Belton High School - Lair Yearbook (Belton, TX)

 - Class of 1964

Page 1 of 168

 

Belton High School - Lair Yearbook (Belton, TX) online collection, 1964 Edition, Cover
Cover



Page 6, 1964 Edition, Belton High School - Lair Yearbook (Belton, TX) online collectionPage 7, 1964 Edition, Belton High School - Lair Yearbook (Belton, TX) online collection
Pages 6 - 7

Page 10, 1964 Edition, Belton High School - Lair Yearbook (Belton, TX) online collectionPage 11, 1964 Edition, Belton High School - Lair Yearbook (Belton, TX) online collection
Pages 10 - 11

Page 14, 1964 Edition, Belton High School - Lair Yearbook (Belton, TX) online collectionPage 15, 1964 Edition, Belton High School - Lair Yearbook (Belton, TX) online collection
Pages 14 - 15

Page 8, 1964 Edition, Belton High School - Lair Yearbook (Belton, TX) online collectionPage 9, 1964 Edition, Belton High School - Lair Yearbook (Belton, TX) online collection
Pages 8 - 9
Page 12, 1964 Edition, Belton High School - Lair Yearbook (Belton, TX) online collectionPage 13, 1964 Edition, Belton High School - Lair Yearbook (Belton, TX) online collection
Pages 12 - 13
Page 16, 1964 Edition, Belton High School - Lair Yearbook (Belton, TX) online collectionPage 17, 1964 Edition, Belton High School - Lair Yearbook (Belton, TX) online collection
Pages 16 - 17

Text from Pages 1 - 168 of the 1964 volume:

r 6 U15 lair 1964 EDITED BY THE ANNUAL STAFF OF BELTON HIGH BELTON, TEXAS U16 Lair Staff Ioycelyn Parrott . . . . Editor Kay Bryan . . . . Assistant Editor Dorothy Kinney . . . . Business Manager Tim .Tones Walter Burtchell . . . . Photographers Danny Kirkley Randall Carroll . . . . Assistant Photographers Alden Shepard . . . Sports Bobbee Jean Taylor. . . . Organizations Sarah Trevino. . . . Personalities Charlotte Millian . . . Typist Cable of Ezwtmfs I Adverfisemfnfs .,.. . . , . 135 IP crsv mlififfs. .. .., 121' Q Spam .... ..... 1 Ol I Q zfifmzry fvmfs .... . . . 95 Q Orgfmizafims . . . . 59' l61 assff . . . . ......... . . IQI L Adminisfrufivn and Muffy .... . . Q I Graduation-- 1964 ! Just one step toward the future that carries us on to meet the demands, the challenges, and the pleasures of tomorrow. Behind us are the steps we have mastered. Yet ahead are steps that are higher, steeper, and even more challenging- -but also more rewarding. Our years at Belton High School recall the changes that have taken place in our lives--and our school. As we have grown in maturity and intellect, the school has grown to meet our ever-increasing needs. Looking back we find the success and the failure, the victory and the loss, the challenge and the con- quest. They will always be a part of our lives and yet -- We ,4 re Klimbingf i Old Building K .QRS -. is , swap 5 ,sw ffmzxszfesixggsi Us-ilwsf YZF: Wlffiifv' -f2Wf2227 f'f' -,Z ' 4,,,A:,w1zi5,Zgg5ssQiss,1qifwfmgm- A-ww Arsawffw Keir-JwMxw?'Q?w:aa -Q gm2egg3,WW -QgmMs1f.g.Q1ff5fFzx?fw www,wigsgsswrfwfwnss V sw xx, siieyiggssifsgvifesyigifiiiiiligfsisgifsgifiiiLYgfffgi-Q?ASWW-ffS1Qfea5fHi335i6ii'MS 'igimk 5 To gm,5Q1isxs1,5smseLfsf.,fs,,,-.fw as-s ggss-.smsafes,zs-J-ffwm5szs'zfsQ1fv'2sm'ff gsm? ,nw 1' :mise ess. Qs? sfsuagffsz-wav, Mews? ffgffmwwzf-K wif 555113 H M fs,,As,s,l,4w .,,W,iM f 2, mmfss,-si ,aww svfsmggf514,-wsfsrlssssl Asus f. V 2 1-sziszgfsfmwSwewwfiasiiwfsiysfrienf warmsrsespsfiiznaewilfeisfc Wg -SEWER? siwigs'swsgimsiis-www:Q-w-miisyf-ws, .ws-S sm-:fmaiw-iimisfm wx 'mme 'sv -my wwv iwhf? SM'-H -z f xfsm-sfssgsgmslfsmysswsfs,f1Qfwm.,: ,s2m2wfsfi.95'ww SEQ si wwmgmLM,s5.s,i,,siiwszllsf gags w X -W wwfwsiffw,g:,zfsissMsmkind, mssf w Sw so '- isfWsmg1f,,s:gs1QHf-S-MQ.sms,Wf2maM-H - my sslfwssfwfsaffshsw- QQQQW: -fn swf 1 :mf was-wfvss?i1f4?'fSw' fix 1+ 'QM Qgifw , M55 Y 'QfQw isoisgsesixiifwasflfsRiuis-Staff H ifwgzefi-w,rE4?fef 'L LTYQESQQGQSQ -P -wwwfwslsw-fsfvw: - wigs:-ws-fwf:vfzwssgf Ye -A wwf'-si.LsSa,,m, , ,V img wsss,iA-ffisfimim f Q,-may Es.glffigslwizssxfssis - ,. H-asks W-gauge-mf, wsu 915,287 wifsf - -- f 'V Mwlsisssgfs5gWWssQf1Hi3g': SEAS , 1 M,-' Missy F' 1435? .. f ,. ,ms feiswwsfwiswaesssrsikisfixfiis gm K -, fg3Qf1is.Hszfmfs1gsWwfes - 4 . ess!is.ssSgiv2fffgs1siiQs,,gfa,siiwifes sais EQ Isiiziifgeuiazl? fs-'oflgrrf' , ff :- ' aiwgf QsaigswlsiqfhsffW1sHQr'z3f1s?'f?51?3is?w . QAQSWIL 7557255552: Q 1?i?fi?1?fr 155 7 . ., lssigfgsfaisgisqssruaffi 'f 6'W5aFwSF:!rss flifzfhfi'-. 'fig s - .. '- G5?+W.5xm 'liiegzsiil-l7i1'L?i' F':i+15-1XPff'393V,z5i?LW'SK55k Lmgffjf i Q sf , seilfssfdwf ifmiigfbzig?Z3f4i?iE?5bggai5,95vf5'1gm5SP!l?E1S4gg5 - ' f' , wi sw iss: iw mivfwafas , ., -. , . ,zi,,,:q,, .W WM,imsgsiwspsf ssgsx-iswzmi V ' H K ' S J Q .iwwsi W fig, Wsffrs s Q P4 Q M 1 'Av V1 if-15fTF:'W32E'l5 if .2,2,mgmwM2gg Wsg,U,?sd:f5V Q ,swiss sr Esg?ss23jE12gfgLf?sw1iseSfQssfiwf-lsfgbfmfa g??s?,5eQsg-5pugs:,i,4S2sW5iQ22fsgeswih'fflsldgizfifififiiflflsi isis 12, ssfswxfiwvf ,Y Zwsgggsfsfigfnsigw-,Zf-Qswds3ieBNf-Esisiwaiisifi V? Mi, ,dwg sm -swf awww-sri .may giffsmgg rf5s1s3gfYs :ei U25 M, wgssmsws-fss,.Ms f M, Wm Xv,A M Y ns Nw. .Ss Q ,wfwsf ,M -- me fs- M- 5 ,Sims sfsingw, MMi,,,s7Ss,gsmm Ai is W , ,, .ww ggfqsesiwisisSif5-922ismiiwfzsssfszibiiwzasww1 5Missingggssgfaisswmgwsggsfswgisuwfiwifsg: iz5Q53figsQ.sqS,Q253S?3gig5Qiigii,55525ffE?Qfi18iSZsij?7ii5I5'K5 9,Missesis-igwiwfgg ws ffsw,swwsss+ 3,- , 1 .fggg Qf-,fnsJ:5f:-fSify-Si,?'i5iVigfflwwii xwifskisisssziw ggiiggggifgeigxsaiiggsizisrgggggsaqgmuwgsgsgigsm,,5wwi:,qwf1 i,5ffAzi,1-ew., fLL+.w1af:fw?'7f'si7f1 'fgiuifsm f i ,.,, U. -,.,i-V, - mi,-.5 ssiswvssfzssiifwiiwsweasfiiifsifWiffsififsgiiils -Mi, if Wm wma :S if g?52,ie:gg,iffgigsffQiisgSf-swfffssmiw gf- 1s1:wns2?? . .sm-sf xg :wx gf 'wmefs his L,-is use s f S N 3 s gg,ggisasvsrqafsagiswsxmzisfsfi sefzisw wgifili-55 .L A.,A s?isws2:QLsv3lafis,Qikiggfiaggswiswkawwi We NMS! 3 is sn is dems?-a'1i?,5!ssY5,iffisfsfwfffffi iQRE.Q55lgS5iii?iilifV155igsj552iiii55:-ii5gf52s!fifV5lf5f 5fL1i'42?:sFl12?4Eg?5fe'1sz?JWsif7Eiw 295355255765 lgss55?1gQ3ibFi1isg?gf'52iSf?iE45T45iiz55l?3ifQ7sL5ffk --:W2,fiQgsf5sswgykms,,gsS:isQWv41f-'exif ,,s,w,,Wrsf.,:,:sws ,VVA iwvqgswgsifmmgegszaw,45yg,fQs-51,13 74921520 wmxmfxixgiwz jggigws,ggsw-figsagiigssfassigfwzwuzsf.wi N Ms:.WAszzs-:mv,wfssyvas.:Su W, ,yfmrgggiffLs1is5Sffs:3?'f4M13ssfQ5f'S?f'se-' 'A . fi 1-V' .31 1 ,MSW Q ,K im- 'gm9gU,sz.w,H-fsrw2sass s-.f41sgg.u,f, ,if s im, swfi12s:sgXs5wvrm-Sy'so'A , ,Lk. Lb-f .,,., I -.,,. ., 'ef 14522155 ,Q-v-582531:-'ww f -QZAHJJYEJYYKS ,sf is sL:w:s1smwgf2f yawning wr-Lsswz f2:1fmw:1W fs:Si- ,www-Ww.f iss-51SFf'-ixxstwissivwaasf?-ksaris,-,z,ss assfif-wg, .sffgiggsgmisis-iegssaiyggieigsyfwigegfsyg-Pm Q K 5 W W,..: misss-sz fa :r2s1is?wx:2ffffV 555,,s,-ku,mss,w.wwsm is J J. f f .sm Lsasf4z+:zs1.ff1fmsf wigs m,s,is,.,MM ,is K ,wx . wsu 'Q- Si fi. A :V sctvwf 1yAa14L2,ggfEl-kzrisffie mes,-12-isis-ii'QL-W -W-M - SK M95-,gEsrmsszz1sfMS5 .Hx gg pzeL'gg1vgwxiv1' Lifialigg- 75515535 -is sw-J sim, ff A ,wgfszimss ww ikyiswffsisws pf ,, ls. Zfk 4lW,A Z,Q, Wgg5,4QLgg:eg,ssgAg,fng1n fg,wLgs4iEg2g:as1?wLvy279' -Lei.,-f -as ffiwrlsiilisi G A57-:f'i2fWl 3,,l,,,s,y fungi Misffsw -U in s ,. V,,. . ..s,.,,A mv ylgzxwswsnr-Sfsfsciriqg. .:f'fZE2 s S s sxxg SF? 5' 'ts :- ,:1i,,,,: W -.,,- ,,7.s-ww. - Construction begins on new B.H.S. ffg ssiJ15ff5:Klil?:? gsW-f1,mwsLmwziiwf S m3?gw??mffi:ssw,fmgfwsf sfifwwi- - i W 5' S X K L ,M Q, zgw1mfwfsis21a113-Mszfsfzwfssr ffm Hz-si-is I ., .,Wm A. is N 1-Q S gsmggssfsgg-Qsgvgeezfwsqiff-HM-isff 55- I 3' -N W isl5wg2:zzf,:2e,:sQgw if 9 gsaiggfw ifizssifgxzfiiizsgfwiuiiiif?--f,'3i5Uf 8 'W ffmHsww1:fPEss1-:Mas sf, 12, fziaiffe Construction progresses on new Building skim- ww ,Mig .si. ,M1,f3fgi.S .,s,,-,iw v --sg. fVfsfg.:e1NLErxs A ?3ff5o1z9WVS?X'H?1isiT 5 L1 -ig?,sggss'gm:yrf'e:fs:-gpsfgsziie-mix'.iff g-ffsgfg-fgrgnx:Q3:s73:f5fs4eiv.g!zisgfsQAsiois ,isifszfsf -4. 1-1.972 A ., .5 fj5gZ,:si.e1Q:2ff1Weis ff- V221ssffsfisz1s2f1QfffL-- X in -XM , wisp As! :agg yfsse.wA5g3:z,.Lv 44582 ig, is swsufy s ,sy L,f,.,fl2,?5gs is is usqstssif 1 as ,,, , . - IW 'JT 7l'i57Iff?l W .iikfifv f-wwwf'evf?sfk5efw:f:Z:2:sz 1, Agriculture Building B-and H311 F' Kampus Vicufs Science Building Homemaking Cottage N-N.. Q 'f'1y M,,,.,ViX,,1, 4 X , ,v .X . , Administration . A , ,... awww Li Tiger Gym New Fieldhouse Football Field ,, mamma swf ..munm.muM-w--Hman . ,mmmmw -'fa-:M ,, n an was The administration of Belton High School gives guidance to our program of learning. Our faculty presents this program to each stu- dent. To both administration and faculty go the credit for a success- ful school year. As students, we reflect the efforts of our ad ministr at ion and faculty through the knowledge we acquire and our application of this knowledge in our future lives. Admiuisfrativu and Qucully N . L. Douglas Superintendent Frank Kraner Counselor O. A. Barnes Curriculum Director STANDING: Wallace Law, Benny Bay, Jack Pittman, J. O. McCreight, N. L. Douglas. SITTING: T. E. San derford, Stanley Casey, Louis Richardson. Administration Glenn E. Lowe Principal W' V E92 .1 P ik g N- ,?.,..,r5w,i,,r,,.,,,,., .. .ww M .2- -ai.. - frf2srs,g,gf.Mf,ss1 v1,,.r f ,K L vs egg? K Rf M a 'A 'iff :is as-as s .an ,' ,WS 5551? Y m,gggfrgg,f My v ,, ,gf to r' Y di Q58 I my :Ulf w wgi. MEX Y 5 V ,riwwj -'W 6 ,, 3 Q 3 asf N is J Rf. -1 '1 5 me at if rt... 5 awww f M' QJWFQQQES, ,. sr rg i r i ii n i fif liiv ' ' Q Q 3512. i is ig , fs i fc as Y Mrs. Glenna Fuller Royce Boren Assistant Principal Virgil Chaffin Tax Assessor ecreiizrie Mrs. Dorothy Langston Mrs. Kitty Burton LOUISE BARNES B. A. , M. A. Southern Methodist University Supervisor, English Department, English IV MARIAN BURNETT B. S. - North Texas University English II and IV SARAH DORN B.A. - Mary Hardin- Baylor College English III, World History, Journalism f 2 iw a up 2 .ggi 82 if I . I ,. P, K . W., A I :Q 6 , T5 I QL .TAMES B PEARCE a B. A. - Baylor University Latin I and II, English II LAURA MCLALLEN B. A. - Mary Hardin- Baylor College English III, Speech I and II s 'fl . . ,Q PATSY LUCILLE MCFARLAND B. A. - Sam Houston State College English III, World History, Journalism IAIME REYNA B. A. - Pan American College Spanish I and II VIRGINIA BROOKSHIRE B. S. - Mary Hardin- Baylor College Typing, Commercial Math, Bookkeeping, Annual GERTRUDE I. YORK A.B. - Baylor University A. B. in L. S. - Emory University Librarian PRUDIE W. HARVEY B. S. - Mary Hardin- Baylor College Typing, Shorthand, Bookkeeping Coach McFarland finds some happy moments! Qfff-' rg' 5 2 E 2 GERALDEAN W HITT Mrs. Hitt and Mrs. Kaiser don't believe in wasting a thing in Biology lab! , sa., M- fsamff. BL ss wswyf. H -:- -- we SE CT Q' ' QZQQ- - ' 5?5g53esisi5gg:5fLsz52se2sfsff 5 ' V 1' ,MIL ii: Y. awww, s ,Wa -M -f-- , K is Kass? a 1. 54351 iiigifpgx , r sfseggiuezwsraiigsiiiiz, s, we :msgs fsfelssmyqgie ' va 'S l V5 -1- -fn 1: jaw is 2. Q , 1 I K Q 'WMM 3 31 es K K ,,-M, H -, , - . ful Hs T td' ri gslaw. Q gigs, 3 gc if . l ,N 1 f avs .,,,,a. - rfj wSz.f::'i1 rg 'Q M3 s, .- 1 or A it i s -si x-i s -Q Jgifsfmswk-'is ,H-15-W , E. H E ass,-.,f ,, . ,-.f A ,..,, ...W H is - 'Si is Q in -: -i ff ? -St iac rzlfr 1- Design:-,-w,sfi1H:--frifffeswiffsi 21 S F - -- ez, -- sw:--. Wffm -f-ff:.z,.- fw..-,,..,f-M'-U r .gs i ns .i ssltssrssz-W-rf, .s...-was . '51 1 :ii fi: -Q 8 gs - 5 f 52. sg-X fs ,L-:fg - E1 E-En' ',, 3.1515 51 , C A -K A K ,fe:,e,gbKLlsi:f2pfQvZ1 '1'L,-2.355f,J'55 .zz-H - r- 'H-J:'1 a s f2ia5::f.'i'f? 51 ,iiff 45w?5:1 5 H5 :': s A j'SS19 5?4Sif? .,.-ij',:-zjggsjgfjjj: 1 255: 5 gi gigs ggi - f..,,.W ' w w s J 3 ,gif B.A. - Mary Hardin- Baylor, M. S. - Baylor Biology, Business Math J, E. PETERS B.M. E. - Sam Houston State College Band Director JOE B. JONES B. S. - University of Texas Chemistry, Math BLANCHE KAISER B. A. - Mary Hardin-Baylor Algebra I, Geometry, Physics LILA PETERS B. S. - Sam Houston State College Choir 2 fbi? ns, ff igsf-V m' E 7 'I'24 ' fl' -wus-sf-uswyw-ilesfmf rn - r 'gfflrf'-1' f 'g : gg-gg-f,:,EQ.,..,, ::.,, -V 1 My 1 5-ri n ,-: :3 1 P' ' .f gflf-9'5lfff5i?3'5'53Es55,'Q?'E5y3W?f'4 V w ere ' 1521.25 -'tiff'--' 5 2' 4' ' 'Q -Mfinfy its fs ' -Q - B ' i Y 'er fl ffi1 ' iEsl'i .fllyiu 5, A 1 1- f ff- A-,,1'kgf. .r.535lSr:.Vl f Q ,ff . z,,s.:3sf,2 ,psg-sl Tl' . fx. ' sz - .,'- f,.1'4fff '5'Qw.J ' E . ' - fi' s ,rs 55535. :if ff.. ,g, V l,51g.QgS,?w?.lf M r Riggs We Q- ' 4 5 w s iwfrff' ,. mf . .i a iiggwe-5'I' 5 ev, K fi A 'A f gre, z I ,K Q. K. . ,nga ,nga i Miz,--7k ,.f, . , Q sf, ky A E as ,.V,V, .,.,zV,: 1 . K iii H . s.,.,:s2Ws-5 w d,g A ,,g.f1t,R,5:. . , .r 4,5 : i--1-TE? , J' ' J 5151 ' ' Q .55-giiiffilsi .'.:'31aLif? . gif fr,jL'l' . ,A ' J-ACB, .ff by , K ff 'fm wfw ww - 1-fs 5. ., 54 . ' - Q? ' , L' f- , -' U as f?Qzi'i-Zi? 1 Mmm , f L 1. '.,.. . , wI,,,1.,., . Km: . his . was It Xia i ii t. Q 1 gi e K gi? M is sis 5 ,, .ee ,Rimini-sf? M ' Y R C. , . 6 is k W- Y 9' I: r W J is . s- ' rw ,nzpsiiii ,. , mfg, IACK WORTHINGTON B. S. - Southwest Texas State College American History, Athletics BOB MCFARLAND B. S. - Texas Christian University World Geography, Commercial Math, Athletics BILL NEWMAN B. S. - Baylor University Government, Economics, Athletics BOB PERRY B. S. - M. S. Baylor University Biology, Boys P. E. , Athletics DICK FRERKING B. Music Southwestern University Assistant Band Director 6 Mr. Peters takes time out to make sweet music! SEX-J2V15f-imffpi- G 'S 3 3 2 S ?f3Si?5sf?f'5bfx asa fy ex, 2--sf-'f..,E is A ,.f--if--nat, , P.. 2 3 Qggseisssiswzmeri M' ' K i:r'---r.-1z- gem ,-me-Qs--,-' J, ., 'uleigfm 'M.:wf4.ZE':iFiQ17 A' ' ' 2 :mths K' 5agag,1ezf.,7 , ,--5,- .-. x ,,5k,,gjgg:f,,. S2 - 3 2 M, , f- -1, ag.: . , A 1-gg. 1 K f P' ' iw, W .LTVT4 sa, H Kwi k. E,-1, -, 'W '-h' sf . ,gy f- U: ' 9, 3.5, ., . ,gms 1 'Y xv. gif . ' 3 ' ' ' i if 5 T 5. V f ' 'Sig' 5 K its .. 'V 1z.fe1..V,.-,. ' '- , 1 1:sw-sip 5. U , we si: 5.11 signals xy. azffff , sg., . ..,.... ,, . -siisiiama 'aafksi frvs wijgfansifa f .ZW-12 ,X ., is-1t,..mw '5Y 5 gi ggag iiglssiamwlx -1' 52 sa, fa -w,-U ' I asa H:-ai2.,. ssgffggwff-1Q?sa-5352211 r. .,,.., , .,,. izss ti' if his A aasgrk ,z,fiaf.s5,-5,1 - w esgvfs wlsl .,-.,,,,, H , , ,Qs - ,T A a i-: xS55Gf Q -- --awfk , vaswsrs xswaw ggrigfekf-,ggssw , iifwfst .. .. s ess. Q54 ff' frksiaws ,es-fa. ' 5,559 5 39315525 fix, Aff Q::..' ef. 15- . ,Elf f5?'Qi5H V' MSHA? . .,.. ,WW .. , qw- .. . - als: V :: s:f2'4::s .rf V- ae.- f.,, n.,,, , he . ,. ma.- mass -is awffww ,mime Q X , , . wsfiw 1 A A JK A , Us as A x f A sf' N f ,f fs, as v t 1- f gs Q as , I s A Q , S ah-f.,,v ., s 6 ' a S' 1 1 v 9 92 fs ass' 92:2 -9,g2g5,51ag:,wiasQ.S, Qt 7 7 ,Q H -. x-,'- ,af ff X X an 2 .. -,A- A sf.. ' W -,.- is for . . WE W 235 . .0 , .aa .. f tx ..,:: 3 trzzfxw , nn:-1. -V wet- 'A ' -,Ha asm . Q , -' ,tisssgigtir ..,,, ,W ,A Mft.. ,.,,,.,,,,,,..,,.,, gss,5... ., Satwiiswrew ' aslsisfsezsftsgsifsrsfz s?1if?2ig3a,Z?4ggag:g 'siA22s 5555?-9sqQ1fsK1ag555g,?' fs?ggi'gaf5mseass5g,gg1 , fs - -1, ,2iQgsiigg,gg,,.. -Weis WA-.ft ..'-Wpwwiwt-fs--ww saw,:er-ss-sw-e2a:s111 .. :sf - 7' -Q.-f,-fi--f,f-. .. ,.,.., .. ft M -awfie-.:s-1fm1s,.w,. vis-asaazszaegig E 5 5E5S55??5,?Qi?lE55?Ef?S?flffef3 5Wf?i'f5'??gQQ:ea Rae,-fine. , ,gp ,K 1 L' ' 'gl ., 3 ...,.. ,, S, M, 91 'S s s AQ, f- I v fsisfefxflli ED FRANKLIN B. A. - M. A. Southwestern University Distributive Education MARGARET DAVIS B. S. - M. E. Southwest Texas State College Homemaking CEDRIC BETTIS B.S. - Southwest Texas State M. E. - Baylor University American History, P. E. , Athletics B. B. SHAW M.E. - Texas AKCM Vocational Agriculture LAVONNA L. THOMPSON A. A. - College of Sequoia B. A. - San Jose State Girls' Health and Physical Education ' are , as-1m,7fw,.e1f-9' . .5 s,,f,f.,,-W-SQ.. W, ing 3 Q25 3?g5Q25?5iiQ5figf7s52 N: .25 W W5 ,. wi Liss-:aaffeisfssfaiifi ...Wx ,a sf f f ,Z -g m mm,s,. M . x aa. 9-wa-.sm2,ff2, --. ,. ,M . .. , ,,.,,.,,s,. , . ,. 13 , ..ssm1aaa,: .-A -.......f-pm. t4a: .a.:r,as fw ivl .P 51:21 Whsifls saf ' . '2551i1:E? 1255 ' :?f55?:H::4E':: ff Q ,T .P 5 X K A is Hs .3 1 3 Z s S 5 f sw X X X . .. .1 is gzlisarm-tws,'a :sm - as f 2 X 1 A , 3 4' 'Erik Q2 N M S '5 s r K- W -27 - -fsiiimsiaf-mms' ' . wa- .,... .awimw ,. -W -W tv, Y f T H I. Q if 1, ws Q g 5 4 xi ma i F A fmt 1 1, ,vw 1 X f ,H 2 .saws .s 1..... :,1fs, 5' ,S ?z HMB xaxsxgash , , . - . msmvrssizart mi .- ws- .1 , ' - -5' 'v m .srlaxfw Y--cr W: :'5::Z- f f .-'A ,EQ -5 5,1 ,'12z4ssz:., 4??ss?f9 :i2:x'!i ZfESq2E:g:i'r's. :EP :M , ' ' 1 'sf f .w,.fqs 5-ruff!-gii v itslllsg. Jag-43... isiafz. ' iiggjgegi iffilhgzlswlfwlsfatft' wh H wx? , :fssIs21., 5-fiifiliif? Yi i-refs, '1 Ars: K' 1 mn. wr, 5 .. '.iI',,' - -ry-5,'.i'3:f5'k St Q2-eggEg5.sz?ai??'59' 953325 Mr V safe-az1a.!1L5s.. - -.w'.i' f s,ie,1assz--.5--,, W- -swf-x. .--fs.L-if-1--w1,f1,fw, :--si. -Sfezfa wgiesfer' Wgjfgini i -' Q ,fsasia enssfsifaisgiszf Y.- 55' ' Qs . .wgaxefigiiisgsaaggs,geigfi Q xg,-sis, K ,M K Z- nflsifeiifife,f4,T:s2iii4?ff34e?wiia,iw 2 f xzsx A A -isis-as U'-gram-Q21--f.,,ffK raw, ,2 2 - -J, E --z,,m-ss54,f2f,s2g52erf1-..2-isit.'mz X I . '- iv.. ,:-si - ,-swiss :es.sagfss's2,gsi,- A --is -fsffs.zsaw, fifff fa? . ,. , lggsifiesgszff-wfzga,m f fr.-Zagat , . . X R A - .EX , , .. ---1,-a,,.a-sm, . . .. , . k . ,.f,,e,,f , , S ,W-f,--M, . . w t-I :nf gm-fsegas - , - hifi -W . f - f - 5, fe, mama -- -- -- , , ,, . , -V '- ,,m,.,, .. . . . ,rf w.R41a5S2?Qfsa5a,' ,,Q, , ,. . ,, -Q51 ,-- if-, -- gig' . ms ' my , : .,: ':ir : ' fi, --..:Qgsf:t5,w... ,s f ..... it---4-f.f Mi-its.. Qfefivwlki ,IQ EL. ' , , . Q - Q - ffA5s:isilf,,.c QQ KSHQSSWKSS Saw :is 11- fliiiwzgf- X,-e5kg,5,.t,,gw,,qggg,1asrage..s5.??g!fig?2g35g25fKgq4gi55s1 . 15..- : f --saiwsass - - V,-fs-Qgggw,gt,,r5,.y,.atf aaste fs- f-.- ii 1 3 WB9ii- A S2911 L. rm s 1. A Q. - ,Q , 1 , Q L .. Q. , S. fa. 5 wa , M... E ss rf Sl is AEE at -ass A me mf QPR' s A tts 4 K Q all S Q-jfs 1, 15 K , sa 3, J P ., U , 2 -was t. . - 11512 seg-,, H--awasaw-2.-sfssfssaaa-.aaa , ws as -.am - '-1-wsfzfwfagszwsaswffsast , 3 s fm- 4-1 mg-1s.a..a,s.wa.,-is.- ass- 7 -wha., rf511 255isszses'-ssifs-152425323 ' ,- f,,.st.s,,fm.1s,.s5,.s.-sat? .2 ' f-e.,, ,.f..,k,- ,. , sa, n,.mr1ez.s:,.sx1e FW -V. X :. z .fx , . f -a,.aaa-agaaagelsen L, U .- f -f ...Y,.-Ws,. .af .- ,.,. ,.,. . . - Mr. Reyna takes time out for that pause that refreshes. SUPERINTENDENT OF MAINTENANCE D. W. Jones ,,-V ur CUSTODIANS Charles Haufler, Lonzo Lawson, R. L. Eason l CAFETERIA Bertha L. Slawson-Superintendent, Hazel Claburn, Eula Francis, Mary B. Schmidt. BUS DRIVERS W. O. Wood Gaston M. Mayes Jessie Whitis Lillard L. Golden Lathayer Whitmire Edward Smythe I al 5? is En, ks 52 35 Ea iff sg. 5 s E Y, 25 31 2 ai R 25 E' 'fi gr f Q 1 K. L. Throughout the years at Belton High we have made many friends. These are the people with whom we have worked and played. All of the students have goals which they hope to achieve in life Some will reach theirs while others will fall short of the mark- -still they will long be remembered as our friends. Zlasscs Svplzamorc Officers Kcgin year Top: Ia ck Davis-President, Jam e s Johnson-Reporter, George Taylor-Treasurer, B r e nd a Thompson-Secretary, Judy Forrest- Vice-President, and Beverly Boyd-Historian. Sophomores learn study habits in Mrs. Thompson's homeroom. Bill Adams Sherry Alford Delma Allamon Sam Amato Donnie Baggerly Ronnie Baggerly Linda Bancroft Barbara Ann Bane Elizabeth Bane Sophomore officers mop up the year in their eagerness to become upper classmen! ! 20 5 'id , ,.,, B lzurl 5 . 5 '5 Qs .fp A 3 3 4 Q fi ' Q I .F wr Q Q QA S2 . hr - N Q3 3 af K 6 . . if ami 'rf ' 2 WM sr X ,gf S, by 1 M it si Q K ' in 3 FQ 1 args ,sw . . 1-:fx .fF5'?i:f5'5LiR'?:flf1lf page is 1 f mv fa-ggi, S 4 sz Q 'aw W 3 J Xi ' rr, Craig Beauchamp Katie Birtchet Jeannie Blair William Blankenship Judy Bode Wanda Boney Beverly Boyd Mike Boyd Beth Brackin Doris Brenek Eddie Brinegar Kelly Britt Billy Brown Janet Brown Lelani Brown Roy Brown Doyle C agle Jesse Canales Ramon Canava Mary Carpenter Randall Carroll Cleta Carter Susan Casey Mike Cloud up 4 -Y ,Q i 4 ..M,.. if Q T f' , , +R wa r i X- as , in 'S' .., S 5 M 3 'J ,NP f s -I9 9 4 NK45 r lf 4 4HX Ju'f ifksii , J- 'rar af ft if G N 4 ix is s i,rag,1.,fg.-Q Qian' , f Vg . ,.,., , Y ,. H, 5 ,, ., Q, all will NL it ' 5 ii A1 1, A, as i Y A , z , S r fi W e as S Hit as A f H if A-Q gf A! ve' ,, .,,,. H Qffrggf '4r-r ilrfxwi ! 'f i ','. ff J ega'g51ff g5g5B?:?55fi: sfwawrint f.-' t:'1 f s -5:15 j 1 , is T M2135 W- , . 0 , K ff 5 ! J, av 5 as EN ,, N A, V zu Q , A .,,. . V' V -- f,.Qsggag,1, V James Duffield Richard Edward Kay Elrod . z .1 af., fiwm 43 . si' , aa J, s 5 J ' W Q , ,SS .f V if 5 I' 3 F 4 ,V W fa- il 'wig A 9 Q W 2 Q33-yi, sf V-ffl .U J' ' . ,-,. , ,L Virginia Curlee Jack Davis Bill Dietz Ioan Dudik Michael Cosper Billy Cowan Sandra Crowl Ruby Culp David Cummins wiv , S? L if J 1- if , i s A Marilyn Graham Roger Green Janet Guerra Pete Guzman John Haley Bill Ham Gary Hancock Pat Hannon Judy Hansen Paul Hansford Ann Hardin Bobby Hawk Don Farmer Juanita Faulk Earl Wayne Fellers Dianne Ferrell Helen Fincher Ann Flowers Virginia Flowers Judy Forrest Alice Fuentes Mary Gayle Garland Lynn Garner Bobby Gilliam Mr. Renya drills the sophomores on a Spanish I lesson. Bill Kelley asks, What would you do with this little bit of charm? 24 .Z ,',, - , -lik ff. 4, I 9' QM vi 1 X w 3 I an My M5 ,gl SHE I ggi...-Q?3'11ii':Ef:fiEi11: 17 133 5332 .