karin Moore, B.S., M.S Winnie Moore, B.S., M.Ed Lizzie Moorer, B.S Pat Morres, B.A., M.A.T Teresa Murphy, B.A Jimmie Nichols, B.S fi f flu? Dot Nolen, B.S.g M.A William Norton, B.S., M.E Richard Osborn, Ph.D joseph Peltier, B.S i - Martha Rainey, B.S Ram Ramirez, B.A., M.B.A Alicia Ramnarine, B.A., M.A Cheryl Reeves, B.S.g M.A Ruth Ann Replogle, B.A C David Rigby, B.S Marilyn Rigby, B.S Edna Rivers, B.S., M.A Ray Robidoux, B.A Carla Ross, B.F .A Gayle Rouse, B.S., M.A Catherine Scherling, B.A Nelda Segers, B.S., M.A. Freida Seitz, B.S. Lisa Jo Shaw, B.A. t. 'iii I is X. f' X Z- fl Y, N I - -Egfr?-fa Mamie Shelby, B.S.g M.S.4 1 Elaine shores, B.S. 'if r se I if 1 Qi JQK fl Norma Simmons, B.S. .X Edward Simpkins, B.S. Vivian Soencer, B.A. , 0.5. janney Sue, BlS. ly I 1 j' m Barbara Tanner, B.A.g M.A. Elaine W. Thomas, B.S.g M.Ed. Fil Emmett Thompson, B.S. w Donald Tipton, B.A.g M.A. Sylvia Todd, B.S. Sarah Tyler, B.A.g M.Ed. 11QffCfl'lj YT' Dale Van Slyke, B.S. Cherlyn Wadkins, B.S.g M.A. Janice Warmack, B.S.g M.S. Hazel White, B.S. Canel Williams, B S 5 M A Claudia Williams, B.S. Connie Williams, B.A. Steve Williams, B.S. wg Marty Yarling, B.S. Kim Yonker, B.S. if 'UID UIELUIEEUU IH IEQIHU 'UUZYUIEIE I bane never been tbe academic sort, for I never was able to get out of tbe babit of writing fast. Louis de Rouvroy Notbing is more precious tban time, hr time is tbe price of eternity. y Louis Bourdaloue Tbinking is bard work. You can't simultaneously carry burdens and bare ideas. Ayred Capus Make it a point to do sometbing every day tbat you don't want to do. Tbis is tbe golden rule for acquiring tbe babit of doing your duty witbout pain. Mark Twain 140 Englirb QQ, 5 Q fl 1 ll Yr ll llllllm Where is my Roll Book? Mrs. Moores wonders as she inspects her cubby hole in the English lounge. I must get my copy ofBilly Budd, said Mrs. Kelker. Her neatness helps the day go by without causing problems, if l I K. 1 . , ,,,, - fw,.,,.. F71 r 4 a t LL, g . , , , A . f . 1 V- ., MW- ,V i Ca...,........4.... . H ' -f'-1 Q an Tffi w -fvl . ,. , , - ..,, 11 --i1::t: ' ' 2 ', ,Q 4 ss's' 4 'e'l 'T t i if slf'l 1 21 I f. ,V X 1 1 X ,Q , Q 4 3 E if mr 'Q' 1 9 IV , v A: 7, . 6 .R ,, f ' .von ,J 5 1 f 1 K 1 mms., ' f if , A 4 Aww Vu a f 1 4. 4 4 -.. - .1 f g D... 1 'Q -.., 1, Q ff-L .-1.----... , ,. .f ,,gr- .-.Qi f f 'f 4., 5 H. X r 1 , ZQ fx, if rr , Wa, ' 4' -M 7 K ,J e 1 .1 C 44,4 N' K A V!! 4 X WW f f ' Yuma '- gag I ,f x,,,, , f The confusing George McKenna Story becomes understandable to Torey Wright and Christopher Wfinterberry when Mrs. Nolen explains the plot. Mrs. Kelker shows Baron Morris an example of what the week's writing af ment will look like. Bi i , . For his project in Mrs, jackson's class, Alan Eubanks gives a presentation on The Hobbit. V1-9 4 arg. J aaa.. I' 1' ' v J' sf .K .A 9 Tiff! e ai. 3' '- at x , . 1 if , , Ex SCX' ri, 1R33 . gfq - .. 'A iii 't 'rffk f K f:,g:--we Sharing a arueof of icfead rie encounferri Every man who knows how to read has it in his power to magnify himself, to multiply the ways in which he exists, to make his life full, significant and interesting. ALDOUS I-IUXLEY For four l - o - n - g years of their lives, students suffered through an intense program designed to eliminate all faults in their usage of the English language. The teachers involved brought an end to limited vocabularies, substandard English, and a lack of interest in literature. The many hours of work consisted of practice designed to help students utilize the language without dangling comparisons, sentence fragments, split infinitives, double negatives, run-on sentences. Vocabulary, literature, and writing assignments became a daily regimen. prepares his vocabulary lesson for his classes. During his planning period, Mr. Blevins Then there was reading. The freshmen read Great Expeetationr and Romeo and juliet. Sophomores pored over A Separate Peace, Lord of the Flier, To Kill a Moehinghird, and juliuf Caerar. Juniors spent many nights burning the midnight oil while scanning the pages of The Crueihle, Huckleberry Finn, and The Starlet Let- ter. The seniors busied themselves with Maelieth, The Canterbury Talef, 1984, and Hamlet. When the smoke cleared, the students reaped the benefits of being well-read, having a large vocabulary to draw upon, and speaking correctly. - Terry Baker Englirh 14 I've found a good thought-provoking question, exclaimed Karin Moore as she completes her quest for the perfect essay question for A.P. European History. ,rs ac' ll 1 Q '.'l A p c,':A Al Q - rf? . , 'HZ I , ,X ii Hr I n 'I 'I 'Q X l ' ' 3 '? ix? nfl! iq- r X XV , , ., 1 ,i c, N n ff: tgp v f mmm, ik N-s--fn ,Z . , f , f .,,, . N.,,, ,M wry, ' ' . ,.sW,,,,, inns ,l fn X T 'i 1 - 1 'QS' F x.x ff I - Tim Broughton and Damon Givehand discuss how to arrange While some teachers worked hard on Halloween Friday, Elaine Thomas the facts for their report poster on early China. It's got to be Leslie Carlin entertained their students with squeals and laughter. correct and visually interesting to get an A! remarked Debbie , , , 1 Cl! if .i f ,Lil T . ptpff V-fvifvf ' f ,g Offh, v V I, ' 'X fr U' fyyyfhrx '7fN,L?af.L if ,- f .ly f Jxffvd 'f wL4'- . ' l A . H' ' ,3 fl -4.3 LEA f, 71 V , f y., ,T fn' , A M , , 5, ig! ,fy-J ,f- -ff, V ,f.c1 fw Q CA Yi Z., !,rfff'f1,f4ffg - he I7 ' ff ,f,f'1fu',l Wfvf f?Lfi,!Q-f- frlfgg L J , 4 f L V' , df- ,' ' ff!-4, . ,. . . 'W' ' Q l' , g ,f 44 142 .S'afmlS1ud1e.r ,ffl 'filly ',f,Q5Lfi,:., ffyff L2y up the prices . . . or loss, prices into the computer. , ,... - fmw- . ' -i..,,,, si, ,,,,.,, , Hi I -'1 Kim Robinson looks up possible stocks, hoping to make money, while her partner Duane johnson waits to add Keep your items in order, shouts Listen carefully and record the facts, began Coach Erwin as he helps Steve Lester Teresa Murphy as she read the story of Siddhar- and Frank Morreale enter correct stock tha Gautama fthe BuddhaJ to her 6th period class. 1404 7' earning .fddouf peopk in ' UC Dead as bones, dry as dust. These six short words do not describe all classes. In the hands of creative, interested teachers, history classes developed into a stimulating, enjoyable, and rewarding experience. Applied Economics used the computer to learn macroeconomics. junior Achievement sponsored the program for field- testing, remarked Coach Erwin. Classes par- ticipated in mock trials, painted murals, developed timelines for historic relationships, presented panel discussions of social changes, and learned gamef puzzle quiz ideas for devel- LWLQ oping review skills. Our goal, said Chair-man Karin Moore, was to promote an interrelationship among our courses so all graduates will understand global relations. Some things go together like Dagwood and Blondie, pork and beans, and bow and arrow. History is full of such affinities or pairs. Our teachers and their concern for teaching social studies provided vital learning experiences and in- sights. The only modifications, remarked Karin Moore, would be to have Mike Davis teaching history like the rest of the teachers and a muffler for Dick Erwin's vocal cords! zgfjgn A' DA iff' ' 0 ' If ,X,,,,f7xZ?g,,V,,4, vqjl-ff-f , V AJ! 5'ociaIStud1eJ 143 'Ai :ii 236131775 vfffg fenqiiel-Y-, mfs. , a . A nm Rene Young, Angels Millendar, Tavara Richard, and Aquelyn Chow check for a chemical reaction during their flame test experiment. I 'VID . -. 1 i Q ,- I 9 If 1 144 Srienre ' S-.A7'l', Qi Mrsiib Mrs. Estrup demonstrates the proper way to mix a homogeneous solution. es, at 1- I Ms. Beacharn explains the theory of relativity, as it applies to human ag to Patrick White. , Allen Mathais conducts his experiment con- ceming the various uses of the pulley as Mr. Moore looks on to supervise. 2, During science dass, Lishelle Lewis and Mike Vonbonunger see the difference in the telescopes located in the teacher's workroom. 3 1 hs.-f 'QSFQMK llffjlzaf ifli cc! adouf. cienfikc nofafionfi Picking up a small test tube full of an ac- tive chemical, the future scientist poured the chemical into a 100-ml beaker filled with a swirling liquid. The contents released a foul-smelling gas into the air. Then he reach- ed for another test tube with a bubbling compound in it. He slowly picked it up and carried it over to the table where his active solution lay. The student carefully poured the compound into the solution. BOOMPH!! The mixture of chemicals blew up into the air above his desk. Aaaargh! The student yelled as his failed experiment land- ed on his desk. Luckily for him, he had adhered to the safety rules closely by wearing his safety goggles and protective apron. Chemicals, alkali earth elements, moon phases, and zones of the earth's atmosphere were all part of the science classes. Students had a wide variety of curiosities to explore, but they all had one thing in common: labs. Earth Science, Biology, Chemistry, and Physicis classes all had labs to complete. The most eagerly awaited labs were the dissec- tion. Students had to dissect frogs, worms, crayfish, and cats. No matter what the pro- blems, the science courses helped students utilize their minds to solve it. Science 145 146 Mutb ti I hr 114' ' l th' F.. 2-.f 'rx T XX X XA XX l- - Brian McElhiney and Diane Perry get advice and a bit of humor from Mrs. Wfilliams. J in Zia: I 4 f ., J Q wg, 'iv-.V 1 - 'G ' 1 fi- 4 ,izwff 55? , 1 V ff .Q 9 X 5 and 401 ,fw,a,.1'3gQ4 ..-.QL ag, '33 M- ft Mrs. Martin checks Allison Slightler's homework and helps her with a difficult problem. ew L'-A 74 -L , , 'f Y Z 7 . , . , Q 1.4 ,tt , Q rf? fii' pt it J? 137' I Mrs. johnson explains to Keith jenkins the procedure for factoring equation. N S Q Calculus. if s . f .- ,f,fff,f4,.f,':v,,.,.,s,, r Brad Duncan, Bonnie Winn, and john Hamilton listen attentively to Mrs. r Rivers', Mom's, explanation of the 11 steps of derivative and integration in Mrs. Arnold shows her Algebra I class how to combine like rerms. S if f 29 214:-, : . -gf,,.w I zi ' ' ' 5' U .af ' ,5 - Q? -4- ,f ' I if 1 ff ,M fi .f, , .f MQW, 4 A 'ff f f ' 41 ,-f47L7f f i15', ff' ' -f i vf sf , - - .1 ,gg M3 i A' f -s f i' A V. f ur , L-.2.j2gf'fQ ,g1-ff . V , ,iff fi i.,f:f1 f,,.x:ig,4y , ,,f , ,. .4 1 ff ., v , , ., ' M ' A i i Wi . Z-wg, 1' , 7 '! K vi f L HIV. .,,.... ,,re ,,,4 y H gi' '-Lfijfiif? if aZ+'i? 4 I ff f 'f diff . I rx ff N-' 4' ' . ff ,f -iijf ' ' 1 f 'f . , . 4,-4 fail: 1121-' yi sw Adds up emfan ing ounfs Known to her students as the ever-so- sweet-but-stern mom, Edna Rivers epitomized achievement in the field of mathematics. A veteran of 36 years, she blossomed into a cheerful, caring teacher who strived to stress the importance of math among her students, In teaching Trigonometry, Analytic Geometry, and Calculus, she developed a straightforward approach for introducing the varyingly dif- ficult concepts of math, She dives right into the subject and begins to work and explain different problems. In such a way, Mrs. Rivers hoped to teach the students to understand, instead of memorizing. It has been my greatest obstacle in teaching math. Ever since her high school years, Edna Rivers knew teaching math would be her future. It was my first choice, because I like it the most. Virtually everything one does contains some applications of mathematics. In assessing her many joys of teaching students, the greatest of all is to hear from former students and of their successes. It lets me know I taught someone correctly. The rapport Mrs. Rivers developed with her children is a special one, for she possessed a sensitive and honest' quality, allowing the students to feel her aura -of com- fort and understanding. Though she plans to retire in the next few years, those 36+ previous years of teaching math have shed some light for all those who have seen that sympathetic smile of Edna Rivers. - Chris Stegner Mails 147 QQ? French club member, Kelly McClure makes a comparison f contrast between the author and the main character of Caicber in tbe Rye. ..,-.v.,. - Senor Golovko, Tracie Lester, and Stephen Mitchell defend the Russian Clubs end of the court in the club week volleyball competition. m if QM, I i i' 'x.s,,,f Senor Golovko enjoys the pep rally held before a Wildcat thrashing Woodham Titans. Z 1 Q K2 72 S 2 fi 5 i ak., 3-in . . . I -..f ! '-X 'I' -Qkmfw-0-mf...-W l ed by a preposition. X ff as yy ix ffffdf peaking wiflz a erence anguage corri ora Spanish Bingo? German jeopardy? . . . No, those weren't famous game shows in foreign countries. They were games foreign language students played to test the skills they had learned. The learning wasn't always fun and games, though. Students labored to master vocabulary, verb conjugation, word order, and verb tenses. Students also learned about the cultures of foreign lands. Many of the students had a chance to get a close-up look at the lives of foreigners either by par- tipating in the student exchange program or by actually meeting Susanne Lennerthson and Carsten Thuma, the students who traveled to our country to learn about the United States. Literature had an important place in the foreign language department as a visible record of culture. Students in the third and fourth year courses read literary classics such as Little Red Riding Hood, writ- ten by the Brothers Grimm from Germany. Mr. Robidoux desperately tries to convince Margaret Shippey, Ashley Weaver, and Erin Elise Lovelace that a sentence cannot be end- Sebelius raise funds for the German club at the Halloween Carnival. - 5 Z ' : ,ff . f eff' 1 1-5 5 1 1 1 ,g ogg: 4 5 ali, we Zifzf ii t When the holidays rolled around, the sound of Christmas caroles sung in German, Rus- sian, French, Latin, and Spanish filled the halls. After all the hard work and memorization was over the students received the reward of having a second language to call upon, with which to communicate and express feelings to a wider scope of people. - Terry Baker Foreign Language 149 f ft , , 'ff A M. ' 'Q' ' 'f' l: - 'V -' f - 3'f's:z!1!!5m 2 ' W. I 1 F' I 1 9' JZ V, 5:6 ' ' '- 'N. , FV 3' ' 41.1 I 5f?T-1' I f W4 f or My '47 U ' ' , 4 ' w-.., ek 64' 1- ,Q -f S' f' f ' ' 'J .4 ' - A .F 1 1, U 1' ' 5 1 0 ,f ,f !L . 3 '- After being taught how to move text around, the students practice on two paragraphs they typed. - K-J s. QQQEA A ?.p-in--. i A i .Y- -1 I - X LA? 1 ' I vb w iv -at R' Ms. Harris, Ms. Davis, and Ms. McClain prove that teachers get caught up in the spirit of Halloween too. Wil fiyfff' 'J-'ffififf Q-yr? -' .Q flflci ffl I-ff04'1,fI'rt f 4 ' . Halloween carnival. I - R X. gi, ompefifiue e ge 'n 0Cll l g The crisp sound of fingers flying across . calculator keys signified that the students in lMrs. Todd's sixth period accounting class :were on their way to closing out their lledgers. Across the hall, typewriters hummed imechanically as students typed with no abandon in their attempts to improve above their previous timed speeds. 1 The Faculty graveyard serves to create fear in the hearts of unruly students who enter During the two-hour ofhce block, Renee the DECA Haunted House during the Finkley asks Mrs. Gamble how she should file two identical names. info flze fufure Most of the business classes required coor- dination and quick thinking. Other classes, like DCT, taught more than just practical arts. Distributive Cooperative Training CDCTJ prepared students for jobs within school or around Pensacola. It gave them the opportunity to attend school for half a day and then work the rest of the day. As the availability of computer classes in- creased, so did the enrollment. Student after student displayed interest in learning more about data processing, computer math, and computer programming. No matter which area one pursued in the Business Department, hefshe emerged with skills for use in the near future. - R. Smith i Burinerr 15 1 'iv YU-4 -:- --, -- 1 Personal Fitness includes not only calisthenics and running, but also instruction on the human body, given here by Coach Haynes. 1 . - .ny z . ,. .,.. N ' 1: -EL.Q-f-Q1i.fi,'?es,:f ' -.gltilfi-'L.'-,fL1 ,, Q L f . 4 W, ,. if r ia,g1g-,ighvg fi .'4..Ae,.sa-L-'ffl-ww-1--s 1- --ivww 2 'Y ' eeil is if , Coach Evans dissembles the volleyball net in preparation for the upcoming basketball games, 152 Pbwiml Edumrion .V W nf 6271.12 I 45 7, wnzfby, 9 UM, , 4 iff ff v,, H 757- iff? Always on top of things, Coach Nichols calls the News-journal Wildcat football statistics for the week. 0 ,gnu J Mrs. Bond really gets into the Halloween Under the supervision of Coach Haynes, students take advantage of the spirit as she keeps students a safe distance weightroom's facilities - in this case, the from the target, bench press and the leg press. f l I A 1 7 I . 'l 9 your el 50l'L6l! My 0,9 gonclifion Ready EXERCISE!!! As Coach Haynes' booming voice echoe throughout the gym, 45 panting, sweating cream-puffs labored through their jumping jacks. Next, ac- companied by a chorus of moans, came the push-up, sit-ups, and toe- touches. By the end of the semester, Coach Haynes, rigorous program of calisthenics, running, and weight training turned a group of out-of shape whiners into physically fit young men. Play Ball!! With the morning temperature in the 7O's, Coach Lewis' 2nd period Team Sports class took their position on the softball diamond. As Lewis watched and umpired, the two teams battled back and forth, finally finishing in a 9-9 tie. Although some questioned Coach Lewis' eyesight many agreed he had eagle l A 7. 9-Al -- - If 14 if-. .,.l My .L 'V Fa 'W gag eyes. Softball, basketball, football, and volleyball - Team Sports had 'em all. Between Personal Fitness, Individual Sports, and Team Sports, Department Head Janice Bond made sure the cur- riculum offered a variety of sports and activities to keep the students happy and in shape. -Jason Carr M06 Pbyxical Education 153 r J Before taking notes, Brett Gerdeman, Mike Boling, and Ricky Aldridge read reference books dealing ' 'ff' I 54 Library A-ff' with their chosen research subject. Towards the end of the six weeks period, Mrs. Silvers compiles an overdue list using the computer. Having trouble locating her chosen author, Jana Rae Abram asks for Mrs to assist her in locating Poe, 'Z I During second period, Tim Baldwin and Eddie Robinson Crightl helps a friend find Robyn Arnold cancel books that were the resources needed for a major drafting returned to the library first period, project due in two weeks. e a puff of if 'Am' Addons QUIET! The students spent many silent sessions in the library studying, completing research, and reading for pleasure. The teachers made class more exciting for their pupils by making use of the various video equipment offered by the Media Center. Ms. jones shared her ability and love of her work with everyone by knowing exactly where to search for any and all materials needed. Ms. Lee kept a watchful eye on the information stored in the Library's computer. Ms. Silvers stood ready to assist with the lamenating and copying machines as well as helping students replace lost library cards. The student aides contributed to the library's effi- ciency by sorting books, checking incoming and outgoing materials, and replacing books to their original shelves after use. The library featured a few new twists. Among the changes was the complete computerization of the books and the cards. Students checking out books watched with anxiety as a library aide stared into the screen, looking at records of past failure to turn in books. More often than not, the student received a smile, a book, and his card. Science fiction, fantasy, classics, reference, periodicals, microfilm, and miscellaneous books on anything from advertising to zookeeping . . . and much, much more all waited for the students . . . at the library. - T. Baker Library 155 . ff, v Yyvy M 4' 'el l ' ii , -fziwll ...X , .gmflui as W ,A ,hi-' m B A Q5 - Q 156 Home Ef07I07l7ifJ' 4A Fix ff. s Q Gathering food and supplies, Mrs. Yonker class prepares for their breakfast lab. lg -in .., After semester break, Mrs. Borclerlon enters the names and grade levels of her new students. 1' 5 I ff ,t 9 , , During her clothing and textiles class, Deanna White asks Mrs. law to cljxecl just made sleeves. 4 , lb I' ' Wu uf 45' crispy. puffing if a fogeflzer i e ana! fimefi Before the ringing of the tardy bell, the Home Economics department was a dangerous place for innocent bystanders! In one room students rushed to grab a seat at the best sewing machines and get started on the garments they had chosen to make. The Food and Nutrition room buzzed with ac- tivity as everyone put on their aprons and took their positions in the assigned kitchens ready to prepare delicious dishes. Getting started in sewing was easy after securing a sewing machine. All around the room everyone worked hard to meet the three garment requirement before the semester ended. Having spent two or three days preparing for food labs, the students were more than ready to cook and eat! Groups stood around waiting impatiently in their kitchens for other members to get back with the needed supplies. Following the preparation of the food, the groups sat down and tested their During fifth period Food and Nutrition, Frank Murphy tells Sarabeth Thomas, I During one of their off periods, Mrs. Shelby like my eggs over easy and my bacon extra grades test papers while Mrs. Yonker calls the grocery store for supplies. dishes. The expertly planned menus were always a hit! Life Management Skills QLMSD taught students how to take better care of themselves. Guest speakers gave information on various subjects such as cancer, drugs, alcohol, teenage pregnancy, child abuse, and rape. With a wide variety of classes to choose from, students learned how to better manage their lives. 1 Home Efonomiff 157 Row 1: Evelyn Worsnop, Tasha Robinson, Monica Chamness Gesse Fournaris Kristin Beeman Row 2 Mrs. T. Blanchard, Shamell Adams, Heather Hudson, Cinch Gerdeman Trina Gamer jennifer Baxley Alicia Gillman, Sherri Gordong Row 3: Tanya jiles, Caren Jones Aimee Delevett Christine Pennington Lisa Hicks, Wendy Morris, Andrea Smith, Leigh Galloway , , H copy notes for their next test in art f p , ' 'L 31 ra Ella' K 'st nce more wiflz feegng f Demurely Rebecca Stevenson, posing as the Princess of the Royal Court, listens for her David Lacey, Wes Hardy, and Matt cue in the Madrigal Feaste presented by Rasmussen provide background music for '- chorus at the First Presbyterian Church. chorus' singing in the Madrigal Feaste. QI 0l l'lfl6U'lC8 C0lfU'li5 Bellowing through the room, the art teacher's voice yelled out the roll. I-Ie turned to snag a student trying to sneak in late to avoid a trip to the deans for tardies. The stu- dent protested with all kinds of excuses. Students unsuccessfully tried both I just checked in and but the door was locked. The teacher yelled again as two students playfully slugged each other. Finally, everyone got to work. Down the hall, a cacophony of sounds echoed throughout as chorus, band, and or- chestra students warmed up. Hours of hard work and practice, along with some caring help and advice from teachers, Tina Blan- chard, Cecil Clark, and Don Tipton, resulted in marked improvement by their young proteges. As the year progressed, the students gain- ed more experience and talent. They entered music and art contests. The Gulf Coast Arts Festival highlighted the art competitions. Music students entered state competitions to display their talents. But for these students, any awards or congratulations they received were extras, for their greatest reward 'was the knowledge of a job well done. - B. Pike and B. Lee Murirfflrt 159 ff' II I t ' .bw ' I ' - i -' Mr, Rigby discusses with Ronald WiUiams the information that will be on tomorrow's test. 'Qs 'Y-xxx ' 1 .. 55555:'5'E5E5Fi r arm! :::::::E::::f l...:Q---- lIllllllllll Melissa Ngo and Tommy Winn slow down to stop before approaching the parallel parking maneuver. 160 lndzuirial ArlJfDriz1crJ Ed. .I ,.i-,o,,, V mmrwg IW ..,,..,.,,Vf.,. - -A- X l 'M f ' ,, ? l Q35- 'S' Coach McDonald heads out that car down! 4' 5, ' to the driver's ed range for another day of -...in-.. Chris McKean uses a photograph as an ex- Chris Sanders uses the hand drill to begin con ample for drawing a set ofblueprints. struction of his six weeks project. 