Augusta Military Academy - Recall Yearbook (Fort Defiance, VA)
- Class of 1926
Page 1 of 214
Cover
Pages 6 - 7
Pages 10 - 11
Pages 14 - 15
Pages 8 - 9
Pages 12 - 13
Pages 16 - 17
Text from Pages 1 - 214 of the 1926 volume:
“
,JJ J J KJ 9 'B 6 dbkx 9' SW XQ l xxx E KXHX M K X 'UWQQ ll X x 1 wmv ' was MWW 2.Q- I-gg, af 1 X f ' X FF ' ' f' 1 ., KX, N I ff NN Y :Akai XE X- Nfl vb-. v, XMyF . ' '-M -'bfi2 ' Nhilsf-W- ' -. mf ,gm MMF I .xx1gVIW'Ei7-wx, xxxfxi-, W xx ' x'.'l-'QA g XX? X F. M 1 IG- f A -1--1' ',.,-f,T-T-,I fx,-. I -- W 4, 'y If .. S 5 2 2-' 4 E ge 5 5 5 E ?s ?: E 3 5 2 2: E 2: gl 2: E E E E3 E E 3: 5 vAv4p'AVAYA'i'AFAVA ' , . 4 W7 ' V l V A LvVA'A'.'AA AA. A wwv , vmmf-vAvmvwMNfVAVNA A AWW MMA , iz' , A-'V' 'L ' Xxxxxf 4 I Q Z R Qi 4 W 4 Q X Q Q f 3 2- 4 f Q Q Q Q , Q '2 Q if Q - 3 4 Z 3 . 4 'U . ' Q 2 ,,,,ff Q ff J + 3 i , 'ii Q vvgfnv-wAvnfAVAf4i?A9kwsfmn'AV4YfA ' - 'vvA-NAA T' i 3 I .wkQAmYAYAYAYnVAVA V47'5'W9VRAYWAVNA Af 'ljifx AJ 4 4, ' ' W - ,--- ' , ..... .... .- nrun-mlmxnin v f- ' ' 1 v 4 1 ,P ' ,K ,v . e.- 'L Q . JA, ' 'Y' U W ' .Z ' 3 , H3 s ,Q 1' ,lstlw V .Q . -, '9-D 3 M, ' ' fx +o' 4 - A Qui'-s-.1 i'. 1' bo 5 Nm' i- 13:65 'QQ f 4- 'L iw- ,- 543-:vi ' Va - w ' 4. V in 'P NTU' VAVAVAV4'XVAVAVAWQVAWVNAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVQ 'Ju y 31 fan X nausea, tary, v 1 5 Lf THE. RECALL QI -nm, Z 3 w Ex' 2. 'Q 5,5 f' 'W fb 0 1 f 3 5 mg F 1 7 1' X I r ls 4 ll' av . T'g!p . C W v K VbhunePHW' 1926 gym. R P ASTRA PIR 9 ASPIRA A' X r 1 I 8 7 A- Publzsbed by the V Cadet Corps of Augusta Military Academy ' 1.-W vm 1 -. 'deg Q W F off Defiance, Uirginia f -f- -f W 5 Q' ' wdQ gl X 1 . 5' ZA?lxWK NAYAVINMlR AV1RfAMYAVAYAVAYAVAVAYAYAYAVAYNAVAVAVAVAVNNAYAVA'NMA 3 5 5 5 S 5 e E 5 S S 5 s S f 5 s 5 s ,wt .6 F W it 4.95 Fl up 1 T i a v u AFA A b - .FJ . ., t LJ N . Q A . Q ? is l 'fg ' f f' ff ' Q a w w fffl,!.,!!1'3+'1f'wHH'm'ff'f'a3 4 E 51' Ijl, .' I J .......... 1 ............ .............. ....................... . . . ....... -....-W . ig,,nQLg:M uf: 3 mwgwkf,+wf - 4' . ' + 'Q,i'e . nw . , 1- r. , J ff ., ' , , . ' ,5 5 .ALM Q r ,pq A iq' I: .,-:L--Q, :. 'VN i - p R- I'-'I E E is Q , :',q.'7l'EvI 2... V.. W U U N E Fir. - N ' +4 I I 7 'A 1 'L 5 In . 4 ... n ' x '. 1 ' N ' 5 sw, . M f . N 4 ,g, M N 2 9 - Q QQ- 6. ' J' Q' 3 f' ' Q 4 i 7 ' ' . b 5 E lm f 1' 1 7 . 5 I . 5 in 4 , . N 4 b m- 7 . 2 ri . M S n . , . ' Y f 5- ' A A ' . X5 7 S t . 5 Q A , 'K A 3'1 A9 'Zig NX 4 s. f.,,.3,'., A' ' 5:1 ,LQ 2 , I 5 lf , Q 2- , . 5 yxlzil' 935, 2 Q , ' , :HM ,vi-ff' J I - I . ' 'El f ' 4 V W ' ' NH- 7 I' . ' 1 Q ' Q ' I 4 I . m .. 5 ' Q - ,, f . 5 .M - ' h 4, - C , 5 ' P-. 5 :A-1 x 5 if - - ' f ' 4 A .U V 5 v 4 4 ' J . F ' ' ' HL ., ,f WAY'YAVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVQ ? VAVAVAVAVAVAV j Q 'I -......... ...-.---.-.n .0 . nu.. ...N . ............-................ ..... qs- 1 . U.. . . . WL 'ww' inn- uuua o. l In ' . X Ll B1 H Q3 A 1 N H VAVAVAVAVWVAVAVAVA ,wr- x X 5 X S . X, Y Sf...-N r w d 'E X X mi? xt 1- 2 I X -' :Yi E! : : 55 25 V Eng I 5 7 5 E E E a E K 5 lf N ll l 4 l 2 3: 5 5 4 2 2 3 5 N N W4 X XX VA xx Z f 1 Q x Z 7 7 Sf l 2 lk M l A A l N VAVAVAVAVAVAW-VAVAVAVAVAVAVAVNAVAVAVAVAVAVAVAVAVAVAA'NAWQA If this RECALL shall serve in future I S I I years to hrihg back to us the pleasures, E Joys and sorrows of the past year at Hugusfa It w1ll have fulfilled 1tS PUFPOS2 52 1 V 4 E . l l 2 E ' ' 3: 2 l h 2 . Z: ' . E E a , Q 2 r E . E 2 .. E 2 21 2 s 4 ll W E 3 QS? fs in QQ 2 4 ' . MAVNMNAVNAVAVAVIRVAVAVAVAYAVAVAVAVAVAVAVAVAVNVAVAVAVAVAYIYAVAVAYP'IFR?ll'lg W H , , . gvgg.WVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVQ VAVNNAVAVAWVAVAVAAVAVAVAVAVAVAVAVAVAVAVAVNAVAWW VAWVAVAWVAVAVAVAV-VAVAVAVAVAVAVAVAYAVAV Yk X x N H-,N m thxm Q KV Ac1rq1n1str'a'c1on M111tary Or' an1za.t1ons A'ch1e1:1cs Social 1 ' 4 i 2 J 5 5 5 Humor' Q E Direciizory Q 5 E E E 2 if 5 S W W 4 4 3 3 Q9 Q 59 QQ gg 4 Qgqtqgf,yyAvNAqyAv1gJAq,vAvAvAvAvAvAvAVAYAYAVAYAVAVAVAVAVAYN'AVAVAVA'R'ti'NKi Q ' ........ .... Q .......... Q .........................,..... b E , F , 5- 5, 'N W.. ................................................. ........ -...-N Ku R-' wig ...By .,,,,,,3f ,sf - y X all 'iuw!I-lml?.mm9'. X C, ........................ I IE.,-, I ,, ,,,, Tx . S lm J' . . Qi , 5 5 I 'f ' fi, N ' f bk S g r ' ' 5 E 2 ' f . N Q N 4 , f ' N 2 4 Q, , - F K f,,, f, ,, ,A A , A 7 ' f K 4 . ! ' 4 ,Q + 4 f m E i 2 '53 3 , + A 4: 54 A I ' ' 4 Q E . ' 2 . . . ' 2 , Q x A 3 . F 1 . S . AVANAVNAVAVAVAWVAVAVAVAVAVAVAVNAVAYAVAWVAVAVNAWVAW NAWVAVAVAVAVAVAVAVNAVAVAVAVAVAVAVNAVAV mxxxvax X iurierv lull 57781, lm c iwxlm' Q k 'I W W TI-IE RECALL of 1926 15 respectfully dedicated to CAPTAIN JCI-IN C SANDLIN U S A commander this unit Reserve Officers Training Corps for the past four years and Professor of Military Science and Tactics A veteran of' the Worlds War he 1S keen alert and a Qressive By his infectious enthusiasm for military his knowledge p of tactics and facultyof' imparting it to others, by ' his energy and perseverance, he has caused. the i Hugusfa Military Ecademy to be rated as one of the A ten Honor Schools of the United States. He is a Corps of Cadets accompany him to his new post. ' 3 5 ? 4 2 3 Real Soldier. The best wishes and esteem of the E E 2 7 S 5 4 1 if ' W , . r 3 5 s 5 s 5 5 2 , 55? as w fi? 4 , WAVEIYIVIVINAVRVAVIWAVAVAVAVAVAYAVAVAYAYAYAVAVIVAVAVAYAVAVK'IYAVAVAVRYVK'Ki SVAWWVAVAVAVAVAWVAWVAVAVAVAVAVNAVAVXVAWXVAVAVAVAVAVAVAVAVAVAVAVAVAVAVA lt 4 s G , ,.......... ........... .... . .. .................. ...M ..... ......... . 4 pm 'Y-p!::2!.':2!:!l1:f:y5ll!!!LlZ !!!!!!'. -'!!H!!!lS1?:!!?!1l!!!l!!!-1!!!'3,: 3 1 'ggmnwvmgwf N JR ................ ....... . . ....... ........... . ........................................ w ' Ln -' ?:,,,,Lf'g3.w!!!!q!gT.,'f F 5 at J' - Q4 5 f s 3 g 2 z Q i i i f. ' ln l g 1 N E f . N 2 f . V . y s Q N t 4 9 4 ff W W J K , Z . Z Z 7 f f 4 f ' Q 3 f y S S f cc 19 . . N 4 f i 2 ' . , . . ., , - 1 i . . , . . K I l 4 5 l V Lin ' r ' 4 ., . . . s . y 1 .171 MAJUR J. C. SANIJLIN v o , I ' Q I ga-xmAvAvAvAvAvA VAWVAVA AVAIA ...Q , AvMmvAvAvAvAvAvAvAv vAvAvAvfvAvf 4 f 4 AVAVAVAVAVAVAVAVAVAVAVAVAVAVAVA7AVAV SW X K V X , g s X I, Wu I' mn A X NW nrrrrzru. . rni11nrzx3'umux1r:n1:1zrn., urn - .. .... ........., . . r 'I ,I kg . qmqun H W gp lm Q i 3 W bw 7 E 5 S E , E 2 Q 5 N 3 1 N 'f l s 4 K N 5 E f X Q f' N Q 4 E f 5 2 A N Q 5 4 2 E Z1 Y N, f s N 1 AVAVANNNAWRV i 4 1 ? 5 if 4 if Q - 4 3 G :S S 5 5 5 S 4 f 2 3 E 4 + 2 E f 2 5 2 if E 4 4 3 if 4 THE Comms 4 E 3 G-Z3f'ff.f.'f m lf ' Q. g 1f '' 'ff.1flIQ1',Lf.QlQ7 n-'AM Q, H E 4 A 5 5, . Q I VAVNNN VNAVRVAV VIRVAVAVAYAVAVAVAVAVAYAYAVAYIFAVAVAVAVAYIFAVAVAVIK'IYAVNKi V V V V V V V V V V V V V V VAVAVAVAV VAV VAVAVAV VAVAV VAVAVAVAV VAVAV W vwrisyw 5, f ' fiwxem xl' . AdmIrIstr'at1on COLONEL T J ROLLER Prmczpal MAJOR C S ROLLER JR Commandaut MAJOR H A JACOB Asszstant C ommandaut MAJOR J C SANDLIN Profesaor of Mzlztary Sczence and Tactuxs CAPTAINW MCC YARBROUGII Post Adjutant DOCTOR W C ROLLLR Post Surgeon CAPTAIN W S ROBINSON Asszstant to the Pnnczpa IXLV J M MCBRIDE Chaplam CAPTAIN N PARKINS CAPTAINJ C GALLAOIILR CAPTAIN G II STARNLQ CAPTAIN H D. DLANE . CAPTAIN W. B. WEBB CAPTAIN W. P. GOOCI-I J f CAPTAIN S. N. MCDOWELL A ,. ' H CAPTAIN R. E. GLIINDY . 1 f , , I CAPTAIN C. K. BROWN I A MAJOR E. S. YATES ' . I - CAPTAIN E. L. OTT CAPTAIN J. R. ERNEST A I 7 E 2 S f 7 S I I f S 5 S 6 E .LIEUTENANT WILLIAM KENNEDY V E X Q Q Q Z 2 Q F1 Z R 2 2 Q Z Q R Q Z 3 II FT' lL E 'b 5 f 3 QS? Q I 22 4 - . MAVNAYNAVAYAYNAVN VAVAVAYAYAVAVAYAYAYAYAYAVAVAYAVAVAVAYNAVAYAYAY'VIVA'Kg gA.AAVAAAAAAAA.AAAA A .A A 'A A . A4 5 I my ,,,,,,,,,,,,, , ,.,,,.......................... .............. . .- ..... ......... .....,,, , 2 F G I... 4 ' - lqohnm -.l.!, 9 .'5!,2.:i' N cf 2 -.....................................--------------------.----------.............. - . . . -3 in - Elm ,mm X G 5 A M19 , . 4.12 9 I Q 4 4 I .2 P b ! 'f P IN 4 , 5 JA f . s Q V J ' 1 . . ..... . . . I ....... ' ' N f f . . A . V if 5 4 . . , . .... ............ f z Q - . I I I 5 3 f ' . . ..... . ...... . ....... I E 5 - I . . ......... ..... - ' ' - E 4 I J Q I f . . ..... ..... . .. . .... - A 4 9 I f I Z: 1 I+ r D f . , bf .......... . , . ...... . . . .. 4 4 J . A - ' Q1 5 'Z I - . - 5 Q l - . . ...... . - V - 1 4 g, I. . . . .............. .... K. . .......... Q. 5 A I I s I ' A 4 . ' E s ' I 2 I A A 2 g ' E s ' 2 4 E .MA r , , vw 14 f - My -. ,An f 1 f f I ' 1 ', ,', -. X 1 ' .. in, ' Q' .Lf,i,,, N ... , ride lf , I -1 In , 1-, ' .5 in V7 , Q Rf-,AQ-Ll ,451 ,',j-W 1 vw-'p.,1 , iv yflyfxvf Y E QQ H 2 1 1 af 5-li 5 , I Q ffl, . , ii f H 1 . . W E 1 I X: I 1 1 + f U 2 1 I as 5 xg 2 1 i 3' 1 l fa I Q U 2 I E if 3 X 5 1,5 X 5 2 'sr E z 1 i S vl 1 I 5 ,H 1 5 li 5 5 1 ef si J 5' 5 5 - N 1 x A 1 . ' ' 5 1 22 s 2 4 , I 4 if 2 2 3 ' i , i V 1 E 3 5 2 5 ' 1 1 y X 5 , . 1 5 ! , I . ' I . 1 S Q i 3 Q 5 . X 1 5 W R 5 2 i' 2 Q I E 1 11 1 il I s 5 E fUl.0NIEl. ANU RIA-IOR R0l.I.IiIl , 5 i ... A 1'-, fi.. I ' - W- - ' 1 i 1 ,. Q,s.z- :f,- 1, , ff, ffifjl Tiff, QIQ.,,,1':ff1Q Ce! 'k Q'ffQfL,1QLAi2Jifif . ' c if . 1-N . v4'-1 f C' ki 1. , , 56:1 ,. X. . ,1 F! fx flf. Ll . H zlf' if sf' 4 X 'x L I . Yi' 1 '-X !xxN 4 .5- 5 rll '! .H Fl' -4 :Iii gf. vx 1,11 . Eff 5. 5 ,J If.: Ex. gf? ax E191 v -.11 H ,lm K, ' Nl XM. ..-,--.,..J CW X K 4 . ,1,'?'t' M ,: 'Z 2-iw M gf?- 'YJ I I' 1Xfl,xJu1: ul. Lf. SANIJLIN l z'r.vl l.i1-lrlvllunl llrfanlrhv, D. O, I.. llcluilccl by thc NfV:11' llcpurlmcnl to the Augusta Military IXCIIKICITIX, Scplcnmlmcr, 1922 IWALIOR I l. A. Ulmwmlz Tacticzll Officer and Assislzmi Cmnmzmrlzmt M ZllhL'lU2lliCS Vi1'fjil'II'CI Alilimry lnsiilzztv, 7905--U9 .'lltfjl1.VftI lWililary I-lmdvlllhv, 19119 C,w'm1N NV. MVC. Yfxmzlaouuxr Post Acljulzmt :md Ilookkccpcr dw E 4 4 5 S Q Q P 4 m.A Avgv3vAvA vAwvAvAvA A Aw, 0 T AvAv vAv,-, AvAvAvAw-Q , N H m agma! I ll ul. , ....... ... ..... .. . .. .. ..........-v 9 gal? ' F U x 1 Mx f 'E DR. W. C. 1 OLLIQR Qchool Phvsician ' nw rvzty of Vzrfzma 1900 LAI lA1N NAHLAN lmu I1 11.11 Unw 1' Lly 0 V1f11llLlI 1883 84 1897 SS l1t1ltYfCl Mzhtary Academy 1916 17 1921 CAI lA1N W 5 IOBIN ON Mwthem It L Vzrjmw Mzlztary lnvtztutc' 1901 11 Au ju ta lllzlztary Academy 1911 11 Umtcd gfllffj Army 1917 22 Augusta Mzlztary Academy 1923 24 3 1 4 f 1 5 I 4 fy - f 5 r . . . .. 5 K1 Um 0 .V 5 ', 5 1 ' 5 f 4 1 A 4 5 5 51 Q x .. ? i 5 w C1 4 Q cs'1 1, - , cyc, -clcl Q fl f ' . V 2 - 1 3. A Q 3 A 1 , Q 1 aids 'I Q , y -- , - Q K , .- ,' Q A A ' ' ' L , 34 A 1 1 5 U 1 5 X I CT Y L: '- -'in'--Y V ' ' ' -h ' . Y QNAYR'NNAYAYNAVAVINIVAYAVAYAVAVAVAVAYAYAYAVAYNAVAVAYAVAVNIVAYAVR'KAWS WKWMVAVAVAVAWV V W ,, '7,W1l f47mWNq VA A AVAV ' , V VA!- ' lm , Y 'I , -P Vp 1' ,, V 2, Ak ., AW-VAVAVAVAIAVAYANDNAVAVMVAVNMVAVAWWWAWAVAVAW-WVAVAAVAVAAVAVAVAVAVA QM V sl fa V LV Qg 1 1 ', Q! ' 2 . 1' 3 ,L - f X2 H '41, f- 5 ' fn 2 '-V V 'A N A , 1 B . H ' ' A V 1 ,Ag W -21 ,J Q? ' lj fi QS72 Q7 - -M-gm- AYAWAYAYAMYAY YAY YAY Y Y YA? VAf'AV1Y 'AWYNA AYNAKWVAVAVAVA' -wi I 1rn.x.- xr Q3121xJLu'1x.:..'x1uLr.uU1nr::ux.u.uxn,u,uu,.U-u,1unr V, N ' Q ' . A X fm f' V' Y W xxlflf '41 Vx - 'WIV , V -, 2- 9lf',,u: 'T'2 ' '- , 1 V ' f , V' C xy' , ' H X3.llT'L'fl'lX.'llIlIfl.'X'IlLXl'.I.l.LJll XI l.Ll l.X1l.l.A.1i1LlLlll LLlLALLL1lJY1.XXTZf1.TfL'l'fffl. J ,IZA w ' N - JN1 1 V V , . f' 2 N , N . S X N f 5 CAWAIN WA'rsoN GOOCII N IQ .. . . . . N E '.!1g'llhh, Hlstmy, 1VI2lthUlTlfltlCh N f Virginia zllilitczry lll.Y1ifIlfC, 1920-24 ,-lngzrxta llflilitary f1l'tIliL'IllN, 1924 N . x f 4 f 1 f 1 f f 1 1 K I E A CAI :MN Hllillllil IJ D1 ANI V I ng,l1 h MathLm'1t1c - Umv rutv 0 Vwrmluz 1919 23 lmfzfvfa Aflfllfllfi lradfmx CAI IAIN S N Mcllomll ' I l'lf,llSh Lulu ltum I hntouc ' Vzrqmw Mzhfarx lnstzfzm 192125 -V fluqzuta Mzlzfarx Irudcun 1925 76 VAVAY YKYAVAU CQ i.-,-V.Lj, xg, V , 4 2 2 A QIRVNNNIFAV YAVIRYAVAYIV V . L J YA V AVAVAVAVlY'A TffSQP' I WVAVAMYA7hVAVAV,NAVA71MxW-VAYAUQRVAVAYHNAWVAVAWVAVAVAVAVAVAWNYAVAYAVAVAVAYAV VA VAAVAIA WAVAVAVAW2 1 AWMVAYKWVAVVAVAVAVAVAVAVAVAWVAWWVAYPKV. A VAVAVAVAVAVAV V1-. N X- I u 1111H'fff111'11111 LX11 flfx 11 5111111 1111111111- 1-11111-11517111114-11111111 V Q W I I F! I ' it Q- , l N 9 . ' XllI.ZI1.KX11X'llXTKX.I.L'KlX.l1..llJ.!.LlLX2IIJ.1.L1L!l1Jl'X ll1Jll'2.i1Y?fIXlT1 W xl M PZ. L . A . Tl Q I ! . ,. Am . za. - N f -M ,gi 4 1 1 1 2 s Q a 1 2 1 1 . 7 1 M i f . 1 1 K . ' L. I C 2 Q 1 K x 1 M' ' 5, . 1 s, 'J ' , s f I , ' ' f ' 1 Lf, - 3 1 2 , x E, l . 'U - ggi lm.. Mix L 1 s , z 1 2 s, .' ' ' 1: , Q 1 5 ? gill ffdedlf Ll, J. CAIIAINI I' CLINDY athematlcs Phyblc Hlstmy A Vwyzma Alzlzfary lrzstzfzrie 1921 25 fluquvta Alzlzlary Acad! nm 1925 26 - 5 I 2 E 2 7 S 4 2 2 2 2 2 2 2 le 2 2 2 2 2 2 2 F 3 CAIIAINPI I FARNISL -V 5 1 ngh h M ltI'K,l11ltlC IIISUUCIOI I md Davidson Collagv 1921-25 - fl1lfjI'lXflI Alililarg 'lcadf H13 1925-26 y MAJOR Ii. S. Yfvrlcs Latin, History r B, A. University of Vi7fji11'ilI,' Post Grad- ualc Univcrsiiy of Virginiag Graduate U. S. Marine School of flfvjvrcnticc, An.- Mapolis, Md., 1900,' 2d Limit. 19041 1st Liczzt. 1912,' Captain, 1917,' Major 1919 1 lfatired. 2 E 2 2 2 2 ?: E 1 2 2 7 s G 2 X .flugmia Milifary .flcadc'my, 1925-26 f 1 x 5 e 11 W 5 4 Z' 5 5 Q43 'ff,,,YM-,A fl ,,A,,,d,, -- M-, ty VAVAYIVAYAVNAVA AVRVNAVAY 'YV V v VAVAVAYAVAYIFAVAVAVNAVAYYAYAVAWli'K'S 1 .1 II 1,1 'mm-Sl rr-N N 4 1 Q 0 NVAWWAVAVAVAVAVAWAVAWVAV VAVAVAV'VAVAVxV WVAVAVAVAVAVAVAVAVA AVAVAVAVAWW 'n u- ummm 'vm 'Ill 1231111 9 1 ' w 1 an Kwmfwumgnmimw 3m.md1,,imi,fiXf1mE ,lp A Q I Q 9 rx DIN 1 fb! R 1 N CAv'1'A1N J. C. GA1.1.AG1u R H History, Geography Z i Virginia Military lnstitiriv, 1913-14 N llizslzilzgtan and Lvv University, 1914-15 N fI1lgll.V1U llflilifary zlcadcmy, 1915-17, 'N N ' 1919 ' , 1 N N N 1 CAP'1'MN G. E. STARNIES Spanish Roanoke College, 1917-21,' U1liU07'.Y1fjV of Virginia Sfzmzinicr School, 1921 f1'I!!jIlS1lI Military flcadvmy, 1921 CAPTAIN WILFRIQD H. Wmsn English 2 1Va.vhinglon and,Lcc University, 19,18- 22,' Virginia Polyfcclmic lizslifmv, 1923: Principal Mount Sidney High Sclmol, ' 1923-24 1911111118111 Mililary flcudvnzy, 1924 X Q59 -2 2 H- fi? sf NNNIVMYNAVNAVNAVAVIMLYAVAVAVAVAYA AYAVAYNAVAVAYAVAVNMMA L VYAYNS l N. 15, lm ' Wm'-' 'A' W W Nj Y'A A ' M 17QI1ffffffffffffff'ff'fQfiffQffIff.'fQ'ffffff'QfffQIQZYQIQQQQQMTA-H-'WWWW - . Ve' 'X f , ,..---ff' CMW fm 'Q , . ., A V ' K mfs-V -----vw--fl--4' ' 'l J,L Jef j f! V J iff ,- 2 qw H gl . 1'T5'11'+f-f-11:21-cfwll'--xll M W fgxi-xI!T:xJ.x..u41.rLl Llxuu :urn xxxx1 lgl1nQlnQlEvlxzx1x ru 1 urn rr1L.uxx11u1, IM ' N 'Hklll T X Q . l 2 riff g li 1 ' ily k ll , - li? l ll lla Y 1 LQ f CAPTAIN Cmxs. K1f:NN1s'1'H BROWN N l l 5 ' , l if French, Mathbmatics, American 1 K, K T,itc1'atu1'e K1 l . '04 ll Coach Baseball ancl lnlaslcetlmall N l l ,5 ll A l ' - xfi 1 Rzzndolfvlz-Macon Collcgcj Ulziwrxily of R Ml 1 Virginia S1H1L1'7'Ll'7' Sclmqlj Principal l M of 'Virginia and Georgia High lg. l l 4, ' l,l S chools for past 12 yca1's,' 11 l' eg ,-1. M. fl. 1925-1926. Q5 3 X G Y xl ll, ,xl 1 Q 2 1 1 gggg 1 1 , + E 1542 1 1 1 lll 5 1 ll will Q ll 1 1 E lfill , ag A CAP'rA1N lu. L. O'r'r E l 5 1 ? Q' g Mathematics, English - 553 5 l l 1 1'la111l1,jvdcH-Sidnry College, 1921-25 i 5 1-'luglzshz lVfililc1.ry flCUdl?IlljY, .1925-26 g 1 l 1 , H l ,Q N , ffl .T ll , Fil' 4 F' li 1 - ll I l Q l s ' 9 l 3 l , ' lfzfl i 1 ,Ni l LIl'IU'1'lCNAN'l' WM. IQICN N1-:DY Q 'Jill i 2 1 4 Scrgccznt l11fc1ntry, D. E. lll. L.,' Detailed l Q by ll'ar Department as fI.vsi.vtcmt to the P. lVl. S, and T. at Augzzsta llflilifary 5 lg Xlcademy, May, 1921 - g 4 g l 1 il Le ll l N 3' -l l 5 f gifl 1 .ll W M S 55 1 ll ll 9 52 l fl MMQWW ,,,, lgg, .2,4,,,A,,-,-,,.,.-----.2,-.....M.,.-..-.- - . 7 t fig-,,,,,,,,,,H,,,M ,,22 ,,,,2 , ggggll l,2,,l2 , ..,. Y 2 lggg M ,,,. .,..2.,wv2 ,.,, 2,-..-l-.-.,,2--.--., 'QQQ E 1' L-M F. Y--A--I ---i W V 1 fxiws 1 -'-z-nr-Q m r-.rf W 1 N ' ' I ' 1 ' 4 fQ1.milEQ711ixim.1Tif.7l.3IZv, WELJ. 1 - JM3'1T9f1Yb?'3ZYZ L L VA , E f .J . ' 7 K x, L 1 X ss l+'l.musxn'l1: Nln'L'ulmu'K Cuklutlwl' Nl:1c D XII '1 F,xcL'LTY I . J f .1 , , . S. . 5, if ,1 x.. x x X f 4 1 . 1 n N.- -W, ' . E V, ,, , ,. A, . X X, XXX ,N jc 'Q Q - - -, - , , Y U . :E 1 , T, ti V , JA -- f ' :ia :J x -' .4 6,22 X ?' f .. ,... . ' fl! 4-5 2 fl- ' ix ' . N I ,I 'IH i A X . Ja ' f ,' I I . E ' fl ,-X I R ' . V4.1 3 2 ? Q i-I, I! 4 Q sv. fav 3 ' i L A 1 x .ga ff, .- ' ' hh lf! fi 1 1 V' -Y Y 1, , ,,.... .. .- V ll ,x' R t 1 Q XM, f- f ' N 0 N,,, 1 x,'fl x .I V .fif- . , I 'jf' ' : 1 , ,V ' 1 X , i Q a V2.3 7 ,, ffm 1' 3.-. '. Y XX . f ' I RZ. 5 , 'f ',g f ' ,-vi, , 3 FF-. xx. Nr 'Vx - 1-4, V V . 'I i , - , 'Q i . ! , , , .X V , .fv ' -o I 1 1741, i --I2 if I , -A .,' Q ,..Y.f. '- - ' 2 ,, y ' - , nf' , .1 P G45-J liACTICAI. OFFICERS , N fx. . ,L j i ww V ZA' K W. :.. ff.: if 4 if-T'f 1fl2 'f',.:f:f'L'iiii'f i1 -fy: A-K 1 W ' ' wi' ' 'W A' MW Y M- ----- ----- -----f--V -- W---A--A Av---V -5-H--W--. ,. N.- -. .,, K, ,fyx , ,VV W W -,,,., -,g,AA,,, , N Y .. I rf ' i ' AA?---'A ---4 f----V 17.7 ..,. .,,,.,. ,,Ax 'gf U2-.Q-'fi-21,-'fi-fv 'z7TX. ,' zugv , :.,fff---ig t. ,, , , , . . . V, .. ,V ,. , -AZN '- 'n -Mk- A -' '-' NME m ' - ' -1ffW ' i!1'!' :V iff VVNIXTN' ' 'IFJ f' x X ' .. X -Z f if-. ' 'Q' f f1'-ff '-WF-' - f - 1-'v i 'P'-'F x -1. w . ff- 'Q-f' -. .. ,.-...s.,LL-......1., ,-,-.Lh,JL-.--,f,,g1.!,,..--fd-,-.Z . 4: ,Ilf..,,:,4.L--1.5.,i-14L1-Pi3fJ..:f.:gJ .zW-4314.11vL:.f,,.'LLQL' 'V WI!-V'-V X-f' N F1 X' ..f-,-.-A.,,-..,.,.-A,.,--- N, 4-Wu SVAWWVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAWXVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVQ ',,,1.r,i ll l lf '..-gc' I1 1 Memory When over life s wide troubled seas at last We ve safely sailed and sight the farther shore We ll live no more in the future but the past Will rise before our dimming eyes once more Then through the mist that s conjured up by time We ll see a sunlit valley hazy blue A slate whose name our forebearers made sublime A grey walled school whose name is sacred too Our memories may be shadowed by a veil Made dim by sadness laughter smiles or tears Old faces blurred a httle lights grown pale The winds perhaps seem softened by the years Perhaps the sun will shed a paler light The purple hills take on a deeper hue , The harvest moon shines not so silver whiteg - The summer skies have lost their azure blue. But though time batters memory, and though I We half forget the lights we've been guided by, One thing will stand, when life is ebbing low- Our love for A. M. A. cannot die. - -ANoN. y I ' f 5 4 f 5 S 4 5 5 S 5 f 4 5 2 4 T 2 S v 3 4 1 e S S 4 2 2 3 Q 5 lu as .y W 4 as T 23 4 L N . . , . p G 6 ,,,,,,,,,,,., , ,...........,,........,.. . ..................... - ....... ....... . .. ,..,., Q 3 l 'egg-em :::urffflgplvygnllgllll rl -.., ll 5?'!?:?H'r!!'!!e--se..L q E ' .7?l!ll'! 'll!'?.?!f!f19! N e '- ............ .................................. . ...... ..,................ ' ....... ....-w' ls - 1:il!?b:lf!!!!!5!a ' S s 5 i 2 1 5 . 24 A 3 :Q r 1 D, N 4 5 , hx I X N Q 4 l W N E 4 f s Z1 :E f s ' 2 v A f r , 2 4 N rf f V 5 , i y i 1 , M y fa S l A .' .' ' ' f w 2 , i Y 3 Q . . . .i u l gi 5 i . ,, . -l i 3 5 l 1 - . T 5 5 EJ ,, - - ' . 3. ' , Y Q 5 . 52 ? I .' S I , , , 7 , . . 5 4 Z Q ' ' 2 31 Z NNAVNA'AYA'AVAVli A0xVAVlxVAVAVAVAVAV'AYAYAVAYAVAVAVAVAVAVIR'AVAVAVA R'A'R'KN S540 VAVAVAVAVAAVAWNAV VAVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVA 4 ' 4 7 mv, . ..... ,ZF m W -w x JAL QI, A f Q S w . x 3' 0 N V ' R ? 5 :Z Q 3 . S f JM 35 Q I 5 4 3 4 2 5 S N K. ' N Hmwsawm PM UMW Q Way ff' riff! xiii W axe, jx f K V 4 4 K 5 3 f T S 5 ' N ? Q f A ,. Q ' N ' 5 Q f - f f 5 ' 4 2 ' 5 Q Q A .egigv by f 3' A II M f 1 H N N 4 P iw 4 4 if 21 5 . flu ,.. g gl Q 7 v f ' W 22 p 4 N 7 Q ' f lm LANONIE ' N N 2 ,ff 2 a Z if R A ,,,,14i..,.,. .1,. -N 5 3 L l ji-59' E 5 ' f Q if 22135 3 32 2 S E Q ' 2 Q 2 D - ,- 5 5 W . W S 4 - . F 5 559 Wig 25 4 . , , , X 2 Q biflfli'NNAVAVAVIVAVIWAMVAVAVAVAVAVAVAVAVAYAVAYIKYAVAVAVAV WlK AVAVAVA K'A'R'KN 'fn 4 ,... i . 5- 45 I P- . 1 . 1 P r . . 1 - V 1 s , ,V ,-1- V -Y COMMISSIUNED OFFICERS I 1 , Nox-C051 MISSIOXED OFF ICI-IRS 4 QVAVAYAVAVA AVAVAVKVAWVAVAVAVN VAWVAWVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVQ VAVAVAVAVAVAWVAVAVAVAVAVAVAVNAVAVAVAVAVAVAVNAVAVAW'NAWVAVAWVAVAVAVAVNAVAVAVAVAVAVAVNAVAV au x-nlllll f uma S299 N Q1 - lVI111tar'y Department fx A S A MILITARY SCHOOL we naturally hold mllltazy excellence WQJ' Milne If Xb as one of our hlghest alms The gleatest thlng a school of oux eleven Honor Schools of the Umted States and to wear on the sleeve as a symbol of th1s achlevement the s1lver Stal Thls has been our first yea1 as an Honor School smce 1922 and ou1 one ambltlon IS to be so des1gnated fox the second tlme 111 successlon Whethel we shall accompllsh thls or not remams to be seen but Ill o1de1 to galn th1s end we have put 1n many hou1s both on the dull Held and 111 the classloom and we now anxlously awalt the ve1d1ct of the govelnment IIISPECIOIS Before w1nte1 began the close o1de1 d11lls we1e 1unn1ng smoothly But just as we had begun lea1n1ng the 1ud1ments of sl nmlsh drxll w1nte1 set ln and we could do httle but Walt f01 the spung Then It was only a few weel s before the government IIISPCCIOIS a111ved that the last snow Finally clealed away and we wele able to get out 1nto the helds to p1act1ce m1m1c wal fale It was then that we had to bucl le down to the grmd of maklng the best out of the tune at ou1 dlsposal to learn all that we could of coveung detachments and of the platoon 1n attack and defense When the 1nspecto1s came on the elghts of Apul we we1e as well prepaled as we could have hoped to have been undel the cncumstances Wlll we get the HOHO1 School agam thls yC3.1P Well we wont know untll some tlme 1n June but whethei we have come thlough on top O1 not zn the IHCC for the sllver stal we at least l now that our tune has not been wasted and that we have each galned somethmg that w1ll plobably last aftex we have folgotten the faclngs and manual of arms In CO1lCl11Sl01'l a wold 01 two of app1ec1at1on would not be out of place of app1ec1at1on to our Plofessom of M1l1ta1y Sclence and Tactics who 19 leavmg us aftel th1s yeax In the wo1l of mal mg A M A a bettez school he has spared hlmself no pams he has glven us fleely of hls expenence and the least we can do ln 1etu1n 15 to let h1m know that h1s effolts have not gone unappreclated and to wlsh hlm as great success Ill whatevel he next undeltakes as he has had at A M A To hls asslstant we also wlsh to say a wold fO1 he too has WO1lxCCl so fa1th fully and unt111ngly that the school could zll have spaled hlm wh1le h1s good temper and humor have endealed hlm to all the cadets We p1ed1ct success for h1m wherever he may go next year. LWB ll SEV W 23 r 4 3 5 5 5 4 3 S 4 E P ii 2 52 I ' ,,,. ,,,, . .......... ......,.......... Q .............................., , 4, p 3 's-e a --l lfffl--1 5 A lb Q, A S e S N me y 0 GI y K lm ln E f I r - l . - y r t f f or I Q -- - t 5 N I S kind can attain is to be chosen by the government as one of the N E if X H, ji w .Q . ' 1 . . X r . . I l ' .. . . 1 , Z 2 ' . . - 1 . . . . . . . S 2 Q . . I X . . L E I ' u . , N. .. , . . ., K . K , E ' - ' . 2 We 5. I YAWNNAYAYAvAVAVNAVAVAYAYAYAYAVA AVAYAYAVAVIFAVAVAVAVAYN'AVAVAVA IYIVIX'Ks W Y H Y A - Y , V A 5 ' I , Q, l W- w . ,E E .- il '-I ,S x f ' . 'i , 1 531 :fu - 5'y.','fwg2qQ7i , i :fu T XZJ: NN EN QQ wx' 5 1,f5VXg,gA4xf!Q,f,fs,'XA'.,f,x' fiL:LzN4bg12x14igAz,QJ.4l5g W5 41454519:53LQ2ifQLQ5QQL2fi2Q3zQ3z1:yiSJ2h4g,1x.4fQz.gym Q ,ig 5 Ls 437.3 , ,fp Qw- rv-.4,,g3g,Y. , ,, ,5,5. 'L , - Vr- - iii - - V' i Y- V '- gwg, 4 Y W Y , , f -- I , r- X - f-if Q? 1 f -f , - mam, q 4 L xi? r - fx -iw, x fx:-N. X. X. X. x :R 'x XY 11 nfl' .. if 4.22-li J ' Ytipx .2 9-4 A, Tplff' ,Fi 5-'Q ' 4 ax sw X , if ' 1 if Fi 52-T L S 2 2521 123 ' 3 2:5311 f V, .3 A 3 if sy I . I Qffi-,, .:, P A 1 1 5 ' 5155? if- ' 'Q' V ff 3 ifnj ff 'I 'x ' A2 , . 531 f . 3 ff' , 5 1 X If ix! N-I 1 gi L f 9 if F 5 2 fi Q43 55,3 A R . 15 use QQ W W - , ' - . 1.1. --Sl 3- il A 5:32 5: thi 3 3 4 J.... , L33 1 A S5 52 E3 s 2 A f Q Em Cf? 4 5 K- V 5 QM' sg - f 1, f .X -1 Lfe 2 :U r r-,J v we f 7 W ff P5 ! u. - 2 . ' ' -V :H fi? 2 1 SEQ 2 1 L. ' , W 2 M-'TY I I ?1 ' xl 'J- DS i , ' e L-'KS 3 ii Q I j . T ,bk 5.32 ' if W3 2 A f 5 f Cf 5 I iz 5 C14 girf fi , ' Cx '- f':E24 H ffl ' 5:15 ! ' f . ,, . m. 5:3 2 j', ' QQ Q . , rf: 1 ' ,ff 1. i . L 'f - - r,-G: , Y ,J , LF-3 1 E ' . ,Q 5 1 7 M . . 5,1 , 1 BATTALIOB ff, .k f L. 2' - , Rn.-. f 1 Y , ff I A ,x-1f. ,X ,,,.,,. --,,...'f 1, f.,-'4 ' T' J ffl .fzflfwcff '11-f--fi :E 5.- gfffi I 5533- MQ..- ....r:i7.-:ff.2::Hf:::1Q:::::1i.:-1 ,,c-mf:T:Q5i?:fil' gg - ,E 2 ,G 1-' ' , , ..-..--..- .Y., .-...M--f. -M .1 M a Q i 1 f , -- ff- -' -'f-'- ' M ' ls, J 1 I f Yzv ,fj--M------- A-N-----n A' v ...W . -- --f------- --i'-- '- fm W M 'PS 2 J L.-5? 5 1172! - f-g I , , 6- omg: W--W--M N-vw-.-mn.,-,,,,,,,-,-.., ..,. M. if rl ,, U., ---.v-., ---G - Y- f -J-' f ' f X, Y . ,. ., ,-fm, 3-12-f 'L i I , N JW, ,,,,, ,-, ,.., ,,,, . 0, v, .Q ,, .- -5,-Y-qt? -p-'Q-egg-fqvrff-:H:f 1 ff-iv'TfC'3'f97 'vA 'R 6j Q si.'f i'1'!'f'5'7 CE5 F-7 'f 'i-?7 T '5f'i'3?'-fk4i27'51 ?'4.g TL A-?f1,'L'.7 'if 'f'2'f'4X 1fj5 'SN 37 25:-R? l7'?iff7f'f ': '1'x-iyw V- E 5 asf: l QQl.fQEf:.Q?LS5'i-2:51 .?. .L.f xif3,.Lf L2vLmm.LL:lifhi5 ' VTX!! 4:i4fi...EfL.LLfg,-,3rS4.fZJl.lv, -,E....'2..:.j..g..f....2'..L.?f4,f .na 1 1 1 1 1 f i 1 .1 1 - ' - Tvs' 721113, 1 I', 1111? 1 if ' ff fi? 1 1 'AME ' mf: 11 N , 1, I1! 1 ,'1' 3 elfi ' UW 5 ni' 1 111' 3 -13 1 LH f H11 1111 V ulx lv 5 . . I I N1 5 -147 1 9,11 2-112 1 11,2 1 pt: I 'Fig K Vfg I , Ui: 1 I !'1 E 1' E 3 1 1 I , 11 E I I1 I ll !i 1 1: El I 1 1 U 1 ,1 V je 1 , V 51 1 1 K ii 1 1' 1 1 1 N 1 5 Y N 1 i 1 1 EQ ' la 1 -i i V 1 I1 i li 1 N 1 ll I 1 I i W I 1 5 -M715 f Q -W , 1 1 ,. ,. ,X fl., .,,.3.,, W,-..,. , , .1 .ff . ., 1 ,N . ' 1 1. 41 . IL' , , .Ly I-Q, F 1 N,' Q, V 1-gl q-1 af' 1 'QQ I 5Qr'1 51.3 Q5 ' 1 fu! QL : 14, ' iu jf' 'HJ 15, I .-ffl .' 1.7 af 1 'JN i 1,5 ' 1 X ,1 1 .rrff :fa fvkfi .yd 2.1: ai 21 lf 1 M ' 1 1 1 . 1 1,311 ,L.L1.Ef-l LJf.ff!..LQ1D,LLl!.1.1w1.4.L.-.1.,1,1'X' ' Q J S 3 I' F3 .. H , 5 7 M. , vg A VAVAWVM-VAVA AvA AvAvAv,-wmv wvAvAvAvA 4 rjjgrv A My 25, A Wx, Z X ix W V ': 'f FIRE: was 3 25,13 L X K 0 A N, .mt rrn'rrnrr1:rxT'n1u-:n1n1rrt1 my hu ' IN N 1' i Hx rm 57 a RLG Wm. oy 5 a of ,Q +5 52 va ilk Jlaiw l-aa N 5 r N K x LQ 5 ns V s 4 K Q1 , , Z X - C an N a fm ,U A.. AV a Battahon Staff A A A '. C. Mcflalccolc I . . ........ Captain and lldjutazzot a a . . .first Licutcnani and Posiimrxtfr .'A . C. I on LINK ' V .. W. lf RAT1 ...... first Lieutenant and O'llll7'fC1'I7l-tISfL7' . A. CARSVADON ...... Second Liwztananf and Ordnance Officer a a ' . D. MARVS . .. . .. ...... .. . ....... .Sw'qzacmt'-llalajcn' ' V, J. T. PALMAFORY .... Swzior Plaioon S rgvant Buqlw' and Assistant Postmaster ' . M. BROWN . . . . . . ...... . . . . .Junior Platoon Sw'goa11ot and Ordnance a 5 W - 1 . To , E 2 2 4 34 3 4 I 'AJVY VAV YENAVNNNNNAVIWIY L ,,j U7 f- O ' H CF Q f R 4 W -- F2 I! N . 'Z Q ' ' ' . Q ' 2 ag . 4 N Q W 1 b Ei E I Q ' 5 ' . S iz ' A a a 'ao i. . - , A ' 4 A a . . u 'Z ' Q ff 3: A Q f l Q li ' K Q Y ' Q E'7 AYA ' f ' fm AYYA 4 YY VA 1 1 1 . 1,11 1 9 ,1.1 1, I I 1 1 I ' s 1 , X h V 1 I 1 . 1 1 ,f I H-X-.xx X91 .f ' 1 1 1 I 1 1 , 1 1 ' vu-'H ' 1- E1 1 - ! 1' .Q 'Z1.3 1' ' -'-1 11 '. fs '15 11 1 .Y 11 1-. 1.3 31 .1 ,, 1 11, L1 U1 I I ' '11 1 ' 1- -f-- .4-A-- '1 f H-X 1 1 1 1 111 1, Nw 1 1 1' ? 11 if ff , if 2 1, 41 !' i1 gf la 11 11 fi E1 ff fl 11 1 l, 11 1. 1 lj ix gf 1. L2 1 U g 1416? 11 1' ' V113 l1,,!w 1 1 V: li 11 ll 1 1 1. : 1. W1 .1 i1 '1 in ye ,A W iz I1 N1 l I 11 1 W I i1 il .31 ll 1. 11 11 11 fi if 21 Em 11 1 '1 in fi X. . ..- -.. , . fx., -.41-' 'A ' :': '11 .:'71fv? :ff pj.-. T.: 'mg-:.1'1f' Q 337' , 1 . -ffl. 1- 1' 1 1,1 -....--. J.. .-L1.-..J.. ..L.u-x...1 1 Q ' 1 A1 -J. A' 1 My 7 1 1 1: , 1 Qj gf. 1 , , 1 11 I 1 ...1 :Vi avi 1 1 1 1 Sf' Lx 1 1 ,, 1-fe ltv. '3 pl iq 511'-. M 11, 1911 f rf-JI Q ' i 1-X I if 1 11 X 1 ,. 1 f ' 1 7 I Aff? Q15 ixfx 2'2 f- -J iam ffl! 1,71 l' 3 I'-.4 I F, 1 f 1 V1 1 r, 4 f' .J :W ? ff- '1 1'1' Q 'iff 'Cl iii EQVAWWVAVAVAVAVAWVAW. . F 2T A A. A A A T T A AVAVAVAVAVAVAWQ ?' I ' 'Y V 4 r ..,... ,, K .. .. -N ? 5 IM Q. ll 5 Q f s S S 5 Q t V E Q A Jr.. Ml? Q 3 2 b 2 4 f 5 5 4 5 ' 3 Q S f Q 5 Q ' 5 f 4 E ' 9 E C E E f E f I I 2 5? s. 3 A Company 2 4 . 5 P E. D. GRADY ..... ........ . . ............ Captazn 4 5 S. T. FAIN ........ ........... F irst Lieutenant g 6 E. M. PRYOR ........ .... . Senior Second Lieutenant 5 5 H. D. HOLDERNIESS .... ..... J unior Second Lieutenant S 5 C. B. SLEMP, III. .... ............ F irst Sergeant f 5 G. B. HARRYMAN .... . .Senior Platoon Sergeant S E W. B. HUDDLES'l'0N. . . .............. .... . lunior Platoon Sergeant 5 ? 5 4 SERGEANTS 5 E FULTON ICIEBLINGICR ROBINSON, W. g Z 2 9 CORPORALS 2 2 wi. l3??QiJF,. 3 9 I Acon Ii T.. 1 4 4 r Q PRIVATES 5 4 3 Amy M 5 EM M ET1' HILL IYIOORIE PRITCHETT SCHONEN num f Amal.soN I FLEMING HUMliliR1', C. NIICRRICK PALMER, A. Sulcuvrawlc E Q BLA KE Funny: JORDAN M l4:r.'roN PA'l'1'l-:usoN TIGNOR 5 a BAUM GWALTNI-:Y ICIRN McCouMlcK,J. PoNzANm.l,1 vVEI!S'l'ER,j. S S CRANE GLENN, I. KISIEIQ, R. XIANNAKHE, H. ROGERS WAIQIQIZN G Q CONNORS GUNBY LALLIQY M1r.r.ER, G. SLEMP, S. Woon, B. 2 Q Dokumu HARGREAVE Ll-:smu NEISSI'2N SAUNDERS WICKENHISLR f Q CRAWFORD, W. LYON STONE, J- 5 Q E 3 it 2 4 3 Q Q59 Q2 22 QQ S Q mifldlifNNAVNAVNAVRVAMYAVAYAVAV VAV QVAYAYAVAVNAVAVAYNAVNNAYAVA!IYAVNA , , ,X X V , . . J' I X 2 'wg 'TEX - I ' 'xi J X 1 1 'i X W'-5 ,.. LA I-NX5 L. 33 my . , ,V LA iff lp!-4 'Nfl !..fX 5 X ,,j: 5'-X 2 1 , 'XA X f ' X, X X F ifk' X f' Q Z..-'21 . sm' slffq PX4 1: X H, MTE 2:53 YW X X' X X ,N z' IQ? X 'Nik X ,gg 3 U X X 3 ,fy , X X X 3 g Ii wi X , X X Xu. i !j.'4fe V,f,X: X E J X W 2 if X A ffxhz X'-lf-3 X dll X I ' 1 X -Mya i .fXX if X X. .ul . ,AX 2 ,ig L. . X X - 1 M.. X ' XX. X. .. - .... ...-. . -.,.-... .,..-, .,,......,-. -v.X.-X,, XV., .,.. . .. .- .V,Y . XX .--.--V VX., H- X- ,- - ,A -- lx K, ' ' 'XA J' Xi ' X H X 1 X XX X Af.' ff X 1 - 1.X, .,,z..,,. ..,,XX .X . X A-,.,NA-., f X XX X. ,XX X. X, ,X XA ,, .X X ' ,X XX ,X , X X. XX X XM, 4,51-f'Xf Wy fiiiirf, :gf f.-T5'QXf'2'. ta SW.. ' Q X ,fgfff-1 N127 Vff' XL1K. f'1g S ' 'W' MM 'f' I' VX '75 ' ff: Xx !'X' - X - V f-lrwky ' :X -3 ' i,X'X i X 5 TX.: X XX E 5 X 159. X X X , X + 35- ,. 'XX g X , 'rc X- X. X ,X fy' XXX' X XX L :V X KX.. Xl,. : IX ' ' ' X: X Xffi XX 4 ' X NX. I: 5 i X Elf ' X X 1 :'. ' Ls 5 i ' NE I1 I I --' - X A XE 7 X X QNX i X rr : lv X , X gf X Q 5 yy:-X if 3 5 gf' X 5 2 ' X TW Q X 5 X -3,111 C2 I l 5 'f'4 X X ' ' Q 1 1 ' X 2 ' X 1 J X- - X . , X X .-H. 1 ' I X I 1 A X X X X H X X X , 1 X X XT: X X xx. J XX - - -X 1 X - X . X ' E , H1 X 1 , U X . 2 Xgfie X X -'..X X' X X X-,f I fX',! X ' 'X 1 1 X 2 -W 4 Lf - v S 2 ! QXNXP X X X X X-,fx F i 2 f if 1 3 iii VX VX 1 A X X, ,W F772 , 41. 'X ,.X ...,.X X X .X Q E X .1-1'-X 3 1 X XX 1 - 1 'Sf X X 1'X',,,i 5 X 9 '-A-.7 X X Q ls 3 I X X ' L X-X 1 ' ' ffl X X X - 'X 4 ' K X1 W 'fbi 17 'QI X X ,XA-X 1 X X X' hh' 1 ' X ',.C X X X X 7.x . X , X .' X .., : 'AX P X 1 X 1 1 X , X X , I -X ' X X Y., .V fa 2 X VX X X X XF 7 1-if l 1 XX X X I XX X X X, X .r--j Xl 5 QJTH XX X X' , , X- X X ' X X' X X . X X ' l , , .M X, X ..e ' X'-.J X 5 1 1-.xl 5 1 T if ' Y .,X.,'I XY wif W 1 LJ X v X '-, X U, ,V - - - ,.., .. .. ,... ' -, f ffl XXX5 M ,..,., A.- ,, -, ,,,,, Nqr, X ,PBA wi.: 3 551.1 .. . -..-..X-....- ..-....-- ...,.,..,....,..-.,-- ,... -..,.. ,.,. ,.................-......- ...,1.Y.X.-......,. ..... ,.-,...-. .... ,--.....-...,--,... ., ...,.,, . .X-,, .., uf! ... . ,.. XXX..-X.f-WN... ,.. -,,.,X.,-.-.X,,..,. ,,X.,.,,...,. , ..,...X.-.. -.,,...,....,-,.. ... . -.M,..,. X..,, . X . , -, NV, . ., V Lf' jd, ,i.J,X'x.X-4px . A uf V 'M , ,.,w,,.,.X RVVL1. H, RL., .. vX,.,X.,1-.y 'xrl.- -?f'kX.,4,-1.,,m'K.Xl 1, XYX ,, ,,.,4v...l X., Q. ,XqX,X, , . X XXX X1 i -. X, X ff-X2 sffQ.T..LXSX5 zgX','gX,..jQff XX QX,,gQQ'i,f,'52. Q2 1jsIf,I.,2:X HE .. all X5 .fl E , jffff fix XfVQfiLfQ2fga3f1.1f!QL1,. E-aJlfQQXf.1,.a:.. aft f f 'LX fbi 34525 --v----...-1.-....--,........ XY... ,Uv ,.,. . . . . ,. ,.. ......,,,,..,.., ,......,, X-A-P ....., ,,...... ,.........A-..- ....-.A..,,,..,...,..,,,...1.....i...1.--..,.Y,.....-.....-. . . ...MJ 1' ,f 111 1 1 1 I.. 11 '1 1 11 1- .x .-1 1 VM.-.-W-.-1 N- W- -..- ,. W- .. . .. 1 1'i2ki1.11.ffilfleiiciififii-fir!?3fCf1?E:fLfJf11f.?.f-iii?1110.1ff?:si1f31F1.1i1?f.3111i. gr 1if11',.ffIf1f1f'31.fQ?5QQ?fiQ2Efi!4?.i551Uififii7EiS4.'lZ1i1ZTi1'3z7TS7i?3T'lff1l'l?'115lQ,,'i13LSW .1 r M I . M M V H Wm wrhlv-nw WNW R M WM-M H 1- -1 -.41-11.1.-: 1 . .111 .... ..f,1.,1..r,.f .1..,. A.. , J, . ., QA... ,, Jn, . L I tri: I 1 .,.. . ..,,.,..,., ,.... , .. .. , .. , .. .-.. .4531 I VL 1 1.1 .,,A A ,W 5111? 2 11 ,.A1, 1 1' ' 1 'I-117 1, 1,51 . 1.121 1l,.ifflJifl5IT7T-, :Q:.rJl71-1-1.,f't5,:,:x.,h1I Diff X AJ nf 'LQ fAR.,,1h.r if 1:27 5 Q- if 3,11--1 if 1 D 11 6111211 .11f37f1f-12' 1 X .- 1,111-55111 f1ff?1351X L 15377 1 .111 1 1 ' ,f 5 1 11---Ng 1- ,lr R., RJ 1 1 1 ,1 ,f 1.q1gU1J1,1 L1 2 'fflf 1 1,1 '11 1 1 15 , J if . V 11 115 11 2? --15: 1 . 11 111 11,-1 11 1 1 111 . 11 1' 1 11 1' 1 11 1 1 11111 1fh -1 Q 1.1 F111 5.1: W' 1 1 11. I 11 1 111 1 1 1 1 1 11 11 '2 1 1 F-ANT: 1141 11' 1ZY 1 -'31 1 1 11 1 1 Y' 1 , - '1 I' 1 E 1 1 .fx 1? 1, , . .44 1 1 1 1 2 1. 1' 1 1-Q' 1 1 1' 11 5 1151 1 1 1 if 11 - 1 112.511 , 1 1 11 x , A--11 . 15,1 ',1I 11 1 1 Lf 1 1-1 1 11 11 1. ,551 1 11 1 921 11' 1I 1. 1 1 1' Ai 6 11 1 .x . 1 L. 1 :S 1 1 112. 1 1 2,61 1 iff: V11 11 E 1 153 : 4,1 1 , -r.. f 1511 1 11 151 1 1 3:5 ' 55-fa 1 1 111 1 5 Elf! 1 1- 'J 1 . fl 1 1 1 I 1 1 11 A if -1 '51 1 11 1 1 151 - i 11 1' '1 1 A . 11 5,1 I 511 1 4 A1 U F 1 575 151 . 11 1.1 1 15:71 r 1 1-1, '51 1 ' fk-I'1 111-1 11 11 1 1 1 21,.1'1 11' 1:1 ,MM 1 1 F -J 1 W Imam.. ri 1 . D 1 1 1 1 1 1 1 1 1 'wi 1 1 7i 1 cc as .1 N, .1 ' , - - ' 11' 1 11 1 B Company 1 1,42 5 1 1 . 1 11 1 1 fig 1 ! W. W. Iloswl-zu.. . . ........ . .Captam 1 I 1 Q. I I 1 I.. H. BAUNDIN, jk. . . . . .lfzrxi L1v11fc11a1111i 1 '1 I D. G. THOMAS .... ...Svcond 1.101111111111111 1 5 Q1 -1-1 1 1 . , ,. 1 '1 .ffl il 1 J. L. C1oo1mw1N. . . .......... Mrs! .Scrgvarzi Q 1 33,3 li. K. RAMSI-zv. . . .St'I'l1:07' Plaloou .S'crgva11I 1 41 . , 1 flfl 1-'rj 1 A. Ii. H.l1N'l'.. ........ .fIHflZ07' Plufomz .SC'7'!jt'lIlIf V15 1 1 -.1 .N Dx: 1 1 17' 1 1 1 '1- ,3 SERGEANTS 1 1 131-1 .1 11 . -f '1 2542 I3111f:1c111aN I'lllI.I.II'S, R. H IX R1c1s'r I 54 14111 1 1 1 121?-1 1.1211 1 coRPoRALs 1 1 wil Ili? I gb-F 1,44 1 AN111c11Sr1N, VV. How1aN, R. TRVINIQ 1 15-P! 1 C11111s'1'1AN Ro1.1.1-211 .IENNINKES , 1 '11 11 1 . L- ' 1 1 211.1 1.215 1 PRIVATES 1 1 .Tyi 1511 K , .Q B11111:1:ss Ufxvues I-1111111111111 l.v141-is N1.1c1m1.s S'I'Rlili'I' 1 f 1 1?-,1 ' H1-:ANS lJ11wN11c vHlI'I I'liR INIACKAY O'N1-311. SM1111, Ii. 1 Vik-J 1 15? B1cAs1.11:1' 1311111111 H111v1111c11'11, W. NlA'1'1-laws, j. 1511.111 11:11, C. SH 11-MAN I 1 ,161 BOWMAN, C. lJ111111.1c11oC1c KLAUS MCCOY V151-Llw, A. SNICAII 1 I Gigi? 1 UCAS1: Ifuvlc LAN1:11o11N1c M1-zssmoluc Vlzvoxz, I.. 'l'1M1:11:1u.A 1411: 1 ' Q1-Q1 -T35 1 QONRAII 13111111 IES LAT1-111011 M11.1.N1a11 Q1111.1.1cN Q VA111a11AN, D. 1 1 C'011111.ANn Hluclals, C. lllbll M 1cv1f111 Nlrmlmvv RA1v1s11:Y, Il, NVIQS1' 1:31 T-1111151111 N1c1K111K W'1111:11'1' 1 1 111.2 N7 ' 1 pf' 1 I 3 Q11 ' xl -V11 , 1. 1. 1 43 ' 11151 1 W I ' ' 1 1',Q1 1 1' ,gg-.--.--... ..... W. x Y k -W------H ---- Q A,-. ---W --A 1 1 1 1 A Xl, ,U fm 1 IJ V1.1 IXXNQTW- - - -ff- -- ------A-.---.--.- ...F ...Y....-v.,...-,.-..1.--P-- M---- 1-1---....-.m--.....--.--,.-.- .... .... .... . . .4 QW 1 f:r,frg11r'rL11 1-v , 1 . r-qvgfwxxr 511357111'--15f.Y.ry4-m1R..., .11i,w-YQ w.1,,fWmg' wry-vy -1--mf 17113. ww- --. -1-7.-11?-11 5 1,-.5 My-11 I K, , V Q I 1 I,-11.21 1-1 iffffliffzbfffbi.1g.1.W..LNZ1iQ.1Mf1Z.1 'lxff121LfI1L1Tf.f..fE1.fy1ifQ1!f.ff?1f'V51f'.-.5f1 1f 1X1.1'1i'-1'fXf'171:'.1.?1f 1 -. f .g .... Q .. 1 1 1151153 -1 1 1 1 -. ---.-..--F.W-.-.-----..-...-. ..... ....... .... .. .... .,., ,., , .W ....... , ....,. . W,v-M-Mjj.,jm-gjkjjljg-11 V--T - , ,---., U-i bv ., .... . 1 J. ,. i J fl ., r ,.r'VM H 'm ' '---, . , Ally! 1 M 1 Igxff.-,:L,,,-,-.bjh-M::f!Lg:55f,,:ffskiVfsblffs aim W A I 1 we --m--A'-V---w-m,,g 'gn Tx ff f I 1, 'fs '--f-Vh,---Q: '4 '12r'a.4,1fQg A L P 1 1 sie? ,I 4 .. f- . ,:g1:f-- - fm, . Q Q 1111 1 F C?5?X ' 1fL'141iErs:kLuAJwl 'af'-H ---- A-.Aww ,-,- -m: 'l :A4'Dl-NLL.,gQAf?lX f Qxdfxndxxxxbl I 3 , HM it .',,:.:,N ,fx A J - ,,1.,:L,1ul:-L A I --.i.,,-M.-u 41134 .mah A A Eryg: ,R wx X, J f UU LL'm'1-1-:J.MAL V I'---A-......-,W .f.L,'Z,EJ, x5 3 Y' nfl k 11 , '3 -f-- zz 'x-12 -551.4 XMB' lf!! up ,J -1 '-Uluugq, I E x 1351 - A--' ...gymI,.1TQA,T,U'Fwf-IT.- g,,, Qs ,X 0 fl 1,-M. 4- 111-H-U,,,,., , A gg mvgf.--- s ,- 1: Y-1x:1,H,,iw 44:1 LJ,-f,A,i'f 5,-4 1 wwf U '-film xp :Qi-gf :qw 'Nl 4 V .:, - L, Q N 4 - if: -.ul-:,QEZ.1'1'pfq'pYljjTN n , T ' ' N- 1 ,. . 1 any ,g VS ' ' Q22 X -' Ab s , 5 : x , x ., , I 51.41 1 5 QQ ,Xb 4:. N' I 4 fri, KL Q '-xii , Xu 1 lggg ' fl3'f'1 ' 1 1 1341 H l A JA ' ' rf? N Lf i HSE xy V45 Y I X1 3 Fi' ffl R1 cgi iw B2 N -1135 xj w ...1 , Fix: N . E '-il? , 1 ik .fix fm , -'xg ML M553 1-MAX a PS? f i1,KfQ.v' 51' JT 551 pu' V: I-iii , s r. . 5 1 , VV .-ff, 3-we ' 'fffli ,Q 1 Wa HW i.,XLi I'-ri. i 6,23 iglrlf 144 f W X Eqiga ' F121 L.--, L, 'T' 1 127 ggi 55 5 LW , in 1 Lfw X17 I , VV 'H A -- 1 i-af: I K s ' - M, 'V'- mf L4-3-.A..! , o , 2lf',1'1L',-P,f:w-- f -- '--A--fv-4 'f.-'---- v-AMW , 'Y N ' ' L- --W .-,,,3g -fi. fxp' ,K ylzyif'fQ:J'QQ:-yg-q:v.,, Raj- ' - ----Y-wl':l-'------..jXR- 4--f'..,,-' P '.- , , 4 'QV' . '-'-- V1 fy' , M,JJ4, Yslfff 5fi,f.jy'FfjQff'f'k?21'QQzj7w:y A .Wm I if-if mf' MXm432i'9iw3zQ f W. 1 X K' 1 ,,, , -P M I , . - W., I MANY RWI, L -A---A .. r I x x,x,4 , 5 1 X ,vdlx 1 .-, ' N . 1' x + fl ,R ' I x If. IJ. HlTRIlll'IIi'l'. R. Ho1.s1Nu1zR. . MCU Company j. li. M0R1Q11oUs1-:.. j. A. lioxu-:Y. . . G. M. IJILLARD. . . G. P.WAr.R1cR.. .'Xl.I.l-IN tll.r:NN, C. .'XRMS'l'IiAh Iixal.1.,.I. Bowxarzs BYICRS CARR, F. CARR, W. CHAPMAN C'ox.l.uaR Cowwfw, P. ....... . .Capiain . .l i1'st Lic'utw1a11t Srcond Licuiczlcnlf First Scrgczznt . . .ScHio1' Platoon .S'crgco11ft . .Junior Platoon SL'7'gPlI1'If SERGEANTS 'l'U'rwll.l-:R KICKICNNY CORPORALS CANNON .HORNICR 1iowl.lN1:, bl. 1,411.1 PRIVATES IJANHQLS ,IoHN XIA'1'Hl4:vvs,S vl':AS'l'MAN Km.l.uM MCCLAMMY PZNIDLANII IQAISI-IR, il, M ASSICY FRAN RLIN LAW, J. Nm RERVIS GRA v Llcw I S O R1fU'r GICISMICR l.l.ovn PALMIQR, J. 1'fARRISON KlAx.oNl-: PERRY, Ci. HfllIS'l'1lN,fi. P. M Ul.I.lS RAl1,r:v HI-:Av RICGAN CARAVVAY GRAVIES, R. RUNN1-:LS ROBERSON, li, Y, S'l'RICKl.liN S'roNl-:, R. SM Vrl-f, T. VAIilllEl,MAN VVoons VVoo1.R1nr:lc VVHEARY ------M -.-W-.- --.V --WY . W. ...N ...,,,-,. 4, . ..-..,.. , n-, , 5 'L -. 1 X , 1 1 . 1- 1 . ,. , - --,vjzxlf'fg1A7fq'17g'1?gw+'v. X, j7Q171x., 1 , 'rjf,.,x 1 -' ' -, 1' tg ,..,ff' Vx-',:fN'Q,-AXL..:.x-,A ...M 1 1 X 1 ,. 1 --A-- ---- - '---- ' A . K 1 f, 1 A - 51.91 fir 51,7 . .1...1.13-rskyv, . 1 1 1 Q , ,.,,,1.1, gif 1-1,9151 ...fz3w.J,-11 1 fy .1 H ,fm .1 ,gli 'ff-V 'I-,- U 1 1 f 11 '41 1 ' 1 fx. '1 F I 'N 5 1 1 W ' 1 V , 51 1 A . 1 3' Af 1' ,A 'J ! 1 , I' 1 1 ' . 1 11 - 1 5 3 1 .11 1 1 12 1 2 fx 1 1 1 1 11 11 1 1 1? E1 14- r1 12 1 1 Ng 1 ,X 1 111 1, 1 I A3 I1 N 1 ,, Q1 1 1 -' 111' 1 1 '1 1 1 l 1 1 , 11 'I A 1 I .. 11 ,, 1 E ,. I 1 Q E 1 - 1 I F I 1 il I1 .1 il 1 11 1, 1 1 ii 55 Ei 11 Q1 11 f I .1 41 11 1 I 11 '1 ! 1 1 4 1 l Il I 1 11 Il A U is 'i l ,1 1, .1 I-' 11 ,-5 '- fljfi' L, -, 7 ., .V.., ..,-,--. -11-V.-,--,..,.,.. -, gvf-. -Mf if:': A1 :'1 ' .-1' f v ,:.3 xi.. Vi! 515, ,,- I ...VI .1 .-! x yr, 1 1 1 1 5'3- .lj Y., .- 1 5-I1 .I X Lf W3 1?-5 1'v'! ix '1 P 'fi QC. 19,1 k, 4,01 4' '1 W1 1'f' 1 1551 32,91 1.5.4 1421 11 Y.- Q' -I , N ny' A-2 11 ,U 21 I :JK-J rL'l 1 Rf'-'I Y. ff.. 13 rf- 12, iffl ?E 15- 11, if U14 191 Iss J 51- t .5 a' vi 131 SJ' ,4 . 1 Lf, - if 2 2 Yi? , K1 PF? if-'fi 1.1 if 3?-.1 -.f 1 1112 IX' 3 .-, 1 HCI 1:-1 f I g.,j'. '1 N' 52--1 1 .1 1 1----1 ,X .. J' I . ix 133 if-fl ef! ff. YN! :-1 .fc .1 ,- ' 1. 1. 17,1 . f,.,, 1 ,- I 1 lx 1-., .,, , 1 , :,,i',yi.At,1'3-.11X'f:x-4f!-.-Ixg?-V-is,,f:1v,:-aI. f EW!YAVAVAVAVAYKYAVAWXVAVAVAVAVAVAVAVAUNWYBVAVA AVAVAVAVAVAVAVAVAVAVAVAYA? WWWWVAVAWVAVAVAWVAWWYM. IV VWNWKAVAVAWA'NAWNRVAWAVAVAVAVAVAYAWAVA AVAVAVAVAVAVAV f ,III x . I I I I I C I WILIIA N W L MAY1 11 'I111 C111s11 1Il7I Imx DA1111A1 AN 3 N1 MAN I I 11w BUN XIA11 L 11MAN I111 1 MAN 1 I ll P -v H gen- xx-rr:xrr1:xrn1zxxu.uu:urrxu:xrxuxxuxxxruxxnugxxnxluxxxwnx K l 1 '51 .... 1 ... . A .QL 1 I I 5 1 D Company SERGEANTS AIN CORPORALS C 1N11Ax 1 PRIVATES IIINI N 1 H1UQ1 Nj N I I NIANNAKII 1 XIAPI XIAIIII W9 1 on NI J11rC DLR XlcC011M ILIx C Capiam lzrvi I llllfC'l'llI71f Sccond I 141111 Mant I zrxf YL rqaauf Scmor Platoon Terry am' lnnwr Platoon Sffljlllllf IANNII A 1 iAN1111q1N 811111 Llxlllil Ml II C1111111 M C I1111 N VA111 HAN W1111111A1 W111x1 HAM X N 111N 11 2 2 ? S 4 2 2 2 2 2 2 2 2 2 VA AVAVA if li? . I A .1 f 1 E 1 1 m . . 1 4 1 1 Q f E 1 I 2 C 1 E 1 1 4 QQ 77 ' E E 1 . E T. V. - 11: ..................................... ........... ' Q I . '. E.. ......... ................ . .. ........... V.. .fr '1 . 2 I I. II. ' -:NT .....,................. , ...................... If -W If . kg I F. R. Ii A111 ........... ........... . .... ................ 7 ' . 'Q 'I I Q 1. I G. S. 9 1111111 .............. ................... .' f' . 11. I 1: I f M. 11. 1 11-:N ...................................... . A I 1 :Q 5 I s , . 4 . L A11 '1cN'1'1s11 I' '1'A1c1e W111111, W. ' . 1-111111, H. 2 '1 ' ', W. R11111-:11 .1X1.s'1'11N D111 11-:11soN 'I'1111:w 7' 1 IlI.l. 'I'1111 As, . 1 3 I f IIA1'oN C11AvA'1'11 611111111 Lv NC11 Q M CGI1-'1-'IQ111' 'l'A'1'1-2 S ' B11:1.1., 13. . - 1 no . 'a-1, 2. I'11 'I l' 'I'u1.A11 G 5 B1-:1.1., W. D ' 1 H11 's1a11 . 1 RICQ II E I1 ' ,L E1.11:v 1 . o , . . -1 :, F. . PE .1 1 y 1 B11 N, Q. If'1'1 1's JO 1-is XIII. .11:11, C.. .' -1' 'Y . 1 1 1: G 1 4' az Ii 1 'INS M 1'A1:111c 31.11 ', IB. I.. 1 li . 2 1 fo.a 1 II11111111 11: 1-1112 1' 11 1. 1 ' 'Q 7 S111 11111 IV11 '1' '51 E 1 , , .. 5 - 4 qv ' ' 'Q M A W G ' R ..-III-ff '. .' . , .QMQQ QQf1'Q...ffQf1lQ1IfQ. QIl.'.ffI1fQIf1f.QL-....1I..-IlflI.'Ig-l.-.---.L.-II.l ' ' 4 951 Av vmxw Y vNAvmimvAv vmmf vAvnm1mvAvnfAvAv VAVAVIW VAVA ' VIVNKS Ia'-v.,L. I fix' ,Y , , ,ru V J WffQ f lQlQf V',15f '-, MQlfQiQg'1':'i TT'T QF '1'T'1 'T' 'T ' 7 -T Y -7721 4 I 'T TTT' YI V i:'72Qf? gm .. 1 E i 1 fx . ,A .uf -' 'V YQ- --1 ' V5 - , a'.,fmiw,'c:f.f.': S114-alfa, .Lael aw.,-wx: ..,.- w.. P. f, . .... ..W, .... . ,. .,,. ,.-,,, ,...-...-...-.. ..,, ,.,,, , ,-,,.,,d,.,-,.,-,......- ..,. -,-........--.....,-.- V-......-,,.,-. .... 1.-- .... .,-.- -.-..,.- . ,. . .. , up-,J :Nia v' W 4 v- 1- x.,:. wg.. 541 ..1 ,gL.. 1...L L u.:u.U1.un::x uu.xxxu..1.x1.ux.x.u.z,Li?.u f ' I ' lq 'J- Ti . ' 11 '!, M k ,'nr,,f ' fi f ' . ' . ' ' ,- J fi' A - 1 4L.,,x.-....m.5G J xx ff. ' 'N I PT iii? rv la H 1 w I y, t, . :XXX '12 Xa gx a fi 1 f Q . Gif U Q vs Siv . K Mi i Q gr! . ' U ' px! H 1 av 1 ' 'Y l Vi ity ' , P ,Q 1.-3-Y 1-' 1 ' U ' - E53 , If I . glff xx Y x ' 3s ' , - .5 'N .Eu ' 5 W1 H Vik H375 5 ' ffffi sa! f - 5 : W3 Q 1, ? 'Ei-i 5 fy, 1' ffl N 4 i .4 my 1-Ei '4 ffl c it G P314 Q Til? 4 E1 s Pl ' Q fffggj , U ,. I 7 'J , ' 4, . W- , , gig1ii 5 , ' i 'Qi5 -l'::,1TLT'-'A -A4 1 F Ewlifj f. ...V .--www W .. 1 .. .l 4 4, 1- . J M1 J, -l J., I1j:f,1Pf,L4 .Q..Fff .PT F? ,-- '-'- , , . . .. ,. . I l , , 'l Il, , AI. 3 mi W I M, Vw ':.,.i.q..:,i--1, :W T ..z,,,. IV. .- ! 1 , z .w .f 1. 6 5 . -f . '..f w!.: Lf'-f1I4.'-'.-l'.J:, ,m.,u.f'nR f' I tlx. ., ,-. ..,. .. ,,., . --..-..,-.,-..- M.-. 'f, ' f-K -4---1 xx 1 'lv v-' ' -', x .,f.'.-- - , .f l if f I 2 ,V l! LN jlffml X ,I K l 5 N-x',L','-Z lr! 'X-WN f ,vim-fmnlllf 1 l --'l -., . l V . l gl 1: '.','l l ll' ' ,WE Lf fl'fl li4,l QlZ1', le' 1 ll ,,., :m, fy ip --,, l all, , .2 fl lil N H51 -.1 lr' ll '. jf ' ' ll fl ng . . 1 1 gg 3.1, lyk sw-.mr M. l . ll: - 'vb' . 1. A l.jT .lfl Z l.I Ei lf A l Sl ll , W il lf. Q If fl . Va l ! l lf is R ll ufg 1 I lf ll l . l ll lfl l l fl 4 1 3,4 X-I-yi K ll f E . ll ll :.,, ,-p ,y lf, lf ll ,. l l Q 1 L , if-41 ill! l ll l ll ll, l A - lil rl? 1- l fl ' fl , 4 'gill il fl 1 ,y ll ll f E 1E'l . - f lf lf l! -. J: f-A fl '2 l A1 l l- l z gfiffl l 1 lege ll l :Eli l Q: v l iffffu, g l Band f lu.- l l r f l'g5f,r l l 5 u l ll W. G. W11.l.1AMs. .. ........ Cafimn -A l lf i lg I. 5. WILRLNSON. .. ...1fir.vt l.icuz'cm111t l l il ' ,, , f 1 H. MA'F1Il'lNN'S ..... ................... . .... . Mrxi .S crgvant 1 4 H. W. fHo'l'C1lK1ss. . . . . .Scfzior Plaiowfz ,S'c1'gcm1lf and D1'um-Major x . Z S f 5 1215 l SERGEANTS l lf, l 1 llm.l.lNc:, Nl. MC1VI+ZR :rug il r 5 , 1 l A . 4. 1 5 2 .i ll ' ' E l . l 1 il Lcnolfl-:R l lf' l : l c iff- lf I li l 1' 1 lil? ll K 3 l l l AN111-:RSoN, H. fqfqxl' 5 l Boxl.1cv,I'. 5 S-mf' 1 l CLARK 4 g l 5 CQAMNER l ' 2 I L'AMvRlal.l. : Q 1 5 DUPAc:1c l 5 Q , EVANS ' 3 l 5 l:lFIlVIS'I'lCR 3 5 A gl FIJQSHMAN E lv . ll GUIJVVIN l 1 . ll l I A l ,ll l E? '. .02 .ul xl f X lfl l ff -fl? l ...,. .,,,,,, .... -...--...- N. ...., ...,..,--..-.. .... -, ...-M-,.... .1-.,, CORPORALS SICASIIORIC IXMBROSIE PRIVATES X ...qw V7 ,fx Q., ..,... .. ...,.. .,.., ,... , 7.g,,-,.. .. ., .. H ARIN K I Nusv KlIEYlCRS, L. l'lCAl.IS'l'l-IR NEFF PARKER, W RAN11o1.v1-I Ro1mR'rs0N, SHRICVE TRIN KLE J. .. , . vw-wr 1.1 :wr A. 5.31, -.r, .l ,. ,lc V ,, Y, xi - l..,., ,fp V A- 'of A 4 '. .N ll iQf'A.15L,1!.fl2fD1J.2ffff.3Q..l5,l..it-,.QW.f?':'ff:f,l?-.lf.L..s.ff.fQ1+lif lf1:,.1. .gf-.lf l Fill Tw- R fl I- - 1 X- l ' f ' YAVAVAIAVAVAVAVAVAWVAVAVAVAVAVAVAVNAVNASAVAVNRYAVAVAVAW''YAWRVAVAVAVAVAVAVAVNAVAVAVAVAVAVAVNAVAVNQ 5 ' 2 xxxxx-X XXXXXXXXX .: 9- . , -- sa IE II n I 5 L .. . Y , ,. . - A -, - . AL . in X , ltr , - n D . ' A r 1 iw: ,A W ' -T ' . V ' . - I V 1 - A 5 3, ',K,3:igh.g3A5 ' ' A T , K - 1 f A - I P , , L- ' 7 A . , ' Agjjxkt' mi' f 2 Q : .Y , - , 0,.'f,J Q ,fr. 1 .1w. uf A 1 , ,f- a -4 af S :S 5 5 4 4 2 9 2 ef 2 5 S 4 ds b AVNAVAVAVAVAWKVAVAVAVAVAVAVAVAVAVAVA AVAVAVAVA 7 ?,eU KS. Q 4 . Q 1 E '2 2 a f 2 r 4 S 5 Q Q . , r D X Q4 2 2: 5 S 5 S : S I X A 2 P . E Spa 5 . QUARTERMASTER COMPAXY 5 ' ,- W , Y K 4 fi 11-fill! 114' Ifl ? 5 X Qs-1 4 ZAVAWYAYAmYAVAYA AYAYnVAYmfNA NNNNNAVAYAVMNNNAYAYNAK'GYAVAVAYR'AYNAYNNAVAVNAVAYNAYNAYAVAVAVA ' fi. .Q-I D . -I N ' is . E A . VAVAVAVAVAYAVAAVA AVAVAVAVAVAVAWVAW.VAVAVAVAVAVAVAVAVAVAVAVAV,VAVAQ 4 um W 'mnmnm H 1 ' 'js' ' ' ' '-'-- ---'----- - ------v ------.-...... ....,.,,, ,,,,.--.-- --..-4 ' . P ? Q ..rM..,...,...,,,,,,, ..,... ........... ........................ ..... .......... . ....... ............. - . . . . og, 35 4 N' x0 Lk 5 9 A W Q A 4 4 . f'w 5 9 li ' . , 5 l 4 5 Captains of the Milit C ' S' 'E 5 E 4 , f lk ary ornpames mce 1885 A B 2 f 3 ! Nlggarwick N 2 ' - . all' + 5 4 f 1887-E. H. Madduex if 2 5 f 1888-C. D. Farror 5 E f I , 1889-C. D. Farror . f Q ' 1890-A. Eggllorn . N f 3 S 1891-D. B. Kerr N 5 1892- A Co.. B. B. McCutchan 4 B C . c. B W'l1' N 4 S f go., N. Green: B Co., I-cf. M. Hamfltglms A 3 a ,L 1895-W. C. tlfollork Rlchersons B Col' W' S. Whitmore A W. 5 3 f 1896-W. C. Roller W ll i y 1897-J. L. AI fl 5 l 1898-C. S. Jeri 1. 2 1899-W. F. H de 5 y r 4 1900-E. B. Warren 1 5 2. 1901-H. B. Andrews ' l f 3 1902-L. T. Warren . 4 Q 1903-H.Brightwel1 ' A A go Q l M. McCreery - S 5 V -B. F. Beard e 4 W 1906-C. W. Parr 7 5. 1907 A - 1 A 4 1 1 Co., E' D' G d 5 :ABU . y Q V 1908- A co., A. c. PZTC SB' C0.,2.'CYJVDkK. Price S P 1909- A C0-. T. B. Sterrettg B CQ, l 4 4 1910-,.A,, . l J T. Cook 7 a Lo.. W. D. Easlyg B Co., C. E. Smith, Jr' 5 9 HAH ' ' , UB!! H u U H - 5 1911-J:L. Jeffries. Jr. W. F. Welch .Q BC D BAND 5 f 1912-T. F. Clemmer H 4 p . H. Morrasy 4 1913-T. C. Waters F. F. Fox E P 1914-L F. Clemmer, Jr. Frank Burdette J- W- Sharp J 5 5915-C. C. Loth T. W. Robinson J. R. Ulloa 5 5 916-E. A. Fox H. S.lRawling5 , geiland , S 4 C ancM - . 0 rlgues 4 7 1917-W. feo. . Barger Q Q 5 3313.-R. 1? Bfffflffsll Q 51 il Btfffqhoiflson 113fcQQ,'f,f,te C S , W. G. Scott af S 1'-Flall-fggshead A' L' Davis. JF- C: V. Winfreer C.1?JaaVl:?s liifyldggperton E 2 ' 1,920-iisewlgagqnstein Q 1921-D., H.. Emi-S ical llgunnlels G. A. Evalns W. A. Fudge ' 5 3 1922-c. H. Tonner, Jr. le. L. Bridger W. B. Bffan 111-19I.gl3gl.Jr' E.l1g.V1?l?g:1:: 4 1923-G C Guvernator W F' and ' E , . . . . l ,I C t , I . . . W. E. Grnmlau 5 X 1924-R. Bargamm, Jr. M. B. Vkzggxzigodr E'.rD.li2dlI?eal n 'B.CB.LBggifer X 3 Q M. Sproul E. D. Grady C H T . and J. B. Terry f -D. G d - . anner W,1-LK 11 S- s 3 A ra Y W. W. Boswell F. D. Humbert C. F. Wiaisgls G. Wgsggs E 4 5 5 . . 4 4 W . E 4 B f MVAVNNIMVAY -f vv vv W - ' H P V V E AAAAAAVAV YA AVAVAYAYAVAYAYA RYAYAYAVAVAVNAyAyA A4KAvNS an ' . WWVAVAVAVAVAVAVAWVAVAVAVRZKVAVAVAWNAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVQ A E I ,pq qslllllmm minus qliflll mrisre Pro ram of Tr'a1n1n WEEK ENDING SEPT 26 1925 School of the soldier Steps and marchmg MIlItary Courtesy WEEK ENDING Ocr 3 1925 School of the squad Mllxtary courtesy School of the platoon for and 4th year men lnspectlon WEEK ENDINC Oc'r 10 1925 Lalzsthemcs School of the squad Manual of arms Inspectzon WFEK ENDINf Ocr 17 1925 School of the squad School of the platoon Manual of arms Lalnsthenxcs Care of equxpment Gallery range practlce Nomenclature of the rxfle InspectIon arades WEEK ENDING 801' 24 1925 School of the platoon Makmg of the pack Gallery range practxcc Callsthemcs Inspectnon parades VVEEK ENDING Nov 1 1925 Calxsthemcs School of the platoon School of the company Maklng of the pack Dxsplaymg equlpment Gallery range practlce Inspection parades WEEK ENDING Nov 7, 1925 School of the platoon School of the company Gallery range practxce Calisth ni e cs Practlce March Inspectlon parades WEEK ENDING Nov 14, 1925 School of the platoon Tent pItchIng Cahsthemcs School of the company Practxce march Gallery range practice Inspectxon parades WEEK ENDING Nov 21, 1925 School of the company Practuce marches Calxsthemcs Tent pltching Gallery range practxcc Inspecnon parades WEFK ENDING Nov 28 1925 School of the company Gallery range practxce Lahsthemcs Extended order Practice march Inspectlon parades WEEK ENDINL DEC 5 1925 Cahsthemcs School of the company Gallery range practlce Practxce marches Tent pxtchmg lnspectmn parades WEEK ENDINC DEc 12 1925 Guard mountmg School of the company Lahsthemcs Extended order Tent pltchmg and dxsplaymg Equipment Gallery range practlce Inspectxon parades DEC 16 17 18 1925 School of the company CalIsthenIcs Cleamng Olllng' and stormg ment UFC 18 1925 'ro JAN 5 1926 Lhrlstmas Hohdays VVEEK ENDING JAN 12 1926 Scoutmg and patrolmg Cleanmg rxfles and equlpment Inspectlon School of the company Calxsthemcs Gallery range practice Guard mountmg WEEK ENDING JAN 16, 1926 Map problems School of the company Gallery practxce Callsthenics Guard mountmg Tent pxtchxng Inspectxon panades WEEK F NDING IAN 26, 1926 School of the company Calisthemcs Cadence drlll Practxce marches Guard mountmg Tent pxtchmg Map problems Scouting and patrollmg Inspection WEEK ENDING FED 2, 1926 School of the company VYYVVYIYVYYVYYYYVYYYYYYYYYYVYYYYVVV IVR qsv- ......... .-.................. . ........................... ..... .... . .. ........ .uap it-414 'E a 5' -I ...,... 1 Q ' ' Q f ,hr . I ' ' - A . , - 1 v I Lv 1 g I , I . , 4 5 . , I '. , ' I Q - I 1 u , I 1 v ' T ' yi .0 1 I - I . . ' ' - l . Q ' '. VAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAA l V10WVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAWVAWeVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAQ f mmlll 111 lllllv ni ,L1 Advance guard problem Calisthenxcs Guard mounting Scouting and patrolling Parades reviews ceremonies Gallery ran e practlce WEEK ENDINGgFEB 14 1926 Map problems School of the company Practice marches Gallery range practice Callsthemcs Extended order Cschool of the platoonj Inspection WEEK ENDING FED 21 1926 Map problems School of the company Practice marches Leremonlcs Extended order WEEK ENDIINK FEII 281926 Map problems School of the company Practice marches 'lent pitching Display of equipment Parades Extended order Calisthenlcs WEEK ENDINC NlARCl-I 1 1926 Map problems School of the company Callsthemcs Bayonet training Gallery range practice 'lent pitching Display of equipment , Extended order VVEEK ENDING MARCH 14, 1926 School of the company Guard mounting Review and inspection - Tent pitching Scouting and patrolling Display of equipment Calisthenics WEEK ENDING MAIICH 21, 1926 School of the company . Guard mounting . Scouting and patrolling . Range practice ' - Platoon problems Review, inspection, parades I School of the company . - Guard mounting Platoon problems Range practice Review, inspection, parades Calisthenics ' WEEK ENDING APRIL 3, 1926 Guard mounting S TF Platoon problems Range practlce Review and Inspection Parades Group games WEEK ENDING AIRIL 10 1926 Guard mounting Range practice Platoon problems Review Inspection parades Group games XVLEK ENDINK APRIL 17 1926 Guard mounting Advance guard problem Machine guns Range practice Review and Inspection Group games Parades VVFFK ENDIN1 APRII 24 1926 Rear guard Group games Machine guns Platoon problems Range practice RCVICW and Inspection Parades WEEK ENDINc MAY 1 1926 Out post problems Range practice Machine gun 37 mlm gun Group games Review and parades Inspection WEEK ENDING MAY 8 1926 Company problems ' Pistol marksmanship ,Automatic rifle Range practice Group games ,. Machine gun Review and inspection Parades VVEEK ENDING MAY 15, 1926 Company problems Pistol marksmanship Automatic rifle Range practice Group games Machine guns 37 mlm gun Review and inspection Parades WEEK ENDING MAY 22, 1926 Sham battle practice Company drill Guarding mounting Range practice Review Parades WEEK ENDING MAY 29, 1926 Final examination C ive A me K Q 52 Q Z Q Q 'Q Z E Z 3 WEEK ENDING MARCH 28, 1926 4 Z Q Q Q Q Q 52 Q Q Q 1 f 1 f 2 r S 4 2 7 4 2 2: E E 2 E r S G P S 4 r S 4 5 S 4 'D S S 5 5 , . get ,,..,,.... ........ .... ..................................... . . - ....... .... ........., , Q P g Q ,p Ia f Q I Q, ?f,,,,,,,,,,.9A,,,,5g.f L ................ ....................................... ..... ..... . ................ . . . . .,,M2:'.a QL 5 P K ' I Q 1' 1 S 5 I I A s I 4 4 P- 5 it E Q I ,I I I p I I E ll Q Q f - , -U . N E a ' I 4 I f I a b l s E i 7 . 7 P f , . . , , t , 4 I I -I I 2 4 il 7 9 i, - . I - 4 4 ft A ' I ll 2 5 ! ' I . . . ,N E 9 f ' - E ll E 5 ' ' .E : . , ' 2 1 l ,. - 7 5 .. . .. , l 4 5 A 1 E I I I ' P ' 7 3 . i 1:1 , In ' i i 5 ff ,. , I . 2 4 , . . I . E ge P - 7 bw mfmmwAfAvAvNAmvxvnvxvnvnmvnvAYAYAVAVNAYAVAYAVAYNAYAYAYAImmf.S Ib '- I I I A . 1. I. I I IT 4, I I I I 1... 1 fl 4 I -1 I I 1 ' ' I I I I 11' L 1' 311' .5','1 ,Z I 11' I '1 wh-I 1X .li .Il ' 1' I,I 1? 1 1, X A 1. f-1 rv.,-J-H r I 1 1 .f,1 i I 1 I XII? LI., 191- I 1 , ' , 1' 1 1-V? --FI'T7Y17x.g:1 , '11 ' H., ,, Q , 1 , f11 111-w-'T-'. L 4, f1 HNVfGDgKv 1Iff , I .I I1-,ix-,,1 I -fi 1 'I II N -. 12' A1 - 11 'I K , 1 FII ,Lf I 1' IW-'1' I -- 1 I , I I- ' I. I ' I I ,T-- In I I I ff 5 I I 1 I'- - II 1 1 3 Q I .1 1 I, 1 - 1 , 1, I 1 1 I' I I - , f,I, 14 f'1' I LI 2 I 'I It A 1 I ' II I I I '- I I4 . I I ','- I I I I I I 1 1 f'If IL .Q 1 I' I , I I: ,I I 1 I I 1 I il I 7 I IIII I-,II IIA I If II I J I 'ff' 1 I I I' I I I :fi I '1 II I I C' ' 1 I Y II I I 3' 'U 1' 'I'. IIIII IIA.: I1 1 I I - I -I1 III: Ifmf 1 1 X1 - I . I I I I I I I QLI III II ' III I ' II I fVH I ' 1- I I , .xy . I I I I I I2 f 1 I , ,1-'.I I I 37-'f 11 gb If I 1 . -yn If gi I II, I ' N ffl' 1 ,I , I, ,II 1I I 11 . w1,I' I 1 I I-I I I 1 I 12,51 1 I 7.1 I I IQ-1 I I Ir. 1111 I If QJ I I arf 1 I I iz, 1. If I I 1 I frxpl I I If I I .N-.lj I I I I I I I I1 I I 1 1 1514 I 1 I I I I FCI 1 I It,-R1 ,J Iii 1 ,I 51mg 1 I , .1-' Q I I I f'1 i I 1 I wtf: I I I-.ul 1 , 1 I'11'k I I I :I'v.I I I I .jf I I 1 I I ,L I II-E I' , I If I ' I I 1. I 1 ' A-, II I ww 1- I IW 1 ' 1 322 I V i 51 I IIN! 1 f'1 E ' I I 5251 1 1 - 1 I I I I ICI I I - If I I gx ni I 1 I ' I fm, II I kv' I I 3 I I I - qv, 1 1 sM,1 I 1 I -. I Iv , 3-1. I I- I . , ' I I 1 111 IM,IWv1:11 w4fA '1Qw -- V I, 31,-35 1K 112,111 4 -I. , , H ' If ' -J' 1.4 f ' ' '14..f,gjAjA II1I'1V, '1',.'f-L' , x 1. , I 1- wma ,11,., H I ., I 122' -------...H-.-,1,A,,i J : .. .:I W5 1 If-I' II f ,H I' 1 gl.,-f, I 17, X -1 1 M'-'-- 11--1 --Y..-.,,,,,-,ww 1 ' I gg '--A-A----1--. ,bn , . A I I '1 ,f I ' -ff-5 V11-7-f-I-,J ,. -'-1--1 -,, 11,1-,' ---1--.--,, 1 ,I I IU ig I ,-,fx ,I .11 ,111 ,,. ,141 1 . 1 -+1--.,..,.,,---B--u - - 5-.Au-Lil-W 111.311 1iAFP-L, 1. Xa 1 X11 'mu-A. 1,1 :V-131.1 r ,Q K - '-I N ------I-.-,-,H- --- - - -IL ,yin 114 If 4.,Iff'N1l' NI, -1 1. ' I-, ' -,I ----- L -1-41-JI-L' if.L.1fL' Ivf' 1 Wx-.I .1 -'----Ll . AVAVAVAVAVAYAVAVAWVAVNAVAVAVAVAVAVAVAVAVAVAVAVAYNAVAVAW VAWRVAVAWVAVAVAVAVNAVAVAVAVAVAVAVAYAVAVRYF 1 VAWWVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAWVAWxVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAQ Hrii n ti? FF i ff: iii-fFe4,Q 3 '41 U W 55? QQ 'Q E2 AQVAVAVAVAYAYAVAYA v A li'NNAVNAVIVAVIRVAVAVAVAVAVAVAVAVAVAVAVAVAVKYAVAVAVAVAVIQ'AYAVAVA 'IYIVR'lg IX' 'fe Qi . K .di nk 4. - , 1 . x 5 -. I 5 1 X 1 YF Ai f-fix I - X51 xi xsxxsxx xx Q RYE A ' if' f' Q!'::K:g-11 31.111153 . A I N 5, i E 5 ' - -, :Eff 2?-f.'1r -L, ' E I 1 ' . . . -gi:-A: Slilazvf -. ,r:.,.3,: ' 3 , , 1 3,53 5- gg, , iiggigg L1 I- 3 1 ,,,,,,,gEZa . , E 5 71. I fj:3f1'?f ' 5 E - F. ff-.Q 5,-tn:-:Ei-li H - 3 l .g 'f : - A ' 1 1 Q f ,J f Q. A 51155 A 51315 V A '. 5-fy:-1, 1:11, . - V A A , , xWge f llgfilllll-fill 4'0' I - - X ' ' ' X ''AVAYAVAYAVAV:VAVNAVAVIRQVAYAVAVAVAYAVAYAK'IYAVAVAVA'AVAVAVAVNAVAVIVAVAYAVAVIYAVNAVR' ' i., 5. 1 i '- Q 2 nik. u 5,1 E f .T 1 Q17 I V V , 1 -1 . Q X i - . I Jr'- Q 1 1 , 'Xi 2 Lf? Jw . ,H .fl I F. , X p-X5 ! ef e 2 l M r 1',,i 1 if -. 5 751 if' 74: TV? , wg -4 I -'xg 1 :K 2 .-L i -Q' 2 1 1 . 1 g ' - V ,gs 1, I S, flfq ' 3 I R4 I DE! L-ff Exxl Lf I VN4 . F- ,Q 4 Vxxi ifge :K-.f iff 5 u ,,, , I ,f4 Y: A-. P T Fifi F4 ,vii we I 3,4 Vx-2 2- jf I ,ff H 1 Lx., it ' LJ.: iv-'X 2,1 5 .ffl fa.-! ,,.. lgff .....-, X 1 M' ,iff . ,- . X S K RECALL STAFF 4 , x , , x X 1 gvAY4wvAvAVAvAWKQ AW. AV r WVAWWRVA AVAVAVAVAVAVAVAVAVAVAVAVA-'Q AVAVAVRVAVAV IW f, 3 mlnu rmmw ' JA uvlvipgi-ntnleulnu fqwsmgmh .-mn.LIv3:JnI.'Inm, - ... . . -........ .. . .. ..... ..-------. n Q' . K ML!! ':,,..!?X?. . IQ lx ! N E n . ...As t9 N 4' , f Q 3 t 0 N VAVNAVAVAWKWVAVAVAVAVAVAVAVNAVAVIXRVAVNAVNAVAVAVA NAWVAVAWVAVAVAVAVNAVAVAVAV K btw f W W BOSWI-LL GRADY SLEMP III GRESHAM WILLIAMS MUNDIN Frrz HUGH ' C MAYER L W BRATT J S W1LK11xsoN W SHREVE W HOLSINGER P WALKLR D BRIGUL' D BROWN S HOTCPIKISS D SEASHORF PALMER W H MCKhNNEY T H TUTWILER FMMETT The Recall Staff hdztor tn Clnef and Business Manager Asst Edztor 1n Clnef and Buszness M anaqer Assoczate Edztor Asst Assoezate Edztor Athlettc Edztor Asst Athletze Edztor Socwl Edztor Asst Socwl Edztor Mzlttary Edttor Asst Mtlttary Edztor Adverttsmg Manager Asst Advertzszng Manager Joke Edztor Asst Joke Edttor Asst Joke Edztor Art Edztor Asst Art Edttor Asst Art Edttor Pzeture Edztor Asst Pzcture Edttor Tvjnst V w f N f x N f N K N ' x f A R N at C w , N J . P C.B. ,.. ......................................... ' ' F.R. ..................................... . ' ' C.F. ..................... Q ..................... ' ' LH. V ..... ..................... g ....... . . - ' G. S. - , ........................................... ' ' VN. . .................. .... .................. . ' ' 6. '. ...QlfflfffllfffffQI...ffff, '. -- F. D. HUMBERT ...................... .......... A sst. Advertising- Manager h R. . .............. . ............. . G. . f .......... ..... ............................... ' A A. . A' ................ '. ........,...... . ' t R. . ........ ...... Q ........, ' ...... .......... . ' H. . ' ' ........ I ................ .................... ' V - M. . . ........ ............... ......... . . ' A. A ....... .. ......... ...... . . ' 4 UV ' W 3 A2 WK IA- A A N I VAVNIVIVAYNAVIRVAVIRVAVAVAVAVAVAVAVAVAVAYAYAVAVIVAVAVAVAVAVIVIVAYKV Fe DAVNKG BAYONET STAFF R. D. BROWN ... A Q 1, 'mlm 5- lfllll mm- N ,,fis:nN fieggq, Q1 N C B SLEMP ITI C F. WILLIAMS . F. R GRESHAM Editor in Chief . . . .... .... . . . .... . .... . . Editor-in-Chic Editor-in-Chief W. W. BOSWELL ....... ............. . . . . . . . . . . . . .Business Manager E. D. GRADY C A CARSKADON M D SEASHORI: L W BRATT 5 D FAIN T S WILKINSON H S HOTCHKISS RWI-IoLs1NG1:R... ........ F D I-IUMBERT ...... .........Asst. A. B HUNT . . . . . . . . . ...... . ........... Asst. Business Manager . . .. ........................... ...... A ssistant Editor A ..... Athletic Editor .........Art Editor . . . . .Military Editor . . . .Exchange Editor ..... . . .Joke Editor .folce and Art Editor . Advertising M anager Advertising Manager . . . . .Athletic Editor CAPTAIN CHAS. K. BROWN ..... . . . . ........... Faculty Adviser BVAWUXVAVAVAVAVAWRVAWNVAVAVAVAVAV VAVAWVAWNVAVAVAVAVAVAVAVAVAVAVAVAVIVAWK? qc, ,........ .... . ' 3311131 a r 1 Q - . .--. J- 1. ..... , .......,', .zwxenrrfe i ii , 1 Q 6 . L!! -qngfrgge .. J!!m,,',E,5Jm2q,1 --.......... .- .-........,...-.-...-..... . . .. . .. ... -................ ...a Y ,, is ,Inn ll 5 1 ' l VAVN:VIVAVNAVIVAVINAVAYAVAYAVAVAVAVAVAVAVAVAVAVAVAVAVAVAYIWAVANW' NKVKM 4, f ffiQ ' W4 4,4 .. .'Vu'45 '4 'avr :Mfr T491 '- rf: 2 '-'V A 4 '4:4'4-4 'fr' 4 , , ,4 Xxx, I' x'k' 1 .f .4f'nf5'ffffxf,-X.fQ':X.'f:.-fwf,fiisZ-,51Zbt,..f.jx:f f.'iztlti' k 'F' A' 7451! fi '4f,g .- .Y . .. .... V Y.., .1 .... ....Y -,,.W--,. -.M...-. ...... M., ..,.-..,.- ..., ..,-, , ,... ..-. .,... ...,..,,.--.. . .. .V .,.- ..--.......... ,.,...-...-....,.., -,....-.., .,..,,.,.,,,.- ,.. .. 5' f j'fI ' N ..,,,., ,,.,.... ,, ,,, ,. . 1 , A,, , ., . W-, , . -'E U., lv iW4,ggp...r.x.u...444104.4.4,.4.4,,.'L:L54444..14...,mU Lu UI. ',4.,f,,1u .1,,w.1.kk K 4 X, if 4444 M J4414f 4:1 4 4 4 - 4 f 4 W fly: L fw'5rvm4,. .., -4'4f1fp414.Jul4.4441144444:114.-44:44-.441.4n 11 4rm1,.1'JJ 4' 'PHS -X Y l I 4 ,-' 4 fl H G- N 2' mf inf' If iif 4 4 I' - 3 4 I 'nas' 4.44 L-'4 H4 E jf 454 V413 4? 5454 Ellg 11 9431.4 VN - I 3 ' ,W r 44 ,. V3 U Lili? 55 I-:il f,l lffq girl ITA 4'-4:5 H I JL 45155 4 4,1 44 5 if F7415 P4 iii? 4354 45225 414:44 I ,L ll -14 4535 .45 T 4 Sf? 4'f f 3 ,f Hvffsx 9,4 4----J. 4, isf 3595 CHE f h S d B d cars o t e tu ent o y !'-. 3 ff.: W. W. BOSVVICLL . ,,,,, Preyidgm 4.f,5'i F. D. HTUMIKERT . . , , ,Vim-Prmidgnhf Kit 4 fi? I 4 I 4,344 rf ,- .,. 5 4 z-, E B ,,', I , V, 4 -M ,f4,, . .1, J. M. UYRD - - . . .Sccrcfazry R. W. HOl.SlNiiI'IIi .. ,,Trm,mrgr 4 !', 4 xl V -MN4.. U' 11' .,. ,A,,, . ,, . 1 Lp A ii51ii 'ii1 ' f1f,:'f 44 ff 1Q'S2 w',wjr1 'f-'s1fff'f 'wvgrr.'5f'Wfx w' qw wr av 'mf'wj1:uf-r'Qxmf'fx?-mr A 1, , 'vrrfmznf' 'Qin-?y4 :gr ' 'gff44j.:vj2 ij'1 W' f4'31- ' fgffblmfdnfm T54U3-'f.s.N.Q4,3!f13L135,3fM!E-ffieANh!! DJJXZJB -14 . .1ifm4,E4ffT.Ei,afBff.L54ff 1ff4i4lfQ.A,,-,,1,A,, . 4 5 i 4 I 1 i I 1 4 4 3 4 E 5 1 4 i 4 i I 4 4 4 . 4 4 4 4 4 4 ? 4 z 5 I 4 . 4 4 I E S 4 4 E 5 4 4 4 U 7 F 4 V 4 E I 4 J I I 1 1 5 1 I I I 1 Y 5 5 3 4 I 1 H x I W i I 1 i 1 1 l I Y I l i 2 0 M 1 . - Z 'lQ 2:54 '1 . Q-1? G ,i P 2 :Sf 3 ff 4- r I1-, , My x, N U5 -4 QNF, . .IJ i : 1- vp wr: 5 J' E1 , 7,17 If 1 ' ' i ' f V e 999999O9g 5 - ,, 1 5 J QEQUEUUUI' Ppiifa -H --4 .H E .-. E FI Q - f , g: 5 1 '11 '1 -3 v-E 4 6 -3 fi I fix L ig? Q 1 125 : 5 1,.JX:Q-if 'U 2 C' C e C C e F D 4 :-Q-. :A Iwi Q g -6 ,-5 5 5 ,Q 5 O 1 K XJ 4 N 77 F3 ' F -' ' T f 5 Q I 52222222 'T .Quia - ' - I 1- 1 ' 4 - 1 P P ... P 2: . , TW - he +1 HG Z z rl 2 z 77 - O gsxgffiisw ,. A ,J . . ,h , A . V -.. , . , , H , ,-1 F- 1 ids H , 572, F1 ww rx P' www Y- 0 fN ..3i1'i ' ' fd' . I 3 .fgalexg Q 'TJ E Z :1 Q Z - :Q ., 1 1'--Q C ' Q - ' S 3 HX Q. l 2731 5 E 4 I Q' 51 ,-- g'fg:f fj . 5 -4 2 x 1+ i 2 561 ' rf 2 U 2 NH' - A41 z '-12? 5' I : T-- 7 N : 5: 5 75.2 E -f I T 3 5' T I i bil 25. 3 1 ',x.. 4, ,s 3 51: 2fT ?? Ea-51 . ' .3 ' -,f f '153' L ft 2 I 1- Q Rf-3 iff: : X aft: S. :4 Q3 - Q :fi-2 Y , qi,-I N fifwf' 1 2 :1 5 . --'fzziiq 12.5 ex 1-mg ,Q-fry fi i 2'-as Y-.off M 1 We rx- f -'.l :L , , 1- .., -' Ti-fx, -,......,,,..,--...,.-. --,...-, ,.. ... ,,....-...- ,-.,.-..-,.,.YX 244 1 J l ffm Ixxq A., 1:..f-. --fl ..,,,, 11-.. 1...- ff-1. ,, ju..-N-,Q A ,-,f,MA,,Q -Q. L.,-5 ?4i'2--jlnfl r 12:-1 4 : ,f' ,. .... ...,.--- ,-.-.,. -. .. .-W,...,.,.,-.. ,,,. ,,,,q ,,,, ,,,,.,..,.,,,,,,,.... -.-.... .. -A ,,,. AM.-. ....--.,..-.. .--..,...-,. ,,.-,....-,v.. .,.. ...........,--...., ,., ,V ,.A, -.v........T.. .Q il , ff ,,, I., -, ...--,......-, . -- .., ..,.. . , ,- ,,,, . ,. N-. .. . . A.- WW. ..4..,-.. . .. - . ,,,, .-. -,-.-,. ,,v, ..,.-.,... ..-M. .. M. .-.M ,. ..,..-. ,.,-.-...,...-A.4,,.., ix --- ..-..v. ...-M.........,.....,................-.. ..-..,..-.-.....-.-....,.,..-..,,--...,..-.. -.-M M...-.-..-...... ..,. ...,-......-. .-..--.,,..P-,,...,..,,..-......-.,.,,..--.-.,....,..,,,-..-Am ,rf iff x'T J'wf '-TP? . -f': ', - if-,- 1f 'g 71:4-'Q-' 'T,w1ii'ff, 'png j'1'1:'?'2ffj':f',:. '55 -,7 'aqriev-rv 11:31 - 11251--33.1-w-me :.y.f:e3f5f-4 -5-'rf' J- q-5-f.y7lv. 7:16-,,,1:1f1l?. AL rm.,-LCD. 3.5 -71 iii. ,,Zf.-,Tv 71'-Q A111 -Vx-'1EiL1iQ1fQ'lgf'iAgL'Q.f ' -i. .1.1'f.LQfJJ'if Vnfri fwlf JV uw' fi'- -ff EV' 'H X-1' W' 'viii x'f'E RN r I V i , 4 1 , ,,,, r... W f' .. . , . . . , . .. .. .5 ' ,, Y A . --....-.-...-..,-W.. .... - M. ,,,.-., .-,..,..,, .-. ---N --- - --.W .----..--....--J 35.4 Q Tf T' 1'T'f, ''- Jf'7'1'Z'. . . . ' v WT :wmv-' --f-ff'-.-'x1u f-1'1 '4'f 1''H'fv'v'7',-'r'-rvffr-H':'2v1'f'z'j ': 7T ': 'r'2'1': 17'-'v.-rw:--r-1--xr'e ,'-.ma ,M f - V ffm .V Z '- F 4- 'f ' CIP 1'Xf 1 U' f Vx ww X1 vcr! 'U-'VMNI Kr' I ' Usfff 'Viv .5-'g9N'.f 4J..-LJ.3f.r.f::..rxFxfi1 l?1 A..ltfL'..f?YfAJs'iJ..l.iVjt31.'-'v.i.x,2..l,a',l,x.'.L-w..l.Xf..f,J m:,.'..-r..- s..:.e-.'.:..N.i...1,. .-, ., .. .... .., .1 f, if 1 ii'-b . . A,L . .......l K ?'1f W u -Q--1 . x If-fn.- -.- .H , ,,.,.,, ,,,,, W BIONOGRA M SQUAD X I I In' I I I I . 1 . . 1 , , Wearers of the , I -In H 77 I' - G 7 I I I 5 IPOOTIIA LI. Q Q V -IIYRII IQKNIICRS . -I A .g, ,igQ'3::::,,'.. H1II.SINlIIfIi S'mNla, I. 1.5 Liigrggqggfl'-rg... In'.f55,,QfIg5J:j:f'Qg3gL H UM m-zlvr, If. McA1.ls'l'lcR ,QQ-jE5Z5??5ffgff5E5Ejg:,liS5ILjrfj-.'jlff.Q3'-gi,2'3. L'ol.l,u-:lc Drum.:-:m1CK '1i55i2r?f:?2223541551551111, 1- .I MW I 'f' M W WILLIAM S, C. 'I'Av1.ok RAMSAY, I-I. M UNIII N f5g55:2gf52gQgfi5:, i5f:fSfg5Q3Qi:fi :ga F l 1 1,1-4 I N IEVA N S QQ2?Z!:LS1Ef '?:5Eg2f5Egfgf!g NIARRUW IQIFNNI-ILS :if13Z5555f Eezaa 4 ff 'W 1v'::::g2:, 'fI'ljI:f 1f31-.1111-2'31125111-fjfjilljfglgf 23:5-5.g2g.g , , Yfjjjgiggs. 5:55.-fgzzggqfgQ:g:g5p::3E,5:5,3 IIASK In I IIALI. 355522525 gfgfffizz:5:32Qgg2gE:5535355515552 ,IACOIQ NJN WAY, W. Vgiijljgigi fgzfig 'jE1fQff:.:.f:2:Q3221iE52f'f!f2gEf 'I' A Y 1.1 nz I I I .A K lf: M on 1-1 I J I nm.1-: m mc K I . Y N 4' 1 I f?I5:52f5'IQ?iE'f1.',.'5?'gi'i131' ' Rl-:IST VVIIIIAMS, C. -255155 HW H IMSI'.l3ALI. I Rvmm Cox Col-'1-'lcv 'IACUII I CRAUN VVII.I.IAMS, C. I Wearers of the Nlmor Sport 5 Mono ram I X s A t H UM nn-:u'r, If' H Alun' MAN Ci1u':suAM LAW I Dow N lI'I Iiucv IfIul.slNf:l-:lc SENIOR!! X t V V U w 1 'S -4-s I'lmm, Ii. UJNWAV, I'. 1, 5 I-Io1.m-:NNI-:ss I uu,1.ll's I Immsox 5'I'IlNI'1. ,I. f I AWVA A155 V VAVAVAYA AWWVAVAVAVAVLVAVAVAVAV VAVAVAI V -me , Um Jiwzzflf- 4- ' N - Ad Astra, Per' Aspera. Fr'atern1ty The p11l'lC1PdlS ofthe Augustx Milit try Acwclcmy on unc 3 1925 founclul thc WL DO N01 COUNT POl Ul.ARITY B U T WL DO PLACE SERVICE ABOVE SELF AND LOYALTY NEXT TO GOIJLINESSH The mcmbeis aie selected by the vote of the ten members of the faculty, who have been connected w1th the school the longest. To be cl membel of the Ad Avtra Per .flsfvcffa fraternity is the highest honor cadet. 1925, were: K. SMITH H. COINER C. SPENGLIQR G. FLOURNOY JL C ILLLLLLI X.-lLl1 IIIU ll illlll XLL1ll,1lilXX X.LX.l'ILl.X :tual Ill X'll I'll,llLlll.YlLIll,Xl lilllll , IL! II Yffflxlflfffffl J ll N ill!! 1 '14 ' z s N J 5 ' N A A 1 N N N N N N N ,N N N N N ll 1 . 1 J , - A EQ D V V ' VA' VAVAVAVAYAVAV VAV VAYAVAVAVIVAVAVAYAV VNNAYAVAW I 1 , ,, , , . , , X . Va J Nfl fi rT.1.fzu..ri.i.':-14f 'zfif-ii T:f.f,1f'ifv.f.i'-5, far' 1 '-flif W' Q!! Mfr -. f ' ' ' X I 1 lax: ,-UI,-Ll 11 , 'fi'.j7 ,!E':Q'ffT'j ,fi F 5 1 ,Ari ..q.f -.sf f. -fa-'-- .:v .Hit ' A 'T , 1 1 . if-' Q f , ., .N , 'fl Young lVIen's Christian Association OFFICERS C. ll. Sl.lcxil', lll. . ....... Praxvidcllt i bl. Tun-:N'r, jk. .... . . .Vice-Pvfvsidmzt G. S. fF1'l'z-loliicali. . . ..... Sccrctfwy W. ll. l'l.L'IJDI.liS'l'0N. . . ....... Trvaszzrvr W. ll. Wi-:ma ...... .. .lfaculiy flciviwv' CABINET W. W. liUSXVlil.I. R, W. l'lOl.SlNllliR J. M. Bvmm li. ll. iiimnv R. S. L'oUl-1.AN11 ,l. R. Melvi-:le R. fl. SAUNUI-:Rs The year 1925-26 has been a banner year for the Y. M. C. A. of the Augusta Military Academy. Much enthusiasm has been shown by the cadets, which is clue to the interest taken in the work by Captain Webb, the Ofhcers, and the Cabinet. Many prominent speakers from clifferent parts of the country, also several caclet speakers have honnrecl the Y with wonderful speeches. May this organization ever continue to progress. We regret very much that clue to illness, Captain Webb was unable to have his picture taken with the Cabinet. IL 1. ,,...:. ...x..,.Tsv..,,..3, - ,7,,.V........i,..f.A:,,t,C uv :'-.: - fm. 3 f -. .5-fl-4.-'H I-yi-V I ,L I, . . . K' . 1 , , . X . . . ,X -. i,,,,,,,,.4,,,,,,,,, ,,,,,,.,,, W, , , ,,,, ,V , ,, ,,, ,,,,,,,,.,,,,, 17 V ,.,,.,- W ,,..,...,....,..........,. W-.. .....-.... ...,- ,, , ,,-.-...........l 'N I fx GBr,::gL':r r'1-r1'r1' f-1-1 1'Ii'Y'z1vr'r:1 vuivzrinigiirzruxri1n:::1u.r1.x. uirrv1r1 rn1'n1-rrrnz1-it fy IN 3' 1 G1 on -,,. ,,...-,....,,.,....1,v-1-11 1 W' 1 'if ' fi 1 'iff . ' 1111 .- 1 -1-M--A-...M 11 I 1? 0 .1l 1 Q- 'Tm 11:11. .l.u11'f1'51t1,1 ' ,511-A-, 11 .I I ffm 'ILT 111' ll-57' fs' I Vf1 ,I --. 111lfQI4i111f:m ai.. l:111,1mi.ufu1gv6?.4l I A! ffl 0QSlk7nzruir1-rrrrcfx-' ifgx ililiiiu xiznlirfrrrrvfirvww-1:11-rrf6qQ ,JM luclkjflrg X i Iii! X K .. .i.. ,t .--. . . 1 .-. CY x ' fax bmw ' QUE 1 Q1 xllwi-1-,1 l K1 1 1- rib-I 1I 1 1 1725 I 1' 1 1 : l i N I ,' I. N, Q 15 'tl 1 1 1 1 1 165 111 1 1 1 55751 1 '1 ' - l1 :Q , 1 ! jiri I 4.11, , xl l lf1ff1'1' All 1 , I D 1 'A 1 l 1- 15 1 1 1 1 219-1 ' Y lil' 1 4--5 1- I 11 1 2371 1 1, --W sg l i ll 1 l l 2141 l 111. ll ' l 1 if i l1 I 'l if lj: 1, W 2 11 th.: 1 1 , ay Q V- ' xhl 1 I lifl fl f I I 1 I1 1 A. li 11115 1 15,5 1 1 111 1 . lf U ' lllbl V 11 1 VT .Rig 'l 1 l l lfvl ISP' 1 ll tl I ' -' 1 ll 19 1 l iifif A 1 1111 Ml If-tl 1' 1 13111 1111111 1 1,11 5' 1 '?2iJF:.. :Mil 1 SN! ,311 1 154.1 551 . l P 1 111 B1ble Class 1 1 '11 . g 1 1 W1 4 I 1 1 1 -1 1 OFFICERS I 1 I if 1- 1 l - . . Il 1-41 IL. D. GRADY .... ...... P resident gl gl 1,s,1. :sl P. is. FULTON .... ........... V mf-PfC.11dmf 1 C. B. Sl.if:M11, III. . . . . .Secretary and Treasurer I 51 1- 1 J 121 Major .Iacob's Bible class, which was founded many years ago by Captain I 11 we .. . . . Q11 if Frank Cnlliam, this year has made great strides toward the goal of a more success- 1 li'-' l 1 1 I 1 Eifsxv-l l 1- ful Bible class. 1 1 5.3: I Due to the interesting way in which Major Jacob presents his short talks at I - 1 N. the meetings every Sunday morning, the attenclance and co-operation has been 1 1 1 3-1 greatly increased. 9 P l Rid l 1191 G1 if il -XI1 '1 11't1 lf? 1 11 lf? 1 -X J, 1' f gn? 5 ff 111 I1 1 Iggy fi , 1 1. I1 1,1, 1.1, 1,,1,1 eei. .1,. I 11 .. A ,1,1 -g:.,..L--tu-e,.,:i2?::'J '5'T. E 4.....,-,....,..-..,,.---, -.. ,.... 1 ,., 111, ,.,.,..,,.,.......--,..,..,-,-., 11 , ,-,, 1 ..,.. .... -,. - ......--.-..., .-1, 11...-.-.R 1 I I I SZEZEZQ ual 111137. V I AVI 'Y ' 'li?'K!l ll'K Ciceronian Literary Society The literary Society has supplied for us what we would have found it hard to gain elsewhere. It is here we have found the opportunity to get over our stage fright and to learn the rudiments of public speaking. No doubt we will have many occasions in future life to be glad of this training and to use the parliamentary law we have learned. Ollicers for the year were: GRADY . . ....... President TRIENT . . . . . .Vice-President l'IO'1'C1IK1SS, , ......... SCC1'Cfa1'y BOLLING, M. . . .. .Sergeant-at-Arms 1 I 7' l i z A 'l VAVAVAVAVAVAVAVA VAVNAVAVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVNMVA Wu':gigs-.,,Elmuaqpv:','q4uq6 l 1 n ! Q1 nl lgunugm' :tml JM f Q 3 0 X BVAWWKVAVAVAVAYKWAVAWVAVAVAVAVAVAXQWXWKWVAVAVAVAVAVAVAVAVAVAV VAVAVAW 4 4 ? ? V ,... .... , .. .... .... mgmmm . 5 ...... .. ..... ..., , 3. W KM 'S Ghz f6N qmn-'lumq ' si ,f ,,- 1 '- . . . .-- - ,.,. -is 'Mn :F .09 'Ffflaa :K Y Y '.. ,. .. 5. ..... . . h N .19 9- ' 5 A !l!'!gil 1 s A 5 M Z: : CAMLBL-11 MCIVIR MATIILWS H Suxuvr PARK1R W W11 KINGON DUPAG1 VVIIIIAMS W HARDY CAMPBI LL FLIMSIIIR 1N11r Cadet Orchestra Du' ct 1 Cornet Ba r Trap Banjo S'ax0j1l1011r' San ophone Taxoplzonc Plano Vzolm Cornet N Gb D 1 4 V 4 - A -, QNAVA . 2 VAVA-YA'AYAWHVAVAWLVAVAVAVAVAYAVA Z Cf Y 5 33214 5 munxux 4 52,1 2 .32 5- AAAN . ik 7 . 1 A 2. 2 v 5 Z A Z 'A :U v , 2 A ' i. Q I j M - I . P -1 . E I 1 1 1 E E I I 5 4 ' 2 3 I I I 3 3 2 2 2 2 4 S 1 Q 2 Q Q Q 2 Q Q 1 1 I Q Q 2 f I I I 2 . 2 5 Q :5 4 1 5 1 5 5 3 1 : : z 5 3 5 Q- 3 Q 1 2 1 Q 2 2 2 f 2 5 5 2 Q 2 Q1 Q Q 2 I I 1 2 Q 45 515111555551 4 1 2 5 5 5 5 5 5 5 5 2 5 - 5 z 5 5 5 E 5 1 5 3 3 Q 2 - 2 Q Q Q Q Q . 2 f f 1 5 - E 2 I z I ' : E 2 I E 4 : 1 1 5 5 5 E 1 1 E 1 4 g5g5.51555g5 4 :1'555.111:5 5 Q 1 2 1 ' I Q f f 2 2 : 4 5 2 3 2 Q Q Q 2 I 2 1 5 3 4 1515551155-15 g 5 2 2 5 ' 5: : 5 1 5' 4 5 . 2 . , Q 5 5 mn Q ' . Q 3,5,,19y1Jf1 3 Q54 Pffmwnvnmvmwmmvnvnvnvmfmwmn' Y .YN Y W YN vhw MVN .Y I RVN V W1WVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAVAVAIAVAVAQ A Q xv' 'llll Un ll Qnq QQE! K gc mb 3 L, Who s Who at Augusta 25 26 Most Popula1 Best All Round Athletes 'VIost G1 lt Best Carnage Most Mtlltary O D s Best Commrssloned OH:lCClS Best Band Men Most Inqu1s1t1ve Cadets Best Football Players Best Basl etball Players Most lndustrlous Cadets Blggest Bums Most Awkward Cadets Biggest Ladles Men 'VIen who have done the mo A M A 25 26 Best Non Comm1ss1oned OH1CClS Best Dancers Best Llne B1ggest Hot A11 Artxsts Hardest Smokers Best Lookmg Cadets W1tt1est Cadets Most ln Love Polltest Cadets N eatest Cadets Best Natured Cadets Most M1l1tary Prrvates Brggest Eaters Most Contented Cadets Most Popular Rats Best Bu1lt Cadets Best Baseball Playe1s Best Track Men Best Debaters LHZICSY Cadets B1ggest Bolshevlks Best F1rst Sergeants Tlghtest Comm1ss1oned Officers B1ggest Women Haters Best Corporals of the Guard Freshest Rats Greenest Rats Best Sw1mmers Best Wrestlers Best Sergeants Fzrst Hurnbel t F Jacob Holslngel Grady C 1 ady Grady McIve1 F lelshman Byl Cl acob B1 att B1eeden McCo1m1ck Boswell G1 ady D1lla1d Mayez Boswell Boswell Ca1skadon Hlx Brown R Bolhng M Fltz Hugh D1lla1d Vv1llmgham Bun Mar Frye Trent Boxley P I-lols1nge1 Byld Hudson Gresham Fudge Brown R Slemp I Fam Holsmger Cooper Ponzanelh Mzllner Hols1nger Pryor E Ph1ll1ps R Second Glady Evans Byrd Humbe1t Boswell Pryor 1' vV1ll1ams Woods J Holslnger Lynch Slemp J McCo1m1cl C M1llne1 Humbe1t F Boswell Huddlestun Boswell Humbe1t F Slemp J Blatt F 1tZ Hugh Shreve Maver Trent McG1ego1 Palmatoly Bught Fudge W1lllamS W Fermstex Runnels Tacob Breeden Slemp I Fe1mster Langhorne Gresham Grady W1ll13mS W Boll1ng M Houston G P Baum DOWHIC Hudson Huddleston D IVA NNAVMAVIVAVIRYAVAVAVAYAVAVAVAVAVAVAVAVAVIFAVAVAVAVAYIWAVAVAVA R'A'li'Ks ' !!9sm'?glg!!29g' .N the '... ...................... .... ...... .......... . . . ................................. , . .-'sb mi Biilgqgll !!!!!!5:i -E: I A xi ' Nl 1 ' Yu ft e lt 1 Q-1 H11 l 5 ' N - ..........,. ....... - , . ............ - lf I -' ............. fff..ffffff 'f'.ffff fff'ffIf l - - .............. ..... . .... ..... ...... . - , F. N .. , 1 ' .. . .............. I' . .............. N 1 .....,.. . .... .... ....... , L . .....,............. D -. ..,... ........ 1 - ,W. 1 , Q . ............ .I . ...... . oaanunnllla Q ' Iuununuuuiuuuluulo ,Z . .i, ...-...-......., ........ ....... ', . ' 1 . Y 'N . . .' -' ............... - ............. .... I Best Student . . : . Z ....... 1 ........ Bun-Mar .... U ......... Morehouse Jlhm . Oltl . liill . uubwlllqli L uunul nilnluuiluunuuln . g , 0 . ............ ....... ....... , . ' 'fffff'ff ffff ' . ..... ffff f...ffff'-.1 I .-.......--.. 1 suvn Y hu, . ....- ..-.-. . . I ........ ............ i , . ............. i U .............. ..... L ...... .......... ' - .- loan uuullvl lltblbtu luunullun .I , n . -....... ......- . ., . ..... .. .... ' ...... ....-.. ' ....-- ... - .-...' i ......... . ...... . ........ ..... C u ,.. . ........-....-.. ,,. ......-...... . ' U It ............... I ,. .... ......... 1 I lllt ll! luilulllu I., I tliulu lllub I u D I v w ' x M , V n V V l ' V Vvi V 'J am. 5 I . , 1 Lge H Am. X . w V AV V PM A , an ' 3. 1 Q51 5 if ! 31 1 Paige V, U V R ,V ,f. C! .li , 'Al-?:fT'3 Q . N A 1-.7 1 5 5 QESYALL Ammo xrnusncs TAi BES'I 'j V 1 , ,JACOB-EVANS J 1' 3' , V . .. , ...... , , ' .I W 'Y 1 1 V V ' 4 E . r ' ft ! vi VV ' X ' ifggf Q iff E' - ' f gn 5 E 2 -- I' E22 ' I 3:33 I ab, 5: ' ' Ez' I A :tg 1 ' x , YI x Z -l f' g V ' 1 3 J . V 3:13 I 'NN ggi V-,ggi V 21:1 gr: A . I V-Q, YM HIV 1 , V ff l: ,V A 5 V 'ful . iq. ' A 9 1 ' 2.2: ' Q f- 4. . 4 An-' E 511 'V 1 .1 , X Lfif 3 VW-F ses-r nmacsuzs ' . 'V 1 :gi 1 k . ' ff-' + Mmsr.-soswen.1. I V ' an 4 ' 5 T-1? t Yr' V '3' V S-' V'f ,' - 1 V V K 1 - V 'J 1 V IQ ,j ' 4 Q-.uf V ' 5 vi-:TQ C :- S: f SJ,V J e IQ , Qf 1 ' I VP? f ' A li'--3 31.41 A e :fu-I ,--A V : If eff? ' 2 - ' 511, i Q E' ' . 554.5 Q, , 5 . 1 wg! 3 4 V V 5 ,Af 3 1 V'--Z1 5 V iff! 5 1 EV'-V1 l L IC : . 4 :X 4 WHo's Wuo AT AUGUSTA '25-'26 5 . I i '-1 V 1 Wil: I . A , 1 ' Q fr 'xii V E. .W .... V..V.. . . . .A .. . ,,. ., , , V -,j L'Y 'QV -Z ' 'V -' 1 -,TQ . ' I' I ,'1.Q'VVQ.'L-2'jLV M Y.-VVQ 'fa' 1:jf.,Qf 7- my V rf- f ' fJV ',i5.f1i'3Vf1VJ,f,,,1Vf' 1,-'Q A ' J 2 if ff:-' 1 1 1 pi.: Ifsl1-LfmL:l?.Vf.1.f,-'.,1f.g..1.ii9fEf.ff:f.:.f:Mf,1l1j-V' V1f1'X'NW I .J v 4 I r 1 1 1 1 1 f 4 W , , , H W- ------Q AA-+M --i ,gi f 74:33 X MFWWTWTZ W . .svn -... .. ... ...... , . . urrrrurrrrf nTx.r11'-'I-'Tff3j'zm1': 1 r hwwwhv-L' MTMW W JH A gg 1 , V4 i K , ,.' l U Arif 1' THQ' . Er, X p ' ,gg YN. X E 4 mil ,M m x i Y QQ l 5 f 1 QU f 15 I 5 i 43 V 'N 1 1 ff 4 ' N1 iq W .la , 5 N X' ' wx K3 V '-,- 'lx - ? 3 Q ' 'cj ' - mg mi, ' N H123 My 6 1 4 I ' ... .I' W 2 ,E X , I 3 1 VIVA' ' A fb: I Q f,,w fx 2: 24 Q2 Q ge 5,5 Qi 4 4 M if H ,s QQ if j M 3 , 5 4 4 SE - 4 51 Q H 'Q fa 3 V 6 1! 5 Qfg......:'::,1-' .. h 'lit WHO s Wuo AT AUGUSTA 25- 26 X Alf A I Q 3 E 1 K x 5 I 5 I 3 I 5 ? 3 i X Z 5 fi F fr ! 11 1: wi 1 4E w S E S'AWPYZ6.VAVA V 1V A AVAVAVA AVA AVAWVAVAVAVAVAV A AVAVAVAV VAVAVA 4 4 P 4 P 4 4 4 V 4 4 4 4 4 4 4 5 Z f AWW' VNMWNVAWWVAVAVAVAVAVAVAVAVAVAVAVAVI-Vlyiwx -3 N A Q d ,...... . .... . ............... . ......,. . ........... 7 W W 4 M Q 9 x 5 25 26 21' YAY V NNN - .Y AVN VAYAV VAVAVNAKWYAVNAVKIMK' QNAVA 4 . . H VA! 4, . If 4 4 7 5 4 4 , 5 4 4 4 4 4 4 5 4 4 5 4 4 2 4 4 4 4 - 4 .- 4 4 4 4 1 4 4 4 4 4 4 4 5 U , 5 QE? Q 4 A . ZAVAWYAYAMYAVAVIYAYAVAVAVNNAVNNNNNAVAVAVAYIMYA' ' W A 1 Lf- i n Bi ' xi A. S' M ' Q ' ' 'i3jAWQ f Us 2 f i Al Z' Pl f nl M KL 4 5 f 1 . - ' Q 5 X W 9' 5' f 5 l f 7 S' 51 f 5 :2 A N Q 1 N ff 5 ,, x' 5 f X Q S f sf 2 Q ' 5 Pl P gy ' Q E 4 w 44 S D 5' 1 4 4 5 if '2 E 5 3 Q f 5 Q. 5 4 5 2 5 w 5 Q f P 5 5 S S 5 i E S l F 3 S 5 WHo's WHO AT AUGUSTA '25-'26 s E 5 + 2: 3 if W is ,--u- .4 f Q 3, gf E '1 5-. 5 9, 2 . 3+ 5 i 9 SS 2 2 si Tis H 5 5 as E. Q 5 , , . g wsv4rAAvgvA' iEl:,f-'lrA3.gxV3L.1,,,,i- T, X, x, X XX X N x X, 'x in xq fd ' E 2 A QM i A W: ,V S E g E 55' Ex EQ 1 P Q F f: QQ 52 gi U S' E sl sy 1 13 g 1 l fd X f ,Q 1 f M . 