- 3 K 8 if SL xxx., Y 'fgg ' V ,f3frf'97 ,Q -- ' Y ' f gr : I j fl R, Wff I gf' f f ,sas . Janell Hendricks Allen Henson Glenn Herring James Hlbbeler W Linda HlCkS Artie Hilliard Tivis Hitt Travis Hitt Tommy Hoherd Terry Hood Sammie Hosch Wayne Housewright Linda Humphrey Barbara Jackson J Mr. Jones instructs sophomores in the fundamentals of Algebra ll. James Johnson Stephen Johnson Dorothy Jones Carolyn Karl Karen Kegley Bill Kelley Mike Kelley Patsy Kelley Miles King Hollis Kirkham Jeannie Lane Jim Langenegger Kenny Law Nancy Law Suzanne Law Martha Lipscomb Daryl Long Randy Lucas Sue Welch displays physical talent as she shoots basketball. I im Mitchell Mary Mosley Mike Mullens ' Johnny McDonald Bessie McDowell Polly Michelson James Mikkelson I on Miller Doris Mitchell Bobby Mauldin Connie Mazza Wayne Mazza Linda Mabry Mark Madison ,, if ...- Brenda backs Big Red! ' Florine McDowell M, LV ,Terry McNe111 ,- .ri ., Ray Nieto V 5 Denny Norman if fa g Norma O'Banan Sharon Owens Lynna Parker Frank Pate Johnnie Pechal Glenda Petty James Pierce Mary Puckett Charlotte Quehl Enedina Ramirez . I Qt X S an at M NM si 5,159 g - 5 E mm as aim? S r ff' S 'I' s Q Rusty Russell Jane Sallee Linda Saski Elizabeth Robinson Gloria Rodriquez Karen Roen Pauline Rogers Mike Ratliff Linda Ray Tommy Reagen I oy Rennels Thomas Richesin Lee Ann Richter Frances Roberson Gerald Roberts Otis Roberts Tinker Roberts OOl-I! What it is it? Susan Casey screams to Sue Welch as they perform a delicate operation in Biology class Homer Sawyer Charlotte Scrimsher Bob Sewell These students prove that Sophomores are industrious! Jo Ann Spence David Springer Ella Stewart Johann Strackbein Donna Strawn George Taylor Brenda Thompson Gene Tibbs Edna Tobin Travis Toms Bonnie True Judy Turnbo Judy Turner Ernest Urbantke Linda Vargas Randy Shaw Tom Shine Linda Smith Willie Snow 'W-es' fl E E T S rif f ' y 7:11 rig, 1 , i f -w.-w1,rm..- as . , ,.,. we -f--' M , , -, -fm . .f - - .sp 'f Marvin Ward Don Wardlow Joel Weatherford Sue Welch Joe Wheat Judy Williams Glenn Winkler Joe Wolf Mickey York Victor Prcin EQ 'Vi K V 7 ' lie gm 1' if , , rr -ffl Qjffi k . Q K ,M ww ,L 1. wr y -. ' gsm , -vt: ,r it f I f45ff?lLsr:51fl,: f5f - ll Ifffi, r ,U A :E:g' H efffwfi'e'1feQ1' p 1- I K .Jeff i ' i Q'fsgff?Qw:, Nw :,, I .71 in I Meg ,.. f cf gy xx y 4, K , rx were Allene White Anita White Mary White Judy Whiteley Becky Whitley Terry Whitley Gail Wiley Allena Wilkerson xr 2 , g juuirfr Ufficers 'Urwk-lip Plans for Approaching year Ragsdale- President Gary Douglas- 5 Y d k 1 yR f1dV PyC pT Ronnie Albright Andrew Alcozer Larry Allen Donna Baird ,fuumrs J-feud P. 51414. Membership Drive Marguerite Burris Clover Cabaniss Patricia Camp Patsy Camp Larry Baird La Verne Bilbrey Joe Birdwell Kathy Boriack Linda Bridgers Charles Brown Laurel Brown Larry Buchanan Sheila Burrus Walter Burtchell Bill Carpenter Eilleen Carter Jamie Chaffin Mary Chaffin Jo Ann Chapman - ' in-as 'agp ., in m W H' I2 5 S F M gi s f T 5 K WV S S 2 I .L -f Q J gg? I ' Arthur Chupik Robbie Churchill Rebecca Collins Glen Cosper Wesley Coufal Margaret James, office girl, busy at work during sixth period 'V jp .5 M y 'ii ,QE M V ri, V,,yf MQ? .Z M .,.. M, fi f ,, Q , Bertha Craft James Cross J im Cross Mike Crow Lon Curtis ,z wgftxir wig. A , tzeszesfmffz. , . ? Sgqi, sfwsft, W A , mm! K ,.,r,, rffs-rw1r:'fst,':fi few--'ttg3k3gg? 2, 1 7a::,,ffg,, we ft 11-,3g,,-2, X V,-. ,, ' A miifiiitf: f,:1:, f-gsm , -S. t -f,. .,,- i ,, ,.,.ff W wk . ,yt- f:1.,.1,.: ,Ewa asc feaehf mt .. Q , ,tw- K Y .P Km W J . ,. 1 W N Q8 ,,,. tr, P' fm Wig! 2 25? IREM? X .64 Y ,Egg 25 wfakm Xi yi? i ,,, , '-,' Kenneth Davls , E . . , ff i-' 'P T' V' V Sharon Dawson eeiiiti i D L-.- Y' Dennie Dixon ,mL, t ' .fi ,J i'i'f?iff GUY Douglas VV.Vg D , ,tet e , - E, 1, 'f.: 17? f',- i 51,2141 if .','- e f K W. 62 'I K' 7 - 1 -,. 1 il -- Darwin Dykes Drew Eastland Betty Elliott Students suffer cold feet and wet chills when they think of their Mid-Term exams! ! I 34 i 3. H, .,., 6. -V -2 ma, e .ef -s at ,114 J K 1 all i .r Q , 4 ' rf 4 L , La' -:X -3 ' 1 A ' W ...: N -ear., . JW straw smug Virginia Fuentes Marghuerite Garner Rusty George Gerry Flowers Sandra Forrest Mark Fountain Johnny Frazer John Elliott Lola Eubanks Judy Finney Frances Fleming Judy Fletcher It's a big day for the Juniors as they make their down-payment Solice. for Senior rings! Pictured are Marghuerite Garner and Hazel Q e , Joe Birdwell leisurely studies f??J during sixth period study hall X . us. if A 3 ri, Alan Hallbauer Leslie Hamrick Lou Hardin Martha Harmon Pat Harrell Tommy Harrell Ruth Ann Harris Richard Havens Mary Heard Johnny Herring Robert Hicks Wiley Horton Fred Howell Veronica Huebel Ann Inman Margaret James Bill Jennings Janice Johnson Aubrey Jones Cathy Jones Tim Jones ,J Tommy Jones Carolyn Kattner Earl Kiblinger Lindy La Roe Janene Larson Cherry Lewellen Jay Lovorn James Mebane Susan Melvin Jeannine Merrifield Tim Jones, Ace Photographer, mysteriously stirs his magic chemicals for the darkroom!! V s,,.s, V,s:s,.: f ,.., J ..s,. fir:sift'--fffaiwalzfsfzzfsz sfzisg, S':s2i4ssiai4's ' si -' ws ieiiiifz ' A : gfol aii, E HT ' fe sQ.faksi'e 5 -' A msf :r si' -fgazwrr sf ,M '3 ' 4. I ' A f f' ' K Wil-'E55ff1f ' f iff: L5 31:22 '-f!1fi ,it'sf ' z a 1211--'1 Haze'-5 ' sasiae- Q I ,seam J Y wr xr S 3 :W f , r , . V, f-as was 'SQ J it V ,Q rw U if M 37 ,2, Eugene Mersiovsky L 1 ' D011 MO11tg0mCfy , r sr e N f N Rrchard Moore 2g,4g5:s 'Q ef Martha Morin V- . W I Freddy McCracken V , - I A X ... . ' -Q Carolyn McCutcheon Gaye McPherson Eddie Nelson Pat Newberry Sandra Norman ' i L '. Susan O'Banan rr gr 3 ' is 4 ez A 've w 4 'F' David Owens Junior st ud e nts take a break between classes to enjoy good fellowship and food in the high school cafeteria. ak' 1 If F wi 1 . iffy M , X W? in 5 K ' A ,Lge ,w ff' .ii- :g,x., -ef' W 1- J, - f-ni Q25 'X Wwtfwkf 521, ,,: 'YEL H :5'fk51: 75 ,5-aff . K K V v Q:figfgf.,,, xg5,,3n5,Qi5gg: -Bk-fi-7wa4Uf5f1'--P ful ',f9.'.,1,L-mg'ff'w1 , - Patricia Richesin sip ezsszn eng, Ui f -ff -2s'fQii f31ff 1 ' eff 'A ag ' sf .25 ,N r Mgr 4 2 Q X r , Wm 21 5 S Q ,L J Q-we - , w?'fsslsvW f :fm-1- :'uz. :ff , l fl L P y r syss ni, Melody Rench Calvin Rennels Carol Puckett Mike Ragsdale Steve Ramirez Douglas Reed Mary Peters Jeanne Petty Karen Phillips Lee Pittman Carolyn Prcin 1 ,M Marilyn Edwards, transfer student from Temple, enjoys her classes at Be1ton.High School. r wggsgff ra MZ gf + 2 W Y P8552 mum Higgs' ga at 3 gm 1 S Ri s ft :Qt fa sr f ' L 2 a ging ,N fl-,fy K yi A laik X 4 fl! s S Q or A V 0' J I 5 . . M SX K gg 54 git ' Q? 5 4 , ,, gifgggy V - 4' 2 3' ia ' I . ' ' iii: if :Lax ' 1 -fi-fig iff 'ii- fwf: -- , fifi 5 I 11' Q- -i K 1 .iii f' fi 1 i f K 1' t Si.gi1a-xg .53 :- , ' 1- A l'?fEivfrf'3y 1iziif?' Q y f I'm BEAUTIFUL, I'm GREAT, I'm going to SHOCK the world! 1 says Cassius II of the annual staff. fso Alden Shepard says !j Kay Shepard Larry Smith Hazel Solice Wayne Speer Larry Stewart Shirley Stockwell Weldon Strawn David Stuart Janice Symank Tenny Taggart Bobbee Jean Taylor Bobby Taylor Davis Thigpen Ann Thomas fa , fit X? . ., X f , af? -, 1' as-ff. Joy Riley Johnny Roberts Ronnie Roberts David Rodriquez Janet Roen Betty Rolston Kay Rumfield Shelby Rumfield Susan Safley Mary Ann Sallee Mary Beth Sandlin Patsy Sawyer Mazella Shed Alden Shepard Mary Heard speaks on behalf of the Wheeler Dealers in her campaign speech for president of the Stud e nt Council. Both parties showed much enthusiasm as evidenced by the many banners around the campus. Q Gif . - .. 4 .:s, l1,1 .'.. t xl wi 41 yy yi Y -m sl , E ,. EY ia 5 2 XX H fy digg, as M , wa QW J X X3 K 1 , A ix X of 11134 s - 1- ffm , , li X X! 'im ' ,:: 'f.f- is ,is , - -'sf' - -X -- - aff pw D 5 ::. s 2 ff ig Xi was X, . fe , ,rs W Q X 715331 - ' ,,.., .2 . ',:f-W, ' T, ' -f ,si -f - ,X nag' X ffiig., 5- X.51r5siX,gfgi . ,, ,A X '.r4-jtzffsh X ,waffle 1 K J' in iiiliisgrszg 1 isa i5f?fg1':jg, ., Q -X,V:kii:'253fk:six1l1.rX5 .Kish , as- ---- ,- W , .,..,.. 5 , . ,.,. .,,.. , . A, XS, f . X sm .sy fm- , f ,rw aw, , ,,., f, X , .W iwggtzk -, . 1 :rf as , my .X fs '11 . 4 4--.X X , . XX .X -,, - -w sf-: fy 5. X Lear ' , , , mf . fr: Qzreiaf' - :X am:-trg' -1' -f . -ur , 'ii T XX l if wi? . i If J 5334 : rf.:f'Xs I1 . f's,.,-ps, ,..'u.'E:2fa -at :-6 1' ,-X125 if af' ' - . ., X. X- , , ...uf 15, ,t at -. ass w 'Ui Q, X all lags, X3 gg My X ' Arr X P X 'fri J.- .13 E XX X Xi- Xi X 1 MJF' 3 , ,X X , X A 8 'L 9 k A Q is f W X ' 3 433 i?fs,,'.f?m,,,.,,..X.f . ,fa - Wayne Ward Linda Warren Phil Washburn James Wheat Carol Thomas Mildred Thomison Wesley Tibbit Mavis Tolkmitt Benny Trevino Dorothy Tubbs Carolyn Turnbo Tom Vaden Mary Vick Rosa Vriseno Christene Whitis Robert Whitley Jerry Wiley Terry Wilkins Sandra Williams Charles Wilson Eddie Wilson Mary Winkler Joe York Everett Zook miffr Officers Make' 29111145 far cw llmr Tommy Lanham-Vice-President Jane Richter-Parliamentarian Anne Sewell-Secretary Susan Richardson-Historian Gary Hannon-President Vickie Parker-Treasurer Not pictured: Barbara Steck-Reporter ip I 1 -f : .2 5 S 'Fi , W Vm:' gf ',., .,AA i . Q ' . K 4 +P'5L. Bonnie Alrum Sharon Baggett Charles Baird Charlene Bishop Beverly Bolton Koyce Bostick Dian Bowman Bill Boyd Tim Brown Kay Bryan Gary Busby Girard Byrd Diane Castleberry Jon Cawthon Larry Chaney Juanita Claburn Glena Clinton Johnny Copeland Anthony Coppin Evon Crowell Marie Culp Pat Daniel Alan Davis Ronnie Decker Bob Devine Alan Drake Royal Dunlap Jack Edenburn Tom Ellis Brenda Ervin James Faglie Bobby Faulk Mike Foote Ernest Forbes Gay Ford Judy Forrester Lura Francis Mrke Grbbs Larry Haire Gary Hannon Peggy Hansford 1 355-Q5 rligilfllefirgiiiiif +sxzfss2FfffQ?w -'ffffir .23 r S-1532521 X VI gffiflf ff- U fFti:.'f?f i Milli? -V V 4 .rgmjfr -V . V. swf, ,. 1fI1Lff1ii2ff 2:1555 ,sf vf.l5Ef'7f1g, 755553, I .I 1: if-1' .sfo ,s :W-sr:-. :f ' if f ' ' ...ata f -' t iff. if f ff? - iiggzik ,., , ,. , K .QM 'M,r,,rt-1 ,?gs5,gsmz Joe Harmon Linda Hawk Jerry Heartfield Cathy Heaton Ronny Hebert Seniorsg Judy Forrester, Susan Tarrant, and Jeanette Lipscomb select senior invitations! Nita Hendricks Laura Lee Larry Lemmons Jeanette Lipscomb Charles Lockett Bill Long Donny Love Linda Madden Byron Mauldin Troy Hood Roy Hosch Walter Huey Joseph Inman Don Jackson Betty Jenkins Margaret Johnson Patricia Johnson Rayetta Jones Dorothy Kinney Dan Kirkley Ellett Langston Tommy Lanham Roy Lawson This group of boys is often seen gathered in front of BHS discussing such important subjects as. . . . . . . . . . . . . .homework? David May Charlie Mitchell Charlotte Millian Mark Moore Rachel Morin Have YOU heard the news? --asks Shirley Otte as she and Diane Castleberry discuss the latest gossip! I I I Belton's own Beatles, George Davis, Paul Phillips, Ed Kirkley, John Wheat, and Ringo Inman, liven up the '64-'65 Student Council campaign by performing on behalf of the Lively Ones. A really big sheew! Lowell Murrah Philip Morisset David MCDa1'1iC1 Ronnie Oldham Darlynn McLaughlin Shirley OIIC Thomas Rennels Gene Renteria Patsy Rhoades Susan Richardson Surely James Ross cou1dn't have any homework tonight! 1555 5, ra . 'la James Parker Vickie Parker Joycelyn Parrott Harvey Phillips Lonnie Pickett Phillip Poth Connie Reed Karen Reinke VL ww is me : ii fi is lisa Q' ,Q 1 is 5 5 E f ., s OI-I! Those Tigers are just wonderful' says senior cheerleader, Juanita Claburn Juanita 's spirit cheerleaders , Jane Richter Kenneth Roberts Robert Rodriquez Charles Rosenbusch James Ross Victor Salazar Connie Schmidt Anne Sewell Jerry Shannon Carolyn Shuler Glena Clinton takes advantage of the quiet atmosphere of the library to complete her homework assignments Tommy Smith Chester Smithart Barbara Steck Beverley Thompson Bobby Tomme Frances Trevino Clinton Stone Io Street Susan Tarrant Sarah Trevino Earl Tuten Johnnie Vickers Janice Williams James Wardlow Fred Washburn Price Wharton Butch Wilson Bill Long is calmly listening to one of Mrs, Barnes' medieval topics, Seniors Harvey Phillips, Alan Davis, and Vickie Parker perform in Our Town. The Senior Play held December 19 in the gym was sponsored by the Student Council under the direction of Mrs. McLallen. Carol Wilson Cindy Wilson Rodney Winkler Kay Wood Jack York -WmfMW:,A:,wWf-,..M.W--MM, . 'W ffy- 'Q wg ,--f v-fL g WWWW,L,.f,..w.L W ,,L,4,.,1 V A W - 4 -- f ff V3g:sf2Es?iElsff ffTlsiYk55flV'sg?iTfs2i .:f1i1:-1.553-:fi ,iiwf 12i5f:sa1f'11ZEl55E'viffbifwiifiwifs-PWF'iZi rl 'ifkiwfcxfzsfi'f2H1fle'f'-easssmf i'1si1111z2ff,ffwg:r1111ft1:3f11fQ.1r3f1 -1 1-12113211f2imns211s1.fs11i3-1s11f1f1 W1-G1i13Sii1ez11-see-W1-12i?z'1 1 3 1k , fflf'1s3if5Si1'fgs1s1-sf?-ifsf51:sw?3wssfi1stiY1f2WLS25Q!512m1s1S1sew3s?sfi1fw?2?Y H M. .,,. My ,133 ,km k.,L:: 1. . ,.kk in I WMMME.. M1131 1Wf,.3,s11s.1,,.,,.5,.,5s..t.s11r1,,11s.1 t--11.,, fy : 7111: -s 1--1z.1i we .V Q,-g:4:.., i111r1fee'.:ssfiHf-1511 -V1-S1214 M1511 537 52,43-M611 ,gfsifms L 'wins il' ,1r 11 W in , 1 tr. M1r,.s.1t111,s,.WI,Qis11QQ63Q1s1?,ssS11,15t,1251s11L13rs1?m1s,,1s111n1fs1sPit1e 111111s51si1r1fz:1, .Isis ,1 . 21i,,3!5Ss1.fs-msg g,?ii,1:fZg5,2ff3:1:. '21 nf?wi ,g2gj1iSLSli1lL'fi9g2Qf5lx5 iw'-b?5'f'1 i71'5t1'1?'i113i ss'1775'5:lV 'k5EEZQiTie51'fXf4v'-l 'fli1? ri,-s,.1s311..gL.,'Wg 113, 3f,1133g3z,1Q-.11wr15321151:rwfe2iS1f211Ssi1is1n::11fw11s35s1q-wrrwsfigafssxss fP?11Q1iw?iiF3f 1i'7A3i111Q2i:if2gli'.s3:314? 1 1 ff!,-as6112121-Qi:-ieiisifilfi 1t1ggjkY'i:v ,..,s.sgjj5:1.1iLg'5911!?i'! A ,3i,. ..g',1k1j11..1,.Q3Q'415E'.lE:1g:H,j5fif5av1.fst11J.551iillxiiww'lengiiiiiisi':2145sf'jgfEg3 O1:agwg':h1'jgl3 wgM.w.15..,m5f.13,.,, 3 71.3 ,Ls,Vtw-N315-sg1g,At..lg.,, ,F?,m.s3?g-,V1s13s:211?1 .w1s:1g?s111f5,1!efs11 1,s3..3,,,,1w-,..,-,- .. 111-.M-1,i1.111s,.111111.t,.s-.11111.s,.rr-.iwsv-w1wfk1fwn11sL11111,,s,.11k.f,.s1111 z,.11f- .11 1111 1,-1.111.-rw,...M-.t111i1s.ML.1s11,1et1,,m1213111s11.s,s11111s1s, 41 1,11f1s1111rg11311t-11.11w,1 H 112:-1 H1 11 1s1sfr,w.111.1111rvsei11s:.s:1rsggs-111w:.1w1w s-r1,ws111sss-15,113 1 .121:w11LEg1',3'1J1f'-'71 '33' .H lei., '1'2'2Ll5i'.:zzrifffii-'f4mz:s,3ig,f'1t.yyg gSf.1sgrswfggSi15fTs f'-IW'isfliflbiaifis .1.v,1,11:1f51.-431,-.133W311L1.s ,. 7.rer:1a?1311,1s:ngigg1s2iafrgqwQ3ta1sg1sgseg1s3't1f11w:ss4i1L1Qg4E5?d'?wg11gs12?sf ksg32Mggj1g15Ljg33:kgji5Lijj1w..sf:g1f,3f.1,iii 2133 iw., 514,313-315sz, 1--1.4331 H-Q 11121--1 1 -13,-53: 15, 11s .1-11.-211211551-::w32S1yt:ft321112115s1Et1s:.s3w5121sg3wsfst1w5:s?Ez1siHir 1-'1HiL1S7'.IsErL1I' Sri igfiiifsi i.'i..,L1:T1.,.. A. A f,--T.SQ1iL:'?f1 ,,,,fl5S5f1fi1..?Ef'i1?i33:1fif77'L1?? i,E,if2i11kw L1s3E1s:Ug:23m-nigga1.5Lqgg,gggQsme31t3o :y1f1,1r1w11,311.-W -1 1 .W ,rar -1.1113111111-s1s:1ss1113H,,ww:1sf+wS:'sees:smfessimmfsweewe 11, t1s1.1,1r,.11-15. L..71.r1:r.t1111v.11111t.1r1.f11rL1 3 V. .3-111v,.,A1.3s, 1s11t11131s3gra-rm15,L,,s11s1w1s111111.s1111i gs,s11ssw1ffs:1e32Af21LS 1gS..3,3ig1g115 1A 3:r.q3.r-15.1r51:,5i??11? 1s2ri11azgm7531tt111g1s'.r111L,:,.s1111:1-is3-use1s'11rg?1g1Snzfseg1Q?fs5g5:g4eiQiigiisigsgesuafeggzw sfw.113 .5fzg1Lsg3s1w: ggi-ssiiggiefxig-:fr-few rhL1si11s2?2?H:.gs1?MfsE iw 537235 wifi isfeefiusfk .s33113sysszvz-1111sz1si1is11retr1e311,11Cvse31s3m-si111-r1sQ1wg11a.Qrgss1ss1ss211sfss2svrs2i3w1sis31sf:ws2fv21s+W:m5?ts?1H11f1sfiQf11sfifsE 531131133g+fgis?2were1sissy3'aesits-1segeesQ13asewwr.sig1KgsaisMs35:2212122siresQgfggtiiiisii5139?ifghiiiitiggifisfiifiiiifig ,mfr 5.3gw,W,.35.3,153,1.s.111,M1t1111sis1s1,g131.r1Qi.,1.s.sfwf1sx1s1-11125915115 cfs: sw,1rs31s1,1.4,gsgwsff1s, 1 iq3gs3,,,,5sw,11--1-5311521111 11.,f1s-M,ff,1r3,1,s.t11.t111,3m1fs.1sv111 g21s1sf11:vs3s-w1s. 15eWf,,gfzr1s, 1 .Wir Mm D 33g,s115g1,3fg311e31agt1sgsm1s511g1z,,,151f1tsgqsss.sqest1sig11,gs3isazisi21fmsi22125911his121113iii?MEn:iihfisefseiiifiirfrbisftsiisfxil 3isfs3.s31szv11s31asv1,s11s32r1S511212211Q2is3ss521'li1iQhef212i2A12aze21sgQais2f?3ih-2s52s1fii?isefisiii2i1 1 mw2Y.:1g3143?g-sggssqnriggizgfsiv gn33551112512145rssir.s??gf2gi1fa?ig1wfisisfes 1 11s31s1wg2s-111u11e,1s1s1 sv-.s3.1t1w11 v11s1s11f.s wfzssiwf? 55,551:g1lg,3,1q11s331m1s1gr32g51S33355122415345131.sqgg1S1.gs315131122fefg1syqf,33g,s?,i1Sf1121315:g1iiis3gg:ff1ez.5y'0EQQQsei511s4si11?'2QWw??2e 1gszfgegw-131211533511:,1131s:?51sr s:S11s:'1s9?,12a141rg12s fef5QffL1sai111S2wgigiii 163511s171m-.sfigiirfigskgezig hw 1 use1s1f11s21s1a1s3.1g1wxfw 1154533ge,19333.133.511fr1Q,1s3gtw1si1t11,r12a1s3271f1 tgwgfggvtszsw --:les Vgit:,g..,Lk,7y1ez3gs-riffs 331w1sv1L:eHV. in 1fg1s,.gsi75gs11.szw:7,.f33g51111..Ggjggi1 W.2'i111S1,i :::.ss1ias-1g1 1: 11'f57'-SAPlg:?11wgr'-K1I-,L ifhwf 157 ,1eafs3f111sf -sift3e-.1rsrwY1sw1wz413: 1t1ffr 1131:: was 3155-W3sg1155-1M1251wim.1w-fglsii15ess .s,:1.:Zg1sgs:xfv 1mfr?f'fi:Sfe2Pv1Mw.fw:SLiHif?15efS1Weii11SifISM-fiiibifafiilh' is Hi-1.121 15'11:?71SsErQH2t1ss'f'-11.152-.133s1:fS3 F2133 IW-fv?'1ig3:..2,'L117t , .:ss1561571-519515-55iVii?'r5S2 1ssU'fi11wt1s5gf W7-l37l2f54?111s31'e1fi-573 :11,3w11Q, 111151s3 f31s,.1s3WL.,3 151291fg3g11sg.tg3 11-img.--,1s, 11511, 112115.11111 fQ2?t1s1,1s31g:iLge1r1s1 1rgf21:w1s-' sr :s f111Q,igi:11151llaiffeilairarii-X91 A45113'1W311i:L:Ef1.mf'1P1r9?151-iii r21si1?'?t.s91if1'9E:.iefM55-iiifsiiiliiizxrfillfviwfi1L1str:f?'f IW-L31:6ifs5 L, ,.., 3 W, , 1 ,.,,.., Q , ..., ..,,.. Q ,..,., ..,, ..,. 1 V 3 , ..,,. 5 ..,,. .,,.. t L.,,..,.,, .... ,. .W U..,... r. ...7 is s- ...,, ..., r ,,..,, s1...,s.,,s ..,,- s,.s..,....1, U if r51sz1g5gf53:,551rgmggggilg1f1.'ms1fg11',.f 9:11-?3E.5fe'1L:-1.92H12.. .V''1-Qz1sz'ie11?Ei9?Q1'NTIYSTT'T TYiS:fg1i1s,3w:1r 1irQ?1':3f11ii.es'1u , 13111-::.11111 211:31-111.1211new1215111111511s1sfir1s,1e3f11lb.s, me.wg5r,sL.,3r.,111 M. -f I sw, t.s-11r1f,11r1m111 5231,-szz1r1fr1.q31111,1,z31 , e,111.111f .111331111eer1111111g-.wisisterslrfsfis:.sr11122r2ef'.fv1xm.2sW iifiaibiw? .J,,..3,13,.:Q., M5351.5.11151q.1s,if1S,11s31rgs,.w1s1.1:ffgsis3t11t1s3sf2s:f1sf31sw. Wg,M.,-3b1t31r.,1.11-K1...mfs -1 asa:11-1112:11s1vs1w:sweiff-.s1rfswtsxsfeE112v11s:t 111 if 11 -1 ' H1 ,sg11tiz12:,11r1111f1exf11-1' 1 11szz111Q21safsWfv bikisikfgi' .QfTg5?7H'V?1if15215mb? i53VZi193klL5'5521 -v1.5?'.ft1rf4-5 1115, 1sEr g::!3j3 15-5I1SzEf3f'2gg5j115121533.ggvgriigggifgiq-1s1QtigQgijg1171??.5i , 31112si11f1,11,.g:q,-agjgggi571w3ff113,1 ' 1 11g3g3f11SgQgz51131w.sf-Wav:s2r1Qf22'1s21afrglsiwfrbiilifv'mei'iimiiifgiiiiif 1 ..s -w,.csk51,1i'-1,.lP5'1 , jfs: '.b15'f4iiYL lj5855553lii'ig1S1f5?:TZ5I.535iirf'1f?iTeiffa,1ivceliiiiifsiwii -1.1, 451111121 if:-1 ,LJ ,ai'gs3?g.f 41331, , 31211e1jg1g5,1353551225211e3-,115g1r.szfu1gg 1 ,.f. 153-111s-.1131r.-H.131113 3121.1 .. 1 ,k,,- 3311.1 .. M1313 3 W Q1-1133mfz1S2iwi122215333113Wszilswg 12' fear 22 Y' .. 3'1 s3z11il2'f: 'jig 5.13333311ii5TTS?Y4if?ii'l1.,, -111 11 f- ,. ,WL 21 -If if sf 59, iw: 'Wi ii if 1 1.53113 1111.11 1w13r,. ' mssiis-ifiisi'1s1ff'11s21:f12'53Q21-1s2:.u4S2Zf?7S:9:2l1i'if11 u'f'f:i 3. ,,.. gr ..,,..,, ,er ..,, ,.., i . Wit'-'is:i11-5 f155k1s3?f!?iis1iL11,g1,j' fi: 4' I 11-1 ' T ' :M Siifllff-i57'sf'L msyfl 3E:.lQ'bfgf?E?iet':f?11VVL5YL:5Lfzt:1sVA 3533.4 3 sq 3 3 is-'igga3gg3-tg.. 5415532,5312ses?sf-Q23e11-22553S25353sais-21iiliiregiwi-iff-Wil' 13 1. 1,- .133313- 1111171 2:113 31 131-11, .W-111112-11 3 t i i'-5921 - IST :wif 5i5F55Z.55:.?:is:y4iif diff W' 2111fi'.1e:Z1eY's'112z.1e3i1fife:1s-we1r1fiiff1i111w 1Sz'.41311f1.11,11 11-11211- i 'f715i?f5 , 15'if5QT1iHf?f2 5QEYrSi?iii1ffiifg1ii1SfL2ii.f5E:i,f5:92A1i1sii?sf5?-:if 'W 1 ' li1'1fZ5L15L1f7 :f M V' , ., , i fe Zffirif 1 3. i ifggggffff- emi, . - U 'Tn 5. New ii 191 2' 1 ,.,, 55 -v it :E if 11. ,,1s3111s, V, .1131r11s..1, . . .. M12 5142 nur- ' . 1? 1 ' Ws T'?d Sir: 3155145 ' f .1 ,.13f1f111:11-f.1gj.11,3,V 3 'LV.i57:- 2 1 51-11..v 15.11 ' ., 1' jg, k 1 - 3 M s111'111n1fQ.r1v'1' -1 , 1 'fS1EEEf55i7f'.':f?5il I1 -3 1-'1f'fE'1g:f1.1 Hlffflifs F'f3iEkf f71f5'k .1 3 1 ii 3gg11L11gggr1 11 gg - 3. tgs35fu!ss1sw!5Q11,1r11 2 13 1.'i1sTf z1:1211fr.1f, 3-33. 5i1S+ig1!fitQ?Qg51- , 114152h21f1.1kE5Z:57.155Lf?'f 57' K :Vi 'L 'VS z 'fb'fI11Lff':f 1 -flfilig 11 1-1112111313 1137 .xiii 1?-2512 Q?':i555?T55fQi5i3E'1iS5?55iTiff -1 1121 13311 wi?-'r .'i571iZ.531Q3Vf5iE1Llfiilhilsli 5.5:Vi5W-553fiQf?9S?TIQ55Qr5:-, --ij j'3'i .5 'L f5,:9f1f L-22.52 55 -Y' 35525 51-56 if 5w?T57Q57555'1,sf5VW 1f3I5 V .JZ ., 'if 1115: ' :r7 :1IVf.fT I',fEz:7f-A -1? 1: f.1ME15E: .5,A1137,11s3-.Q1r,.e.W111,.s ,,.1,, ,In-1 r 5 ff .3257 31. .12 11 :itszig 1.Qii1gMZls31gg2?i1ifSil'i0119: ' fs '- f .W ,nm .s:!11sjjjggvLs1lL W. in . :,.U,,j'3. 1111311 u1,,.s1..s ,.,,11,.. .