'Yip-Q Q Sfep - y - sap raiding an cracking TURN THAT RADIO DOWN! Only WCOA and WOWW 107 are allowed. Cut the Wheel. No, to the left . . . TO THE LEFT!! CUT THE WHEEL TO THE LEFT!!! SLOW DOWN! Those harsh words, amplified by Coach Rouse's megaphone, struck fear and dread into the hearts of his students. Mean- while, in the Industrial Arts Wing, the electric whine of a table saw blended with the less im- posing sound of a freshly sharpened drafting pencil moving swifty over a blueprint. , ....g15 Whether it was learning how to drive a car or learning how to properly maintain one, the students enrolled in Driver's Education and any of the Industrial Arts classes learned the value of following a given set of instructions to the letter. , The Driver's Education students spent a long semester perfecting their driving skills and in- creasing their knowledge of the open road. The inexperienced drivers practiced their parallel parking, figure eights, three point turns, and end of the street turns. During classroom time the students did worksheets and watched films dealing with the trials and tribulations of drink- ing and driving, as well as lack of attentiveness to the road and fatigue. The students taking drafting, power mechanics, or woodworking learned to assemble small engines, sketch an apartment building, or even how to build a skimboard for the beach. Industrial Arts and Driver's Ed. provided the skills to make students' lives a little easier and safer. - T. Baker lnduftrial ArtJfDriver.f Ed 161 While Dean Merrill draws up a poster for the While others in the Guidance department are taking their lunch break, Mr. Thompson looks over a student's application for college admission. Aside from answering the phone, Mrs. Mayne's job also requires her to keep up with the attendance of students and to type the absentee list for teacher's records. WI M! Dean's office, the sign on his desk welcomes the customers. ? ,1f gguvv' 162 GuidancefDeanf I see a student, male, approximately 5'l0 , proceeding down the English hall without a pass. Dean Kyle, please find the offender and bring him back alive. The response came back. He's as good as caught, Dean Bennett . . . I've got him. I'll read him his rights from the handbook and I'll bring him in. Dean Kyle, obviously pleased with his work, hummed the chorus of Another One 66 9 f 77 U6 eCU l'Le my QJJOI1. ai y gui ance Bites the Dust to himself. He notched another mark on his Walkie-talkie and con- tinued his patrol. The apprehended student tried to run for the shelter of the guidance office, but a large hand on his shoulder had different ideas. When confusion about their future arose, many students looked to their guidance counselors for direction. The counselors worked throughout the year to help students plan their schedules, arrange for taking tes and make plans for college and a career. Besides enforcing the rules, the Dean's c fice regulated the checking in and out students and controlled the amount of traf in the halls. Together, the deans and the guidar counselors worked to make the transiti from adolescence into adulthood an eas one. - B. Pike and T. Baker X arenfd: Our laarfnerfi in e ucafion ,,,, -15 XA Nw.. , 2 ' 1,w,,,f Faculty Members and Their Kids: Corby Brown, Marilyn Brown, Eric Doggett, Anita Doggett, Kathryn Roberts, Lon Roberts, Mary Creighton, Katherine Creighton, Ruth Ann Replogle, Barbie Replogle, Elizabeth Thomas, Elaine Thomas, Sarabeth Thomas, Andrea Law, Doris Law, Sarah Tyler, Tip Tyler, jason Tanner, Barbara Tanner, Tracy Bond, Ronda Bond,janis Bond, Ronnie Bond, Easterjackson, Ladelle Blevins, Danny Blevins, Rose Arnold, Prince T. Arnold, Lizzie Moorer, Renaldo Moorer, Dawn Nolen, Dot Nolen .14 lzefping paw for flae cwlfinq Sara Don Mary Willie Virginia Regina Neta Acreman Bennet Creighton Gaines Hillburn Howard Hutchinson I 1 t w i J 5 Bobbie john Lori General Juanita Ron Teresa johnson Key Majors Morrisette Parker Philen Silvers Farully 163 Z5 H V 1 f T5 -a xx 3, ,f Q J xg 1 4 1 -N X, gk 53 ,4 Z Z a Difficfer ,A 5, 1? ,, fl . N if 1 7'ilTfTX'3f:7 FTWi'FiX A V NNW was 1 ' em xx ax f X' 1 f ' X X A ix :ww pp ,F , M .za fy if Qfl-i5f',:12i?1txYEfQt A H- I t X X X .. c Q' A , - - ,ff ww , A F Q v i 5, . V f V v X .....,., WW, , Q.. WWWWW W A , J - q , , X M, ,f.w,,W,w.N,::X::,.Ww,1:f:-L fe-in.Qgpgwlizmfwf-zwpfixfl:-fri-s .'.gz1.,.,.Lf:.. 1.,4-,4:.1f1.-.ml.f.1.mZiz.s.- f ,QA . - if j, -,gg , f.ff5X X- X- lx N .. , g ff x .V W Rl .--'-- as ' P if 1 f A X,www,.VWW,Y,..,V .,ww,W-f ' 3 V, - ' ' - 'ff' . , , fx - ' - . -1 !,1f f2 I a A if fi , , ,L-'.1' f Q 5. ' P f' ' .2 , J -7 , , . A X A .., ,X , .. ,, . . , .. . kf' ,- ' 5' f L - - 1 Wwsm ,X ,ww 11ffsgfgtsfl-51-::.1':.'1:'Lf f A Q 9+ M, , ' ug A 1- .LA A , i . 1 - j f-v .4 ' ' 3' t 5 ' ... v , .:. X . . ,.., f 'X'- 1 5' ' 5 4 S r f ' U1 71' , 2, ,, C? ' L1 Z'-J f 51 , ar , '- - vp' ,K -' - ,.. ,jf 5 'T - '- ' . 4-Dv' 711, A 'Ca--'iv--pvivrf , . :- fl' -. 1, ,-,Q M c :v iw:-vXXgf1gff:X 'J' ft ff., xg at Q2 5T,lY'fS. QX T125 E1i5XX5Q XYXQSSW RYXSNXQX X H1 Eff 1 H, U g 7 Q , Q C uces , , . A :ii X is , 5,54 ,vi I' 1.5 ix 5 Q3 ki P., iii iii lfi iii ab' if 51 332 fi' 2. 553 ' ., ,. 5 Z 4 i 4 1 7 A M Z ff W 6 f ,A f f 5 W f 4 4 Q f f f' K M M 7 f, Q M M M 5 W M if 4 4 y fy A 7 W g M W 7 W 2 f Q f Z ? f A 5 M 2? f f W V 4 V Z Q w 4 7 W Playing To Win HS0mething is going to happen at Washington. We may lose some games . . . but we are a sleep- ing giant. We will win.', Words spoken by first season Wildcat Jimmy Nichols. After losing 3 of their first 4 games, the Wildcats were invincible. Losing those games only sparked their determina- tion. The winning began with Woodham's defeat. The New Attitudei' worked against area teams. Nichols set goals to improve each practice and to ensure a district win. His five goals were to im- prove after each practice and gameg to become a team and a familyg to have a winning season, to beat Woodham and Tate, and to win the district championship. The Wildcats made the goals come true, no more dreaming. The new ,Cats had an explosive defense, a sound offense, and a strong kicking game. Senior Greg Golovko kept the opponents starting on the 2, 16, and 8 yard lines by his long punts. Hard- hitting Chris Truitt led the defense as his key tackles led to the turnover of the ball. Guard Dave Brooks pushed the 'Cats closer to the goal line. Chris Tolbert with 852 yards on 160 carries and 13 touchdowns used his speed and multiple talents to push the score higher. Eddie Riley averaging over 5 yards per carry helped to make key plays and to keep the ball and clock ticking. Through the dirt, sweat, anxious moments, and wins and losses, all the players led the ,Cats to the District Competi- tion against Mosley. From the beginning of the game, Mosley was frightened. The eight buses thatjourneyed the two hours drew a sudden hush from the Dolphin crowd as they filled the stands with the color of loud and proud gold. The Cat Attackv sign foreshadowed the victory. ln the first quarter, Ben Howze set up the first and only touchdown of the game. From there on, it was a defensive battle. Chris Tolbert, Chris Truitt, and Corey Moultry kept Mosleyfs run- ning backs and receivers from moving the ball. Philip Hicks sacked the quarterback late in the game on a 3rd down to force a punt. Greg Golovko made a 40 yard field goal to make the score 10-0. The Wildcats fought and clawed the Dolphins all night. As the game ended, victory filled the air. The Wildcats had captured the District Crown! The football players danced and lifted Coach Nichols on their shoulders as the crowd screamed . . . and yelled . . . and screamed with the exuberant joy of victory the first district win in 15 years. - Sarabeth Thomas Eight bus loads of fans intimidate the Celebrating their district win over 3 Mosley crowd. 400 students traveled Mosley, the team waits for Coach T A y .Af ri.. -s -4 112 miles to see the 'Cats win district. Nichols to give his closing remarks. 166 Vanity Football 5-A District Q35 A. 9 Champion The defensive secondary players, Philip Hicks, Mike Jones, Marzett Simpkins, X -. . 1 Corey Moultry, a few of the heroes who shut down the Mosley offensive, watch GX - we-'wwf v H Q i'-- X V X A if 1 5 the 'Cats drive forward. A 2 V i X The loud and proud Cat Pac, who never sat down, cheer on the team as Ben , . an -, f f r 7 Howze sets up a touchdown. 'I Q , X4 2 K .ff e 2 L LI. , . 'f lf 4 Y 1 NM 6 lst down and looking for more yardage, Chris Soft-spoken, but carrying a big stick, Coach Clements's Tolbert, an All-State team member, thrills the fans defense shuts out the Mosley Dolphins. The Panama Ci- with another key play. ty scoreboard tells the story of victory. Sport: 16 7 9 A f ? v Lv - W i Yi' L 75 :5 t. fl if All-State kicker Greg Golovko warms up in pre-game practice. Hank Fillingim, the all important holder, expertly handles another snap. High-leaping Greg Crandison attemps to catch another pass from Ben Howze. The offensive line, Ricky Seely, Craig Worley, Dar- The Ugly - Belly Contest winner, Ricky Seely, rick Warren, and Mark Jefferson, hold Chowtaw's gathers mud, grass, and grit while playing center. Seely tucks his shirt underneath his pads to keep the shirttail from interfering with the snap. defense on a field goal attempt. 168 Vanity Football . iLl ,mic K fs-K' 2 ,Msgs 5, N gitgQ1i.2y f ' K, 2.5, A .I r Vg1w.f5f A - L T' W! if 1 ,Wy . ..r, W 'Y 1, 'vi f .. yi Maybe now some people will believe in some of the things we have been trying to tell them. Tonight, we told our kids to keep on keeping on. Itis going to happen, Coach Nichols told reporters after Miltonis defeat. The 'Cats turned the tables as they ended the year with an 8-3 winning season and the 5-A District Championship. The beginning was rough losing to Pensacola High flater had to forfeilj, Escambia, and Pine Forest. However. these losses molded the 'Cats into a strong defensive team that generated six straight wins including a district win over Mosley, but losing sectional title to Buchholz in Gainesville. The com- eback surprised everyone. Everyone thought it was just another losing year. g'Tonight, they started to believe in themselves. They started to believe that they can win,', Coach Nichols said after the victory over Woodham. The Cat Attack began to gain momentum. Coach Jimmy Nichols was the head coachg Offensive Backfield: Ronnie Bond, Offensive line: Edward Simpkinsg Receivers: Sonny McDonald, Mark Humphriesg Defensive Coordinator: Quincy Clementsg Secondary: Steve Williams, Mike Bennettg Defensive Guards and Linebacks: Charles Haynes. The ,Cats used the power I ffullback and tail back lined up in the I, with a blocking back lining up on either side of the I, depending on the playj and an eight-man defensive front. The big plays made the dif- ference, like the 90 yard kickoff return by Chris Tolbert with 18 seconds left in the halfg the vicious quarterback sacks by Geoffery Brayg the dynamic punting of Greg Golovkog and the key defensive blocks of Hillard Goldsmith. The ,Cats were the Cinderel.law team of the year. Coach Nichols summ- ed up the spirit of his Wildcat team after the Mosley game, H. . . played like they never had a chance of losingf, The ,Cats astonished their fans, the com- munity, and especially Woodham, Tate, and Mosley by cramming victory down their throats. - Sarabeth Thomas What did the team do without CI stadium? They came out the winner. 'Tm so proud of these guys. They've come a long way. Theyive taken a lot of abuse, harrassment, and criticism. But what most people don't realize is that we'1l have 17 of these 22 kids back next year. jimmy Nichols Eddie Riley gains short lst down yardage behind offensive lineman Dave Brooks. Sport! 169 170 Ffmlbrlff 1986 Varsity Football Team 9741221 , ,fears , , . : sa, , .L f f T 4 ,aaa 2 ' sa 'r ' r piifiili' it E , 4 ., G Row l: David Brooks, Chris Truitt, Geoff Bray, Hillard Goldsmith, Mike Cannon, Rick Seely, Head Coachjimmy Nichols, Todd Snowden,-jason VanMetre, Scott Hawk, An- drew Nettles, Philip Hicks, Row 2: Deon Howze, Billy Bob Harris, Arthur Btye, Willie McDonald, David jones, Kevin jackson, David Powell, jo Simmons, Brian Keigley, Craig Worley, john Carmouche, Rahzohn Gross, Row 5: Coach Mark Humphreys, Coach Sonny McDonald, Coach Ronnie Bond, Coach Ed Simpkins, Chris Tolbert, Corey Moultry, Greg Grandison, john Wallace, Doug Mitchell, Mark jefferson, Darah Colley, Frank Murphy, Ben Howze, Raymond Grier, Greg Golovko, Capri Williams, Mike jones, Coach Mike Bennett, Coach Steve Williams, Coach Quincy Clements, Coach Dick Erwin, Coach Charles Haynes, Row 4: Vonshea johnson, Hank Fillingim, Erskine Robinson, Calvin Gillis, Marzette Simpkins, Kevin Clements, Paris Brierly, Tommy Meehan, john Reineke, Cliffjordan, Derek Warren. 1986 J. . Football Team t 7 Row l:Ronnie Hale, Daniel jones, Eric Hicks, Otis English, Rob Heck, Robert Helton, Ronald Reese, Row 2: jonathon Thompson, Benny Flournoi, William Carson, john Holmes, jonathon Thomas, Elijah Hall, Steve Ferguson, Anthony White, Row 3: Coach Nichols, Lewis Ricar, Leon White, john Holcomb, Garrett Southworth, Woody Carter, Roderick Carson, Vincent Rodriquez, Tim Gamble, Row 4: jack Grimes, Daryl Brooks, Robert Showalter, Brian Murray, john Moates, jay Wirth, Roger Millhouse, Randyjohns, Hoke Clark, Todd Edmiston. Cats Hit Harclg Win Big. XY'ildcat pass defenders make sure .in opponents awe-some passing attack stays grounded. ,J -f J. V. Foorboll winning season was the result of hard practice and dedication. The J.V. team knew that all too well. Although the season started off slow due to a forfeited game against Choctaw, the Cats got excited once again and mauled over Escambia plus bar- ing their claws to pull out a last second victory over the P.l-I.S. Tigers. The cats were led both offensively and defensively by many out- standing players who pulled the team together to heat both Woodham and Mosely to finish out their season. Even though the Cats lost to Tate in the County Championship, the junior- Varsity players proved that they had the talent and guts to become part of the new winning tradition. Asjaclc Grimes 14755 puts the hurt on a defensive lineman, Wootiy Carter pivots to hand-off, j. V, Fovlball 171 WHAT A YEAR. jamesjenkins and jay Thedford devastated their opponents at the snap. ur freshmen began the season with inex- perience, but with a great deal of determina- tion. The opening game of the season was an action packed overtime victory over Gulf Breeze 18- 12. After the loss of two tough games the Cats pulled together and posted three consecutive come from behind victories over Woodham 16-14, Milton 7-O, and Tate 24-23. The Baby Cats won the District Championship. They began with much inexperience, but each game developed their skills and gave them great confidence. Coach Dick Erwin with the help of Coach Mark Humphreys and Coach Steve Williams led the 'Cats to their successful year.' Coach Erwin stated that our plays were very basic, but when we needed a big play or during a critical down, our basics were very effective. 3 5 .Q s, . ,..a 4 cfir ,, iii Egg e . . g yV.., ' ' , , A ,.g,,,,,,.J .v,. ,ffl f.-- 4-A rw. Y A. A il, J H by ,F I Q W A. 7, - 5 .ay :V 4 in 1 .N of ww ' 1 'rf' -. if lf n . Y ' gi: ., 1 vs' if i. - ' -f-cn sf ' fl! . C ,r-.i ei 'fi-f'? 9, f JW- if . T t-t1 ...... 5 cc'.iit, 5: fif -cyi . ,..... , ' 1 f, K , V , f i.-, eaifav .ai. . t if A ' 1 i i Coach Erwin Row 1: Brandon Barge, Mike Davis, Robert Lovelace, Chris McGee, Carlos Floyd, Steve Dunmore, Mike Edler, Charles Bowman, Bobby Byrd, Kevin Eggleton, jeff Carroll, Paul Bullington, Luther Smith, Mat Ferguson, Ellery Mangas, Jay Thedfordg'Row 2: Kevin Hamm, Sean Ballard, Ray- mond jones, Sherman Daniels, Scott Boone, Ryan Hardin, Chris Robinson, Wayne Norman, Todd Forcl,5 Cedric Singer, Wes Norman, Robert Beasley, Mike Flumerfelt, Row 3: Bret Moyland, Robert Prewitt, jason Stimis, Mike Shenning, Antonio McNeal, Charles Bowman, Gerald Franklin, Casey Nobles, Daniel Byrd, Phillip Glover, Larry Shoemore, Greg Stevenson, Billy Hale, Barry Gogginsj Fred Hall, Clyde Rudolph, Row 4: Tom Wimer, Gabriel Chandler, Al Baker, Andy Matteson, Tim Baldwin, james Wallace, james Mulder, Greg Munro, james jenkins, Thomas Blackman, Ricky Carroll, Mike McCollum, jeff Coy, james Whaley, Gerald Helm. 2 Frerbrzlan Foolfmll ,-Q- Freshman Bah Cats Surprise thers foofboff y Taking itrict rown Nw The baby cat defense BLOWS through the Titan offensive line in hot pursuit of another tackle. The offensive line holds the Escambia defense for a Wildcat gain. Coach Humphries and quarterback Ricky Car- roll go over the plays in search of another Wildcat touchdown. Sporu 173 Gil i' an .1 qi R EMM ' 1 ll' A ll 14 'Q l , 'y x l ,, Hi i ' fi 'l f 2 Volleyball y ore than just a game . P ayers Attain District unner-up! 'Q we v is: mfr-- -w-. . . l t l A t The Cats celebrate after winning a berth to District Finals. All city volleyball player Earnestine Middleton calls to her teammates to block the ball. Row l: Alicia Gillman,'Ernie Middleton, Kelly Esala, Angela Lasley, jennifer Campbell, Aleitha Smithg Row 2: Shelly Scotto, Catherine Louy, I 74 Volleyball Tiffany West, Bridgett Williams, Michelle Parker. .ij ' .gt X fs, 5 2 M' iwf' qu., r-cts ' Volleyball took more than athletic ability, it took a sharp mind and lots of practice. Varsity and j.V. girls had both the talent and ability. Varsity coach Ms. Rainey stated This team was a very aggressive defensive team. XVhat we lacked in size we made up in speed. And with the help of outstanding players Aleitha Smith, Bridgette Willitims, Earnestine Middleton and jennifer Campbell the ladycats also got a new attitude toward their game. Beginning each game with ag- gressiveness, they intimidated the other teams with their defense and spiked their offense down the opponents throats for victory. After coming off a 5-13 season last year, the ladycats finished the season with 14-12 record and as District Runner-up. junior Varsity kept the spirit going with leadership and strong discipline upheld by returning players. The J.V. girls silently watched and learned from the varsity players, gaining experience in their 5-7 season. x far, 'tl 'lady X if 6 l6.olgf',12.,1 1' A 'QPR 0 :W A .Q it' 4- lil' 54 li of 'J rw 'Swat r Q57 Y' cffve Q '00 6 Coach Rainey af' .7 Mfg 'ij jlwufiafjnfwfjj ,. .E V W tq!fr,,Vp l 3 WU! A iw Mfg ,flfyw ,V Oliiflfiffylb Row 1: Michelle Parker, Angie Oberto, Shannon Burke, Audra Ewing, Katie Mashburn, Gayle Harding Row 2: Cheryl Hopkins, Shadonna Cook, Christi r Warrington, Laura Flugherty, Wendee Pou, Melissa Rickard. All eyes to Aleitha, all city volleyball player, awaiting her set. A hot and tired Kelly Esala prepares to receive the serve, Sport! 175 Cross- Country Staying ne Step at f .. . s X .tg ' 121.43 1 W ' X S 3 Croff-Cozmzrjy Row l: Kim Barrett, julie Sanford, Laura Gill, Trey Urghardt, Darrell McClammy, Everett Spain Ronald Ross Coach I-Iemmin R 2 C h , , gg ow 2 oac Snyder, Mary Moulton, Keri Roberts, Diane Perry, Renee Cork, Pam Ruckstuhl, Heather Hudson, Jacqui Overby, Christian Yots, Scott Whiteman, Ted Rosenau, Tom Bedics, Chuck Snyder, Gene Mitchell, Chance Regina, Kevin Raymond. 4 Running on the Cross-Country team is a lot of fun, but it's also a lot of hard work. The truth hurts - literally. Everyday after school, when everyone else had gone home, the Cross-Country team was doing what they did best - running. Freezing cold, burning hot, pouring rain, no matter, the team ran anywhere from three miles to ten miles every day. Laps and hill climbing were also integral parts of the rigorous training, which only got harder as the season wore on. Countless Saturdays were spent waking up at the crack of dawn to travel to compete against rival teams. The boys, led by Scott Whiteman and Kevin Raymond, proved to be tough com petition throughout the season, which ended with a second place in District arid Regionals. The Lady Cats matched the boys' excellent season stride for stride. Led by Pam Ruckstuhl, Diane Perry, and Renee Cork, the girls came home with a second place in District and first place in Regionals. Overall, the two teams excelled past all others helping them to get state rankings. The boys were ranked l lth and the girls 13th. WS' Coach Snyder, Mary Moulton fmgrj and Coach Hemming. Seniors Gene Mitchell, Laura Gill, Scott Whiteman, and Kevin Raymond. 1a'-' Pam Ruckstuhl and Kim Barrett, leaders of the pack, kick in the after burners and head for the finish line. With the aid of Coach Hemming, julie Sanford stretches her leg muscles in preparation for the upcoming race. During the trip to Regional Competition, Tom Bedics, Chuck Snyder, and Trey Urghardt have a few laughs while devouring a box of Doo-Dads. Trey Urghardt and Tom Bedics cross the finish line following a long and grueling race. ' Sporlf 177 178 Swimming Swimming STFITE CHFIMPS The Mens' Swim Team won the State Championship under the direction of Coach Mike Haas and Coach jim Martin. Pensacola was on the map again in high school sports. An article in the Orlando Sentinel referred to the Pensacola team as the team from nowhere. Coach Haas remarked, This was the biggest feat ever in high school swimming. The sport of swimming on the state level was usually the crown of South Florida teams. Never had a Panhandle team, like Pensacola, ever won the State Title. The Wildcats had a dream to bring the title home to Pensacola. Leaving on an early Friday morning, the young team headed for Orlando ten hours down the road. Arriving for warm-up, the team seemed unsure when seeing the size of the central Florida teams both in number and physical size. The moment of truth began with the opening ceremonies . . . The No Where team from Pen- sacola early fell five and six points behind. A cou- ple of key swims brought the team back in striking distance of the title. The 'Cats knew that everything was super close and that their coaches had them just a little ahead. But, could a mistake have been made in all the excitement? The official stepped to the microphone and said, Ladies and Gentlemen, Second Place goes to Lyman. The of- ficial waits for silence and begins again, The Champions ofthe 4-A Swimming Teams are the Washington Wildcats of Pensacola! Coach Haas remarked, Teamwork was the key to the phenomenal success of Wildcat swimming. We began a tradition, today. -7 l , if . f :Sf ' if Medley swimmers jason Nettles, Daniel Waters, Alan Famigia, and jon Hemming show their State-bound attitudes, ' ife in the Fast Lane la, Robin Moore checks the schedule, yes, he swims again! At the sound of the horn, the girls dive for an expected victory. ,W N s j is i i , , ,. , 5 as , , . A 'ff ' -yr ,.-g ,U V' V .,,,,,,. ,,,, ..,4 L., , i r f -.fL,egfg1J pgyyga, , I 'wigs .32wg:f 7 , .,f if vii 4 1 , ,di ffm, fr 'L - . f ,, ,W ,?' ,- .af.,,'a 1- 1 ' assays 1 vin-' , .is jp' r 1? 1 ag! xjl ,V y ,ur I 3 1 -4 'r 1 fi 1 1 I , ,, 1 1 , .151-f'-f rg'3,w ,gy , ' 4 Q ' gf f, 1- ,MK t , i f Y 4 .im - : 5415, -p-. 5 ., X X , i ,, 'f X , i S Row l: Sara johnson, Andrea Nelsoh, Melissa Ann Elehash, Allison Cobb, Cindy Liu, Kim Koehler, Kristen Raymond, Regina Robertson, Bonnie Winn, Theresa Gardner, Karen Far- rugia, julie Meehan, Michelle Moss, Dawn Cookj julie Strickland, Sylvia Woodsj Row 2: Karen Holiheld, Maureen Morgan, Heather Kelly, Helen Rucksthl, Susan Epps, Allison Dun- can, Beth Stillwagon, Rachel White, Shannon Wilson, Daniel Watters, Chris Barfield, jody Bryson, Bart Edwards, Steve Struck, Lee Smith, jake Fox, Row 3: Coach Mike Haas, David Sapio, Chris Howell, Mike Curry, Trent Martin, jon I-lemming, Chris Nettles, Alan Farrugia, jason Nettles, Chip McDaniel, Will Reihm, Chris Vaili jason Struck, Alan Edmunds, Lance Wright, Mike Campbell, Coachjim Martin, Not Pictured: Robin Moore. Sportr 1 79 1R0 .fm CHAMPIONS FROM HEAD TO TOE 1987 Swimming mo 9f29 9f30 10f7 10f1l 1Of14 10f21 10f25 10f28 11f15 11f21 I7 Relay Invitational Girls' and Boys' Champs Tate Girls' 130 to 36 Boys' 113 to 59 Wfoodham Girls' 86 to 86 Boys' 124 to 50 Pine Forrest Girls' 113 to 54 Boys' 119 to 52 NSPI Orlando Girls' 16th Boys' 6th Catholic Girls' 132 to 26 Boys' 119 to 49 Pensacola Girls' 118 to 50 Boys' 122 to 48 N.W. Fla. Invitational Girls' and Boys' Champs Escambia Girls' 133 to 35 Boys' 130 to 28 Districts Girls' and Boys' Champs State Boys' STATE CHAMPS Girls' 9th -fl vf f l , 1 v Ir f 0 A- C , , ' 'Ig 5' 0 il s.r ' ' Chip McDaniel shows his skill in the backstroke, julie Meehan splashes the way to victory in her race i Swimming 'Win my ,, , fifffffrfwef ,Z-Gif? f V ff ' 9 ' 'f' fi 1 gtg' H if ff f f ' ,,,,,,,, ,,,,,,., WH, A ,,,,,,,.,,....+-f-owfv,,,,v-W-,....-Q-f I wlllllhillllf f 1 Q ,, h,,A,,,,,G, , 1 t , f If r' A: 1 V ,,,, ' W ww, ,cp nw vi, A, f, ' 'V i ,,,,,, J we l gn he 1 i ,U Wm , ,f,,,,,,, , ,,.,f ,f ,. , ff, , .,,. ,,,,,,, ,, ,, ,,,, ,M .,,, , ,,,, , .ff. , ,,f.fW4i?yav5,,L I W f fff'Zf5jZ 0 ff 1 Chris Barfield demonstrates the ease of excelling in the butterfly. Captains Chip McDaniel and Alan Farrugia proudly display the efforts of the entire Swim Team, the District Trophy. Chris Howell executes perfect form hoping the scores will contribute to another diving team victory. Cindy Liu, julie Meeham, and Shannon Wilson grope to gain the slightest edge in the backstroke. it 4? . Sporn 1 81 Home of the 1986 State Champions. It's not just another lockerroom - it's like a sma.ll home for the coaches and players. While the players listen f closely, Coaches Ronnie and Janis Bond review the first half against Choc- taw and make adjustments. iPhoto by News-joumalj One oflbe top scoringplayerx, Sabrina Wallace makes a amove inside for a short jump shot. , ,, .,,- -. 4 ? ff., 2 'L flyygg , Dynamite on the Court. Aleitha Smith, leader of the Full court press ex- plodes with quick, aggressive defense to rattle the opponent's point guards. Versatile and assertive, Robyn Husted drives toward the basket looking to pass the ball to Chris Davis. 182 Girlf Varfify Bdfkffbdff WNW 6 into HISTORY DHZZLING LBDYCHTS THE RECORDS Beat Tate 1 1 1-28 on 2f6f87 to break state record for 100 point games in a season 163. The 11 1 points was also the most scored by a Lady Cat team. Broke the then existing school record for consecutive victories by beating PHS 82-36 at PHS on 2 f7f 87, becoming victory No. 53. Aleitha Smith handed out 17 assists vs. Moss Point, Miss., on 1 f 5 f 87 for a new single game record. Tied the existing state record for consecutive wins on 2 f 24X 87 by beating Fort Walton 58-41 for win No. 58. Broke State Record for consecutive wins at 59 games by beating jacksonville R boult on 2 f 28f 87 by a score of 96-53. Set the State Record for consecutive wins at 60 by beating Seffner Armwood 85-55 on 3 f 5 f 87 at State Final Four. ,si ., 1987 Varsity Members: Coach Ronnie Bond, Ronda Bond, Manager, Shelley Suarez, Chris Davis, Robyn Husted, Sabrina Washington, KaKa Simmons, Theresa Gardner, Manager, Darlene Williams, Managerg Kneeling: Sabrina Wallace, Fran Clausell, Bridgette Williams, Sit- ting: Earnestine Middleton, Tif- fany West, Cassandra Pauldin, Manager, JoAnn McWilliams, Aleltha Smith. 