1 ,-AfffQfJLy,f',f,f'lll1 1 .Z .fill ',J4w, Y v vi? v, ' mfmmmm.vafm'sfN4mmvn? YVIMWNVAYA ,HKVAVAWKAV U6-Wk '.WD'AVMi VAKQVAVIFAVAYIY I 1 1 P i , - 3' 1 T 'Q f , W W JV AVAVXV V vhyrg I , WAV .MVA A ' , , VV!-H513 Wuo A'I' xXmsL1s'rA '25-'26 Q A YAVA W wr IFAVAYA Q T-'--!M -'lf- 'IIMWMIQ' - -..,.. w - ..,, ,. M ,.-. .,. . ,i:l,S'llfu?ffx 'A 4 AVNAVAVJVKVIVAVAWKVAVIVAVAV 'VAV AVAVIV 1kVAYli'MiliVAVAVA' IiYR'A. W WXRVAVAVAVAVAVAVAVAVAVAVAVAVAV AVAWVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAV YQ A , 1 wa , ,, iff . '1Q1gi r W . XII WVAVAWV TF W QSM Wi? ' 2 Za:AwfmwmmmvmfAvAvAvAv,.vAvmz.vAYAYAYAVAVNAVAVAVAVAYNAmmv 'mam Q E Q 2 Q 2 Q 2 Q Q Q E A 2 5 1 X ' 7 9 A ng, .... . mmmim .... X . M' mm mm 5 9 f - w 3 V f ,hm b f pl! r E f Q E 2 2 S S Q - 9 N f Z f 0 N 5 :f f 2 S f 3 G r N E r N 7 , ' 5 ,Z S Y 5 i it .,, . i. tes T 5 af s 5 . V 5 - 5 s X 2 s Q 4 4 s 5 S .4 '5 if 5 5 4 A ' 4 5 5 5 ' ' E 4 I , r 5 2 5 f 3 5 5 Q r T- . 1 ' H, i in - ,A f 31255 -'ffiff-V-:: , ' ' 'by-Q QM 'a' ' 9 , ' I A L SMVVA AvAvAvAwvA.vA.VAVAVAVAIAVAVAVA vA vvA AvA.vA v,-,VA AVA 4 ph WY 1 m-fmfQQQm, ,.x, ,, .,,i Lx,,l I,m.,f . ,,1,..x ' ' - 52 wg J, ,1 L , ,, m 1 4 ki + 11 fl 1? w 1 ' E f I Amt X W Q I N 5 f , Q , 4 5 P f N id 5 + ' H 4 Q 5 N :S 'Q N 5 Q f N f 3 C A 5 5 f N 3:1 4 5 7 3 3 N 5 5 Ev 3 Q 5 E s - 5 if Q 3 Cheer' Leaders V 4 . Q 3 I3osw1cl.1. . ............................... H cad C lzvvr Lcadcr 4 - 3 SLEMP, J. ...... ..... , fI.fsi.vta11t Head Clwvr Leader 5 S VVALKICR . . ...... .fl.YSiSflI11f Cllrvr Lmdcr A X 3 MAYICR ...... f'l.v.vi.vm111 Cheer Leader fe f 5 4 E 5 5 E uf W get 5 gy -mm - Q T Hz' 9 2- mmf'vmAvmnvmmmwmmyfmvmfAYAYAVAVNAVAVAYNAWHNAY --I--AM -- --w'--- .Y w- H., .... .,.,.,-,.Y . ..,. ,V ...Y .,,,-,Y .... .,-...-,-4..-.,-.-.- .,..,.., -I YN- . r ..,Y,F,, .,,, V., , . ,.., W , ., :1II,T'X, I.,-.1fI,,. , J, , r,, !,,I,,Y , ,Lx .pl A, . .,5,1,1f - .1 x-,, ,, ..Il ,I ,, 1,-X'xv.,f. I ,M 1'-I rg 1, 151, 4 I I 1, I' - wb ffsff. f' Y' fLx.LffMB'IfF.Iz1Q.,:f-Tv-Ift-I, f.A'I.I-1-wfguig--.ff-TI w-fr'f.f 'Sr f..-Li. ' I ' - z ,fg..,1 ., --- ,. 1'- , rn. Ik- I IX V L. I. . .,'.1I.'11. :L.,n.: .' .,.' .IL -111 .'-... , 1 , '.,, W X,-L, .,. ..x, ,f:,.,,-47 , .. , .IVUH-A,., .. H1 fr - -If-rv ,- .- ., I , , , .....,,....., WW .,..,.,,f. 4 , ,I v. ,v ,I , 1' f ', .. .4-I ,NM , I ,. I , I I Y ,, j K lf 4 I 1 'I f S , ' ,' ' f , gf I -4' ,J S ,ff - I 9, . I ,-, ,',,s..,I 1 'xx I :I x'Ifx '4 'ix N irx 'I' f'II ,IS LNNXI I I CAPTAIN DIQANIQ .. CAPTAIN BROWN . . CAP'rA1N CILENDY . . CAPTAIN OTT ...... . MR. EMORY VV11-1.s0N CAPTAIN CAl.1.Ar:1ncR . , - frguf7 ' 'H' mfr' ':,71'-Njy ww :Hula jv'x'f!xN-jIN.1'xR 1 QU Coaches I lx I A I X r , If 5 ,, fv?c,,f5,i,1iLf,IXf i .ff?!a Nfrf-I' 'Q' 'f' I W X' II 1 If f X' 'V ' f' lv I 1 'II' f '+ . . .F00fbz1Il, S'ZU'lIl1H1LiI'Ig . . . . . . . . .lff1slec1'bf1II, liclxclmll lxxisz'c111,1 Football., I I y7'LKS'l'Iil'IIg . . ..fI.vs1'sf4111i FUUIIQUII, Track ..... .....l?0xiM,g . ..lm1i01' fltlzlvticrs .kl'.3:.,T, CW 3..,b,W,.-.J,.4x,,,,7,,..1 T , n,.,.K.3,,l.5I -,Q IW, :-.T ,,7fv,uT.1k.-,l,TI .I ,Tx-,T X74 Y :II K I-M237 5 K -V . . , I , X V ., ' .x,,,. V., .1 .1 Q., If 1' L. I Iss B ws.. we MI Wi We Q51-I sf- ' I uw --' Vi' I N IJ Iv. I yi,-'fl In gifffl If 5 -I IfQr I iw wi If-' RI IN Iigfs IQQTI IIN' LAI Biff f-I if I ISI I 2145.1 -Lb? ,I I 1.1 ICI ,xx X I ?l:.iI :ICI I+, I ' 1 'II IJ 'I V , '.-I Mx' 5 Qi PQI -Hy' If .I 'fr-.' I 4 I., ,I 'Ai rxfl-i Ifx' Lf..I IPI III gs.: 35' EN. Fw I I 'I'.,,j ' I . . ,f 1 r, n,: I If I I , I I I' wi if . ,. I wtf I I VI, ' f -' I wif' 59.1 I '. H.-I .I Y-. far -,I I . , mb' -If, 1 ' I In-I -.Qs ,- I 'gli-I Aff:-I X1 Nw ' Q-...,r. I I I I I I I I I I I 4, I I I I I I I I I 1 I I I I I I I I I I I I I P I V 4 ,.: - U 1 1 ' .4 x ' fl I 1 , w O 1 E , ,,' -' . ' ' ' ,I 1:5 . M . i - 1 , ' EVAUKYAVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAWWYAWVAVAVAVAVAVAVAV VA ...V , y f 1 , 1 9 - ------- tri ? - T1iI'l Ll1UQL1H I I ILIJLLLI l 'U.YBJ 4 4 u I nn vu-uw l nj r -V A y Q ll' X --.omgg fgfljliu gts ma 5 Q l ! .QB . iHlZ IU3-IKTIL11E11DLl1l.f.lll1'LXl.lT!IlIX1iIY,IlXTI'!l1fKI'I'!1'l Jl mud. 1 1 I . :v All W ' A - il- - 4 - eo w P X ' ' 3 4 5 l C X v R ' . f Z 5 1 - 5 f ll. l f l w 5 1 f if ' Nl P 1 Q N 1 P 5 f ' ill-L 5. 4 r l 5 K f,, fl ? K 4, , . 1 ll fy f I . Q 6 f s .!' H lll' N P s 1 ' g E 5 Z o ll E 'IM I N I S 5 I 1 H l 3 4 4 il ? ll Football Resume g Before attempting to summarize the 1925 season, we wish to extend to our f coaches, Capts. Deane, Glendy and Ott, our sincerest gratitude for their unseliish Q and untiring efforts which they 'gave to the squad, putting one of the hardest f Q lighting, never-say-die elevens that Augusta has ever put on the gridiron. S A Ca tain H. D. Deane, our head coach, halfback on Virginia's 1922 eleven, P . . was one of the ablest coaches Augusta has had. From a veteran backheld, which 7 5 . J he developed the year before, he put forth a quartet known as the Four Horse- gg men of the Shenandoah that were renowned in the prep school circles. E 1 Captain R. E. Glendy, who ably assisted the head coach, turned out f1'OI'1'l a 1 5 green line, without a letter man, a veritable stone wall, which strengthened as the E season progressed. ' Q Captain E. L. Ott, guard on Hampden-Sidney's 1924 eleven and graduate of Q at Augusta, assisted the other two coaches in getting the kinks from the squad. He Q 3 coached the ends until the squad was divided, when he took over the junior Varsity. 2 Before we write up the games we cannot pass our captain, Butter Byrd. S S He raised the spirit of the team in it's darkest moments by his undying fight, f 5 and was one of the fastest end skirting backs iielyiiiginia. I O I E . Our initial game was with Fork nion in ar ottesvil e on ctober thirc. ' Going into the game with tremendous odds against us, the Keydets showed their 'X fighting spirit. Fork Union scored a field goal in the iirst period, the Blue and - - White then tightened up and held their opponents in mid-field until the last stanza, L when Captain Byrd booted the farthest held goal of the season, tying the score Q to 3-3, and thus the game ended. We must mention the splendid playing of Hol- Q , singer, who tore the Fork Union line into shreds time and time again. 5 The team 'ourne ed to Charlottesville again on October 10, this time to pla 4 4 J Y Y ? Q Woodberry Forest. The Keydets fought to the last white line, but the Foresters 5 were too strong and turned in a 14-3 victory, Captain Byrd again showed his 'Q ' stellar toe work by booting a goal squarely through the uprights from the thirty- Q 4 five ard line to score our three points 5 Q QT Y ' ' 1' 5 Qi tl , U! 5 6 -,,s.e,,,,. so , - M e me e S 5 qs-, C- ce, .- -B ..-- - .ze-A 5 4 5 W'NMAYNAVIRVAVIRYAVAVAVAYAVAVAVAVAVAVAYAVAVIFAVAVAVNAVAVAVAV VIVIYIVNAS ll y ,,q'Jp5fi'a lt ' fc 1? V' ik On October 17 the Augustans battled the V M I Junior Varsity to O O score Neither team had an advantage the ball never bemg advanced past either teams twenty yard lme The Blue and White showed vast improvement over yy the preceding game The Blue and White next traveled to Winchester on October 24th where showed decided improvement in their defensive work and the backs showed their usual punch The teams were evenly matched however and the ball stayed in mid field most of the time Augusta though in scoring distance several times only scored once fumbles bemg very frequent b V A scored in the third stanza but failed to make the extra point Things looked dark for the Ft Defiance boys but their determination not to lose started a series of lme bucks end runs and passes which bewildeied their opponents and they took the ball over to tie the scoie Byrd also failed in his try for the extra pomt Holsmgei our All State full bacl received injuries in this game which kept him out of uniform until the Fishburne game The A M A eleven next played the W 8: L Freshmen RCSCIVCS in Lex mgton as an opener for the W 8z L Virginia game on November 7th Ploughmg through a driulmg iam and a sea of mud the Keydets swept to a 7 0 victory over the yearlings In the second period an Augusta end pounced upon a W Sz L fumble on the thirty yard line and from there the Keydets carried the ball across in three downs The game was slowed up considerably by the slick condition of the field but both teams displayed their usual fighting spirit which made the game very mteiesting There were no outstanding stars as the team reached their climax as a whole On the following Tuesday November 10th the Keydets entertamed the 9 C I team on the Clay Bowl Though outweighed n both line and back field the Augustans showed superior lnowledge of the game and registered a 25 0 victory over their adversaries The entire Varsity squad was substituted and made a very creditable showing in evei y department of the game On November 14 the Blue and White went to Woodstock to meet the Mas sanutten Cadets The Purple and Gold trick plays were soon weeded out after making several small gams and from then on the Augustans showed a decided advantage until the last part of the final flame gaming almost at will but never bemg able to carry the ball over In the last part of the ending stanza a Massa nuttean received a punt on the fifty yard marker and ran down the s1de lines through the Augusta team for a touchdown but failed to kick the extra point The Blue and White received the lick off and made steady gams on passes and end runs but the whistle blew and Massanutten took the game by a 6 0 count P On Thanksgiving Day the annual clash between Fishburne and Augusta was 5 held in Waynesboro The Blue and White took the offensive from the first 4 f whistle and scored a touchdown in the first period, but the try for the extra point E Z failed The ball remained in mid field most of the game in possession of one y Q and then the other With four mmutes to play Fishburne took the ball and f P started an aerial attack which ended with a spectacular catch over the goal line. 4 4 The extra point was made and Fishburne romped away with the 7 6 victory f S 5 The team wishes to congratulate the corps on the wonderful spirit which it Q 4 displayed during the game by a never ceasing stream of support which has never E Q been excelled Though defeated the corps carried the players from the field It 2 Q was rightfully stated that Ythe corps and team are greater in defeat than in 5 P victory S 5 'G 5 ir rr 5 3 3 E3 D 4 4 939 2 2 5 A' Y YNAVNAYINAVIRVIVAYAVAVAVAVAVAVAVAVAYAVAVKVAVAVAVAVAYIWN V VA'Rf!VR'g 3 I Q G ........ .... ..... ..... . . ...... ..................... L E Q ,, at a as r.. irifat I Q 3 h,,,,,,,mW,, .......... ......... ............... . . ... .... .... .... .......... . . . ..,,,,i.,,,,m,a,,, V 2 f ' - . S 3 Q f . D . , I . . I. , ' ' ov N 5 Q f lk f - ' . ' ' ' f 5 5 3 : S. V. A. was encountered. The game ended in a 6-6 score. The Augustans I ' . . . n. N 4 S f .g - . ' Q . Q . i , I. 5 E Q J , - 4 - f t r Q if 7 a ' 7 1 Q t 2 Q fl , r . f q- t - a t 2 Q f , l , . -. , . t . , , 2 9 z - , . . . . . . . , ' . I E 5 1 . ' . ' . X 2 4 f ' . - , N y Q , ' . . . - I . ' . . . if . . 7 . ,, at p 5 Q f . . . ' f . . i ' . 5 Q - . . -. g 5 Z , ' e ' - f Q . - - -I 5 P - - - f 5 ' . - ' . . - 5 ,4 - ' . . . 5 . . . 7 WAVWAVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAWVAWxVAVAVAVAVAVAVAVAVAVAVAVAVIVAVA-YQ bl Q41 Ii' RINAVAVAVAVAWVAVAWVAVAVAVAVAVAVAVAVAV,-VAVAVNAVAVAV4'AVAVAVAVAWVAVAVAVAVNAVAVAVAVAVAVAVAVAVAVAVJ tlt f VAWWVAV VAVAVAWAVAWVAVAVAVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVQ wsllll ' - l...f!-- :t------1-- X Wifi? - -. .....,...... ................................................. .... . ................ . . . . -.1-11. N11 - - 'N A. af: fl q0:.f!!Il!'!4u-S.!l!!2'Fl N cl u' s K9 . ':'l!!L'E':'h HE!!! l e r at .ua 7' Q f 2 ! li e o All Hail to this hard-fighting never-quitting team! A large share of the glory of the Varsity belongs to these boys who gave up their spare time and pleasures 1n the afternoons that the Blue and Whlte could put on the gridnon a team worthy of the name Augusta These boys bore the brunt of the hardest work 1n the moulding of the Varsity eleven never complaining never getting down hearted never stopping but always pluggmg with all that thele was in them After runnlng signals until they were tlred these boys would be sum moned by the old familiar call Bring the Sweat shirts ovei and they would run over to face the Varsity and the hard knocks that they knew were coming What was in this team to make them do this? The answer is simply this The ole Augusta fight Though they received nothing mateually foi the11 services they have in the hearts of the Varsity squad and the corps the highest esteem possible for a scrapping haid driving team to have Enough praise for these self denying boys is 1mposs1ble to be put on papei and it IS the sincerest w1sh of all that some day a large A may be plesented to each and every one as a small compensation for the11 work The l1ne up of the Sweat bhlrts 15 as follows Left End Left Tackle Left Guard Center Rzght Tackle Rtght End Quarterback Rtght Halfback Left I-Ialfback Fullback Center Quarterback PATTERSON LALLEY DARRALL WICKILN HISIIR JORDAN H01 cH1c1ss SNEaD FITZHUGI1 FLEMING HUDSON K1NLhY LAW ! 2 ' 3 f . . . .. r f . T I . . .' .. . f - J I 1 , n I . f . ' ' if ' I ,' l Pl i - f N 9 V ' .v . f I ' - r . . , , . U I . . . H 1 rr u l , ' s u Right Guard ............ .. ....... . . . .. .... ....... M ORECOCK . up - W 'g 55? A QQ 4 ' N Y 1 Y G4 ZAWAVNIYIVAVAVA'IVAVIRVAVAVAVAVAVAVAVAVAVAVAYAVAVAVAVAVAVAVAVR'AVAVAVAVR'A'NK5 X .x 'T-751' ' Avi.:-.4' 1 00'l'llAl.l. SQUAD BY ll ll llAl.l -MACK Butter to whom goes the honor of being Cap- tain of this harrl-hitting team, provecl one ol' the hest hack-iielcl men in the valley. His ahility to drop-kick and his sure passing, stands ottl strong in the offensive work of the team while he coulcl always he counted on as doing more than his share on the defense. hYl'lCl1l'VCl' the whistle lmlew one coulcl always lincl him right in the thickest part of the battle. NYC regret very much the loss of our Captain and with him goes our sincerest hopes that he may do as well for the college he attends. Il - , xfi, y K.-tl fi, , .,y!., Y. V, tl A r HOI .S INGER rm.t.-:mek Ralph, our hard-hitting, never-say-die, as- sistant Captain and all State Full-Back, was a widely known ground gainer. His spectacular line plunges heing his chief glory. Whenever the team needed ground Ralph was always sure to get the needed amount and add on some for his trouhle. His defensive work was also a great credit to the team, his motto heing The higger they come the harder l hit 'em. The alxsence of Ralph will he noted very much in our next year's line up. t'Ol.l.ll5R iml.lf'-:mek NfX'henever the word fight is used around harracks one always thinks ot' Yank our fast little half-hack. Irish was one ot' the out- standing features of this year's team. His abil- ity to put a stop to the most complicated of the opponents plays heing his hohhy. The team is very lucky in having Yank hack next year for the Captain and we expect him to lead the Key- dets to many victories. H U M BERT END Frank, although having several minor injuries this season, proved himself one of the most con- sistent men on the team. His stellar work in the liishburne game was outstanding, and showed the style of foothall he played all year. VVhen 'Frank was chosen assistant Captain for next year's eleven, every one agreed that a hetter choice could not have lmeen made. 4 t 4 V., , . 't . . Ai W .,.. f . !,tNl4.f gl'-. ' F4-,.- f.? f 1 1 l -ffl ' l lfil l 1 bill g-af! I t v f'.' l lift l Z- 1 '53 l L, ,K t -, lzafl bg, L I 1 PG: I liz, i i ikji A- xv , lvl, I Vg-' ! .X J, tw, l c ram 1 t 5 ax., l-:yt l'i4J l iff-' tXxf l ,. w' lflfil tial 5 l P2 S3 ,xi . 1 by g i ig'f:' , 4-.ing V 'nl I xf. lb-Ii t I 2,-Qi . ,Nl y EIL-111 'at I -. ,4 K5 . l..f:l:l Lacy 5-33 l , W7 5 5 xg r Fil' l , lim ' t. -f M. '. Lff-if ? lif' Q 24,1 . PQ, i : 2151 3 wif- i l.-fi' 1 l-j,, K 'ak' l 516 2 mxqt I lf- 'f s iii? 5 lf? ! 5.1, t I .,... E , - i 4 .fl L lm l 'W 5 LA . ,Q '-'Tcl A .X 5 I, .. .Q I .fr fx ln J 4 f'fX7'Tff 2',YT'j 'T'QiXI7'Qii'2T7 T'I IA't l ' -'TV' E ,J'T'f 1. . .' 2 I ,. N A 4 ' 4 ,, 1 -:..f.fv-2,-a '-Elgin-l1'w0 413-J ff-fi? v1l'N.', -'F-1-'lf-A .i' ' - , P ' ' '11, ,A rfwyvi I' r it ww, ,AU ,V rv'- V-.k ' 'gf t' , , ' ' ' -- v I I . MY' .,.. 4 L: ix X f-- -, , g -hi X . na 15.15532-,j t f-'f'---Nm, ,- 1 . 1-, t ' W ' t, Lt!! .Lff X , , 'THX it l. CJ -YN T fm at , ,, . if . JM on ,HJ t QUAR'l'l'1R-IZACK Here we have jake the leacler ol' the Four llorsemen of the Shenandoah. The success of this year's hack-lielcl is clue to his generalship. ,lake seemecl always to know jnst when to rnn the right play, ancl when the play enclecl he was always in the thickest ol' the fray. Although heing the smallest man on the team, he showecl as much light as any of the pig-skin warriors. XX'e sincerely hope that jake will he hack with ns next year. Alt'.'Xl.l.lS'l'lill l-'lll.l.-IIACK ln Mac we lincl a very capahle all ronnrl hack-lielrler. He hail a way of always getting his man out of every play, ancl of leading an intert'erence that was lotmcl easy to follow hy all. 'l'he playing of Xlac in the XV. X I.. scruh game proved his hest and was found laultless hy everyone who witnessed the game. ICVANS IlAl.l -MACK I'at is noterl lor lns snperh encl rnns. llis knowleclge of the game cottplecl with his speetl make him a hrilliant player. This was l'al's first year on the team hnt from the sidelines his play- ing looked like that ol' a veteran. XYe are very glarl to know that he will he with us next year. 1 H, - -- - ef tif., hm.-- .... ..... --...-.---..-.-.-M... ....... - ...,... .,.. .....,.., ., .. .M . i ,e A , , ,.. Lt . f F.-r..i1rr1vr':-'er' Isfv3'frff1q-:,- f-na' Arr :qv--,T 7-,f ---7,.,.t.,.,-,-JV,...-if-vm-I--.Tv-.5vy.,- -- f .W -...w..7:,-. .ms .Z A ..X,..,...ki. A A., ...W V I ,x-.,. E.-,1,,. ., .,,:i..:, L5 ,'frfJ .xl..tN, Pvfilf fMlfS!i.t.i'f'ilk15X5T,f'r'l4 511,12-Ji 'if i if Cid if-lf! 1 '-X' p Af.: 51343 4ffs.?.ff A 1 SLI QL riff :fi 'f,t,5sTft,,'+i'f.i' ,Qt E 3 ,jf , 'N fbi? lin! 1011, ,J . ., linux jx .rbyqg 1 121. , 1, K si l-125 1025 'isis 1 1 .11 Qi L, 4? 1,711 1 f .I 1 at mt' i. . X, 1--rl llfei I,,Qk,! 'QJS1 '-2.0 1.rf1 1 ,NV H 1 l is at wt -1.,,e. Q, NL , lf- '1 l 11:31 , I .1 i 1 1 11:11 fly 1 Q 143 lr' W i... -9,11 1 'sd A4 Nl 1 Qi 1415 l iffil 1 15 .fl .iff K fill :NJ W 5xA.,-tj94iiieii1S,i-ft.ff5igi3g.?i,i1'1.21.teas.. ,..,vff X cQl Tfl1il11lUH1IZyTlIU2fI,IfU 1'lYi'l'7.!.!.!l1JEXllT'fII,l2C!.1.'11'EY1'1 1 2 Lh1 11w'rrw:'.T.1zr:n .41 I.. 1' Y 1 1l11 f 1-v I , Q sag- .. mari.. ,:t,f,.l ,AQ . YI, 1, .4 1 -. M111 tt, 'T?1,,,, , 4 lJfQ,iAEk-'TF:fwY1rf'r1'rrr1'rrJ':'rvrrrr1-rfrg1-rr!rrxx'xg:vrQ1Qrrxxfxnfrr1xvx11'rrn , 3 i !grEEJ::.iNh'IKtiX L7 5 ll 71 li Ill lil JLIQBOCK l HAI.l -MACK If fl A player of exceptional aliility is Bill.', He fr 1 tr v f 1 A1 fp: 'li Hn proved a very good one lnoth on the offense and the defense and was a valuahle asset to the team. A smashing, hard-hitting lunge at the right mo- ment, was his favorite play, and was the most successful. We are very proud of l3ill's work on the team this year. TAYLOR ' ICNU 'l'hough handicapped very much liy his lack of weight, Shag came through with the goods and held down his position like an old timer. His dogged determination to make good is the reason he wears the coveted HA. Shag stands out strong as a good reason for using forward passes as he always met the hall at the right place for a neat gain. Vl'll.l.lAMS, C. ICNII t'harlie did not get limlrered up until the lhird game, going in the Vlioodlierry game to emerge as one of the outstanding features, His stellar work on the defense and the startling way he got down into the very heart of the opponents territory made for him many admirers. The liackheld always felt. sure of a gain whenever the play called for t'harlie to receive a pass, long or short. Nl'e regret very much the loss of a man who's position will lie hard to fill next year. i it X1 X '3 . 1 1 - at 'fjSi::i.1ff.:.i1Q.Q.-.Ll:.fffQfQf.i.Qi Q:1:fQQl-Q.-.g:.f IIIffIllI'Q71Q,11IfIlfI.'lII.'LTQI'.Qi1'.'.'.'I..-'' '.....'-'V 4 Zane W 'V' Ynwnv was wg AYAV' V mam mvavavmtv wa 1 Y Y 'Y YA A RI UNIJIN tatmlm Declan was the inspiring force ol' the whole team, NNhenex'cr the opposing team came his way, they were stopped, hut he, on the contrary, coulrln't he clownecl. Decla easily proverl his worth in the Fork llnion game, where he was a stttmh- ling lwlock for our opponent?-2 llashy hack-lielrl. VVC are very glad to know that his smiling conn- tenance and Hglitinpg spirit will he hack with ns next season. STONIC :simian l'lt-re we have the lteaviest anil one ol' the harclest tnen on the team. joe coulil take anal give some of the harclest knocks ol any man in the State. He was a new man at the school this year, hut he soon pickerl tiphthe olrl A. Nl. A. clrivc ancl showed it throughout the season. XYe are very fortunate in having him with us lor another season. l U,l.'l'ON HIYARIU lied was an all round lineman. l-le startecl as a tackle hut his ahility to holcl out the oppon- ents, no matter how large, soon caused his po- sition to he changed to guarcl. 'l'o get through him was as easy as lwreaking through a stone wall, as many prep school men will verily. He is leaving us, and we are sure that he will make good on some freshman team next year. RA M SA Y, li. mmim lCrk, a lighting little guard who never said die, made for himself a name in the V. Bl. I. Freshman game, and lived up to it throughout the season. l-le had hard luck all the year and suffered many minor injuries which kept him out of parts of several games, hut he was very con- sistent and never missed any game without play- ing at least a quarter. lirk, old hoy, we are very glad to have you hack with us next year. t'Olfl lfY 'l',XCKl.lC Pot the heavy tackle of this year's eleven proved himself to he a go-getter that will he re- memhered hy many prep schools for quite a while. l'ot's stellar playing in the S. V. A. game made every one on hoth side lines sit up and take notice. He was always sure to open up a hole large enough for the man with the hall as well as several others for interference. NYe have hopes that he will return to us next year. ROGERS 'I'ACKI.I'I Another of this hard hitting eleven who show- ed his worth as a foothall player early in the season, was 'l'ip. He was a strong defensive man and met very few opponents during the season who could come through him. 'l'ip kept up his hghting spirit throughout the season and in the lfishhurne game stepped out with great vigor. NVC are very fortunate to have him hack with us. ,4- l' f I :iw t'. l l l 1 l i lflil Nl S'l'l2R el1N'rl-:li Matt is a large man and he proved as large a help to the team. He was the first man to get hurt and his injury kept him out of every game except the last. But when Matt did come hack, he came with a rush and lltll up a light that conldn't he lueaten. A hetter linesman is hard to find and had he not heen injured, some of the season's scores would he different. . Xl A KNOW LTI-1N'l'l'IR Tom was the keystone ot' the team. His weight coupled with his remarkable ahility pre- vented any ot' his opponents from coming through at center. 'l'om played the whole season with the same spirit and grit that he first had. No hrilliaut plays came to him, hut he held every time. A more stuhhorn linesman is hard to find. RLINNICLS l'1Nl1 Nip, one of the Staunton products on the team, came to us from that eity's High School with a hig name as a footlmall player and al- though the change showed in him for a while he soon picked up the old A. M. A, drive and came through nolwly. His fearless tackling, which was low and hard, soon had his name on every tongue. Nip will hear watching on next year's team and we feel sure that he will some day he an all State end. 1 , s 1 X 1 . . , .. . V.. ., ....,..,,.,.,... ..,,,,,, -,. .,.......-, , ,.. ,.. V ,,,, A, ,X . W . I , U . ,- 3 t -.4 .,W, . W, A , 4 ,V 1 1 ' f l N , 'i l I '1 It 4' -'lu' cj'-'lliellf ifi. I flu- f','tf,l'i'f.x 1 4 ti ,ff 5 4 ,I:u1u:11'y ,lzmmlary ,I zmu:u'y ,I anna ry VI Zlllllllfy bl .mua ry ,la1mzu'y .lzuulary ,I:muzu'y ,I an u 21 1' y ITL-Imrllary I cIm1'u:1ry I cIn'uu1'y I cIm1zu'y I7cIn'ua1'y I cIn'u:u'y I9cIn'u:11'y I7cIu'u21ry I cIn1'uzu'y NI2l.I'CIl KI :L rch To 9- 11- I3-. I6-. N ZI- 236 25- 29- 30- 13 I6 18i 20- 25 26 I.. 4.. tal-. 9- I 0- Z2- e K I 2 I ll f I f , , I In j' , il A F 55Aucns:r'0 I I. SVI' IiIDlII.Ii VV. .NND I.. I 37-S. Cf. I. ............. I5 20-C. II. S. ............... I2 IS-MVV. :mal I.. I rvsInm'n ..... 3.3 37--I Izxlmwclcll-Sicllxuy I'Il'k'SI1IIIL'Il .. . 23 I9-NI. KI. .'X. .............. ZII Sfmfil. XI. S. ............,. ZI 25-II1'IcIgL'w:xtc'l' CYIIIQQQ .... ... 26 50--SI1c11:1l1rIuaI1 N. :mtl NN. Z3 3SYIi. II. S. .... ......... . . I9 25-V. If. S. ....... I3 32-S. I'I. S. ........ IS 23-V. NI. I. I 1'csI1mcn 30 26-I5. XI. S. .......... 33 I7-VV, I . S. ............ 23 32-Iirirlgcwzltcl' ffullcgfc' .. ... I9 40-RI, XI. .'X. ........... II 33-S. V. A. ..... I5 28-61. XI. S. ...., 39 24--I . KI. S. ....... ZZ 24-I . LI. NI. IX. .... -I-II 'FOIIIQNIXNI IiN'I' IS-I'. H. S. ....... Z5 52-Oppmmcnts . . . ..... 400 1 I t 4 I' l Basketball Resume liacing one of the hardest schedules ever undertaken by .lXugusta, the 1926 team went through the season in hue style, having a record that has not been surpassed in many years and has been equalled but a few times in the records of basketball at A. Nl. A. The team, handicapped by exams and an epidemic of sickness, lost several games in the middle ol' the season, but came again into their stride to win some of the most important encounters. The lllue and VVhite won twelve and lost nine starts, splitting even with three prep schools and Bridgewater College, eonquerors of V. Xl. I. The team was moulded around Jacobs, Taylor, lliddlehoek, and Conway, letter men of the preceding year, and with the aid of Coach Brown, Reist, Lynch, lllakemore. and VVilliams made possible the successful year which it gave to her supporters. 