-1.5, 1t11,.1,-.151-1, -fs-ftegrs 1s:r1e31.3111-mfs 1s.,,3 15,113 V ,113:11:s,.11,11-U1 1S1.:3,rr1v3 11- r. 11, 11111.13 1 ,, We -fini-12.15 wlsmf .sziisia-T 1 .. .V-1f,.1,.1 ,,,,., ,119 ,,,.. 1. 33 ,.,. 1-3Ef2if13i 11,fQ1. - 1' .1 ' i' .. r iff.. . K fifff' W f 1 ,.. 131535. H, .,1131r1W.s T-113-.1 ., ,- N1 1H2....f1.,, ,L1Qz1s2'f 121i1,fg5E111f' 7 1 ..., ..., . -f.1, ,W . V 334 11.1s Mg., 3,3 ,..,,.,1 t- ,1.1,., H5521 .s 1. ,133-5,1 v,.15311,1111: 11-qg1s111s'w..3112 '1f: 1f1..w1Q rss ww 1 11211411 U ,. , 1131- ..1121. ,,..w11,,1, .--f 1-,-1,.1 - -1 1131 1-15:31 ge'ir33ig2i'.1sfi-4flssx, size mL1s,1f, ' Y . 3 3 11 31s-1:11--.qv 1151153-11313wwgiggszis 51 .13311-r14fg1s11s3x113,1 M113 1.1, f--11: . . 11-1r.ga3:vg.1sw11111s:3::,1.,,. . -noIL1'G'11iEEif?Q:2g:rz.1a111,z11531 M 1 1 wr ,. 6f11s111,3, 3- 4 f ,. 3k:.::V..HE,Ek iwgzikisi:57gFi.kkg?g55.1i1 if 51 1. 3k:V3V13111.gg IR515.33-k.51g51e5Lg15fg535LEElfL5iEi1Ef552ii.5:?iAfir.51,-55533571ff5i75::i7E1?Eil55'1iai'3 mg. ,i.g3i3M.,1111s:.i f111,A,,.,,s, im 1s,.t,31,-,,.13,.r331g1 .11111-11,3 .1--,,11g,1.11: 15,'ws-+13335311113fs3.wfe1.121.s.11i,s,rf1gs11i1111.,111s311111f 1133 152 fr1qg3 Q11v1:2:i111,.r3grq13l11s311151215 f511f11swg1fes1Q5555igYSff5afgs2'1:iii1fS? 3m..,W im wkw.l,5.lLwk:L. gqikggii. 3,3-L. 033:km.ig.o,,g-srrilyimkigs, 15,5Wig,,.osy5391s.3,g1ye,11 1 1231f1.1.1szis,a311-?i,'iW5-ici,:.s,T1ssr ss'--111' .3111E..35125.5315,3m5121533W.133.gg3ff51s11r,-we152is:2L4QfY+f11571539115.sfgfrefeissfggsgeigssigsaffafisig,1siQ1e1iu1s25-.sggzviisz152312, 15,111fzgiw'252vasbgz522L2b13M151ssi1igfs1s33Zw141i11 ,1sz's1a1g1sQ4s31535452meig:fge?e15gssi52ir-:mise1i1S1gi4:123511511sssfshrifibigiglffffsfsif ,.1,3 11-1wif:14121-:ei'e1?11Qf11f1f1f1v1s3zr1r11 Q-13f11w11S Lg-51-w31r1 iw-:1ssav1si111'11115115ms11s:Sw:1wfsfisfiifii1hf21ff2LVi1ifier?f51?iMf if? ' 5 1135 nt-sr 1s315s1sL3s ,3-,1Q131M3-s,.1s311: M 153i,.111s11s-eff: ,11.smssff.rr4sf1,yggsg1g31g1s,11s1s:w v1ssizx11 sfffsf szi5i?5g1e211s3f3 Jim'53w:.gQtjQgi5gi?c1s:tFQQELSEE1iw?1.vt'.rQ12g52,1s9ff 3E15?Iisr12f?7TTbW'L5'Eki26ris5lfXK'F'11421.551'5f'15'Qi5fF7'xa'Yii9Sfi'-H:5f5.iQf!i11i:fff?' A31g5,q1559'.is9 LSB?kggS7l1kiQf?:'19Y595:iig.,, exif'S1553f5:r7tf5iTi5i1s:5fE9i5INWESEZQSE1'Ifwfiiif:5'7s555mf5?i2Es'A'?3iE5?I?s51523321553ggi511iEl5fEiiei.a99f 9 Lsi2i,1s3,11s-'f .g1e21svf1f2f'-Issff.i111131r: i fiSLg4aw1ss11fSvf1-111+1121.112-11455 fi 1113-.mgw 1s31gr3gb331.2i1s,1r1ss n311rw17.:11,1 A W I.E,1isss11t,,s,s1m1gqs,1.S3 1s3s,11s13nf1 1s1-t11n1ag1s,.1 15s wrsg-s11u11111 11f1.111z11w3si sw flS91If5fE587:'3.,. Ty ,,Z!isie:.nsxtfgf15g1aze.1ss? -fwieiirsi1fWV9f'iZ5,ilSG7ffil1?Eii'e55!'5?141'-3'275'T?1i,'YW?-SWA ,Ii'?tffsf1'179ii6?1 W?L seek 'Q ,H ii? ,l.1s,.,3t1,s5s1.W,sesfisr-.t53t1.:t1s31tgr111hr3sags11ssQ1,1e2s1sgs11mg1 11ers,1fsg1se121f2w1fsf1r1ef.svff2211sez1W1zl wses ss rw.. , 1 1-.zissrf VJ H -wen fs-we fft1sew,1ss,.r ,H11114 ire- L-W1 -.wow 1 11Qt11r1sw,1191, -111f51..:'f'v11--13 rf M5112 JGQM95' Yliff rx r 9511 ,1,iX,qis,.,,W.Mfg.s1.s .,s,.s.Ws,.3,,,gsmw1Q.New is-,sf 1 .. . M 3 33 W, .3W,..,3,,.L 1.r1s,.1s.13111,,.i sew. ,fe,.gs,.r:L1,3f11sr.s,i4,,f,s,sc1 ,ssh A ,, ,, 3, 1S1rs1.w'eis1311122-2231153.51Wife,51,W-1s11111q1m1?M1S1fswslhsi-1s,5T1e1rmr1pez-.sweartW1w31s1-,rfUff11e5Wfs1 f 119152 Hgsgsf rf , ms,31ge1sAfS,,m,-,,,w.113qg3s,1s11t11fs,111113.111f1az:s13w:1r1,gegzsa1m:w:fsu2Msvswiss'fs3211ss11s3sgsag3g1,111,31A ,Ls 1 .15 . 115q11,3lg5,,1s1,11q1.1r.1s3w111z1113msQ.11111.1wr1s.s,111351.51 s1.1ev:g3ev1srsw:,11sz2312'ei1fsss311f Y 3 i 3111m11rs1sts 1f2ass1?s:frisf13-f1Xrib1wise1ss1s:5ziiZrw11m1rf1r11w..sa13A,W .1211 . -w1 1w1ss ,ra,3 ,..,.w, .111is,r..g.s.s11ri,3,m11t,s.t11gs,.s-.11sr1s..X, fsvfshfsisfiaiigegs gms st Ie sw ,x3w119gt1j3gffw.ssxixw 31.3331 :.1a?1'21i 15t.xsr1:: 3333- 11sz1xv5ff??54J.'1'f-F1531'is,z1esWVLQSSQQSV1'-i,L.s.3L'o911f.,7V',5 hauc 1155192 rx. 7 A if 1,3 5 8,3tgt,,.KM,,133W31,.LL..1ty33,.,,.1,,r ,. ,..s,,. ,.,35,3 s.s.,,1.,1si.gg.,.si ms, ,W As,s1.ig1,f 4 we K 11M A . ves- Jmrl,335irM,.,W3., s,:2..,,,,s,1W,..,,,s3,1,, w,.m1fs1.11s-.1m1s.1s,w1 W -3 L 111 f .. , is ,L W A ,V 1s.,.,..s,..,,1,w1sf : X sf5111-fm,1s11s111r1fbsfnr-,,m1rt1m,111f,Wt-111, has.Qsfigee,1ss1.11s11,1f-it1ss11gw1s,1s,11:1S1s11myztgs11121m 35 S s Through the organizations of our school, students are given op- portunities to become leaders and work together. These organizations give students the chance to further interests in chosen fields. There are clubs for every interest and students pursue these interests with the ir own time and talent--sharing together their experiences. Organizaiian Student Grfuucil Top: White, Spence, Law, Lanham, Coufal, Birtchet, Sandlin, Wilson, Ragsdale, Mr. Kraner, Sponsor, McPherson, Heard, Lipscomb, Elrod, Pechal, Sewell, Claburn, Forrester, Davis, Coppin, Parker, Tarrant, Hannon, Thompson. Gary Hannon-Treasurer, Brenda Thompson-Parliamentarian, Anthony Coppin- President, Susan Tarrant-Secretary, and James Parker-Vice President. Anthony heads a called meeting 1 N w STUDENT COUNCIL ACTIVITIES: On slave day, Only Everett Zook's rnilliner knows for sure. Did you say a size five shoe??? Of course I'm expensive, but look what you are getting! I John Henry was a steel driving man! ! ! Ear Smash Senivr I9 ay Student Council accomplishes its goal of boosting the spirit with a car smash. I 'vant' to be alone, Jane Richter announces. Y aficfmz! J-fmor mary Hicks, Ragsdale, Reed, Clinton, Melvin , Forrester, Shine, Hitt, Davis Owens Coppin Kinney Crowell Petty Kattner, Williams, Birtchet, Casey, Long, Russell, Brackin, Alford, Sandlin Inman Sewell Richardson Camp M. Chaffin, Lanham, Lipscomb, Vickers, Gibbs, Burtchell, I. Chaffin, J Parker Richter Claburn Bowman V Parker, Lee, and Heaton. Anne Sewell is shown during the installation of the National Honor Society speaking on the merits of service, Mr, Jim Bowmer, Temple lawyer and guest speaker is pictured in the background. During the recent in- stallation of the new Honor Society members Jane Richter describes the merits of character, The National Honor Society displays a memorial to the late John F. Kennedy. OFFICERS: President - James Parker Secretary - Juanita Claburn Vice-President - Dian Bowman Treasurer - Jane Richter Senior, Anne Sewell, displays one of many charm bracelets sold by the National Honor Society. Cigarettes Top: Cabiness, Harris, Johnson, Whitley, Sawyer, Johnson, Millian, Mrs. Lavonna Thompson, Sponsor, James, Mc- Cutcheon, Rumfield, Bryan, Clinton, Kinney, Jones, Roberts, Rolston, Steck, Lipscomb, Kattner, Burtis, Peters, Bode Reinke, Lee, Hendricks, Parrott, Lipscomb, Bowman, McLaughlin, Otte, Schmidt, Jackson, Mazza, Lane. OFFICERS: Vice-President - D. McLaughlin Secretary - G. Clinton Treasurer - C. Kattner Reporter - C. Schmidt Qnot picturedj President - K. Reinke Drill Sergeant - I. Lipscomb Drill Corporal - J. Parrott 64 Lflzeerlmdcrs Left to right: Susan Safleyg Susan Tarrantg Diane Castleberry, head cheerleaderg Juanita Claburng Brenda Thompson Who are the Tigers! '?! Left to right: Diane Castleberry, Susan Tarrant, Susan Safley showing their spirit for Big Red at one of our football games. 65 e, .,C. 6. glllb Juniors 85 Seniors - H e n d r ic k s , Shed , Whitis, T h o m a s , Prcin, Rumfield, Richesin, Eubanks, Reed, lnrnan, Melvin, Sawyer, Newberry, Phillips, Craft, Fleming, Kattner, Huebel, Larson, Merrifield, Norman, James, Reinke, Steck, Baird, Safley, McPherson, Cabiness, Kinney, Otte , Lipscomb, Bryan, Altum, Parrott, Sophomores - Turnbo, O'Banan, Roberson, Strawn, Owens, Stewart, Bode, Hannon, Ray, Michelson, Flowers, Wiley, Carpenter, True, York, Thompson, Mazza, Long, Lipscomb, Casey, Roberts, Crowell, Russell, Welch, N. Law, S. Law, Birtchet, White, Williams, Boyd, Spence. 8.17.61 Officvrs S. L. C. Officers: Turnbo, Publicity Manager, Safley, Reporter, Carter, Secretaryg Reinke, Business Managerg'Law, Representative of new membersg Cabiness, Treasurerg Kinny, Vice-President, Ervin, Treasurerg Street, Co-Captain Tigerbe11esgA1tum, Presidentg James, Secretary. Zfiga Tig o the II, Da vi d Stuart, vivaciously leads the Tigers on the field at each foot- ball game. Klmir Left to right, top to bottom: Martha Harmon, Carol Puckett, La Verne Bilbrey, Ellett Langston, James Parker, Alan Davis, Glen Cosper, William Blankenship, Don Mills, Carolyn McCutcheon, Sandra Crowl, Pat Newberry, Mickey York, Beverly Boyd, Tinker Roberts, Jeanne Getty, Kathy Getty, Hollis Kirkham, Jane Richter, Laura Lee, Jo Street, Karen Phillips, Bertha Craft, Christine Whitis, Doris Mitchell, Judy Fletcher, Susan Richardson, Susan Tarrant, Johnny McDonald, Danny Kirkley, Juanita Claburn, Linda Ray, Brenda Thompson, Judy Forrester, Anne Sewell, Joseph Inman, Jerry McNeal, Harvey Phillips, Dian Bowman, Vickie Parker, Darlynn McLaughlin, Mrs. Peters, Choral Director. - w Anne Sewell and James Parker in a scene from the Singing Freshmen. lv vm-an-w mwerwemw., f 7 M H --QQQM-f---1 wswemfseifesgmmww.opxzsamvevmansmgag-3 Q:w.azaAswhxme-gsezsmaswwmefawwmgef'Gfwvawfwwgwwwwmsmma Hand Swvcfhmrf Susan Richardson Marching Hundred Sweetheart for 1963-1964, Susan Richardson, was chosen by secret ballot by members of the Band. Susan was presented with a dozen long-stemmed red roses by Band Captain Tommy Lanham, during the half-time activities of the Big Red Homecoming. Officers Joseph Inman-Student Director, Byron Mauldin-Lieutenant, Tommy Lanham-Captain, Vickie Parker-Secretary, Ann Inman-Drum Majorette, Gaye McPherson-Librarian. ,Majrfreffes Susan Richardson, Nancy Law, Ann Inman-Drum Majorette, Judy Turner-Head Majorette, Anne Sewell, Karen Shropshire. There is a mad scramble as some of the Band members board the bus for an out-of- town game. Susan Richardson is pictured proudly re- ceiving her roses, after being elected Band Sweetheart, during the half-time activities of the Belton-University game. With pride in his voice, Mr. Peters congratulates the members of the Band on completing a fine year! Senior members of the Band including: Bill Long, Dan Kirkley, Byron Mauldin, Tommy Lanham, Joseph Inman, Susan Richardson, Susan Tarrant, Linda Madden, Anne Sewell, Jane Richter, and Vickie Parker, are shown receiving their blankets at the Band Banquet. Top left to right: Jenkins, Ferrell, Graham, Shine, Coufal, Coppin, Cawthon, Foote, Mullens, Guzman, Birtchet, Smith, Williams, Blair, Russell, Lewellen, Turner, Sewell, Reinke, Law, Boyd, Law, Ray, Parrott, Robinson, Casey, Welch, McLaughlin, Boriak, Bishop, Tarrant, Alford, Richardson, Madden, Steck, Burtis, White, Symank, Forrest, Petty, Melvin, Inman, Bowman, Kattner, Mrs. York. gufure Fcachers OFFICERS: Parliamentarian - D. Bowman Secretary - S. Melvin Treasurer - I. Inman Historian - C, Kattner Vice-President - I. Petty President - J. Forrester 75 Quturc' J-frfmemuk ers of America Top: Brenek, Ferrell, White, Lee, Wilson, Richter, Quehl, Graham, Turnbo, Rennels, Bode, Turner, Lipscomb, Harris Miss Davis, Sponsor. Bottom: Sawyer, Alford, Roen, Mazza, McLaughlin, Saski, Parker, Culp, Trevino, Fincher Officers: Parker-Historian, Sawyer-Secretary 85 Treasurer, Turner- 2nd Vice President, Roen-3rd Vice President, Richter-lst Vice Presi- dent, Alford-President, Bode-Public Relations, Fi11cher-Parliamenta- 76 rian. ?.ff.,4. flffilfific' div 2 ' SH rr 5 X in V 3 L A 125553: Y 55313522-1.11 S A K 1 1.3 4' . ..ff?:ir.sfv1sqg,2s?1. Z5 is was Q1 ei iwfieifelifsli1am9112zf.1i 11r1sss, ::f1s1g.-1, wwf: 1, -. an nm , I,-an , 151. .gas ,,,,.as,,Mf .Wagga ..,, pi, 2.11 ,ff-, ,asm . .41 .,s1,1151aQ-...Q 1g,1gQ33affs11afrEY--1s.s.m-W - .1 1 . ,.,. ,ar . , ., --f1.r2z41.,13,, 3. Q. 17 A, .,.Q3,,1L,f, W. 5111552193gtgagafmmefaf?z,S!.q,g1eggwW1 . 921151rms151355s111sg121?7tfgqgfwf-12? 11,2 age: ':N11fe,11s?s32i.gig, A an1111:-:::11sf11ff.s1,111112111s11:fa:t..1f.1,-11,- 2 Qfi1.Q,l5'E -HfiEQETii5'i5?2Ti552i?',,,S?1Qiilgiiitifsrsxs' fx! 5? M.S,.Uw,.x.., , ,..3.i,, .. V,,,,,.M 11 Q it S S. as fsw'.sr11112ais5i2iff-1ff Q A X 1 1, rg 41 'Q er S Z 11.ss1,.,m2 E W 11 a s 1 1.3 M ,ms ,ms Q ., ,, A..,A , weilzb xiii 1 -1 s X .,,r,rgA,. ,. as as Q1 ,m,.S.111.. is .. X 1 55935115 sirisiizws.-12,52 M, ,1eezz1m1f'zfQ..sf.s,1.,.11, ss., 11 , .. if 'sm K W1--1515121115 1 -' W 1 .. f1s1f:u ,, , -51 - ..- :1..-' . P 7 15- , ' ., ...ss ive . .. 2 sg., -1 - an 1.341 sew. f'5i 1.ef..1fi,s1.,'1f'Y 514 .1 1- f . 11.11.111 1 Q' Q' iaisiiefiiff 5 ,V 1 l1f1iEs152i.,r. 1 rigs is , . -as 1 -1 .,-11. -aw 1.41, ,- f.f3g.,71s-Q713525111 ,V ,rr-5.ff51.-1-p W A may ,1:--1 - .. em., a-111. .. N K gmgsfy In .. ,, .. . . . A Q 3.3 5M.3,f,L V, L1 :.1:, ' ' swigff s1fETsef51i?iu9Yf7Ss ' ' ' -1 Q1i'.fSQKisi11aa1a?'L-sg1sf1'i1s3i:ig,v1Qf11gi1-gf H 1. if Qwssessi sQ.12?'.,zaesnaf1-.,way1,11 , Zsraf 1, 1 Bef Mfggr 9 wash 553.1545 is 2 w X a gr aes.: ..,'22,.,1s,g . F 1. Q ,H W ,, gag. Q.. 1 ft.. at 1 N 1' tif.. t Y 2 Sw. -ffm:-111:1:1-if11wa1sg1s1eaf1.- .. , . .. 1 ws 5, 31 31 11 fr M . .. ' 1 1 11, ws? B, .1 ff -1 15 ' 111 ,ff 2 1::f,9Eiii' 'ffg3lQf5fiQ3jfgg1jL-25QS'..?,ikw'i : Wm sn .Q ,,. .1 ,A 2 ,,1 ,,,,u v .J e .,,. 1 r, Q ms if ,si 7 . 1 1. ., ,. 1 ,. . ,. 11. H 215-1'a2l:2233r5b55g2w: .1 1,2I'figsz11s11.f15-f,-1...t11,!'fg1.ff11- .32 1. 11,2342 mr' fa K ' 'H' A A Lf' 'i S , H1 sm it 'X' - XM a9l,r355l5 ?r 'fl't1is-1 'x ' ...AEIICEI A'-1g 742S57QifT. 5- M- zl ' ' ' 42' . 2 .efu 15:1 L21 .yi ,gf 7'- f?'?,:!c'.:T1s'1e59T5f ,719z7ff:I.1afws::1.gUt.M 1' rgj 15-,p..r1Ps'rLgr1 ' , , G N ,Mm ,, X 15.12111 . i' ' fr' r s111112ns-1f1w1..w ' 111. 2-i11,,1. . 21-1211:11,.11.s.s-412121111111111,1ss!aaffsm?E11:1 s+ ff1.,1,,-,, 1s1T2,f2ggsg2g1f22Qv5S?yi53f.f21 J ' ,si.m,,.., ..-, 1 A , .., H G gg., t9w f,12w,1:-, 1 1- :2?5QE5'117f7L5ia35?ikY?1i2silfPzflf,Z11fi1f'L,fLg .ex ,-1-'55 gs ' . sz Pg: gpgjgg g1ges1sxz:f'sss1L.Pg TV-fI1x:1: :z' 1. ' 3 'L 1119 'f ki'51A- .- ' - 172, :viii-:' ., .1 K f ,plz : '1 psi 'nr ..: Zzf: 9' Vai-1, ,- 1- , ,,, ,ew f71,g31.1.,f..11.,11.11.11111.1 .1 V, -1.,1f.s.11,r11e111- 2.14. 1:,.1 21311192 , 1 1 ji7fx12gSi. ,t.sg1gf1swgi,f .1',5.:5W3ft17ff'U1f:w.f5fs1.:?TEs 1 ,-wil . 1 , V - gi 1 1 WSE-1 5' If ,,-ii iwffl , 'Fra VH-:Vi-1 ., .5: P .- J.. , f 1 ' 1 0' : '52 sz.1fn1 .1-,,.1, Q, 5 . rw- 1-sz , .sr wr- .5 .5 s s 24 sl S ax .N 95 . 1 1 ' rx 3555 ,, ,fra I1 mar. 11, as 1 . MM ,ws a sf 1? 1. as .1 N N 8 gk s Ms 1.1 J 'G 1 S mf qs 1 sp S X r r -1 ns my , 1 K Wi 1 X ,ra X 'Q 1 3 vi r if ar. x E XE sr , ,Q ,Q J is X H F K an 1 Y 4 L .1 S. 3 1 2 in Y' xx Q X Q SB 1 1 .Qs l . ami ,Q 4 2 E, r ,351 gggg, S H ss 1. tg 91 ,. Q2 . . ag L , EQ gs rf 5 1. 1 Y A -- 5 3 1 114 2. sQ.g1vf1s21.'.15s.11, 9.11 n.f-2fS11..1qvg 55,1551 . J ,, ,.,,. ,. , , ,k,, 2 1 Wt S ,. 1 K S 5? U14-'gg-igit?1tir,1w . -1 3. 11 ff 923, 1f,sg11v:1f,1 ,31-z. 1 .-f.,M1,gs- i1r1t1gsggsfaify. 1 .11, . .ff ,-swseff. ktQ,1,f' 1,111.1 . .1,.1.11,1Q?f -- 1155.51 M1 ,. 15:11-Myat11,i12,-1.,15w,.1,,11a , . . ,..,.11si5r,,1rg11 -.ag1zz..,,,1,gg13:1 1 '-Xian: : :1 '35-QNQEF1-',L:v,.:t I JIS 'l . ' w . , -11551555-.'sfV1W 1 35' A9359 WE? :f L' , VL. 5,257 'f.s.:firt..-1 12 .,,-J ,, . ,1 f,f1X1s..rf..,s. 1 114vf.f1sw,1.-Q 11 If g . s:2.,fi11f1'f1sy 193 an ,wg.51zigigg5,Jl,.ggag12z is A5353 sr . '14 1 '- 'till K gf ,.,. ,spa., -1-., '1 -.. .1-,f, - -11.12 -- wt -11.1 , nee. 1,13 . -.3-..11N11,y,,.:.r,a,1f':.1-1,15-wrssiswf11-1+ rs, My E,L.,m, 'ZW' '1,,.. X V 211115221 V115 .:f1Qgg3s5Qi1.s51le:rifXf L,i?Siife25f.ft.s11ast11ffVf,fr K X4 ' ' ' ft 11 -. ig. m1s,111r.ze.g1r.sr.r . 1 1 2 1 ' -ei '11 1 1 1 L21 QI? 21.193511 11m.s1sf.s,1g.g1. . ., s -,sw .11 --.1f1s:11z,.mf 1131118111-s1.e1w-1 sq A, ig J' ff H1 1: 115 1,315 srrsww S11-V A-'W ,ww S 11 ,G 1: , ., . sg, 1 N 1 ,11f,.1fs1LQ:.1sa15., Marla at 11 .5w1W:115,fg. :-,ra W , r.gg.fgw,. , may 2 ,v .' .112-154 , 1.1 we-1'1 A 1211 is K 11 + H 5 mis K-E1 rs 'E 'K 5 'Si' tw X. Q 11 an 2 kip. SS .--' , .. Q. ,-.-. T , , f 1 K - E . .ks JfL11s11s:Q1g?sgmfg1egs,g11kg1sg.sSr,gg5rssz?f,:i1115 ,..,-5.-af ., ,,g:s,1Q.:? ' U sis. 1g fgggiagw.. 1:113531.,yzg.i1s2,grgg1f.gg,.11 1. - . 1- f 1:1 ,sea-ri 121.1.:11-fa,-:v1f'11-5 arse: 1 ' t 1 .111 Q Q1 5,9352 1 'E -fx.-w.1.i1e2r1t,i1.-mtg ,- 1g,1v:1- ., '.Q31',1 5 sr H 335353511 P S X 1 , 1-2,f1,,,1f1:,.: qg.1m-1,15g1,1,g 1 .s.1,11t-.1...3,1-15.5 S 51 at 5 r 5 ,L 1. 5 1' -1:1-'z,,. . 1 1,1 2 at S 1 11 Pl W -5 Q.. s 1' , S aw .3 1 1 rf X1 3 W ., iyQ13.1s'i1,H1,-11.55512,1 Ms gskhiflfsf 155351 we sg Sgiiw T 1, is P' HY . 1 ,-W ...- . .,1s,1 .,,. 3 , ,H 9, j K 1 s 1 ' 1 . i V is it 2 1... 145127111 :1 K ,gn W 5? 1 gf was? QLQ1flf1 f11 3 I 2 f 2 2 , H 14.11 .M-mai? 12, . xx 5 .Mr .M,,.k..., S W 3 C sf 9 x ix 2, s 2 X is X L 3 2 12 L 5 f rg, 1, L I K .M N , rt as AIM! ,' 5k'1i'f'fZ f12 . 1.9 12513555 sp :li '-' AW .. 133 U. ,sexi 1 K , 121131 7 'vp' gfq , ,A ,,'I5,, ft- 1. ,- ,- 1 -as 12, -S 1- -,g -nj ' --512 ,..j::.g.12'.1?1?ff2-::i.,l5.:E?.r -1 ' '11 1 - 511.11 12sr22,1fS? 1g . .- , ,1-,,. . , ..,.. me . . ,-.. . .. . . Helen Fincher, Iudy Turner, and Judy Bode demonstrate a phase of homenursing. Sherry Alford, Helen Fincher, Karen Roen, Marilyn Graham, and Sheila Graham are shown with a patient at the rest home for the aged on Christmas d ay. w 5 Marilyn Graham is show n with two of the patients at the rest home which the FHA girls visited Christmas. . 8. Klub D. E. F A V O R I T E S Don Jackson Shirley Otte Seated: Shirley Otte-President Standing: Beverly Thompson- Secretary-Treasurer Eddie Nelson-Parliamentarian Larry Lemmons-Reporter Don Jackson- Vice- President Connie Schmidt Donny Love David McDaniel C1ement's Drug Pi8S1Y Wiggly Minimax -M-aww' Sharon Dawson Drew Eastland Eddie Nelson Wayne Speer Law Insurance Agency Minimax H. E. B. Super Save Y' tx Beverly Thompson Carolyn Shuler John Elliott Larry Lemmons Cochran, Blair, and Potts Perry Brothers Giles Service Station Household Furniture Co. Linda Hawk Clinton Stone Sandra Forrest Eugene Mersiovsky Cochran, Blair, and Potts Ben Neuman Dept. Store hfk DfiVC'1HY1 Howell THY10f'S Grocery Charles Baird Don Jackson Terry Wilkins Wesley Tibbit Piggly Wiggly Taggart's Grocery Belton Auto Service Main Foods Jerry Shannon Susan O'Banan Arthur Chupik Roy Lawson Fina Truck Stop Duke 85 Ayres Belton Journal P0115 Hardware Johnny Herring Gene Renteria Charles Lockert Wayne Ward 0 Herring's Grocery H, E,B, H,E.B. Frank's Lakeview Inn Baird, Allen, Coufal, Frazer, Hallbauer, Kirkley, Long, Ross, Tibbs, Kirkham, Tarrant, Kegley, Karl, Ford Wood, Richter, Heaton, White, Rodriquez, Garner, Carter, Brenek, Karl, Millian, Boyd, Spence, Reinke Lee, Safley, McLaughlin, Jones, Parker, Burris, Heard, Taggart, Churchill, Parker, Steck, Madden, Otte Brackin, Bowman, Street, Cabiness, Schmidt, Sewell, Forrester, Richardson. Medical Zarecrs 61116 OFFICERS: Reporter - L. Madden Secretary - D. Bowman Vice-President - S. Richardson President - B. Steck Bbw,-a. ,, juuivr Elassiml league Second Year Students: Poth, Trevino, Rameriz, Reed, Speer, Frazer, Coufal, Jones, Strawn, Whitley, Boyd, Gibbs, Stewart, Ragsdale, Jennings, Wheat, Curtis, Byrd, Kirkley, Brown, Long, Murrah, Inman, Owens, Chupik, Shepard, Heard, Williams, Steck, Safley, Carter, Melvin, Brown, Whitley, Stuart, Jones, Taylor, Finney, Flowers, Inman, Lipscomb, McPherson, Petty, Sandlin. First Year Students: Law, Robinson, Sallee, Whitley, Smith, Garner, Sewell, White, Kelley, Hicks, Law, Richter, Ferrell, Humphrey, Mauldin, Hallbauer, Havens, Hood, Brackin, Elrod, Long, Casey, Lipscomb, Russell, Parker, Welch, Turner, Williams. Joseph Inman gives a report of the Greek God, Janus, at the regular meeting of the Latin Club. OFFICERS: Secretary - Ann Inman Vice-President - Joe Inman President - Jeanne Petty Treasurer - Bill Long Parliarnentarian - Susan Melvin Students appear interested in the mysterious lives of Grecian Gods. l6'mk cr Break ers Top left to right, Arnato, Hilliard, Sawyer, Adams, Hoherd, Brown, Devine, Davis, Dunlap, Long, Beauchamp, Cloud, Hitt, Moore, Byrd, Curtis, Coufal, Moore, Pechal, Stuart, Mauldin, Kirkham , Green, Mr. Jones, Sponsor, Boyd, Brackin, Kirkley, Jennings, Spence, Law, Humphrey, Mills, Shepard, Mrs. Kaiser, Sponsor, Casey, Welch, RusselL Norman, White, Blair, Smith, Hannon, Owens, Roberson, Mrs, Hitt, Sponsor. Off icers: Bill Long-President, Rusty Russell- Secretary, Dan Kirkley- Vice-Pres- ident, and Susan C a s ey -Reporter. Not p ic t u r e dz Beverly Boyd-Treasurer. 