'QSH 1 H170 pl Flflliffgl 'Wilma Er U5 f1xx.n9.A'rs Sport: 18 HL K Of fh8 TOWh STAT E and USB! The Lady Cats traveled the road to fame. With eight returning seniors, their regular season began with a one hundred and one point victory over Pace. They ended their season playing for the 4A State Champion- ships with a season record of 30-0, and a final record of 50-1. The Lady Cats were hot to handle as they defeated opponents and dazzled the crowds. Only Fort Walton gave the 'Cats a scare, but Robyn Husted made two last second free throws to make the score 46-44. From then on, the Lady Cats were untouchable. With 100 point games against four teams, Ronnie Bond's Lady Cats broke the state record for 100 point games at six. They played PHS to break the city's con- secutive wins record with win No. 53. The Lady Cats beat Fort Walton 58-41 to cap- ture the region crown and to tie the record for consecutive wins. The state record of 58 was broken by a smashing defeat of Ribault for sectional title. The next step was State. Amid the roandr of a jeering, bortile Winter Park erowd, the hal-calling rejereef, and their own miftakef, the ftreaking, brilliant! Lady Catf aefepted tloe Jeeondplaee trophy. We can still see them play: Aleitha's pestering defense caused many turnovers and steals, Chris' smooth moves made her look like a ghost flying through the airg Sabrina's grim determination to get the ball in the hoop scored in double figures. Opponents couldn't get past Robyn's denial defense while joAnn's tough defense caused disorder and confusion. Bridgette's powerful moves produced rebounds and points. Shelley's consistency and versatility had a deadly pur- pose, Fran's height got her rebounds while Earnestine's forward motion transformed her into a fast, wild moving guard, and Tiffany's hair streaked her face when she quickly 184 Glrlf Vanity Barketball changed directions. As the twelve Lady Cats played, their fame spread and the crowds grew larger and larger. Coaches Ronnie and Janis Bond gave the entire country a team to talk about: No. 1 in the State of Florida and the defending State Champions and the No. 8th team in the USA. For the fans who loved and cared for them, their memories . . . their games . . . their glory will always remain with us as winners. - Sarabeth and Elaine Thomas Forcing a turnover, Tiffany West looks for a steal. Bridgette Williamrportr low for an inside pass. Sbelley Suarez grabs the rebound over her opponent a freethrow attempt. A713 11 ,J f' 6 fx' 4 A ,waf Nh , -tx I o L4 I W, Christy Palmer fake: to the basket to make a .rbortjump rhot. J. V. GIRLS BASKETBALL A young team began learning the basics. Practice consisted of dribbling, passing, and shooting. Drills became the subject of prac- tice. At the end of each practice the team ran sidelines to get their bodies in shape for hard, long games. Coach Elaine Shores taught offensive plays, butconcentrated on good defense. The beginning of the season was rough with only two returning members. After the first four games, the Baby LadyCats came out undefeated. During the Christmas holidays, the team worked out and practiced defense. Scrimmaging was also a focus of the Christmas practices. The team worked together. Coach Shores outlined their jobs: Robin, bring the ball down the court, Sarabeth, hang tough on defense, KaKa, keep the play moving, Christy, post down low to score points, Stacey, get the ball in quick, Nedrina, play strong on defense. As Coach Shores gave each player a chance to learn, the momentum kept going. The Baby LadyCats were County Champs with a record of l l-2, losing only by a margin of two points to Tate and Escambia. Some of their goals were to score at least 40 points a game, to have less than 18 turnovers, and to have at least 30 re- bounds. Captains for the team were Stacy Suarez and Sarabeth Thomas. Locating the ball, Stacey Suarez get: back down the rourt. 5 2 - Members: Katie Mashburn, Sarabeth Thomas, Cynthia Turner, Robin Sanders, Kerri Earl, Nedrena King, Standing: Yolanda Williams, St: Suarez, Shadonna Cook, Ladonna Dewindt, Shelia Dean, Christy Palmer, Tammie Scruggs, Shantell jones, Wendee Pou, Elizabeth Thor Manager. 186 V. Girff Bafketball rs EXACTLY What n Looks Like . . . ,M R Learnine junior Varrity roarb, Elaine Shores become: angry at the many controversial Nedrena King preparex to take a :bot calls. aper driving by ber Woodbam opponent. Finding an open player imide, Sarabetb Tbomax look: to nzake tbepaxx. Sawanza Simmonx direct: tbejump ball to teammate Robin Sanders. Sportf I 8 7 l987 District Champs Pine Forex! defender: can? .flop Walter Green on hir fast break lay-up. W 1 N N 1 or if I s A 'r P. A D 1 'I 1 o N 5 ee l e f Left to Rnght Coach Maloney Coach Stallworth, Kamarcus johnson, Roger Mxdclleton Ivan Burghard Anthony Coleman james Denms Greg Grandrson joseph A d ews Walter Green Eddle Robmson, Curtis Dawkins, Corey Moultrey, Lester Kxdd Mark jones Larry Shoemore Coach Snmpl-uns Coach Lewxs Not Plctured Ph1l Leavine Miracles as They G . wma., , 'W,,,, ffl' ,t,,,.,w0f kv 1155630 .4 :gy , w,..f 5 'Z 9 With hustle, teamwork and a little bit of flash, the 'Cats dazzled their op- ponents. They played with fierce deter- mination and great desire to win. Keenly attuned to each otherg a nod of the head, or a look from their eyes told teammates exactly what to do! Even in the face of defeat, the 'Cats never gave up. They played hard. Picking themselves up and preparing for another game was sometimes hard. The season was one of rebuilding, but Coach Lewis quickly pointed out the ream's immense im- provement, We starred out slow, but the team has come together and we're playing the kind of ball we are capable of. The team's roller coaster season was highlighted in the opener against PHS. Walter Green snatched 19 rebounds and 22 points. Yet perhaps the greatest show of skill took place in a fierce competitive game with Woodham. Earlier the Titans beat the 'Cats in an overtime thriller 67- 64. Now it was our turn. On Woodham's home turf, Mark jones 'smoothly' set the pace with leadership and control to achieve a game-high of 32 points, 9 assists, and 4 steals. Revenge was sweet. When asked What do you like about your team, Coach Lewis? he replied smiling, . . they'll be back next year - to win! - jason Carr and Ron- HII the wav to state! da Bond After receiving a pax: from Markjones, jorepb Andrewsfaker to the bnrketfor an easy two. All eye: await the result asjamer Dennis pump: up over tbe Pine Forest de-knderhr a hoop. Sport! 189 VARSITY BASKETBALL ,Kem .Ci Witb determination etched on bixfare, Greg A reacbexhr tbe .vky and addx two. A: a Pine Forext defender attempt: a blork, Walter and Eddie are ready to spring into the airfbr a rebound. Larry Shoemore taken' the artion away from tbepoint in an attempt to get the lead. 1 tfT'f Wf X f v ' If f F? la , W I ,1 , Q1 If 1 1 If , ,X ml' fxwl il, Xxlb ff' I 90 Vanity Baxketball K was A WIP' TRYING T0 BEAT me CLOCK ii :ff Www ., ,fwfr- ,V 'M , 2 A..,,,,f , Displaying the intense Wildrat defense, Markjanes turns the Vikings away from the basket. joe and Lester watch intently, preparing fir their signal to run tlreplay. F,, 1 1' fi Z I N712 f' ff' , I' nj 7022 iafz,?'..ff5i. . ' I van Burgbard slides tbe ball around tight dej?:nsej91r an assist. Sports 19 A! the beginning of the game, David Forring tbe oulside rbot, the Wildra! jane: ix a ,fecond late in winning the deknse fight: to keep the Titan: jump ball. away from the baxkel. J. V. BOYS BASKETBALL Members: Bobby Dale, Nikki Nixon, Coach Simpkins, Danieljones, Charles Shoemoreg Top Row: Davidjones, Al Pettiway, Cedric-Iohnson, Earl WiUiams. X , , K i 192 V. Boyf Bafketball Keeping an eye on the ball and bix player, Charles Sboemore overplay: tbe inbound pass. Afer the ojficial wbixtle blew, Coarb Simpkinx wonder: wby and how tbefml could be on bix team. G3lhlh2 Gl'0Uhd, Score by Score Hardships filled the j.V. Boy's season. The team lost its two best players to the var- sity squad, cutting their roster down to only six members. Then they lost Coach Simpkins, who found a new job in the public school system. The boys had to learn new positions to compensate for the loss of two players. They also had to establish a rapport with their new leader, Coach Stallworth. The 'Cats overcame their hardships and strife to turn out a winning season. Solid plays from Sedric johnson, Al Petway, and Daniel jones set the standard by which the Cats won. The team awed their opponents with tough D, excellent ball control, ferocity on the boards, and blinding speed, The 'Cats took each twist of fate in stride as they traveled down the road to victory. Before leaving, Coach Simpkins told his Getlirzg the ojfenrive rebound, Nikki Nixon puts the ball back upjor two poiniy. players, Your goal is to play well enough to move up to the varsity and to compete. Remember, the more you play, the better you get. - Terry Baker j. V. Boyf Barketlmll 193 Ricky Carroll pulls up for ajump shot in the lane for an easy two BO Y5 WV , BASKETBALL 5 ya W' 1 l can If 41 Q! N ,7 . E gg i Y w 3 i 'x . 'cg-:J 1 ,,,, i t r 'fiffzi , . M . .. ,TH U' With time running out, Cameron Leslie sees an opening in the lane and drives for the inside shot. ' X A Snatching the rebound, Anthony Shoemore sees a man open down court and the fast break is on! Members: Cameron Leslie, Paul Shuman, Coach Haynes, Daniel McF'aul, Reggie Robinson, David Grimm, Gordon Pike, James Fields, Sean Lewis, Ricky Carroll, Anthony Shoemore, Jerald Helm. Freshman Boys get Basketball Schedule WHS Opponent Dec. 9 Milton J an. 8 Woodham 1 0 Tate 1 7 PineForest 22 Escambia 24 Pensacola 29 Tate Feb. 5 Escambia 7 PineForest 1 0 Milton 1 2 Woodham 14 Pensacola 94 Freflmmn Boyf Basketball VF i 'I 'N fx. 1 , In a close physical match-up, a quick Tate player Coach Haynes outlines the second half game plan disrupts the ,Cats fast breaking offense. while his players observe attentively. Learnina the LONG and HARD way ow's This for Starters? 1 Learning how to play high school ball and a winning season was a great way to begin a career in sports. Play- ing games on a Saturday morning wasn't a good way to draw a crowd, but it was a good way to display the talent on the Freshman basketball team. Coach Haynes guided the boys through hard fought games. Competition was tough, but the teamis hard practice' paid off. The freshmen never stopped trying until the final buzzer went off. A combination of great coaching, quickness, and leaping ability resulted in numerous defensive rebounds which ignited their fast-break offense. The intensity was visible on the faces of the players as they executed their offense. During timeouts the players not only listened attentive- ly to Coach Haynes, but knew that what he said could change the course of the game. The spunky freshmen usually carried out his action plays and added points to the score. Although not many people turned out to cheer them on, the team members, undaunted, played for themselves, the coach, the cheerleaders, and their parents. Sportx 195 Chrirter Einvik and a Guy Breeze defender meet 'head on' while trying to gain control ofthe ball. msrmcr SOCCER Andy Dormoir .rtare.r in dixheliefafter the 'Cats defense letx Choctaw store. CHAMPS Seniors: Greg Walden, james Rough, Glenn I.aFlamme, Brian DoLittle, Matt McKinney, George Lowery, Andy Dormois, Greg Golovko, Coach Golovko, Angel Cole, jeff Hawkins, john Hamilton, Tim Fox, Coach Murray. Sorter I g Q 3,11 1 ri-' J Coach Murray and Coaeh Golovko watch in- Catching Tate of guard, Brent tensely a.: the 'Cats prepare fin' a penalty Horhim' takes fontrol ofthe hall and kick. head: toward the 'Cntr goal. Matt MeKenney': mid-air rave, :ue- cenfully .rtymiex the Dolphin scoring threat. The ROUGHEST Game in Town If T . 1 5 . Q 3 H V ff 33 v , .,,, w av QL . 4 .nal V4 I I . .. J-. is we C ,I ,. X ... .. .Sl i l N 3 A in l . R I 9:39 N tm, ...A-.W ' g it .: 'Ya www-1-wa ' M an 1 S , W .. ..,. N ' ' N v , S -Wg v-nr ll A. Q r Q- 'Kam-ug sung . a .-. ,- - .4 - -EJ N xl! y ...Q vm-f 1 is t Q3 . i Rx ' Nt, I ,, .H--4-g5fff,: , ,. N i ' ' Z i.5,,V.,,.,,, Lzua V, K .-'A' ,,,,A, .V A Z f-1'-rf. ,ag ,' f I .4 . A , g ec., 2 Q .Q.,'j,,,.,iM:v,,f U .., .g 9-if-,f'!?'4f ..,,'.,1 fg ,f 5, .1 e T4f+Q ff tL..L.fmga,.,L,,gj :U A 'gy jizz? ,I 2' .ia ffez-if - -f 5 .3-'ff fa1 'i2,c-..,,,,-4?tf!'f?4'f14 - ff 41- .f , ' ,V I V - 4 , l f H? ' :ff y fgq i .V . 1' ' 'K' ' ' ' ' p iff ,nfl fi 'w V-3' 114' 5 iff?- 4 ,. we it 'aff 2' y fa, . v. I ' . -'af 4 . ,.,.,p4',, ,,,, .-My ,. J ' ,Q . ,.f . ,Q f fag.. ., ,., ,.. ,... 0: 41.2, .1 L. 5, lg ' Aabv-ir-vi Www Mc 'Q ' Fast becoming a popular sport, soccer in- vaded the halls of Washington. Returning eleven seniors the 'Cats dominated their op- ponents, crushing them on all fronts. When asked what made the team so special, Coach Golovko commented, I have a group of boys that live for soccer, not football or baseball, or basketball, but soccer, and I love it! The season began with a big win over PHS and a thrilling 1-0 defeat of Gulf Breeze. The 'Cats then lost to a greatly im- proved Tate squad, 2-1, putting the 'Cats second in the district competition. As the season wore on, the 'Cats faced must-win games against Woodam and Tate. Defeating Tate in a 2-1 thriller, the Wildcats advanced for the district showdown against the Titans, a crosstown rival. As the game with Woodham etwproached, the team suffered a loss of momentum. Key injuries to Kevin Gentzel, jeff Hawkins, and exchange student Christer Einvik took their toll. The 'Cats, however, bount :d back in the last game before Woodham, defeating Fort Walton 2-0. Excitement was in the air as Washington took the field against the Titans on February 12. The night was warm and muggy, but anticipation was crisp. Successfully defend- ing their district title, the 'Cats emerged vic- torious with a 2-0 stomping the Titans. The key to the game was a boy named George Lowery, commented Coach Golovko. Lowery's defense and the offensive efforts of Brian Murray and Greg Golovko led the 'Cats to their third straight district victory. - Bruce Vredenburg and John Hamilton X Sportl I 9 7 Soccer SOCCER ri f A Qt During a break in tbe action, George Lowery listen: .witb intensity to the Senior Andy Dormoi: kick: tbe ball down tbefield to ibe forwards. inrtrurtions of Coaeb Golovko. X - X any , V ar .W Q, l A ' .Tw Fil ,V -Sv-'J .X ei r ,,.,Q.,'i - 1-or ' i 'V , A ,H I ,f ' ,,,...,. , 4,-f if I - or f , I , - f , f' .. W, w. ,, , E , ,I Aj?er paxring tbe ball, Guy Breeze player fouls Greg Golovko. Members: Angel Cole, Sydney Decker, Greg Walden, Scott james Brough, Andy Dormis, john Hamilton, Greg Fisher, Neil Postlewaite, Brian McElhiney, Scott Rezek,jim Golovko, Glen LaFlomme, Brian DoLittle, George Lowry, Balcom, james Long, Scott Porter, Brent Hoskins, Mike Tim Foxhleff Hawkins, Brian Murray. Denton, Todd Edmiston, Matt McKinney, Christer Einvik, g , Wiiglsocceni more x,.. 5 a- 4 A- Grit than ldck inthe , , grass , 5 'T- Members j,V.: Hoa Pham, Frank Morreale, Doug Crenshaw, jason Fitch, Brian Barnett, Chris Stromberg, David Seuzeneau, David Stillwagon, john janey, Sven jacobson, Kevin Glenn, Dang rr -X Sang, james Clark, Mike Gibson, jeff Coy, Sergio Diaz, james Shipley, Chris Hawkins, Chris Coun- tryman, Patrick White, Mike Muldoon. Tommy Winn, playing a great game defenxively, in- tercepts a par: intended jbr a Gub' Breeze center forum rd. While being rbared by a Tate dejiwzder, Brian MrElbiney :burger down tbefiela' inta rmringporition. Sport! VARSITY BASEBALL You're OUT. ' :creams the umpire while james jenlainx .trans the in- field caper making tbe tag at Curt WoUe'r sacrifice fly rurrerrfully bomeplate. advanre: tbe runner to third. ' ' ' 'v-P mr' ' ' :wa 'lu Ai Sitting: Brian Deweese, Scott Lauder, Darrell McClammy, Richard McLeod, Mike Gray, David Urban, Kneeling: Coach Mark Humphries, Tim Slay, Craig Blackmon, Curt Wolfe, David Perry, Brian Hay, Mike Daniels, Vfillie Armstrong, Standing: Coach Mike Bennett, Darrick Warren, Darrel Brooks, Hank Fillingim, Stephen Gamphet, Bob Dracos, Mickey Clinard, Ben Howze, Coach Sonny McDonald. lv Rn rvfvaff 964 Battle ofthe BLUE and GREY . ,f f f, aj 1 1 Z ,A ff? M99 if 'luv' , 54 , ' ,X 'Qfni 'ifiwkvfl , , 'wi ., ,un As the winter months set in and the freezing winds blew, the 'Cats prepared for their season. Beginning in january, the 'Cats broke out their cleats, threw on their hats, and endured long hours of grueling workouts. The season began with the second annual Blue and Grey game. The members split up into the Blues and the Greys. The Battle at first favored the Blue, but the Grey fought hard and the ending score was . . . Blue 1 lg Grey 1 l. Get lively on your feet, boy! yelled Coach Sonny MacDonald at practice. One focus of practice was the infield. Coach MacDonald told the players repeatedly to field the ball and make a strong throw. Catcher Bob Dracos yelled encourage- ment at practice. Coach Mike Bennett On a wild ibrow lo Brian Deweere, Vincent Traweek earily .rlider into .recond basefbr the steal. Pitching lbefirrt-1?w innings, Mike Daniel: burly a fart ball hoping for a strike. was in charge of the batting cages. Pitching machines threw pitches as the players practiced their swings. Coach Mark Humphries watched and coached the pitchers as they perfected the different pitches. The district title eluded the Wildcats for the past few years and this came first on their list of goals. Mike Gray commented, We want to come together as a team, beat Woodham and Tate, and win the district title. Vanity Bareball 201 .I x f 'Q VARSITY BASEBALL T sr, 32, V A pf f'i.-74.9 if 'I ici- 1 ,Je -7: k 1 7 J di? we YE!- c.! ' What's new underneath the lights? Baseball!! Our field chosen by the school board, had lights which enabled all area teams to play under the lights just like the pro's. Along with the lights came the new dugouts and the sprinkler system. Yet the most enjoyable thing for the 'Cats was their new look. The new 'Cats emblem, blue hats with gold and white letters and long pants put the 'Cats heads above the rest and made for an exciting season. Practices were always rigorous, but seeing the boys in action showed that the prac- tices paid off. If one person messes up, Curt Wolfe commented, we all suffer. Being the News journal Tournament champs was a tough image to uphold. Yet, with the bad practices, running in the dark, some losses, and some great games, the 'Cats became a family heading for the district playoffs. With the experience of many returning members plus the expert guidance of Coach Mac, the team is counting on becoming champions. Seniors: Kneeling: Mike Daniels, Brian Hay, Mike Gray, Standing: Tim Slay, Coach Mac :lands proudly on his Hank Filingim, Bob Dracos, Curt Wolfe. newly remodeledfield. I. 4 - N. f ,. 5, 1 iii: L, nh I2 Vamlv Bafelmll EEK! B232 2 23 fp-.iYf?53v'M4 '- -' f' 1tiQQ?1V 5'ifgliixfkffiilsffysF?2fw?lQQ:' 7 WA 5 H ank Filingim pulls zz base bit as Stephen Gampberpreparex to cover home plate. X. 21- t ' 5.1 41 V .f ,-. ,. Put ME in CDACH, rm Reaov 'ro PLAY. V -5-.E-I5-:EL 4: Wanning-up behre practice, Darrel An incoming fast ball force: Mike A j I fig 1-':EjE??i.3f Brook: throw: to his catcber. Daniel: away j9'om tbeplate. 4 il. -,Mqan i .g gwna'+ :,,a L :fi .nil in-lg gf 2.g..,rf E. -- . . ' r SX, , 1 :k GEE xQ? ,rvfQ,Eb3gn, gif X, '52 ,X ,I ' X xxsl , .M -fix' ' X e . ,, - 1 ' X. D' 'fs - . 1 V A fpvxztg , W V 1 vi V' 'Aw , . - -5- :YH fa V + .:.,f :' M' . . , or . ' 33, -m y Q a 1 ff-WFT?-.lgz l f' 5.3w., 'f,'4Xa'. frfww2wfpM,wu WMQWWWWWQM? .K , --pre. ft ' -3. .- MQW ' ., ' 3 'P f f QF 'f:rrT'?Q,zfe-.lf ' ,7',L,,.'i1.f, . ,,' we . , -v-.1 ,. e l- ,. f-'1 9' 1'-, .fi-'I 'I -' . -:ff? 'o 'W' -' wi. . ' .f-.1 x1-f ? ws n f v 'f ..v 4, .X t wat..-'..,g., -,.f-g.:, f4f'x J L 'N no ew . 'Q 'def s:g5,f::z?5j , A Eli 4 4.'15,ffg,,,f,- ' . j ,c f zg q pz 1'1f'w-- 3? 5'rf'- ' f, 1' J' - 1 .ff ' ff? .g - -N-f'.'11fx4, z.c v 1 vf1,wfr,1','G'ff'.'- l . 'f gibflfaif ' . 'fe'- l .1 D ,s:,ffw,,.f:-rfgg-If ' .Eff Q-PT-9.8 . 5 iff 2 vJ'.iffL'f.fgff51f ffl , . + ' 5-L'-.. f dv.: .- ur.. . .- .. ,J .1 ff. .mf fr ff! e fef- .A lf: at . 5f:f'f'ff54'f T? 7' i f 'QQjI'fZQFQ'1jf'f' 'lglff ifif 47 ul viLfi.:?f43' -nivrgr-1 if 1 we-.--Q5 f - rf1,', ' v . A sl K' U ..,,A 3.1.-,Ml-zggti g 51 ' ,jg fjid, fi Ill. if ' '13 --.P-1?-92 W .5 pG'H7:x'ffgfjfY1,. fly!-o , ,. 1. af: 1' ' ' 'Yf'+,f+f5V.' .' A' ' q 3. ' 4' flffL'i?3fElfaf li fi 'A l Q of 3 wH1www:n+'mww0JwW' +.ww '- 'T'u? '1 5 .2 ,gfjq.f,Q1 ,f?rf.f,f ' Na M Q. -1 I , .bib .. 32',1j'ffrff, J, - 'fd Q ' . wlgli tt, . J:,.,1. . 1- 'lA,,'f!.',, . . ,f f, ,, H. .- F92' Xi'j34,'Q5.,'Qfi i , f . 7 -54 M L 'flflfflfffb 1521! all , A lx, '. , 7'- 'e577f ' - X fl Q 7 , , '1ff2.,V.: 9. I if ' If V 'hi' l ,t.,,,n,, , wffjf 'V ,W tv 4402 Q I If ' 1' f' L' fy' ,, f ff , f a,,, 1 f c ' It , . I gk.: , 1 - I - for . a a, . . M: wif. M5,9,,,,r,.', my ,V ,0'7m,+:d1of4 if f f ' t - ' ' , ,, ,. v , nb a.-.14 ' ' ' Jkuijyf, 1, 'ci'feZ' fff 4 , . ' ' ff ' ' ' , , of , -f.+f2'?if f'z..f,,qy,,. ye. J 'I f , ' Alla I Afer a wild tbrow, Daniel Hart trier to recover tbe ball. Attempting to catch the runner, Bob Draco: tbrow: to .recond and tben watcbe: to .ree zfbe wa: succesful. Vanity Bafeball 203 5 4 4 Bafeball BASEBALL Brian Hay quickly round: tbira' base a.r Ben Howze watcbe: the action alfirxt base. Third baxeman Scott Novota quickly snags the ball to keep the runner on second base from stealing a bare. Junior Vorsiry Baseball 1 Y7 , Members: Mike Wilson, Ryan Erbacher, Greg Fields, Kneeling: Brett Moorelancl, Pat Fairhurst, Todd Ford, james jenkins, Vincent Wynne, Standing: Ricky Carroll, Terry Busbee, Vincent Traweek, Daniel Hart, Garrett Southworth, Greg Broxson, Scott Novota, 4- YW 1 K 1 I to that title by giving every school Hlttlne BETWEEN The LINES We're favored to win district and we've got a couple of people who have a good chance at State, said Heather Hoffman about both the men's and women's tennis teams. In 1986 the Sentinnl newspaper called the Wildcat ten- nis team quite simply, a powerhouse. Both teams lived up t TENNIS -3. , r Z 2? 2 -4 . .,. new arrivals organized the toughest line-up in the district. They began early in the season by quite sim- ply blasting their way to victory in their first tournament, leaving the opposition stunned. Through hard practice, teamwork and lots of dedication, the teams were cham- pions last year and are champions again this year, making their Men s Team Kneeling Brian Seaver Mike Eddms Charlie Parker Richard Reid Everett Spaing Standing: Curt Williamson Mike VonBodungen Tyler Lemmon team manager Ross Williamson james Hayden, in the Northwest Florida area a run school proud. - Donna Hayden. for their money. Coach Ramirez put in long hours on and off the court with his players. The eight returning lettermen, including Heather Hoffman and janaRae Abram, who came in as runners-up in their divisions at state, and the Witb a vigorous swing, Mike Eddinx prat-tice: volleying tbe ball over the net, Allyson Yarbrougb watrbe: intently as .vbe .vlamx Ibe ball over tbe net and into a defenxelen' opponent. 206 Tennif R8lSlh2 3 RACQUET all The W3 The tennis seas wJ5 ll year round. Many mek? in- dividual coachegisvi Egfgfed with them and acco them on various out of to inents to compete or starfeijgankings. Throug r.leach in- dividua comes first and QM his own physical and ment agiiaing. But by the first match of the school season, the 17 members pull together and become a team for Coach Rameriz and their school. Last year the girls' team went to state competition in Gainesville. Each victory gained the team a point. Each player played op- ponents who held the same posi- tion as they did. When the playing was over, the 'Cats were short a couple points leaving the state title to a Miami school. The 'Cats were winners though. The No. Three girl Heather Hoffman and the No. Four girl J. R. Abram both won in their finals to become State Cham- pions for their own divisions. - Suzette McGee ,,,,,j,,ff,'.,.,,,,, Il'.v in. ' .rhoutr Mike Von Bodungen, ax hefinirhes practicing a hachhana' xhot. Charlie Parker watches his return ar he knows' that a quirk .rolid return ix sometime: the difference between win- ning and losing. Flying afro.r.r lhe court, R. Abram: slice: the hall through the air. to STATE E , i .a ,7ln, af- ff U ,..,,.. ,, ,, fan, . A rl .,,, -J . I I I 1 ' , If Y if Women's Team: Sitting: Kathy Wfilliamson, Katherine Ross, Allyson Yarbroughg Standing: Suzette McGee,j. R. Abram, Amy Kruczynski, Heather Hoffman. J I TENNIS Since many long hour: are spent in ihe hot run, Rox: Williamson hurriedly return: a volley to end another praciice. Keeping lhe championship title in mind, Heather Ho-Hman hllow: through on a perkrt hackhand. ,l ,i,,. X tfiii V- VVA' ' f,v'Zsli1l'fXhl ' i,'.'