1 1 -,i-- 4 AVAVAIAVNAVAVAVAWVAVNAVAVAVAVAVAUAVAVAVAVAVAVAVA Euqiimgievmml 6 A 5 y -H! --.. --' - ' dun. ' .. wL JACOI C UARD jake hae been a malnstay on the A M A quintet fo1 two years and hm playmg th1s year was above pal whlch IH saymg a great deal conslderlng h1s pLlf0lITl3.l'lCCb of last yeax One of the fastest folwalds 1n the prep school cucles of the Valley 1 hard hghte1 and 'ln uneumg shot ale made an lcleal captam Although the small est man on the team he wah able to tal e opponents Hxs 'lbsence will be keenly felt by next year s hve TAY1 Ok IOIUVARD Shag symbolues 1n hxe playmg, a hght mg spnlt and an overflow of pep whlch never acknowledges defeat He proved hlmself a worthy ass1stant captaln and dul mg 'lakes absence he led the team l1l e a veteran Shag s playmg m the Gleellllllel game showed a sample of hls ablhty as a shot and he l ept up this stalt w1th hls ac culate shootmg and h1s qulck suie passmg EU ll, TV lr 55? QQ 5 5 5 5 5 5 5 5 5 5 5 45 ye if 4 5 2 ye 5 5 5 4 P 5 5 5 5 5 7 5 5 5 E 15 i5 ai VAVAVAYAW1'AYAYAVAYAYIMXVNAYNIVAVAYAVNNAVIVAVAV AVAWYAVAVAVA 5 ' ' 'I ' A ' , P, UC. 1F: XDL UllB1HDL 3 UJB e 5 V l 9'-yu' u 'ill' WK 3 jf, If 'C a .ns l.Y!'e g,xu E ? ru .in m,,,,.a1-gn! ' n3'rtxu1xzxL1xnrcxx:rn:'.rz.:unn11rrn'm.xurnnuxLn ' T9 ' N 5 lj K' y P K Q Q t 5 2 ' - 5 x f 3 lt Q ll llrix ll y Q f a N b f 5 w 4 K H . H . ' . 4 f y - , ,. . , A 5 y .n S s. . . K. ' X . 4 f -f H - -- . l Q f . ' ., . t , b. I Q ll 4 J care of himself as well as any of his larger D 3 I 5 . s , 1 5 V 5 V 5 P 1 I . Q Q K, ,, . 4 . , A P . , ' . V . . L Q S l ,S n I . .u . 4 C . 5 . . . , 2 a E l . l E 2 ? 5 . G 5 5 G V l 5 5 ZxwmmfAs'mmm'AvNAmvAY vf.mY1mvAvAY1.vAYA ,.yAvAvAvAv,.v1mf nwnms V, V4VKVAVAVAVAVAVAVAWNVAVAVAVAVAVAVAVAWKVAwKvAvAvAvAvAvAvAvAvAvAvAvAvfVAVAVQ A 's1 'l lffn-1 , N 1 '40 F tg' A I S N . .......... . ............ .... . ....... ....... . ...Sb 15,535 ! 1 l xg: Q, f Q Q 1 cr ' 1: ,- ' , - l . I :sin si 5, .' Y Q . . 5 1 K . 's Q ' l ' I . '. 1 T S A . . . n .51 . : , , K. . . . ' , 4 DIDDLFBOCK L Umm B1ll hopped ught mto basketball w1th the same old flghtmg spnlt that won hum fame on the football field and came thlough w1th gleat success He was always 11f,ht under the bacl boa1d to th1ow the ball out of the danger lme and very few eve1 m1ssed h1s sl lllflll 1nte1fe1ence We ale pleased to l now that he wlll retuln to us next year LYNCH FORWARD A man w1th a rema1l able al11l1ty to put the ball thiough the hoop was Lynch He was thc h1gh pomt man on thus year s qum tet and one of the fastest playels Augusta has had for some yea1s To hum falls the VlCt0ly ovex Fnshburne m Waynesboro and he w1ll be lemembered fox qulte a wh1le over there Thus was h1s hlst yea1 w1th the team and he w1ll be wlth us fo1 foul mo1e P LAKEMORE GUARD And now we turn to a dependable guamd who could be relled on to keep the oppo nents' SCOIC down and often to capture the ball from then' very handi Although It was h1s first year at Augusta, he sta1ted 111 w1th a drlve that soon won hlm a place on the team, and marched through the season for the coveted A Q D VAVAYMNA'MAVIWAVIRVAVAVAVAYAVAVAVAVAVAVAYAVAVAVAVAVAVAVAVAVAVAYAVK'R'A'li'M SVAWWRVAVAVAVAVAWAVAWVAVAVAVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVQ l ,lq'1oH ' Wu c Q'-gil l - S.: 4 3 5 s 5 s 5 5 5 s 5 5 S 5 5 5 5 TV 4 CONWAY CLNTI R B111 has the best jump of any centu that the Blue and Whlte St1LlCl thls season and a large pa1t of the c1ecl1t f01 thls year S success goes to hlm He was an expe1t shot and scoled a laxge pamt of the pomts fo1 the team Hls stellal woll ln the Flshbume game won hlm many favozable comments We ale very sor1y that h w1ll not be wlth us next yeal WILLIAM? CIINTFR In Challle we find one of the best Jump e1s that can be found Bemg a l1ttle tall he could always be counted on to get the trp off Charhe was an excellent passel as well as a jumper and hms passmg saved the team from bemg scoled on many t1mes H -.howed that same light he had ln football, and thls alone was enough to make hlm a valuable man to the team We a1e ve1y sony that he wlll not be back next yeaz REIST Cl' NTFR AND GUARD After spendmg a yea1 w1th the subs, Hal ry stepped out wlth the Valsity Flve to do hrs stuff, and we ale glad to say he dld It When in the centel of the Hoot he was al ways about and ln the an wlth the whistle, and when swltched to the guard posltlon the ball was sure to stay cleal of the op ponents' basket Hal ry w1ll be back to help the boys with then next yea1's victones D YF 595 M if 5 5 5 5 45 1 S 5 5 5 5 4 5 5 5 5 4 5 5 S 4 5: r 4 2: s I IVR'NAVAVAYAVAVAVINAMVAVAVAVAVAVAVAVAVAYAVAVRVAVAVAVAVAYR'NAVAVA IYIVIR'Ns Q . . V . . . 5 saaa -vt ll- 'a-'l 2 3 my! ..... .... . .,- .N ....., A Q Q f e S l S .5 4 9 r J ft N 5 4 lt 4 b lf r 3 E 4 r 1, r P 4 4 f H . . - .. J 5 . , N 4 s f A - f 2 4 f : : : - ' ll 2 4 y . . . ' L. . S E 5 f ' ' '- ll E 5 f ' 2 5 , h. . .. 1 2 4 f l 2 5 l 1 2: sf ll l if f i ' L yd Q . . S Q 5 . , f A s '2 . ' 2 Q . , ' 2 'Z A - ' . 5 , - . C 2 1 S8030WAVAVAVAVAVAAVAW-VAVAVAVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAN? 4 . RlNAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVIVIYAVNAVAWW'NAVAVAVAW-VAVAVAVAVNAVAVAVAVAVAVAVAVAVAV 1 Q x Aprll Apr1l Aprzl Apr1l Ap1 11 Aprxl Apr1l Aprll May May May May May May May May May H .. . .... .,, rg Em,'w':uL'n-IuggslHulglllllybwgmllnillm ' ' Kmllllllllsmw nw!!!-!!!!.:.Rli'q f 4 '--.. 1 5 .--' -' .-. .. - ,'8:,,,,1g N er-. .. . . b ' 2, ..:e,,......:.ta,- f trier? I . ....... ..... ...... . ...... . ........... . at-11 F V 6?!m,m.um-,, ........... . ..... ........ ,, --r I --.,- , A ,11 s 1 1 A 1 . 1 1 N March Z7 March 31 5 10-A 13 A 22 A 24-A 28-A A 6-A 8f-A 4 Q 0 . p' 1 vf f k Z XX' 1 - iE- Baseball Schedule 2 Brldgewater College Ram Br1dgewater College 8 john Marshall Hlgh 6--S C I 4--U Va Freshmen W and L Freshmen Greenbr1er M S V P I Freshmen Greenbrler M S Shenandoah N 8z W Shops Vlfglnla Ep1scopal School Waynesboro Flshburne Here U N C Freshmen Here Woodberry Here F1shburne Dayton S C I Here F U M A Lost Lost Won Won Won Won Here Luray College Cancelled Waynesboro Fxshburne Cancelled 0 1 . Q r xi 2 s S 4 E E K . . 5 r f ll , A N g i A ff A I I S x ' mvlly , f, 1 A ll E f . ' xr - A . f' 1, 4 f ,I ' ' ' 1 3 c 1 f ' xv . 5 .1 I 5 sig?-i. in ' Y 54 A A if s A E - -A. M. A. ............ - ' ...... ........ 9 Ef- --A.M.A...'.... .... '- ' S ' 1-A. M. A. ....... .... - ' ............... 6 if , ' 3-A. M. A. ..... .... . . . .............. ............ 1 0 ' S ' -A. M. A. ............ . . . ........ ..... . 10 f V ' .M.A. ..... ...... 9 -. . U .. .....1 S -' -.M.A. ............ 1- ' .. ............ ....4 S April 17-A. M. A. ........ 5-U. Penn. Freshmen ..... ......... 9 ' - .M. A. ............ 7- . . . ................. 10 E ' . M. A. ............ 2- I ' . . .......... ...... 1 2 . Q ' . M. A. ............ 2- . . ......... 11 Q 1-A.M.A. ........ ....7-' ' ..... E 5- . M. A. ........ ............... , ' I- . 2 . M. A. ...... . .... . ...... , . . . - 3 .M.A. .......... ....... , -I 12-A. M. A. ..... .... . .. ................ , ' - 2 ' 15-A. M. A. ..... ........... ............ - , . . .- 2 18-A. M. A ........ .... . . ........... ' , .... - 5: ' 19-A.M.A ..... .. .... ..... . .. , - 4 22-A. M. A. ..... ..... ..... , ' - Q W s 9 4 4 55? . in sf 4 Zliflfli'NIVAVNA'AVAVIRVAVAYAVAYAVAVAVAVAVAVAVAVAVIFAVAVAVAVAYIVAVAYAVA R'A K'S l 1 ly YW l ,,l ,fl l :E l liiii l :fa i sw ' , B , l i M325 l l'W 4 N ' 4 LQ I 5' ffl l--ill !..f ,lg l Lp. p lm . JW . l N 56 if ,N ZBA N 1 65 3 5 lil l l .u'k,1 mfg l Ups. list l .. yi , 5 Mr .XT l 33? l l 1 LQ ,-A :, f l 4 . -.. X l-a llfil l l l ,4. l .411 1lQ'gI Hill 41 , QQ l l l Sl I-Stl l E41 Q ,, l F ffl 24 2? r til ' Fflxwgi lid' l l Q3 , l E, lzfg- ll N, if L5 lst lf 1 in Q x l, . .. ,.fS1Ll7.,.S.lZlX'7E,CLVLSLZEJJX4'lxki3.sQ5Qf!gli',I4.Xl2'IN4fl fx.,VlMRtti,fiix f f iff, AQ ll Ki l V' l l 1 v' ly fl fl T K I I l' ly K ! lp lille We 1 4-gxrrtzmrrrfr1r11n1:Lu.r.Ux:.uxuurxn uuuuxxxxrx,n'.uxuua:x.1lv Ln xxnnu ' 5 I f , . f Q- if hifi QP! ,fg , all X 5 bl. it C'?i5N5'Yvwxnx':x1L11ix'x:1LLLfxu.ri.x17:uzu 1 vv:.xik'.tl11il1l ixaixuuxiuuw I i xrvv fran x'rr1u'n!' - lv! 1llf : 5iE'g', ,f55xE3 l If l f f flkf I Baseball Resume, 1926 With six letter men back and a world of good material, the outlook for an- other record-breaking team in 1926 is bright. At a meeting of the baseball letter men Byrd was elected captain and Coffey assistant captain. Owing to the coldness and snow of this spring the squad was hampered much in its work, hut rounded into great form before the schedule was well started on. The team looks as though it will, at this date, be composed of Captain Byrd, Coffey, Evans, Jacob, Cox, Feimster, Burgess, Marrow, Boxley, Williams, Collier, Craun, Whitehead, and Ramsay. lt was too early when Tim IQIECALL went to press, to predict the exact strength of the team, but the corps is placing their faith in Coach Brown to turn out as good a baseball team as he did a basketball team. lil' l ffiifffl 'W' i Nj ' -V 9- if lf' ,,,., ,. .. f 'A , ll ff' - .iff AQ, , flQ.ll Lllfilf J Xl J 1 . ' v 1 , s frugqrlyxqyvs? Y X 2-ww -n?Q:r M m VA my f.Dl!.l'!l..! Lt f L . 1-.9.,...1. -1.,i. L, 1 .1- .L -1. -L ,Q-.aa .L,f 1.i.,l- Qty' .1 J. iff lfl 1 1 Baseball Hvmm . . . . .Ca-fvtain Cmflflcv . . . . .f I.s'xixfa111l Captain CAl r,uN BROWN . . . . ,Coach A irffffif. v , , V , 1' A2 lfws, 4 VAVAVAVAVAVAVAVAVAVAVAVAVAVAVNAVAVAVAVAVAVAVAVAVAVAW VAVAVAVAWVAVAVAVAVNAVAVAVAVAVAVAVAVAVAVAVF A VAWWVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVAVAWVAVAVAVAVAVA AVAVAVAVAVAVAVAVAVQ . ........,... .................................. . ....................................... . JK' ly ' 5 Af 'Rf' ' . QP ' N 5- N dz. ,Sb 23 - Q ,,- :: I -lnnunuwv ww I r-1 5 Y K Q x N ! H Q N fn . V 0, S :M V ' N V N ' s r f i f Q ?fIi A'lR AVIVAVNAVIVAVINAVAVAVAVAVAVAVAVAVAVAVAVAYAVAVAVAVAVAVIYAVAYAVA'll A'hI'tg 2 E f s ig 5 4 W 3557 wiQ WAV'WVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVAVAVAVAVIVAVAVQ ,QTQSJX C iT l ,11 7 WW f 1 MZ ff X -+lZ 5' ii l Track Schedule A April 10-Virginia Military Institute .... . ....... ........ ..... H e re - 4 3: 2 2 April 19-Washington and Lee Freshmen . ........ . ............. Here - 2 A r April 26-Fork Union Military Academy ............ . .... u. .Charlottesville fs - A 5 May , 8-State Meet .................. . .... ........ C harlottesville E 2 May 10-Fishburne Military Sehool ..... .. . . .. ........... Here W M ' 5 4 v If Q Q 52 72 Q Z Q 5 3 5 w 5 S 4 s Q 4 Qyq My SDQQ AVNNNAVAVAVIVAVAWAVAVAVAVAVAVAVAVAYAYAVAVAVIVAVAVAVAVAVID'AVAVAVA'IYAVNRi Z ' l i A A ..................... ' 2 x l vi!!! l'-- ..... - - - --- ------ Q , G M M 4 is Q l ' iw E 4 -M M M j ' 5 2 Q f it l 2 9 , ' 1 M I N E 4 f M M M 2 5 - f ' f ,Q , ,- VA, , N E 7 A K 4 t 4 :Z C A Q W fm I 2 E F W ,,,,rrr 5- Q ffl I A .Vg I, 'j:,:'.- N f a M M s b ' M mg, r 4 5 ill ' f lll s 4 5 L 2 sh 31,5 or-sr.-0 2 5 E 4 ,J ' 2 .4 ' fl 4 i 4 3 3 S E 5 3 4 5 l .,.1.vf , I 1 Track Resume At a recent meeting held by the members of last year's track squad, 'l-ludson was elected the pilot of the team through the 1926 season, while Fitzhugh was chosen to assist him. A A call was immediately issued for candidates for the team. Although no letter men returned, much good material responded to the call. Coach Ott has been putting his men through the paces and is developing them rapidly into what looks like a winning team. The 100 and 220-yard dashes are well taken care of by Evans, Reist, and Adelson, all fast men that have made good time in both events. Lohmeyer is coming forward very rapidly in the 440-yard dash, with Kiser, I., and Harris, C., pushing him hard. The most competition is encountered in the half-mile with Ureeden, Fitz-Hugh, and Carr struggling for leadership. Breeden in the mile is probably one of the best men in the State, having run away from all competition, but Jennings, showing great promise in the event also. The hurdles were struck most by graduation, leaving no men of experience to till the places this year, but Fitz-Hugh and Hix in the low hurdles, and Brooks and Diddlebock in the high hurdles are making great strides in their work. U' The pole vault is well taken care of by Hudson, who has taken several lirsts, and Fleming, who is an able running mate for him. The broad jump is handled very ably by lfvans Cwho has reached twenty-one feetj, Street, and Diddlebock. The latter two are pushing the leader hard. livans and McAllister are in charge of the high jump department and are living up to their expectations. Hudson has also taken several tirsts in the javelin, but McAllister is stacking up right next to him. McAllister also takes care of the discus and is seconded by Keblinger. Feimster puts the shot a good distance, but with a little more coaching and practice will be able to turn the trick nicely. THE RECALL, which never specializes in predictions, goes to press before the season is well under way with the lirm conviction that our 1926 track team will be a very good one. I a 2 ,, 5 1 lt'! l'ilf'i'f1l Nfi, 7 l 'ix f. 1 i 1yf ',,,1, , fu r Y, Y L. GTZ- A'l, T',,'x 'NTL ', , 3 ,'Q rx' f V' J, 5 - ' H ' - A :A A ffm 215911?'A fffTQf4M.. 1-. 1' ::J4 i.'f Q' A' if ffl X f' lf fifffffkfzf f:M:-ffi-:.ff1iA':J.f4.1- 1. ' X' t ' If , sw ----fA ,-v' - f-r ----A--------------A-,-M..-......... ..... - ,.,.,... .... M-, N- ,,,, , .,A, .,,, ,,,, ,M X L MW- IUWNTWMWTtiyjr'fi3.?,:1:f1--..-ry V X llffrf I In .H 1ff,,w,,fy?Cv,r!jf'.,,1-vlwrrvr t frfi' ' W'HI'?w'-Q ZETU W flkk I W V' ' ' xl' 'a 1' 1 f'V V , :L ff ' fm' 2 rl 5,4 fz.kl,1.1li-3-Iv' ' - wwf., f 1 rw 1 H m,,'..1...mm: fm ..,w1'fX QT if- j.'.,iN- . 1 , fggixh up fl!! aj., 5 '-f':'?f-, i Z Q3 Mi' f- Mx 1. 531,43 i fi xy? ,. ,. 1 5 ma M 1 ' fi 1: Q Ei L4 M LJQI fl ffm: W ,R ' E 1 aw! 11 f ,, ny: 1 4 s , A 54 --Q: I 11 ,ff F5-rff. fi lf'-A3 1 m Q-iffiff Q il P W 1 1 Q U 5 QE 11 'fs EE 55 ff-J . rl ii JL X 3 F, 1 lf! S-we l lj S V Sw ffmi I :fa F'-Ffa E lif' :gl , 1 , I , 2514 1 gg fi F:-fl 5 k 1 53 3-11? ' H Ci ...Ny QA V7 E 1,191 11 ffl. :lx Q I 1 A1 E 1 2 2 -1 1 z'-5-ffl f I 5 'M F1 5 I iff? 1 1 1 Lx., f 2 1 i 3 2 i..1g ' glflkl i 3 1213 Q 5.5.1 Q 1 1- - I f..f'.'J 5 E ENT? ' 1 1 1 1 2 QF-,J J ' Q ' 5 y ' fwf 1 I .--A, ' 1 lm 3 4 T k ijji 1 5 , Q Q I 1 3 ' 155 , E 2 I'fUlJSON . . , ,Cgfwlfym E 'i 5324 f 5, , - . 3322 Q gf l'llL-HW-II - - ..fI.v.f1.vIr111I Cafvlcml Kg, i . ff-33 i M f ' ' ' f- nm ' L.T'QVi is C,A1'1AlN OU .. ..C0lIClL f- ' Q R VT? I ' I , . - 2 1: 5 A v ,X L 4 ,, f i JL .A 5 N 'J 1 15 M ' 4 1 1 1 5 . Sf, , l 1 V '1 I E 1 ff ' 3 sg XX. fi! A 'X 1 r , ,1k',P 'A 7i ' f ,, 'U X, V Af! Vg, f 5 1 l 1 L V ,-- - -HN -- --..,.. .... .- ..... .-........., , .,.,,,. ,g,,,,,,, M , ,,,, ,,,-mum-Mmmw M0 M U Y HM 1 f ff?--Q-N, ---': I 1-mn.-ff -a.,--- -Q-A ,- W.-F-W.-.m.,.,-. x .H .,,,.,,.. - . . ,,,,,,, H Q, 'Q' A ' ' ' ' 'A f 1 X- -, N. 1 qi. I -,f ., . ., , e.f 'Q 'WT 'Tiff f W1 ,I vf.fu,1-,.-,,-- A .'-v':N1v?tjfffj, ,f .T-., ,A My-4-fvw-W-w,' yi,--y3-1--1-yy-Wy-1,172-5.4-f3,w.7J.:.55.---qi-,N,:.,7f.l---.45-I ,k I '.Yf'll.X'.' y MQf:fjf1!fH.Zf?L1.'5Hfbf 1f?1'MzPl,2,TfZ.1M'f4,3.1,12ii.:,2-11.!.E'f,4,fTfe W, fYff.s3if WH.:Fff1fx-ff1,f'f.2Af'wfi:MQ1.3ff3.i411.0 QV v f 1 1 ai ' ' AVAVAVAVAVA'NAWVAVAWVAVAVAVAVANAVAVAVAVAVAVAVAVAV 1' pw! nllilllll me 5' mlllnu of mm- X J A Swimmm Resume This year s swimming team is one of the most iemail able teams evci turned out at Augusta Handicapped by an epidemic of sicl ness and ve1y little material Coach Deane put in the watei a team that brought the State Prep Championship to A M A foi the sixth consecutive time Cetting off to a bad start by being defeated by thc freshmen from W. and L. T 54-9 the first meet ever lost thc Augusta tankmen started on their campaign of wins by taking our old rivals Fishburne into camp by a 37-31 score. The next meet was with R.-M. A., in Staunton, who succumbed to the Blue and White under a 38-30 count. Once again the Augusta Mermen defeated Fishburne, get- ting a 45-23 decision in Staunton. The last meet was with R.-M. A., in their pool. , R.-M. A. led by a slight advantage until 'the last event, when Augusta forged t ahead to win 39-37. - A big part of the credit of the team's showing should belong to Coach Deane and the five last year's letter men, Humbert, F., Gresham, Castell, l-lolsinger, and ' VAIAVAZPBMVAWMLVAVJNAVAVAVAVAVNAVAYIMNAVAV Downie, who gave their time and energy in producing a team of this calibre. The men awarded letters were Captain Humbert, Assistant Captain Gresham, Castell, Downie, Holsinger, Harryman, Law, and Ely. The outstanding perform- ers were Holsinger in the dive and relay, Law in the 100-yard clash and relay, and T Downie, our midget All-State man, in the 220-yard dash. 3 4 E 2 2 2 E T 2 3 The swimmers and their events are as follows: . g .Holsingei-, Humbert, F., lily, and Law E E E 3 S S 4 Relay ................... D ......................,.... 50-yard Dash .................................................. Holsinger and Humbert, F. 100 ard Dash .............................................................. Law and Ely' l , .................................................... Downie and Harryman -y 220-yard Dash Breast Stroke . ............... . ................................... Gresham and Fitz-Hugh , Back Stroke ....................... ............................. G rcsham and Harryman . and Frye Plunge ...... Diving ............................................ ............ H olsingcr, ltly, and Roller r 've Y! . t lr 'L T N -. 2 5 4 2 E A WNVAVAVAVAVAVK AWNVAVAVAVAVAVAVAVAWKVAWVAVAVAVAVAVAVAVAVAVAV vlkvfv ' . H ., ................ - .... .................................... ....... ....... ......., , , P F n mm- sg ------ 1-l t ---' Q HU- lv ' . Q . ' f S s r 3 2 f' , il 5 f ll. ln i i x N' y 4 K g 7 4 K s E . f N f l 2 4 E f l 2 x l E f l 2 f r 4 T 2 , ' . i .' A if 2 N , T Q b , T y ' . . . r ' . I . 1 A S y ,7 7 5 5 4 5 C3 DVR I VA'li nYlVA'f1RfA'lVAVlRfAVAVAVlxVA AVAVAVAVAVAYAVAVIFAVAVAVA AYIYAVAVAVNKNNE l fl l E S 1 gl ll 1 . W,-WVAVAVAVAVAVAAVAWVAVAVAVAVAVAVAVAAVAinVAVAVAVAVAVAVAVAVAWVAVAVAVAWQ wall 4 lf ZS27Y1TxJTx2YY'l'!l 252515 ZxJxJg2,,fX,l,JxQX,g,g Letter' Men The follow ng m n wwe lwalclul then' letteis fol then hnc WO1l 115 pound Clas Captaln P1yo1 125 pound Class Holdemess 135-pound Class-Hudson 138-pound Class 145-pound Class 9 158-pound Class- Q rw ' 1 a 4 'Z Q Z Q Z F2 'Z Q Q . Q Z Z Q Q Q Q Q Q Conway, P. Phillips, R. Stone, mf Ur 95? Q22 F2 1 3 43 4 1 4 KA . . 5 5 4 2 2 E 3: 2 E E E r 5 4 2 E r 5 4 E 2 5 4 X4 g s ......s,.. ........ .,,.............. .....,.. g ,...s. 1 ,..,,...,...l..,,l,,,so, , , ,, A if M ile 3 Q l. - is E 5 Cllrlx yll r g 4 1 . f E of i 2 4 2 , 1 7 Z N 4 v 1 1 E S f 2 5 2 1' 1 N- 3 Q 1 1 of 4 5 1 HH 1 2 1 4 4 4 4 1 2 4 1 5 3 fi 5 - i e Hz ' ' -' ' ' ' ' 4 'c: E 5 2 5 . . . . 2 4 1 - 1- 1 4 4 1 5 P - 4- - f s 4 5 5 l VAVNNNAVNAVAVAVRVAVAVAVAYAVAVAVAVAVAYAVAVAVRYAVAVAVIVAYIWNAVAVA HAVES 1 z 1 1 l 41 N, A.,. ,..H..,..,..L,-l-Y.. ...L.m,.,..,,. --.- .F.2!.igg,'giig 'ip 1f,'51L1Q.lp dawg.. 1, M., ,,. ,VM Qgfzfdm ll Q f1.tf:,'A--5-'. -- 1ik.vf'5f 1. -.,...-... ..,, -,.,.,.. ....., ..,.......-.-a...-.-...2...,..-,a.,,.....,,.,,,,,,,-,,.A,,,,,,--,......-W-..-...,.....-...,...-...............- .... ,-....,....-.-.....,..,.,..,,,,. :?'?:.1 6 If 1:32 3-gr:r'1'wr1':17'1rx'ri1::n!Ixlxnmmqvtxvivuux fuzz: .11 uxnxy:Lt'.,,Lau:,:1,1Trx'iLt11t1'r11:-X xi, , 1 'Mft' 1 W. -.. ,.- ,.., ..., . .,.w.a..f!f Jef? fm i .. f 'b , X11 .,,., , , Y, , ,, - if--x : Jite, cf11.ffi. trim' ci 1- b ' 1 It 1 11126 1 lJ,wnflnjlL-fglmgfigiiff-V XS! 13 iff.-.-mf.-,,,.-,,,-1,,.,,-m-vfmmmm-fm,ffm..-.1'mlmmmmf-W-fm-I---mxxfdy ,,.. pyirf,-iglgzfvjvgt k 3,213 1 gj If f ,Ai falfjwl tal 1 1.171 Kill,-'f-If , vig I 'Q f err QM. 44 Tx, , Q I I f I-1 1. f -2 343 1 fr tg tl 9,1 1329 1 ll 112 59 N 11'-1 1 I 1 111 1111 1 1 12151 1 1 1111 1- 23:5 f re-ig I , 11 fs, . I lift 5 I I f' ti..-F1 12,51 1 I! 1, Ei-5.1 l 1 11 it-5 .fa , 'J - 1 . If :1 l '1 .1 I 1521 I i f le 151 ltxtl I lf ll 177 1 fr-Q71 1 A 1' 1 ' 1:-5? 1 I 1' 153 1 tl S ..-fi-a 5 1 -- V lu- , 1 1 1 ,l 1 lf!-gt '1 1-Q21 571 1 V 1 f-fl 1 1 lf 115,-.425 5. 51 1:1-1 1 iff-3 1 11 11 2 11:31 5 g at 5.5.1 ..,. 4' 1 K , K' 1 jr: .L I W xiii l Q-jx 1 1 5 111.5 , MT' 1' 554142 1 Wrest11nQ Resume fre 2:55 l - V.-f 1 l,. T1 1 , li-Jus z ' ' . . . 1 iff 1 For the sixth consecutlve tlme the A. M. A. matmen have captured the State 1-.gl I if-,X ' ' , , . - . . . SVT? 1515 1' Pre 5 Cham 310115111 . After ffettm Y awa' to a had start the franlers hmshed '-12:1 , ,J . 5 1 s . 1 is Q. A. , 1' it 1 . . . . 5?--,' i ffm? the season 111 hue form, dowmng every prep school whlch they encountered. 1 171, 1 ' 1 . . Y . . 4781 1 1 Wtth the ald of Loach Glend and La 31121111 I-'r or the Au fustans turned a it 1 1 'X 1 F-5. 1 Q F E5 1, 1 we,-I 3 i . . . . S 1 1,33 5 green team mto a hmshed set of matmen Wl'l1Cl1 A. M. A. was proud of and who 1 'fit 1 1 ' . . ff-T1 I iff' 1 1 1 were res Jected ln ever f are JH school team 111 the State. Q55 1- l 1 15,1 ...aw 1 ' , - . - . .W ' 1 . 1 Phe hrst meet wlth the W. and I-. 1' reshmen proved a defeat, lmemg a defeat 3,51 -11141 I , , ' WW 1 1 21-3 but m the second encounter the Au fustans t1ed them 15-15. In the second hip- f ft ' 5 15,--I meet the Iilue and White lost to the V, M. I. Freshmen h the close score of 13-12 125' si 1 , 51 ,Mg ' , , , Eg tilts 1 1 a11d 111 the second setto downed the yearhngs by a 12-8 score. The Illue and Wl11te 'iii 1 ' l I also lost to the L1ttle Cavaliers 12-3. The Keydets next conquered Virginia Qgffl L '1 I I n Y ' 5.9. . 1 , l Eplscopal bchool, wlnners over lu. I-1. S., 111 Lynchburg, by takmg a 19-10 V6l'Cl1Ct. . 14 . . . if -3 Thls was the freatest reslstance met wrth from a re J school. In our last meet ga -'NH-I 1 . . . . tif 'Q . the grapplers met then' old 1'lV2l.lS, F1Sl1l3L1I'llC, on the latter's mat, and whltewashed N . 't 1 .... 'X A I I them comm f home with a 25-O vlctor on thelr shoulders. lvl' -Xu l ' xxx '65 1 1 ti--1 1 1-iliw 1 5 i5'gj.E s , lf ds f l l 'Q'-.3 1-.11 ' I 'jp , QQ 1 , 511:11-2 X .1 1 1 .. lyme s lit 1 1 l, Y -4 111 QQ-1 ' F-1' ......-..,..., . ,...1,.-.. .. .Y .-... .--...W..f-. -V--.-. .... ..-. A-...-Q-.-N, pp-NTXX .X rf sy ,S.,,-.. .,.. ,,., , -,.,.,. W. - ,.-,,. ..,. , ,, , , .. ..- .... ...-...- ........ ..-....-MM-. .. ....M-.,,, ,ff XI- E f 1, -. ,.,-,..-., W-.. --.,.-.-,.,-.,ummm,-,-,,,.,,.,,,,, ,,., ,.,,--,..- ..,. .... Wu--...-,--,-....-----...-..----...-.,...,,,.,-c.-....., I '- . I www .f .'1'rw ffi W W 1I'?t 5 E1 '1'- Tiff mlm ,-S.4',1 S.f1bZ'LE!1t,SLsS5J.S.i.1 1. .L 1 - f .Q137,cv.E.e.31.f.-z.1q,.1,1.m-. f 1 Boxing Resume lloxing is an entirely' new spurt taken up at Augusta this year, hut was met with much enthusiasm hy the cadets. A large ntimlmer were present at every prac- tice to try to learn the game and uphold the schonl's athletic traditions in this new sport as in the older ones. - The team was coached hy Mr. Willsciii, of Staunton, a professional nf former years, who taught the boys the liner points of the game and turned out a very fotmidahle set of punchers. The team was composed of Captain llright, Assistant Captain VValker, l'ayne, Merrick, Lynch, Mackay, and Adelson, and was managed hy Merrick. i Only one match was held, owing tn the newness of the spurt in this school. The Augusta leather-pushers met lfishlmrne in our ring, and after a very exciting and hard-fouglit match the teams were called a draw, the score heing 2-2. , '1ff1'ff'7'1ffGf'Q i W I 1 y x 1 v t l ,yr,'gw,'Jl'1,'gSj-, l -- Mg- -- fv...Y.v.--.-.........-....... J PEEP :XTHLETICS S34YiBm mm.4V'7i1J 7 A EE 1 f'Ef2ZEgAf7 MQ ,,M,, MM , N, G, W MM h -, W N- ,- 5 ,T 1 , Q - , I FJ '':.'x:nn'rr3n1rgT:J41.ru1xuLgn:1,1uunu1.xr1.111,x.L1n.v.u:nx!.4.Lf.1u..L.:.x.LuLp ... ..,. , W -' f ID AS-, - x. , . Q J J 'A M' ! X -14, an :tiff f C N . :u4..u1,nn1:'Yxxu1u11:,1n Luuxux,u,1un xutuuu:xn.:.xuu1.uxxLxu11'1Itn J HM , -ZMM X D xx X x A 9 R .1 ,T ills' will fl -X Pail A 'N nfl' Lg ' I .. ', , we ,' W x 'X - ' If - 1 17 ' ' ' rw! VK ,VA X XY ,. .y - 1 f 1 - 4' x G - 'K ,ff ., 1,1 EQ ' X3 . xv ' -- ,A N 16 f F , .,f E fl? 4 gg - , U 5-I V 'IO 14 'Egg N ' , ,nm my L --' . I 3 H f H 14 ' wi Z ,xg T ff Y Q , 5 K . hx 5 l A A 4 V5 I N 1 1 A - K ' N 5 Q 'gg Ri f gi . 5 V A 5 4 1 I S3 I ,C W s 1 Pri 1 aw N, .4 A V ' El JN: ' i na?-N f HQ q gg, wif? 4 9 Q ' l , W 1 Cx: H i I ll- f 5:52 X 5 9: yj M 'U Q I in ---.-.L-...---....., AY. ..-.,---..,..-,,,.,-.-,.,,.,,,-,., ,t-,.,,,..4, .,,,.,,,.,, ,-A . ,,,,, D wi gif-537 G1?....,.--,,,..,-hM,-A ,-,,--,- M ,,A ,,1,- A, n.,-,, ,,,, mm, M.-- W tp 2 Y ' , W -.f- 7 1 34. Q. vv vnv mv v vmmvzmw' k , 1 11. H s 1r'. I 1 1 I W-A 1 -... .. .- ' 101I,M'7'?'7T 1Cf71Q1'71f1' Ff7 fjf'v'w'w'-ff -- - 1 11-1111 1--f 41'-ZTITMT'Z''iiiifilifigi7gi1T w'-1-M1 '----- -A -----N-.N-.....M,,.I,,,,, xl 1 .. .,,, Ak, MMUM- www., at-HHH . , .,...... J..-,,,.1.1 ..,-.,.f:..-4.m.:4 .,1- inf' 1 , I1 c. 1, . . ,, ' ' ' Ip--.. X2 IIZ11 , .-U-rw--1x-11'-K'-fi cg? -P-'- 1-1' 1-'ff ' ' M 'LL'A 1m-'11-11'-1: I - 1 1 -bv-- 1 I. 11 W., 1, , , f 1 1 Q4 1 1. 1 wi13N1,I M1122 I I If N Q30 1: In K, Him... .au-my ' - UU '1-1 1-21111111111 .11u.xn,1u1,m:.. 1111114111 11:111-,,111:: 111111 nxt,-U, U :QQ Nif ' f!I,f,r-fxilvxhw Mqfygbivgt 'NNI , lj? W Qk H1 'll .-..,,, 3111553-T1i1,a N A ,gil U I K1 1' 1l'f1,II1 ,1I!,4A5, 4,,ffL 1 -.,Y-jf., I A ,YP 1 1 .11 IS II 1 I 1 FJ .Ifxff ' I nj c 2241 IvI I Is III IN I' I 2 gulf: 1: 11 11 1- I1 11, 11 1 1 1 1' 21,111 11 ' I I 12'-1,5 I IJE1 IIAUI ' 1 1 liz: I 1 ' If I I I I 1 1 1 ,A 1,1 I 1 I II I -3 I I If I I fffj If .111 1122 MN1 I I F ' I ? I I I 1 1-S1 1, .1 I qw 5 ,Q I ,I fd 1 I I- K LI I Iyii L I I U , I II I I 58.1 1-A E25 N Y I I1 I 1 IIQI Si? 1 I I VI 1- 1 1111 1 1 ry-1 1 1 1 I I ,1 ,..I 3- JI' .IX 11 1 . Q I I. 1 I I ' 4 I I Iii: 1.- - 1 I I I 3142 I I 1 P' 1' 1 1 1 1 In, 1 I I I9 1 I 1 I K1 111, I 1 I 1 IQ, 1 I I1 V1 1:4 I I II 11'-21 1 91 l I 1 1 64' 1' I I 1 1 15-XI Ii I I 51 I RLQII 11' Q1 I I . I N 1 It I 15,31 KY ' II 1 1511 wg 1I 1 1x1 'KN I I . Iv E43 I 1 E 1191 I- I ' ' 151 L I I 1- I II I ISI g 1. 1 gf . 1 'xg I--CI 1 I 191' :,, h I 1 1 Y Jay! 1 1 I I I If IX? I 1 I - YI Dfw I I ' I 1,5 1 I 1 'I 111 I 11 I1 1 11 rf? I 1 I I' 1 I IZ 1 I I I I 1 If LY 1 I 1 II I KU I A 1 , 1. 0 1 1 1 , 1 3-1 ' 1 34 I1 I Iv 1 Tx, WI I 1 gl 1 , 'I I itil, .I I ' - , I 1 Q----W-um.- .1 I II H 1 - 1.51 if? 1I 'f-'W-----11 11A1 M -A11 - f11- -1 M F 1 'A-1'1ig:I1gq N- 1-1-----MM-AM-1111wwf-, ,Afx 1 1 X15 1 ----1---W'-Y----- rw, -1 Af .1 1 X- fl'-J.- 4-L-..1 .1 .LLL 1 'qW?'QfI1I5'iY3??'f'i?XWWvVVsg.ff W ' 1 -I A-f23Qfff'417I'll' 'f 'TI'i 'I Q37 RL..- , ,.i-.HI..1..1,.Q,-.1fI,13L1,sK,,,1,, M1, up 1. 