84 ,Activities Wesley Coufal and Lon Curtis are shown illustrating the principles of the vacuum pump as part of their activities in the Science Club. Don Mills, Bill Long, and Dan Kirkley are shown with the skin of a large rat- tlesnake! Don't cringe, boys, it's not alive .... I think! 85 86 Officers: Kenneth Davis-Secretary, Darwin Dykes-Vice-President, Artie Hilliard-Treasurer, Gene Tibbs-Reporter, Randy Shaw-President, Ion Miller-Sentinel. 5'.?.,4. Under the able direction of Mr. B.B, Shaw, the Future Farmers of America strive to carry out their motto: Learning to do, Doing to learn, Learning to live, Living to serve. F.F.A. SWEETHEART Judy Bode Judy was chosen by secret ballot in a meet- ing of the F. F. A. members, She is an active member in the Tiger Belles and an officer in the F. H. A. 12an4f ptri r P p ZNNUQE O . - 7 1 s 'ISA F ' ,ff - Anv QR '. I 1' QQIQL1 Randy Shaw displays the Harold Shine Memorial Award. Randy received the award for having the most points at the Bell County Junior Livestock Show held January 18 in Temple. Artie Hilliard displays the Grand Champion of the Shropshire IHY LOVSTU CHSPMYS the Grand Ch-amPi0U Pig- JHY Won the Class. This award was also received at the Bell County award at the B611 COUHIY Junior Livestock Show- Junior Livestock Show . ene Tibbs and David Cummings display their skill -with the acetylene torch. UTTING METAL mn pl'HEd Actmtur TORCH. ,vanish Klub Spanish Il: Harmon, Tomme, Wilson, Thigpen, York, Taylor, Horton, Zook, Carpenter, Allen, Howell, Rennels, Washburn, Wilson, Roberts, Tibbit, Mills, Stone, Cross, Kiblinger, Crow, Langston, Birdwell, Baird, Wardlow, George, Jones, Alcozer, Renteria, Edenburn, Mersiousky, Cosper, Devine, Winkler, Moore, Chaney, Copeland, Pittman, Dixon, Rumfield, Davis, Reinke, Steck, Madden, Taylor, Rodriquez, Kattner, Huebel, Larson, Merrifield, Roen, Riley, Fuentes, M. Morin, R. Morin, James, Lewellen, Millian, Kinney, Ford, Trevino, Vriseno, Rolston, La Roe, Chaffin, Dawson, Sallee, Boriack, Symank, Winkler, Lee, Chaffin, Bryan, Churchill, Phillips, Taggart, Camp, Craft, Fleming, Turnbo, Richter. l Spanish I: Roberts, Jones, Hoherd, Baird, Michelson, Shine, Birtchet, White, Ray, King, Garland, Mabry, Adams Roberson, Rodriquez, Hibbler, Owens, Jackson. Langenegger, Wilkerson, Rench, Brown, Williams, Forrest, Ham, Boyd Flowers, Jenkins, Spence, Blankenship, Fincher, Burtis, Richesin, Karl, Kegley, Hancock, Gragam, Blair, Law, Mitchell Vargas, Canales, Nieto, White, Fuentes, Cummins, Carter, Bancroft, Strawn, Guzman, Henson, Wheat, Hawk, Brina- ger, Wardlow, Amato, Boyd, Green, Canava, Lucas, Cowan, Whitley, Davis, Cross, Norman, Douglas, Mitchell Hosch, and Britt. 88 ,vanish gfllb ,llcfizfiiicfs Linda Madden- Secretaryg Karen Reinke-Vice- Presidentg Laura Lee-Treasurerg Jo Ann S p e nc e -Parliamentariang Judy Forrest-Reporter 85 H is t o r ia n p Jane Richter-President: Not pictured Walter Huey-Sergeant-at-arms Davis Thigpen is shown describing a poster on which Charles Wilson is sh ow n pointing out a poster are two Spanish folk dancers. describing Mexico. Jerry Wiley - Photographer Judy Fletcher - Picture Editor Walter Burtchell - Photographer Cigar Mrs. McFarland - Sponsor Barbara Steck - Editor Beverly Bolton - Managing Editor Diane Castleberry - Gir1's Sports Editor Susan Richardson - Business Mgr. Janene Larson - News Editor Beverley Thompson - Advertising Mgr. fflff Pat Johnson - Typist Pat Daniels - Typist Carol Wilson - Circulation Mgr. Connie Reed - Assignment Mgr. Marie Culp - Typist Betty Jenkins - Typist SPORTS STAFF James Wardlow Tom Smith Larry Chaney - Editor Byron Mauldin Rodney Winkler FEATURE STAFF Harvey Phillips Joy Riley Don Mills Mrs . Virginia Brookshire Sponsor Joycelyn Parrott Editor fair Kay Bryan Co- editor Bobbee Jean Taylor Organization's Editor Alden Shepard Sport's Editor Charlotte Millian Typist Staff Randall Carroll Administration 85 Faculty That copy has just got to be here somewhere .... I L,rL f.-ffm-L,,, , L, 'int'-4-iw, Sarah Trevino Personalities and Literary Events as ' A p 4 rw Tfi sf R E 5 sw? S, Q X 5 5.2323 if Z M ,aa ark Jimi m y S , ff ,gs ig F Q , , ,... - LJ asf? 2 it - 5 - sqaff sffs, ' .-Iv-f :,:w,u,S 1 2. ,if ffafi s -- .fn 522 f A .st , Q A ' ' s ral' 1-I2 f. 4 fr 1EJ:N 'ikgsfii jf- A 'iggffii '..QQf f - ?1- S a f ef: S f i S S: - ,VQ a ,K ,,,, t wi 'Yi 4525 , i , t sa it 5 - - , is , -, x s Dorothy Kinney Business Manager 93 -T55MQ 5E3?57f??ESEE623461'9.?552??3iW?9553?w5?2?iS?53?-i?L4l2i3:?kZ-?:IiEfRi4355iii?4f5'2Wi??kS'SLE??iieEii4fi SuEs92n1ahS'3s.mwwf:SWlt'ifwiv'Lay-Ysuewffmwlswww wzmfw 'L-:: 1f'-1' --:If-.zfx--fm,f.--www W. ,. , ,. 'W The students who participate in the Interscholastic League literary events are the unsung heroes of Belton High School. These students spend much of their time and effort in preparing for various events. The honors won in each event are evidence of hard work, skill, and application to the task of learning. lfifcnzry 51151415 Contestants participating th is year in number sense are Alden Shepard , James Parker, Wesley Coufal, and Lon Curtis. literary Barbara Steck and Larry Ch a rr ey are th s t u d e n t s representing BHS in journalism Juanita Claburn and Dian Bowman are this years rep re se nt at i v e s in readywriting .Events Harvey Phillips and Ann Inman - representing Belton High School in Prose Reading. Persuasive Speaking contest - Judy Forrester This year's contestants in shorthand and typing - Susan Melvin, Cathy Jones, Jeannine Merrifield, Dorothy Kinney, Joseph Inman, Carolyn Kattner, Susan Richardson, and Phillip Poth. Mike Gibbs, Earl T HIGH , and Phillip Poth compose the Belton High School Debate team, Mary White and Randy Carroll are the Belton representatives for Extemporan eous Speaking. 98 Belton High School rep- resentatives for the One Act Play are Vickie Parker Joseph Inman Harvey Phillips and Dan Kirkley Ronald Roberts is not pictured Walter Burtchell- Belton 's representative in Science. Evon Crowell - Rep- resenting BHS in Poetry Interpretation F I -- . -, -K f, Sportsmanship is experiencing the glory of victory and the shadow of defeat--the glad feeling one has in knowing he has done his best for his team. H These pages are dedicated to the participants of sports. They have worked hard learning the skills and preparing to play sports as representa- tives of Belton High. Sparfs .Queen nf Sprfrfs JUANITA CLABURN Each year the football players elect a Queen of Sports. She is crowned at half-time of the homecoming game. This year's queen, Juanita Claburn, is an active member of both The National Honor Society and The Student Council. Juanita is a cheerleader, class officer, and has attended Girls State in Austin. She was crowned at the game played with University at Tiger Field, Oc- tober 25th. Victor Salazar Gary Hannon Senior Quarterback Senior Fullback A Friday the 13th jinx and a host of Furr Brahmas bring Gary Hannon to a halt after a short gain in the season opener. The Tigers struck fast to take a 13-0 lead at Travis Hitt Larry Baird half time behind the running of Hannon and Hitt and Sophomore Halfback Junior Halfback the passing of Salazar. Second half jitters humbled Big Red as Furr went on to register a 14-13 victory. David Owens left and Travis Hitt right slash the Killeen line for big gains in contest won by the Kangaroos. It was just one of those nights as the ball always bounced the wrong way. A rugged Tiger defensive line con- fined the flashy Killeen backs most of the game but the Kangaroos cashed in on several breaks to take a 24-0 victory. Doug Reed moves in to cut down a Lee back in battle won by Lee 30-7. Big Red, playing heads-up football, grabbed a quick 7-O lead on a pass interception by Bobby Taylor, after Joe York had batted the pass down. Lee came from behind to overtake the Tigers and to post a victory. Larry Stewart Mike Ragsdale Junior End junior End Tom Smith closes the gap on a Brady back, after a short gain in contest won by the Tigers. The Tigers crushing ground game led by Gary Hannon with 102 yards proved to be too much for the Bulldogs as they fell to a fired-up Tiger squad. The Tigers closed out their non-district schedule with an impressive 18-14 victory over their arch rivals, the Brady Bulldogs. Doug Reed Junior Quarterback Bobby Taylor and Mike Ragsdale prepare to halt a Lee back after a pass interception. Walter Huey Senior End Tom Smith Senior Guard Joe York Junior Center Travis Hitt storms the Gatesville line for short yardage, as Gary Han- non looks on. The Tigers chalked up their first district victory of the season 28-6, as their mighty ground game rolled up 284 yards, and the defense held the Hornets in check throughout the game, with the exception of a 95 yard kick-off return. Everett ZOOR Bobby Taylor Junior Tackle Junior Guard Coach Bettis talks things over with Walter Huey i681 and Bobby Taylor Q6l7, as they look on from the sidelines during the University game. The Univer- sity Trojans jolted the Tigers 34-6 before a large homecoming crowd. The fired-up Trojans, led by powerful Joe Ward, just proved to be too much for the Tigers, as they dominated play. Johnny McDonald picks off a Hornet aerial and re- turns it 53 yards for a Tiger touchdown. Tiger Meat, a Johnston back is brought to a hasty halt by Mike Ragsdale 1855, as James Wardlow Kenny Law f5OJ, Doug Reed Gly, Walter Huey f86j, Larry Stewart f8y, and Tom Smith Senior Guard Q64j, close in for the kill. The Tigers dominated most of the game, but the flashy Rams used the speed of their brokenfield runners to defeat the Tigers, 20-6. James Ross Troy Hood Senior Guard Senior Tackle 106 Coach Bettis exchanges a few pleasantries with the referees. Larry Baird is stopped shy of the goal as the Lanier Vikings starved off a last ditch drive by the Tigers to preserve a 12-8 victory. The Tigers suffered a heartbreaking defeat after leading the Vikings 8-6 for three quarters. Johnny McDonald Sophomore Halfback Tigo leads the Tigers onto the field before the La Vega game. The Tigers crushed the Pirates 21-16 by combining a good ground game with a good passing OHS. The Lampasas Badgers proved to be too much for the Tigers in the season final as they de- feated Big Red 38-6. The powerful Badgers scored early, late, and in between to route the 'aa y, ,srl Xxx r 1 it at ' Y' M Q, -El x V ' W,- ,M 'A - 'd xf ' sp ,,- : i ff iffrzzik' E ?5l51i1is1zg' 7 cv ' i ' Q. I ms-fist-,,. kZJE.i1,l:vf KSHHY Law Rodney Winkler Sophomore Center Senior Guard Tigers, d e s pit e the Tiger's never-say-die spirit. Travls Hitt is nailed by' a Furr Brahma, after picking up a first snarling, Tom Smith sets his Sights on a Robert down, as Troy Hood arrives too late. Larry Stewart and Larry E Lee back Baird carry out blocking assignments. ' ' Killeen back picks off a pass intended for David Owens during the tilt won by the Killeen Kang- aroos. The erratic passing game of the Tigers failed and the Kangaroos prevailed! Doug Reed is m auled by onrushing Lanier Vikings after his pass protection failed . Travis Hitt also feels the Viking onslaught as he bites the dust! 108 T iiil, ,,L,,, ,,,hsZi,i,sr,i,. T R obert Hicks David Owens Junior Fullback Junior Halfback Mike Ragsdale pulls down a pass during the action of the Furr The play covered 45 yards and resulted in a Tiger touchdown! Shelby Rumfield Bobby Gilliam Junior Fullback Sophomore End Kaftan '76' Umm ack Row: Albright, Madison, Adams, Britt, Hallbauer, King, Hancock, Hamm, Rennels, Allamon, Thigpen, D. Baggerly inkler, Rodriquez. Front Row: Pecha1fMgr.J, R. Baggerly, Mazza, Davis, Brown, Douglas, Strackbein, Crow, Hood Hitt Mgr. 9. f5Z,7iI:f!E,LlfLilf9f Elf 3- ' .I K - , .. V K -- 4 U I, ,wsiiiif .:Z 'Y ,jp - :'L,'i :' X if ' g lw f . ,, T., 6 555, .F . 'Qr'r L in q?5?5E3S,,Q?SiT?i:?l3 L ' 311 5 'V EF? , Qf' I . 'f .gsz-s.:a,22fg1'z 4, ls' - ' ' . Johnny Pechal Manager Gary Busby Bill Jennings Head-Manager Manager These boys stay after school and on week-ends to assist the play- ers and coaches. A few of their duties include: bandaging wounds, washing uniforms, and cleaning up the field house. Their diligent work is rewarded by a jacket at the end of the season, meals, and trips to all games. This reward is well- deserved. Tivis Hitt Manager l5'ig ICM Kagers Bob Sewell, Lowell Murrah, Larry Stewart , Iames Parker, Gary Hannon, Larry Chaney, Kelly Britt, Walter Huey Doug Reed, Shelby Rumfield, Mike Ragsdale, Glenn Herring, Victor Salazar, Coach Worthington, Coach Newman James Parker meshes two points as the Tigers fall to Gatesville 52-48. The loss was an 110 example of most of the narrow defeats suffered by the Tigers during the season. Larry Stew art Junior Hannon drives in for a lay-up against Gatesville Hornets, who went on to post 2-48 victory. Walter Huey Larry Chaney Senior Senior Larry Chaney 's jump shot racks up two points for Tigers during clash with Lampasas Badgers. The Badge rs won 64-49. fY5 Z'r34Q ??1kif53?5W?37?' '75 Q ., .Wwe , , is ' 1 L . rg W , . .rw-fr:-Q: , :fa ,say -wi--f., - my I f st -' ,V -ssfssqgaj. sta-ffr ,gf -Q -r ,H - -if-is M .. .,,,, ,A sew f,,m..., -.L -V ,ei -'-- f Y' 4 f ' 6 i wma- w i' -f:w..i,:q. -t- A L, V .. k,,,.i.F,.5, 3:-4g41.,gg, A, , , T , ,, ,W ,B ff ' ' x Q-ef , A , is W ' , ' , , -- if -, Victor Salzar Senior Senior Gary Hannon Larry Stewart gets off a shot during action of Lanier game. The Vikings defeated Big Red, 68-66. W James Parker Larry Stewart hits from twenty-five feet out as the Tigers battle the Lanier Vikings on our home court. Vic Salazar meshes two points for Big Red against a fired up crew ofGatesvi11e Hornets. 112 nn Y Kelly Britt Glenn Herring Bob Sewe11's set shot registers two points fo the Tigers in Gatesville c ontest , Th Tigers fell d e s p i t e a great t e a rn effort alter Huey fires a set shot during the clash with South Houston. The igers posted a 61-49 victory over the South Texas team and took third lace in the Belton Tournament. Low ell Murrah Doug Reed Vic Salazar drives against South Houston. during action of the battle for third place in tourney . Bob Sewell Larry Stewart's jump shot racks up two more for the Red men as they fall to Lampasas. Helton '76' Umm Hagers Bob Sewell, Donnie Baggerly, Gary Douglas, Jerry Wiley, Kelly Britt, Terry Hood, Gary Hancock, Ronnie Baggerly Coach Neuman. Bill Jennings Manager Don Montgomery 114 Manager Craig Beauchamp Manager Mike Ragsdale sinks two as the Tiger B team rolls past the Lanier B team in action at the Tiger Gym. Crack Back Row-: David Owens, Larry Baird, Miles King, Gary Hannon. Second Row: Earl Kiblinger, Travis Hitt, Johnny Frazer, David Stuart. Third Row: Bobby Gilliam, Kenny Law, Bob Hicks, Don Montgomery-Manager. Front Row: Johnny McDonald, Tivis Hitt, James Cross, Philip Poth. . - . I 1 if , ,Mia .. , V. ,,,A.,,:.v, r. , :an -X z ff--K .1-Q: : ,:fjf,i, . ,N H s ,. ,. . - - , 5, . 5 55, grit . . . . . ,,,,,,,.- A-Ji., ,f5?L :1 g,-F5a,,f- '-,I :ggi -H:-55:5-' 55. . gk f v.Ef.c.:'I ' :if ff K, , fn, K , fr:zz14235315.12'iggg,,f555k??,r?fa'59i55'rar , 5 ' ' wi' ff g f - . , awszss :H-1 A . ' 1 - - 'B . J Ka' ' M J' wi A f f P , s:f.,ris55l ,r:'L5 ,,., , , , , . are --if 13' - , J , , , - nw:- ' -- iii? 1713515531 i :rE1i X ETC?WTS'-u57'15sfffw1. 5Z-5'f1liEri5?f1Hf:'V G .LE 51? f- I' M.-Y.'1'1 :!i2155'fS:?i5,5::: f. , I .J V . I-551, , q 5, fy .5 It jj 5,f5sr,,,,:,,5-gig lfgairiqsgl -if gaqgrn ,gf 1,-Q1 5.1:-Q, , fair-1:---B'-rfgza,asf' rf r ' ' 'i 'B .,-it-,fQw1'f2'.fv 7 fr:-Mfr '- I 'rare-J - K - v xr' arf 'iff ' , Biw rf k .E..,,.:, ' ' J ,ji V. 'X 5 an S, W Gary Hannon, Larry Baird, and David Owens David Owens passes the b at on to Gary Hannon as the relay loosen up before b eginning daily exercises, team perfects its timing. 115 Kasebnll Back Row: Royal Dunlap, Walter Huey, Everett Zook, Bobby Taylor, Larry Stewart, Bill Long. Second Row: Coach McFarland, Wayne Ward, Jack Edenburn, Earl Tuten, Gary Douglas, Douglas Reed, Rusty George, Mike Ragsdale, Shelby Rumfield, Gary Hancock. Front Row: Gary Hannon, Rodney Winkler, Bob Sewell, Jack Davis, Johnny Pechal, Mike Mullins, Eddie Wilson. Not pictured: Tim Brown and Lon Curtis. Jack Edenburn fires a fast ball toward the plate as Everett Zook watches for flaws in his form, Jack Davis receives a few tips on pitching from a few help- ful assistants ??'??? lfrfyis' Gay Dan Kirkley, Bob Sewell, Gary Douglas, Lon Curtis, Tim Jones, Tommy Lanham, Not pictured: Jerry Heartfield, Wiley Horton. Gaiden 5101155 Thomas Rennels-middleweightp Donny Love-bantamweightp Phillip Morisset-featherweight, holds Regional titleg and Calvin Rennels- welterweight, holds Regional title. 117 Hoy Lv Zfelmis Standing: Bill Adams, Wesley Coufal, Rick Moore, Bill Ham, Alan Hallbauer. Kneeling: Johnny Pechal, Weldon Strawn, Randy Shaw, Tommy Lanham-Captain, Johnny Copeland, Girl is' Tennis Kay Bryan, Marty Lipscomb, Rusty Russell, Jeanette Lipscomb-Captain, and Dorothy Kinney. Girl is' Vrflleyball Back Row: Mary Winkler, Patricia Richesin, Nita Hendricks, Frances Fleming, Mrs. Thompson-Sponsorg Brenda Ervin Joycelyn Parrott-Co-Captains, Christine Whiris, Kay Rumfield, Mazella Shed. Second Row: Katie Birtchet, Mar- ghuerite Garner, Susan Safley, Kay Bryan, Janice Symank, Bonnie Altum. Front Row: Suzanne Law, Mary Carpenter Gail Wiley, Virginia Flowers, Tinker Roberts, Doris Mitchell. The volleyball girls work during the noon hour to perfect their skills and develop better teamwork. - W'-5E..'i iffvfiliivigisi fflii?':F1lfflfifidi ri l'ET5uiYff'f f3573Tf3:YFfziwwf, fx'Yf7.fifC?fQiE W?-l'?JfY'.'3,5 Lvifw :2 :xi'f,' 'I 'fi ' '- X1-ff,,-z,.f::nw:fSHfi vz ww fr by wwf- ' - ---wd-N ' -' 'QW-'f ' - f ' - H - - '- ' ff I 'iff fff! if 'La ffflytt i ,AUM gy V , W lsye y The personalities of Belton High represent the finer qualities pos- sessed by all the students of our school. All of these students have traits to be admired: scholarship, citizenship, friendliness, leader- ship, or sportsmanship. Although many students possess these traits, these personalities were chosen by the student body and faculty to represent Belton High School. lkrsaualities Miss l6'.fl.S. In November of 1963 Anne Sewell, March- ing Hundred majorette, was paid the highest tribute by her classmates and friends of Belton High by being elected Miss B. H.S. for the school year of 1963-1964. Anne has received many other honors her senior year. They in- clude: class favorite, class secretary, and Stu- dent Council secretary. Anne's outside activi- ties have not marred her scholastic record, as she has been a member of the National Honor Society for three years. Anne's vivacious per- sonality adds to her numerous other assets. Mr. l5'.J-l. . After nominations and run-offs in November of 1963 Gary Hannon was elected Mr. B. H. S. for 1963-64. Gary has been class favorite for three years, a Student Council officer, Senior Class President, a football, basketball, and a baseball Star for three years. A friendly smile and a fascinating charm make Gary a person to be admired by all. Mr. A ,Miss Pcrsanalify T y h Brenda Thompson l l5'csf ,411-Around Shelby Rumfield I C1 b 125 Most Outstanding fudcuf Joseph Inman Joseph Inman, graduating senior, is the outstanding st ud e nt of Belton High School, on the basis of scholarship, character, participation in school activities, and versatility of talents. The highlights of ,Toseph's activities are: Best Supporting Actor in One-Act Play regional contest in 1962, finalist in Prose Reading regional contest in 1963: first chair timpani, regional band, five yearsg first chair timpani, all-state band, two yearsg scholarship winner, two years, and outstanding percussionist, one year, at the National Music Camp at Interlochen, Michigan, Joseph also holds fourteen first division medals in regional band and choir contests. ln 1963, Joseph performed with the National Music Camp Orchestra at the White House for the late President and Mrs. John F, Kennedy before a nation-wide television audience. Belton High School is proud of Joseph for his prese nt achievements and the future fame that he will bring to Belton and Belton High School. fiQf:s2?ffj' - - - A Q M, ,w:5 ,M.f4zr ?gf fl 5:5 NFA fikwkl -1325355511 0 .,,A Nmflf gj5Q5sflzf'gif' su. --,yu mm-Agrwgl-f'5YWfA f ' isivwzgsfw 55532 52535 wzegiffiiifiif 5, . :Rf :keg A 5 gf'f A- W2 gggggf V f -' ?k2MK2i5ie?3f?f.43? N g 7 1 nf . , e, f fn. f u -Jw --fy a?m.f..:f ,L -44? ,K .:, - 'il Y 2 Q' W M 55 fi 3 ar X KH M 7 Y J! u S? EK X an is 3 f gg 3 S 5 :Mi in Q Q A Qd fqgisgf 5 f ff? 3 EV 4 WWQQ fyqxxw EW Q w igg f5w,,, ,. if. fa-Qing' f.