. I, l , 1.4.1. L,,f3 if ' Ram Ramirez Tennis Coach M., .gf , We have great potential on both teams, but especial- ly the girls. We'll be playing in the state championship. Sportx 207 SOFTBALL Beating tbe ouq'ielder'.r throw, returning Practzczng be ore tbe reason opener player April Dolgow slide: .safely into Rachel Ruckman and Melusa Pursell second base. work atperkctxng tbezrpztcbzng :tyle ' A, J f 'XX i V . in , X , I ' ' 5' , V, ' 5 A ii l1,' yi ' L 1 1 lil. I 'A A ai ' ' lil 1.-, lr' , -as MQW, A , .Y 'MV' , r vs- ,N ,, .L V-A -, -in 'ifaie' ' 'Vi' . ' M -' ff Matti 123' h ,. ,.., , ,,.., K 4, W. n 66, ,, .. W . A,f. '--3 , ,., . re- 'JY' fr w ,, , 9 L ,.., ,V . X, . .Ns ,.,... A ,-,w,,, . 1 , a. -, A, I , ,Q wx rs -f. Y .Saw MSA... 7-' - v -V N A' A I 4 , uf ,-' , rw 74' 'i-iffif' t ' , . ' .'gTfg2wg'w' 1 1 pee- ' . A'-W'-rs. ' is A3-in ,, , 1 - ., sent. + 1,1 W , . .555 J- fwvwfrf We ' 5,6 - vffg,i,, L fs- W--,.k-11 ff1.,w3+.vf'-fz,1, Q, w ' at-Y ..,,, ,.z.1- V . ' ' -i 3 1- Front Row: Alex Doerrer, Melissa Pursell, Ashley Sherrell, Courtney Bryson, Kit Deason, April Dolgow, Rachel Ruckman, Carrie Earl, Katie Mashburn, Melissa Rickard, Shadonna Cook, Pami Esperseng' 2nd Row: Wendee' Pou, Stacey Suarez, Michelle Godwin, jennifer Campbellg Shelley Suarez, Robyn Husted, Tiffany West, Gwens Washingtoni Santoria johnson, Alicia Gillmang Not Pictured: Heather Moore. W ,. 1 i 'A ,Q wt 1. X l 'V 4 ,Q f,,.,..v,l...s,eL'iE,lhA'- ,gl mf A ,Qin ,,, Q Wa.. F in Mmm Tv PLAYING me BASES T0 WIN l .... N '- - e -' .-.ws..-..-- at--F .1-' - A 'xgle Q . -.rt - N- ' . .. 2' ' ff- - . . ' ..- -s -. . -'1- -. . V - ,....,,. 2 . ' .A- -Y: sv ,, ew - -.,,.f-t 'l H - '.:..:-3:1 -:Cru T, ' - ,- J V 5 A R' . 's , f Ni' - - ' - -- , x g K 4 A .-rg. ' .' r f' 'fl - - '5s.,a.wkwu . -4 4 --,. t .. .+.,.. x' '-- Mali e... .L :, .' , 1 ' Y sl 'gi AF' ' gl 3 l ,. gl if 1 l l 'v I Combining speed, power, and excellent timing, the girls' softball team had all of the qualities needed to dominate their op- ponents. Under the guidance of Coach Martha Rainey and the leadership of Seniors April Dolgow, Shelley Suarez, and Robyn Husted, the team greatly improved as the season progressed. Agility, pitching, batting power, catching with exact timing, and throwing with accuracy were just a few of the many skills mastered during the softball team members, practices everyday after school. The team made the most of their natural athletic ability as they worked to better their game on the field. Although the team lost the season opener to Woodham, their hard practices and self determina- tion made things difficult for the Titans. The 'Cats concentrated of- fense and strong defense made for an intense game with a final score of 9 to 5. Coach Martha Rainey and her softball players have spent long hours managing the concession stand during basketball games to earn money for a chain-length fence around their field. A great problem with the playing area is that the field faces west into the setting sun where only the batter and catcher are free from the glar- ing sun. Looking forward to the re- mainder of their inspiring games, first baseman Kit Deason pro- claimed, This is going to be our best year ever! - jenny Desmond and Missy Kubosh A: part of ber daily workout, Sbadonna Seniors: Shelley Suarez, Robyn Husted, Cook practicerfielding grounderr on the bat- April Dolgow, Coach Martha Rainey. ting tire. junior Courtney Bryson field: the ball at third bare behre getting the runner out at first. Sporu 209 l987 County ,RACK District Champs Cbanging tbe driving range into a track Reggie Victor, and jawn lead tbepacb inpraclicing the 880 run. Semors Row I Arthur Brye Shannon Potter Kevin Rease, Dwayne Scott, Rodney james, Everett Wrlltams Calvxn Gtlhs Row 2 james Ltcharowxcz Gene Mitchell,-Iohn Vlallace, Reggie Walker, Chris Tolbert, john Reinike, -1. Practicing each day, Capri William: work: on good form for tbe 330 burdle. Concentration is the key elemenlforjobn Reinibe as be prepare: to let the discfiy. E H ,fp , , I. p, Q , 4 1 E i 5' .151 .,-v-f?,4,1,, .- f eg- ,, , L 5, , ,ra KICK a llffle BSPHBLT Cat track took on new meaning in 1986 as they won their first District champion- ship, finished second in Regionals, and scored 10 points at state. The team ac- complished this without a track and by prac- ticing on the driving range! The big question was 'Could the Cats keep up the momentum? Coach Erwin, assisted by Coaches Haynes, Hemming, and Bickerstaff, felt that the team could ac- complish any set goal. Track required supreme individual commitment. Reggie Walker was highly recruited in the, 440 and high jump and accepted a scholar- ship to jacksonville. Scott Whiteman was of- fered a scholarship in the mile run. Arthur Brye proved himself to be one of the area's best hurdlers, as did Lawrence Floyd and Mike Goodin. Calvin Gillis and john Wallace were tremendous in the 440. Chris Truitt stood out as the area's best disc thrower with john Reineke close behind. Rodney james steadily improved in the 880 and Robert Moses made an outstanding showing in the long jump. Victor Marsh, Kevin Raymond, Gene Mitchell, Capri Williams, and Chris Tolbert provided that all important depth and leadership. Could the 'Cats repeat? Coach Erwin responded, If they want to win they will win, because they will make the right choices and make the necessary sacrifices a winner must make. WOM I5 Coarh Bond congralulate: ber learn befzre banding ou! awards. TRACK hx-..- Front Row: MaryBeth Wright, Erin Sebelius, Kerryl Roberts, 2nd Row: Dian Perry, Mary Petruska, Joyce Stokes, Sabrina Washington, Clay, 3rd Row: Catherine Louy, Chivonda Lewis, Sarah Warner, Cynthia jones, Tonya Lawrence, jamezetta Horn, Pam Ruckstuhl, Tonya jiles. in 1R5- Aleitba .Simiib xetr herrebf in the block hr a winning 100 m. dasb. gli. 'in Tw ,,,. , .,,, ,,,,p,..,,.,,fY-f,:,,,, ,,,, ', ff, , .f,,y,, ,,, .fn f,,f ,,,, , ff f , ff ,fn I ia..Q,Z,Z2pQQyf7:':::Tg1fgW'j 9f-4.Q3Q4'ygg? fn , Au argl V, 32,3 1,37 H , ' , W X' , vii, 1 ,,.. , ,,,,,,,, ., I ., X 236, g,,,M,Mw, .fa W V ,, V, , L, ,MM V -QW, y -- if, Aff, WM' 375173, f Q f ff' ',,'. f ' ,. ,,,fQ:,.-M' ,Q,,,,,,-wif 1 1 A mm f: m!ff: !c'6l iz, fffff F , , 4, 4, L , wf'f-ffm fiff f-r,3:2'W'rfL4w.z ., ,,,,,, ,,:, ,-if ,f- f. ,fm -1 .' , 2 fr , ' ,eff , ,f.f ,Q.,f .V ,-fu, fm V' , f 0' , 'f' f '- 5 ff Q, y' ,f 1, , V. -I ' , 'e ,V W' , , 4 , , , , , , y , , ,, F, , this as f L - i,nn , Ge , if ' A , F , , f, K 5 , - J Q . 1 2: ,W 7, V 4, . t ,,,. ,....,,,,,,.,av.,. , I , 7' , 'Z an ,, M., k ,, ,, VV ff-ff-WM - wr ' ', iff , 1,-,. f Mfr ' ff ' V. , a f , V L ' W 4 2, fffffyfwfiz Q . , ft 4 ., if we ,f,, :V V , ,, ,1'f?+: ff-Q f ,V , fsyy v 'f lfyjdfff iff- 3 f i , V4 I , 5 , Z ,t I J VV nmfkwf. ,X ff .ymfyfw V- 4 , ,, V f r ,A rf ,. ,, 2 if ,gf , , V1 , 'pw ' , ' V, , , '. My M 4' if ' if 4, -'Q 1 4. Q22 -. .,k.. I ,TV I ,Q , f V ,j g f .Q:'i'l,f','T.'f, Q f 1 ,f ' ' ff, 1 'Q 'V 5 ' 1 'wwf In ' , 4 ,V 3? -4.5 r , it , .-fa, . I f ,, ,ff X, f , f H , .4 2 ., 7 ' , ani' -,' 'Q ' , 1, , , 1 ,gi f , A T , 'ZH' 5 MH ' , My f I 943' - , f , f ' ' f 'Av' x , f az- r -J W...-ww Q a W 'HN Z l L awww 1 vw ' ' fry,-1, ' 'f V V i Q 5 , , ,ai ' ,f .2 1 gf' - , , ' ff 'fi ff 'ff'-,xi ' at fqmr ,, 1 4: pw 5 ,, , - Q ,, , ,aaa --1 up ,.,. S' ,Y A H fy'-, - ff ffrr V ,, t 'gn f, --W V ,WH ' Front Row: JoAnn McWilliams, Shelley Suarez, Bridgette Williams, Fran Clausell, Chris Davis, Aleitha Smith, Sabrinia Wallace, 2nd Row: Earnie Middleton, Tiffany West, KaKa Simmons, Robyn Sanders, Christy Palmer, Sabrina Washington, Lisa Glover, 3rd Row: Nedrena King, Tammy Struggs, Sarabeth Thomas, Coach Bond. 4:- .... FAST AS FLASH, sooo as coco Success is Measured in Practicing bdfId0f-ff, Sarabetb and Lisa :mile tbinking of winning tbei r relay. Earnie glide: over the 330 low hurdle: with grate and agilily. ...-nl. Ladycat track is all about winning. The girls started off shaky but throughout the season they excelled at every meet. Dominating all other schools, the cats racked up all available awards. To win district and Regional as a team, plus a state ranking was quite an accomplishment. 'Tm real pleased with it. Coach Bond said. Coming down here I didn't think we'd do well at all. We didn't come down last year because we didn't think we would be competitive. I think we'll do better next year. To put as little time in it and place in the top six in the state shows you what kind of athletes those girls are. Four ladycats received medals at state. Chris Davis placed fourth in the discus with a throw of 122 feet 7 inches, and sixth in the high jump with a height of 5'4 . Sprinter Aleitha Smith took 4th in 100 meters with a time of 12.5 seconds, and fifth in the 220 dash with a time of 25.78 seconds. All in all the ladycats survived the rigorous practices and sprinted to victory with a dream of being number 1. - Ronda Bond nnuis f-4- 'W4 i' F4 f I Cbri: begin: to warm up befzre throwing tbe disc. Women J Track 2 7 While Chris Truitt spots, Razolm Gross prepares to clean and jerk 225 lbs. Count Winners WEIGHTLIFTING Members: Row l: Coach Williams, Razohn Gross, john Reineke, Roderick Gulley, Gil Hayag, s Tolbert, Chris Truitrg Row 2: Hiro Ueda, Roderick Carson, jonathan Thomas, Alvin johnson, mald Reese, Luther Smith, Bobby Davis, Terry Shoemore, William Carson, Randy Gill, Row 3: Ed Scholz, Robert Heck, Ben Vaughn, David Brandon, Wes Norman, Michael Acton, Wayne Norman, Phillip Hicks. Weifbtlifqing '2 Watrhinghr any possible afridenls, William Carson, Rod Carson and Dewaynejolmson look on as Hero Buda executes a clean andjerk of 220 pounds. Trying to beat bisfirs! IM of3 75 lbs., Ed Srbolzprepares to IW 385 lbs. jizr a personal best. wlsvrwwsmvsvai A ,P Luv 31 zu? 'ga 73. 4 H , l ix E .aw ,W ,awww f. NND TOIV W5 1 ..,,A, qasaixayt ix. 1. K raw tilt Warming upjor thefirrt meet ofthe reason, Chris Tolhert complete: hz: 11 t o 185 lbs. Aj?er eornpleting the .scoring and judging ofthe bench prefs, Chrzr Truztt asks Coach Bennett and Coarh William: when the time ofhi: next scheduled lzrt The weightlrfing room ix tl huh ofmany activities since all the weight division: IM at the same time. Keepina a GRIP onine mae The worst thing in having a county cham- pionship is the stress and strain to keep it! The Weightlifting team worked hard to win its fourth consecutive championship. Along with this goal, their three year undefeated regular season record was on the line. Under the guidance of first year Coach Steve Wihiams, the team's ultimate goal was to better its two consecutive third-place finishes at state. Led by Ed Scholz 12205 and Roderick Gulley 11485 the team competed in four regular season meets, the county championship, and finally the state cham- pionships held in Port Orange, Fla. With contributions from other team members, David Branum 11145, Ben Vaughn 11235, Gil Hayag 11325, Chris Tolbert 11985, and Chris Truitt 1heavyweight5, the iCats opened the season by trouncing the Pine Forest team 51-30. The scorers and judges had a block system in which the observer would clap a set of blocks when each lift began, and then clap the blocks again when the lift was over. If the lift was good, the coach raised a green block, and if the observer coach raised a red block, the lift was not good. The weightlifter had to listen carefully for the 'clapping' of the blocks so he would not begin the lift before the blocks struck. In case of a tie, the lifter that weighed the least and lifted the most pounds would win the event. Weightlifting took endurance, durability, and purpose, or just determination to insure success as a top lifter. 3rd Place State ward In the midst of a picture perfect back- swing, Sean Rourke prepares to send bis next ball straight down the middle. Driving the green of Tiger Poinfs Stl: hole, Grover Robinson nails tbe ball solidly. 'fl' 923' JZ ' 'x: N-.. .' 'i,:,S. F.: ---- I ' -fix ??:'.J-'J - -- -- 1 ' , '-- - ---M.: 1 ,Q-ff s - -r nf' 'Za -pe CQ., ,1- 'J '5T'lfi9Q - 5 - , 5 rf. N V 's - s. -S, V.. Q 'N 'YQ Q .A Ns .QM rom TEE to Shining GREEN With the opening of the golf season came the arrival of a new coach. Coach Quincy Clements took the place of former golf coach Bob Gaines. Coach Gaines was coach for 13 years C1973-19863 and took his teams to three second place District wins, a first place win and three second place wins in city competition. Traveling to and from practice and actual competition add wear and tear to the members. In one year Coach Gaines added 3,500 miles to his car's odometer. As golf team member Paul Goodrum stated, Prac- ticing five days a week gets to be a pain - especially driving all the way out to Tiger Pointg but once you get on the course, you're glad you made the trip. i What was Coach Clements' plan as the new coach? NWell, we'll just see what we've got, look at our strength and weaknesses during practice and gradually work on our goals. A three day qualifying tournament at Tiger Point gave Coach Clements a good idea of the team's potential. Looking at their best two out of three 9 hole golf scores, Coach Clements selected his 1987 team. Returning members Mike Heller, Trey Breault, and Paul Goodrum will hopefully lead the 'Cats to a district win. . ,A A, iw 0111449494 H112 49459 I C021Ch Ronnie Bond Vanity Football So tba!! Mem and Womens Tennif G1 rl! Vclfflty Bdfketbczll Coach Jimmy Nichols Coach attha Rainey Coach Ram Ramirez 61 28 Niceville 7 Jamboree 2x19 Woodham Z! 18 Ft' Walton High 83 34 Vigor 7 PHS 2725 Escambia 2x24 Woodham High 101 44 Pace W 35 Escambia 2726 Pine Forest 2x26 Tate High 61 28 Catholic 0 Milton 37 3 Tate 3X3 Pine Forest High 77 10 Escambia 21 Pine Forest 37 10 Pensacola High 3 7 5 Gulf Breeze High 78 38 Pine Forest 12 Woodham 3713, 14 Klwams Tour. M9 Pensacoia 61 46 Choctaw 14 Tallahassee 3 7 17 Pace Cathoiic 61 3 5 Fort Walton Lincgln 3718 Woodham 3X1 i Mi1tOn High 79 29 Woodham 10 Choctaw 3420 Tate . 37 17 Woodham High 64 41 PHS 10 Panama 7 Rutherford 3 7 24 Cafh011C 3!19 Tate High 46 Fort Walton 7 Tate 2726 E5C3m131a Chocktaw High 100 47 MOSS PO1flt O Di5tfiCf7M05ely 3727 Ciulf Bfeeze i Ft. Wdton High 106 3 1 Woodham 17 Buchholz 3 7 30 P106 Forest 4X2 pei.iSaCo1a 97 3 0 Tate 4X 3 Woodham Catholic 71 60 Quincy Shanks 47 6 PHS 4X6 Chocktaw High gg Egg 2412 ETB 1 477 . Escambia High u reeze . , 102 40 Woodham V47-'Z fy 505567 4714 Catholic 469 Gulf Breeze High 85 40 Pine Forest Coach Alex G9l9vk9 4716 PHCC 1 10 13 Escambia 4721 DISTRICT 79 55 chofiaw THEM OPPONENT Mem and 11'Zomem'Tmck 11 1 28 Tate Coach D1ClC Erwin 82 36 PHS 0 PHS Us THEM OPPONENT 5 5 36 caihoiie 0 Gulf Bfeeze - 2 Tate C70-U' Counhy 37 7 Choctawatchee 7 5 39 Moss Pom A Coach Bill Hemming - 80 42 Quincy Shanks g gllocgaw Fliiscangbla 98 IHC O1'CSt 3.126 flV1t. 58 41 REGIONAL 1 Woodham Us THEM OPPONENT U17 Woodham A 98 56 SECTIONAL 2 PHS 9713 Wiiaeai iiivii. V21 Cbadboufne Imm- 8 5 55 STATE 0 Gulf Breeze 97 17 Tate, Pine Forest 34 24 Milton 69 70 STATE 1 Tate 9720 s, s. ,Dixon W 23 ESCMOS? 1 2 Chomfv 9727 Choctaw Invit. C11amP10nSh1P 1 Catholic 9f30 Guif Breeze, 3731 Pine Forest 3 Plflfi FOICSY Escambia 474 Pace Invit. 4 Fort Walton 1074 ESU iiivii, 4X7 TMC I L Mosely V 1 iofii Mobiie City Rec' 4711 Gulf Breeze lnvit. Bay . 10718 Mcoiu Relays 4X 14 Efambla A 3 1556211111318 10x25 Eagie invit. 47 16 Pine Forest Invit. 0 Fort Walton 107 3 1 Escatosa Co. 4X 25 DISTRICT 0 DISTRICT 1 V8 DISTRICT 4730 REGIONALS 0 REGIONAL 1 1715 REGIONALS 5f 1 STATE 11722 STATE ,' fffi 7 f'fi ' gs 7 f ifff1,',,. vz ff,- if,., f 1'aii,9,:af ,a i51 ,ijififf , 7 1 5 , 7 '3 1 , iii i i i 'fe-1117! ,-M' - ,741 iii' J :if , ,Li -,'i :ifZ3Q,Q1' , ,,k,. I , ,iii f j 'wfi ,521 ff , ,V f 1,1215 ,f, , f -'ifffwyl ,,. 1, -.. fi I ,,,,i Y Y 1' .H Li. ' -R l 'V '7 v1L 51, f,ti,',:'fi 7--1,7 ,, 4' , ', '5- ' is--5 -i 2+ff,,-. '. of -1 U-f ' f 'V ' 'wp' 6 ,- . 1' . I My My iv M .I , - ,..,, ,, , , ,7 1 I 4'!'r A' 1'e,Idc4'! V!' l A -- N ' Volleyball Vazrxity Bmeball Vanity B0 5 Bmkerbqll Freshman Boy: Bafketball Coach Martha Rainey Coach Sonny McDonald Cgach Wfyiffed Lewis Coach Charles Haynes US THEM OPPONENT US OPPONENT OPPONENT OPPONENT Pace 2X2 1 M0516 Murphy PHS Milton WON Pine Forest 2 X24 Choctaw Milton Wooclham WON Escambia ZX 26 Pensacola High Pine Forest Tate Tate 2f27 Ft. Walton Chogfaw Pine Forest WON Gulf Breeze 3 X 2 Milton Ft. Walton Escambia WON PHS 3X6 Woodham Ft. Walton PHS Woodham 10 Ft. Walton M055 Point Tate WON Pine Forest 3 X 12 Pensacola High Woodham Escambia WON Gulf Breeze 3X 13, 14 Ocala Vanguard WiUiamson pine Forest WON Escambia 3f l6'21 Univ. of W. Fla- Tate Milton Tate TOUR . Quincy Shanks Woodham WON PHS 3f24 Tate PHS PHS W00dha1'n Woodham Woodham WON DISTRICT 3f28 D0fh3l'1 Pine Forest Woodharn Northview Escambia Milton Choqfaw 4 3,4 Little Rock, Ark Tate 4 f 9 Choctaw M ilton if Tafe Moss Point A X Dothan Quincy Shanks Northview PHS U IV 14 Woodham Escambia ,I . V. Girl! Bafketbfzll 4f18 Tate DISTRICT Coach Elaine Shores 408 REGIONALS REGIONALS V. B0 J- Bd 55915411 W 1 SECTIONALS SECTIONALS E Coacg sfaiiwoffh US THEM OPPONENT STATE OPPONENT 34 Pace 28 Catholic Milwu 38 Escambia Pine Forest 47 Pine Forest Choctaw Ft. Walton 40 Woodham Woodham 30 Tate Tate 45 Pace 29 PHS Woodham 26 Woodham Pine Forest 51 Pine Forest Escambia 23a Escambia 'N Choctaw 4 l Tate T Tazfe 39 Catholic Milton ASEAN ' if .si -x 1 mmf w. 21 -V af 3 A sl fin. A! X .JR .I OD f' f 42 v-,aj , Q X .V 1 . fi A ' .S 'F 'X ,X ,mm 5 my f H Y A Q 1,5 AFV: 5 4 J 5 3' x I J C Q if ff? M lf V! QE 3. 6 Ti 1 , ,Z 3 ,. ji 'tp , V VY -fs is 'i lx f Q 2 f x ' A 5 f F if ni m AA ' I p lf' - A X gi 4 'f i '1i I , A P. . .L .,', 1 ' ' QE b , iff' if-,,,.f ! VV . . , u .gs 5 ff 'W f' ffl T , J N Y, . 31' 1 3 W 'VN ' Y VY Y YV A f f V , 3 , ,fi 4 X 12 .s D -vi. 1331 . 1 iii' , ' A A nf 0 1 'X f fixiwl in 1 ,kyt I 5 J fri f Q W f Q '1 s fx ' . Jil ' 1 YD 'n X 5, A 9 2 ' i ' 1f 5 f f f ig if 2 H A i iA li 1l X .XA Over n an Bet Pad vrr to acl ntagekof th Pho grap Clu s m ey ' ,1 M , Y :IV ' earm pro cr. Q is uf V 'A X ' K Q Q 3 V . M S 7 7 l M isa, 'idly 323 il W 2.11 I ' x 'z ,, I 131 Q, E ,s if 3? V 4 iii H+ ax, ,mv WH! 1:11 ff: 311 his l Q ,if 21 gx N Yxsiii as 2? 5 ii, QQ, if 'fa 1921 5 S fi is he ,X 2 821 if iflz AEK ogg N2 lei? H 5529 WG :Sli 5 A iw' N. 125 111 I I :li in 1 I 1 232' E i! 1 sp Z f i IJ' 22 Club ll ee'lP It's More Thom Just o Gome- The best of friends became bitter enemies when Club Week ar- rived. Members from every club battled in a contest for inter-club bragging rights. Who would win volleyball? the silly games? Com- petitions from the clubs began with atrium displays to the more hectic Egg in Spoonn race as the clubs matched wits as well as physical prowess each day after school. SGA led by Inter-Club President Cathy Hufford organized Club Week with hopes of generating school spirit after Homecoming. Also Club Week celebrated the beginning of soccer and basketball seasons. The week turned out to be a smashing success, but above all everyone had lots of fun. - Terry Baker WEEK 1 , fm Sydney, Tracy, and Eddie concentrate on walking faster while skillfully controlling the egg-on-the-spoon. lnter-Club Council Members: Kit Kievit, Ex. Bd,g John Hamilton, Ex. Bd.g Lori Fish, V.-Pres.g Cathy Hufford, Pres.g Amy Scruggs, Ex. Bd. .ale fn, Club Week Sweethearts: Kim Sjollema, Margaret Shippey, Grover Golsen, Lorie Sisco, Mici Jones, Gil Robinson, Stephanie Carr, Barbara Hayag, Katie Creighton, Marcella Barge. ,,, , K w Exceptions Were the Rule for CTIA CLUB The cracker whistling event was a messy game for Scott Lee and judges. The word charity symbolizes the Beta Club, Their charitable activities gave students the opportunity to help the needy. Club members have assisted in the Challenger RunfWalk-a-thon and joined in the Angel Tree Christmas Project. Requirements for be- ing admitted to the club were a 3.3 GPA and teacher approval. Beta remained one of the largest clubs with more than a hundred members. Club President Gil Hayag, together with sponsors Mrs. Rivers and Mrs. Williams and fellow officers, discussed projects the club would be interested in. They planned activities so that it remained an active club throughout the year. Once more, the club continued its reputation for participating in programs de- signed to help the community. Officers: Elizabeth Thomas, Treas., Gil Hayag, President,Jonathan John, Vice-Pres., Lori Fish, Sec. I Sponsor: C. Williams Row 1: Jean Lin, Jennifer Wood, Kim Robinson, Anne McBrayer, Elizabeth Th a , Gil Hayag, Lori ish, Jonathan John, Mike Vorbodungen, Marcia Barts, Angela Kyle, Roderick, Parker, Richard Reid, Renee Finkley, Ms. Williamsg Row 2: Helen Ruckstuhl, Clndi Lu, Diane Perry, Stephanie Carr, Cathy Huftord, Bruce re , .angel Cole, Tra e Lester, Heather Lindsay, Barbie Replogle, Jennifer Veasey, Bar- bara Barge, Nyasha Junior, Seqwana Thomas, Dawn Green, Michelle Grier, Row 3: Jenny Banta, Kathryn Roberts, Liane Olmstead, Margaret Harris, Dawn West, Amy Childers, Truon , Stfjfielchggr, Alison Warren, Tracy Bmond, Laurie Snowden, Lee Carol Griffin, Sheri Curry, Lisa Morreale. Blossom Daviesg Row 4: Greg Walden, Brad Duncan, Lee Smith, Jason Struck, Bren-dan Lee Terr ake , Elizabeth Z-orn, e y Kievlt, John Com- mon, Dona Yarbrough, Ines Benitez, William Wirth, Melissa Ortegag Row 5: Reginald Parker, Harriett Moore, Julie Kagel, Scott Rezek, Jim Balcom, Bud- dy Bowden, Brent McNeal, John Hamilton, Patty Hawkins, Mark Davis, Emory Chao, Scott Lee. End Bern 225 Ten pairs of hands poise ready to hit their buzzers. The students anxiously await the question. The emcee poses the question. What do the Four Horsemen of the Apocalypse represent? he asks. A student hits his buzzer, receives recognition from the host and answers. War, death, famine . . . and . . . conquest, he says with a hint of hopefulness in his voice. t'That is correct! proclaims the host. The Scholar's Bowl team matched their wits against teams from several other high schools in our region. They competed in front of a television audience and could be seen on WSRE TV channel 23. Before the actual contest there was practice. The members met once every week at Ms. River's house to absorb more material for the contest. It wasn't all work, though. At the end of each meeting, one member was designated Uliquidsl' and another became solids At the mid-point of each meeting the members feasted on the 'brain foodf, Alexander Pope explained the spirit of the games best with his famous observation, What mighty contests rise from trivial things. - Terry Baker - Studying for the next competition gives Michele and Suzann a challenge. V , Row 1: John Hamilton, Susan Gibson, Michele Fischer, Nyasha Juniorg Row 2: Brad Duncan, Scott Brown, Charlie Wiggins, Angie Kyle, Mark Gibson, In Chollenging Situations, CHOLNS iS BCDWL reosoned Scholar's Bowl team members Angie Kyle and Brad Duncan prepare to buzz in an answer to the next question. Sponsor: E, Rivers 24 5 hnlarr Burr! , Tutoring ond Teoching, IATH CLUB Colculored 'WMC -we A The situation reached a critical point. Many students were lost in a veritable maze of mathematics. Thoughts of theorems, properties, and inverses ram- paged through their tortured minds as they prqyed for a remedy to their pro- blems. Little did they know that help was on its way. The members of the Math Club appeared on the scene with a master plan to put an end to the troubles. Serving as tutors, the Math Club set several students on the road to mathematical understanding. The members participated in Club Week, sign paintings, and Homecoming ac- tivities in addition to the traditional tutoring the members provided. ln order to raise money for the First Annual Math Competition, Mu Alpha Theta members held car washes and sold Homecoming pencils during Homecoming Week. We're like one family of calculating cats, said Marcia Baris, club president. 