57.0 4.5-fQf'xl.J :Qi A , X I , 1 I A 1 4 ' 1 ,J I x, U- I lm' 1.1 IW.. .I xfl ,L4 ,.. I. I I I N I 1 ,IF ,P II I WI IFJ W1 I9 aff 2 I' gf-I E, if If gm?-I I ,, I li' I2 'Tfi If If I I IS Is: WI W'W' 'T'T i f1 f,i '-'M-W' W--- 4------'---------' W -- - -W-----I 7 ! gun 'PW' up'-msn -V U vm ,d-,Ilia LQ '113314-f'L-'. 'A1'EZ:'t2x1xn1 .UL Q3..u:,Lu.Lxu.u1.uJ4.Luur:ux?1n.u,1 :rn1 1 .,,-1 3 1,1 -,fjl3,Q::1'L1'1S1w1fL?', ,.-it . Jim. tjjj I A K :Q A' .L I: iw!! YT-67,5 :WDM I ix '1x4I'IrIn :I any li M Q I, fx '-uf:-E'-f.J,f.:1w:nx ' ll X YIM wI,,,IIfIf ' I If BS' WWI I I I If' gb IQ I I I If II QI L1 t ,fa ,Q II I I ' I I .I Y 31061, F 3 Y , I '02 I ' '. I IM I II I I V 3 I 'I I IQ I I I1 I ,- ' I I I9 II I I WNQII I I I II' - I I II kk I1 'I I ,fi 54,5 I , I, VIII I 6 , will :N ig, 1 .mfiiw t II I .Q I I 4, .,. I 4, ,, I I E I 6 ' I 'I I I I r A X I 531 I II I I I - W I l , I fi aw X if I I 53 01' I r CHKIS I X5 II I I I 53 I I rj II' ' I -'T'9'----W-HV----- ,--,I,-.,, Wm- -. ,. , ,,,,.-,WM .,-,,,,,W, nv- , 3 gl I I I-I-.--.-W.---,.,,-'- .,I. -. III.I, ,. I, W-. ,I II,I,I, , I,,,, W ,,II,, ,-,,U-,,M,,,,,,,,,,,,,I,,,,M ,,I. f -Mggg, I ' f a r-I - I---I--I - -I ---M , jf?M12Q3?If!.z5.WT,J S7Bi?.'IY1',IS'ZI.Y2?'5fJ .KI?..S.f1g,., ' , .L AYAVAYAVAV VAVAV 'VIC NI WMAUNUGDUF2335DGBUHNFU4ZQBEDSDUFUNW4QNWUNU5DUPUWZQDQWZHZQUGUNUMWUQZNZ VAVNAVAVARWVAVNAVAVAVAVAVNAVNMVAVNAYAVAVAWW'NAVAVAVAWVAVAVAVAVNAVAVAVAVAVAVAVAYAVAV 'gy'-Heal , ., ttf - f.ifg,,N J 4.1 Soctal fin HE Soelal Season at Augusta thus year wxll be recorded as the most for play have ever expertenced and the success of them was due mostly to the members of the Cottlhon Club and the School orchestra The Keydets took more mterest ln the dances thls year than m prevlous years and every one dld thetr share to pull the Hops off m grand sty e lhe Grand Opening of the Soclal Season began wlth an Informal dance on the nlght of October 12 and it IS needless to say that a wonderful time was had by all who partxct pated It marked the first appearance of the Keydet orchestra known as the Augusta lxamblers who surprtsed every one wlth the excepttonally fine brand of music furnlshed Closely followmg the first Informal Hop was the first Formal Hop of the season whlch fell on the mght of October 30th and was attended by the largest number of cadets ln many years The muslc was furnished by the sensattonal Augusta Ramblers who were at thelr best The decorattons consxsted of red and whtte streamers runmng from balcony to balcony arched m the center where there were two chandehers draped m red and white The orchestral platform was draped ln blue monogram blankets and the red white and blue foothghts added much to the effect The Hop was led by Cadet Platoon Sergeant F1t7 Hugh wlth Miss Marye Johnston assisted by Cadet First Lieutenant and Quarter master Byrd wxth Mxss Margaret Perry The next call for the dance crared kcydets was for an Informal on the night of November 5th whtch was attended by an exceptionally large crowd for an Informal Our same old standby the Augusta Ramblers furmshed the mustc and they are gettmg better every day Thts was a lehghtful httle dance and w1ll be long remembered by all those attendmg The Keydets were craxmg pleasure agam so they called on the Cotxlhon Club to give another dance and then' request was granted The week end of December 4th and 'ith found Memorxal H ll the scene of two of the most beautiful dances of the Socxal Season at Augusta The success of these two dances was doubly assured by a dansant on the after noon of the Sth Thus dansant our first proved to D8 the perfect endmg of a soctal week end The ladles seemed to be at thelr best ln the afternoon and the occaston was full of pep and excltement everyone trymg to put weeks of pent up excttement m what seemed a very few hours of dancmg Put enough sa1d about the Informal The Formal the real dance that prepared everyone for the dansant was also most wonderful The rhythm of Jeb Kelley s Southerners was received with great enthuslasm In Cadet Captam Boswell and Mlss Bruce Boxley the leaders we have the explanatton for the beauty pep and sue cess of the Hop They were ably assxsted bv Cadet Captam Humbert and Mlss Katherme Roller Phe hall was tastefully decorated wxth orange and black streamers and the use of colored spothghts added greatly to the effect Another attractton of this dance was the many famxlxar faces of our Alumnt Now came the let up ln our Soclal Season only to break agam wlth increased fervor supported only by a favored few thls time Cadet Jack Slemp, the manager of our Football team, gave a very dehghtful banquet and dance at the Stonewall jackson Hotel in honor of the Football Squad Major Roller seemed to enter mto the spxrxt of the evenmg, as he always does, extendlng our permit so that we would enjoy the charms of Stuart Hall asslsted by the Augusta Ramblers Not to be outdone by the Athletes, the more socially mclmed Keydets supported an Informal gtven several weeks later by the C0f1l'lIOI'l Club wxth enthusxasm The success of S2 p56 Gxyc 5395 gEw9!tgDf ' .Dt W E3 Q if ' .......... . ....... .................... ...... . Q ........ . ..................,.., , ' lasa M- I r .,l.,,,,,..,,l,.M9g. ................. .................... . . .. ... .... . ........... ....... . ... .,,,!uL,..M!!mi:!n,ff S I at 9 S1 I It K ' 'l Q 2. 1 3 . ,I w f lt All Z : successful and enjoyablelone that the Keydets, who always find time i f ,ffI'fQ ' - .9 ' ' I , -1- is U H Z ' . H H . V H U I ' l q P J ' ' l f A ' 5' JL' 1 . 5 f l - ! , I H . N I H y n ' ' Nl f . . I r - -' l f . - ' l ' u n N N -Y . , . . . . M l . V ' : , ' it as Za. VNNMNAVNAVAYAVNAVAVAYAYAYAYAYAYAYAYAYAYAVAVAVAVAVAvAv1gqyAvAvAYgyggvgA W WWVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAW VAVAVAVAVAVAWVAVAVAVAVAVAVAVNAVAVMVAVNNAVAVAWUs'NAWVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAV IE' A A , u nn umm da tm gb en Qual 27119 N vs Egg!! l L - 4.1 thls dance was credlted to our Faxr Lady Charmers of the surroundmg c1t1es nestlmg wlth us ln th1s beautlful Shenandoah Valley Thus comes a Flnls to the dances for a whlle The next blg thmg scheduled on the Cotllllon Club program was the Easter Hops whlch proved to be the biggest success of the season The Formal was held on the mght of Aprml 9th and the Informal followed on the evemng of the 10th Pete Macla s Orchestra furnlshed the music for the occaslon whxch was enyoyed by everyone 'lhe Keydets were well re warded for thelr hard work displayed at Government Inspection by the Formal Hop the mght after the Inspectlon Many a word w1ll have to be expressed to ClCSCl'1l3C the Easter week end Wnth the wxthdrawal of the Inspectors the more mterestmg personnel began to arrive At dlfferent Intervals a Keydet would come dashlng through the arch to welcome hrs Falr Lady The largest and Jolllest group of young lad1es that ever attended the Augusta Hops was present and many new faces were notlced From the enthuslasm and excitement shown you would never guess that the Young Army had gone through a tedlous week The Gym was attrachvely decorated ln colors lepresentlng Pastel and Sprmg Stream ers of various colored hearts hung from the beautifully blended chandelier hanging from the middle of the cellmg to the balcony Strams of Good Nlght Ladles and Home Sweet Home were heard at two ocloek and the Reverllers returned to barracks everyone look mg forward to the Informal the followmg evemng In the meantlme amusement was fur nlshed by a track meet and a baseball game rn whlch the Athletes proudly dlsplayed thelr sk1ll and abllxty I INALS Now comes the mad dash lnto Pmals openmg w1th the lmal Cotllllon Club Hop on the mght of May 30th which easrly surpassed all other Informal dances given by the Cotlllnon Club of the year 25 26 Not to be out done by everythlng else the Monogram L lub offered several hours of supreme amusement Cadets ln whxte and young ladxes ln snappy sport dress made the occaslon umque and attractlve hor these two dances the Augusta Ram blers were at thelr best exportlng the newest Jan hlts Oliver Naylors Band playmg Our ITIFCCIOI' lssued IH the 1-'mal Ball of Z6 led by Cadet Captam Boswell wlth Miss Bruce Bovcley ably asslstcd by Cadet Captain Humbert wlth Mlss Katherlne Roller and Cadet FIYSI Sergeant Slemp with Miss Carolme Goodloe The mlhtary figure was gone through wxth extreme beauty and grace Ihe ladies of the figure wore solld whlte evemng gowns each young lady carrylng a large corsage of Amerl can Beauty Roses 'Ihe cadets wore the olhctal full dress unlform wlth a rosette of Blue and Whlte Thls presented a very attractive and fascmatlng scene 'lhe ball room was placed ln the hands of an mterlor decorator who fully llved up to hrs reputatlon changlng the room mto a palace of color and enchantment After hours of happy and pleasant danc mg whlch passed away hke mmutes a recess was called in favor of the Dmmg Hall where all enjoyed the dellclous Fmal Ball Mid mght Supper I-'rom there we adjourned back to the dance hall where many never to be forgotten hours were spent Joyfully and happily untll the wee hours of the mornmg as the sun was peepmg over the top of the Blue Rldge Mountains called on Ollver Naylor to play The World IS Waltmg fOl the Sunrise Many hearts were sad as the Cadets walked through the portals of Memorlal Hall 1n Full Dress for the last trme So the Soclal Season at Ole Augusta comes to an end but we stxll llve up to our former tradttlons as havlng the best Prep School dances 111 the state of Vlrglnla The Olhcers of the Cotllbon Club of the year '25 '26 were Presldent, Cadet Bos well, Vxee Presldent, Cadet Humbert, F, Secretary, Cadet Fltz Hugh, Treasurer, Cadet Byrd, Chaxrman of Commlttee, Cadet Grady The Commlttee cons1sted of Cadets I Slemp, G Saunders, I-I Hotchkiss, G Walker, M Cooper,J Wxlkmson, C F W1ll1ams,I-I Bowen, I Taylor, C S Roller, 3rd G S F W C M W was 4 qs, ,............ .... ............... . .................. . .... . ..... .............. . ,ip T V 'f'eg5guu.'z.':::1fzsflgi-sy,',,!,.-mm - me 6, 5-L - .,,, 1:T?'g!lE?!1E!!'!!!'!!!!'3.:v ,m!,,,,,,m,mm.3ff .............. ....................... . . .... . .......... .. ......... - ...w ' - ,, 15.3 V mea? 'ff Nl IM xl ' ll ! 6 . I u l . H . ,, . . . . . Ku' N flr ' -. H : z . . . . . V , . f ' - , ' , ' f t u . r I I , U N ,, , 1 f . . ' . N f . . ,, , . . t y N . z ' ' ' I ' 1 - Q 4 - Nl C H I H . E . . V4 . . u nr 1 K , N 1 . . . ' I . ,, . H . ,, ' ,, N f 'Y . 1 I 1 as ' H . . . I , X 4 QSM 4 Z. VAVNMNAVNAVAVAVIRVAVAYAVAYAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVIYNAVAVA'HTFR'Rs COTILLION CLUB MLVAVNAVAVAWQYAVI - AAVAWLA NIAVAV. 15.5. 5 Q Q Q Q Q Q Q Q Q 5 4 Q r K 5 4 5 5 4 4 4 4 4 4 4 4 4 Q Q AYAVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAWNVAWQVAVAVAVAVAVAVAWNV'.V VAVAVAVAVA 5 '!h!!!!!lmQLi2L,9, 4 62- -............... ..................... ..... - . ...sb ' 'Q7,!!,:!,-all-u.!!!!!! 5 N m L' I III S9 Q .II I I X 3 II Jinx if I f I I K fx f r f f I um! W . W. W.'BOSWELL F. D. HUMBERT G. S. F1'rz-HUGH J. M. BYRD ..... E. D. GRADY . . -.-.---..... C. B. SLEMP, III. J. L. TAYLOR M. H. BOWEN C. F. VVILLIAMS H. S. HoTcHKrss The Cotillion Club ' OFFICERS . -.-.-v-...... COMMITTEE . . . . .President . . . . .V ice-President . . . . .Secretary . . . . .Treasurer . . . . .Chairman R. G. SAUNDERS G. P. NVALKER J. S. WILKINSON D. M. COOPER C. S. RQLLER, III Q54 ZNAVIRVNNAVNAVIVAVNVAMYAVAYAVAV VA AVAVAYAVAVIVAYAVAVAVAVIYAVAVAVA IYAVKIIS i - f .- , . 4 --.-A-H V. V .. , . ,. ' 1.1111 A T ' vylncfxi 4H4x1,441lx!ow-r-11:1 I, .. ', lfhff.-N' 4 1' Wf ' 'V . I. x rw-urn f K If ' ' W ':' '--' ' -Mr 1.1-'Q ' 1 w , 1 f V ,. ,, 'H..,.,. , , V , ,y 1 , x X H , X 4.x.1.l7lf-'f'QIY'-'i'f:- ,1,lwfA.- ,Jug 34-,1g gQ 1, gs' .J ,-'a':.-:a,v4,Ca1f-fn3:'1 '-,r Qmvjqffrj,'Q:rifv1'Q':'-1',-1, Vw 1:5 'fu 4 1 1 Q r I v L P . 1 1 i 1 1 3 f Y I 3 Y i 1 1 F S l 1 Y 5 i 1 , 1 E I S Q 1 5 2 1 x I s - 27 x, YQQ .+. N. H' ' ff,,f 1v4-.,x1,.Q..in41Tv.f ,. s zffiTff.ff,Evfr.sfi,.2,21.L1fif14sf,Aff ffJ.u.'fQ:uA4,f.1 - gag 2 5 ' U 'K 'Nr' ,. :Zigi 5 'ayi gvm-mvAvAvAvAv,mvAw. Nw. AV , , M 1' ' ' ' 'WN VAL!! vAvAvAv,mw-vAvAvAvAvAvAvAvA1AvAvAvAvfvAfAvAvAvAw-W'MMVAVAJ-VAVAVAVAVAVAVAVAVAVAVAVM - , fl 'g x It ! ,... . ... . x A 4 QW -if ' V 1 Y 5 e Mm ' 5 fn 1 NW K 5 a N 5 S 4 2 3 K f F K. NN , f N 4A w ! f Q . f X rg ,r X' N F a 1 5 l 5 2 E 4 i . G . E l S ' U? I -'A'-'i,,-,.4igil1...:1.1g:i:gi1T:4-,.':,.-'l:..iSfJ V' ' E Q23 A AH ---M . V V- .rrvn 'IE-141 lv E mahvhy,yAvAqyAqpfAV1gv'AvAyAYAYAvAYAV Y YW, Y V, VVAVAVIVAVKRV .Eff 1 ' VAVAVAVAVAVAVAWVAVNAVAVAVAVAVAVAVAVARVAVAVAVNAVAVAW NAWVAVAWVAVAVAVAVNAVAVAVAVAVAVAVNAVAV N 3 S 4 P 5 4 2 Z: 2 2 2 2 7 S 4 5 S f 4 w U' W A if 5 s 4 be Q A 2 E ENDYAVAVAVAVAVAWAVAWVAVAVAVAVAVAVAVAAVAWV VAVAVAVAVAVAVAVAVAVAVAVAVAWWQ my ,............ ...n .... ............................................................., , ' . 4 1 V m,,,,,,t.,L,,,,,, ................ .................. .... . . . . .. ..... ,,,,,LL, ,4,,m,i,,A ,, JEL Q , wa!! g 9 5 N i f N , A ,fm ' ' MI S 5 f 1 N S x . f f i X 5 P N 4 K 3 y I Q . 4 Q S g f N g f N 2 xx f f 5 3 f 4 r 5 5 b J V L-all g f s 4 E 2 , P 5 5 5' 4 4 Q9 2 W QQ Q ' Z!IR'A'lR'ti AYA AYAVA AVINAVAVAVAYAVAVAVAVAVAYAYAVAVAVAVAVAYAVAVIFAVAVAVA ti'li'NKN ,M VN AVAV Aviv ,MV NA vw AVA' AVN Am, AVN IVAV AVA v Wk mv AVA VAV AvAv AVAV , AVA VA VA VAV AVA VA' Av X wh 'n 'Jun' ll!. nx'L'f?g,g, .Neg . -.s La Kmququ' STE M he 1 L N I 'J 1.4 lm'g'TN m yfw-,Av . AVAV AVAV AW AWA VAV AVA V AVAVAVAV Avxv Aw . VAV AVA VAV AVAV I Av VAV A T lv . Av 39 Q a,' if 5 5 N A , pg Q Q Q! Y , YN, AVA 'lv Av nm, Amv A 'mf IVR, NN AVAY AVA vw N MA Viv N Av, N Av li' nv N Ms Z P2 F2 Q Q Q ? Q 5 if Q Z Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q R P Q 5 fx Af ! K f 2, N l - N F' gg? 4 by Q2 ' X- Q-tp 'P QQ 4 M f---- ---V- ..-- .. - . - , .,..--. , A 1 A VADKV AVA AV, .H 41 my 1-'- ---- Q-'- '4'--'-- -----'---M '4'4-- -'W---:-------i------------- -3'---- - ----- -- 1 l , 1 1 . 1 '1--mfm,111:.1-'1 .1:.111.mn 1,.r1.1..1A1uL1m:In1.um:g.,u..uu.g1.11u,.::.fn ' - yrmwrm mmm- JJ 1 MMSTVZ ', A 1 2,1 U! Y ' 3. , ,. 1 5 1,11 ?:fIi.-f4:.,,1!3Tf ,ku ' f ,. ,A '1Q!1w - .. j N if F I iv :u ..,.. 11z:'L:,,t!iu rugxux r xqflzzfgfgixxxfswtzzmxxx A -, , im my 1 51' RU? J fi T 'X' N 1 Tj! W i XR' 1 4 1 iz K 1 ? ,-- 1 1 '57 . 11 ' 4 :ju gf 15 iff--F. - A - , if ' V151 V ' ' 1 1 1 1 J 1 F ' ' 5 ri 5- . 141 1 11 11 fgil' Y D I L 1 15511 1 4 1 . wi! 1:31 1 - Vyfi 41 Q14 1 1,-6 1 . I 191- 1 1 15? 111 1 Q 1 1 2 1 1 2 1 E 1 11 3 1 1,1 g 1 1 1 5 5 1 16 'ffm , 131 2 5 2 1 2 E :- 25 7' 5 4 2 2 5 r r S 1 1 4 -41 2 1 L43 ,r In 1 1 'ei 1' 1 , 1 ,11 B. 2 1 1 ' 27, 1 5512 , E I ' 1311 l 7 T 1 Q -if 1 1 xx 1 1 1 3551 1 11 5 1 1. 044 1 1 P Hrs? I 1 M iii 1 5 , V1 125122 I I 1 ,ya 1 W 151 1 I 1 1 11111 1 1 Q53 1 ' Lf' ' - 22? 1 1 WW ' I 1 1 S. l 1 F41 ' 1' , ! -. 1 1 . 11 1 1-'V 1 1 13 sl 4 2 Q11 'be 1.1, gr ' 4 ,cffli 1,4 'V MM A7 211QIllfIIIQ11QQfQf.QQIQIiQfQfI'W 7f M'AT ',Q'f f ,,,gf--' ,. Q , ., 155 ,U K' ' ' W' FB ' 1 1 F . Liam .,1l n M 52i3ZiQ11fZY1?m fE9l?'f1'f1fS!.-5,.7,n1f7'f1 .Ji i ,, 4 4 1 1 4 1 VAV AVR' W WY1 I. I ,..V.7,,k , ,,, , ,, ,f.1, ,Aff -if ' J iJ ' 1 , .'1 1f1'f'1', ,'1'-.H 1 1' ' 1, 11 f 1 - .5 mfkgl fx Y .1 K 'fu 1 '.,1-,.',gf1:.?.L f,,i,z , . ' ' f 1, '1.1,'1 i41Z4, 131:14 ' , 1 : 1 1'1 ...x-111,111 1,. ,1 - ' 1. ,-. , .1'. 1, ,f , ,N J .T f' ' 1 '1 7 fn'--'P If 371 .4f,f' F- 4 -. fx-L1 1 .,,ff '3 fff'iff'-1-.1'1',f T 1 1 5 X' X X V N Lf,,.,1, f ,. .,f2, K. X ,WJ V ' fn' ' , 11--V J ' 4' 1 1 .-- -, 1- 1-. 1 111 - 1 1-1'-'v'rrr'1-11y W'Ix9 Cf' 1 -'T-f-1'-1, Y 1 A---A1 gl A 1,11 , 4 'U'-'1-':.:g:,J A X1 X :xo 1 , X 1 1 YE 11 H x 151 1 f 11 ff. 51 1 1 ,xx -......,.... -Wx .Ai V... 1 lf, ,,. 1.4 1? 1 1 MJ-ke f ,,f-., 1 111 V1 15 ff 11 In 41 1 1 1 5.1 11 211 IX I 13 ily rv 11 '1 iw ,E Y ,. 1 11 il nw 11 1 ---ff 1 J 'u 1,1 xx, ls f 1 1 1 0 v .1 1f 1 11111 Q 1x1fp+1'11,5141,,l111'f1X11l ' 5-4 -3-,j aww ,L Q' '- w:,11'f-,.-111' 1-57 --1 Q.-A:'yr-My-.,,,,!.1g.111 gf: 'x,l,.i1 ,:1.WX--,WN ,N 1f,f'1v,-XJ, 1, ,. .JM ,. ,Y E-.n Lai1.sz,w11x.L1g.11...L3f.1.1111LgL113.1..z.--L.Lm,,f1.,L1.1.41 z,g'J,Q1.1. 111 ir '11 H' r, 4 . 1 1.. I 1,11 ..1,, 11 vm 1'f 11 f ., M. ,11 . 1 J. fi-.M 15, ,N . ., , 1. .'-. ,1 12' ' Ax. 13 .- 1 .-.. 1 1 1 If 14 1- 1 1 1 L 1'1- 1. 1 A., 951' 1 W. , Af -, ,J 1. 1-,hx 1! 14, - P- f Eff 1 1 ,1.' , 1 'J 1x'x 1 1 J 1 nf I. -11 V , 1 1 1 1 KJ' I 1 1131 I KI 1... 1 1 . I -Q 1 ml 1 N 1' I I-,I 1 1 Im gmia 1.515 T fl Fjjif 17112 ,,. 1, ffl 52111 1 ,fy 2 1 ' 11 ..l' ' I--1,11 '11 I 1 fx? 1 11 S913 xv, ,I I 'QI 1511 JI. H711 : 7l1'1 1 -.1 1.- - 1,14 VMI 111 I.- x1 .1. fy 15.1 34.4.1 -mf I- w1 1 ,Mg 5'-kj, -fl: K-1,111-' 11971 1 ,ff-I I1- 1 1 X1 , .fy QI I., N: 1,-- QA I,.g1 E ,,,, X13 113141 1' . :I 1'- I, A I c 'XI 1 1 11 1 '.'I 'Q '15 . 1. 1' -Ni I ' 11 1 k .1 1 . 1 I I' 1 1 H' ,Q 1 QW 'f vA. 1 'I I-,fd , 1 1... 1 1 1 1. I KQ- I ,1 'I KY, -'KX 1 I ff ,' mA.. ' f 1 f :II 5 'r S1 ,, . ,fiwgtl I1 I1 1 1 'fj 1 1 Qff'I',' 1' .:. an 1-11 1 f ' N1 , A 1 V W A ' ' f ' ' ' J ' x 'N I 'XI I 1 ,, 1 - 1 1 U lrqj...-..:...4u-,,'1. 'cg , A ,11 , f -,H 1 1 - .,: ' ' , ' .o 'IN'-17.1 W 1. .1 1' J- I ' ' -1'1I AH ' 1 1 I Ixf' ' 1411 If 'I11' ' ' ' , ' ' C I I ffl' I 1 1 1 If .f1 ,W 1 H.: ..... , V 11 1 f , 1, 5 1. I . I I ff 1 .I 'v' 111 -X1 1 l EI,1.--11 , I9 3 I1 1.1 I 1 11 II1 IKI lj,- I I 1 I '19 I I I -I1 I 1 1 1 1 -111 1 . - 1 1 -1' 1 1 1f1 11: -1 1 1 1. ' 1 . 1 1 If I I ' .I I . I1 II 1 'Q 1 ' IQ 1, I f ' L 11 1 1 I II 511-7.1 II II 1111 QI II 111-,I ' I 1 I'i1'I 1- f, 15- 1 1 14 il I1 ' 1' II 11 1 - 1 fy. I I I1 1 111 11 -, 1 1 ,., II II I-,III 1 i Q Q1 1 1 1 1 I I I1 ' 1 I ii I 1 IA 1 I 11 . 5.1 I I I '-:I , 1 1 , ' I I f ' I YI 11 '1 1 I II I 1 1 1 -1 I 1 .. I I I I 1 I 1 I 1 4-11 1 1 I I I , , 1 1 1 1 1 1 1 I I 1 1 I I 7 . .1 I 1 .YI I Af: 1 1 11,--1 1 I 31314 I 1 -I . 13, , 1 1 1 'l 1 1. 1 1 5 rj- ! V X1 1 I 1 I I ' 1 I 1 1 1 1 1 I I I , 1 1 I 1 ,, V11 I I 1 1 1 . I I , 1 V , I 1 I if 1 1 1 I I I ' I I 111- I 1 I '1 1 1 5 J I I III 1 , 1 . I, ' ,I I ' 1 I1 I ' I .J 1'--'Z 1' ui 1- 1 2 , ,f5'I: 11 A 5 M ' X 1 21' f-I I 1 5521! '- ---Q-A------N -.-- W ..... .. -,w--.,.,... , 1 1?f 1 .. -Y .-.M..,.-,. ,..,., 1 vs: f 1If-l?'?'i?n.21iM-ia-'11'-ir-'F17 1 1 M' ' iw' ..-5f..?..1I. 1.11 If.,Ii'13f..Ifef..9i?Iii'I'I' 7 IfI'1 It I ' 'I ' 1 1 I I ITV I?IIf'i'Ii'I7'QII?II-'A' f 1 ' ' ' A' ' ' I IH I '11 1. v....1 1 1 1 11, 1 x. 1 in 11 1 gf 1'-J .A MQ V151 -.,.1 115 1-J-I My if- 1 135 1 11-'V if! 11' z .51 111 ik ,1 1? K 1,2 1551 ff? 1.513 1 , .1-4, 1.551 1153 1.512 JU' I i 1-. V. lie 1, ., 1.4 1 ,Q 1':,.ft 1-.fi 1'24f 1.25. 1? Vis fajfff 1251 1-551 1 Hz 1 LFC' f 15? Q ,fix fn... 1,-M1 1 .-JZ' 1 X HN 1135 1 if 1111 Lfm if--1f I 1?-.f 1 ,1 1 'X 1 1 ,1, -1,1 ' --11, 11 ' J .f 'fxfj '11 .JA .7 ,N 'Nr , . 151 1-111 I 5113- VH '--1-1--.. 5 1. ..f 1 fx 1- 1 1-'-1-.. ' 141 1 115.11 r -0- '- 1. - ..f.f.1f1 '1'1'9ff21-?2 f1f1-TL.f111111. 11-11- .- 1 . ,JN W H 1 ,. U'3ifNf A j'Yw51i3. Off' ' 1' -,- J A -11 55 fb-1'.11EQfK1'fF1'zf'wr A E I -i1fM.lILj1Kf:!,?r3:.-5,7 K Midi? ,131-1 - :A My Nj? Y --., .Y 1- ii fx., ff -Z Tx, i11,f.,1j11,xJ1L1f1 'A .1 1,11 Efdqf 15:1 6, If If ...QW Q 1 1 . ll IIAFNEQ, J--u1,1H 11 3-:inf 1 A , N 1 fl .11 . .111.11111111 , A 1 1 1 1 ff.1.,fy1,1., 1rL1f11f -1g.fm.1-1:1131--,1-1 In -4 MJT,-. 11 11 3 1 111. 1511 ,111 1 11 1 11 1 11 ff? 111 11 11 fin 1' 1 11 1' 1.1 lt 1! -ffwz 11 1 5 E5 1 1,1 kj 11 11 11 1l 1,4 1,1 1 1 11 '1 1 1.1 E11 31 ij 11 1 1 V 11 11 111 11 I F 1111 x 11 1,- 11 71 1+ 11 i E1 11 ll 1 ,ll - 1.1 11 il L1 11 if 11 11 ,1 U VW 'H 11 if? 1 1 W V1 Pg 1 11 ' I 1 7 1 1 I 1 1 1 . i 1 1 I 1 1 1 11 1 I 2 1 1 I 1 1 1 1 1 , 1 1 L 1 I 1 1 . 1 1 1 1 1 1 1 1 1 1 1 . i 1 Y 1, fd? ,ffl ----ffm,-W M! V ' y -.., 1-A1 -1 A1 , . W 'f1V:r-1: . 1 . 1 . ,!'-. 1fyq:::?1sv1.q,3,.l,q'w.h ' A 3 ., '1':-1-yi -.-.., 1- f .Q 111 f1fw-,.. 11-1 Ju 1-117-X:-7. - gn-f-4-PY. '1f'3'2 tr r --1. 1 1 -ry-X-:NJ-+,x.,L7.,,y:,?l-W PM ' 11 Mllilflr 1... , - 1'-1' , K' flvfr-f-1-1 1. ..5fl.5j',g,,15. Aff!! V, r ,X -.-..-AM W- --.x,,,1YjQ ,v' 1 'Ji' ' 'W'-' ---- uf --+1-.,xi,1,3g N1 . V ., .. ..., ,h V, Y ,i.1l.I-'1!,!.E-fnlkjjzg 11, NM, 1 xr K ,N ll X '-'-----.QL Q -1-J..f.1Yg, 1 X M--. -.... --,..,',,ffEi1fjiiL3.F-li!.f.f1Nf,fij-'f,f PW L X ' R '-----.,f...Qff' 3-241.1 11,-1 L11 1 ,K 1 .f'w.l 1 1,1 1 If-1 WE. 1,--Ai 3... 1131 15,- 1 ,.1' 1:11 1 i 211.1 114' 1f f 111 1 N151 ig--.1 1,f 1 15. K' 1935 11 v1 521 -.1 1131 rf--7 - 1 i.X.1f 1 1? -' I .111 1 .11 1: 1 15-1-E .J 51'-11 QW Qi .N , 21,1 I .fffi - -1 ?'1jI'f -1 1 l1 1 1 5 . 5 -I 2,-31 , 1 11 A1 '1'-.1 1 1 51 -1 I 1 .' ,Qi ,QQ ' '.' -1 11 1 1 11' 1'-I-,' A1 ,J 1 . 1 i .J 1-1 I .1 41 11719 ff- '1 'I U1 51 S024WVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAWV? 4 , , , ..-n..-nn....n-.--n--nu nn -u.--nu-.-. -n .N .. .. .. . .. ..... A ,N AVAWVAVAVAVAVAVAVAVNAVAVAVAVAVIYAVAVAVAWUK'NAWRVAVAVAVAVAVAVAVNAVAVAVAVAVAVAVAYAVNY 3? Q 5:- i 1 I 4 f Q9 Q AVAWYAVAVAWHVAWHYAYAVAVAYKVIFAVIVNIYAVAVAVAVAVAYAVAYAVAYAVIYA 'n ,....... I ..... .. .... .15 ....... .......... , .u..m-mx.eee'.:- --' lk V1 x1 H, Q ri 51 41 f f N rf' , LE Q x f s Q x f T f s 4 VN i 2 5 S 4 E E E E 2 E E E 2 r N f E r N r ' , H 3 4 9 VAV AVAUAVAV '53 D ZlifldlifNNAVNAVIVAVINAVAVAVAYAVAVAVAVAVAYAYAVAVIYAVAVAVAVAVNAVAVAV Ymmm p -V-mail K1 , X qu., K 1100A 5301' 73011 83011 930A 30017 40011 SSOP 8301' 10.00 A S, ? 4 4 5 5 4 4 4 4 4 5 4 4 4 4 4 4 4 4 4 2 52 301-1519 c 1-7, 41 3.00 P. 4.00 P. 4 5:50 P. 10:00 P. 9:00 A. Q Pro ram of Fmals 1926 SUNDAY MAY THIRTIETH Baccalaureate Sermon Old Stone Church REV S Room TYLER Full Dress Parade Concert by Cadet Band on the Green Final Celebration of Y M C A Old Stone Church MONDAY MAY THIRTY FIRST Guard Mount Company Drill Sham Battle Full Dress Parade Final Celebration of the Cic roman Literary Society Memorial Hall TUESDAY JUNE FIRST .-Guard Mount Bayonet Drill Calisthenics y Competitive 'Dr1ll- A B C and 'D Companies Individual Competitive Drill I Review before Alumni followed by Dress Parade y ' Final Ball ' ' ' WEDNESDAY, JUNE SECONDV Final Exercises ..... ' .... 1 ....................... Memorial Hall Awarding of Distinctions, Diplomas, and Academic Medals . By COLONEL T. J. ROLLER A Awarding of Military Medals, Cups, and Prizes y I By MAJOR iCHAs. S. ROLLER, IR. , V aledictorian ' ' ' CADET CAPTAIN E. D. GRADY Illinois , AULD LANG SYNE .Q in ir f Yr ea EV!-W1YAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAWVAWAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAQ 5 I J ,............ . .... .... ............................................................., , C 4 i. i f 5 i i '.E!!!!!!!Ili-23221222-' W bmi ............ .. ................... ... ...... .... . ........... . .....................- S QU ' 3i5,,!E:n.m!!!f!fi -F Q ll ik I i - il' o ll Ig f 5 . . 5 I ? I f' ,2 N E i llix ' Q . I yi! S Q Q 5 K I . M.'- ........................ N 5 S ' ' ' P i 4 i I . M.- I S E i : .M.- ' ' .... ........ . ....... ' 1 Yr S 5 4 -I ll 3 f I . Mi 'i i N f gl : . M.- I ' i Q . l M M n Z J 1 'Me - . b I E 2 .Mr . . . S . . . , . I y 5 n Q ' M ' , ' , , I Q ' M ' . 4 , , ' Z - M NNNNAVNAVAVAVINA'QLVAVAVAVAVAVAVAVAYAYAVAVN'AYAVAYAVAYIFAVAVAVA IYAVIK'M FINAL BALL COMMITTEE 1 1 1 1 1 1 1 1 J 1 1 ..1 I. ?1 5377''f7Sf'f7'ff'Q?5ZZ?5Q?.7..E1.'7Q...iH325?TZ5fEiQEf51.'.?..-F1,FWZTSL 7...xQf S'7.fxf2.1g4'5.14.3.71EL. 1SLfbf.i1f55E7fZ57 L ' .....1..m15u1.51m.gmmmw,,, J J '- J -J J ' 1.5. .,M .. . .,,1... .Mg w --1 +111 N117 . - , ' 5, bf! .. 1. .. 1...1,,, , ,sig 1 J V --nf' ,W gin, f' 'Eff 5- X-, 5 wo 11 'AQ fj',L,.,.4?,,, ..,1,I 4j.,g'j, 1 . Q A-Q'1'Jffq41Qi'i-F! 'L 5 1 'xv-rf 1 X511 Tx :'::1.v:f:T1.wrT'j zfrxrnrwxzvitrnrfiix 'lf 1 V 1 ks M - -1 1- ' ' '- 'M' umm. -1.13.5 .ix .Y I , 1Je 'H 1,110 im, 1 ff' f'M.iff' kg?f!f41jJHY 1 . , . . wr., ' X-'illlf' 1 ' ' 5 1 -I HJ 1 1 J 1 2 fi J P1 ' 1 1 1 11. JJ? . 1 : If 155.1 11 L . , X ! 4 fx Z'1!'1!'1- Zffxb 1 V I , J 11 Q 1 J L ' J 1 Ml 5 T 1 . J It 1 1 E 1 Q 1' 511 ...a 1 J 'J 5 . J. J 1 J . 5 X1 1 J A 2 . 1 N, 11 , J 1 , If , 1 11 M ' . A Q 'Z N' . L. L 1 1 1 H1 1 . Z . 1 1 . X 1 ' ' 1 11 ' 1, . 1 1 1 . . . 1 if Yi 41, 1 ' 1 1, QJ 11 ' 1 1 1 1 A J J J 1w1 1 E J 1: 5 91 1'J 1 ., 1 1 5 i 1 Q ' X if 'H I! 4 1 1 1 11 1 1 . can . 1 sig.. 1 1 5171 5 1 V W1 1 1 5 3 1 1 M 1131 f ' V '21 I 1 3 F1 1 1 1. 1 1 1 1 2 J , lyw 1 1 Fmal Ball 59 1 1 Gif' J. J J 51211 .x Q .' J 1 1 1 OFFICERS 21:1 . F ' 1 if 1 5 .' 1 1 J 5 1 1. W. W. Bosw11:1.I. .Preszdent and I.vaa'1.'r J agj I 1 f ' 5 J .. 1 5 In D. PIUz111x1zR'1' . . . . .Asszsiaut Leader I 4 Jil 4 Z ' ' . 1 ' . f 1 J -- Q . 1 tim. 1 5 gg L.. U. b1.1zMP, III. . . .Ass1.rta1zt Leader J 1 :QQ ' 7 1 . . J 1 1 1 G. S. F1Tz-HUGH ..... . .Clzazrman 4 1 1 1111 j i f 5 iff. 1 1I N21 1 . 1 1 .41 ' 5 if COMMITTEE N 51:1 1 ti i 1 iid ' 5 1 1 'f' 1 I 1 J! 1 3 3' J. M. Rvun W. M. MAYER G. P. XVALKER J 1 ', l 1 5 ' J 1'-.71 ' 5 31 E. D. Glmnv M. H. Bow1cN J. S. XVILKINSON J QQ5 f 1 1 - 1 Q 31 M. Plwonc I... M. I3or.1.1Nc H. S. H0'1'C1IICISS JJ HQ ' J F .. -. , fl 'fi ' Z1 J. T.. TAv1.o11 A. .ll I21:11:11'1' 1.11. XX111.1.1AMs J 5 V25 1 J if , 1 1 f-:1 1 Y W... - 1 11111 . P x 2 51,1- , v . - 1 ' - 11' J E V L ' 5 1? f'i'7if1i'i.i5i'J. '1'111g,g-.-.---- . T IQ'1f1 1'A fm 1lTffL.'I.lI'flZl..4.f...i'D- ''W kv 13 2 L A fr, W., ., . . . -.. ..... ........ , N J LM 1 .........--......,.,...-.--...,..-v . W .,, . . , - . ,,, ,,,,. .. Y, Y V , Y 1 1' .:l..L.,. xg-:qybr 1, - if wwyywvg-yfyyy Nu ' V1 Www? 5 ,gg-qyf. ey -Q., 4'-11' XT '1,,Z1.i1f.1.iS.f1:,1ffi51'Q.?..'?f?E.L'.1.5..1..:fM.Mmf1FL 1J.-sf3.L1.S. .J ,..1.Lf'. 1 .f7:RE!'1.. j.1.Qi3.f.f.1?.fN'.JYLN.-.11 .. n' 4, '4 VVVVVVAVAYAVA A VAYAVNAVAVAWRWVAVNAYAIA VV Mono ram Dance CFFIC ERS I D IIUMm1cr Inadu T L Mon Awzxtavzt leader COMMITTEE Lynn j FULTON ll CONWAY NN HOISINIIR 4 W M, . . . I. Lk- Cz fl' Q.. MA WWA' 'X2i'LQf2 iii: iQxf5h5f4 4 -fflswzjfmgf 4 V f4 - XXXMXXXXXXHXE44 4 4 a F-S' E f if 4 E 4 i? Q E 5 S 5 ag! 5 2 44 if 2 E 2 2 : 5 5 1 S S 5 4 2 4 Z4 c.-a Q 2 4 4, A 41 U I 4 I 35 - 4 +4 p li -4 ,W -4 45- 2 4 VD' AYAYAY IWYAFA 5 'Z Q 5 4 7 5 4 4 4 4 4 4 4 4 4 4 1 4 34 4 4 4 4 4 4 4 4 4 4 4 4 W Z .Q f Bgg, , 4 mtl 4 ,4 Q 4 i X '4 ' l i. .Jr . .. . ..... .. ... . - M 'x W. H. 1jIlJDI'.l'IllOl'l' . , .... . . . . . . . . . .......... Chairman 1 4 4 , J . , I FOI l'I ' ' ' ' E 4 W U? 4. Yi ' . ES 4 Q39 S 4 QQ Pi, 4 4 4 4 . 4 4 54: 4 4 4 4. 4 v. Tg.. 'V' x 3 ri Y-1 Q Will 5 ? 1' Q V42 i xg , ?',-'E I iii 1 J fl 1 1- 4 x -,f , P-ff S 1.-fri l Q F' Q ,Q . E T F1 1 lxgl . g if li' 11 s..- gn- 1 a ff' ' OLD MEN 4 1'-M .X kids..- -,. , ,.,, ,. , ,., , ?'.!' All if . 'A-. ' pi..