-gk, I f ff' RH Q ggggw H Ex 5 4 yi? rm' F ffk E ? Q 1 dv Y f4iiQif? QQQQEQ? , ,iw 3. if 5 f sf S E n K Q 2 2 aigfigeai .fa .w .-a4Wi5?x: ,,,1,W,,.5 3?QQ?f5f?? A 1 A ful - V , ':5QiL hvhgk 3tg L 6335? Q -1. E .., 1 fn- --1. Q-Q.. fig? f 5 , s i Le 3 E M. 4 ,L 1 , Vx' . 5 Q . 'y M mf is i ? I i ' f A X W L? QS sa? ir . M , , .. i , , . M1-ire-5, ,..nw. . ffi n..,-.Wd?,M. , A., L X, , X ,M Sgilvfig .'f??i . 5-5,422 . 7, 'EKU k Fwy? . li! F N fda . . N 5 ' 5 fi Q iii' , f fy!! L K 'QM' 2. A f2z,12,f-- f, 35 W, . ' i 1 ? 51 ,sf E ii 1513- .Y ' F , 4 .nf ij 3. iii,-' 1 . i , M -M1-,,,.f' i 3 .4 .1-wa 3 f Q J 0 Wim s Whv llfl ln activity we must find our jo as ,Activities Y well as gloryg and labor, like everything else that is good, is its own reward , Judy Forrester Senior 5 e 3 Ann lnman Junior Wim if Wim in Hifizmship We should not be taken up in the search for truth, as to neglect the needful duties of active life: for it is only action that gives a true value and Commendation to virtue, --Cicero Jamie Chaffin Junior Jane Richter Senior Who 's Wim in Svhvlarship Real knowledge, like everything else of value, is not to be obtained easily, It must be worked for, studied for, thought for, and, more than all, must be prayed for. --T. Arnold Carolyn Kattner Junior Anthony Coppin Senior Wim is Wim in Athletics Athletics d e rn a n d a combination of physical skill and strength, an alert mind, enthusiasm, purpose, and usually teamwork. Kay Rumfield - Larry Stewart Juniors Jeanette Lipscomb - Gary Hannon Seniors 1, , 'HH'.m,,wwM'M ' ww w' -., ....,,,,..,g',M,...,Q,, 4. . f. .,,,.. ., . 14.31,-,,,M. 1,.. .. ,mam W mmm 1 ww 1. - . --W. WM... jww 'K'-f-Mmgg, 1 tg -- j , .WU , .1 W 'A 1 - - - QW -- xi my . ,M . 'W 1 1, , .. - y 1 - ,, , - SE . .,, . H--Q5 1 5 - . ,,,f :V 5 Ez .: 1 . . ,ggaygw 11g2gq,,,z,r1g4g-11...5gg.1g!1gQ1,Qg11g-.'Qr1QP3re+g -1-:m..,.:, -.wQ.Qf,Q .,. wvfgf-gy .,. . 1s . . 5 my , GT'-11.21912-ffl-aff-- -.. K, . , :K .ss m u? v. 1 ,Ex . . 1 ,K K. ,E .. 1 2 M.. , . , mg 11, 11 2g1,s1.1,,ma, .J,,.,.fz,.1,,1e1,1Mm,,.,1-m,11g.m5,. ,. 11s,.L,,,,,g,5 1-wg wg.z,,.,u,,m.fm1,.Q..,,.,Q911116,'mf2fAs21,-ag.,..x,-Kf1,.1l..,,,f'wF-.M',,,.,.w4.,.5ef.Q 1..s, dm, w,1j-5,fq,m,,,f:-'-w.1g2:.,,1,,,, . .- . MKG- gi . . .. 1. Q., ..1,.q. q,f. .. . .113 1 f.e,11,qfG?e,,K'.,mE1e'14s.1,.1'.s,,1,,w,-ww,-,,1,-,.. -we.,-. .,, ,.1wQ,,,..u.U,3f3w1f f?,,f..-,,,1, -M115fsa.,-e,.,11Hf1,1..1,- wa,1.ge..,5..-v.w.1.,,f.f,f,.w.,,f. .. WK ,.K ,g 3 9, 5.5.9 1. K, 9- 1 e1 . wF-a . '- .gsymigm'Q11s5?1,eM?1gg1.fQ:i2.1,f1.,,..,,ba112:ig-.L-gf'2:w:Q,,gm,-12.1m,si'5wv5Q-ffifc,f?xes511QSi1,:fgfaz1sS1ffm,f,.152-1.i4ff339' . , ,1,,. W 1. .,. . - - - , . . E ,- 1 . -sf..11.-,35..wg,-2,,.,f,,1g,.,,-3,131,W.,,m.1,',,.12,s,5215,,1131,f,,',,,f+1-.gm-,1,-,,.,vg,1g1,e11,,,,,,f,,,.,.,,,,m..g..,1,1,-1f,.'1,,g,1,:-m,gm',,,.1,-5,1-Q,,..,,g,,.,:,,,.f,-M..-,..,,,1,,,,1.v-w.1,,-,mfs . -159' 'gfiwi-A , .1,, -vm. K-M1, .1,,'.N,,5 .WK,E,,KK, Sm.-.K,.,,,,,, 52, ,N K-,,,M,.,,K,,,,,K-15.11.35-f. .51Kb4,K1,,,,d.,,y,,,1,.,,,1,.,,41,,-.1,,,.,,g1Q,,,,,Nag.,M,,:1..--.,,Wy,-Q'-'.fWv..-,L-.51,,ww. ,,w.'gf,,',m:1Q-,f.f,1..,.mfs..-1,...Q--fn--.-,G',f,,w,H 6 .59. -. --..G-gif. -1. ,ww 1, 11 3 -egg W,-x..,,,g2,1W.1,,.fii.1fMv- ,..5,S1T5ag,:..1g.1f5 .g..f.,..mg1. ,,g,,,5K1,e1,e ,,,,,,,,.,1,.,,,,f,,g,,f,3f,,.,,i1,s,.,.,0..., 11.,.,,,.11.1,es111,.,,.L1,.3,-,,.2-.,,.,,..,,.-,,.1,,1,w-.g1,.,.,.-f,,,,,,,,11,.. ,. ,,..,,,..,....,Q.,,.f...,..1.,,w-.f,.,,f.w,y1,,,1,.,,,,.,..,,..,,1 .,..1,w.,..,.., WE' 5525515 iw 'ffl-3552? 'Arg'1Q11Si.1i?+Qf,A2,H21fs3i51Q-M-QSQPQ'-Q-13535355.52 -SE? . -1 - Emi al,g15.'Q?,,,K,19r51grg,53.,5Q55ig1,k'13,-gig,s5.gS,,53,35Lmxm,g5g,g11',.,y,,2K,,,,5L1,Qwgyg2,,fng,f.fgv2y1.1.1.,21w3-1,1x,3-nm'-.,,,,g,-Y,11,f,is.5w,n.,gmn,.,w,,f'1..,-1.1,N11S,y,-3,3-,',f,1,v-Maisy,-. H.'.vi5y,41.2N,-',,fW,'.'G 2-AH .W Pi 5 Kg. , K1 5-s.21,31?i,,:-.Qs .K,,MW,,W,.K55K,.,,1 ,1,,..35,mm,m,,1,3,g,Q.,W,5,,,,g5,,.,,,w,K,.,1K,6,,,K.,.,1K,,,M1.,,,..,,..,,1....,,,.,,.1,,S..Qs,..,,1.,,,1,,1,n,.,1f-1.3,,..-,.,,,1,-,rw-.,,,a.,w,Q.-,,1.1,,',..,,.,m,1.-1-13,',Q.p--,.1,w,.Qf11.v.f'-w ,..1y,.,,,a,,:.,ff ,ww-w,- ,f1z,f'.2eaw. . ,K . , K, .K . ,.,,,3,g,,.m,,,,151,,.5,1...,,,s,,1,Wg..., ,gmgwg ,Q K 43. . .1,,KK,5.,1,Qn ,.,..g,.g1K,,,,.,.5,g,1,,.,,W1,. ,.1m,,, m,,,,1,,,,..,,1.1,,,,g,1,1,,. ,,..,.,,,,..,,.,,...,,.,.,1.,,,,.,.-M,,,,,,.,,1,., , s,......,.,,1..,...,,,..m,w ,,,1..,.'-..,w,..e. 'vb-f-:,.,-2,..e-'feK..,9!'., 5 R 1 gf,M5gfW251s,.,ggi..f ,,,.1,,S,Kgz.Qy.g1 .mg ,K 1,3!55,A,.51..9ss,.g,Qw.1.,,,s.5,,,,,.,y,,.Q,,,,.,, gm, 1,w ,WK,115f.,Sw1,,,..,1,,,,,1,s,1..U, 11, ,..,-1,.,..,,.,..,,,,.q.,,m,1111.f,--11.54 11-ia.,-,sw ..fef.1,1a..1,-.,.,.Yf91?5f'1fWwf',-fgsff.Lf',,::+11w'-1S'.w-ff mx ,S ' ,1fg,'g,25,Q6 2-,?1,5.gfWf' ,551 '21s1,,,,.4,,Lg1gL,QQQSQQEQQM523?gwu52.fsvf,,Qg1,aEg,Qf5.,.51,...,,.5sff,,,s1.,,.f1,. f,.m,i..,,'1'.,,'1,.,1f1w1,f-',1ssw1..1ti,.f,:-1 22.25,i1,,ss-w1:s,-if--,.sw-5,411,152sf-11--lizfu.-if-Js,fgQS9E1,ff.f1sS'-W 1,21 . .,,K. ,K M., ,K .. NK . KKf4,,,,,,,q., .5,K,.,.1.5,,15,,,1,,.w,,.fg, K,K,,.,K,,,,K,,m,.m?..,g,K3MMK,.,g,,,S,,,,Kg,KK,,,Kgmm,K,,.,,,,,'-,..,,y.,,,.5,ss,1,.,.,M,:,.,z,5.,.,,f,1.,,.g5.g,,.,.,,1..,,-11.:,.1,, fm,,Q..1,'1.,,.f.,,,.g,,,,,,1..,,-.,,x,.,y'1,. 1'.H,-1--11.1,-..,1,.A-,f,,1,.if-,w.,f,.f,-',A-1,..,,f w,...wm,2..--rv1,,zfw:',Q-1w..1,+.fer5,114-511. ii?'wfi'x,Lea5. 1,1 1-'WYQWS .W 5159?-L,,f?,fQ.,,wi553,1ss5gsew'1?X3E2s,.1,,,,rmei5,,?2..,pmw..vw1mQ,- A,-.1,f3:.,.,. of-.Q-f.,,,,,z.s.1,,, ,-.,,1,,:,11,w,-,..s.11Mf2.. uw., 1.,...,.f,.1,,fa..-w.,,f,,.,,'..,,..,f....1-11,111.3-.,..: .2-+1.w,f?,,,.,,f.,.,,1,,,,.,.'1g,,M111s,2.1,,4,1..1..,-21..,,f1,,,.,,,..,w,,.,..,.2,.,,.,.e-.,,Q,1,.,,1. 1, ff, .,,-.,,,,'1,,, QgQ,,,,,,, 5,531 QQSYKSESQ, f?5G?3g,5K6n15Qz?22Q21.K 1731311 1,QZ,...m.g,,,1gvg,.,?u,,ggrw .S:5fg,,Wf1.,Q1iqgg.,3M,,, ,2.1,f1,17.g,gf15!21,9,g,,2EQ5i,a?2,sQ51,131,..,g11..',gg,K1:.1,u1,:112-z'1gfw:'f,f117f1,1 ..1,a,w':,,szf,s:,e1152, ssgg fagf-nwgiwi:'51is,1'i..,,2zee.g14fixszgsmwgs,Q1s921Qwfg1zg.,s22E,a'n2,tswf31,f1211,-3.112111 .',-iw' w,K?Qg,5mgQg ,gm Wm ww mk5gms6wK5gG,,Egw.,5gKK g,gKK,KQ1giQEM,15,KgmSK WKKWWN MKKK35,K?Qi5,,1bi,,,M,MK,,Ky.,KQ3.?QKm,,w1.,3g,WKmK,,,,mK,,KKQ,,KK2,K,K KM Hwy, KW 5K,,K,..Ak,?, ,K15,KQ,, 1,5 ...Z iw,13,.,,,w,:g.,L5.p,1g,,K1,.f,,.,K,1Qf.1,.mK1,,f1,:1,,..,.L,.,,.,,s,,w11..,K11f2f.1,,..m1.f.W 11,5 ,1..1,f5,, Wm -Q,,gg,,f,..,.,.y,f,.15.-,,.1 - ' Qfgssvsg ws,-w11??iuHsg.gmm12,.. .-smfifa:,5.SM51?'-fvgQ5'151f5vfSifgw,622 .Q-Q'f1e,19S2,11,rzzgiS-1-Ligffri 'sfwfeyywgai' m51i,s1,11,-2 if 1-.Sw'1-f2i1:t?22f1,-511.52-efiggi1,,f2,fe--zm11:2f-es?1651-1,1'2,f,:?1,Lf.'sgz' 1,Q-11,-fi:1i92'f1.wiz,sQ::ffii.,,ig,,,'4,se,fi?1QtS11,g-...sais-.gflgrp1-32, '.,Z:.g.ffz 1616535 fg1,1w11.w,1,,,Qm,11p,Q-515,.gg--m42Jfe4.1,1x,1,,,92,p1,,5g 1.Qe1,g,,,g1'..Q,,1,M.qua1.,,s,1,gK?.. 4g:y.,.Qf..y,115,,QGeg1,.: ,gs.g..q1s.K,,,:,.1,,f,g,.i,5,,i,,s,,.9-11..,,g,,,,1.,,,',.11, 11s,,m,,g ,525-5.1, 1--me-1,151-,,,fw.., '1:,.,,-,...1.ff..,t1':.a-.Jw f,-2'-J,,Qa,f2i.-W m1v..m 'A--2,,,,fLm-:zp1,,.,fw',1fs-m. w.,,2'm v, ,s,,i.iQr'1fw1,.w1w ,ff-W11-55,9191 .Qfi.f,-rw'X1--iv.-2.2-Vw11,92 .5.,..1,, 6.51, ,.wQi11Q,,15f,f-S35 11,,gsgLS5,,5i. ,.,,,.S2.,,,,1 mym,1.,5,1,,,11f,gqgx,,,f-,,,',11..-Q-9g..mvs5g151,1fQ.1q ,f2ag4EX-E9 sQ?,5Sg, Ms 5592.3 15-.f.me5:'1,-21.11,-,..,,..ee: 1.22 1,--'.,,.i11..:,,, .511 ,..,,,',s, .g-,fa -ws .g.,-1em,.1,-,QQ-254 5,1 S,,i1,,,f14w1,fw.1gMG'uf,--..w1fw-1,,e.1.w..g,f,,z,.w, W-iw'--21 -5' f2L'1lfwvT-Wm-Q.i21J--'v'i'1 ' 2 wa-'S-.,-1,.1e,f-21,.,d1,fS1 -5. -rsi.1g5'1s,1QxL'115mf.M1w,a 1.1-S',..Q.,f.--.-fa1.s,:,.,.a,..,-.,,.,.,..:ew ,1,,S1,f,1-ww' 11-.,.,.1.sL11.u,,,,1.,1,,',.e..w,11,f- mg, sw. -,,f1...1,,,w..f-2, .,,-1,21'1..,gs,,'..z.,4,,-.--1.1, 1.-f Q. 1,3..,,,.1,,.,..,f,,-1.,,.ff1s,,f.,, mf., KE, .,,,,,1 ., UK, 15 ,, ,,W,g,,,K.Q,1 , M ,T ,115 ,,1.,5.,,n93, K,,,,K.K,1 gg, ,M 5, M,KKM,K,,,,,,w.,1 .M , 4,1 ,.,.1w111qK , 1,,,,.,,,..1K,.,,.,1 ..,, 1 .,..,, 11.2,.1.,1,.., , ,..,,1,.. ,.s,,.1., .s,,....f.w .m.'..,,.2-,..,w ,ww www..-'1.,. 11, -W ..v1f.w...,..,6-, saw, fzngv 1, . , 2, .. , A 1,,,m.X ,,,,,:5K.,m,,,, wg 1,1,,.,1,,.,w,,,g,f,f.,,,. Q E, .K .5,g,,,,g 1,,.K1,,,.,,,15.,..,,1 fQ,,.,,ss.M,5,,,,2,.,5, 395, . MS, ,g.n,,,,,..,g2,1,.i.,Q, 1,11,.g., .3..,.,s,,.., .,,... X1 f . .fm .,,,.,-. ,gs ,.U,.11-,,,,,'1,-.1....,.f, ...,..,-1.- ,.1,. .L .'-...,.1,,.-.,, f 1.-...., .,,f, .,.,',.1- .., .1,f,'.1.,J..4x Q, . 1,.f,..,,1.,,m S., fem. ,s2..,..,..--N.. .. .gm W 1. .,. 1 fs. W2-1-.,.2'ke,,W w 1w'v'QwS'b,f1,s: www? 5-mifia, 319,-1,1-5'':uw,,w.w1!?2,ww,1gf' 15,,11,w,'mf.,a' :i,.,fq,.S ..f1f.,2p-,1ec.,,f-,.s2: 5315-' .,,e,i1.1,-wx,',..,g.1.f1..,,-1.fw-1,-mm.22'1, ,,., ..w,,,f..1,-,...1: -.:,,,1..::.m-1e,..w,,,,,11,-1,.+..1,-.W:m--.,,,,.s,-1,-fs 2,11--,.f..a'.1.fw-,af, 1,-1.1, 1,22 1,--..,,,,,+,f.,,.,2,, W.,-5,w,,,,.1,g11,ezg-f4f:,s,, 1,1.v.21w1:.1g,,.4,1a4,1.-Q ,,w5,w.Q f151121,g,w,11,aies5.q.i!gSaifi,,s,,1gg-.g5sg,1m,f3wjg1i,,.s,Ygs.524yi.''.mg95:.g?1,w,1ggQ,g.1-51,1,1w.5Q1,1i,-,.1,fge215195wzw1s, ,sf?ym.1v's1-f,,1a..g1z.:s1,,,,v5..,,5 QQ,1,-21,,4,f,.g,.11-451, fy, 1.f,v3.,e,gg,,,,:,,-,,s,,115,gf1,f, ,,,,.:1gK1,3 ,gg,,1,,,,,-fpg,.s,w1,,,,1.Q,.,3.,..',,:1,11gsz.:,g,,.g,,g.1,f1.ag1,,- 1,311,119 f,QH1S45g11.Q,2fg,M1,s1zf,vg?11,C5,,Q1,- ',1sW,, My .,1w,1,1,,5,,g31g,9,Q,. K1,s,,m,g,gY.,,K,1,,g,-,,5,mK,K,,, 1.5,-11, 15 111. J, ,,,,g3,.g,,,gs,,,.,., .151 Wi.,-K,...g,,.,,,..,,..,11,,,g- ',f,5..,--,.1,y1...g,f,f, .:,,,12,.1,w-.1,-1,,,:1'-1151,,1f,m,9y1f1sg1s.,112,11--Sas-5.1,-Q1.2,-i1,f'wx,-z, 55.213, .,,fp1.f.ff12avgmii,-7.13-iwwzief-A11-551211-12,11-Q, .ev . iam ,.3,K2.KKg,5',46Q,,Q,K,gwi1E3 ,gmK41sgS.51S..1,f3.,,.K91Egp1g,I,,gggggxgq,-K.1,w,,.gg, g,5L,g1Q,13pi1,,,,615-,,5gyxggh.1,,,,,..q,5,3xegg-G,,gK,gg5ffg5,g1.fx1 15 ,m1g:.i5i+5Q.QiY1.v,i?,5Qx Qs-2551vK,3L1,.1,jgg,gy,f,55:5,v5,fSg1g:2.-155 Kgffiigga-i.,fijiw1-IAQAQQQTQQS-if, 1,:9z5g11f.1 l:,'1,'T'g1--.uk'Qiiilwfgfix ig3d.wS,51s,?1.k- 1-S3,,i,j1iZfYE5g-Iwi' MLW f:Ts1.635,gTi5,i7 rxfzg-92552 553.52-iWm?3z?Q,15mw:.5Y1.1,2SYivf.i1?fQ'+'fQx5P'f ,M,5ggiy3..,3WL,K1,K31?Qg,w,-.,?,,S,KWqW1,5,,3,.1,,11,3s5,me, 12,K,315a,,.1,w,,,3i Egig,,11,.s.1g A,1,,1M1,K H.,,Km.1,m.,iK,,,.KWV,, ,,.K. .,g,..,..,,K,,11,, M., ,Kay ,W ,K 1,,,..,,K...y,..,,:1,.5,, gg.-,Mft '.f1,1',-H :v2,.',w- .:, 1,41 1' 2-1.1, ,fa .mam s,f1 1,f2..5:-1.,x,-.1551 Q2- 15-,f..s, ,gg3:-.1.1,,wf,fS 11-41sfS,.a-f11fv.:v,.,1f,,,v ww1',1wxfvi-e'3'.f1i nf- ,'f:?4wLf1?' -M- 1 '.' J ,1 'ww zwkig, ,11- 1 1,71 fm, 192 1- '.'.p'i'-- ' f11,:..,f 3.- -. 1 15,3 'IGHW-154 gi-X',vi5'-i2':H'ilf3:f..v1-.:L,+,.:15v'm1'.f-.1.1151azsfi'--M'f:m.,z.,Q-K,..4 13-7144-3,.w 11.-2' 51-Y ..6i.,2Gg-:2i.ff--fw 1-50-'::,,,.5-f..w 1-ff.f1,fsif.fU. 5'f31:z3,--, ,HlK:s,a ,,.1 N'-S1:-vV.1::L'1? s--'.5S-'v.m,fgg-:,.gzQ 1111...,K:,-,,.KK5,1,,5,.1421,,,1q,15:,Kg,:-f11.K:g5,,.5,.,a.5,L,,A1.. 1 ,vf,.w,.11,,. ,J '.51,K,g7q g5,L,.K .,gea2fsv'2,,1.,2-3,'S3151gg,:2,e,,SQ,f,,,s??.,,f13'?1..,1,-2-15,-va,,-isN2..s:H.f1.Qe11zg,91.1-,-,tim -swing'-:z5,2s.,,Sf,g5?,fi,aQ ,Qqga,?1,2,fsf,:,w1-f,,.,.wa11,+-1,,,f:a1..,-may,.1,-Y., 1,121 ,, :.,'1.f,,L.1,,,. 1.-,,z1.- fs, 1.-,:: ,...::- .1-f2,..e.,.1. 1g--:f--1.2- iw-'-S-1-fi-ef--.fiS'3,21'12-ff -1wi -,mf-'1111-1-MSW-Q11,f1f-sf,-Kiwvf--'Zif-ffiiffw 5- if.-LiHQf21w1feF2.Q-i,.4ws-'+ 11.1-i,ff,w21sQL'fa921,f211f1few9i-wsfF,,419,QG-E3srf11.1,f,,...wig-'a3w,,,.:ZiE2?i-1 we w.11,f:S'.1,, 15-12211,fx1,tf1gf,- ',-',z..a,f- Q,,f1,,f .e2i1 f,'f,.ssfif'2f2.fS-'1,-me- ,Q 21, 13-ff, 'A 1z+f.ea:1,f1iTf i,f?i1xf'12fH1,-6 -w1,efv'1,f11,w--151,-z,ia1'22 '- we mf-544'-.g'3-1,133.315,Q,..sg315fg,K,,1,z 5.Laws?x:.1,5i.iggug,9S,.gg,nz.15,-,fK,11g51W-31,1253-1'zfa,?,3.gsEm,-,3f?g31x,f-fJ12f:fv,,5fz1YQfv'-QSSLSQLQQI-.3,i2a15:n.a5' fe,-.5,5tQ:2vg,SS gn-1 iyisiklifiiffig-.5?iA,f1.-'EY-2212IH?.L59Q5eSE'g,f2..'5--ii' ff-1.iEW..f' Zf::T',ff.5.E5E.5f,l?-5,'if-f1.lL?fZg'g:v ggi!581151151-iefisw,:wg-i,.1ii?'aV25',--FS, 1,5 L,-3U,:'i,Q'? .:i'ZQ-37..SfnN2..'-ii?-5-v.fi:s.!Sif-Siuiii 163,212Midxziif-Nafikldi11-99 ',.53'li'f11.i,':sf31 IST'--2, lgwxfziwlii ,,m.,.,,1.,1,w,.,,,S1..,....,,,1m wasf.m,Q+1,.Q,,,WQ-1-.5,1,w,',,d,.,,-13.21,,,.w,,,z:.1v:,ey,,,..Y,-2155.1,.fe-f,,:'2-.1vm,,,, gy,11,2..f,-,..,Y4,,,1.11,.1,:,,w,.1-1,1,4121W...,.f....f,:.w1-. ,ff wg .',,-,ff-...w, ., 15.-f , .1 z., 2.fe,f.,f-1,-f '-f1WQ'-11.f-'1-f..1ff21--1 -ffm,11'-f,f,'1..,:f1-h1,-1f-.,1,.1.1,f,,..,w.1e,'11,s,.1g,,11,,.f,,-,,..,,1.,,.m,,,,,,.1,, ,,,,,1. glwfiig, M,515,KHIwgg-15,ssz1ra:v'5v1f::1,fQgi-1,519.21545K3y5K1Sf2Qf,1g-K11j,2,ws2f?A.1,q:.9is4,3525f.'gg'e:11,3rj,51b,5,,1g555M5,p 11.312f.1nsYh,b,vL2-1.g??,.e35i:i3Lj,1,, 21,39'55T:zgee2'1i!fa11,Wjlw.lQ,:f?. 5531.517,P-1iTL,iSl55,' .LEQESE 139232261,Ct.1',T55,-:ff-i.i,Q1191.15115,2213-fi-K5,!Qsq'.7E1,fgr,17 3,f3jggi21wrgf6'f,3-,-.1S',i1S9,5191,.5W14-7,55E'if-7,15 'fylfflfg'l9'1g:5iQ55?.?zEV15121-?w'f.f'.iiQ11?'i152531555 132 -gUflEi'?5WZW'fg,55 g,-iffif-KS? - Abiliw-f273f?,tV 312?mg1fxfQ95 1 REU- .fFff,:f:3L:Y,!'1x::gQ fUE .efffkizakfz'5ZSAW11L5.'s??FEf3-W5 fbi11E-M15311g1g5'b'55.iw.:2-581bs'W'fi,im11v1,q.5-NF' gr1wif'12v:riw'119?.,.?1Q1sf2S.'1sff'Y1a-57.1312:1,5if1,,f::-9 2,-S111,w513,9I.v,Ig,l',g1-i,!ii'1f SAWTE-w:f'71-'ii'fiiif-PLS1' '-fri-Sf'-If-V2 1:fT,z1l'-2.53 Sf i',9'f15'..l5' 1 -,FL--MQZW ii'21Wi5's.H3.'Lff2.l5 -9L.iE- -21,1L'!,,f-3? 1,3251 fk?'55 1.fv, w1'fe'7'livf Ji 1s?fiif'i,gi'4-V Sidi?E:-M.,iQ:1f..b-ff.-fi 1'-idlfvi 1. .,1,,,K1..,,.,.,.,,1.,..,1.19, ,.,. .,..,.,,,.,.,. ,?,.W..,,,1,,w.....,..-1..,,...,, ..,,.,,...,,, 1. ,. wa.,...s.f..f..-?1..1,..,., Q, ..f...,,-sw W' 1531.314-.2, 1:51.14 Mm... --1 fn.,-S ,1-.v.,W'-91,fa,S2.y5- '1we1',,5r.191'f-fx,.1.xl-5:-vx,1 E4s4gfMLff.1,YK.1e'i1 52.1 Mrs-.,e4-z.' ,e. 1,531 51-iffmsx 11,1 121- 9 11 aw- '--.,.11-1-1, 1' ,,.f...d 1 wg ,-W sv- 11, Q..--J ,Q 1.f 1-'M' ,-1,.w:2, 1:,.'1. 1..,,v' ww-' 1,-2.1:-vw is- .L',f+ W' L,- ew '-f..f- 2-1 -Vw 1 L-'11--'P I fm -114.3 '-we--'f-fS1 -2 -21-9.1--4 ,fx ,-mf, --vip!-V N2 ' feA.m.1,,,..s, ,1C,..:, ..g,,.-3f...v Q, Q. f.. .f, 1 ,1x1,,,, .,..-.,f . -f,.f.w.,1,1,1-,1'-w,.,.1 .ff-,--...,,,..5Q fo,,,,,1.1.,,Qg,,1.1.1,1..,,,. ,af , .W 1.1 .1..,,.,..1,., ,.,,.., .., ,..2 L... ,.1,,,.... ,,., .. ,,.f,. ...,...-1.13. 1.,,..,,. v1......,,,- ,,1., q,K,..9w.,v,.,-V. 11, . .,.., w.1s,.,,.,,w..f,.vg 1:11.21 -s,,1,KK'.a--.'-,Bm -? 1si '-.3115 mf 1:5SS...,.Ff 53,9 f ,.,b ,355 ,KP ,a5H.xx::,,,q-,. .9312 ,, W,KK.,,1,.s,.,,.,, 1,:',.1, af. - ...1g , W, f .,, 1,5 we 13.1. f, ...z-'..,. 1, -...M 1,-:g,,--, .xv 10,-...W J www- ...rf 1.,-.z, 3 ...,, ,..x., S., N.-W -.,, :bw ,M 1,--' w... V'-, x1.:3,'w.:ee 1--2.3,-'hwwffsi,-2, ' 1.1 ,.,,,.,, .-!2,'f.,11faf-,wx 1v5,.1.-1Sj,f,.,,r Aw-5,13-,..f ,Eg-f1v..,,.g,-,,.y 1 ..,,,..,,,,.,,.K,,1,., ,...,,,,,1,,1s,,M. ,.1,.,..1.1.,,,,,,,, .,1,,.,.,,g,n.,,,..f,,w,,,,.,,,,...,S,,,.1,..,,...,.K,,.,..,.,,,,,..,,,,.,...,1,.,,,U., .,..,,1,, 11, .,, ,, ,,f,,1,. ..,,..,,f 1 ,,.1,,. ,Q a.. ,..,, , 1, 1,Q.,..,,21.,,....,, ,fm ,- ,M-.,...,1..,, ..,wa.,. 13- .3 W, 1 1.2. ,,. , ., .. 1.1 . ,,-, 1. , 1 A, 1, .,, .f, .,-,..1 - 1.11,-,..1..1..,. . ..-,-M, .. . .,. -,m,',..,v.,., 1..,,-1.-af... www, wwg,.,a1.1,-2fp,-,,.y:1r1s1 .1if:w,x1s'.1,a1.www 1,..,--1,,,, 1s- .'- 11-fi '- . 1 -if .', -:W-1'sw'-wwfi'-1-11f...x 'e-f 1 ff -11 .fi fl-1,fm2v. fH1620 1:1 'S-gf.-W .gmsi12,L5'igfg:?iggQ1X1355-.Lf,?1s.93fiiQS1,j,1giS1,LE11553553591-fP1.1i,r 532135, Q:15W'f-311555 LMT 2553115545351 .1,-354,531.942Qs..51f,,,1,iT.2n51E352'?ii1S5'--Q,-.'S?,T.ggfiiffi-24,51,1555-E.'g-3.5,-,1,S3'1 - .S5S1,jL3 '5W1i' M-, , .li L-L -125,11-19. ' 'Q1 -'i.ffq'-h 25,541.5--..Lz'T -S' 1,-If'1:-ii'av-'ELSJia-f1.'S'1,1'T'.1f'1155iii --TILE-2,-if1553,-.Lf? .Si.'i-515551.54514 153f3Y2sQi35a?Q.5'5J1.Ss-.1i15:.F,?'i55'1,-3?fi1,,i:55.5'KZf77Y2i1L Sl.f5'9l.i2L'kf'VY,f 3 ,x5i'Kmxs11: 11 :WT -5le',Yl?0.-'E,,ez1'1'Rt'2 fisfwwz 9222,-5 Sf-W, ' 55' 53.911-5S1gs,55?,,tf'-.ff :525i.1:sEa51e'J 55.1,-7K.m,1:m,f111,i5'?-a2x'f?.m,.3:3l4,g1Q.-:f:i1,Sw1'f,i'w ,e ,'5 ,ai71,S,' .s1:5f,?ZL- -V.,S1'T lf- yi V',-- 1-Z1-,im , '-'11,--,. -' :Wflf .vb -WS' fx ,-'., ' 1,-9?1w'5.. -v.ff1.b ,1W 4-2.12-J' 2f'ff'f11:?':'3'L51..L-'gl-35.15-5TYAQ551lfi5'f'.2-27.181'ifffliiiiil -3, SP1 157'-51152-5iffG'-Earl?A 21,5 1-31-AW 1-?'.-Wi-Qif' I lsilfiif'5'Q:fsf?iW'.1-5. Sewffffi'11-f17Zff, Ni5H5Q fv,9WE?5k5iiL?s:55 1LlE'iP3s?T7fl537UffWi 543-V9?.f15 71555-'R,3i:..i'5iliS 11'-?Y355?iY9, Pxiftiwgfxiifz .2-95235 T-12251--,ii-'1.i9g',fEzT9i.'f131J57'fi-559 1-53412-3i.1,5SY x,'1,1,5'1.!i .5 ,11'?T:fi?1-WT ,--9351 1 - K -Q'-iii?-5 iii 5513511213:-57 MISS 5S,i?'l:L 5Si'1s5' flex?.1Sfi?.w'.'lL37',s?k1b5'iffc225'51-.IE255W1k'Ef'3il-?5Tf af-EE iGL?Vf?i i,f5?Q5? lW'i:-?31L gi5'T--3LQLi5'.f2'z-Lili, f5,W,,K1,.. K,,1,,,,,,mg 4,,..,,-?,,,,,,.,..,,.1,.,.gv,,,,,Kq,M,-11 5,,,,gf,.s,5,,1,,1x5:g,fgEwi.,,,.1 -we-,,sw?,,Y,i1-,?le,,a,-w.1,f.ar-f,a.i,amg1w,1,v1W...m,f-.f-2i',f,,-111-.2--5ff,:g:R .Lsmf-:,, ,':,f1.1z-.1.-5: g --gggsszf, . iw fi11',g, 1',-wifi,-1-1:-111161.-U2'1--2 -1.1:-,.gL1:.,-151, 12- , . KKK? 13,15 LiiawslilwKKiK,,,,5'5,73, ggfisgim ,?,.,6g,-,QQZQNQKQ1 jimi my LMS 5.55 ,,A,gf,wVK95.IW5QK:ggg-,LKLSWWUK5 QQ5-!K.,5Kg-,RW15.Ag9,f,J..,,?,5Aqx5g.ij ,gK5,,,,K5,f?K53f,3.g- get 1531,-51, 5155: K1, EQi1j5f1,K fig.:-KK3.l511fg1ff.1:.G,11,53'.:z g5,,f1f'fi.le 'M ,ff-'f'r,V1f,-H215 W, rg'i51'Qg:if'1iE'g,,111',, 1,11-13f,,1x,f'. bf-Gffzfifi 't?3Zi,F55fz,491.1,HHHjLf.2,fr'fIV',5?-3 15 '?'i,',V'.. -fi.l.,G7i5i2,f,j119319 : :1,,i,.' ,W ,1,1y,.1.?,51g3,,.ii5,., ...,,.,.,5g,,1,w,,,,11,, 1555,,,,g,g.g5,,,,,,Qg,,.,,,.K5,,K3511-25.53,,i,W,K.,,Mi.3,,.,,i1,,K1.1,K11,q3.,,-.,.,15,y-'.,.,,,1,.f,..,KK,.f,,g,,-1 pl.,,.g,,,.g,K1,5,,.,,.51,K1g,K,1,f,,,,.,,f1-g1,f,,K1,-Q.-,,1 Mg,-,K'.,-',, 1 ,-1,.:,.1,f-,',g'1,.f'gyj,4,z1?5siavi.--11,?'.,1f,sfs,?..L,-i.,f:.2ipqmffgf1,f115- L'.,1'.,sfff1.-111,-2'., ' ',1'i-W:-'L'fsi s-..1,-Xia,-1,-,-.'. if ,Q-,,-I.1-,1.1-1551-'ei.,.,i..'eA' .. 'f i.-2 Q iff, .Lf,i.,fiz?2,fE,-Eg.,-f:,i2ei?-2f2'',,'1z-Sw.,-Zfiif1g1,i?..N-15,22-fz,fL,1zf,fi1'-fa,1,i11:,-'Lmiff - ,av3'-,-321,11.+11.1gfg,.,,-.,f'g,,1',,', 'El.fvf3:,4:iLl.2 ', ff,-Si 'fi' i.f?2fi?fi?'i .,2i3? fi'5if.55 ' ,K ' K9.,iiffg,.17j,1.53.,..5jg,1,g'V-,gffL1.g'2?T3i,i4i'i1i452-13.-g.L'-541 gg3K1,,g1gj1g-7,155:-,Qi-.'55t.E,gL',,,gQKg, ,13,f,.,,f.1'5? ,ss'5.L5f,16,'-gig?-1--.g,tK2s:,gK, 1g5g.i,z.gQ5fj51,'.1,-31155-5.iiglgigs-51,233 1.s3'1f'..S-E.1,.1 z 5,'1,QQ,Q1,S j':5s-T'-- lf1.52 -:', 11 -V, iw? I, .v',.l,.52 1 ie- 1. . 'fizE'l5-'3'.,- , U'-Wfi-'E'-- 1-5T.l2'5lfaiffgf '55 2315-Z5.'L1L?b'i,f.5G 5 5'ii'1f5Yl1--,.1i:5'..? 1-Wisf' 51 -':ii:'V'-9i.',f'kf1-'11 , 1 1 135- .Qjdga .5-'E jg E-11.5, 1,5 - 5?'?,?Qlf21g.5X!5 fgfikgrik' -17,5 Wye'-.zi5,QfZ',j-ij'!'L.-.iQijg..,.i5 :,Ji1:g,,zZ i5.:,ii 51. 553.17-'1l?5 igi1TfL,1'513'Yv3.,'i'? .7 -Q-51 J.,-5, 1,15 g:f'71l,5'1.31E '.fCx1f-,'V'-WTIQ?-G '3 1f!l1- 7131 - W ' -'V Z--T. gf.-5' f-- ..'f'Q-?.53 ' H.: --iii-11.55 SSE! if'fig-H-557c,f,''f173f:f1JFf -if if 1 ff1'W 43,52.,1,fw1.,,z1..w..1..1,.11 11.311,-Uff.,,..,3-f.e,r.1,,,1,,,-.,,f,ff1,-5--,E,,2,21m.2--me1,3,,Hsizi.vP3,g,511i1,,2,11gg,fe22,,'1.e,MLf:P21fgrw-11wi1,51.fr1eW..5-V2312.-'.i--iffg'1.,,1,.,-1'I-1-'..-i-'.',-1 2,-211,z 1--. -- -' -QQ,-.:,-,,.. ii 1',, '- '- ,4.,,,y,, 5,,,,K,..,,.53,,i.,,Q1,,,,K1,, 5.5.3.'Qf,,:1A,.,f,:.,,g,.LzgW1.ee,?fs1.,,1g,, :,,51.S5.1g:'1y1-1,p1,'.4a-31:w:l1,faz,11-32,-'g2i,sfK1.s,,,-,exww, 1,f1:r.i1,ff4fQi.eQ:...sf.','.,w1,-2:.'z'eg-41,',i1,,',.l,,, WI1,-',J.',--1,11.-fi., Q1-., 1--,7.,-ff 'Q-'i.. W .,?'..',,.'f-71.511-'Y.',--ag:-' ' iQ .,1','1,- ' A ' -ug-'1.g,-v..f, :1vQ11,m,.1,-2gi.,-121,'..1,-.1,-1,,f4,,e1:f1--1.., , 1, - 1.1 -1 f 1:1 '- 2 ,NQ,QKi,,K,g,1,K,5.,KK KKg,5L.g,Kw,Q.ij',,-,,jggg.:,Lf1,.w,.,ii5,1.f,,,12.35fm,-5.1,f.1,s1,mgext,-Pr.ge?1L,biib-155111.-Tw?.5--.iij1eSgsQQii1,wg2,-H.-Sie,'ijfff-.',:i-541111I--W'.1iQ'?f.22fii-Qifif .11 'H- fii- ' f ,iw K1 :.,-.-- , M - . . 1, - .' 59235: A i ' fi-I W .:,g5fT- '. lin, H' 7 HE' .f 1 ' .',,i:'-- 119: . , - -QQi:,j11s-,J1,?:,L2-.1--'.2,.f,K1,svi.?,-1 -'zfsiif isf'fz.1,e2L.ii,s-1,S51g.ff1is,--129535,.