4' npr H I 1 i'i , N, ' ilT4T'Tl ,N C Q .i.. , , i 'iii ix T cf 5 2 Marcia Baris, Barbara Barge, Claire Kingry ride on the Math Club's float adorned with flags from Pensacola's past. Claire, Marcia and Patricia build geometric figures to attract attention to their Club Week display. Row 1: Jennifer Clay, Sequawna Thomas, Barbara Barge, Nyasha Junior, Linh Truong, Patricia Williams, Reginald Parkerg Row 2: Claire Kingry, Marcia Baris, Lori Fish, Brad Duncan, Blossom Davies, Melissa Elebash, Harriet Moore, Mrs. Williams. M atb Club 225 Excellence Live it Up to the Best ONOR SCDCICTY Officers: Lisa Morreale, Vice-Pres., jim Balcom, President, Suzanne Gibson, Treas., Grover Robinson, Sec. Claire Kingry, David Klingaman, and Angie Kyle anxiously await their induction into the Honor Society. ?6 Honor Sofieiy Bring dues and cans. Be sure your cans are in bags with your name on it, said president jim Balcom. These words echoed throughout the cafeteria during the Honor Society meeting. The cans supplied the Manna Food Bank with stock for the holidays. The dues provided money for the club to buy cords for seniors, t-shirts, pins, membership cards, and more. The club boasted approximately 150 students. These students met the requirements of having a 3.5 average and good citizenship. Row 1: Cliff Lowe, Melissa Elebash, Ling Truong, Vanessa Padla, Dawn West, Amy Childers, Sydney Decker, Ayer Whitley, Kathy Lee, Cilia Lom- bardo, Lisa Eddins, Patty Hawkins, Caroline Holland, Row 2: Lisa Mor- reale, Suzanne Gibson, Lisa Oberto, Sabrina Miller, Michele Fischer, jill McAfee, Charlotte Frederickson, Nancy Gander, Wendy Morris, Adri Spain, Mindy Beache, Stephanie Ellis, Dawn Blackbumg Row 3: Barbara Barge, Har- riett Moore, Blossom Davies, jill Marsden, Kathryn Mitchem, Cathy Hufford, john Hamilton, Lorie Sisco, Lori Fish, Jeanette Mogg, Carline Hatnett, Elizabeth Thomas, Sheri Curry, Wehdy Aston, Terri Falzoneg l Row 4: Reginald Parker, Alan Eubanks, Christine Kelly, Gil Hayag, Scott Lee, Emory Chao, Stephen Fluharty, David Lacy, Garland Borowski, Neil Breiten- bach, Chip McDaniels, jeff Hawkins, Row 5: Angie Kyle, Marcia Baris, Brad Duncan, Peter Delevett, Greg Walden, Scott Brown. Y, l i The Honor Society provided service to many students by giving the an opportunity to work for people less for- tunate and in need of help. The members had service pro- jects not just to help others, but to give its members a reason to be involved. Ms.Martin said, The Honor in Honor Society meant a chance to be recognized for academic achievement and also to honor a promise to the society which we live in. u 3 E ' ig 'ii NATIONAL HONOR SOSIETY 'a Z S Va if Officers: jim Balcom, Lisa Morreale, Grover Robinson prepare to explain the Honor Society's Code to the new inductees. Holly Benson and Alicia Blum enjoy the dignified atmosphere of the Honor Society's candlelight ceremony. ,,,,,'. , ' -5 filtl ' juniors: Row 1: jim Balcom, Scott Rezek, Brent McNeal, Grover Robin- son, Claire Zorn, Elizabeth Zorn, Michale Eddins, jonathan john, Nyasha junior, Richard Reid, Row 2: Mike Von Bodungen, Carol Kahn, Buddy Bowden, Curt Purcell, Paul Goodmm, jason Carr, Heather Lind- say, Barbie Replogle, jennifer Clay, jen- nifer Veasey, Seqwana Thomas, Row 3: jason Struck, jeff Brown, Terry Baker, Michelle Godwin, Angela Fennell, Stacy Leichner, Angela Rupp, Cindy Liu, john Common, Kevin Gentzelg Row 4: Mike Bolling, David Klingaman, jen- nifer Desmond, Kelly Meachem, Ines Benitez, Dona Yarbrough, Trcie Lester, Melissa Ortega, Kelly Kievit, Debbie Bogardg Row 5: Stephen jefferson, Daryl Lassen, David Key. Sophomores: Row 1: Steven Flowers, Leigh Precise, Anne McBrayer, Tammi Benson, Susan Epps, Kim Robinson, Lee Carol Griffin, Tracy Bond, Lisa Arnold, jenny Banta, j'e-arniliip, julie Nagle, Chris Wu, john Kelly, jason Tanner, Row 2: Shannon Burke Aijdga Ewing, Kathryn Roberts, j,u1ie-Korte., Sylvia Wogd, Nikki Andrews, jennifer Dolgow, Casey Gilmore, Ken Christina, Tip Tyler, Row 3: Frank Morreale, Alicia Blum, jennifer Wood, Holly Eubanks, Row 4: Duane johnson, Braden Ball, james Clark, Buddy McGraw, Phillip Towles, Harland Cason, Daniel Hart, Tommy Winn, jeff Crigler, Mike Gibson, Mark Mc- Cuiston, David Matos, Dung Hag Not Pictured: Sarabeth Thomas. .p-,,..,.i. Honor Society 22 28 Key Club ,QJJQOQO sl C L '-. O '- , 4' o m 0 X 9 s 5 s Q N X 5 ' .1 X 7' 7' of 1 he ,A X '. N AT X ,,1 'vcalll' Key Club member Kevin Bradley and classmate Gene Mitchell take a few moments for homework while waiting for the bell. The Key Club kept a busy schedule in their efforts to display the same pride and capability that has become their trademark through many years of service to the community. They spent a good deal of time working with the Manna Food Bank, as well as collaborating with the Kiwanis Club on various projects. Also on the club's agenda were tutoring for the Boys' Club of Escambia County, aiding with the Angel Tree, which provided underprivileged children with Christmas presents, and assisting the National Federation for the Blind by making tapes. The members also convened with other chapters of the Key Club. They attended two zone rallies and went to the district convention in Tampa during the Spring. Their hard work paid off when they received and inter-club award for uexceptional participation in projects with Kiwanis Club and other Key Clubs. Row 1: Dona Yarbrough, Jonathon John, Jason Struckg Row 2: Tim Fox, Scott Rezek, Cindy Liu, Susan Epps, Stephanie Ellisg Row 3: James Hayden, Lorie Mann, Inez Benitiz, Kathy Hill, Heather Lindsay, Will Riehmg Row 4: Mark Davis, Buddy Bowden, Kevin Bradley, Mike VonBodungen, Debbie Bogard, Melissa Ortega. matmiliw Sponsor: C. Maldin Opening the Door to the City EY CLUB Serves Z R- 1 i 1 ' E rf wr. ff , 7 43, 4, 'Vinyl 'Q i 4 Just for the Enjoyment of Giving Civinettes members took to the beach during Homecoming week! L N x T L... 'f' ,-,Q tiff-auf Thriving with an abundance of projects, the recent- ly formed Civinettes Club contributed greatly to the community. ln November, the members created a Thanksgiving basket to aide needy families in the area. During Christmas the Civinettes supported a young child for the Angel Tree. The child submitted a list of his Christmas wishes and the club members did their best to grant those wishes. Another community project which the Civinettes enthusiastically took part in was the clothes drive in which they collected winter clothing for needy families and took the clothes to the Waterfront Mission. Members donated time and energy to make Civinettes as successful as possible. This service club overflowed with projects to heighten school spirit and community awareness, but the year would not have been complete without the assistance and organization of Ms. Bortone, the club's sponsor. - Jennifer Desmond ? ,i , ,F Eli, Xi jx 'rs Row 1: Alysia BartholomewQ'Angela3 YM'illen'deF1 Joyce Stokes, Jennifer Spiwack, Mici Jones, Kelly Riddle, Paula Roe, Cindy Flanders, Laura Allen, Amy Schnuppg Row 2: Tarina Pettiway, Ingrid Quinn, Erika Young, Donna Boling, Shelly Peaden, Leslie Gore, Kim Lucey, Stacy Leichnet, Tammi Arnold, Jenny Banta, Kim McGraw, Row 3: Susan Weber, Leigh Leidner, Robyn Arnold, Beth Baggett, Amy Childers, Hope Ellis, Vivian Gillard, Nita Miller, Casandra Ellis, Tara Dudley, Felicia Moffettg Row 4: Betsy Mathews, Ruen Castillo, David Peaden, Denny Wilson, Tyler Lemmoh, Buddy McGraw, Ms. Bortone, Michelle Riera. IL. 'Q i v-Q'-: j'1,,. , Q3 ' Officers: Cindy Flanders, Sec.g Kelly Riddle, Pres., Paula Roe, V- Pres., Laura Allen, Treas.g Amy Schnupp, Parl. Sponsor: K. Bortone Civirletlef 229 De nl y X E if X ,, 1 A Putting Ideos ro Work at f A 0o 0+ 6 Q 4 X Q X . 0' CLUB Looking elegant in a dress designed by Rebecca Stevenson, Diane Perry receives 2nd in fashion show, Dana Couture twirls around the stage as she models Ronda Bond's December gown. Smiles and masks in hand, DECA members get the homecoming spirit in a ride downtown. lq sia V -- ... i t Q l , i . fl A 2 J! ' ll- ! it 'l l 'fl if lviv 1 f:,'?2' Q, 4 A H J 6 , ' AM? A , lf. v . , SA' J ., k,, ii.,-I if-QV' 55 1 r Wihfge i B . 1 ,li X Sponsor: C. Ross Ghoulishly devising another trick, DECA sponsor Carla Ross instructs 3 Lmonks' on the art of ter rifying students. g i ' f Y I I I N v . K ff an x ii z gala Y Q '-,. W,- ssgzf' 1 ,Il 39+ , Q4 4 Y- A ll Vg ' 6 3. W X 'ww U f 1 ' 3 P'fLfZ1 N ,A 'riife 1 im ' fQ' ' -- 4 as kv .4 4 l ,Q 'W' is - aff: R Mill Don't forget this month's fund raiser, said Mrs. Carla Ross to her DECA club. Fund raisers were a necessary part of the club's agenda in order to raise money for competition and any awards that needed to be purchased. DECA put on many dances on Friday nights in tribute to the basketball and football teams. The students involved in DECA also spent many hours at the school on Oct. 31 Hfixing up their annual haunted house. Wowll What a ghoulish success. To be a successful club, people must work together and become a family, a slogan heard by all DECA members. Deca members stocked, managed, and operated the school bookstore full of t-shirts and supplies. Preparing for her midnight snack with Becca Lisman, Carmen Rivers asks, Would you like some Roast Head? Officers: Kim Kelly, Gaylier Davis, Mark Jones, La-Shawn Chow. Chandra Hill, Kathy Gray, Audra Masiarczyk. If Row 1: Ms, Carla Ross, Sponsor: Pamula Wright, Kim Kelly, Shondra Hill, Laura Warner, La-Shawn Chow, Audra Masiarczyk, Kathy Gray, 'llf Mark Jones, Gaylier Davis, Cassandra Pauldin, Audra Phillips, Latrizce Cunningqhamg Row 2: Lenetha Perl-ring, Vivian Gillarcl, ,.,.,....,.,...fA.a.. Lorainne Snow, Teresa Stokes, Tarra Savage, Debra Jones, Sheldra Puryear, Tabatha Stills, Lisa Hicks, Guida Jarman, Dana Couture, Robyn Watson, Ronda Bond: Row 3: Daphanie Nelson, Sylvia Galloway, Aqualine Chow, Cassandra Westbrooks, Christian Cobb,'Tirl5f ,lift Hamm? Cherrie Meyers, Karin Jones, Carolyn DeLeon, Carmen Rivers, Alicia Perry, Cynthis Foun- tain, Row 4: ,Samantha Herd, Michelle Velaskh Tracey Newth, Dana Ruben, Betsy Mathews, Tif- fany Van Demark, Valerie Hardoin, Cindy Sockwell, Jammie Harris, Shavonda Lewis, Jerome Ruffin, Row 5: Clent Byrd, Timothy Baldwin, Tabatha Thompson, Yolan- da Grimes, Anthony Coleman, Rodney James, Jonathan Thompson. Dem 231 Adding Floir Everywhere 'LCoach Gaines, where is a cup that cloesn't leak for the red parm? asks Kit Deason. Clockwise: Coach Gaines, sponsor, Lori Fish, President, Loire Sisco, Vice-Pres, Stephanie Carr, Treasurer, Cathy Lee, Secretary. Seven seafaring Jayettes celebrate the induction of several new members at their summer tea. 11 Hvwmsmt' 'N--Q--.-....... i -3, I H , QA -gi3jfr?igi+4iL'g3i.5,,-. :f,,pQ2iL5 , A, ,- rf l ,1 ..-. X Q rT?' , 3,9 tk , , ,, K v ,X 3 ' A N 4' ' 4, . fi g fJg,rS1 ffi-i a jL ' , , , i wi fiif ' 1,1 Lift , ' Left to Right: Donna Hayden, Patty Hawkins, Cathy Huf- ford, Loire Sisco, Kathy Lee, Lori Fish, Nancy Gander, Kathryn Mitchem, Stephanie Carr, Adri Spain, Penny Spurigo, Jill Marsden, Elizabeth Thomas. f , 1,54 .ab 1- , , -- -.--- , t f g, ,,, 414.-awp v -ww ,. fax, .K , 1, 4 ty - - , V V -,gn ,, .3 2.-,, ,111-,::,f,-5 :wi 51:4 amor -fwfr? tzww-:.',2 iw ,- I 1 ,,. ' A - '1..'.ff:1w1 QL' Q h':lf, ll31'3 i :fi-1' f mf A ,,,- M, - I juyettw , fu 'x 'XA J 'F 4 Fire! Fire! Fire down below! Rosie O'Grady gladly supplies the Jayettes their fire truck to help them depict the burning of Chicago. Junior Jayettes: Ist Row: Amy Pittman, Claire Zorng 2nd Row: Elizabeth Teresa Stevens, Michele Plant, Kristi Zorn, Jennifer Veasey, Kit Deason, Mitchem, J. J. Clay, Seqwana Thomas, Jenny Desmond. 3. t .lr 1 Building school spirit and pride through a variety of activities was a major focus of the Jayettes. Members designed projects to pro- vide service and support to both our school and community. Jayette members assisted parents in finding their way through the maze of cor- ridors during the school's open house in Oc- tober. The Jayettes showed support for the Wildcat football team, by designing and painting spectacular banners to keep spirit high. The community benefited from several worthwhile projects in which Jayette members assisted. During the Children's Day at West Florida Regional Hospital, Jayettes manned booths, conducted games, and helped boys and girls in having a good time at the charity event. The Jayettes restored the Scenic Highway Bluffs Park to its natural beauty after giving their Saturday to clean up this beautiful area. A new pro- ject initiated by Jayettes was the Special Parents program in which members provid- ed T.L.C. ttender loving carej for children who were handicapped in some way. Our leader gave us his support and in- spiration. Coach Gaines was always there Keeping the Promise. lst Row: Julie Barrineau, Shannon Burke, Anne McBrayer, Diane Brooksg 2nd Row: Leann Holifield, Vicki Millerg 3rd Row: Katie Sweeney, Allison Warren, Not Pic- tured: Sarabeth Thomas. jayelte 233 234 B.T. Ladier 6 Gent: sy. f Building Pride to Lost o Lifetime LADIES I'd like to give them the opportunity to share their time, energy, and knowledge with people in the community, said Walter Gulley sponsor of the Booker T. Ladies and Gents. Mr. Gulley arranged for the members to work with underprivileged and lower economic housing developments. The B.T.Ladies and Gents offered its members the opportunity to get involved in school activities, strive for higher goals, and make new friends. Academics, character, and good conduct were stressed great- ly. Prospective members were checked thoroughly in these areas before being accepted into the club. The club offered fun, excitement, and the thrill of being in the Booker T. Ladies and Gents! according to Earnestine Middleton. Members were required to participate in all functions, to keep good grades, and to stay out of the dean's office. 81 GENTS ' may if rim:-.-A -ll' ' The feeling of pride they received proved that their work had been worth all the time spent. - Stacy Leichner and Elaine Thomas Roderick Parker and Cheryl Chandler offer the students a chance to try their Officers: Alicia Anderson, Sec.g Roderick Parker, Pres., Shonda luck at the B.T. Ladies and Gents Coin Toss. McDonald, Treas. -B.T.! V11 K Qi. Row 1: Roderick Parker, Reginald Parker, Hope Ellis, Shonda McDonald, Alecia Anderson, Ingrid Quinn, Vi- vian Gillardg Row 2: Toya Moultrie, Barbara Barge, Stephanie Woods, Nita Miller, Acquelyn Chow, Maricris Suelaf Michelle Grier, Rene Finkley, Lisa Hicks, Tracie Simmons, Miriam Nelson, Benita Jackson, Sylvia Gallowayg Row' 3: Mr. Gulley, Kevin Rease, Clinton Byrd, Carlos Williams, Roger Middleton, Artro Saulsberry, King Walker, Victor Marsh, Tarina Pettiway, Yolanda Mon- tgomery, Joyce Stokes, Tara Dudley, Anthony Coleman. Roising Money for the Needy, BC Lends o Helping Hond What was ABC? No, it was not the first letters of the alphabet, nor was it Channel 3 on TV. ABC which stood for Auxilium Bona Charitas lhelp good charitiesl was the first club of its kind in the school. Eddie Spears and Mike Armstrong originated the idea for the club, drew up a constitution for the club, and Eddie thought of the catchy name for the club. Getting the club started was very tough according to Angela Rupp, club treasurer. Learning the ropes - organizing and getting the club started required a major portion of the club's time. ABC began raising funds for its goal by selling goodies at the Halloween Carnival and holding various other subsequent fund-raisers. The club's goal was to help students with monetary needs and to help other charitable organizations in the community. For its first year, ABC did well in gaining steady membership and in realizing its goal. - Linh Truong is QQ 9' .s.-. X 1' ' .. 'NC .gf 1 r A 'X if -MZ' Efifiiif. sf r Officers: Mike Armstrong - Presidentg Eddie Spears - Vice-Presidentg Marilyn McClain - Secretaryg Lauren Scott - Activity Directorg Angela Rupp - Treasurer. Members: Eddie Spears, Angela Rupp, Mike Armstrong, Mike Bolling, Karen Holifield, Marcella Sjollerna, Roger Ser- wack, Jennifer Allen, Lauren Scott, K5- Mrygcgeightorig Marilyn McClain, Christie 'fTomlinf' A.B C Club 235 ABC club members Mike Armstror Jennifer Allen, Christie Tomlin an Angela Rupp sell their ghostly goodies at the Halloween Carniv 6 B.A.5.1,C. B.A.S.I.C. was a service club that supported school spirit with a Christian attitude. The name B.A.S.I.C. stands for Brothers And Sisters ln Christ. The club met year round on Tuesday and Thursday mornings. When they got together, they studied and shared Scripture readings. They also shared thoughts about Christ and how He worked in their lives and the lives of others. They closed each meeting with a prayer asking God to help them spread His word and present a Christian attitude throughout the school. Christmas time was a very special time for the club to celebrate the birth of Christ. During the Christmas season, B.A.S.I.C. club was an organization that anyone could join and have a good time in Christian fellowship with friends. W Officers: Katie Creighton, Secretary, Kathryn Roberts, Vice-Pres.g Tammy Williams, President, Stephanie Hamilton, Treasurer. Working Together ond Shoring Together .h.S.I.C. Discovered Direction in Life B.A.S.I.C.members Lisa Crews, Kathryn Roberts, Holly Pilcher, and Sponsor Mr. Coward keep to the city theme with Jerusalem, the eye of God. Members: Kristin Beemarrf Lisa Crews, Stephanie Hamilton, Katie Creighton, Kathryn Roberrs,1Chris Anderson, Holly Pilcher. YV Working to Get the Whole Picture LUB PHCDTO For a couple of hours each Thursday, Club Photo met to perfect their picture taking and developing skills. Under the guidance of Mrs. V. Spencer, a group of 45 students worked in the darkroom after school preparing photos to enter in art shows such as the Greater Gulf Coast Arts Festival, which took place on Oct. 31st, Nov. 1st and 2nd, Club Photo had the responsibility of taking pictures of couples at the Deca Christmas Dance. The club also came up with the idea of making a prop for Halloween designed as a skeleton and a witch. Students could place their heads in the prop and have their picture taken. Club Photo also designed their own unique T-shirts. The club went on field trips to Pensacola Junior College and the University of West Florida to look at the art departments and the opportunities the schools had to of- fer to students interested in the arts. A trip to the Museum of Art was another activity that kept members busy. Club Photo was one interest club that worked for their interests as well as those of the entire school. t Mickey Clinard, Vice-Pres., Brian Dunson, Treas.g Kelly Garrison, Sec., Teri Boyd, Pres. Andrew, Jennifer, and Mrs. Spencer plan their new project. Row 1: Jay Campbell, Scott Whitemang Row 2: Ted Rosenau, Lacey Parkhurst, Judy Nock, Peter Delevett, Tim Fox, Terry Falzone, Teri Boyd, Erin Sebelius, Rick Mathews, Colin Dwyer, Row 3: Mrs. Spencer, Suzanne Gibson, Donnie Allen, Mike Kirby, Ben Bogan, Shelly Yates, Shane Zaleski, John Williams, Paul Powell, Row 4: Nathan Price, Richard McLeod, Scott Brown, Kelly Kievet, Philip Moffat, Mickey Clinard, Robert Bancroft, Joey Davidson, Ronald Reese, Andrew Kelly, Laura Shephard, Nan Rich, Danny Blevins, Dale Barnes. Club Pbota 23 H Video Club Sponsor M. Davis Get a four shot of the floor. Give me an over the shoulder. Camera three zoom in. These are just a few of the phrases one heard when visiting the Video Club. ln just its second year of existence, the Video Club produced two television telecasts, a public service announcement and another edition of the Wildcat Video Yearbook. The Video Club was a uni- que experience for high school students wanting to gain insight on being an actual member of a production crew for a television station. The Video Club offered its members the opportunity to learn the skills needed to become and independent member of a successful television crew. The W,H.S. Video Club members were proud of their accomplishments in just two short years and are looking forward to bigger and better things. The successfulness and experiences of the club are summed up in these few words from John Gilbert, Senior member of the Video Club, Being in the studio in front of the camera . . . and under the lights is an experience of a lifetimell' Dressed in their homecoming attire, Chris Truitt and Ms. Cousins discuss a novel, Working With Lights Corneros, ond Action IDEICD CLUB Recorded the Milestones 'it Row 1: Richard Reed, Jeff Gilbert,fChris Countrymang Row 2: Jennifer Spiwack, Bruce Vredenburgg Row 3: Lori Mann, Ms. Cousins, Rachel Templeman, Rachel Templemang Row 4: Chris Truitt, John Gilbert, Mr. Davis. , A little something extra or special not only defines the term La'gniappe, but it also accurately describes the club of the same name. ln their first year, the club, sponsored by Ms. Bordelon and Mrs. Yonker, organized several fund raising events. The primary fund raiser was the Christmas cake sale. Club members utilized the cake decorating skills they had learned to create at- tractive cakes that were a hit with the faculty. Another fund rais- ing event was the Easter basket sale, where baskets full of goodies helped to enrich the club's treasury. La'gnaippe par- ticipated in community service projects as well. Visits to the Childrens Hospital and the Children's Home Society brightened the day of the ill children. Although they were one of the newest clubs on campus, La'gniappe enjoyed a very successful year. 2 -41+ 1 a 1 ,xr ,,,k f RN r ,X 1: VM. , .su ,JI fl , K Q 5-'WST' .461 r r f f X L X La gnaippe officers Kim Golson and Jill Richburg play the part of gamblers and showgirls on their 3rd place float. Row 1: Rachel Ruckmam, Jill Richburg, Kim Golsong Row 2: Carroll, it Christine Ronsella, Parn Esperson, 4Carmen Riversg Row 3: Shanay Lawrence, Mrs. S. Bordelon, Cynthia Fountain. Sponsor S. Bordelon Larnluppe 2 39 Wir wollen das Deutschprogamm in die Schule starker machen, sagt einDeutschschuler. Translated: We are trying to strengthen the German program and increase its followingfl said one German Club member. The Club survived a Time of Changesf, including a sponsor change when Dayle Van Slyke took over midway through first semester. By second semester, they were in search of another German teacher as Ms. Van Slyke left to return to New Zealand. When Oktoberfest rolled around the members traveled to the Escambia County Nursing Home and entertained the residents with several rous- ing German holiday songs. When funds ran low, the members sold Gummi Bears and Toblerone to boost the club's treasury. With a shared interest in the German language and culture to bond them together, the members enjoyed a memorable and successful year. Auf Wiedersehen! - Terry Baker Viki Nelson, Wendy Aston, and Will Riehm go under cover as Wildcats behind the Berlin Wall. Officers: David Lacy, Treas.g Wendy Morris, Sec., Garland Borowski, Pres. Members: Row 1: Kelly Meacham, Margaret Shippey, Garland Borowski, Wendy Morris, David Lacy, Row 2: Shelia Hamblin, Stacey Knock, Gaby Melton, Tara Calhoun, Helen Ruckstuhl, Jenny Banta, Julie Nagel, Row 3: Holly Pilcher, Monica Waters, Christy Pen- nington, Dianne Fischer, Rod Bish, Mike Bloski, Will Riehmg Row 4: Paul New, Frank Stuart, Gasper Per- sio, Aaron Pennington, Carter Mansfield, Pam Ruckstuhlg Row 5: John Shippey, Jeff Earl, Brent Hoskins, Susan Weber, Paul Bull- ington, Curt Purcell, Cathy Hill. 740 Gtflllzlll Clnb Visiting nursing f on'1GS. ERIYIIAN CLUB Shores Oktoberfest pi' NNI? X i i ,fig It 7 V if-, iii! R V! 5,3115 3, Q rw Yiiiiii.. -r PCD Doncing for Enjoyment, Dozzles N 4tbIf- ...nv I '1- ll L TT 1 J I? ' . Spirit came in many different packages. The Pom Pon Cats were one of the best surprise packages who did their part to promote school interest in basketball, Practicing twice a week, the Pom Pon Cats strove to perfect their dance routine. The spotlight during the boys, varsity basketball season shone on the half-time routine of the Pom Pon Girls. Using a combination of dance steps and cheerleading routines, the members smartly dressed in blue and white entertained the crowd. Led by sponsor Mrs. Ester Jackson, the girls gave support to the basketball team and enjoyed the warmth of shared friendships. - Terry Baker 55' X I ,r x .- 'U 'l A Row 1: Stephanie George, Tara Savageg Row 2: Wyette Burnett, Shai Hall, Michelle Jiles, Melissa Jones, Tokie White, Row 3: Renee Finkely, Samone Brinkely, Brandia Kidd, Tina Newton, Shenita Johnson, Row 4: Lisa Hicks, Michelle Grier, Ken Curtis, Miranda White, Felicia Moffett. While some spectators visit the concession stands, many enjoy the Pom Pon's half-time entertainment. Wyvette Burnett and Keisha Nelson enjoy the applause. Seniors: Lisa Hicks, Renee Finkely, Stephanie George, Mrs. Easter Jackson, Sponsor, Felicia Moffett, Melissa Jones. Pom Pon 241 Wirh Invesrmenrs in the Future, Looks for Tomorrow Tom-Wat top sellers Cherrie Turlington and Darlene Williams together sold over 51,000 of merchandise, bulge 43 txftx x!5g, 1 5 N ,- -Y fy.. V -- -e '-: 1 , f m lmm UT U R E USINESS EADERS MERICA Mrs. Gamble shows two-hour office block member Karen Brown how to replace the typewriter ribbon. C Row 1: Angelia Gay, Thersa Wasko, Denise Kilsrease, Kelly Garrison, Casanda Pauldingg Row 2: Marny Roche, Cathy Morrison, Jennifer Veasey, Suzanne Peeterse, Karin Brown, Liz Kintner, Tonette Kitt, Mrs. ' Gamble, Row 3: Cheri Turfm lington, April Dolgow, Elizabeth? Thomasli Robyn Arnold, Gina Roche, Darlene Williams. Tom-Wat is here! That was the writing on the chalkboard as we walked into the room. Boxes covered the floor, desks, and filing cabinet. Members plunged in, opened boxes, and inven- toried the gifts and goodies. The Future Business Leaders of America collected over 53,000 and made a profit of over a 51.000 after all ex- penses paid. This money went hand and hand with lugging heavy cardboard boxes around, filing out quantity sheets, and calculating prices. Members of FBLA took the two-hour office block during 5th and 6th periods. The twenty girls spent tedious hours learning about filing, letters, memos, documents, calculators, transcriptions, word processing, and general office procedures. Officers: Left to Right: Gina Roche, Pres.: April Dolgow, Sec., Robyn Arnold, V. Pres., Denise Kilcrease Ass't. Treas.: Elizabeth Thomas, Treas. 'T73?',n ' l . W S, L.. , 4 3 L ,3y'L5g7+- fq,4gg,!i sip if si' iifwem. V 'Z .fTW?5f. A ' maillist P s f ig . , 2 ll. ,,,' C VL A FUN A xiii Hal 'DT 5511 5Bif By the end of the year, the girls had become a special family. Mrs. Gamble had taught more than business skills. She taught them how to survive in a business world. Students learned to work with others and understood how to work within a system. Perfection's the name of the game, re- marked Mrs. Gamble. - Elizabeth Thomas Gina Roche appreciates her new panasonic typewriter as she indexes 100 names. f the fun of ordering a t-shirt is thinking of a name, nickname, or label for the back of your shirt. Who is Ape Dog? Luv Bug? Shorty? X FBLA 24.3 With Lights, Makeup, ond Scripts iii 1 'till - 5 RIAI ' IIA ' his il' 4 The Doctor played by Nathan Renaud receives a rude welcoming from the complaining housekeeper Enrertoins Sponsor: R. Replogle Lori Fish. The Devil alias Greg Ayres appears with the intention of claiming Phillip Morlock's soul. lr Luigi Lanconi and Phillip Morlock portrayed by Tim O'Brian and Peter Delevett slug it out while the rest of the cast of l'Rest Assured watches in anticipation. 