- Nl, 71' N' 11' ti-hu? 1 423,-LJ. U f. ,JS wr' - RATS WAVWVAVAVAVAVAWAVAWVAVAVAVAVAWMVAVKVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAWQ AVAVAW NAVAVAVAWLVAVAVAVAVNAVAVAVAVAVAVAVAVAVAV WVAVNAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVA f Vrivm W ciww' KV 5 r 5 4 E 2 2 E E 2 E E r 5 4 2 E r 5 5 5 S U' W 59 SQ 3 E 2 2 L2 ' 5,4 ........,. ......... ji....L ......,... Q ..,...,.. A 1 ,..,.,......... ' , qlfiuglng ,',1 , m:w9g,' N Q - -.........,............ ...................... . ....... . ............................. ....-'ka - 1,,,!,BMM,?gT,7' 5 LK - as A 4 Q Vaf' 5 f 5 ' 5 5 1 a N 5 fm V yi! S i f N E ! RY E N 4 , f E f 5 2 , f 5 E r ' 2 r A 7 r N ' Q r 5 2 a ' V y Y WN 9 2 , JA dm 3 E 4 3 7 , f , Q A I 5 VAWNNAYNAvNAVNAVAVAYAYAVAVAVAYAVAYAYAVAYAVAVAVAVAVAYNNAYAVAVNNNS . 5531 ' ' ' QA I f NWI ,H K 1 gl my qkmmk . - I ' I Maw' I 'f :W 7 f'..f1' ' GQCQYGQJGDCQ I' AVAVAW'NAWAVAVAWAVAVAVAVAVNAVAVAVAVAVAVAVAVAVAVAV NV WNAVAV VAVAVAYAVAWVAVAVAVN AWVAVAVAVAVAVAVAV VAWUVAVAZN Q WI-' A'1HI4lx 'lhesc Artxsts IJIRW A ,A s of Il MI I ss I I I s It fl :X 4 I fl I FORECAST P C Igenaltyhlivery Coal and Dusty e a Monday VOL I-IUMPrl'r1x IDVVIAN 'I' N ONI' I II'VI'N SOCIETY LEADERS FAVOR A M A WITH VISIT THE UNHOLY THREE ENTERTAIN CADETS On july 4th the Saturday mght tudnence at Xlemorml Hall was heated to a surpnse vlslt hy the Unholy Ilnee lhe gentlemen gave helpful hmts on Ibomg Nothmg and llomg It Ihoroughly After they recount der freight cams they passed the hat fox xoluntaxy contx lIDl1lIOI'lS actually gettmg hack the hat hands from amongst the sou xenn huntmg cadets lhankmg Nlajox and toloncl lor then warm hospualuy they IC tuxned to the frozen North whele men a1e I'sk1mos and so a1e women Jumpmg on a Pullman CARIx I met a CI-IRISIIAN who was on his WHPARY way to the SFASI-IOlxL alter xettunmg Ixom I NCLANIJ We dlscussed the topucs of the IJAY and the IIIIL of the LRANI' whlch although a small BYRIJ he loved to HUN I I mally we declded to L VAST and go to the dmet where we had BAC ON and BIANS wlth LOIIILY I et af 1 I PANC AKI' and endmg up wtth a how of IUIJGI I satd lt was good GRUBI3 He s'ud It was quxte llxlf KN but a man who uses that ewpressnon d serves a 'tludmg Irnend had hrs IYKPS and dis xkes UIIOA youx morals hy the MARKS on voux CIxAVAlH he screamed A the Bla LL rang the tram came to a stop Ihe I-IUNII lx and myself were thrown logethel m '1 I-IIAAP Imy a BAUM of the CANNON Accldently I hlt hxm In the j'tw with my NUCKOLS which I know gave htm a PAYNI- I felt there was MOORI' IIOIIIJIC Blxl I IDI N when WC passed a cemetely ll . ' -.4. ' Fl. e -., VA. 0. f.- 2 1. 'I I I I I , I I ' ' I . ,I ' A :AI , ,I , I ,I . N I I I A I .I cg I I 'I I 'I I IIIII ' I 5 I R ,. ' ' Q . . . 4 5 -4: Q I ' J ' 2 ' ' 2 . 1 ' f 97' , at ' l CK b -, . M B .s I 1' . . I E 5 ' 'D -H . 1 l ' .' ' . e. . 5 cd then: experlcnces of rndmg m and un- LYNQH' Thus I found that my I4AXAI 4 V, I ', 1 .y . ' . L. . . J in ..- p f -' - 5, 1 1 .. 5 n. ' B 3 n S Q A .' . ,Q ., p ' 1' . ,kh- -2 . 4 b I I A 3 v I I XI 5 I ,.,,,,Ies 4 , N I 'Hain' MT .Q Qfmm' 0 .. ' ' I, W Y ' I 3 I I FUMBLED F OOLISHNESS A I VAVNNNAVNAVAVAVIWNAVAYAYAVIVA AV AV VAVAVIVAVAVAVAVAYIFNNMWKNNM J NVAWAUKVAVAVAVAVAVAVAWKVAVAVAVAVAVAVAVAWVAWxVAVAVAVAVAVAVAVAVAVAVAVAVIVAYAQ VAVAIAVNJMVAVAWVAVAVAVAVAVAVAVNAVNMVAVNAVNAVAVAVA'NAWAVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAV for xr l pw vvrwlllllll mllmlll 'N' YW Qmisrl , rt I t'5:gg'3f h Jai A s Page 2 THE Pl:.NALTY CALL Vol I-Iumpteen full of GRAVES bestde a STREILT BE A MASTER MUSICIAN When Fmdmg that my frxend was not a WALKER I offered to take h1m rxdmg m Learn to play Jazz m a Snappy way on my GRAY HUDSON but he llfefeffed 3 your choice of mstruments Be a master Look a very unusual slght there s the rag tlme by new easy way Be the llfe of NIAYER rtdmg on a LYON every party and the most sought after Get OFFUT cautloned my compamon member of your crowd Be popular be 1 Offered to KELLAM but my frlend yond your wxldest fancles and have access had disappeared over a QQQNE WALL to all soclal gathermgs Obey that lmpulse gomg WEST and mall that coupon to THF EARNEQT LONSBRVA1 ORY OF MUSIC, 'lhli My frzend may have been very BRIGHT RAPIN KNOB ARKANSAS but to me hrs head was as hard as WOOD Probably he stlll beheves m Santa KLAUS G R W YOUR FACE IS YOUR FORTUNE THEY USED T0 CALL Years ago I took no prxde tn my personal ME appearance and lf approached on the sub ject I was shamed into admtttmg that I was only 100W above the average Now I can truthfully state that smce regularly us 1ng my patented process of freckle remov mg applylng llberally my Own brand of beauty cream and foot ease anomtmg my head wxth a generous quantity of self made Sheik Luxe on all occasxons and carefully promoting the natural gracefulness of my Adams apple my mlrror tells me when its favored wtth my fifty mmute out of the hour gale that I am equal to any and surpass the majorlty in that well groomed tallor made look so essentlal to young cakes of the present day who would find favor wlth the falr sex My beautlfymg appltcauons may be procured at all second rate drug stores Watch for the trade mark Snook l'yes and beware of lmlta Thlrty days ago I had hardly a handful of han' but now thanks to my dlscovery I am the proud possessor of a Hourtshmg frmge ot youthful hatrs decldedly an Old Vlrgtnla Mtxture My system IS endorsed by the authorltles at West Polnt V M I and by Col Roller hlmself thereby eltml natmg any element of chance m my guar antee Get my booklet I-IFLPS FOR BALI? HEADFD F' F V s sent free If money order for four dollars and mnety elght cents accompames letter to help cover cost of marlmg Address to Mayor Charles Summervllle Rollers 'lonsoual Parlor Iort Defiance Vlrgmla l.1Ol'lS 5 No one need suffer from bow legged self f consclousness smce my new remedy has BE A SUPER-MAN! Q been placed on the market I have made G my formerly bowed legs strong enough to I was gtven up to dle, but was saved Q hold any glrl thereon wxthout lostng thelr from the grave, restored to normalcy, and E I proper shape No braces, trusses, or bun advanced to my present stage of vxbratmg 7 lon pads Address correspondence to Mc ltfe, real red blood, sound flesh and a 5 Ilowell Laboratory of Bone Research, veneer ol rrpplmg Herculean muscle Fel .S Gluckupmsvtlle, Peru lows, 1t's great to be strong' Get wxse to 5 2 4 E ? wt' tr QW? RQ ' '2 A ' q ,,.,,,,,,, ,,,, ,,..,,,,.,... Q .- .............. Q ..................,.........., ,P A 3 l a a K 1u!!m,,m9m9u5,f -. .... ...... ..... .... ..... . . . . . . . ... ... . , . . . .. . ... .,, 2- 1 -Hein I all tp I xl I 3 f ' I S tl f , f ' . ol. N I 5 I I ' 4 fl Ill - Q L SI I f . I . - r w I I . . . . ff K, i K - ' ' ' 5 I E BROWN JORDAN- on the sax, trumpet, or jews' harp. Learn I , 3 2 I ! H .i 1 l , -o I 1 I l II IIII . . . II I I,, I I , I 1 E I v , - -. r Q ! . I ' - . I A I IE E I I , I . I . I . .I .. I 2 ' f ' . ' N P . , . . I I -..-....-l 5 4 5 2 U gl I - ' ' ' A at 2 I as '1 2 X 99 ' ' 1 i . L A 9 If I . -. I ' . . . ' S , -1 . s . I . I I I I I E . - ., '. . ' P . ' - ' ' v Q I I . . . - I 7 - ' 7 . ' 4 7 I . . . I I I . E I --- 2 ,, - ' ,,I .. . I I -Ii ' I. I ' ' , 7 4 mx NNNNAVNAYIVAVANAVAVAVAYAVAVAVAVAVAVAYAVAVAVAVAVAVIVAVIWNAVAVA IYAVNKi t A VAY4YNVAVAVAVAVAWIAVAIZNVAVAVAVAVAVAVAVAYAVA VAVAVAVAVAVAVAVAVAVAVAVAVIVWAYQ .1 ... ...... ......-.. ... . . .. ..... ... ................ ..-.-.....-. ...... Q 5 eeyim-'ff Y . . .. ... .. .........- ... .. . ........ . .. .......... S' .,,n--tall.----.if -,I I W ' all l m Ei tw I A , . at Q, Vol I-Iumpteen THE PENALTY CALL Page 3 the Yates system of development I take chstant stars were dim weaklmgs and bulld them into dynamlc I slowly groped through blackness with a forceful txger men hke myself I do not hand agamst the wall ask behef wlthout proof and wxll go to Untrl I saw the letter B upon a door the mat wlth any man to prove the truth thats all of my assertuons Pamphlet sent free Around this door the cracks shone brxght written by myself entitled YATES THE though all outslde was dark MUSCLE BUILDER Upon a sound from m the room my form A Sz P fAlbert and Pmkeyj froze stlff and stark A volce spoke I knew xt well though sadly IF I WERE COMMANDANT dld If quake Emotion made xt soft and low but thls IS If I were ln charge of A M A what It 5133146 There d be less work and lots more play Instead of revellle every day When e er I look m thy brxght eyes those We d he xn bed and there we d stay DOOIS Of depth and gladness If I were eemmandam Those laughmg mrrrors of the skles that Thered be no foolish rules to break My heart ns cast before thy feet my all IS Thered be no sxlly packs to make at thy blddmg And as a treat for old t1mes sake My soul and yours wlth rapture meet my In the mess hall wed have porterhousc life of sorrow rlddmg steak For never eyes have shone so brlght nor If I were commandant hps looked more like roses And never teeth so pearly whxte as thy 'lhere cl be a movte every mght sweet sn-nle dlseloses Where one Could Yell Wlfh all hls mlghl The blush that r1ses to your cheek makes In the court yard xt would be all rxght dawn Seem cold and breathless T0 hurl 3 bomb Of dwamlfe Those eyes that more than hps can speak If I were Commandam proclzum our love as deathless In all thus world about us here no feelmg can I capture To rxval our great love my dear that all engulhng rapture What poets tongue could eer recite the love that I hold for you? 'lhere d he no study hall and such What tender song could croon arlght the Nor drxlls and thmgs we hate so much words Love I adore you? But would your famxly play the fool And now once more before we part Id And send you boys up here to school kuss thee dear m earnest IF I WERE COMMANDANTWW? ust clasp thee to my throbbxng heart R D B whxle thou my kxss returnest 'lhlngs luke th1s to us seem strange As clgarettes rn the Post Exchange And all youd have to do IS speak To make a trlp home once a week If I were commandant DISCOVERED I flung the door wlde started back and weakly clutched a shelf! A mlrror m h1s arms he held and sweetly cold and grjm klSSCd himself' The hghts were out the moon had set the F R G 4 4 be 4 J Z VAVNNNAYNA'RVAVIVAVAVAVAVAVAVAVAVAVAVAYAVAYIVAVAVAYAVAYN'AVAVAVA K'A'li'Ki 5 . if . ..... . .,, gg Q nntp. E .. . .... ... '... .C me Kb ,, 2 .fl lm-m..... :I 1 5 Q m A ...,..., . .....4 . .. . . . . . ,, ,mmr,,. N X 5 P 1 X 5 Q o 2? ll I S . 7 7 5 L lllx MIN 5 5 r I - ' ' - N 5 4 f f f ' - I -I H - I a 5 f ' ' ' . , N W 4 f I I I 4 . 4 f I 2 4 f ' I 4 4 - I 2 5 f -L, ,,' . . . I E 4 f -4 --t I . f I I 2 6 x 2 . . L I' 2 9 f - -r ' ,- ' I' 2 4 f ' , ' ' . I 2 ' U . . ' . M 4 E 1 . ' H never dim with sadness, ' I E Z ' -' . I .. ' ' ' . S 3 t H , . ' f 2 4 4 I 4- 2 4 . . . - . Y . . I ge Q . . , . E 4 1 ' ' f 4 .. . . -- - ' ' ' ' 4 Q . . e 2 5 ' 5 4 , . . ' , , S Q ' I I ' I I 4 Z Z 4 ' , .' - I f 3 ..... HJ U i 1' I, i 5 . . . . S 4 - -- I 4 5 I crept along the silent stoop, so dark and ' ' ' 1 - E 9 - . - -- , 5 5 f ' - 4 5 5 L I ' 4 f I ' ' ' e I V I 2 5 tl rr 5 ,,i nnmllil mtl in 'sr mln- in PZ. 'F'i 4 I f' l fssoyaf I ,I 4,1 P 4 4 4 5 4 5 4 4 4 4 P 4 5 4 4 4 4 3 4 Page 4 THE PENALTY CALL Vol Humpteen Entered as Low Class Matter Ft Defiance TO FLORIDA Va lieb 30 1926 lnue In My Gondola THE PENALTY CALL 'lo Pensacola to Pensacola MOTTO When the roll IS ralled down yonder we ll be there Subscription rates one report daily CThe mstallment planj STAFF MECHANICAL OTT Editor in Chief SARGE KENNEDY Business Manager ASSOCIATE EDITORS BIIL YATES Toczal Sr PARKINS Militarg COLLEGIATE YARnRoUc H Jokes SNOOK EYES Gooci-I flthlencr CAPT JAMES SHORTS Faculty Adviser PETEY McDowErL Marrot EDITORIAL The editors of the PENALTY CALL after the usual games of pool finally got to- gether, argued together, and at last swept to- gether this heap of rubbish, which you are now feasting your eyes upon. If you can't laugh at the jokes, laugh at their age, and if you can't laugh at their age, keep your mouth shut. Although this section of the Recall is entitled the PENALTY- CALL, we sincerely hope that it won't be a penalty to read it. We also hope that you'll please try and appreciate our hard and earnest work nightly, for the last month, although The Big Boss didn't recognize us in thc Family Hour talk. Well, I think 1've said enoughg anyhow it's getting later Cit's always doing thati and I need my beauty sleep like the resi of you who are now dead to the world ir barracks Call except Mapp, who is throw- ing his usual good-night bombj. -TH E Evlrous. Sweet Colonel Roller lets take a ride Beneath the moona we ll Fish for Tuna From our baloona you at my side And while lm running in my Hivver car You can Fu ni cu li and Ill Fu ni cu la If you wont go la Sweet Colonel Roller Ill put Shinola in your Loca Cola F R G HATS OFF Halt Off I Jim Shorts For cleaning up the stoops single handed with the aid of a mere broom Bowling l For licking every stamp in the Post Oliice for getting stuck on him Major Jacobs For holding up his week s laundry in his back yard and putting them on the wrong line with a few clothes-pins. Mrs. Landis-For sewing up all shirts so they couldnt be put on anything. Capt. Kelley-For not letting a fresh loaf of bread go too far in the mess hall. Last but not least we bow to Capt. Glendy for unselfishly devoting his time to preventing our young Generals in the Making from being contaminated by too much association with the fair sex. -HAI Sl 13.91 , AN IF FOR KEYDETS QWith apologies to Kiplingj lf you can keep your oliice tho' men about you Are losing theirs and saying you're un- true, lf you can certify when teachers doubt you, ' But make allowance for their kidding toog If you can drill and not he killed by drill- ing. ' TF A il in QW . Bv io vAvAvAvAvAvtvA vA AvAvAvAvAvAvAwvf vAvAvA AvAvAvAvAv vAvA AvfvAv,-wg .o..... I 3 mlm v af. .,.., . .-.. ..- ..,.. .... H 4 . x t U 5 ' 5 1 i ll 4 l llrix I All S 2 f , . ,. I 5 l 1 ' ' '- -ff H N 4 -1 -f ' l ' ' - i 5 I f ff - U N' , 4 1 , N 9 l . , H . , .' . . - , 5 r I . . 4 f - , I , t 5 i f , - - 4 -, . ly Q .......... ' -' - ' ' - ' ' ' 5 Q S ........ ' . N Q 1 U - u -..- 1 Q ,fp . ........... . ............ I Q Q ---U, I fy E J .N ....,... ....'. up .'...'.'.i... . ,H A i 4 g , 3 4 u ....... . '. In Q I 1 5 . .................. . A - - i Q - U, 4 - - -4 S , ' Q l . Q . P ' , 5 , Q 1 WVR'NAVAVAVAVIVAVIVAVAVAVAVAVAVAVAVAYAVAVAVAVIFAVAVAVAVAVIVAVAVAVNNEWS W4VKVAVAVAVAVAYAVAWVAVAVAVAVAVAVAVAWVAUsVAVAVAVAVAVAVAVAVAVAVAVAVIVAVAWQ Qisid Q, it Vol Humpteen THE PENALTY CALL Page 5 Or being stuck too much dont give up TWO DAYS AFTER hope JUDGMENT DAY Or be1ng hissed at dont go in for k1ll1ng And yet dont feel your oats or start to mopc you can smoke and keep your plpe alone If you can drink but nothing worse than o you can make a class room break or bone And keep you1 grades from any fatal drop you can bear to see your rec1tat1on Made to bear mute witness to your dumbness Or see penalty take your recreation And st1ll study on without bram numb ness you can walk ten tracks without legs ach1ng And pick up paper till your back gets stiff f you can talk without your two legs shak 111 Fo the O. D. who of your fag gets a whiff, you can clean your shoes or sword or riHe Not griping over wasted elbow grease, And know just when to talk, to laugh, to triHe, But yet observe the proper time to cease. you can stare at girls and be .contented To live the same old life without the skirts, you don't grow stark crazy or demented About the tit of regulation shirtsg lf you can fill each certified wheel-barrow Completely full -of coal dust to the top, If lf lf you can censor and yet not be narrow, You are going some and had better stop A D B. A PLAY IN N0 ACTS SCENE CYou know wherej A well known gentlema11 clad in a scar let dress suit reclmes on a throne of red hot cxnders Other gentlemen similarly lad are playfully tossing hrebrands at each other pausing now and then to take a cooling drink of boiling pitch A messen ger enters and hows to His Satanic Maj es Messenger We ve got a man out here named Roller who says he wants to stay Satan Nothing doing hed try to tell us how to run Hades his way CMessenger lights cigar butt off his arm and exits Reappearsj Messenger Well heres h1s brother known as Doc who says hell cure all our ills Satan The same rule goes for h1m my man I dont relish those pink pills. . CMessenger does one and-a-half through the door. Five minutes laterQ. Q Messenger: Major Sandlin waits with- out, a bird-dog tucked under his arm. Satan: Take that war-time genius out, tell him this is no dog farm, CMessenger does column-half-right and exits but soon returnsj. Messenger: Your honor I'm sorry to disturb you again but herecomes Major jake. 1 Satan: Tell him I'll let him go back to earth, we must save him for 'Trig' stu- dents' sake. CBearer of tidings fades away. Returns perspiring freelyl. Messenger: l've just been talking to Henry Brown and he says this place suits his eye. ' E Satan: He'lI have to move on 'cause U' W Q3 A . . ,V ,............ ..... .... ....................................... - ..... ...... ........ . , 5 P Q ,,mQj?E2l5f -.N 5pmL,g1-I nn, qi by Nix If -, ' - D 11, - ' , ' If ' , , ' ' If . . A . . .- ', . typ. . ' . ' ,i If '- ' ' ' ' I . ' - - .11 . g : H 1 11 ' If Jir' NNNAVAVNAQVAVAYAVAYAVAVAVAVAVAVAVAVAYAVAVAVAVAVAVAVAYN'AVAVAVA IYIHK'M NVAV V 5 F I AA VAVAVAVAVAVAV Q '?'f3ef2mu-.. . -, i A AVAVAVAAV,-wvv 9 i l ' Afwxv WN and -- - -- AVAV so it am, Avavavavlwv 4 . tj ........... ................. , -'--...,,,.' Q f g 5 --...ni i.-' A !! :!!yiYY E!!! num, 3 ! ff Page 6 b 3 i --THE - -.Zn .. 5 4 K it we coum k PENALTY CALL , 4 A 5 5 ! if wefd try-7, eep him from but-nin Vol, Hum t K S 4 i fMessenger ' g us up ah0y! P een fi i S b i Once mor SDIIS molten 1 ' S il 4 . ey' Siva and atang UN i . r f M Speaks - ever m i I Z ! com essqnggfi ul aim i tlzus land is too Sm llnd Stopping fo ,P S 5 Q ii Iuckliailiecl hY Yates waist Sjslggtlihers ac- gltiiiia boys, al to hold a U, of Vi: il 5 ' A ' C' tr h' ESSe . ,, A 3 Q Daiag1:Z,T,.-i1?0nrt consider him Y IS lqnown azggigrneifljvrif q0mCS a gentleman Ni a 5 Messeiirlltlal fee of one bucilibe Wouldnvt lCan ACC. 0 Says hers an Amer N E f i Parkin gg' ,uwhar Shall ' Satan: Src - S 7 b 5, h1s f I Sa I D him b f 4 f fcalm h mend' who y to CY cave t0 foll - e Ofc all o - K C does ' ,, SWC2lrs fo . rr OW h15 ha ur ladies 7 J Q f i Satan: ..TeiiIi1Ije. 1' thls Now about that F0 'dS0me face? N 5 Q at ani he.d lm I say We ca , our band h , ft Defiance Cfowd , 4 4 scorn Our nt use him Wh - as Smners ' tho V 5 2 iMCSSen 'at S st eu It co mcluded 5 4 . ger y em s n mes , 5 gi Qoupeii g0es out, Returns fgilfigie, d most of then? the men from A M A ii l , ' .Mes . i u or must be 1 n . D, 1 1 i Willy singer I Look what I Prett characters and 50 egccluded ! H Q , j ebbi he , took fro Y hotyy Orth bum i Y 5 Dal'- SWS hlS rent here h nh up. S ' Satan' ei ' 4 1 his . - Tell him - . 4-1--IA. D l I . this k . - B. y I P 3 Ml'lfefiQQfe,51on'r r,0aSt Qg'1Q'mNiSEOtin FIVE POINTS OF ET ' i 5 4 Earnest, v ' He di-Ove W. ' 1 - .i Aj' HW ii 4 5 s hrs 1th 11 NEW E r 7 I him a john na,-,ici who wants IS friend. Q ' 4 an Satan: .uNix I h you -to give Pirrt-when arg? D I l 2 5 saxapho ' ave noi m Seated, jum man enters , r 5 Messeil12et,i1?m,ithe Army hasoiiruseiifor a proceed to Iihfgacefully to the Hxfm' If 2 Q McDowell mid How 'bout these 3 gobgr This will I-egist W arms around his 1 and if Q hit?-n Gooch' who aiw comrades him to ii er Passion, so at 'Heck' 1 y 5 Sat ays make 3 iS I ay a game Of I once Invite i S 4 i 2115 uExpIai 2C0nd-Whil i aCkStr3,w5 ir i 4 9 ladies W' n that We out ' e Pacing th ' l i y 5 iMessg:out lthem he1,,i,,g 2ia'i1.f'muSC Our Skiplsimade that you favs stoop a turn- l S ' i ge . 1 . a o . , r, 5 fgllows his nz uttons his asbestos the ri hng the mside throw' proizeed to 4 4 Se tl'lI'0u h coat and ,,i g t and lef Ing klssgs Q 5 .essengerz f-H g the d00rj. 1 hird-If t as you go. to 4 S galesty, and I comix: oil argihaagaiig, your :O an erranin icidirjain commands you to g . 0 . ' ' ' . Z Satan: Hwith h friend O32-.gently on his leftlllr Jokmg, Strike p Qxlst in a plac 3. Bart S0 cold he C i ight that you canit b eek and tell ' 5 Messenger' euso eternally hop, ouldflt marvel at your Worldl e fooled' He will Q the you - Does that i- f ' 170107111-If - y exlierience Q Z some .1125 miaTPGIencly who 35531 go for i0r asks for' lnffthe meSS hall yogi. ' 2 glr i S t - C0 I Sup - Q Satan: HYOU I o meet him Say please. iiftease him and mifi: E D. C0uld sta ,et YOU1' ho Dfeciate h- 15 will mak . e E 4 , nd such FHS, no IS java i e hlrn p mind awhi,-1 H when any giri Set m9-in Fifth..VVhen il the more, ap- 5 cmessenge, gets S hrs iiothingi but grid to get a laundry Sa E S tugs again to .,His alfmicsiibas door theii neaifgfroom. This Eirsclahide it in Ma? 3 es . u - r ' - - n ' ' b Vveu senger' See the m . froth all-5 lo bring for h old Joke, but 4 a E 4 thats AI n m yon F all the old much me . 5 9 Cck Dean' hey th Ord? he signed men, and you , fflment 5 5 ere! Ford up for the minsti-ei will at once l 5 4 W ' i P l G P W 5 4 t i 4 4 E D tr 5 'N 4 Z v t 5 ANmm'1mgvNA,R,Av vi W A :zwmgi NVAWVAVAVAVAVAVAWAVAWKVAVAVAVAVAVAVAVAVNAWxVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVQ AVAVNAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVNAVAVAW'NAWVAVAWVAVAVAVAV,QIAVAVAVAVAVAVAVAYAVAV w rmiili lm ggi? ,D ll' ff gy I1 Q , ' Jokes ' Capt Yarbrough Shreve this meat lb tough Shreve Hurt your teeth Captam f them Walker Bright is going to be another Edison Hotchkiss How come f Walker He only sleeps four hours a night Major Roller Did you do much shooting on your trip to the mountains Captam Stalnesp Captam Starnes Yes I won two hundied dollars at one tlme Major Roller ulckl Help me get a faculty officer I ve been robbed' Langhorne Yes slr Which way d1d the faculty ofhcer go 7 Captam Glendy Cabout to be arrestedl But Im a graduate of the Insti tute su' Pollceman That doesn t make any difference ignorance lb no excuse Motor Cop Hey haven t you gotten your 1926 license yet P Voice Inside of Ford Coupe Lioshl Since when have you had to have a license to pet? Fam Why is Captam Ott gazing so earnestly at the mirror? Profane Dont you see he s counting his mustache? Armistead Cwlth gunj Is there any law against shooting at scarecrows? Cannon Yes against shootmg at that particular one It happens to be Captam Parkms Captam Gooch Why did Washington cross the Delaware? Diddlebock For the same reason the chicken crossed the road You cant fool me Major Sandlin Hey' Dont shoot your gun isnt loaded Captam Parkms Can t help that the bird won t wait To the audience in Memorial Hall on Satuidav nights, the next dumbest thing to cheermg over the radio IS to clap at the movies Cooper' I can spot a uniform room tie every tlme Bolling, M Why don't you use a napkin occasionally 7 Bolling. The little runt' I d1dn't think he was tall enough When bigger fools are made, A M A will educate them. Lykes . Boswell broke his arm during the Fishburne game Dislikes' Too bad' But I d1dn't know he played football U, Lykes. He doesn't he's cheer leader W 52 5 E 7 5 Fitz Hugh Greasy, I just saw Tut kiss your girl 3 E 2 5 5 5 S 4 3 99 53 QQ sf S ai A'Ii IYAVAVNAVIVAVIRVIVAYAVAVAVAVAVAVAVAVAYAVAVIVAVAVAVAVAYAYAVAVAVAYKIVNRi haf e 5 Avg .......... M- .... .............................. Q ............................. W5 ' 'g I if I ll s x Q el 2 , d li , cc ' ', H 5' 3 ft lim I 2 ,i ' T I ll N g I Capt. Yarbrough: Well, pry them out of that piece of meat and let's see N E j Q - 5 2 . , Z lc - ', - 1 'J 'n I , 5 H ',,. if 'YY I 5 N l , Z ff , 5 ., . I j S g f - - ' I Q , Q H , . - i S s v I 5 h S I H- X , : cc 1 4'- X. Q V ' if I H ' - ' Sl' '1 .Jr ' M 3 I . lll s , . xg: as y 9 I. H ' 1 H 'xl I E .I Q . .,, ' 2 : , n s ,Q - -Q in ' 2 N . . 2 . . ' ,, . . ,, 7 : ll , , ' 4 . . ',, i I E ' H ' ' If E 'I i u H: . n . . , 2 In A. H . . Q 1 2 ' ' 1 7' 'lg - , fx 9 , , ' 9 n ' ' i: if .9 IT., ' 3 'Ill . ' Q Q i . VAVAVAVAVAVKWVAVAVAVAVAVAVAVAVAVAVAVAVIVAVAVNAVAVAW'NAWVAVAWVAVAVAVAVNAVAVAVAVAVAVNAVAVAV 4 V,---J---A 1-.. '.. Elllll is ' E W il., lE',,-.g'v,. Qing 1 ........... .. .. ..... .. ...... . ..... y ' l . ' -N A J' Q41 Hlx. Hello joe. How are you? Glenn J. None of your business you re not a doctor. Boll1ng M says he loves a Jack of all trades V1s1t1ng Gxrl fto Gradyj You say you ve been here live years yet you have servxce strlpes on your sleeve Grady I don t wear them they chafe my nose Major Roller Mr Brlght where we1e you last mght P Brlght It s a l1e ' Captam Gooch certamly lb consnderate He straps a veloclpede to the slde of IS car when takmg young ladles out to rnde We present W C Mayer who thought he was God s glft to women but who Captams Dean and Webb meet for a chat on the campus Captam Webb IS much brulsed and bandaged and Captam Deane 15 even more so Captam Deane What s the trouble Wllfred P Captam Webb I ve been ah teach1ng my wlfe to dr1ve And you P Captam Deane I refused to teach mme' Gunby Qto McCorm1ck C who IS holdmg bag of Bull J I guess A1nbrose 1S back from the mflrmary McCorm1ck No I bought thus myself CGunby famts Q Mrs Jacob I d l1ke some lard Clerk Pall? Mrs Jacob Well have you any other colors? G1rl I m just a httle Love B1rd Holderness That s funny I was told you were a httle coo koo V1s1t1ng Party How do you l1ke llfe as a rat Cha1l1e? Prltchett I ve only a hazy 1dea Captam Starnes Well Aleck how was the huntlng? Captam Dean Rotten every tlme I almed at a rabb1t another would get rn the way and spoxl my shot DuPage I can t understand W1lklnSOU Cooper Why? DuPage He went to see a grrl and fixed the fuse when 1t blew out HOME TOWN TOPICS Glrl Do you love me the same as you d1d before you went to A M A B ll? 1 Boswell Why er er I thmk I ve lmproved some U' W :QQ WVAWWVAVAVAVAVAWVAWVAVAVAVAVAV' lAVAWVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVQ 4 3 5 4 5: r 5 5 as .. .. ...... . , ,W 2 lt'-sy:-3, .-.. ...,. ...- -1 1 bw-I-ni nlkj . gf I 1 3 .4 ljnlqgs--gg,..p-.nn ..... .5 ., E N QIlnnm..,,.o ,lm-v -W cl' . ... . .sb N 2, nfl: .af Ei 2 fit 7' xl 7' l 5 f S . , rs , .n 5 W 5 y 0 , : cc S 1 sv 2' N 5 fl bm I J 's ' S 5 If . . . . ll 2 ! I . : CCL, ,Q I Q, N 2 K no . rc r . , , n J, Q X I C - :cl - , - n I N E ' Cl ! : ' lf. , I N 2 I : . N E . . . . - N 5 f h . 