-ffm,-igifzi5f1g.a:',:P712gr,52151,lfgia,-'i.5,11..QT?f 1,-il'--'1,. '.'-v,3,-'i:E, '.f,2-1 ' 5,-1.g'.g1,.KK K. sy, Simi33...-,,fE.f, 2,971-ii?-f ' -1 M 11 1 -- j 1,g1g'.f-f.,-'-- .1532..,,'1g.f,ii1,f1gg:,-1 -5.9.1,.ik-2.q,'fZ.-,?i,.wi-zilfiig f11-fv,- Q 31.1,-'. -i lf? H'-'11',-'iz' 2.13 . ' U lf?- nfl -1' ,1K,,.., ' ,Vg ,,g,,. ..1,-'1,-1L11,-1,,:e-KL,-..,,,'g.,2-gsiw-i.,fz'g1,i.v,gQ,Q2T'i,-Qffm.fswglffx-Uv3?,,L1. --'11,-',, ,' 3. , k . - . - , H f ,K .. fi -E3 z.1,,K,,1,fi ' ,..,f3,.'z.g',,,, -'1l',gi1.f12,f?i' 'M' ' ' ,Wm .',,,,',1,g',g1-,,5f,f1 -11.2,-11.g',-gf -2,3-21.511,-2,11,1-'.5:fw'.',f1.g,,-',-ff1',,f ',,.i.:,f.- , Q-e, , 41-.!,,i1T-12.1-ii,x-4, --'---' L ' 'N '- 59 .. -1 'G' .iii 0 - .f,f2.f,-1z,.::: 1. ,'21.f,iEi, ',S'ZL- , ,f'- ' , -. ,2i,,ff2 1' ''V,--if,-11:1-:Q,'2.g1,-gi .9 .ff .g.11gz,f,- .f',,j.' , f- ' '.fg.f1i.1. ' , F' I 1.5-,,., ,. ,. ., ., .-1,55 gf.--e, 1,-Q L' L.--, gr.: , f F ,' ' + ' H., gg,51,111.151111.,4g,gf.s4--.5zigf-52111Q?E1s,v .. -' D - 453' '-. 1 Q' '1,5?f'f'5lA.ffi,-1. wg ',.,',. . V Ya f- . '- 1 , K r.',,-zj.1,x ' X X' Y +L., .. . .,-11 ., 1-,, 1 - ' ., - fm, 1 ff .fi 1.-ii.:-ew-' - - f. '- f '- -1 ..: 's,'3..1, ,.., .,,'y-Z...-W. -A ,:L, ., -:. . , L.'f: - in .- ,' 7 VK,K1,..KZ.,ig,., Q, f..,,,.,,,,,,,g.. .,, K. KK 1 ,W S, ,., fx., K ., - ff,.,- 55,15 - mst! 1. H .1- K,Li, '-,11 66. 59, K K , gf' , - 1? 'gps -, ,-..,- ., .,-5 , 5 5 ,ff - -1 Elf' ...il ., --i,' 'X gi 3,55-T1'l'iif2'i-'ii 1 1' ' - if? 1.122 .is-'Lexi--'i. ,- . . ,Q - if Lreiy.-- -- i' g ' :r1Q-QL,-2... , 1.-' . f X ,. 11,1 , 1'7 ' -if L-' 1, 5 - 1 T 1 nl zu, . ., ,. , ,, ' ' w '- . 28 1 ' , ,. , 3 K -, --,, .--www 1 , f--1 if-'x -121, , , K,.1,,,.,.,-,., K , -- ' ' ', 4. 9.1, ' . f ..,......, .,.. F .wr . . ,yu ., ,,.,,..,z .. .., . ,., f , ' 5, , T. ,Kr .fff wp 1 1515, ,i..,,q,,g,-'T , KK. ,mi ,K1..,,V1,wV 1 1. K -.2 1- ,Q JW . 1 .ft-1..'qK, ,-1 1 '31 . 2--gg 2 1 -- . ,gi ',-: ,- :..fE'f'.C, ' '55 LS 15 V' -- H . '- 4 171,-f.Qg2,2g,-.,. ,.:-K,,g.,--- .- ' ,, . .:,., .,.i:1,:g . ,,1:,.,fG,:,'fs--if-21.1f.,g,1,., -'-- f ' ff W . K , . ., Ak,. ,S ,,,,K,, ,, 55 -,Ki , . , K, KKK,.,,K.,K,K,..,KK -K.. K - 1,1251 , 5. . . 1. Kiev' ,-1,1 ',4,..:,... , f .552-. .. ' - Jag? - 2-i11,-gf,-.11 .1 ,. 11.155519 -' -' f - -195' , Am ,..', f -' ,. 15:-f . .. ...,.,, ...K,iQ1,, K 3551,-K, K, V. fx .K rujy A . , ,.,.1K'-K , . . is ,,., K ,,, . ,K K, .- ,. ..,.1,.. . ,,.,.. . . , ,, ,. -. , - -fa .. ,.g ,' .1 4, f Q- r ' S ' , Q' -- -1f':,,-1- .92-i., -f . is , fm' 'K - ,j ' -'i 33.11, Q. KK .5 .:,g ,-' - , A ,, -,,,..,,, Kg-'.,f,.1,-g,.,,g,,1. kbyvalb . . . 4. --- '. fire ' -Q6 .. . ., K . ,,..,.,.. ,Sb K, ,K K ,, 4 , 1 QS- 1 4 - , 'flif ng . . . ,fl ,- ij, 'gs'1-i,,g,Kgg.., K ,K K' -f 1 'nf A .. 1 f ' - ., ,. I KK. ,, ,3',,gg,..,-13 -.,, .K, , 1,-f'li'.'Ei: -, -:,i7,'-'Q-... -T, 'i ' . 4 .5 1,-1,--,,f,,K. ,,-1,,--gg-. , ' K .2,Ti,-H?f'1l-.Ei:l fi:.- 'f,,f,f3.ff-- Tfg,,522f11iU1lf-2 l,.f-' 'A , fx., -- :,,,,.4, ,.,, , -Q, -,'.' -1. -' .f f.. , .. -f:-'.-S . , 1,-15 - 1. ,-.:,, ..', 1 -Q 1.-fi., -' . -- -- --nz.. ., . -. .,.,,.1f1f,.1:,- .. 5:15, ' a ,'-', .Q . f, Q,-1.--:.., g,,e.f',, , 1-4'.'1f3if.Q-1..L2TEkv K1.1,.'E,.' A ,,-',.ie1fa,f5 1 ,jf- 1 fig J, f,5,.S'---g3f2,.f:g22,.. 7 1-j,if,g,j'2.' V1 :i L:lij V, , ',j .1z,'l,E' A K1-- , 1' 'I Wifi--,,1 ' Mirlf? 1,f',?71:i1s-'1.'i'1:.E' -:?.i57,f,, ' ' 1.1-,P1 if-3, , if1f',,.9i'.i1- Ti ,. ,'.i.,:1 Q-...,-,,:,,-1,'. 1. 1,.'.,1.--1..,p.,..,:-:1,i111,-we-,,, ..f,-C-. ' , f'--. M .-, -.1 ,Q-.1,-.fx ., - -K1-.--.1 ,1,KK1, 15. ,. , ,K,, ,K K N , K HK,-.,f3,K,,1,A K, 1,, 3' H, x,1LK,V.,K.,.KK7 .K ,y K J my ,,..,K.55-1 5, ,,KK, -1,5 , 1, . '. 1 .. . 3 4, - ,,.z1,-,f-g1',.g',- 5'--' -Ur 1, ,.g A .ug-L51 1..:i'--Tv ' 1':1V:.fi1 56 - fl,-7 13 'FV- 'f:,K,,y1'1,--wg,,553-Ug1,1,g53g.,-f1,-,,. w1,f,-1,,12.sf,-.1 , - ,j:,- . g., 11.,-',,..,qg::'1,--j..f1gMfg., .,- gl-gg.1,K1. 14, 1' . .. ',,K1g..,,,...,'1i,,g1f,gj,,,-,QS if-, ,-7 - ,-ff,-. - 1,2.1,711--gg,-ig-12112,-1..,f1..,e-'1.-mf,1g.,Lig',,i3g:fs-5,,gl5.1 . if, ,alfa -g,'-f25'f,.:,f',.ii-11-'i1-f-?1,- - H K -' -- , 1. -i1 z.,--2 ,f1p:,,v f, , ,. ,i,:i12,,2,-1-Zffgfl-' K' .1 1,,- 1, 1. ff 13.11241 ,I-igxw,-11-1:1,-21f,zi.-',w5i..,,- i,21f.,f-..f3ig,,sf,31,.1 f, f f- 11-- -Q .-,, .,, 5:-'.. ii:.':::E.::'..'::..i?i11.222 :.1: 'wW1. M ,Bm,ggQ1A7fYT'm '3-- 'mm S 1112 S ' . 1 ..,..... 25 . . 1 ...f,. 1 1 1 1 1 .. ,1. ,,,,.. .. .4 .. .,E1.s.p,,.n. ,, ..,,.1 .s..,1 . ,s W 1 e . i P,-::. '.: ::, ::- F :m C:: '.:!?EuEE' ?:'I:E':5iiE:Ef:::L1:: .E: ' 'ni E-.H-1'51 HI, - 1 151351 s5s1?fa3g11-5242111295111 ' . 11 1S'5 1.. jj-1 :21 fs1 ,e111 1 . M115212131If-i?vfSirN55qe'ie11Q3:i353g . 1 5. ',2:.,'11 .j1 Q1 M11?1A35dS f 1 Egg- gmwigggggffifwwgsgsgi.gkfggessveesdg,-egg ,s1z55E15u ms - ,mmt wasw - - 5553251 1331 sEgf1Mffi1fQ1?5F'1-S19145115191151-seWe-waiafesesffie.aW1s1s-ass1eeg11125111 Msg are 1 iw? 'EW - 1SHwQswe1rs11emsvda11mfs11sSk1fd1m11g1,Mg, ,Qm,m51,,11S,11,5,.E,x gy .1 . 1 ,QQ we Q21 1155 if1152912i21f111eiF2HS11sfsfeeeisfsfffieseifee1s11ss3 s1 has -pa ,Q- -3311-135211 21'0?gf2'12gisg55gg51,,gsggvig52,g125fes2s13as1-w55?gs11sss1Q1 sig?-?5'511ss11??Qgt1111g??53. 1gs,Q1155s?Qir35?1?g ? mxi1fgig5gQ1,g?QE5?L.iSr2 11 1 M 1 ans .wse,s,.s, uw ,.e1,11w11. ,. 1. 1 ,1 QF fm! 1211fL5'15'Le 'ease' 5 191 ef Q1 Q1 S as Stk WFS s S5112-2 is SZ ff hmkfgww 51 ugfzsgrzgigxsiggfgfxgggiaqsggig 1 L.,. ., 1. 1 1. 11.11.11,.1- f.:f,:f '- .. 11, M, ., ., 1 1,,,,,t,,1.,1 11--..1112- 1-111151111811111111-11 me111111-121-fx11f1--S5-211-11-111:-1111111 mm: 1s1111s-19112-1215211111-15111 1-11111-1111-1s111111s1 e 1111111 11111s1P1m111111111 12111s,1s1.111111 1.-.11 1-:1s1112,1s1e111s11s111-113 e1s11ts,1e-11:11-me,fs1111f'111e11s,1e,, 15111-1t,1ff111 1. uf.111 -,11fSEss?isE2s1pi5311: 1?wsik11e1' Q-19111593512112111111111111s1ssiien53es11111Q,S1e2911,,11g,111511st'i:?511111111Q1gage152Q55153555ggfgwigwggfigggawn ss1sYs11s11111s5 ,fee-sep1jQw1mss1e1w1e11s1:a,1 11211111 ,s,1M,,5,1Q s11,111.s-.111111.s,e,1Mg1gm1,,i5, .Wg,m,,1,,,Ws,,e,1s1s1 ns11m55,s1A1z,s1,1.,, Se 55534515?Q4135f?2S?!115f1fe71?5Q5gLi5975J?fgEfkigififSE I57213215E15175I75'i91e111erZxQ3z1LS1X?5Vls5ZZaZifEZ'8xSLSZQIXXAEJSKTEZLEWYQ 19135 15355551551 sE1f111fssgsa112f gp51f1gegs1t5ggg3s1s.L1gsu N211-111s11111sg1111111fe11sssr1w1911mgw11s1m11s1s11sgs1gt-11sQe1g,1eeam11s.1111 11m1 .11 112111-Q 1 -ww.11-sQ11s111111. -s111111e11Q11s11e111,1 11u111s1.m11s111m1.11-1ws- ,mme mm-,,, -,ys1ss11-2---11-14fQ--11-f2--f+ww-- P21-we-1511i2111s111111s-15111151MHS111111-111 121-we-1s11111s11v1121-151 8:1121-121-HK win-1111125-W.-11.11, W. 181 1gs1.s.,,Q R. 1.,,1.11.1m1s1.111.,1.1,1s12,1.1s..,1.s..,,e,1,, 1s1.s,,,1t,,1.,B11sgtig.,Z,1g,,M11fm 11,1,5111iw11s111,1111,1gs1s1,.,gmw511,gsusw1111111,111.1,11t111m 1,111,112 ,.V, 113, 1.1 .1, .s,,M,.s1121 tws, E1 M,1W-1,- 111111, ,- 1.11-1.11.,s:11111s1.au1111111s11111111 s,11111s11-911111111111-11111111111111111111 12115-W1-sw111111s1w11111111,1 ,, L,., W U.V, W.1,.,,m,,, ,X V,,.V,A 12, ,.., 1.s,,11. VA.W,A.W,A 1 ,,.W, 1,,1.,1.t,1,1.1,1..3,1,,1.mug s,,s,S,,1e,.1,11g1.,S,,1,,..,,11,,1, 51 1, . 1531151155153511911111291111131111151112,111-1s?,v111s11,.51,.115, ,1..11111, .,1.s,k,,,5gq1Wl,m.,1,11,1 1. 1131511--films :is 111111a112g5s5, Q s 11 ,1 ,1 11111 11,11 gjg,2?3Zif11m3'?sf'?5fm1. 11115111.11 1151? , 1 LU,. 1 11. 1-W-121-we--21-W1-1111111 1- 1- 11 11111 ,M 151115.g?151.g111111g1i51.g1115?1s1-.1x?i?Ji1s1Q11s1Q1sggsg5,1?1gf21g11f15131isg 1 we-1sMs1f11ff1we5e1fe2wifi-51fff92sf?1.1fiii1111f1 -511121 11gf111111fs11f11 Q1 s11x11s11s-.11 11 -fs-1?111,11s11,21-1111111111111 2 5 - 1- m11111111111s1s1,, 1M ..,,11,.t.1, .,1.s,.f1-11111-111. W 1N,a11s1s,121 51112121-11.1111111111 W1 1,1 11s11a11e11e11s11sw11?11121811211.1w1111:.1111a1e,11111m-11111111111-1s11fe1m111e1-111111111,111-111-1111s11s111X1f1w-1e11211s11efsi1.VW1-11-11111 11,1s11m111-.1311111111s11111.11111111111111111111111-11-11 111-1111111111111-111111-111151 -1111f1111111,,,1111.1111a111111w111s11s11211e1p, 111,11-11-1 4 1s1Q1s1 .11111111.111s 111f51.e,1s1 11141121.Q111sy15s31111.g111s111s11g,1g1111g11gus51.311w1e1-ssas51142111sfs1-1s-'1:11s1. 1s11fX1--11 -211121-111 A-ei-1s11e1 .1e1.ss1 1111s1s-1 se-M-5151-ns1f1 1s1111-13 11 51111111111212,1.x111111111.1,1e..1..e..11 .1 ,, 1 111 13, 1 1.111 .1 .1 W,ses,.t,,1s1t1,1s,1s111s111,.111.1.11, M.,E.,11 11s,1s1, 11111 15 1111s1111111-1-1e1111,11111: 111111-1111111-1111511311111 111115-1,114511111-.e11s111s11111131-51 ,m1.,s.., 'S1e11s:11111411112-41111114:11-Q1411113111111.s:14es1.4111.41111111s1'1s1ie1.::11x11m1:41ss11511141115'1s1i1s11a11-1111111,-21151211214214212121111111:-1e'1111e1'11'M1 -151--31--1-115 121-1a11s21ss11sf1 '21'f111:11sQ1fs11s1111s11911:-5111411415151-215142112112121 1F11 1sf111s,1111f111f11:1s:a1' 1 ..,, ..,,.. ,... e,.s,.w,.s1w11,ww1f-,Q-11111-1111111 1111111111 11, 1,111-21111111 -11-e114 11111111211s11sesf11ss111111s11.s'sfz1sz114s1ss1se:'ea'IQ1-221121411-2-124531121-?sf2i?i13xis111s?1s1i:s114- 1isr?117ias'1s:1g11f1?11111511,f1- 1 11111111111e1,111111sg113s111s11111311,ssQ513.11551511g1f1g1S1gfSigis1rff1111z114e1:11s111111-214411211111 11.1111111111 s-1,11111,1.11- 1 111 11111 11111 1111111111111-111111111111111111111111 11,111 111-11111.11.1,112,1.111,1-1411311111131 - 11 1:11f'z1.s111e1,1'11ezz1sz .e,.n,::,,1:1'fs, 1111:-, f1 erm: 1a1.sz,:sc 1:111:1sa,:z.:.f:-.s11.s1:a1,re1.1m1mz.ee11f111e111f1 211111-111s5'Es?5s-1s-11 -'z-V11-1 1111111 .,,.., 1, .. .,,s ,.,. .1, ..-.., .,.. 1,,,, .,,,.. 1 .... H1 1111111s?1,1r21111,F21?12f -1- -1 1113 111.-1115911111 1l11sSL,f111s2g211::?Qgs114 1 11111111111 ,1.., ....,, 1 11-121,1s1111111-1111111,1 .,,. 1 -ff--.f 1-111 ff-- 1111111-11-111-111111-ws.e111111111f111fs-111-111111111-.111-1M-.1111119151-1Q ,11-1115 1f11111131111,11-1111 11-1.1-.f .1 11--11 1111111 121-11111-- 1-121131 1s111111111.11111-11111:,111,?111-11 W3iLE??E??2SfE35?: 121211-11 1 'il' M1121 Milli? li'E4SSisS2i1f5EL5121945121QEJHZESL51ELi?25?11iy?Ei?1sE?E1iwz1:w,.ez, :x1114e141174s1,4L11.11 1 1'-111' MQ11- ' 11111111151..'e1se1?s11is11i411isS11S1511x211s:111S15f1A1' V 1' 11is5fLf1111 is 111 11'11'11?151 1s1x1??11'11?2f:1 1511411121111fl111se1:1,,..,,.,,.. ,1.111f1-11-.11-111111111,, 11, 1.111,1 1111.1 111 111 131 1- m111s11s1.11,.11,1-,QL ,,., ..,...,,. 1 .,..,. ., ...,.. ,. ,,.,,..,,. ..,,..,,..,.. H, ...,.. . .,,.1,,.,H. 1 .-,. , ..,3111.'1 '1JJ'1,:111:1 1 111e1,'a1111411s111s11s11--11 2 .,,..,,.,, 11 1411-1 4411 11:11 4111 11,s11:11,'ss11:211s11f1, 15.715-15 5 11 - e111111,.1,M.1 51.1,-111,. g,,k11,111,111s111- ,11- 111.s,1g1,1111f1,1f1,,111.-11-11111s11111:s1,sQ11s11 , . , ,,..1, 1 .11 115521191111 1 111 111 11.111 111,.f1,1 y111a,i11,1111i-15. ,1 1 11 11, 12,11 .11,.s,111, 32Q1?12Z4111'1e1:s, 15112115 fflf1fI.f,l,f. fff. ,. ,1 . , .. .,,., .2115-111.s.11f1111, 2 1, 1 1 .,.,., . , ..,,., ...,..., , 111111111 11-111,11 121.12,.111111,1 . 1:1111 11 11'111s7:4z11s1?fs111:1,111 1 11111151 1Sg1w1?'f111,--11-1?1L1'111 1 1 1: 11115 411,11 1111111112 me1112111f111:11i4s114w1s11111421 .11f.1,,. 11,1-111-111-1111111111111111,1111.21111,,1,11Lf, 1 ..1,::11'111:11i..,1 , . Q13-1:1111 ' 112111115111 1' 1 21:11111111134111sz1w11s1111f2s11111112s1s1111ss1111 .11fg11-1.115113 1511-,12-'1,1g11 ,,.-i11f1111111111is111111111111sss1ge1gf1,:11r11-11111- 3141? 11-1111 'mein-5 -'11-E1-21'-115' - 5251111 1-1115'L-fe:sf1:sf-L f?iQE5ie1fEvElsiiI5ileiHLS1i1125 -1' 1'1- '11111, 1 11P115111s1?111?:11iT11?'1 112111325251ffL?1I!f141e111,1f' 1-1.11112 -11Q11111.11:11171111111'111111 1,1111a1i11i111411.91111-111-fi-1 1-191 . ss1.1111s11a1:1t41,1 1 -- -1 12 1 .,,. ,5 153-1fz1lEii5'V' 1k an-:1 111:11 1.1 -5 , ,... ..,,. 1 . ...., , W ., 1 ,1 1,1 21112111 11-'15-1u11ei1s11111'Q1ss111e1ss21111,s21 11-111.111 ,1 '11 ' - 1 .1 1, 1 1. 1 s ': ES?1f??lf?E1S?11Qifl,1152151155712131I5i1l9,l5f,1?E1S??1I?iYE, ',1 1 ' '2,f', ,'fi1l-','11L 'A'11'lf'.1 15,-if 1771- -115'51f1117151'111'1 If s VM? 1,-ef' 11 111111 9 5 nl ,1 .V as L 5, 11'-5.5 E-fiji, 1 , ., 2 hifi ,-1 111115 lf klfik 1 111, 17 f, 11 -' 11-1 11g 4- 12111-if 111111 Q 11 ,L 1 .11 --j1,1 .j--1,y.- 511113 ,. 'f1i1,13. ' 1 ,- 1- '91 :SI T' 11'111'f1'1f1 1 ' E'1 11' :C 111111, I1X'1 .'1l1?,'1. A111 , 1 1911911 . 1 1 1 1 331351111 f,1.,1Sg,5 -,,'. 211 '1,'11,:1:111i,.1T11':11'.l1l11 515151 , 71- 11172 1 . 'N .1 -?1,?e1111.-1, M-11.-1 .fr s:-1 11 11:1 ', :1':1 Vlimifle, 'K '71, 1,':' I 1117713141 11111111 .'111-111-1L111. 31 1 1111 .-1 1:1-,,11f1f1 11- 1-1111511 1 111e1.' '1 l-1111-1111-11 1-'h .1ve,':1,':se,:Pz'::1, .sz,:e,.s11.P,,.11. , 1 1,1 1, 1.11 1- , 1 - - 11, I aria. '-511. 1 1 1' ,I1 7 ff'1111111is11,122-1Y1'1 21f1g1f1,111,111 ,111 '1 .,11:i1.11-11111. 61111' '1EiE'E-11112 1 ii 4'1-:T-11is-1,1ff1f111l':1 ff- 1,1221 ' , ,.,.,.. 1. . , , 1 1,1 .1 1,-1.11,1 ' W' . ' 1111-11-1 1M ,. - 11: 1- ,N -1- , .,,.. 1 eff' 1. , 5512 59125-12 1 E11 T1 f s- 111 ..111111f,, 1-12 11? 'L 11145114 1111111 1 111111111 .1,:s11s1,-f 1 15111 4e,11111i1111e'f 1111 1, .11.s11.11 1 1-L1151v?1F'A 1511 , .,,.,,..,.,,.. ,,.. ,.,, ,.,, ,.,. , . 1113221111111 111f1111111?l11T-,E1151 QQ ..' If '11111 1 ff? 1711111111-111 1- ' 1371113111 1111-17-11121, 11fiL1'71111 111 111 -H11'11'l.'k C -1'lf.T111's1,1S1gs1' -11'1Zi11ff1Q2f'E1gf: in if R51 353111111511111111-115111111 1.e1Ts1jZ'52Qs1QQ'1-1 1 In-S? ' '1111111111' Q12-1325115111531211551ii?-iiliifff?-97'-1 - 1' -1,---1---1 1- 1 11-11--11-11-1--11.11, 1a,1e11111a11111211111-f111w1-111:11 2111111112191 ,. . 1,. ,,.,,., ,,.. ,,.11,.1, 11 11111111-11, -.11-1. . .11.s11s1.s11s 11 .11 1 1.1 11 -- 11- 11-211 111-, 11111121 -91-11-1f131Ss1 1s1,-151 111 111,111.11 ,.1,,. 1 ..,,.1,.11 .,11 11-11-1 ---1---1--11 1 . 111, -1--- 11-ww--SK-11-11-11 -1111111,.11,11,.11 1-11111211111111-1s11s1,1s11s1A1-me-11151--114111121121121-1 11--11-12111-111. 111111111 1- --111111111111-111'11-11---1s1-1111111111118131151.21-51-111211-11:1:111e1fais1iwx21 .11-11--111-1111111111 11, .. ,.1,.1,31 1-11--11s11s1111.111111-111111111119111112 1---11-+1211-1 1- 111 1 11 -1 -- 12-15 1- 1.-1-3-11 ,.1--11 H11 ,11 1,..,.,.3,.111112,1111111.111-. -11 1. -- -1 11-111-1s 11111111-1 1- 1111111111111111311:zz,s11g111s11711-11-1111-s1131-.1w1.s1,n111f11W51x?e?1e ., ,,..,,.. . ., e 1, 1. t1 .1 .1 ., ,, 11,,11111w1111111111.1-111--11---1? 12-1, x1:ef1e1Ag11111m11m11s11 .- 111 .1 111 .. 111 5911521 1-111121111155211-'lei-1511411511421155211lg1?Sa2:a:1k1fW1f11Ni , 111511-f3si1s1'1.51551i1E1i 11531551351113l5?1i5931?5P11i5if51s59255ifi571ETPSE252215-QKQQHQ-Skiiiveii1 111111- 11,11 1s1i111111ie11411ss1,.f1 111:51:za11111Q111s11411111gg111512?51itQ2s1s1Q1ez11e11s:g31-fe, ,-1111111111-f151s-11-31s- 1' 1':111111'11i1s111111111 11114111 ggssggfg-111- 141125: f11 :s1i's11'111 :111 'K 111,1'11s11-H1 11 11111111111-.111111-.s111s1fQ111:1s11-is 1a1i2111fw1 Isrfw ,, 111 1111s-111.11-111,511 .. .. ,. 11,11 ,1111111-111111-1s11,.11.11.1, -.-,--- --11-- 1 1--, .,11.1-1 .. .11-11--1,11-11111s,11111e11me1-114111s11111111911121 -1-111 1. ,, 115-1g111111e 111 .s .11,11,1.11 1f1.-Q1g121g11 111-113-111--153 19-13131 -- 11 1 11 1- 1, 1 11,1141 . , 1511211 11- 11-1e-1s 111.11 the-111 - 11111115-1s-1133,-ggggsg111,1g1A151A11A1g1,111111111111.1,511s11511511111111551-.5151111-1111111-511921Sv11212egg5sf1ggs+11111a11sie1'as11?11?lf??535e?3w1211' 1-11-1-M114111-111-11-w111111f111-15151111111211111111:s141151:9142114111s1eu211:2151se?s11211311111fe-121111-211-11:-M1131-11111fg1a11s11re1:e14w1-S S, 111 111 111M1ws11sze1 - 1- -Q Q -f- -2 1 ,. , 1 ,1M,M1. 1, 111111, 111, 111111, .11 1,1111 gg-1111 1,-11--its e11s1swa1s11se 1s1111kx55aiff1bv1sw111 --1 -2,-W1-11 fe-111111 -21 M11-111-1121'1f11f1's2111:14-11':1gsHz.gsg1gs1gg1g11-Q1-1111-1111-151iQfss11e:iwi4Q7412151221-21f1112'm2a- fszifilfvfflw-15111 - 21--111f1.sst111111e1111eff2Qf'-21111111351 - 11-1 -1--11 ,.1. .,...,1 1 ,111.ff-- -1-1 11-,-1111- 1 11--1--11-- 1 ,..., F. 1,1. ..,..,, 111.111-1111s1111-i'-'fees-1-1 1 14Xf1S S121S1'111111 111111111 1 11 M X 1W9K.11.1,?,1,13 1 . giglmiwygisggglggky 1111111111.1,1.1 ..., 2.1,2.,,,.,,. .1-11 111111111 11-1311e11e-12 .1111112- ..1 111,1t111X1,1 11 45311111111 ,1-11111,11111111 61112672211Q?fs1i.g1zQ2i1 1111111,I1e1111-3111131lwafff --111-1s-1.1- 1s1111 1521121 11, .11111s11111111 111111111 11,111 -1 11.11,t,,11,1ss11.1m,1s11s11s1-s1..11,1 111 111511 ,1i-we:1fP1- ,mel 11111g111- 13111m11s11111 111111,1-1gi151133,g5:11115,3E11w11t1Q1s21t111g55s1e111,1111111111QS1,515-1,si11111,111s55sies1fi11W1 M1 111-111 fe-11114Q114s11s1iss11s1114s11sf1311-11sff111:sf19s11sv1s-1s11s1ss11swaw1sgg5gs151q15Sg21,- saggy-w,egg,Q:1,1gs 1 1151411 Q1 111151,-se1 25332115 1511112111111151211123511 1 ff,i9E15?25fS2gf'QgfPfgff'235557575jj5jgc5Vg327gg11gg1,geixg, 1212514211511 ,1.,Z--1151111x'7s.flV:iziSi?ii54531Ti6715E5iE5I5152552 V? ii? 191f5115ii7i55'ii-55'Avf7X539 1111111 111-12hs1,s1121111i11 M111111511ri111111111ts?15:21sf?a12s?15?keew5,:w1w11esf1mf1Q-1Q11H1Q11-5z11f111ffSs1119e.f1S's1Qtsiss5s?15 , 1151 181Jia,'4s1g1gS2giXL1?1e?15121-5151--11: 19- 111- 1111111 111-.31 .115gQa3sggm-.Mgg1Q555 1 -511131-5f1f911f '11 F145 1s5?f:1S11I51fie51iL51 152115S5l7?5E251191'f'31t-1' GSW wsmiazfez'1s?1m1:e':14u1fbA-1L'91s11i3'iZLl1 A 5'L'493X1V5t1v ma- 1 1 1.1. .11.. 1 1 ,1111 W W11,1,.,,s,,-111-,,,s 11,. .111,,.3,.11. 11,1121 :s1is1gSgg115221fS1i?s?is1?s?s1i1s S 1 1 1 Q2 is 1 1, 1. 1,1 ,.,.., .1,,....., 2 1,m.w.,11 , 1:1 111.151191118111151112-1- 1- ., .1 ,.,.,. ,,..,, , 111113111-111-1211s111111s11e1,1e11s ..,,. 1,.!s.,,., .1 ,. 111-111111111121111,-. .11s5g1m1s51, ,,msg?g, 1i,,1,,,,,i13i1w1,11.Qs,M,Smgg1.g,w .1 ,gfsjggw-,,?,,g1s5 . ,1.,,. My 3 13 1 11 111121 ,s. ,, X M . ..,1,1,1,,. ..,,. as y 3 we 1,11111111111111t11m--11111 as 1 asp s as SME M is 9315 Y 1 new 111':11:a1115Q1111 '31 1 1 , 1 11 -211s111f11:fzzeeS'A212191--E-t??eHsi5?1 -15111111-2di11i+11s??s1:f2?gff252iss'iw-H1222 1, .11 E s,,s1,e1 -111-111 1 1 ,..,,.,.1211 11 11 1 s11111.a1fe1s1g11w- 1-W 11 1,1 ., ,111 W 1, -11. 11.111 ,1 1 .1-,1 -,111 1 11 -1 111 11 ,151 15,111 N11 , s- -we ,,1,e1,qEsqE2-g,W,,,,ss,,w5W,g1.mt1-,11x1.1qa1Q1e.1ggEre2,1s1S,s,g3'm ,,3,W,11g11.12k ,W 32111181 11-1 1-1,--,--, 1 W 1s1 ,1,, 1-1- -,Ws11y.11111 -- 1. 1 1' 9112151953-sg3V 122.55525 SgQ11s11geeg11s1wfs1-me1-2S111i1111s1--5sa??e??e15isiisesf11 J-EWEEQFFQ1 f 1- 1 M- 12 as vi- , -,Q-1m1e1 aww 3,153,355M1-,W,a,1,,11s,1s.,s11,..1,1wgfff5K21,2Ss1 eh ,A ., .,.. .W 15 1311.01 .mes ?L5??i?1f1X1 11E 12161iiis2?k2EL52 f I 15115111511 i93v?Y215E5 !57 3T-53 SWK 1 'V 'V A ignQ,1iv3x1Qgb171'igi1 , QL1-11 '79 ss Q1 1 11i'3-WWW 11 .gvyglzii 219,11-g -A -,1e,f.1.s1 1,1,5M-Sikisiew rw Merchants of Central Texas help make our annual through their advertising support. Many of these merchants also lend their support by participaticfn in the Belton High School distributive education program. The firms and individuals on the pages that follow take this opportunity to show their support of Belton High School. Advertisements ii I l l YEA TIGERS! WE ARE BEHIND YOU l, 000, 00070 BELTON ATHLETIC ASSOCIATION Hudson Allen President O. D. Lewellen Vice-President Wallace Law Secretary-Treasurer MAX M, NEuMAN's OU' DEPT. GLASS co. in STORE Y' Belton, Texas PR 8-7173 Phone WE9-3051 Temple, Texas We Give You Stylish Merchandise at Reasonable Prices for the Whole Family in We Fine Jewelry B205-3 X 'QL ' A X fl? Your School Supply DRUG COMPANY Headquarters Prescription Druggist Phone WE9-5142 WE9-2171 WE9-2682. f IW ? M M 4 , p mmm Z EDERALSAVINGS AND LOAN ASSOCIATION TEL. WE9-3711 114 E. CENTRAL AVE. BELTON. TEXAS CLTENAEIXITS DRUGS 106 E. Central Phone WE9-2771 Compliments of COLETA'S BEAUTY SHOP Phone WE 9-2551 o F A X N Your Dollar Buys More FRED ESTILL MUBIL STATIEIN 24 HDLIR SERVICE - MEIEIL. TIRES REIAD SERVICE - ACCESSORIES Us At Your 5 8: 10 Cent - Store 912 EAST CENTRAL EEQLT'-GN DUKE AND AYRES Belton, Texas CLINE DRUGS Prescription Service Cosmetics - Sporting Goods Gifts 210 Central Avenue Phone WE 9-2154 CENTRAL TEXACO TIRES BATTERIES SERVICE 300 E. CENTRAL PHONE WE 9-3651 Use Our Easy Pay Plan . . . Our compliments to our Ladies, Shoes many friends and customers and in Belton High I Ready-to-Wear Temple, Texas Complete Outfitters I WWIZWZQ PR to men and boys 8-3538 Temple ll E. Central' m -I Drive Car efully! I We need the taxpayers! CITY OF BELTON NORMAN LUMBER COMPANY Bu1lders Suppl1es For Every Need ' PhO1'1e WE 9 5132 P O Box 576 BELTON TEXAS TEMPLE GRANITE WORKS F. S. Walker and F N Walker Gramte and Marble Monuments Bronze Phone PR 3 5220 310 South Maln Temple Texas INTERNATIONAL HARVESTER Sale s and SGIVICC Phone PRospect 8 3648 Temple Texas Located at 1401 South F1rst Street FORD S New 8: Used Furmture 211 N Penelope BUY SELL TRADE Call WE 92531 '9'??'M ' as 2112 In A imc' SUPER SAVE MARKET 210 North Penelope Belton Texas . . H . . I 1 . . J P I N . 