44 Drama Club ,911 S f rs.. L, Quiet on the set and Action! With that the video cameras started rolling and so began the opening night of Rest Assured. The Drama Club performed their fall produc- tion, Rest Assured on November 6th and 7th. The play centered around Phillip Morlock's greedy lifestyle. The cast of characters included Pete Delevett as Phillip Morlock, Rebecca Stevenson as Mary Morlock, Tim O'Brien as Luigi Lanconi, 'M 7 gy as and Eddie Spears as Joe Lanconi. Bye Bye Birdie was the Drama clubs spring production. lt was a musical and the WHS chorus, along with actors and actresses made it a success. The Drama Club also held a fund raiser. Members sold merchandise to help buy lighting for th stage. With increasing popularity, the Drama Club had a very 'lproductive' year. Greg Ayers directs Barbie Replogle and Camera man Tim O'Brien on the Drama Club's float. Phillip Morlock lPeter Delevettl receives the wrong end of Luigi Lanconi's iTim O'Brienl vengeful actions. Row 1: Barbie Replogle, Andrea ' Housand, Lori 'Fish, Peter Delevett, Rebecca Stevenson,.Mrs. Replogle, Tim O'Brien, lMrs. lngebretsen, Heather Torrence, Melissa Pursell, 1 Beth Padgett, Row 2: Nilgki An-A drews, Kris Gray, Jenifer Clay, Geoff Nagel, Robin Moore, Nathan +4 Renau, Jill McAfee, .Susan '-Epps, Nicloe LeMarsh, Sandi Trehern, Row 3: .Clorissta Johnson, Liz ' Baisden, Suzanne Gibson, ,Gil Hayag, Greg Ayers, Darla Brewton, Liane Olmstead, Jennifer Moore, Ami Delevett, Heather Matolay, Todd Burrusg Row 4: Susan Morris, Julie Korte, Kit Deason, Doug Mitchell, Chris Christian, Eddie Spears, Tre Chipman, Chris Hudgens, Jennifer Myers, Jennifer Orlando, Leslie Gore. Drama Club 24 To increase the students' awareness and interest in science was the goal of the Junior Academy of Science. The club started the year off by hosting Dr. Jerry Gurst from the University of West Florida. Dr. Gurst provided the members with information on college preparation for science-related majors. The club also invited other speakers including Dr. Marsh from the University of West Florida. ln addition, the club helped in the setting up of the school's first Science Fair in the spring. And throughout the year the Junior Academy of Science made astronomical observations at the beach under the supervision of Mr, Moore, the clubs new sponsor. Members of the Science had fun as they learned more about science and science-related topics. - Linh Truong lv ' ., . , -1 l .skvrnrwmw , , - ,J 1 W V.W,W,,,,,Q . Science members Brad Duncan and Linh Truong add a flicker of humor into their senior superlative photo, Row 1: 'Linh Truong, Clair Kingryg Row 2: Richard Reid, Caroline Holland, Lee Smith, Ernie Lansford, Melissa Elebash, Nyasha Junior, Blossom Daviesg Row 3: Ce Ce Boone, Will Riehm, Mike Raines, Hunter Pfeiffer, Scott Lores, Jason Tanner. 51122116 Club With o Double in the Fifth owiiiic O.K., Bowlers, hold up your practice and start rolling for scoreln As the Cordova Lanes PA. echoed throughout the snack bar and the gameroom, Wildcats dropped their french fries and deserted their beloved Space lnvaders to join their teams. Within minutes, the roar of balls thundering down the lanes began to drown out both the driving beat of the jukebox and the laughter and shouts of the excited bowlers. While some bowlers preferred a devastating curve, other opted for the good ole' straight ball. No one style guaranteed immunity to the dreaded gutter ball which always seemed to pop up in those pressure winflose situations. The strike, a bowler's best friend, also appeared often in the tenth frame to help lead the team to a dramatic victory. So ended another pleasant afternoon of throwing strikes in the fast lane. - Jason Carr. Kevin McClammy, Sgt. at Armsg Scot Maltby, Sec.g Donna Boling, V. Pres. and Treasg Richey Merritt, Pres. Practice makes perfect as bowler Chris Varnadore prepares to roll a strike in the fast lane, Row 1: Mike Wilson, Sean Maltby, Chris Varnadore, Cheryl Blackmon, Renee Delorme, Crystal Fraser, Cheri Lang, Donna Bolingg Row 2: Richey Merritt, Kevin McClammy, Scot Maltby, Ed Schulz, Charles Dinsmore. Sponsor: B. Gaines Bozzlmfi, Club 247 Officers: Kelly McClure, V, Pres, Kit Kievit, Pres., Vanessa Padla in words G octions Treas French club member, Sabrina Miller, anxiously waits for the opposing team to serve the ball A rzfun ueeu R Kit Kievit gives his senior English class a summary of the novel E H f ' Q C - slam' 1st Row: John Hamilton, Geoff Nagel, Kelly McClure, Kit Kievit,- Vanessa Padla, Rhoda Lea, 2nd Row: Sabrina Miller, Michele Fischer, Catherine Louy, Larry Waszink, Trina Edwards, Stephanie Ellis, Nysha Junior, Angie Kyleg 3rd Row: Jenny Desmond, Tammy Disney, Lori Mann, Jennifer Spiwack, Melissa Elebash, David Klingman, Clair Kingery, Sheri Curry, Penny Spurigog 4th Row: Bil- ly Pike, Kathryn Mitchem, Brad Dun- can, Peter Delevett, Suzanne Gib- son, Scott Brown. 8 Prem b Club .,-IIN I, ,Wil RANGAIS ,,, Fun-filled, Action-packed, and Awesome were adjectives used by French Club members to describe their club's year. With Kit Kievit as President, French Club was always in contention during club competitions such as Club Week and Homecoming. One of the largest clubs in the school, French Club's size enables them to spon- sor many events that brought happiness to others. During the week before Christmas, members visited the Escam- bia County Nursing Home and brought joy to the residents by singing Christmas carols and giving gifts. On Valentine's Day, French Club conducted their annual carnation sale, which spread the Valen- tine's Day spirit of love throughout the halls. The year concluded with the annual steak dinner for French Club members. Mr. Robidoux prepared the meal to show his appreciation for the great year that had come to an end, - Billy Pike. Geoff Nagel and John Hamilton dress as true frenchmen for the French club float. L' rfb, .I an Haas diritti wie, YTEAU jgjaerlouerrw ggfiags mock, I i,Ui'i+Qfl'om seief, 0oQ1llcuQW Cyorveti 1 ,-ii, ,az , ' Fixx' eg, lst Row: Anne McBrayer, Cindy Levi, Deanie Turbeville, Chris Wu, Daniel Hart, Dung Ha, Chris Jones, Bart Edwards, 2nd Row: Sylvia Wood, Dawn Nolen, Rachel White, Tracy Bond, Laurie Snowden, Adrian Kelly, Lori Phillips, Holly Benson, Angelique Halter, Krystal Donal, Kara Slade, 3rd Row: Amy Pote, Leigh Precise, Liz Baisden, Di- neen Mansfield, Amy Holcombe, Carrie Brown, Aimee McMullen, Robin Lowe, Mary MeLeod, Megan Benson, Kathy William- son, Laura Samala, 4th Row: John Kelly, Jason Tanner, Steve Flowers, Susi Kennedy, Christy Kirk, Elizabeth Mitchell, Susan Kennedy, Beth Parker, Shannon Wilson, Alexa Larson, Casey Crutcher, 5th Row: Tim Messier, Charles Dismore, David Pote, Jennifer Dolgow, Nikki Andrews, Christine Kinsella. Frerlvlu Club 24 The mind-blowing con' jugations, declensions, and deponent verbs of the Latin language became suspenseful and exciting as members of the Latin Club competed first in District Forum at Mosley High in Panama City and later in State Forum at the Hyatt in Orlando. Besides each member taking writ- ten tests, which varied to mythology, the club had a scrapbook in which ac- tivities of the club during the year were captured in pictures and imprinted on decorative backgrounds. The scrapbook served not only as a memento for the club but also as a display of the club in both District and State Forums. For many years the Washington Latin Club from grammar to history U Ltlfnl Club won first place for its scrapbook at the district level, and during the last summer the scrapbook took fourth place at the national level - something for members, especially historians Stephanie Carr and Kathryn Mitchem, to be proud of. To make an an- cient and dead culture alive and exciting was what the Latin Club was all about. - Linh Truong -warm f. - -,. f -an .ni A. a .aa-af,.r.B..:. im 5' nw ui: .. Brad, Lisa and Heather capture the spirit of Rome on the Latin Club float. Row 1: Lisa Morreale, Stephanie Carr, Kathryn Mitchem, Brad Dun- can, Heather Lindsay, Cathy Huf- fordg Row 2: Mike Gibson, David Jonson, Kristin Beeman, Linh Truong, Marcia Baris, Mrs. McAfer- tyg Row 3: Baron Morris, Danny Kill- ingsworth, Susan Hamilton, Jennifer Troxel, Alison Warren, Megan Bevinsg Row 4: Mike Bolling, Richie Beal, David Klingaman. ,j R Shedding New Light Corries on the Old Trodition Officers: Lisa Morreale, Sec., Heather Lindsay, Treas Stephanie Carr, Hist.g Kathryn Mitchem, Hist., Brad Duncan, Pres.: Kristi Mitchem, Vice-Pres +,, 4 W tl Leorning o Longuoge Foreign to All, USSIIAN Explores Q. L 1' ,, K an '-P I 1 !l..l -..... i il 'G f aG'?5'1i9. ' nl Moscow or Bustll' was Rus- sian Club's motto, symbolizing the high intentions they had for the past year. For the past three years, the club had attended the annual Russian Competition, held at Florida State University. Though the competition was in April, the comrades began prac- ticing and studying at the begin- ning of the year in hope of achieving a trip to the Regional Competition. A gold medal at Regionals was rewarded with a trip to Moscow. Russian Club developed their motto in the spirit of such rigorous competi- tion. The club also participated ,gn rf I 135- J TC 'Nur V ,.,aBt J lll in other academic, as well as community, events. The club designed a float for the Homecoming festivities, sold refreshments at the Halloween Carnival, and won third place for their display during club week. In the community, the Russian students sponsored a needy family during the Christmas season. Sponsored by Alex Golovko, fifteen active members contributed their time and attention to making the most of their club. Together, these members guided the club and set a standard of excellence in foreign language. -- Chris Stegner , rllv 7 VV , V ,. ,,..,. , A . . ,V,, M'rf'M-we-rs' fffew. -M.t.,1 4 l n' ,f -1- 1 ,a,,,r.. L , , rw A A Sponsor: Senor Golovko Jill McAfee, V. P4 Sydney Decker, Treas.g Jeff Brown, Sec.g Donna Hayden, Pres. Y Tip Tyler, Donna Hayden, Sidney Decker, and David Key show their homecoming spirit by singing Russian songs. Row 1: Jill McAfee, Donna Hayden, Sydney Decker, Jeff Brown, Row 2: Roger Serwack, Tip Tyler, Traci Lester, Mike Isler, Kristin Raymond, Row 3: Kathryn Roberts, Garland Borowski, Angel Cole, Chance Regina, Trent Martin. Raman Club 2 51 Speaking o Longuoge Close to l'lOfTlQ Traweek, and Grover Robinson celebrate their lst V place club float in the homecoming parade. With ribbon in hand, Tim Fox, Claire Zorn, Vincent PIANISH CLUB f Communicotes .- I iii f I I Spanish Club has really come together this year, said Angel Cole, President. The Club newly sponsored by Elda Antunez had a very productive and rewarding year. The club boasted one ofthe largest memberships and participation from their members. Their hard work resulted in a lst place in the homecoming week float competition. The club held can drives in order to help organizations which help the needy families in the Pensacola community. Spanish Fiestas gave the members a fun time while they learned. The parties gave the members a new and exciting look at the Spanish culture. The parties were a fun experience that brought the club together. The members combined enthusiasm and dedication in a mixture which created a successful club. -- Sarabeth Thomas 1 Sponsor Elda Antunez After the excitement of homecoming, Vince, Matt, and Claire anxiously wait for the relaxing parade ride downtown. 252 Sbunifh Club i -Q ..- ., M 1 ,A ,Y ' ll V , . , ,,, ing., 'V' S l sr 1, . xx S.. sw.. p ,,,.-w , I C V rg?-91? ,af 5 A x in U K wis X Q Q Q x if mn ' ,x f Anticipating the path of the volleyball, Angel Cole and Billy Carroll get ready to hit it over the net. While some members go home, others spend the afternoon trying to win the club volleyball competition. ,f . , ,, ,.., H , Wx. , ,1 Q if ' f-if H ' U s gf 1 ' ' ' . ' , , , 9 g,i,,,, We 3,4 my. -, ,,.-- M , 'swa y L X it ,, , f-I , V -,Z -5 -, ' 9 my ,. 5 x .ap i , tx A-ay H . at ,,,,,,...,A:,4:r:,ig ,M , y ,JM . lg , i' ' J, -Jw' , ,ww-f-. f -5 If 5 - 1, ., ' ' if I .' , 1. J, - 'W lf. r 's , ' ' and 3 ' 1 . V . ' rv l m L i v,,f, . ., f 4 Z., l Row 1: Kay Pinnix, Kim McGraw, Angel Cole, Amy Childers, Mary Petruskag Row 2: Jennifer Traynom, Laura Carlyle, Amy Pittman, Elizabeth Zorn, Sydney Decker, Grover Robinson, Jennifer Newth, Michelle Riera, Tricia Mudler, Dawn West, Aaron West, Leslie Gore, Susan Morris, Tammi Arnold, Shonnie Capps, Row 3: William Worth, Lori Fish, Matt Vinson, Jill Richburg, Diane Brooks, Kris Gray, Jamie Hoyt, Lee Leidner, Meg Turnipseed, Angela Ballenger, Susan Epps, Row 4: Michele Plant, Claire Zorn, Vince Traweek, Kristen Marsh, Vicky Miller, Jennifer Wood, William Duffnerg Row 5: Billy Carroll, Ken Christian, Frank Morreale, - James Clark, Buddy McGraw, Harland Cason. fi? I ' Spani.fl1Cl11L- 2 254 C111 Par Shoring Spirit ond Screorns, Wos the Ultimote Fon Pausing a moment, Frank 1 Murphy explains what signs need to be made for the Lady Cats' games. During the Homecoming Parade, Cat Pac members cheered and chanted continuously throughout the float judging. What do you do when your school is a contender for the girls' basket- ball state championship - but little fan support? Answer: Form the Cat Pac! Alan Shaw and Frank Murphy did just that during the '85-T86 season, and the Lady Cats went on to win State, destroying all-comers in the process. What started out as a group of loud and proud Wildcat basketball fans became a full-fledged club, Supporting not only basketball, but football, swimming, soccer, and other sports. Locker decoration, sign painting, and fund raisers kept club members busy throughout the year. The real fun, though, was at the games. When Friday nights rolled around during Football season, the 'Pac's support was all vocal. At many of the gridiron battles, players looked up to find the stands washed out in a sea of loud and proud, yellow Cat Pac t-shirts and sweats. With hundreds of cheering Packers behind them, the football team concluded the regular season with a District Crown!!! Then came basketball season, and the cheering was louder than ever. With the sixth Man behind them yelling, Bust a Dollar, Bust a Dollar, the girls team kept mowing down the competition, reaching that dollar 1100 points! in two consecutive victories! What started with a few fans ended up with the whole school sup- porting sports and the athletes. Throughout the season the cheers of ,Y the Cat Pac echoed, We Love our Wildcats, We Love our Wildcats, We Love our WI-lS!!! - Jason Carr Most Seniors: Left to Right: Ronda Band Sabrina Wallace, Dean Richie, Shon! da McDonald, Razohan Gross Theresa Gardner, Cathy Hufford Stephanie Carr, Kathryn Mitchem: Calvin Gillis, Brad Newman, Robyn Arnold, Elizabeth Thomas, Frank Mur- phy, Not Pictured: Todd Snovvden, Tim Slay, Craig Worley. bg ek- ' Qxgltllllll Ui , if 5 X Spirited r f f -I f 1 ,l X , ., ..4. V - ff,- X fi gs . ,,,,' ' fi' rweeeaa e away W? 2 1,7 1' Juniors: Left to Right: Heather Young, Koehler, Keri Roberts, Not Pictured: Sean Roark, Debbie Orth, Angela Rupp, Christine Pierce, Tom Meehan, Randy Monica White, Regina Robinson, Kim Johns. Row 1: Stacey Nutzell, Angela Ballenger, Meg Turnipseed, Susan Weber, Lori Phillips, Adrienne Kelly, Jason Van Matre, Tracy Bond, Alison Warren, Stephanie Sanders, Tracie Lester, Michelle Bierag Row 2: Sabrina Wallace, Stephen Boyd, Tommy Meeham, Ronda Bond, Frank Murphy, Teresa Gardner, Heather Young, Kathryn Mitchem, Stephanie Carr, Sarabeth Thomas, Lee Caral Griften, Amy Hicks, Amy Pitman: Row 3: Danielle Johnson, Jamie Hoyt, Lucy Ho, Kaye Robinson, Tricia Mudler, Shelly Scotto, Stacy Knock, Jennifer Newth, Dana White, Allison Slighter, Audrey Busbee, Shannon O'Brien, Jennifer Wood, Diane Brooks, Phillip Hicks: Row 4: Allison Cobb, Chris Christain, Keri Roberts, Brad Newman, Sean Roark, Monica White, Krystal Donald, Jennifer Waston, Ruen Castillo, Pam Espersen, Alexandra Doerrer, Kathryn Roberts, Alicia Blum, Row 5: Kim Currie, sf-'r-H - Elizabeth Thomas, Amy Holcombe, Amy Walker, Andre Nelson, Nikki Wingate, Tina Wild, Stephanie Wynn, Dawn Orth, Debbie Orth, Dean Richie, Calvin Gillis, Razohnn Gross, Row 6: Sabrina Washington, Beth Baggett, Robyn Arnold, Kris, Linda Sanders, Cena Underwood, Angela Rupp, Christi Tomlin, John Kelly, Liz Baisden, Tammi Arnold, Susan Morris, Shando McDonald, Jessica MeDonald, Row 7: Braden Ball, Buddy McGraw, Ken Chris- tian, Adrian King, Chastity Kutzer, Jen- nifer Fell, Marybeth Wright, Tammie Struggs, Clossiti Johnson, Shandra Hall, Paris Brierly, Kelly Cushing, Katrell Jones, Gwen Washington. .,-' 3i ff p:,,,J ' 1 - J . , ,, ' ' A H- . - ,-Y.... .Q:ji..,-. .,.... -.. ,.., .,., A F . -- 1 I?:..wG'?T:::mr' 'rio' . . .. V of ,',, f fff ' .e 4 QE2,,,,,'f ' fs 'MP' - S' W 5' pf' Q it .. 1 sf ' ' if-1 iiifii f f J . X Q . , as M . if 5 . i 1 ' V l .f .SI , - - . R , , . . ,, i - +L , 42 ' , 'Z 4 ' Q P w!f,zf1,r:rVffi1.e.f'fQ h -s,1',.V ,,,,,,,., -,T 9 ,, N . A-x. .7 J' ' ',., ' 1' mi- M V M., ' .. ' . ,av 4-9-'Q A W N V wr In ' 'Q' - 2 .- , if f- ' . y l ,1-V6 . ,-,, -vw-v..-,VA-. ffygggs M. ' - ' ' , I'-A, ' , . 'f . . ' . l V Q ,- ' li .V ' W., - T U i K - - i T . Q . J t .,,,,. V .V V - V x - f ' 1' , -' ' i 5' ' . .1 A .V vtv- : --epzrfrfa my .M ' - , . V' , , 'A -, I E V,-:hae t .i , L I ., .., f .. Sf - .1 ,- 1 5' 5, , wi A- if u V4 ' . . . .i... Q ,W , , V ' ' ' .4 vy,jm, ,.-1 V, 3 ,A W gg , '- - . Vi- ' Tb- ,f ' ' .. , VA' 'H V .il if KS 'ix N . ll' - - 1 Tv I , . - . fit if e,gVVVVisV- 1, . i , fa 1 ' -3 ' N ' , u. 4 V A T41 I ,' f T' T fT'.4 ' -if . ' '. A. ' . H ,f ' W-' . ' ' - -VV . V4 - ' 4 -2 Q..--nl, an K ., A , -I . M, ,V N , . .-.-. V ag Q P W, .. . Va V, . as J. I M, . , ,, . , , A r U, ff . , , T 1, - : ,1.f, ' ,. : , , .- L f ' ' 1- . f- - i 1. f.. V , . , f, X ,V . i by L L K V '53 ,. A f 4 1 3, , . if 49. , . .. f if ' 'vii ' cv- A T A -V J iff ' ,. 1 I V - I' 1 . ' . 5 5 I its-,'.f f ' iii . '19 s ,1 I, f ' '- ' K '- ffl Vs, V . e ,,,f, A 2 'S .fern -, , 'S ' .. . ef 71. , ffffffi 1 I ' ..Af't'f f' ' M' - . .V i f'- :--ll 1.1. filajf.. f 3 1 ff ' , If , .4 1 J 5 , sf 7 ' f - ' J v , I V .i Q . . can fr V- y f. .. , 3.1. Q ' W- . T' 1 Q it ff ' f 'f , E 'Tw 'iff' Tse- C' I ' V -:Q Q .. Mt V I 1, Y f , lg. 4 y VY ,I x ff , A. .1 'xi mil., 'Niki' ,Ax I- -,Q by . sv ' ,Qc ri . ' f i 'Shelf - ' ' 'Sf ' ' - ' ' W , , . -ns., I H3 . '-' 4 , , -M - 4 Q I ' i ., ,. fV f ,I Q ---V I - P23-155:5 2 1 f f - -lv! 4' I 4. ,, yf z' I T Q A rs 1 4 I L ne- A, A... ...z .44- - -W-4-vm-f-V,f1c.f, ,,..,.,,., .,. Wildcats 0 V,2i?44!?fi: Sophomores: Standing: Shelley Scot- to, Jennifer Wood, Sarabeth Thomas, Pam Espersen, Alex Dor- Matre, Lori Phillips, Adrienne Kelley, Angela Ballenger, Jennifer Fell, Buddy McGraw, Standing: Liz Baisden, Lee ag, 6 ff ,gee ' cf K V,.,,,,7, W Freshmen: Left to Right: Andrea Cena Underwood, Mikki Wingate, Nelson, Kris Gray, Amy Holcombe, Amy Walters, Chastity Kutzer, Lily Ho, Stephen Boyd, Dawn Orth, Jamie Hoyt, Stephanie Wynn. rerg Sitting: Katrell Jones, Krystal Donald, Jessica McDonald, Susan Weber, Tracy Bond, Jason Van- Carol Griffin, Amy Hicks, Tammi Ar- nold, Not Pictrued: Laurie Snowden. Ca! Paz' 2 A n ram, Kim Alexander, Kimberly, 65, B.T. Ladies SL Gents 12, Cat Pac 12. Allen, Donald, 65. Allen, Jenifer, 65, Band 9-12, Chorus 10-11, ABC Club. Allen, Laura, 65, Civinettes 11-12, Nope to Dope 11-12, Spanish 9-10, Surf 10, Baseball Manager 11, Soccer Manager 10, Cheerleader 9, DCT 12, Chair- man Project Graduation Committee l2, Chorus 9- 10, Civinettes Leadership Award 1 1. Anderson, Alecia, 65, B.T. Ladies 8L Gents 11-12, Band 9-11, Perfect Attendance 10-11, Band Bar 10-1 1, Band Letter 9. Anderson, Mark, 65. Angstadt, Laura., 65. Arnold, Prince, 65. Arnold, Robyn, 65, FBLA 9, 12, Civinettes 12, Drama 11, Spanish Club 9, j.V. Cheerleading 9, Freshman Cheerleading 9. Aston, Wendy, 65. Atkins, Demetri, 65. Ave, Robert C., 65, NJROTC 9-12, V.F.W. Conduct Medal 1 1. Ayres, Gregory, 65, Drama Club 11-12, French Club 10-1 1, Cross Country 9, Newspaper 12, Camenae 12, Student Council 9-12, NEDT High Score 10. Bagget, Beth, 65, Civinettes 11-12, FBLA, Spanish 9- 10, Tennis Team 10-1 1, SGA 9-12. Baker, Marc, 65. Baldwin, Timothy, 65, Drama Club 12, DECA 12, Band 9-11, Band Bar 10-11, Band Letter 9. Barge, Barbara, 65, French Club 10-12, Honor Socie- ty 10-12, Beta Club 11-12, Deca 10, Math 11-12, B.T. Ladies 84 Gents 12, Baris, Marcia, 65, Math Club 9-12, Sec.fTrea.s. 10- 11, Pres. 12, Latin Club 9-12, Beta Club 10-12, Drama Club 9-11, Science Club 11, Calculus Club 12, Honor Society 10-12, Camenae 10-12, SGA 9. 1 1, 12, junior Classical League 9-12, Newspaper 12 Quill BL Scroll 11-12, Prom Committee 11, In- terClub Council 12, American High School Merit Finalist 11, Top Ten Student 9-11, English Award 9-ll, NEDT Award 9-10, PSAT Award 10-11, Latin Award 11, Kiwanis Award 11, Who's Who Among American High School Students 10-11, Outstanding High School Student in Florida 11, Hugh O'Brien Youth Foundation Ambassador 10, JETS Award 10. Barnes, Dale, 65. , Bartholomew, Eugene, 65, Varsity Basketball 10, Honor Society 9-10, Tutor Organization l0,,job En- try 10, Student Council 10, Citizenship Honor Award 9-10, Honor Roll 9-10. Bates, Alicia, 65. Bates, Mike, 65. Beason,james, 65. Bennett, Noelle, 66. Besch, Melinda. 66. Blackburn, Dawn, 66, Action Club 9-12, Honor Society 10-12, Chorus 1, Latin Club 10, Home Economics Dept, Award 9. Blake, Roger, 66. Blanchard, james, 66. Blevins, Daniel, 66. Bogan, Ben, 66. Boling, Donna Lynn, 66, Civinettes ll-12, Bowling Club 11-12, V.-Pres. 12, Student Council 11. Bond, Ronda, 66, DECA Club 12, Cat Pac 12, Honor Society 10, Varsity Girl's Basketball 9-12, Varsity Girl's Track 9-12, Yearbook 1 1-12, SGA 11, Perfect Attendance, Graffiti Yearbook 1 1 Bc 12, Graffiti Award 1 1, Borowski, Garland, 66. Bradley, Kevin, 66. Braslow, Richard, 66. Breitenbach, Neil, 66, Honor Society 10-12, Top Ten juniors, Drafting Award 11, lsr Place National Heritage Week Essay Contest 11, Pensacola Kiwanis Achievement Award 1 1, National Merit Commenda- 6 Senior Index tion 11, Top Ten Sophomores, Top 20 Freshmen, Biology Award 9. Brewer, Candy, 66. Brewton, Darla, 66, Drama Club 12, Women's Var- sity Soccer l2, Chorus Singers 10-12, Band 9-10, Flag Corps 10, SGA 9. Briggs, Freddie. Brison, Benita, 66. Brockner, john, 66. . Brooks, Dave, 66, Honor Society 10-12, Nope to Dope 12, Golf 12, Varsity Football 10-12, Freshman Football 9, j.V, Baseball 10-1 1, Weightlifting Team 1 1, Men's Track 9, Fellowship of Christian Athletes 10-12, First Team All Northwest Florida Football 12, Mathematics Award 9-10, Industrial Arts Award 9, Top Freshman Award 9. Broughulames, 66, Varsity Soccer 11-12,j,V. Soccer 10 ' Broughton, Raymond. 1 S ' Broussard, Kent, 66, Band 9-12, Freshman Basket- ball 9, Freshman Football 9. Brown, Christopher. Brown, Karen, 66. Brown, Scott M., French Club 9-12, Photo Club 12, Scholar's Bowl 12, Honor Society 10-12, National Merit Commendation 12, Honor Roll 9-12, lst Place History Essay 1 1. V Brown, Tracy, 66. Brye, Arthur, 67. Bryson, joseph, 67. Burghard, Ivan, 67. Byrd, Clinton, 67, DECA 12, B.T. Ladies SL Gents, Football 9, NJROTC 9. Campbell, Fred. Campion, Sean. 1 Cannon, Michael, 67, Varsity Football 11-12, j.V. Football 11, Men's Track 10-ll, NjROTC 9-12, Varsity Letter Football 1 1-12. Capps, Shonnie, 67, Honor Society 10-12, Beta 12, Spanish Club 11-12, Symphonic Band 9-12, Mar- ching Band 11-12, Orchestra 11-12, jazz Band 12, District Superior Solo 84 Ensemble Medal 9-1 1, State Superior Bc Ensemble Medals 9-1 1. Carmouche, john, 67, Varsity Football. Carr, Stephanie, 67, Latin Club 9-12, Historian 11- 12, jayettes 1 1-12, StudentCouncil 11-12, Student Council Fundraising Chairman 12, Nope to Dope 12, Co-Chairman, Beta Club 12, Honor Society 12, Prom Committee 11, District Latin Forum lst, Na- tional Latin Forum 4th, NEDT Award 9-10. Cartaya, Michelle L., 67, Senior Superlative Best Looking, Spanish Club 9-12, Civinettes 1 1-12, Nope to Dope 12, Cat Pac 12, Drama Club 10-11, Calvacade Performer 11-12, Prom Committee 11, PSAT High Achievement Award 10, WHS Junior Miss 12, Runner-up Escambia County junior Miss Pageant 12. . Carter, Fred, 67. Cassiano, Deena, 67, DCT 12, Drama ll-12, Civinettes 1 1. ' Castille, Oren. Castillo, Ruen, 67, Nope to Dope 12, Cat Pac 12, Civitans 12, lnter-Club Council 12, SGA Class Rep. l2,SGA 11,j.V. Baseball 10-11. Chandler, Sheryl, 67. ' Chao, Emory, 67, Honor Society 10-12, Beta Club 11-12, Nope to Dope 11-12, junior Academy of Science 11-12, Latin Club 9-11, Russian Club 11, Prom Committee 11, lst Place School History Fair 11, lst Place Regional History Fair 11, 2nd Place Latin District Forum 10, 3rd Place Latin State Form 10. Chew, Kim, 67, Varsity Cheerleader 11-12, .I.V. Cheerleader 10, Freshman Cheerleader 9, DCT 12, Cat Pac 12, Civinettes 11, Most Spirited 12, Cheerleading Letter 10-1 1, Cheerleading Certificate 9, Spanish Club 9. Childers, Amy, 67, Spanish Club ll-12, Beta Club 12, Nope to Dope 12, Civinettes 11-12, Honor Society 12. Chipman, Donald, 67, Christian, Chris, 67, Drama Club 12, Cat Pac 12, Nope to Dope 12, Swimming 9-11, Varsity Track 11, Yearbook 10-11, Swimming Letter 9-11, History Award 9, Yearbook Layout Award 10-11, lst Place 11. Clapp, James, 67. Clark, Peggy, 67, Chorus 1 1-12, Singers 12, Key Club 10, Spanish Club 10. Clausell, Francetta, 67, Basic 12, Varsity Women's Basketball 11-12, j.V. Women's Basketball 10, Women's Track 10- 12. . Cleaveland, Rebecca, 67. Cobb, Allison, 67, Swim Team 9- 12, Track Team 9, Academic Achievement Award 10, Swimming Award 9-12, Track Letter 9. Cobb, Ramona. Cobb, Winston. A , Cole, Angel, 67, Beta Club 12, Spanish Club 9-12, Russian Club 11-12, Nope to Dope 12, Varsity Cheerleader 11-12, Soccer Manager 9-12, j.V. Cheerleader 10, Freshman Cheerleader 9, Women's Varsity Track 9, Volleyball Manager 9, Honor Socie- ty 11-12, B.T. jayettes 11-12, Homecoming Queen , 12, Personality Plus 12, Spanish Club Sweetheart 12, junior Class Sweetheart 11, President, Spanish Club 12, Senior Superlative Personality Plus. Cole, Keith. Coleman, Anthony, 67, BASIC 10-12, DECA 12, Varsity Basketball 10-12, Men's Track 12, Freshman Football 9, Freshman Basketball 9, NJROTC 11-12. Coley, Darah. Collins, Chelesa, 67, DCT 12, Flag Corps 9-11, Band Bar 10, Band Letter 9. Copeland, Erin. Couture, Dana, 67. Cowden, Robbie. Crawford, Melissa, 68. Creel, Patty, 68. Crews, Lisa, 68, Nope to Dope 12, Cat Pac 12, Action Club ll-12, Spokes ll-12, BASIC 11-12. Currie, Kim, 68, Drama Club 12, Civinettes 11, Spanish Club 11, Women's Cross-Country 9-10, . Women's Track 9-10, Diamond Girl for Varsity Baseball 11, Play Performer 11, SGA 10, Most- Spirited WHSjunior Miss 12. Curry, Sheri A., 68, French Club 9-12, Beta Club 10-12, FBLA 10, Honor Society 10-12, Camenae Staff 12. Curtis, Kenneth, 68, Flag Corps 10-12, Flag Corps Captain 11-12, Civitan 12, Drama 12, Bowling 12, Spanish Club 9-1 1, Computer Club 10, Band 9, Stu- dent Council 9-12, Trend-Setter 12. Dailey, Stephanie, 68. Daniels, Leonard Michael, 68, Fellowship Christian Athletes 9- 1 2, Baseball 9-12, Football 9. Davies, Blossom, 68, Math Club 12, Science Club 12, 'Beta Club 9-12, Honor Society 9-12, Latin Club 10, Camenae Publications 12, World History Merit Award 9, 2nd Place District Latin Forum, Vocabulary 9. Davies, -Leah, 68. Davis, .,Christeia, 68, Women's Track, Varsity Women's Basketball j.V., Varsity Women's Basket- ball 10, 11, 12,, Number 1 Girl's Basketball Player in State of Florida, Basketball Captain, Senior Superlative Most Athletic. Davis, Gayiief, 68. Davis, Mark W., 68, Nope to Dope 12, Key Club 11-12, Beta Club 12, Art Club 11, Spanish Club 10-11, Football 9, SGA 9-12, Newspaper 12, Prom Committee 12, SGA Treasurer 12, Nominee - U.S. Senate Youth Program 12, SGA Calendar 10-12, Who's Who Among High School Students 12, 2nd Place - Talent Show 1 1, Sophomore Class President 10, 2nd Place Art Focus Award 10. Dawkins, Curtis, 68, Chorus 12, BASIC 12, Varsity Basketball 12, j.V. Basketball 10-11, Freshman Basketball 9, Track 9,'Varsity Basketball Player of the Week 12. Decker, Sydney, 68, Russian Club 11-12, Spanish Club 9-12, Key Club 12, Civinettes 11, Soccer Manager 12, Honor Society 9-12, SGA 11-12, Nope to Dope 11-12, Prom Committee 11, Treasurer Rus- sian Club 12, Nope to Dope Council Member 11-12, 1987 SE IORI DEX Russian Award 1 1. Delacruz, Chrispin. Delevett, Pete, 685 Drama 9-125 French 9-125 just Say No 12: Honor Society 10-125 Scholar's Bowl 1 15 Newspaper 11-125 SGA 125 Camenae Staff 115 Chorus Vocal Ensemble 115 Play Participant 9-125 Co-Editor Newspaper 125 Senior Class Secretary 125 Pride Program Award XVinner 125 Senior Superlatives Most Likely to Succeed, Most Talented 125 National Merit Semi-Finalist K Finalist 11-125 Outstanding English Student 10-1 15 Drama 1 15 Top 10 Award 9-125 Outstanding French 8: Economics Honor Student 105 Quill SL Scroll 11-125 Scholastic joumalisrn Award, Pensacola Press Club 115 Best Actor Northwest Florida Region Award, Thespian Society 1 1. Desorbo, jamie, 68. Dibella, Giuseppe, 68. Dien, Hoa. Dillard, Daphne, 68. Dolan, Melissa, 68. Dolgow, April, 685 Softball 9-125 FBLA 125 Softball Letter 9-125 FBLA Secretary 12. Doolittle, Brian, 685 Photo Club 125 Varsity Soccer 11-125 j.V. Soccer 9-105 Football 95 Nope to Dope 125 Civitan 125 Cat Pac 125 Soccer Letter 10. Dormois, Andrew, 68. Dracos, james, 68. Drasutis, Harry, 68. Driskell, Steven, 685 latin Club 9-115 Suring Club 9-115 Golf Team 125 Swim Team 9-105 SGA 125 Varsity Letter Swimming 9- 10. Dubose, Tina, 685 Drama Club 12. Dudley, Tara Y., 685 Civinettes 11-125 B.T. Ladies dt Gents 125 Beta Club 125 Deca Club 115 Spanish Club 95 Captain of Pom Pon 10-125 Flag Corps 9-115 Captain of Flag Corps 1 1. Duncan, Brad, 68. Duncan, Heidi, 695 La'gniappe 125 DCT 12. Dunlap, Dawn, 69. Dunson, Brian, 69. Dwyer, Carrie, 695 DCT 125 NjROTC 9- 1 1. Earl, jeff, 695 German 125 Surfing 11. Eddins, Lisa, 695 Women's'Tennis 9-125 Honor Socie- ty 9-12. Edwards, Trina, 69. Eggleton, Melaine, 695 Flag Corps 1 15 junior Achievement 10. Elebash, Melissa, 69. Ellis, Hope Rochelle, 695 B.T. Ladies and Gents 125 Civinettes 11-12. Ellis, Stephanie, 69. Engeuan, David. Ervans, Raeanne M., 695 Nope to Dope 12. Eubanks, Alan, 695 Honor Society 125 Perfect Atten- dance 9. Ezelle, Chris, 69. Fairchild, jeff, 695 Varsity Football 10-1 1. Falzone, Terri, 695 Honor Society 125 Photo Club 125 Beta Club 11-125 Spanish Club 9, 125 NEDT Award 9. Farrugia, Alan, 695 Honor Society 10-125 junior Academy of Science 11-125 Swim Team 9-125 Band 9-115 Swimming Letter 9-125 Academic Athlete Award 10-125 Scholar Athlete Award 125 Leadership Award 125 Latin Club 9-10. Fields, jeanne, 69. Fillingim, Hank, 695 Fellowship of Christian Athletes 125 Nope to Dope 125 Chorus 125 Challenger Award 125 Calendar 11-125 Sr. Class Sweetheart 125 Video Club 11-125 French Club 115 Varsity Football 125 Varsity Baseball 10-125 j.V. Baseball 105 SGA 115 junior Class Secretary 1 15 Prom Committee 1 15 Most Valuable 8c Most Dedicated Player Award in Baseball5 Senior Superlative Personality Plus. Finkley, Fernita R., 695 Beta Club 125 Honor Society 10-125 B.T. Ladies 8L Gents 11, 125 Pom Pon Cats 11-125 Flag Corps 10-125 Track 105 Perfect Atten- dance Award 9, 10. Fischer, Michele, 695 French Club 9-125 German Club 1 1- 125 Science Club 1 1-125jayettes 125 Drama Club 9- 105 Camenae 1 1-125 National Honor Society 10-125 Scholars Bowl President 125 Flashback 9-1 15 Chorus 105 Commended Scholar QPSATJ5 Honor Roll 9-125 Top 10junior 115 Top 10 Sophomore 105 Top 10 Freshman 9. Fish, Loria, 695 jayettes 11-12, Pres. 125 Beta Club 10-12, Sec. 125 Drama Club 9-12, Projects Chair- man 12, Sec. 115 Spanish Club 9-125 Singers 125 Honor Society 10-12, V.-Pres. 115 Camenae 125 SGA 11-125 lnterclub Council V.-Pres. 125 Prom Committee 115 DAR County-Wide Winner 125 Top Ten juniors 115 History Fair 3rd Place 115 Drama Festival lst Place 115 Top Ten Sophomores 105 Top Ten Freshman 95 Optimist Oratorical Contest lst Place 9. Fisher, Stephen, 69. Flanders, Cindi, 70. Fluharty, Stephen, 705 Spanish Club 11-125 Russian Club 115 Honor Society 10-125 Scholar's Bowl 125 Flashback Staff 9-1 15 SGA 105 Student of Month 125 lst Place.School History Fair 115 lst Place Regional History Fair 1 1. Forgie, Denise, 705 Civinettes 125 Key Club 125 French Club 9-12. Foster, Lisa, 70. 5 Fountain, Cynthia, 705 DECA 125 lagniappe 12. Fox, Tim, 705 Spanish Club 10-125 Key Club 11-125 Nope to Dope 125 Photo Club 125 Varsity Soccer 10-125 SGA 9-125 Class Representative 125 Manifest Destiny Award 11. Frederickson, Charlotte, 705 Honor Society 10-125 Chorus 10. Gander, Nancy, 705 jayettes 10-125 Beta Club 125 Spanish Club 10-1 15 Tennis 9-105 Honor Society 12. Gardner, Theresa, 705 Varsity Women's Basketball 10-125 Swimming 9-125 Women's Track 9-115 Prom Committee 11. Garrison, Kelly, 705 Photo Club 125 Surf Club 115 Women's Varsity Soccer 125 FBLA 125 Prom Com- mittee 115 State Award - Photography 125 Art Award 9. Gash, Holly, 70. Gibson, Suzanne, 705 French Club 9-125 Drama 9- 125 Science Club 11-125 Photo Club 125 Magazine 9-125 Scholars Bowl 11-125 Honor Society 11-125 National Merit Commendation 125 Honor Roll 9-125 French Award 115 Drafting Award 115 Art Award 115 Art Club 9- 105 Drama Award 105 Chorus 9. Gilbert, john, 705 Nope to Dope 125 Video Club 11- 125 Spanish Club 9-115 Surfing Club 10-115 Prom Committee 115 Freshman Football 95 Calendar 125 Senior Superlative Wittiest 125 Homecoming Court 125 Spanish Club Sweetheart 1 1. Gill, Laura, 705 Cross-Country 1 1-125 Women's Track 1 15 Cross-Country Most Improved 1 15 Cross- Country 5th Place 2 Miler Dis. Ribbon 11. Gill, Randall, 70. Gillard, Vivian Y., 705 Civinettes 11-125 B.T. Ladies lic Gents 125 Deca 125 Student Council 12. Gillis, Calvin, 705 Fellowship of Christian Athletes 125 Men's Track 9-125 Varsity Football 9-125 j.V. Basketball 10-1 15 Weightlifting Team 1 15 Freshman Basketball5 Varsity Letter Football 9-125 NjROTC 9-105 Uncommon Man Plaque 10-115 Varsity Letter Track 95 Weightlifting Patch 1 1. Golovko, Greg, 705 Varsity Football 10-125 Varsity Soccer 9-1 15 Freshman Football. Goodin, Michael, 70. Gforbow, Henrik, 70. Gray, Katherine, 70. Gray, Mike, 705 Varsity Baseball 10-125 FCA 10-115 Pensacola News journal All Tournament Team 115 j.V. Football. Green, Dawn, 705 Beta Club 11-125 Honor Society 11-125 Varsity Cheerleader 125 j.V. Cheerleader 115 Chorus Singers 10-125 VP Chorus Singers 125 Chorus Award 1 15 Perfect Attendance 9. Greeson, Phillip, 70. Grier, johnny, 71. Grier, Raymond, 715 B.T. Ladies 8c Gents 125 Varsity Football 10-125 Track 115 Band 105 Computer Club 9. Grimes, Yolanda, 715 DECA 125 NjROTC 12. Gripka, Mark D., 715 Bowling 10-125 Drama 125 Honor Society 1 1-125 Yearbook 10-1 15 jEA District Award lst Place 10-115 Camenae 9-105 Flashback 9-10. Grissett, Wayne, 71. Gross, Razhonn, 715 Varsity Football. Guy,jeff, 715 Spokes 125 Chorus 11-12. Hall, Troy, 71. Halpern, Rachel, 715 DECA 125 Video Club 115 French Club 9-10. Hamilton, john G., 715 French Club 10-125 Beta Club 11-125 Nope to Dope 125 Varsity Soccer 9-125 Honor Society 10-125 Scholar's Bowl 11-125 Newspaper 11-125 Newspaper Sports Editor 125 SGA 125 Camenae 125 Project Graduation 125 Na- tional Merit Commended Student 125 Top Ten Stu- dent 9-1 15 lst Place Newswriting 1 15 Pensacola Press Club journalism Competition 115 Kiwanis Club Award for Outstanding Scholastic Achievement 115 NEDT Award 105 Perfect Attendance 9. Hamm, Tina, 71. Hardoin, Valerie C., 715 DECA 125 French Club 9-10. Hardy, Wesley S., 715 Chorus 125 Band 9-11. Harris, jamie, 71. Harris,jimmy. Harris, john. Harris, Margaret, 715 Beta Club 9-125 French Club 9-115 Civinettes 1 1. Harris, William. Hartig, Sean, 71. Hartnett, Caroline, 71. Hawkins, jeff, 71. Hawkins, Patty, 715jayettes 11-125 Beta Club 11-125 Honor Society 10-125 Nope to Dope 125 French Club 10-1 15 Soccer Manager 10-1 15 Freshman Cheerleader 95 SGA 9-125 Newspaper Staff 125 Copy Cat Staff 1 15 Class Representative 125 Business Manager, Newspaper 125 Top 10 Award Freshman 9. Hay, Brian, 71. Hayag, Gil, 715 Latin Club 10-125 Beta Club 11-125 Drama Club 125 Science Club 11-125 Russian Club 115 President Beta Club 125 Weightlifting Team 9- 125 Varsity Baseball 115 j.V. Baseball 9-105 Honor Society 10-125 Scholar's Bowl 11-125 Scholar's Bowl Captain 125 4th Place State Weightlifting 115 3rd Place Latin District Forum Derivatives 115 3rd Place History Fair 115 Latin District Forum 2nd Place Derivatives 105 2nd Place Latin State Forum Derivatives 105 lst Place County Weightlifting 105 3rd Place County Weightlifting 9. Hayden, Donna, 715 Russian Club 10-125 Key Club 1 15 Science Club 95 Varsity Tennis 9-125 jayettes 125 lnterclub Council 125 Newspaper 11-125 Camenae Staff 125 Nope to Dope 115 Prom Committee 115 SGA 9- 105 Best Social Studies Student of the Year 95 Captain of Tennis Team 11-125 President Russian Club 12, VP 115 Circulation Editor Newspaper 125 Bronze Medal Russian Competition 10. Heller, Mike, 71. Herrington, Patricia L., 715 DCT 125 DECA 1 1. Hicks, Lisa R., 715 DECA Club 125 B.T. Ladies 8t Gents 125 Chorus 125 Pom Pon Club 11-125 French Senior Index 25 7 '?CQ XT .-.5 K , Club 9-10. Hicks, Willie3 BASIC 9-113 Varsity Basketball 9-113 All Northwest Florida 1 1. Hill, Chandra, 713 Video Club 123 DECA 123 Student Council 103 Spanish Club 103 Band 9-123 Band Sec- tion Hill 11-123 Band lst Chair. Hill, Marcus, 71. Hoang, Vuong, 721 Hobgood, Lisag Swimming 9-10. Holland, Caroline, 723 Science Club l23 French Club 9, 11-123 Scholar's Bowl 11-123 Honor Society 103 Pride Folder Certificate 123 Outstanding Economics Student 2nd Semester 103 NEDT Award 103 Perfect Attendance 10. Holley, Angela, 72. Holmes, Melisa, 72. Housand, Andrea, 72. Howard, Lisa, 72. Howell, Tonya, 723 FBLA 103 Science Club 103 Band 9- 1 23 Flag Corps 9- 1 23 Scholar's Bowl 10. Hudgens, Chris, 723 Science ll-12, Drama 123 Bowl- ing 1 13 French 103 Gamers 9-103 Men's Track 9-113 Varsity Football 9-1 1. Hufford, Cathy, 723 Ilonor Society 10-12, Historian 12, Pres. 113 jayettes 15-12, jayettes Historian 113 Latin Club 10-123 French Club ll-123 Beta Club 10-123 Singers 11-123 Singers President 123 Inter Club Council Pres. 123 SGA V.-Pres. 123 Nope to Dope 123 PRIDE English 123 WHSjunior Miss 123 Varsity Cheerleading 113 SGA Class Representative ll, Prom Committee 113 Student of the Month for May 113 School History Fair 2nd Place 113 County Gov't. Award 113 j.V. Cheerleading 103 NEDT Award 9-103 Freshman Cheerleading 93 Senior Superlative Prettiest Smile. Hurd, Samantha, 72. Husted, Robyn, 723 Varsity Basketball 10-123 Soft- ball 10-123 Volleyball 10-1 13 j.V. Basketball 93 Women's Track 93 All Kiwanis 11-12. Hynes, Leslie, 723 DCT. jackson, joseph3 Chorus 12. jackson, Kevin, 72. jefferson, Mark, 723 Varsity Football 1 1-123 Band 1 1- 12. johnson, Bessieg Honor Society 113 Beta Club 103 Softball 1 1- 1 23 Varsity Basketball 123 Tennis 12. johnson, Kaimarcus, 723 Varsity Basketball 10-123 j.V. Basketball 93 Freshman Basketball 9. jolliff, Debbie, 72. jones, Debora, 723 DECA 123 Softball 103 Softball Bar 8: Letter3 Flag Corps 9-103 Flag Corps Letter 9. jones, Karen, 723 BASIC 123 DECA 11-123 Swimm- ing 9'lOQ Chorus 9-12. jones, Mark, 723 DECA 123 Varsity Men's Basketball 10-123 Varsity Football 9-103 Men's Track 9-103 Freshman Men's Basketball 93 Student Council 113 Mr. Basketball 11-12. jones, Melissa, 723 Band 123 Pom Pon Cats 123 2 Bars SL 2 Letters in Band 12. jones, Mindi, 723 Singers 123 Treble Choir 113 French Club 103 Varsity Cheerleader 103 Honor SOCICW 10-12. jones, Paul, 72. jones, Roy, 72. julian, john, 72. Kelly, Andrew, 723 Photography 12. Kelly, Christine, 723 Wildcat News 123 Pride Folder Honorable Mention 123 Drama Club ll-123 French Club 11-123 Camenae 11-123 Honor Society 11-12. Kelly, Kimberly, 723 DECA 123 junior Achievement 10-113 French Club 103 Perfect Attendance 9-10. Kidd, Lester, 723 Varsity Basketball 123 Basketball 9- 113 Men's Track 9-10, 123 Football 9'l03 Nope to Dope 123 NjROTC 9. Kievit, Kit, 723 SGA 123 French 11-123 Inter-Club Council 123 French Club Pres. 123 French Club Sweetheart 113 2nd Place junior Class Talent Show 113 Flashback 103 Drama 9. Kilcrease, Denise, 723 FBLA 11-123 Perfect Atten- Canine lnflzw dance 9-1 13 2nd Place Fastest Typist 1 1. Kingry, Clair, 733 French Club 11-123 jr. Academy of Science 123 Math Club ll-123 Honor Society 123 Science Club 113 Swimming 10. Kirby, Mike3 Chorus 9, 123 Drama 10-123 Honor Society 9- 103 Football 9. Kruczynski, Amy, 733 Beta Club 9-123 Key Club 10-123 Honor Society 11-123 junior Academy of Science3 Latin Club 113 Varsity Tennis 9-123 Varsity Cross-Country 9, 1 lg SGA 11-123 Camenae Staff 123 English Pride Certificate 123 Georgia Certificate of Merit 113 Georgia's Governor's Honor Program 113 Model United Nations 113 Academic Award Tennis 113 Parliamentarian Beta Club 113 Merit Award English 103 Honorable Mention School Social Science Fair 103 Most Improved Award Tennis 103 Merit Award Latin, English3 Citizenship 93 lst School District Social Science Fair 93 Sportsmanship Award Tennis 9. Kyle, Angela, 733 Honor Society 123 Beta Club 123 French Club 11-123 Key Club 11-123 Scholar's Bowl 123 Drama Club 10-113 Latin Club 9-103 Newspaper 1 l-123 Camenae Staff 123 Quill 84 Scroll ll'l23 National junior Classical League 9-103 NCTE Writing Award 123 National Achievement Semi-Finalist 123 Century III Leader 123 Pride Writing Award 123 Perfect Attendance 113 ECCTE Poetry Contest 1 lg NEDT Award 9-103 Outstanding World History Student 9. Kyles, jimmie, 733 Photo Club 113 Track I0-123 Football 9. Lacy, David, 733 German 10-123 Band 10-123 Chorus 123 Honor Society 123 Perfect Attendance. LaFlamme, Glen, 733 Spanish Club 123 Soccer 9-123 2nd Place Architectural Fair. Lasley, Angela, 733 DECA 1 lg Track 9-123 Volleyball 9, 11-123 Cross-Country 113 B.T. Ladies 84 Gents 123 Cat Pac 123 Track - Wildcat Blanket Trophy 123 Track Trophy Pin 103 Track Letter Pin 9. Lavine, Scott, 7 3. Lawrence, Shanay, 733 La'gniappe 123 Pom-Pon 9- 113 DECA 113 Band 9-11. Lee, Katherine, 733 Drama Club ll-123 Beta 123 jayettes ll-123 jayettes Sec. 123 Honor Society 123 French Club 9-10. Lee, Scott D., 733 Spanish Club 10-123 Beta Club 123 Drama Club 123 j.V. Soccer 93 Varsity Soccer 10-123 Honor Society 10-123 Spanish Award 113 Physics Award 113 History Fair, 3rd Place3 lst SL 3rd in Spanish Competition ll3 Top Ten Sophomores 103 NEDT Award 103 Top Freshmen 9. Lemmon, Tyler, 733 Civitan 123 Latin Club 113 Spanish Club 9-103 Tennis l2Q Tennis Letter 123 Cross-Country 9-10, Letter 9- 103 Track Letter 9. Lennerthson, Susanne, 73. Lett, Averett, 73. Lett, Myra, 733 DECA 123 Band 10-12. Levin, Kimberly, 733 Civinettes Treas. 113 Spanish Club 9-10, V.-Pres. 103 Spanish Club Treas. 93 Manager j.V. Soccer 93 Manager Varsity Soccer 103 Manager j.V. Volleyball 93 Manager Varsity Volleyball 9. Lewis, Angela, 73. A Licharowicz, james, 73. Lisman, Rebecca Deannah, 733 Video Club 113 Drama 103 Swimming 9-113 Swimming Manager 10-113 Lettered in Swimming 9-113 Stock Market 123 Chorus 10. Livingston, Amanda, 733 DECA 123 Civinettes I 1-12. Lombardo, Cilia, 733 Key Club 123 Civinettes 113 Spanish Club 113 Varsity Women's Basketball 103 Freshman Basketball3 Honor Society 123 Dual Enroll- ment 123 SGA 10-123 Newspaper Staff 10-113 Sophomore Class President 103 Yearbook Staff 93 Key Club Sweetheart 123 Class Favorite 10. Long, Yvette, 733 DCT3 Perfect Attendance 9-12. Longmire, Lena, 733 Bowling Team 1 1-123 Volleyball 93 Perfect Attendance 9- 1 2. Looney, Ron, 74. Lowe, Clifford, 74. Club Competition 10. Lowery, George, 743 Soccer 9- 1 2. Lucey, Kim, 743 Civinettes 11-123 DECA 113 Spanish Club 103 Surfing Club 103 DCT l23 Women's Track 93 Cross-Country 9. Magie, Geoffrey. Manware, Lahna, 743 Honor Society l0'l2Q Dual Enrollment 123 NEDT Award 10. Marsden, jill, 743 jayettes 123 Honor Society 10-123 Pep Club 93 Varsity Cheerleader 103 junior Varsity Cheerleader 93 Class Officer 103 Top 5 in Class 9. Marsh, Victor, 74. Marshall, Bill, 743 DECA 123 French Club 123 Latin Club 123 Freshman Basketball 93 j.V. Basketball 10-113 Varsity Basketball 123 Band 10-123 Honor Society 12. Martin, Dana G., 743 Spanish 11-123 Civinettes 11- 12, j.V. Cheerleader 93 Cross-Country 93 Chorus 9. Martinez, Anna, 74. Mason, Christy, 74. Mathews, Betsy A., 743 Civinettes 11-123 DECA 123 Varsity Cheerleading 11-123 Cat Pac 123 Honor Society 113 Spanish Club 9-103 Surf Club 103 j.V. Cheerleading 103 Freshman Cheerleading. Matolay, Heather, 74. McAfee, jill, 743 Drama Club 9, ll-123 Russian Club 10-123 Camenae 113 Chorus ll-123 Honor Society 10-123 NjROTC 9'lOQ All-State Chorus 123 lst Place ESCA Drama Festival 113 Superior Rating District Solo Ensemble Vocal Competition 113 NjROTC Distinguished Cadet 8: Bronze Academic Award 9. McClammy, Kevin, 74. McClure, Kelly A., 743 Drama Club 123 French Club 9-12, V.-Pres. 123 Chorus 123 Project Graduation Committee 123 SGA 9- 103 Student Council 10. McDaniel, Charles, 743 Honor Society l23 Beta Club 10-123 Math Club 9-123 Science Club 10-123 Drama Club 123 Swim Team 9-12. McDonald, Shonda, 743 B.T. Ladies 8-L Gents ll-123 DECA 123 Cat Pac 12: McGraw, Kimberly, 743 Civinettes 11-123 Spanish Club 9-12, Treas. 123 Surf Club 103 SGA 93 Varsity Cheerleader 11-123 Co-Captain Varsity Cheerleaders 123 j.V. Cheerleader 103 Bat Girl for Varsity Baseball Team 10, 123 Cross-Country 93 Nope to Dope 113 Homecoming Court 123 All-American Cheerleader Nominee 11-12. McKean, Chris, 74, French Club 9'l03 Freshman Football 9, SGA 10-11. McKinney, Matthew, 74. McWilliams, joAnn, 743 Deca Club 11-123 Cat Pac 123 Girls Varsity Basketball 9-123 Girls Varsity Track 9'l23 Girls Varsity Volleyball 9-12. Menda, Cathleen, 75. Meyers, Mark, 753 Soccer 1 1, Middleton, Roger, 793 B.T. Ladies Sc Gents 123 Var- sity Men's Basketball 123 Men's Track 11-123 j.V. Basketball 113 NjROTC 12. Miller, Cheri, 753 Civinettes 11-123 Swimming 9-IO, Women's Track 9. Miller, Sabrina, 753 Honor Society 10-123 French Club 10-123 Camenae Staff 123 Flashback 9-103 Commended Scholar 123 Top Ten junior 113 Anatomy Award 113 Art Award 9, 113 NEDT Award 103 Algebra Award 9. Miller, Tonya, 753 Beta Club 123 Honor Society 11- 123 Chorus 1 1. Mitchell, Gene, 74. Mitchem, Kathryn, 753 Beta Club 10-123 French Club 123 Latin Club 9-123 Science Club 11-123 Cat Pac 11-123 Nope to Dope 11-123 Honor Society 10- 123 jayettes 10-123 Camenae 123 SGA 9-123 Prom Committee 113 Flashback 9-103 Student of the Month Award 11-123 Homecoming Court 12, Na- tional Merit Semi-Finalist 123 Paws Award 113 I Dare You Award 113 Outstanding American History Student Award 113 Top Ten Award 9-113 Outstanding Latin Student 103 Outstanding English Student 9-10. Lowery, Cheryl, 74, Russian Club 9-103 SGA 9, Dcr Moffat, Philip, 75- 123 Russian Club Service l03 Silver Medal in Russian Moffett, Felecia, 753 Civinettes 123 B.T. Ladies Sc g,,, , Gents 12, Chorus 12, Pom-Pon Cats 10-12, DECA 11, Flag Corps 11. Mogg, Jeanette, 75, Drama 11-12, French Club 10- 12, Tennis Team 10, SBA 9-12, Honor Society 10- 12, Gayfers Teen Board 11-12 QPresident 123, Class Representative ll-12, Sophomore Class Vice- President 10. Montgomery, Charles, 75. Moore, Deborah, 75. Moore, Harriett, 75, Spanish Club 9-12, Beta Club 12, Honor Society 12, Math Club 12, Photo Club 11-12, B.T. Ladies 8: Gents 12, Pom-Pon Club 11, Nope to Dope 12, Dual Enrollment 12, Photo Club Honorable Mention 11. Moore, Robin, 75, Key Club 12, Drama Club 11-12, Spanish Club ll, Surfing Club 9-10, Swim Team 10-12, Freshman Football 9, Chorus 12, Varsity Let- ter Swimming 10-12. Morreale, Lisa, 75, Beta Club 10-12, Latin Club 10- 12, Spanish Club 12, Camenae Staff 12, Honor Society 10-12 QVice-President 123, NEDT Award 9-10, Top Ten junior 11, Kiwanis Club Award for Outstanding Scholastic Achievement 11, Latin Club Secretary 12. Morris, Cavid, M., 75, Men's Track 10. Morris, Melissa, 75, DECA 12, NJROTC 12, job Entry 12,junior Achievement 10. Morris, Wendy, 75, German Club 11-12, Honor Society 10-12, Camenae 12, Chorus 10-12, BASIC 9. Morrison, Catherine, 75, FBLA 9, 12, DECA 11, Citizenship Certificate 9, 11, Certificate for Filing 12. Moses, Robert Allen, 75, Men's Track 11-12, Sym- phonic Band 9-12, Marching Band 9-12, B.T. Ladies and Gents 1 1. Muldoon, Michael D., 75, Soccer 12, Band 12. Murphree, Birtrue, 75. Murphy, Frank, 75, Varsity Football 9-12, Men's Track 9-12, FCA 9-12, Varsity Football Letter 9-12, Track Letter 10-12, Freshman Football 9, Cat Pac 1 1-12, Most Spirited Senior Superlative. Musselmari, Dana, 75, Graffiti Yearbook 11-12, Drama 10-1 1, District JEA joumalism lst Place, FSPA Lip Sync Contest lst Place. Myers, Cherrie, 75. Nagel, Geoff, 75. Neal, LaTonya, 75, Bowling Club 11-12, Chorus 10, Perfect Attendance 9-1 1, Basketba.ll 9. Nelson, Mirriam, 75, B.T. Ladies 8: Gents 12, DCT 12, Women's Track 11-12, Marching Band 9-11, Track Award 12, Band Letter 10, Band Pin 1 1. Nettles, Chris, 76, Spanish Club 10, Latin Club 93 Swim Team 9-12, Math Team 10-11, lst Place Math Competition 10, NEDT Award 10, Varsity Letter Swimming 9-12. Newman, Bradford, 76. Newth, Tracy, 76, Civinettes 11-12, Deca 11-12, Bowling Club 10. Nieman, Robert, 76, Photo Club 12, Honor Society 10-12, Student Gov't. 12, Science Award, Nock, Judy, 76, Beta Club 10-12, jayettes 12, Drama Club 9-12, Surf Club 1 1, Art Club 11, Spanish Club 9, Chorus 12, junior Miss Contestant Escambia Co. 12, Honor Society 11-12, International Thespian Society 10-12, Flashback Staff 9, PRIDE Writing Award 12, junior Miss Performing Arts Award 12, Outstanding Drama Student ll, lst 8C 3rd Place ESCA Tournament 11, All-Star Cast Award 11, 2nd Place Spanish Competition 11, 3rd Place Spanish Competition 10, NEDT Award 10, lst Place ESCA Toumament 10, 2nd Place ESCA Tournament 9. Nuetzel, Stacey, 76, Civinettes 11-12, Cat Pac 12, Deca 12, Track Varsity Letter 9-10, Cross-Country, Varsity Letter 9- 10. Oberto, Lisa, 76. Oehler, Sonya, 76. Olmstead, Liane, 76, Drama 12, Civinettes 11-12, Beta 11-12, Spanish 9-10, SGA 9. Padla, Vanessa, 76, French Club 10-12, Sec. - Treas. French Club 12, Beta Club 10-12, Camenae Staff 12, -I.V. Volleyball 9, Varsity Volleyball 10, Honor Society 10-12, Top Freshman 9, Honor Roll 9-12 Parker, Reginald D., 76, Beta Club 12, Math Club 12, Nope to Dope 12, Honor Society 10-12, Band 9-12, SGA 12, Drafting Award ll, Sewanee Award for Leadership ll, National Engineering Aptitude Award 1 1, NEDT Award 9-10. Parker, Roderick C., 76, B.T. Ladies 81 Gents 11-12, Math Club 12, Beta Club 12, Key Club 12, Honor Society 10-12, Band 9-11, Society of Distinguished American High School Students 9-10, United States Achievement Academy 10, jazz Ensemble 9, Na- tional Achievement Scholar Student of the Month 12, Drafting Award 11, 2nd Place County Spanish Contest 11, PAWS Award 10, NEDT 9-10, Spirit Award 9, Top Ten Freshmen 9, Solo 81 Ensemble Superior Rating 9, jazz Ensemble 9. Parkhurst, Lacey M., 76, Computer Club 12, Drama Club 12, French Club 12, Latin Club 12, Photo Club 12, Cross-Country 12, Camenae Staff 12. Parks, Michelle, 76. Paro, Mike, 76. Pauldin, Cassandra, 76, FBLA 12, DECA 12. Paxton, Anthony, 76. Peaden, David, 76, Civitans 12, Football 9-12, Weightlifting 10, Track 9, Perfect Attendance 9-1 1. Peeterse, Suzanne, 76. Perry, Alecia, 76. Pfeiffer, Hunter P., 76, Science 11-12, French Club 10-11, N-IROTC 10-12, Drill Team 11-12, Chorus 11-12, SGA 11, Honor Cadet 10, NEDT 10, Perfect Attendance Award 9. Pham, Giao. Phillips, Audra, 76, DECA 12, Track 9-12, NJROTC 9-12, Track Award 9-12, Porter, Chris, 76. Postlewaite, Glen. Potter, Shannon, 76, Photo Club 11, j.V. Track 11, Varsity Women's Track 12. Powell, Linda, 76. Price, Nathan, 76. Puckett, Patty. Puryear, Sheldra, 76, DECA 12, Band 9-11. Quinlan, Scott, 76. Rand, Melanie, 76. Raymond, Kevin, 76, Calculus Club 12, Honor Society 12, Nope to Dope 12, Varsity Track 9-12, Varsity Cross-Country 9-12, Soccer 10, Orchestra 10-12, Band 9, Freshman Music Award 9. Rease, Kevin, 77, B.T. Ladies 8a Gents 12, Men's Track 9-12, Freshman Football 9, World History Award 9. Reineke, John, 77. Rembert, Millicent, 77. Renaud, Nathan, 77. Rich, Nan E., 77, Video Club 12, Photo Club 12, Civinettes ll-12, Softball 9-10. Riddle, Kelly, 77, Key Club 9, Civinettes 11-12, Spanish Club 9, Cheerleader 9, SGA 9, President Civinettes 11-12. Riera, Michelle, 77, Spanish Club 12, Civinettes 12, Cat Pac 12, Varsity Cheerleading 9-10, Track 10, Girls Basketball 10, Drill Team 9, Chorus 9-10, Physical Fitness Award 9- 10. Ritchie, Dean. Rivera, Michael, 77. Rivers, Carmen, 77, La'gniappe 12, DECA 12, Spokes 12, Band 9-11, Chorus 12. Roberts, Kim. Robinson, Eddie, 77, BASIC 12, Basketball 9-12, Varsity Track 12, Football 9. Roche, Marny, 77, FBLA 12, French Club 10, Spanish Club 9- 10, American Cancer Society 1 1. Rodgers, Traci, 77, Pom-Pon 10, Band 10-12, Flag Corps 12. Roe, Paula, 77, Civinettes V.