3 ' SSI' '. 155651 . I-fx rhhrhr so I ,,,, , - L W' 1 -A -+ P rf I , ' . '. U .gl -X ' f' W?:gv,Iw f w T I ,-I 'W ' --. 3 It ,I , 1 I I -f As...-- tx. , , ,,.5,,,W. .. . - Everything for Your Horne and Car LAW FULWILER, Owner Phone WE9-3632 Belton, Texas SOUTHWESTERN TRANSIT COMPANY Serving Central Texas and Charter Service to All Points in Texas THE BELTON JOURNA Your Hometown Newspaper Serving Belton Since l866 106 W. Central Phone WE 9-3366 L Compliments of SAM , Mu1212AYs REPAIR SHOP Belton, Texas Grain - Hay - Pecans - Poultry DQZZZW FEED 8: PRODUCE CO. J. R. TAYLOR aflfgi-. I-TPI' jg: Phone WE9-2162 J Belton, Texas ' Frosty, E Man Frosty! DR, PEPPER - BOTTLING co. I. :e Temple, Texas TOMECEK MOTOR COMPANY FORD Hlghway 190 West Belton, Texas Telephone WE 9-3708 CEFIZIG-3653 LECQLJ ID IV13E:-JN! 'T INCCTZDCDTZATED IMENTS OF 1 .... - 1...-.I I I L..-l 1 BROWN EXPRESS PROMPT AND coURTEoUs Serving Belton Daily Phone WE 9-2361 COMPLIMENTS TEMPLE DAILY TELEGRAM Compllments MILLER HEIGHTS GROCERY 402 East Avenue O Comphments TEMCO FEED MILLS BARKLEY S STUDIO See Us for All Your Graduat1on Portralts A Spe c1alty 106 N Ma1n Ph WE 9 2742 Sale s and SGTVICG Butane and Propane 6 South lst Street Temple Texas O F of of I Photographic Needs MARY HARDIN BAYLOR COLLEGE Chartered by Republic of Texas 1845 Belton Texas A Texas Baptist Institution BEST WISHES for your FUTURE SUCCESS! P URL I HON XNQXXNEN CUM,D4fw, Manufacture r s of Agri cultural Equipment Flowers are the gifts which make an event a memorable occasion HEARTFIELD FLORIST We Deliver WE 9-3787 415 North Main Flowers For All Occasions TULLOCH BROS. Good Plumbing Is Important Plumbing - Heating Sheet Metal Works Electric Water Systems Phone WE 9-2751 113 South Main WWWMZ C LEANERS Through the Years Our Business Has Grown Through Quality and Service Compliments Of ABSTRACT CO. Established 1876 FRANK J. TURNER, Manager Dependable Service MEANS LUMBER CO. V. R, MEANS, Manager Phone WE9-3745 201 N, Penelope Compliments COCA-COLA BOTTLING CO. of xl TE MPLE I 11,9 I I Ia' I v l I dj 7 A E u? . FARM EQUIPMENT SERVICE J. I. Case and Massey-Ferguson Dealer R. T. Wall, Owner Across From McCloskey Hospital Temple, Texas Phone PR 3-5817 TOM NUNNERY STUDIO 611 North Third Street Temple, Texas Phone PR 8-1272 Photographs that are different Compliments HOWELL TAYLOR GROCERY FRANK'S LAKEVIEW INN Belton Lake WE 9 5221 MINIMAX MINIMUM PRICE MAXIMUM QUALIT Y 204 N East St Belton Texas C omplime nts CLOUD CONSTRUCTION CO INC 14 West Adams Temple Texas B 81M CAFE Temple Texas r and Mrs Bennie Mueller Our Specialty Seafoods and Steaks JENKINS WHATLEY CO Allis Chalmers Oliver New Holland Roto Cycle Dealer We appreciate your business of of C, Q 113 S. Main 205-7 S. Main M . . ' - Personal Hair Styling Complete Beauty Service A1r Conditioned ' AGNES BEAUTY SHOP Our pleasure is your satisfaction Evening Appointments Agnes Johnson Owner WE 9 3627 New and Used Cars All Makes Highway 190 West Belton Texas WE 9 5821 GRADY TINDLE TINDLE AUTO SALES 2nd Location 1414S lst Temple PR 8 1221 Quality Groceries Q! WMMZK GROCERY 8: MARKET EDDIE SASKI CENTRAL HEATING PLUMBING Kr SHEET METAL 126 N East St Phone WE 9 2621 Belton Texas I Powsu. 'I1'g.',Y5 suPPl.Y G E Appliances Goodyear Tires f 121 North Main Belton Texas Sheet Metal MAXFIELD S 519 South Main Temple Texas Phone PR 3 4470 MAIN FOOD STORE Openfrom7am tollpm Complete Lme of Groceries Sundries Fishing Supplies Sporting Goods LOCATED AT MAIN 8: 6th STREET TYPEWRITERS ADDING MACHINES CASH REGISTERS JUHNNIES UFFIEE MACHINE EU SALES SERVICE SUPPLIES II EAST AVENUE A JOHN GUILLEN PR 9 7505 TEMPLE 'rExAs . . . , , II ' ' ' II -I ' - . St. Heating-Air Conditioning- l CO. i . . I, - ' , I OWNER h -- Prerrnurn Brand TEXAS ROCKWOOL DIVISION Arner1can Gypsum Co Manufacturers of Mlneral Wool Products Belton Texas WEbster 9 3775 P O Box 184 World's Largest Independent Rock Wool Manufacturers PLANT LOCATIONS Belton Texas Denver Colo Fontana Cal1f Pueblo Colo f J ' - . 4. 4. J. J, 4. sl. J, 4, J. 4. 4. J. J, 4, fp fp ,P qs ,P ,P ,P ,P ,P fp ,P -P -P ,P 4. ,P . . . ' 3 7 1 0 3 1 u 3 9 Q 1 Congratulations To Belton High School Graduating Class of 1964 Choose TEMPLE JUNIOR COLLEGE As Your College Campus for September, 1964 TEMPLE JUN OR COLLEGE 2600 South FITSL Street Temple, Texas AMERICAN DESK MANUFACTURING COMPANY T mple, T ED :FT-'l2!ANl4l.HXI FLOOR SERVICE Sanding Formica Cabinet Tops Floor Coverings Linoleum Asphalt Tile - Rubber Tile Phone WE9-2424 802 N. Pearl Belton glfllflltllfldld f 0 POTTS BROS. HARDWARE HARDWARE, PAINTS APPLIANCES SPORTING GOODS and TV Phone WE 9-2211 UMMZMQ A COMPLETE DEPARTMENT STORE QUALITY HIGHER THAN PRICE Compliments 0,5-eV,,- of ii i A HOME at BELTQN ' ' AUTO SUPPLY CHAMBER OF COMMERCE E . I . 5 102 East Central id-Q60 Rfii A-2 1-Tri' :Sir-fr ' ' Phone WE9-3781 R S . . 'Rig Belton, Texas Cornplnfne nts of BUTCH'S BURGER BAR 702 East Central BELTONIAN THEATRE The F1ne st ln Enterta1nment Owner 206 E Central Fred Srn1th Always FIISE Quallty BEN NEUMAN FAMILY DEPARTMENT STORE 2 I ' ' I I l 1 l GREAT SPOT for a sales meeting, convention, family reunion, or personal holiday! Try the de- licious fare, the lux- urious tranquility of INN On Interstate 35 at Salado, Texas Call Harry Lane: AC 817 W1 7-2811 RIVER FOREST JOHNSON S MOTEL AND RESTAURANT Clothes for Men and Young Men Ladies Sportswear NEWEST AND FINEST Temple, Texas Belton, Texas Telephone WE 9-5711 Box 506 CONTINUOUS SERVICE SINCE 1907 f 1 P NATIONAL BANK MEMBER FEDERAL DEPOSIT INSURANCE CORPORATION BELTON, TEXAS UQQQH fr cally for 0 ly SI so to Q M Km -d,,,,.....A-. A S2 25 a monih X IT S MODERN IT S CLEAN IT S SAFE IT S ECONOMI CAL you can cook elec TEXAS POWER 8 LIGHT COMPANY DAIRY QUEEN 5OZE Central Belton WE 9-5021 LAW INSURANCE AGENCY ALL LINES OF INSURANCE AND BONDS In Mvmrfriam John F. Kennedy 1917 - 1963 John F. Kennedy is dead! Perhaps the greatest man of these troubled times has succumbed to the bullet of a Texas assassin. My God, my God! What man is this that would murder our President, the man who has led us through this period of hate and fear. God, you know the toil and strife I feel when I hear these words. My mind feels foul and filthy when I think of this man's death. So dear to me is this man, that I feel toward him as son to fatherg a love that cannot be explained through words, only through feeling. I This man, dear God, whoever he is, thinks himself godly enough to take our dear Kennedy from us--how can lfeel pity tow ard him? I feel hate, dear God, and can only ask your forgiveness for such a feeling. The bells ring, the flags fly at half- mast, but these things are so material! I feel as if the only appropriate place for me is upon my knees. Oh God, this feeling of strife hurts me inside. Please recognize the entrance of that dear soul into your domain. In martyrdom he shall be established as a man so loved that perhaps God Himself weeps at his passing. Written: 2:00 p.m, Harvey Phillips November 22, 1963 Senior Class of 1964 VV! ALTUM, BONNIE Band 3g FHA 2g SLC 3, President lg JCL lg Volley- ball 3g Baylor Olympics 3 BAGGETT, SHARON FHA 3g Beaker Breakers 1 BISHOP, CHARLENE FTA 1 BOLTON, BEVERLY FHA 2, Historian lg Beaker Breakers lg Pep Squad 2g Office Girl lg Tiger Staff 2, Managing Editor lg lnterscholastic League BOWMAN, DIAN NHS 3g Beaker Breakers lg FHA 2g La Junta 3g Medical Club 3, Secretary lg FTA 3, Officer 2g Pep Squad 3, Officer 2g SLC lg Citizen of the Month BOYD, WILLIAM FFA lg Beaker Breakers lg La Junta 2 BROWN, TIM Beaker Breakers lg Football lg Baseball lg La Junta 2g Library Assistant 2g Perfect Attendance Award BRYAN, KAY Annual staff 4, Editor lg FHA 3, Officer lg Junior Duchess lg Lariets lg BETA Club 2g La Junta 2g GRA 1, Officer lg Pep Squad lg Volleyball lg Ten- nis Club lg Baylor Olympics BUSBY, GARY Beaker Breakers 2g Manager Football Team 3 BYRD, GIRARD Beaker Breakers 3g Band 4g JCL 1 eninr CASTLEBERRY, DIANE Pep Squad 3g Beaker Breakers 2g FHA lg Medical Club lg La Junta lg Head Cheerleader lg Meet the Elite CAWTHON, ION FFA 2g Football lg Medical Club lg FTA 1 CHANEY, LARRY Football 1, Manager lg Basketball 4g La Junta 3g Tiger Staff 1, Sports Editor CLABURN, IUANITA Class Vice Pres. 2g Miss BJHg Best All-Aroundg NHS 4, Secretary lg Student Council 4g Annual Staff lg Pep Squad 3g B Honor Awardg La Junta 2, Officer 2g Class Secretaryg Citizenship, Who's Whog Inter- scholastic League Typingg Choir 2, Regional lg Cheerleader lg Girl's Stateg Queen of Sports CLINTON, GLENA FHA 3, Officer lg Beaker Breakers lg La Junta lg Pep Squad 4, Officer lg Lair Staff l COPELAND, JOHNNY Beaker Breakers 2g La Junta 3g Basketball lg Senior Play COPPIN, ANTHONY Class President 2g Class Treasurer lg Student Coun- cil 3, President lg Football lg Basketball 3g Track 3g NHS 4g Mr. BJH: B Honor Award 3g FTA lg Slide Rule 2, Third in District lg La Junta 2, Par- liamentarian 1 CROWELL, EVON NHS 3g FHA lg Annual Staff Editor lg La Junta 2g Beaker Breakers lg Office Staff lg Interscholastic League, persuasive speakerg Stud ent Director of Senior Play cfivifies CULP, ANNA MARIE FHA 25 Rep Squad lg Tiger Staff 1 DANIEL, PATRICIA Beaker Breakers 15 German Club 15 FHA 15 Tiger Staff DAVIS, ALAN NHS 15 Choir 45 Beaker Breakers 35 La Junta 35 Boys State DEVINE, BOB Beaker Breakers 15 La Junta 3 DRAKE, ALAN FFA 45 Beaker Breakers 35 Librarian 1 DUNLAP, ROYAL Band 4, Tri-City 15 Beaker Breakers 45 Basketball 25 La Junta 1 EDENBURN, JACK Beaker Breakers 25 La Junta 25 Baseball 35 NHS 2 ERVIN, BRENDA FHA 25 Beaker Breakers 25 Volleyball 35 SLC 3, Officer 15 Counselor's Office5 Baylor Olympics 2 FAGLIE, JAMES Football 35 Basketball 35 Track 2 FAULK, BOBBY Football 25 Track 1 FOOTE, MIKE Football 25 DE Club l FORBES, ERNEST FFA 2 FORD, GAY FHA 25 Beaker Breakers 15 Medical Club 25 La Junta 2 FORRESTER, JUDY Student Council 25 Pep Squad 25 Beaker Breakers 25 FHA 2, Officer 15 La Junta 25 FTA 3, Treasurer 1, President 15 SLC 15 Interscholastic League Typ- ing 1 FRANCIS, LURA FHA 25 Medical Club lg lnterscholastic League 15 DE Club 1 GIBBS, MICHAEL Band 25 Debate 35 JCL 1 HAIRE, LARRY GENE FFA 35 Beaker Breakers 15 La Junta 25 Track 2 HANNON, GARY Football 45 Basketball 45 Track 35 Baseball 35 Class Favorite 35 Class Vice Presidentg Class President5 Student Council 2, Treasurer 15 Mr. BHS HARMON, JOE FFA 15 La Junta 2 HAWK, LINDA Y-Teens 15 Pep Squad 15 FHA 15 DE Club lg FTA 1 HEARTFIELD, JERRY Beaker Breakers 35 Band 4, Tri-City lg La Junta 25 Golf Team 2 HEATON, CATHY Literature Club 25 JCL 15 Pep Club 15 Medical Club 1 HEBERT, RONNY FFA 2, Officer 25 Football 25 Basketball 15 Track 35 Student Council 15 Beaker Breakers 15 La Junta 2 HENDRICKS, NITA FHA 45 Beaker Breakers 45 Pep Squad 45 SLC 35 Medical Club 35 Volleyball 3 HOOD, TROY Football 45 Baseball 35 Basketball 15 FFA 3 HOSCH, ROY Beaker Breakers 15 La Junta 2 HUEY, WALTER Student Council 15 Track 25 Football 35 Basketball 45 Baseball 25 NHS 25 Beaker Breakers 15 La Junta 2 INMAN, JOSEPH All Regional Band 35 All State Band 45 Alternate 2, Solo and Ensemble winner at Regional 45 Tri-City Band 35 National Music Camp 25 Student Conductor 25 Choir 2, All regional 15 Beaker Breakers 1, Of- ficer 15 Student Council 2, Treasurer 15 Football 15 NHS 25 Prose District Winner, Second at areag Best Supporting Actor at District and Area5 One Act Playg Poetry Reading5 FTA 2, Treasurer 15 JCL 1, Vice President 15 Senior Play JACKSON, DON Football 25 Basketball 25 Track 25 Beaker Breakers 25 Student Council 15 La Junta 25 DE Club 2, Vice President 15 Favorite 1 JENKINS, BETTY FHA lg La Junta 25 FTA 2 JOHNSON, MARGARET Pep Squad 45 FHA 35 Beaker Breakers 1 JOHNSON, PATRICIA FHA 35 Beaker Breakers 15 Pep Squad 25 Tiger Staff 1 euivr KINNEY, DOROTHY Beaker Breakers 15 FHA 25 La Junta 35 NHS 35 Medical Club 15 SLC 3, Vice President lg Pep Squad 45 Tennis Club 35 District Tennis 35 Inter- scholastic League Typing 15 Baylor Olympics 35 Lair Staff 2 KIRKLEY, DAN Band 4, Trombone Sweetheart 15 Beaker Breakers 3, Vice President 15 Medical Club 35 La Junta 25 .TCL 15 Golf Team 35 Lair Staff 35 Debate Team 2 LANGSTON, ELLETT Choir 45 La Junta 2 LANHAM, TOMMY Band 4, Tri-City 3, Officer 1, Captain 15 Beaker Breakers 35 Medical Club 25 La Junta 2, King 15 Class President 15 Class Vice President lg Student Council 25 Neatest Boy5 Number Sense 15 Boy's State5 Golf 25 Tennis 25 Band Directors Awardg B Honor Award LAWSON, ROY FFA 25 Beaker Breakers 25 DE Club 2 LEE, LAURA Beaker Breakers 25 Cheerleader lg La Junta 3, Of- ficer 15 Medical Club 35 Pep Squad 35 SLC 2, Of- ficer lg Student Council 2 LEMMONS, LARRY La Junta 15 DE Club 2 LIPSCOMB, ,TEANETTE Pep Squad 4, Officer 25 Beaker Breakers 25 FHA 4, Officer 25 Annual Staff 15 SLC 3, Officer 15 Medi- cal Club5 JCL 15 Student Council 15 Tennis 35 Baylor Olympics 2 Activities LOCKETT, CHARLES DE Club 2 LONG, BILL Band 4g Football lg Medical Club 3g La Junta lg JCL l, Treasurer lg NHS 2, Vice President lg Beaker Breakers 4, President lg Senior Play MADDEN, LINDA NHS lg Student Council lg FHA 3g Paper Staff lg Band 4g La Junta 3, Officer lg Medical Club l, Officer l MAULDIN, BYRON Student Council lg Football 2g Basketball 3g Band 4g Beaker Breakers 3g La Junta 2g Paper Staff l MAY, DAVID FFA 1 MCDANIEL, DAVID Football lg DE Club 2 MCLAUGHLIN, DARLYNN Pep Squad 4, Vice President lg FTA 2g JCL lg SLC 2g FHA lg Medical Club l MILLIAN, CHARLOTTE FHA 4g NHS lg Beaker Breakers lg Office Assistant lg Pep Squad 4g SLC 2g La Junta 3g Medical Club 3g Volleyball lg Lair Staff l MILLS, DON Beaker Breakers 3g La Junta 3 MITCHELL, CHARLIE Beaker Breakers 2g FFA 3g FTA lg La Junta l MORIN, RACHEL FHA lg Pep Squad lg La Junta 3 MURRAH, LOWELL Basketball 4g Tennis 2g JCL l OLDHAM, RONNIE Annual Staff lg DE Club 1 OTTE, SHIRLEY Beaker Breakers 2g FHA 3, Public Relations Officer lg Pep Squad 4g Medical Club 2g SLC 3g La Junta 2g DE Club l, President l PARKER, JAMES Beaker Breakers l, President lg NHS 4, Treasurer l, President lg Basketball 4g Track 3g Student Council 3, Parliamentarian l, Vice President lg UIL Number Sense, Third in District lg Who's Who in Scholarship 3g Most Courteous Boy, Jr. High Scholarship ping Class Treasurer lg Class Parlia- mentarian lg La Junta 2, Award lg Boy's Stateg Undergraduate Scholarship Awardg NHS Scholarship pin for Juniorsg B Honor Awardg Choir l PARKER, VICKIE Band 4, Officer lg FHA 3, Officer lg NHS lg Beaker Breakers 2g FTA 2g Choir 2, All-Regional lg Medi- cal Club lg Class Officer lg Most Considerate girl l PARROTT, IOYCELYN FTA 3g FHA 3, Historian lg SLC lg Pep Squad 2g Volleyball 3g La Junta lg Lair Staff 2, Editor lg Baylor Olympics l PHILLIPS, HARVEY Band 4g Beaker Breakers 2g La Junta 2g FFA Officer lg Interscholastic League Poetry, Interscholastic League Proseg One Act Playg Senior Playg Choir POTH, PHILLIP Debate 2g Track 2g Persuasive Speakingg JCL l REED, CONNIE La Junta 2g Volleyball Team Manager 2g Beaker Breakers lg Medical Club lg Tiger Staff l REINKE, KAREN Beaker Breakers 2, Officer lg Annual Staff lg Pep Squad 4, Officer 2g SLC 3, Officer lg Tigerbelles 3, Officer lg FHA lg La Junta 3, Officer lg Med- ical Club 2g FTA 2g Counselor's Office 2 RENTERIA, GENE La Junta 3g DE Club 2 RHOADES, PATSY FHA lg Beaker Breakers 2g Medical Club 3g La Junta lg Pep Squad 2g Office Girl RICHARDSON, SUSAN Band 4, Majorette 2, Tri-City 2, Second All- Regional Band l, Band Sweetheartg NHS 3g Stu- dent Council lg La Junta lg Beaker Breakers 2g FHA 2g FTA 3g Officer lg Medical Club l, Offi- cer lg Interscholastic League lg Class Officer 2g Tiger Staff lg Choir l RICHTER, JANE Student Council lg Band 4g Reporter of Class lg Historian of Class lg Parliamentarian of Class lg Medical Club 3g La Junta 3, President lg NHS 2, Treasurer lg Most Artistic Girlg Citizen of the Month ROBERTS, KENNETH Football 2g Beaker Breakers lg FFA 2 RODRIQUEZ., ROBERT Football 2, Manager lg Track Manager lg Beaker Breakers lg FFA 2 ROSENBUSCH, CHARLES FFA 2, Vice President lg Freshman Playg Basket- ball lg Track l Smmr ROSS, JAMES . Football 4g Track 3g La Junta 2g Medical Club lg FFA l, Officer l RowE, ROBERT FFA 2g DE Club 1 SALAZAR, VICTOR Athletic Boy 3g Footb all 4g Basketball 4g Mr. Personality l SCHMIDT, CONNIE Pep Squad 4g Beaker Breakers 2g FHA 2g SLC 3, Officer lg Medical Club 2g Tigerbelles 2, Co- Captain lg Volleyball 3g DE Club SEWELL, ANNE Miss Personality lg Scholarship lg NHS 4, Secre- tary lg Student Council 4, President l, Secretary lg FHA 3, Treasurer lg Beaker Breakers 2g Band 4, Tri-City l, Majorette 4g FTA 3g La Junta 2g Who's Who lg Class Favorite 2g B Honor Award 2g Medical Club lg Secretary of Class lg Chorus lg Operetta lg Girl's Stateg Miss BHS SHANNON, JERRY Football 3g Beaker Breakers 2g La Junta 3g Track 3 SHULER, CAROLYN FHA 2g Beaker Breakers lg Pep Squad 2g La Junta 3g Volleyball 2g SLC lg FTA lg DE Club lg Lair Staff l SMITH, TOMMY Football 4g Baseball 2g Basketball lg La Junta 3g Beaker Breakers l STECK, BARBARA NHS lg Beaker Breakers 2g FHA 2, Historian lg Office girl lg Counselor's Officeg Pep Squad 3g SLC 3g FTA 2g La Junta 3g Senior Class Reporterg JCL lg Medical Club 2, President lg Tiger Staff- Assistant Editor l, Editor l Acfivifics STONE, CLINTON La Junta 2g DE Club 2 STREET, JO FHA lg Beaker Breakers lg Tigerbelles 3, Cap- tain lg Medical Club 2g Choir TARRANT, SUSAN Class Favorite 2g Co-editor Paper lg Beaker Breakers 2, Vice President lg FHA 3, Parliamen- tarian 1, Vice President 1, President 1, Parlia- mentarian District FHA lg NHS lg Band 4, Li- brarian lg Student Council 3, Secretary lg La Junta 3, Sweetheart lg FTA 3, Parliamentarian lg Tennis Team 2g Cheerleader lg Girl's Stateg Interscholastic League extemp. lg Operettag Senior Play THOMPSON, BEVERLEY FHA lg Volleyball lg Beaker Breakers lg Tennis lg Student Council 2g DE Club 1, Officer lg Tiger Staff lg Literary Events, Baylor TOMME, BOBBY FFA lg Track 2g La Junta 2 TREVJNO, FRANCES Beaker Breakers lg FHA lg La Junta 3g Journal- ism, Reporter TREVINO, SARAH Beaker Breakers lg Pep Squad 3g La Junta 3g FHA 2g SLC lg Lair staff 1 TUTEN, EARL Debate Team lg La Junta lg Senior Play VICKERS, JOHNNIE La Junta l WARDLOW, JAMES Beaker Breakers lg Football 4g La Junta 2 WASHBURN, FRED Beaker Breakers lg La Junta 2 WHARTON, PRICE FFA 3, Officer lg Beaker Breakers 2g DE l WILLIAMS, JANICE FHA 2g La Junta lg Pep Squad lg SLC l WILSON, CAROL FHA 3, Officer lg Beaker Breakers 2g Pep Squad 3: Tiger Staff l WILSON, BUTCH Basketball 2 WILSON, CINDY White Ties l g Secretary of Horneroorng J aspers lg FHA l WINKLER, RODNEY Beaker Breakers lg Football 4g Baseball 3g La Junta 3 woob, KAY Medical Club 3g Pep Squad 2g DE Club l YORK, JACK Beaker Breakers lg Football 2g FFA 2g Track lg Basketball lg La Junta l FHA lg Beaker Breakers lg Pep Squad 3g SLC 2g flufvgraphs


Suggestions in the Belton High School - Lair Yearbook (Belton, TX) collection:

Belton High School - Lair Yearbook (Belton, TX) online collection, 1945 Edition, Page 1

1945

Belton High School - Lair Yearbook (Belton, TX) online collection, 1956 Edition, Page 1

1956

Belton High School - Lair Yearbook (Belton, TX) online collection, 1957 Edition, Page 1

1957

Belton High School - Lair Yearbook (Belton, TX) online collection, 1965 Edition, Page 1

1965

Belton High School - Lair Yearbook (Belton, TX) online collection, 1966 Edition, Page 1

1966

Belton High School - Lair Yearbook (Belton, TX) online collection, 1967 Edition, Page 1

1967


Searching for more yearbooks in Texas?
Try looking in the e-Yearbook.com online Texas yearbook catalog.



1985 Edition online 1970 Edition online 1972 Edition online 1965 Edition online 1983 Edition online 1983 Edition online
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.