-Pres. 11-12, Surf Club, Spanish Club 9-10, Women's Varsity Track 9-10, j.V. Volleyball 9, Freshman Cheerleader. Roeder, john, 77. Rosenberger, Amy Susan, 77, Softball 9-11, Varsity Volleyball 10-11, j.V. Volleyball 9, Perfect Atten- dance Award ll. Rush, Becky, 77, Civinettes 11-12, Drama Club 10- 12, Thespian Festival Best Actress Award, Student Council 10, Student Council Class Sec. 9. Sale, Raymer, 77. Samuel, Camelia, 77, NJROTC 9-10, 12. Sanders, jeff, 77. Sapio, David, 77, French Club 12, Science Club ll- 12, Swim Team 9-12, Honor Society 10-12, junior Academy of Science 11-12, Sportsmanship Award 12, Outstanding Earth Science Student 9. Saulsberry, Darlene, 77, DCT Award 12, Schnupp, Amy, 77, Civinettes 11-12, DECA 11, French Club 10, Dance Club 10, Homecoming Princess 9. Scholz, Ed, 77. Schroeder, jerry, 77, Spokes 1 1, Basketball 9. Scruggs, Amy, 78, Drama Club 12, Civinettes 11-12, Spanish Club 9, Track 10, Freshman Cheerleaders 93 j.V. Cheerleader 10, Varsity Cheerleader 12, SGA 10-12, Chorus 12, Inter-Club Council 12. Seely, Richard, 78, Freshman Football, Varsity Foot- ball 10-12, All-Area Football Team. Settimio, Lynne, 78, DCT 12, Volleyball 10. Shea, Stephen, 78, Science Club 11-12, Honor Society 10-12, World History Award 9, Industrial Arts Award 10-11, Economics 10, lst Place Architectural Drafting 12, 2nd Place Architectural Models 12. Shepherd, Laura, 78. Shoemore, Larry, BASIC 12, Varsity Basketball 12. Simmons, Laurie, 78. Sisco, Lorie, 78, jayettes 11-12, Beta 10-12, Drama Club 9-12, French Club 12, Nope to Dope 12, SGA 12, Honor Society 10-12, Camenae 12, Singers 12, Prom Committee 11, Flashback 9-10, NEDT Award 10, Perfect Attendance 9. Sjollema, Marcella. Slay, Tim. Slayton, Julie, 78, Spanish Club 9-12, Civinettes 11- 12, Russian Club 11, Nope to Dope 12, Varsity Cheerleader 12, j.V. Cheerleader 11, Women's Track 9, 12, Cat Pac 12. Smiley, Tracy, 78. Smith, Alietha, 78, Varsity Women's Basketball 10- 12, Women's Track 9-12, Volleyball 9-12, Softball 11, Volleyball Certificates 9-12, Volleyball Pins 10- 12, Volleyball Outstanding Senior Award 12, Basketball State 4-A Ring, Track Ribbons 9-1 1. Smith, Dawn, 78. Smith, Leigh, 78. Smith, Rachel, 78, FBLA 10-11, Yearbook 10-12, Excellence in joumalism District On-the-Spot Con- test 10-11, Who's Who Among American High School Students 11, 3rd Place Office Procedures - FBLA District Competition 11, Certificate of Proh- ciency Business Filing 1 1, Outstanding Salesperson of the Year in FBLA Tom-Wat 11, Journalism Award 1 1, 12, Graffiti Yearbook Editor. Smith, Stephanie, 78, DECA 12, Track 10-11, Band 9, Band Letter 9. Snowden, Robert Todd, 78, Drama Club 11-12, German Club 10-12, Science Club 11-12, Nope to Dope 12, Football 9-12, Track 9, Chorus 12, Honor Society 10-12, Camenae Staff 12, Senior Class V.-Pres. 12, Flashback Staff 9-10, Student of Month 11-12, National Merit Semi-Finalist 12, I Dare You Award Winner 11, History Fair District Winner 11, lst Runner-up State History Fair 11, Escambia - Santa Rosa Counties Bar Associations '86 Law Medal Winner 11, Outstanding Math Stu- dent 10, Outstanding German Student 9, Outstan- ding English Student 9, Top 10 Freshmen 9. Sowell, Leigh, 78. Spain, Adri, 78, jayettes 12, Beta Club 10-12, Honor Society 10-12, Newspaper 10-12, Newspaper Asst. Editor 11, Newspaper Co-Editor 12, Camenae 11- 12, Quill 8: Scroll 11-12, Student of the Month 12, Spanish Club 11, FSPA Finalist 11, English Award 1 1, journalism Student Award 11, Feature Winning Award Pensacola Press Club 11, Math Club 10-1 1, Senior Index 25 gi, fx State History Fair Winner 103 Best of State Na- tional History Fair 103 NEDT Certificate 10-11, Flashback 9- 103 Latin Club 93 Band 9. Spurigo, Penny, 783 French Club 10-123jayettes 12. Stallworth, Traci, 78. Stegner, Christopher L., 783 Yearbook 123 Russian Club 113 Band 9-113 Most Outstanding junior Musician, McDonald's Band Nominee 113 Superior Ratings in Quintet Ensemble 113 Band Letter 9-113 Latin Club 9-10, Civitans 9-10, Honor Society 10, Most Outstanding Sophomore Musician3 South Carolina District junior Band 93 South Carolina All- State Regional Band 93 Most Outstanding Freshman Musician 9. Stevenson, Rebecca, 781 Drama Club 9-12, Chorus 11-12, Art Club 10, Photography 12g DECA 123 Ensemble 123 Gayfers Teen Board 11-12, Thespians 10-12, Camenae ll, Prom Committee ll, jr. Miss Contestant 12, ECAC Speech Toumament Award Winner 10-123 Drama Club Sweetheart 103 Outstanding Drama Student 113 Senior Superlative Trendsetter 12: 2nd Place Fashion Design 12. Still, Cynthia, 78. Stills, Tabatha, 783 DECA 123 DCT 12, Pom-Pon 103 N JROTC 9. Suarez, Shelley, 78, Basketball 9-123 Track 9'101 Softball 11-12, Band 9. Sullivan, Vince, 79. Surratt, jack, 79, Yearbook 123 Photo Club 113 DECA 1 13 DECA Student of the Year 1 13 Deca State Competition 11,-I.V. Weightlifting, Tank, Katie, 79. Taylor, Michael, 793 Varsity Football 11, j.V. Foot- ball 103 Freshman Football3 Men's Track 10. Thigpen, Vincent, 793 DECA 12, NJROTC 9-11. Thomas, Elizabeth Elaine, 79, FBLA, Treas. 123 Beta Club 10-123 Beta Treas. 123 Honor Society 10- 123 j.V. Basketball Manager 123 Band 10-123 Flag Corps 10-123 Flag Corps Captain 12, Graffiti Year- book 11-123 Graffiti Yearbook Co-Editor 12, jayet- tes 11-12, jayettes Historian 12Q WHS junior Miss Contestant 123 Poise 8: Appearance Award junior Miss3 Escambia County junior Miss Contestant3 FBLA Filing Award 123 Public Speaking Award FBLA District Contest 123 French Club 9-11, Year- book Award 11, 123 State joumalism Convention 2nd Place 113 Second District Yearbook Award3 Principal's Award 9-103 NEDT Award 9'l0Q World History Award 93 Honor Student 9-123 j.V. Volleyball Captain 93 Calvacade 113 FSPA Lip Sync Contest lst Place 1 13 Talent Show 2nd Place 9. Thompson, Maggie, 79. Thompson, Tabatha, 79, DECA 123 Band 9-1 1. Tillman, Kevin, 79. Tolbert, Christopher D., 793 Football, Varsity Letter 9-123 Basketball 9-113 Varsity Track 9, 11-123 All- Area Runningback District 1, 123 All-State Defen- sive Back 123 Golden Helmet Award, MVP3 Best Offensive Back 113 All-Area Running 8a Offensive Back 10-11. Toro, Melody Ann, 793 DCT 123 Honor Society 113 FBLA 11, Student ofthe Month Uanj 11. Torrence, Heather, 79, Drama Club 10-12. Truitt, Chris, 79. Truong, Lihn, 79, Math Club 9-12, junior Academy of Science 11-123 Beta Club 123 Honor Society 10- 123 Latin Club 9-123 GrafHti Yearbook Staff 123 Camenae Staff 123 Top 10 of Class 9-123 Earth Science Award 93 Latin Award 9, 1 13 Biology Award 103 lst Place County Award in Biology 113 Senior Superlative Most Intellectual 12. VanDeMark, Tiffany, 793 Civinettes 11-123 Drama Club 103 Spanish Club 103 Varsity Cheerleading 123 -I.V. Cheerleading 1 13 Cross-Country 93 Track 9. Varden,-Iames, 79. Velaski, Michelle, 79. Vinson, Matt, 793 Spanish Club 123 Men's Track 10. Vredenburg, Bruce, 79, Beta Club 123 Spanish Club 9-103 Baseball 9-113 SGA 10-123 GrafHti Yearbook 123 Nope to Dope 123 SGA Presidential Cabinet 123 junior Class Treasurer 113 Calendar 10- 123 Class Sweetheart 10-113 Senior Superlative Prettiest Smile 123 Baseball Academic Award 113 Honor Roll 10- 1 2. Walden, Greg, 793 Spanish Club ll-12, Photo Club 11-123 Beta Club 11-123 Varsity Soccer 123 Honor Society 123 Camenae 12, National Merit Commen- dation 123 Civitans 113 J.V. Soccer 9-11, Men's Track 103 Flashback 9-10. Walker, Elizabeth, 79. Walker, King C.L, 79, B.T. Ladies 8: Gents 123 Track 9, 11 QManagerJ3 Band 9-123 Cat Pac 123 Society of Distinguished American High School Students 10- 1 13-Iunior Achievement 103 jazz Ensemble 93 Perfect Attendance Award 1 13 Junior Achievement Sales Award 10. Walker, Reggie3 Basketball 9-123 Track 10-12, All- State Track 10-ll, All-American Candidate Track 12. Wallace, Sabrina, 79. Ward, Russell, 79. Wasko, Theresa, 793 FBLA 123 j.V. Cheerleader 103 Treble Chorus 1 13 Flag Squad 9. Waszink, Larry, 79. Watson, Nancy, 793 WHS Singers 11-123 Chorus Vocal Ensemble 123 Treble Chorus 103 Chorus 93 SGA 9. Weiland, jennifer, 793 Beta Club 123 Honor Society 10-123 Key Club 103 Band 10-123 Outstanding Band Student 10-123 Perfect Attendance 93 Student of the Month 11. Werner, Laura, 793 DECA 11-123 Video Club 113 Drama Club 103 DECA V.-Pres. Region I. West, Elizabeth Dawn, 80, Spanish Club 9-123 Beta 11-123 Nope to Dope 123 Honor Society 12. Whigham, Brett, 80. White, Christine, 80. Whiteman, Scott, 80, Varsity Cross-Country 9-123 Varsity Track 9-123 Nope to Dope 123 Captain of Cross-Country Team 123 All Panhandle Team Cross-Country 1 1-12, All Panhandle Team Track 113 News-journal Athlete of the Year 1 1. Whitley, Ayer, 803 Honor Society 10-123 Civinettes 113 French Club 9-10, SGA Sec. 103 SGA V.-Pres. 9. Wiggins, Charles, 80, Scholar's Bowl 11-12, Track 9-103 Freshman Football 93 Honor Society 123 Pro- ject Graduation Committee 123 Newspaper 123 Na- tional Merit Scholar 12, 3rd Place Sertoma Essay Competition 1 13 3rd Place Radio Speaking Competi- tion 1 13 2nd Place Talent Show 1 1. Williams, Bridgette, 80. Williams, Capri, 80. Williams, Carlos, 80, B.T. Ladies Sc Gents 123 Freshman Football. Williams, Chandra, 803 B.T. Ladies 81 Gents 123 Drama Club 103 job Entry 123 NJROTC 11-123 Flag Corps 11. Williams, Darlene J., 803 FBLA 123 Varsity Basket- ball Manager 123 j.V. Basketball Manager 10-11, junior Achievement 103 Chorus 103 Top Salesman Award FBLA 12, Certificate of Proficiency 123 Perfect Attendance 9. Williams, Everett, 80. Williams, john, 803 Photography 11-123 Art 11. Williams, Kyron. Williamson, Ross, 80, Key Club 10-12, Men's Ten- nis 9'12, Chorus 123 Beta Club 123 Science Club 113 Spanish Club 9-103 Freshman Football. Wilson, Denny, 80, Civitans 123 Nope to Dope 123 Varsity Football Manager 10-123 Cross-Country Team 9. Winn, Bonnie, 803 Beta Club 10-123 Spanish Club 10-123 Swimming 9-123 Women's Tennis 11-123 Honor Society 12. Winterberry, William, 80. Wirth, William, 80, Key 11-123 Beta 11-123 Nope to Dope 123 Spanish 10-113 SGA 123 DCT 123 Head Chairman of Project Graduation Student Committee 123 NEDT Awards 9-10. Wolfe, Curtis, 80. Wood, Michael, 80. Worley, Craig, 80, Varsity Football 9'12, Weightlif- ting Team 10-123 j.V. Baseball 113 Men's Track 9- 10, 1017: Award for Football 103 Freshman Football. Wright, Kelly, 803 Civinettes 11-123 Drama Club 10'12, DECA 123 Spanish Club 10-113 Varsity Cheerleader Letter 113 j.V. Cheerleader 103 Women's Track Varsity Letters 9'lO, Women's Cross-Country Letter 9. Wright, Paul, 80. Yarbrough, Allyson, 803 Honor Society 10-123 Beta Club 9-11, Nope to Dope 12, Women's Tennis 9- 12, MVP Tennis 10, Top 20 Freshman Award 9. Young, Pamela, 80. Zaleski, Robert. Zuleger, Michael, 80. ?60 Senior Index , G Best Wishes to Washington High School Students for 1987 Mutual of Omaha United of Omaha .I Lynn Golden Agency 404WC 1 L Mdal Db Lfl Congratulations Best Wishes from 38520 ou ss S L... QOSIJSQIBB 101 FQ - ' . ervantes St. 'WW' H Pensaco a,F 74:1 X al laid' 134-val Major e ic - isa ility Income C RSE'Qwmm1su-a 1 Group Insurance- ie nsuranc ' x 1 . . I . 1' . 11 4 .' ' i 7 9 1 otocono so soooououa soossoututuost i ucocououao ouu ouoto 1 1 1 Q uuu ,uauu,u iulul X ' t ' i'i'i c t J ' I Q YZ,-:jg:V:1:53:j:g:':-:':2:.:3,,j53gfI5'-a:-:iz5:-zz --t----' 145211211 - ' -'rfgfg5'5,2'2,fA2.2:fI'-212:11 '22:'E5EjEg:g1512E:f 15522253532-f'E3EfE3E':gif:2EfEE1ElEjE1E2E5231i 5f5iI:5A555:5f3fI:-5 '-l.1:f:2:2-' fri-If-2:2: , EIf':'5 1--:2:1Ef1fi' - . ive . - . exin ron uare 5 4 ar more Plaza? Pensacola 408lSEOl Rd CL g Sq 5 4741117 Milton 6231 Hwy 90W P k 626 2766 Congratulauons Class of l987!!! S i D E LTA RESERVATIONS AND INFORMATION 0049432 9871 Magrc Monogram Custom Monogrammed Sportswear W1leyC Buddy Page Owner Amerrcan A IPIID Company Makers of Oc fyloc N091 QS Cin THE CREATIVE FIBER Delta Arr Lmes Inc PENSACOLA REGIONAL AIRPORT PENSACOLA FLORIDA 32504 19049434 6187 904 433 5966 615 S Palafox St Post Office Drawer 270 Pensacola Florrda 32592 Tomorrow's Treasures HABERSI-IAM PLANTATION FURNITURE DECORATIVE HOME ACCESSORIES GIFTS CORDOVA SQUARE 4400 BAYOU BLVD , SUITE 52A PENsAcoLA, FLORIDA 32503 49049478 9612 904 433 5966 Southern Aclvertrsrng Specrahsts One West Loyd Sc Pensacola FL 32503 Trsh Pennewrll Cr1s sy Vredenhurg Sprrngclale Exxon 5300 N Davrs Hwy Pensacola FL 52504 49049477 6309 Harry T Clancy AIISIEITB sf 'O HENRY FILLINGIM Semor Account Agent ta Pensacola FL 32505 UH Bus 904 477 1350 Clanms 478 5002 Res 476 0354 540 E FAIRFIELD DR JOHN MEACHAM PENSACOLA FL 32503 C9041 432 8820 Jann mncnnm -WMARINE 0 agar lik! il if SALES PARTS SERVICE ACCESSORIES I . -1. -f 71 --'Fr' -1-'ii f'1.,rU- 4,- 4 , ,, n..:-'P' .. . . 'G ., 'YP I 11 Litre 'x' ag h ..-L, A 'x ':.1'!z.s's1.'g -A rfb ,- .'. .an 5'iQ.1A. g . e :Q 1?--'g f .sir I 'Q-S-ighfai ' .-: - Qlfrffiff- ' -. 4.'.:r'.7 5 QQ X -N 1?-' ' I . -59.3 Ti-354'-I - ' 3faQ.?1',f,4Q33 ' . , - I 5 7 , . Oo e + - - 'T 3 O 3 2 . , .1 'L A N ALL . . . O Q' 6' - .. ,, , , , , 4 Q , - 00 S V 5 I . c - Q I . 4 Adi VQR Rentals Movre Rentals Vrdeo Channel, Inc 3000 E Cervantes e 2 Pensacola FL 32503 O Kathy Boutwell 433 3437 D W Doug 040402 I G ,,.,,-,R Kubosh Branch Manager 3009 E cERvANTEs Plggggjgfg 455 2822 Grayban Pensacola FL 32523 Steve Irwrn 8c Davrd Dodson Invrte You In to See An Impressrve Collectron of Unrque Outdoor Fashrons for Men 8: Women 904 432 3463 QAMWMMOD Sm ure HEALTH Home cnn ausmtss Harold W NATIONWIDE Brown 191313 Ol1veRoad vo C Pensacola FI. 32514 478 5972 SO YOUYS 6 ,W THE DIVINE YH - BIBLE BooK STORE IM 8: ANN TACKETT Patagonla I 1 904 4g Mila? 2081 E Cervantes St C 2 Pensacola FL 32503 hat NextP Congratulatrons to the Class of 1987' Now comes the drfhcult part what next? Regardless of your future plans Pensacola unlor College can help We have college classes for both full trme and part trme students and durmg both the day and the evenrng We have three unlque and beaut1ful locatrons Pensacola Warrrngton and Mrlton to serve your needs We offer a full varlety of one year certrflcate programs P C also offers you a great number of two year assocrate degree chorces as well as unrver s1ty transfer degrees We offer major areas of study that range from lrtera ture to weldrng from computer scrences to sculpture Whatever your Interests P C can meet your needs Even If you are not sure about a major area of study our counselrng staff and our Career Plannlng Program can lend you a hand Our computer Ized Chorces program can even assrst you In choosrng a reward1ng career area before you enroll at any college' Regardless of what your plans are, P C can help Call us today at 476 5410 frn Mrlton call 623 46411 Plan now to Jorn us th1s fall We thrnk that you w1ll find that PIC has a great deal to offer the Class of 1987l PENSACQLA I IDR coI I EGF, . J l J I Milton ' Pensacola ' Warrington Tl An EAXEO InstItut1on 2 cc 3 J , N by' W N- ,... , .. ' ' ' inrornrc ooluunt. neo. 1 7 A Nationwide i n id 1 I - 8 . CD w 4 Y. '. N. P 1 - N I 7 I I gg O f-Aa, 2 . 2 - - I I I ' 1 -V ' .- . ' 1 . '54 . 1 T . ' 1 - . J I I - u , . - , . , J - v n , I X . . . , . 'l . ' X F- ' ' l 1 f 2 2 Q Congratulations Seniors ' Best of Luck in the Future I Q1 May God Bless You! yi! jim Sc Rosa Seymour Congratulations to Kevin Tillman and Seniors of l987!! .. J Love, Dad, Mom, Kenneth, 8: Kerri Congratulations E! X141 ,L B Rachel Smith and 5 7 47 , ' u Elizabeth Thomas. ll ' E Good Luck!! G We love you, Don Bc Joyce Smith 'Q' OPTICAL Brent SL Palafox 434-6388 Pensacola, FL T Congratulations DANA! J l Love Mom Dad 81 imm Lax 7 7 7 .I y H :sri it Q C g l t Dana Musselman fo g d Y umadeit' ROBERT T, - Y b b dd ' EGENKAMP Stacy Leichner8LL d R y Congratulations Senior Class of 1987! Q f WULZM ,SFX-e HARDWARE 'KV Let Us Help You Do Things RIGHT f T if FRIENDLY OLD-FASHIUNED SERVICE FOR OVER 30 YRS. 434-5353 Contact I if PACE l PALAFQX . Plsnly ol from parking W ' The city of New York gave the Statue of Liberty a big 1986 bash - A Fourth of july festival of song, celebrities and fireworks honoring the great lady's first 100 years. They call it crack on the East Coast and rock on the West Coast. Whatever its name, this refined, smokable form of cocaine may be the most addictive narcotic ever sold on the streets of America. - e After 20 years of ruling without serious challenge, Phillipine president Ferdinand E. Marcos was forced from office amid charges of corruption and scandal. The new president, Corazon Aquino, was faced with political and economic turmoil. Front Page New! Caroline Kennedy, who captured Americas heart as a little girl romping through the White House, married Edwin Schlossberg, a New York businessman and artist in Hyannis Port, Mass., on july 19, 1986. X4 'te G69 Q i i 759' V. 1 Iranian Arms Deal creates White House Crisis: After the President's successful surgery, his smile vanished as new revelations about Casey, Poindexter, and North seemed to show that they were aware of Iranian Arms profits being directed to Nicaraguan contrar. Miss Tennessee Kellye Cash, the grandniece of country star johnny Cash, was crowned Miss America 1987, She received the crown from outgoing Miss American Susan Akin. Two Arab terrorists stormed Istanbul's main synagogue on Sept. 6 killing more than 20 worshippers with submachine-gun fire. When police arrived, the terrorist detonated hand grenades and killed themselves. Front Page New: A drought spread throughout the Southeast during 1986. lt was the worst dry spell on record. At the peak of the drought, crops wilted from southern Pennsylvania all the way into northern Florida. Even after some rain, many farmers in the Carolinas, Georgia, Tennessee and Virginia were on the brink of ruin. an, A -S-.. K President Ronald Reagan and Soviet leader Mikhail Gorbachev met in Reykjavik, Iceland, for a two-day summit in October to discuss arms control. The two leaders reached an impasse on testing of the US. Star Wars weaponry. ,,,..?. Deep under Lake Nios in northwestern Cameroon, the earth belched. A bubble of scalding gas rose to the surface and the wind carried it across the land, Within minutes, more than 1700 people were dead, burned by steam and choked by carbon dioxide and toxic gases. Among casualties was a large group of cows. 0 I Page Neuff Among the celebrities who died in 1986 were singer Kate Smith at the age of 79, Benny Goodman, the King of Swingg james Cagney, one of I-lollywoocl's famous toughguysg Ted Knight, television starg and Cary Grant, Hollywood Movie Star. t . ght to H mber Gennadiy Zakharov, a Soviet U.N, employee was arrested on a subway platform in New York City and charged with spying. A week later American journalist Nicholas S, Daniloff was arrested on the streets of Moscow and accused of spying on the Soviet Union. Both men were released within weeks and the entire affair set the stage for a superpower Summit meeting in Iceland. U.S, Air Force and Navy jets attacked five targets inside Libya under cover of darkness in April, delivering a response to what President Reagan called the monstrous brutality of Libyan-backed terrorism, Among the targets was the Libyan Naval Academy, shown in the enclosed photo, located in a suburb of Tripoli. Fran! Page Near the unexpected emerges lf, ji 1' 'Tw ILICA ! if-- - A gift from the Class of '87, the ceramic floor cat tile located in the front foyer welcomes visitors to Wildcat country. The 'Cats Blues Brothers, Frank Murphy and Hanlc Fillingim, lip sync and dance to Sou1Mar1 during thejunior Class and De-ca Club Fashion Show. Dressed in trash bags and smiles, Seniors Curtis Dawkins, jimmie Kyle, Chris Davis, and Aleitha Smith celebrate a fantastic football season as they cheer Trash ' the Aggies! ?70 Clfuigrg No one knew us . . . until we took that step . . . Out of Bounds - the step that separated us from the ordinary and average. We'll remember the joy we felt as we collected district, sectional, regional, and state awards from the unsinkable ' swimmers and the untouchable Lady Cats. The step that we took left deep footprints. In academics and athletics, we excelled and left a path for others to try to follow. We unleashed fury and determination and broke the chains of undistinguished to become a OU T O T OU DS school . . . ,XX Trying not to remember he has two essays due for Dr. Harrison, Robert Nieman relaxes a moment in the library reading for pleasure. Searching for clues during the Club Week Treasure Hunt, Nicole Bunch, Lori Fish, and jill Marsden look for a special locker with a message on it. The sign says it all! The Wildcats went forth and took district championships in football .am swimming, basketball, cross-county, soccer, weightlifting, and tennis. lil' lElElSllE'Fl'l'lElN .glzerman pogindon .1 fwfvffppl- V-:Q f,m mwzfp f an ,A-fm. 444 M ,MV ff Ziff- fp ' 1.54-532,527 ifjfli yfpji, 55'f-WW?lflfifffif,-'f I i'?7'f.-2ffjZQf2. Q6ZZ???Z fa4Q2eZZQwZzw ,KQQQQZZZZQZZZZZZZZZ a ,,fj,j,jC, Zjffyyi E3 , vii Z h if i This yearbook is dedicated to Sherman Robinson who has shown dedication as an educational leader. The school requires conscious and constant administration. No school can realize its purposes without someone assuming the 2 72 Dedzratzon kK?WWQ?4WZ?V ZQMZWW5W9Z54 ZZZZZZZ2Q?Z32??z QWWWW W W f responsibility of helping the many per- sons involved. Mr. Robinson's greatest strength is not in the raw, unfettered power, but in his skillful leadership based upon knowledge, good human relations, and the ability to get things done. 1 fi-'Q , ,Q 13 ff Ljk W V W Vmfg, ,N . X92 wgbobjgj QVUL, I 051110 ij CJ CAL z,jQLL ,LLL VMMM QVIL . . 1 X f . , Q Dyumfc aeplgclbg ffl vc QL 13644415 A yn, MH if 1 , L W, 0 ,wwf , x,d,f ..f , 9,-, 'MQ 1 V N' ZR ' LES . 1- X. 1, dx ' gr 1. x , ? J. ,v X THEME 3 W V ., L f . K K. + P55122 15 STUDENT LHFE 7 F Q'S W xQf'w ummm 7 g D dw Y X X 1 4' VYWLDQ LQCVD . .3sU.4Q,niL'xf Q ., H' Voss '29 Y? Q01 Ll,,fwQS,!wf'v wfQ,r? V1.9 f ' N Afiff wsfif Kixwi V YJLQLQ ,L ,zgqdkrm c h 4 D551 LLUEQJQ Ugfk' 'A 'QUMY 4-MLfwQ4 LQQJJJ U f . ,M 5- 551 + 5 of l Q90 Ng x0 - lam - N gcfofp SWWQKEHY 3 LJLJU3 L DL! .77 :J J , .Aw 09 49 xg' 9? 6 6' 6' Y' W1 ,JM , 1 W 1 Q 4, 1 ' 1 1 , 1 1 1 , 1 'v Y, Q, 1 1 1 1 X NV ii Jr' Jj.-A-' . Li ,W M mf ,M . hx ,Ll 1 ' A '1 4f1,LJ Vf' 1 1 , vu., n-3 f ' '1 Q WM. w X 1 ' X Q uQ 1' 1 1 -Q 51' .JG 1 X 'WZ , , 1m 4- f 1 1' U f Q., 1 x,1 . 1 -1 . X Q I 11 wx L J .-1 uk-if W I1 Q, if hid- ,Q 1 1 X .Xa . W . M J , K 1 1 1 Q 1 X1 Lf sy N J , 1 1 1, . 1 ,. -W J 1 , f1 au 1154 .5 T1 1' wa Tis 5 11f 1 v LM W' gk! Wil 1 9 yy THE i1 x ' xx 1 ff' 1-. 171 Elf 1 11 I x , 1 1 1' an ' 11-W: M. du ' J iff! y, g. GJ 'ftbq kia 4? W1 WY YN Tm 59 J 155' 1 1 B-11, digg' wax - fav 1 -S352 H J' fqiy, V xxmx www 'Q4., W N41m-3wQkf fkfizwff. V Uukfkffpfhifq- ,,, , 1' ,1,1, k,,1,1,,r 341, 1?!,.,,1!,,. ,J gf V 'P1,v1,f,1' ,ff 2,1 2 , ' 1 N1 ','11',1'V?11, 211111 fr-f' J--,A . cg. -gf M1,1 fM41numl2.,g --3 , 1f.1, ,f, 1,1 V ,,1 ,,f1.-',f11,7,1 11 .fu ,A 11, - Q . -A QQ ,-4. -L, ,1 11 fQ11e1-221551i1Q1f1,f11f11f1f -ffffsf ' f -4LVpMpQ7Mi5fffUMU'P,?'fdAQ' 'L1ff1,z1,'1:1,1,Nfj,W. 'N ffm , ,y12Lf11, , 1 f ' 1f1 f ' 11 21' f1 fff fl P1 21 1, il, xx MMH,n,m1QWufCfyfC2Qle'f1 1,,411,1l7f4v,C,.1 1, ,rj .K ' l'1,,1fE,i11,,If11f,f Q f V: yi C 'f I - '14,1f1f.-f.rl'f11pf1 1'f1 f1,1'f1'fr',1 ,1 1 1, Jig, 15,11 51,4 f.1,f1!1f!,1 11,, fx f1, ,J 1315! 11,V1A,1'y7,fjF,1?1,4NCf 1 ,K 714f'ff'91 -4'f1f7f1f'f4 W ' K f 114jf11,QC1,'?1?:f,1?ffmgi Nffx F , ,11,f,f,Q51i,f1?j jfxgxff ' lf 1 fl Xxxxxxwf QQ A KQUSQO