4 x 4 .f I f . . , ' ' , l' y 7, is only the answer to a squirrel's prayer. S 5 1 . . . l f ' , cs , 1 ' as u ,yup 5 ' ,. cr 1 - , ' . ' ' n , mx 4 ' - ., xc ' n . I S. ' , ., ' ' lf 7, : if E . . ',, l E ' : fl , ' .if U E X ' p , H P 5 , is s ' as 1 4 I : u .' .rx ' ' E I : rc , In I E ' If U ' C ' 7 U, E : . li I , . A ' ,I E . - 1 ' - . 2 h - : u c ,r , 'ms - : cc J ' .av 4 E - : fc , , , ' 'II E l . I ,, , . . . .I . 2 - cu N E . . n I E - : cc r 'H E Z cc .vs V y : ff ' ' .,! 1 S ' , C I . E . ,, . E ' 1 H , 1 - - 1' ' .u V' ' 5 QW E. I Wm'nfmvmmmfnvfsffmvnvzsvsvnvnvnsvnvNAYAVAVNAYAVAVAVAYNsavvy Wrmlii w .'?J5 mn t 1+ in I DL ., 4.1 Seashore What do you thmk of a man who wears red knickers ? Captain McDowell No man wears them Seashore You re mistaken don t you believe in Santa Claus ? Coupland fback from Stuart Hall Field Dayj You should have seen Neeks run the 100 yard dash Tannehlll What did she run it in ? Coupland I ll be darned if I know what you call them Mapp How did vou hurt your hand f Carskadon Went to Staunton to get some cigarettes Mapp Carry on Carsl adon And a man stepped on it Captain Gooch Who was that lady I saw you with last night? Captain Glendy What were you doing in that part of the town? f'Var1at1on No 10000 Q Captain Ott I want to buy a present for my wife Clerk Could I interest you in something in silk stockings ? Captain Ott Well let s get the present first McKenney I hate the Charleston Roper I can t do it either Morecock Do you think I look lil e Captaln Yarbrough? Hudson No why? Moiecock A man just told me that I did . ' Hudson . You d better not let Captain hear about that or he ll kill him. ' Morecock: Be at your ease I ve already killed him. ' ' A i U Captain Kelley: Send me two pounds of butter and I dont want Oleomar- Q I garme. I y Grocer: What, Government Inspection soon ? y 4 WHEN WILL- ' - 4 l is 5 Major Yates start his classical dancing school? I 5 5 Captain Parkins patent his new rat -trap? . f 0 Captain Ott start his mechanical school? B I f Q l Major Jacobs start selling two bags for fifteen cents? ' I I 4 Q Captain Gooch open his beauty parlor? . ' ' I g Q Major Sandlin build his dog-kennels? S p I Captain McDowell find a man to fit his boots? 4 5 y .Captain Gallagher observe ordinary caution on the public highway? 2 5 I Captain Starnes cease neglecting his duties for the ladies? 2 4 Colonel Roller get his new car and regulation blouse? ' E Q p , Captain Robinson leave his boots at home and keep away from the mess-hall? 5 Q I Captain Glendy loosen updand gave a girl of his own up for the dances? I g . Same- uit gumming ca ets' ates. ' I gf p The speggal order come out against Major Roller for loud yelling in court- Q ' 3 5 yard after Taps? , Q 4 ' I HA. sf P. ,..pp 5' p I S 5 S 4 4 9 x 5 S f 4 Q 3 Q s A . , 1 r TF I it-Y Q, -N ,SDQQ Awmmx-mvmN1.vNAvAvAvA Y VN mwavnvnvnvn AVA NAVAVAWHAVNS EVAY4QVAVAVAVAVAVXVAWVAVAVAVAVAVAVAVAWVAWVAVAVAVAVAVAV V 'VAV VAVAVIVAVAII? Q ' ' Q ' qs., ,.......... ....... .... .......................................................... .nf . 7 mr ' A 5 4 li fp 'I I ' .I I I ll D JAR I1 ' 4 4 X to 5 ? d h cs ' ' ' n ' V l 4 Q I : i . , ' v f i f -. . . . ' s f f 3 I 3 H -H rr 0 A 3 C I H 3, ' ' I I E 4 : ' H . I . H l 7 9 I -Q z . l 4 4 rl . 5 D K . ,, . . ,, 4 4 : . . , , N 9 e . ,, . . - ,, E 1 1 - I I r Q ' ' ' - - - I I 5 a J : . 0 5 5 -': ' 'c ' . 0 4 . . ff v , b . , . p f 5 , . H , , . , , . . ,, . 2 4 if , H 2 P I 5 5 U , I I 4 4 E - 5 ,' '4 .6 t ,, nl?'? 1- vm- I- 44f4. 'V.',- ng ,u-,rig --wise, -at .: 4 .1'Qm',ffv? ., inf' 3, A ..a,,, .,-. W , - . . . , .. 'li' '-,,.?, N ...gf ., fg 1 4 ,'l 'W 5, 5 .f . - .' ' f -4' fn, fa , J.- 1. is - - AVAVAYZA'1VAVxVAWxWVAVAVAVAVNAVAVAVAV VAVAVAVRI 1. . A A, , , . , Q . s . -K .- g . - A gi. V.f'iif gwmsaszuoaosgccg-g-gwocgwgcogi '. ' U' -N ' . 'f Q 1' i5 Ag ... 249-2peE522w2s'31sEPQzS?o?2'u.,.g rv C2 1 'O fe 4+ massage-grasses 1 W if N as 2 'A ,. - - ities- 5?'?5g?s-E315e.3 2: t as-55' 3:93:73 5.2 UE- I 5,T 'f3SQf D-I ' Q:-mf 'If7'I.'i3.Igg:IOE:-g..jjIJPl E5 .--.'1',-.g.rn,:-g- fjjOp..5'- :S '2?'323?r'2s2? 5E?.eS2i2+5 if I Q 31 5: I Q Q j 1,1 21 : 1 1 I 5 323 3,15 2 :Ii 3: . 5 f'5a1E ' . 4 '::a:. . S -5 E S1325 : 'g' g Z: - Z xl 5 D , . ... . Q 12 :SIE E S1 ' a 2 E. E I 1' O EN ' ' ox-2 ' E 5 2: ex. ii. :ii . :E II.. - --3. 3 ' .. 1 z 5 . UI. . . : .. . I 2 , - , . 5 5 4 ..::e::3-:.:--:itfgzi 1,55 zggggoggggggggzgggluggg Gang iu::ZI:P.UU43 ZZ:'E'.5 'D'9z. ' En ' Q tn 2393: Q - P.i.m2lAT9f 'sQl'1'1 5 --- '11 f-+W.-.rbi :so :ff -:X ...... 5 cl 3525-'cr 5.54 gglw W-52.0 4 QQEESSDQQ I-'-fT8 ?-45-'2D'DS 115'wS' 7 5n'Q'E3.gg': 3.CW3S-575 'O2S': f 34foS2wsf:.1f:U31cB'2'c1 cr? 52 5:1-:sag 5 E3 rfxvrffffxfdvffoax- S A f 4 - 2 VAVAVAVKA AVAVAV - .Most in Love . , . . vPolitest Cadet .... . 'N eatest Cadet ......,. ...........Morecock ...............Nickols 2 wBest Natured .......... .Captain Yarbrough Q f ' Most Military Private .... .............. G rady Q P Biggest Eater .......... ..... C aptain Parkins QQ . Biggest Pest ......... ....... W ater System Most Contented ...... V ...............Glenn,-I. 5 , Most Popular Rat .... Woo-Fang Williams 5 Best Built ........... .......... C . W. shack 5 Best Baseball Player . .. ........... Slemp, S. 5 Best Track Man ..... ......... R oller 5 Best Debater ...... ........... C amner Q W Laziest Cadet ........ ..... C olonel Roller 2 A Biggest Bolshevik .... ' ........ ...... M ajor Yates Z ' Best First Sergeant ............ .... S ergeant Kelley Q Tightest Commissioned Officer .... ..... M ajor Sandlin Q A Biggest Woman Hater ......... .....i.... - ........ C aptain Gooch P y Best Corporal of the Guard ..... ............................ C ooper 5 . . .Freshest Rat ................ .... T he One That Teases Major's Cat 4 1 Best Swimmer ............. ...................... I vory Soap R Best Wrestler .... .............. C aptain McDowell Q ' , . ,e l -iw ET W 5 v ? 3 Qs . y eff QQ y 3 4 , L 1 Zi' 'NRVAVAVAVAVAVAVIWAMVAVAVAVAVAVAVAVAYAVAVAVAVAVAVAYAVAVIFAVAVAVA IYIVK'Kg lil it 4 ' 4 1 4 .Wai mi Q, 2 if R .1 -7,99 , I . V ' . ,f ,,,Y 7 , , ' if xfv , . rf- f' gg' -' ' 'lu5 q,'f J ' 'f , ' V , , -' I ...A l 1 1 si' T I 1-,,. ' . r , , ' . . wir S gi. we A vw, Aw-vAvAvAvA Avavav v,.v,-wvAvAvAvAvAvAvAvAvAatvAv AVA!-Q c F X i , M I ........ ........ ........................ ........ . . - ..... ...... . ........,,,f, I - ' .-' i -seizes: ui-sy, 'F V E X-s E ' ill!! ,. sw- kv- 22 1 ll 'RTW 1 ...... ......... m- ...-... usb ln I mv f , 2 lx 7 The Shooting of Dangerous Mac. 1 I 5 ly, - llnl 9 5 5 4 5 ' ' AVAVAWVAKYGRWVAVMLVAVA A AAVJMVAYAVAVQVAWYAWUJAYAVQBVAVAVAVAVQVAVAVAWV. .Q A 2 VN A g lCWith the Usual Apologies to R. W. Servicej A bunch of the boys were whooping it up in the Bowen Post Exchange, The kid who tossed the Toddle Bars had nicely gotten the range, While back in the store room knee deep in old bills lloundered McChesney Y. And squeezing a dime stood his partner in crime, the man who was known as Si. When out of the night, which was silently dark, and into the framework hut There 'stumbled a man from the underworld, with a head like a hazel nutp l-Ie looked like a thug who had strayed from a cell, and had never cherished a thought, But he took out his roll, and you couldn't count the number of Dopes he bought. There were none who could place this moron's face, tho' all did earnestly try, But we drank to his health, and the last to drink was the dangerous McChesney Y. You've doubtless seen men who offend your eye and look like a huge mistake, And such was he, for he looked to me like vaccination that didn't take. With a face so blank, like a vacuum tank, it resembled an army quilt, As he mixed Coca-Cola with Cherry Smash, and gulped them 'down with a tilt. Then I got to figuring who he was, and wondering why he was here, When he turned, and there on his threadbare pants I perceived a solvent smear. The mis-lit's' eyes wandered 'round our store, face Hushed from a dose of . morphine, Then he grabbed up a cake and with nonchalant ease broke the frigid air machine. The cash register lad was cleaning his nails, as the register was already bare, When the stranger Fixed him with his gaze, the lad vaporized under the stare. In an A. M. A. shirt rather soiled with dirt, he sat, and I heard him hiss, I'm darned if I see how the powe1's that be can sell men garments like this. Then a jews'-harp he stole from Harry Pole, and began to play us an air, 'And 1 kept myself from rapping his head by remembering the blow was unfair. A more hideous tune has ne'er been composed, and I trust none ever will, For it brought to our military minds a longing to maim and to kill. Did you ever sit with appetite keen in the mess hall at A. M. A., And then have them bring you food that's fit perhaps for one fond of hay? Then you have a hunch of what that music meantg hunger with table bare, Hunger not of that second-hand kind that's banished with mess hall fare, But the honest craving for decent grub, desire for food first class, I N l l ss.. vb if as Q9 5 4 .fs A i S ff AVNIVNAVNAVRYANZQVAVAVAVAYAVAVAVAVAVAVAYAVAV VAVAVAVIVAYIFAYAVAV YIYh'KM WAVWAVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAVNAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAV, 7 my ...... . ...... . ..., .... ........................................................,.,, , , W p r '9 M I Q ' S , The longing for dishes of mother's make, whose cooking none surpass. 2, N htThe music almost died away, so faint you scarce could hear. A S The fainter the better, all of us thought, covering each aching ear. N I guess you better bounce him, Si, said old McChesney Y. lk Then the stranger stopped his playing, and a gleam lit up his eye. A N In an A. M. A. shirt glazed with dirt he stood, and I heard him say: Boys, I've waited for twenty long years-waited for this one day. i When I was a lowly cadet and attended this school by day l I had plenty of money in the school bank, but McChesney would delay X In giving me my pittance, tho' I asked for it week by week, - And I'm sure none ever asked him in voice so small and weak, ' N Yet he still refused my allowance and gave me hardly a glance, So I left the school to learn to shoot and fit myself for my chance. 5 Now I want to state, and my words are straight, I'm telling you no lie, 5 That one of you today meets death, that one's McChesney Y. ! i Then I ducked my head, the lights went out, and two cream puffs Hew through f the dark, The lights came on and Guthridge screamed, for two forms lay stiff and stark. Lying quite dead with a smashed-in head, lay old McChesney Y., While the man unknown, his wild oats sown, lay at the feet of Si. Now they are the simple facts of the case, and though I don't know why, The one who clutched him and grabbed his roll was the man who was known as Si. ' ' -A. D. B. TAKE THE LATEST COURSE IN BREAKING BARRACKS Wizzard Bright will turn his deepest secret over to you for three cents post- paid. His theory of getting out of buildings with stone on every dimension, in- cluding the fourth. Cut out coupon in middle of page and send to Adolphus Bright, in care of Track Department of Penalty Squad. - I find Mr. Brighfs theory thc best, and do not hesitate to highly recom- mend it. 1 . QSignedj ERIC GRADY. ARE YOU AFRAID TO LOVE??? sHoULD A PETTING PARTY s'roP WITHVA K1ss?? Profesosr Wilkinson will clear up any of your deepest love problems in his twelve volumes of the most daring books ever written. Nine-month trial. Mr. Wilkinsorfs theory carmot be surpassed. ' QSignedj PUGNACIOUS BAUM. Il' r W G-3 ' V .23 Nm'NNAVNM1kfAV1R'AYAYAYAY1.YAYAYAYAvAvAYAvAv,yAvAvAvAvAvN,gq,vAvAv,ynvggs -ii... 1,, 3 M wvA w v vAv '1 1I ?A TAw:t ,N ,............ ..... ......... .................................. . ..... ......... ....... , , 11111 -45 gm A. 2 - 111 , f1Ug11g11g1gz2.g131i1g1.1 QL 1 1 wi.. .......... ........ . . .. .. . fimggfm, , f - naw? 11 1 N. 'EEK I SAV ,Q 1 Y' 1? 13 I1 ,gy 513 jf 1 '1 'F flu K1 11 1 1 11111 ifi 4121511 -, 19151:-'. 11 , 'A 1 XE 1 12 1' 1 P3 1 Y N I 512 1 K Q, 1 lf S' E 1 if 1 G 12 1 K 1? 3 1 I 4 '1 E1 1 1 I I f 11 1 IE 11 1 111 111 51 41 1 Ev cb 1 W wh. E 1 1 5 1 1 1 1 1 1 I X, 1 1 1 I AVAYIVAW' VIRYAVIVAVAYAVA AVAVAVAVAVA AVAYAVAVAVAFAVAVAVAVAYIWA 'Q I if Q1 1, 'fy ,fbfjjg-1 2 1 1 1 11 , 113 1 1I 1 . L1 1 I 'flQfLT f '-- W- ' -- V 'V ' I.1L 'Ililifj I -i S Q 965123 035555731 0 lx gkwlk Slmwl vom fmzzbh s away. FAVORITE GEM FACULTY ADVISER lul IJ1 xmrmcl Gen. Loc Lando ,Ru ul Imowrw ... P7t81dfllfS HIIUMINOKS VVAIKII ....Vw Prfmifzzt IIIRAKIII Olilllx s ...... .... S LL7'LfU7'NV DIMINISHERS OF THE PILE GRI-:Asv I-l01.I.lNr: Cows C0lTl'l.ANlJ Sl,Ol'I'VU Gmmn C1rlf:A'l'lcM SNIQI-in Clmu-atom. SAUN E633 L.- ini, X O X A a Z K .f -:4:- - i.g.::,g,., Y 'BYTXE 4 -- -e.-ian! v'-4' I .. f I .,,.. I - :4 ' Qihgl-:.-:-3.-.Q -:-- - g 5951? Y? V G58 Vg, 2 we--d U MOTTO Dorff 'wake me up, lc! me dream. FAVORITE FLOWER Bed of Cactus OWL EYE IDUPAGIQ. .. . . . . . . .President CoN'rEN'I'IQ1I GLENN .... . .......... .... V ice-President MASCOT FUDGIC I 1'1D1'l'OR,S N0'l'l-1 :W-Fudge would have been made President, but he went to sleep during the election. SAND MEN DRI5AMY HUIISIIN ToMnsToNIa GRAVIQS WINKs MAI.ONli FOUR-IN-HAND CRAVATII HRIP VANH N'ICKOI.S HFAVORITIEH LYKI-Qs SwoI.I,I:N livin MORl'ICOCK llKIDIJY,, CARR NBRICIKN WALL BVAWWVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAWAVAWAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVA? 4 e 7 .V- ,-... .... ........-...u.....-..................................-.... .......... ......., pm , , - L, ' Qg6im,,,,,,,,,.u nm qm.. in 'nr-nuail' ug g A As Q R , U U oo oR R fi 5 + E 4 2 1 1. - The Post Exchan e 'Q MOTTO Enter not through the exzt the crowds may trample vou doun NICKLE BERRY AMEROSE Vzcc Preszdent BABY RUTH Sponsor IDEAL WILRINSON Secretary EDITOR s NOTE The new Post Exchange IS ded1cated to Hang On Wxlhams MEMBERS GUM DROP DOWNEY MAUL TEASER CAMNER - OH HENRY HOTCHKISS CHOCOLAT1' HUNT 2 BIG BITE MoREcocK TANGO SHREVE CHERRY SQUEEZE GUTHRIDCE TODDLE BAR CANNON Q ev A b X A 4 A . 2 P P f lf . N N 5 4 x XO. 4: N 5 4 W fc, w 4 9 f , Q V 2 4 f QQ of if 2 5 C fr ' 1 S Z ,' V , 'Q 1 4 , f t ,r w y 5 , It w W. R 5 Q f Q Q-IH ' 1? V if 5 P f 5 R 4 E S + E 4 A , 5 3 Q X X Q - I HH J Q E2 JZ X E Q A A 9 3 ii S Q E , . y 5 B 5 5 HPIGGLYWIGGLYU BOWEN ....... . . . . . ..... .... ........ P r esident 5 5 A H .. R... .. .. -- A 5 Z, ff ff .......... .. . . .. . . , 2 a ............ ...... ........................ S Q .- 1 . E , A A y 3 2 5 ff If . U H , 5 P - S 4 ,, ,, c 4 A- f- H E 5 s if E Q fs, QQ Q 5 A051IVIVAVRVAVIWAVIRVAVAVAVAVAVAVAVAVAVAYAVAVAVRVAVAVAVAVAVN'AVAVAVA IYAYK'Ki Q 2 E 2 5 S . i 5 fa A Ye. 3 Y TZ 1 wfvfWVAVAVAVAVAVKVAWVAVAVAVAVAVAVAVAVAVAWAVAVAVAVAVAVAVAV VAVAVAVA a 1 4 ,NAVAVAVAVAVAWVAVNAVAVAVAVAVNAVAVAVAVAVAVAVAVAVAWVA'NAWVAVAWVAVAVAVAVNAWNVAVAVAVAVAVNAVAVN sp ? pi..P-igggumg-refs::ezffg-at-mgmgggllm - me 3 , mlliiliim,-gigggqMgr!!!-i,,,-sq. N Q 'ft . ,.' Q - - w v f- -Su ..:-N 3 -- ..,,........ .......................................................................... I .' jk lb xl! 6 4 A Directory li ADAMS THOMAS I CU T203 North St New Martinsville West Vxrgxma Private Co A Boxuggn Squad Track Squad ADELSON RAYMOND C11 R Success and East Park Sts Lakeland Florida a Y Private Co A Boxing Team Track Team ALEXANDER JOE L C23 Al Woodlee Staunton Virginia ex Platoon Sergeant Q M Co Track Squad ALLAN EDGAR CSJ 2915 Monument Ave Richmond Vlrginia CCand1date for Graduation, 1 Private Co B 2 Private Co A 3 Sergeant Co C ALSTON VAN D 125 V Warrenton North Carolina an Corporal Co D AMBROSE ARTHUR C23 3408 East Howel St Seattle Washington Desperate Corporal Band ANDERSON HARRY W CU Greensboro Florida Harry Private Ba ANDERSON WII LIAM D C21 Franklin West Virginia Corporal Co B B ble a ARMISTEAD ROBERT B 113 P I Richmond Virginia a mo ive Private Co C Dams Private Co D BAUM PHILIP CU 11 Maiplte Ave Woodsdale Wheeling West Vtrgima 1 Private Co A BEASLEY THOMAS R C13 LaGrange Tennessee Nu Grape Private C0 B BEANS HARRY G CU I-136 West Loudon St Philadelphia Pennsylvania arr Private Co B ,Track Squad BELL WILLIAM C31 Box 298 Miami Florida 1 Private Q M Co BELL I MCKIM CU M ao Paulo Brazil South America ac Private Co C BELL J W fly Quinwood West Virginia Dinner Private Co D Peep Athletics BENTLEY L B Q32 Bastrop Louisiana Mouse CCand1date for Graduationj 1 PrxvateCo B Y M C A 2 Pr1vateCo A Tennis Club 3 Corporal Co A Manager Track Team Episcopal Club Q , , ,o 5 1 i . s S ! mv N N 4 Mi 2 fi li . . . .. ln Q U A , , . .............. J. N ., , i, E 1 ' ' S 1 - . i 2 . 3 A , Q .... .... U U ., , A N 3 l ' ' 7 1 . .. N 4 , i 1 , , ......,...... I: .... 5' .............. , , S E f P , in 2 g , .......,....... . ..... Jian.. u ., , N 3 f I ' .at In V E f u ' tu .H . Nl 5 f - . 5 4 f , . ................. 4.4 .... 5 ........ I ....... , M 2 f . 2 , A ........... 4. ......... H ., , - p W 3, i1 I 2 . . . , . 5 , . ............... .1 ...................... , l y i ' 5' d e , . . ........ dignilh .......... . ...... , E I I 3 Vi cies. I . H Q X I , U . ...... if ...... i,..,..'. .................. , E BACON, PAGE 419 ....... . .................. ............. Pass christian, Mississippi ' ',, ,, . . . . 5 ., A ................ I at .lun , 1, i , . ,.....,. ....... .......,....,,... , g ' - .ll -II S ' , ................. ., ' ', ' ' , 5 ' . D gil H I ' ,. ......i ............. 4 ......... s , ', 5 ' A ' . ffl ....,...... - - '- S I y l c nuunasuunuannu I llnnounnn t li agluliy u I y , . ............,..... A ...... Q, ,..................... . , 1 ' l . l': l D : ' - ' E 3 59 C in 2 ZIXVAVIRVDYIVA'AYAVIKVAVIRVAVAVAYAVAVAVAVAVIVAYAYAVAVAVAVAVAYAVAVAVAVAYAVIY'WAVES TM KL 'X' 1251 'fa' 1 . ' f ' BLAKE WILLIAM E. CID ............. 818 Railway Ave. Ronceverte West Virginia 1 .4 1 X Parson . 11 1 . , - Private Co. A. ,Q .X ,.W.. X . , BLAKEMORE VAUGI-IAN C1D .... .... ...8l0 North Augusta St. Staunton Virginia ' J. e e . 2 . Private Q. M. Co.' Basketball A ' Baseball 'Ieam' Monogram Club. 1 BOLLING MAURICE CSD ....................... 1027 Main St. Fredericksburg Virginia I .g. 1 Greasy l ggi Sergeant Band' Sergeant-at-Arms Ciceronian Literary Society' Wrestling Squad' l I Final Ball Committee' Secretary and Treasurer Episcopal Club. :T -f 1 BOSWELL WILLIAM W. C4D ............ I ........................ Yaney Mills Virginia . 044. X X X X CCandidate for GraduationD 1 1. Private Co. A 'Track Squad. .,X, 2 Z. Private Co. D 'Track Squad. 3. Ser eant-Major' President of Y. M. C. A.' Ifinal Ball Committee' Cotillion Club' A- RECAI.L Sta ' Bayonet taff' Cheer Leader' A. M. A. Minstrel' Rifle '1eam. l . 1 1- 4. Captain Co. B ' President Student Body' President Athletic Association' Chairman E 5' X Honor Committee' President Cotillion Club' President and Leader Final Ball' Editor-in- 1 f-, Chief and Business Manager of RECALL' Business Manager of Bagonet' Head Cheer Leader' Q f X . Y. ,M. C. A. Cabinet' Ad Astra Per Aspera Fraternity' lwin 9 Club' Rifle '1eam. 1 BOWEN M. H. C3D ..................... 1 .............................. 'lazewell Virginia ', Batterfoot X 1-3, ' ' A Junior Platoon Sergeant Co. D ' Manager of Post Exchange. 1 Tf 3 BOWEN R. '1. CZD ...................................... I ........ Wittens Mills Virginia E i.L: ', Bates E Xf' Corporal Co. A. 1 BOWERS JAMES H. CID ................... .208 Boundary Ave. Elkins West Virginia L '- Hug ' Q -:X X1 Private Co. C 5 Peep Athletics. X 'j,,f'f, ' BOWLING, Xl. TRAVERS CZD ....... ........ ............... C h arlcs Town, West Virginia E Xia, urrravu li Corporal Co. C. Q BOWLING, THOMAS C. C4D ........... ................. Charles Town, West Virginia 'fuel H om!! 1 First Lieutenant and Postmaster StaFf g Ciceronian Literary Society, X ,LE X Y. M. C. A.g Bible Class. ll BOWMAN, CLAYTON R. CID ..................................... Bridgewater, Virginia l ,QS Clites I X351 Private Co. B, ' BOWMAN, R. A. C1D ..................................... ...... D aytona Beach, Florida X ' ' KlAl,cmanll X E Private Co. D g Track Team. X BOXLEY, J. ASHBY C3D ................... .365 South lvlain St., Winchester, Kentucky X HAS 11 I laps' First Sergeant Co. C g Ciceronian Literary Societyg Company Basketball Team. l.r 1 1 1-- till arg, 2? BOXLEY, PHILIP S., IR. CID ......... I ................................ Orange, Virginia XX-:XX I llPhllYYl-llA.rEdyl? i Private Bandg Baseball Team. l BRATT, LOUIS W. C4D ..................... 1591 Uuarrier St., Charleston, West Virginia 'N Doctor ' ' ' First Lieutenant Quartermaster Staff g RECALI. StaPfg Bayonet StaFfg Company Basketball: Ad Astra Per Aspera Fraternity. BREEDEN, POWHATAN C3D ........... ..... 105 North Linden St., Richmond, Virginia O U 'anll Junior Color Sergeant Co. Bug Varsity Football Squadg Varsity Trackg Wrestling Squad. ,WX 1 1 1 1 . . fe 1. All .fa W -fa W wi? .41 l , Wdiidiiidhiididid Qihbiiiiiibiiiiibiiiiii iliibii iiiiiikik EHR' AMLHBWEQWQY BGYQQQEQYHPZMRMEHMHHA 1866! '7 1 .1 1 Fr 1 . 1, -1 1' -,-1 . , X 1 1 1 1 1 fi, , , . 4 . 1 .... f. ' 1 .AYA AW 11 X PK, J -1-5331-A-1 HIL. -1-, U,-13111 1511-rr vzru11u.1.rx.v:xxxrrp nj: y ' Luft -1-M , ,,1 Xl ml f K1 I, ,L X an 1 DL- ,p 1 I 1 ' , 'X .-4' YT! L 1 1 1 munununl 1xzr:Ln11Lurzu.1.x:1:1rrn.un:nIrxrr 4 A 1 , Q .X X f 1 rlh ,Q X A 1 N P f 1 Q 1 W fag 1 1 1 1 1 .. ,. - 1 Q 121 f C101 - 1 Ei f N ,1 1 1 1 1 , af, ' u 11 ,X Xi 1 11 , u 11 , Q , N 1 fl N ,N 13 X 1 1 1 1 ,ni I X D 11 11 N 115114 1 1 K 1 1 ' 1 ' 1 ' 1 , 1 4, ' D 55' f ' B ll ' D :fill 3 K at 11 N ggi 1 I 11 11 : N .f 1 - Rl 1 ' I l S f at S 1 1 1 1 S 1 I 11 11 N 1 1 1 9 1 - , 1 1 lx C ' r 1 11 11 1 ' 1 Psp X 155, 1 1 1 iff? V 1 , ' fp Q31 , 41 11 ' ! 1 'f 41 11 1 ' ' 1 .f ll ' I 11 1 i u 11 ' L 1 u 11 'ill 1 lwhl, ' I 11 11 ' ' 131 X u 11 1 l i OL Xi X ' Lo ran 11 ,Xa.? ,. uiiigz x .At ...J VAU-VAVAVAVAVAVAAVAW-VAVAVAVAVAVAVAVAVAWWVAVAVAVAVAVAVAVAVAVAVAVAVI-VAVAQ V 'gs' vn nilll m img, I FF Q Ill l ki! .1 BRIGH'1 ALBERT D C35 100 Last Matthews St Elxzabeth Clty North Carolma I CCand1date for Graduatxon5 1 Prwate Co A Wrestlmg Squad Football Squad Track Squad Wlnner of Com petltxve Drxll 2 Private Co D Football Squad 3 Prlvate Co A Varsxty Football Squad Captam Boxing Team RFCALI Staff F1nalBallComm1ttee Twm 9 Club BROOKS EDWIN D C55 D Fort Defiance Vlrgmia uc CDay Stuclent5 Track Squad BROWN RIVES D C35 1809 Grove Axe Rxchmond Vlrgmla Duck Prxvate Co D RFCALI Staff Bayorllet Staff Y M C A B1ble Class BROWN SANFORD M C35 155 East Sprmgettsburg Ave York Pennsylvania Jumor Platoon Sergeant Staff Peep Athletrcs BRUBECK W H C25 R F D No 2 Staunton Vxrglma 1 CDay Student5 Baseball Squad BRYANT GEORGE R C25 R 2923 Monument St Richmond Vlrgmxa ane Candidate for Graduat1on5 2 Pr1vateCo D BURGESS MARWIN l:. C15 Mt Crawford Vlfglllld Marne Prxvate Q NI Lo Baseball Team BYERS CLIFFORD C15 K Harrisonburg Vrrgmla 117 Pnvate Co C BYRD J M JR C35 B Mountam Grove Vnrgmna utter F1rstL1eutenant Quartermaster Q M Co Captam Football Team Captam Baseball Team Honor Commlttee Secretary Cotlllxon Club Treasurer Student Body Monogram Club Wmner of Gold Football Y M C A Cabmet Rifle Team Treasurer Athletnc Asso cxatuon Twm 9 Club CAMNER IRWIN D C15 Y 652 N E 57th St Mramx Florxda ts Prxvatze Band CASTELL R K C35 Pl 301 Takoma Ave Takoma Park Maryland uto Sergeant Co D Presxdent Tenms Team Swlmmmg Team Mmstrel Show CAMPBELL A J W C25 108 South Kanawha St Beckley West Vlfglhla an Corporal Q M Co Dxrector of Orchestra Buble Class Y M C A Cabmet Muslcal Dxrector of Mmstrel Track Squad CANNON H L C35 Sh 2034 Monument Ave Rlchmond Vlfglnla ot Corporal Co C CARAWAY F C25 214 Warner St Jonesboro Arkansas Senator Sergeant Co C 4 CARPENTER IOF H C35 I 312 Locust St Covmgton Vxrgmxa E oe 3 Sergeant Co D , Peep Athletxcs 2 I Q p U' W S 4 p 5 4 S Z YAYNAVIVAVAYAVAVAVINAVAVAVAYAVAVAVAVAYAVAYAVAVAVAVAVAYAVAYID'AVAYAVAVIl li'lK'tg 5 5, W M .....s...1... 1 .-.............1s......-.-.-.-.-...-------a1s.-----t---1.-Qs.-,-ssss ! 3 Q C aasata -sil t! ssa 5 3 111 s 2 4 x e e 1 2 4 A 5 5 E Q z I -, 5 . ......... H ., -I -, - ,gl 2 Q 5 M I Al D I A fe 7 P I C '. 1 ' 2 1 2 ' - 5 fs 5 l . ' ' . : . 5' 2 5 V C , - ' , Hn' : ' ' ' : . - 1 C U E 5 f '. ......... ' .....................,..,.... ' -- 4 2 s f ' -f 1 C Q rf f - 2 4 1 A, - , ..,.....,.,.,,........... z., - , I -- I 2 4 f . .. . .. It 5 2 5 f ' ,.... f.. .f ' ' ' - A 2 s f ' . ,, . 'I I I 2 5 r ' I ' . .. 2 5 r A, . . ...............t.. hgiid ......... . . . . ,. - , 2 C ,, ' y Q I f 5, It -, . .........,.. A ...... ., P- , ' -' ,l S E 1. Pr1vateCo. 213.11 C I I ' 5 3 3 I I , - ,It..t,.,..,.,,.,t.......t.....,.,, 5 I ii 4 . H , H f Q , ................ ..........,......... , E Q , . ., . .................. it ...... 5, ............... . , K E 3 .g . u Q ,, ' -.,: .2 9 . :U Q. 5 E I .5 5 I U H I 3 .... 3 5 , . . u - g 5 . , . .............. 6......,3 ........ . .. . ., , S a , . . H ...... a ........... b .... 3, . . ., Q , Q 3 1 , ll . Il' I. . .I ............ 'IJ H ' v . ., , I E t,rt,t I rr.r..' .,,... .5 ...I E 4 H H H H ' E 3 , . ,........ ........ 3 t ........ ,HJ ., , 3 4 , . . .................. ,, - , I -- 4 A WAVWVAVAVAVAVAWVAWVAVAVAVAV VAVAVAV VAVAVAVAVAVAVAVAVAVAVAVAVAVAVAV, N F Qu It 'sly 1' i KJ' .1 CARSKADON CHARLES A C4J 208 Fourth Ave Haddon Heights New Jersey Half Pint Death Second Lieutenant and Ordnance Officer Staff Bayonet Staff CARR F P up F k 2525 ontario Road washington D C lf ie Private Co C M1nnow1Frootball and Baseball Teams CARR WILLIAM G CZJ 109 Whitehead Ave Wilson North Carolina CCandxdate for Graduationj 1 Private Co C Peep Football Swimming S uad Junior Literary Society 2 Private Co C Track Squad Tennis Club emor Literary Society CEASE WILLIAM M JR CZJ 2006 Lamb Ave Richmond Virginia 1 Prlvate Co B Peep Athletics CHAPMAN FREDERICKP C15 Smithfield Virginia Chap Guntz Private Co C CHRISTIAN MACKT C25 709 South Dakota Ave 'lampa Florida Tom Corporal Co B CLARK B Clj B Richmond Virginia ruce Private Band COFFEY I A C35 Mint Spring Virginia o First Sergeant Q M Co Football A Assistant Captain Baseball Monogram Club Rifle Team COLEMAN FRED W CID F Edgemore Maryland rit Private Cf: D COLLIER W H Q22 36 Lewis St Geneva New York Yank Corporal Q M Co Football A Baseball lcam Monogram Club A CONNORS MORTON L. ..2345 Crest Road Birmingham Alabama A . Private Co. A. CONRAD RICHARD F. Q11 ........,... .154 Adams Road Framingham Massachusetts ' ic Private Co. B. ' , CONWAY POWHATAN M. CU .............. 525 North Main St. Henderson Kentucky Private Co. C ' Wrestling Team. CONWAY WILLIAM J. C25 ................... 525 North Main St, Henderson Kentucky Corporal Co. D g Basketball 'A 3 Monogram Club. COOPER, D. MORGAN C25 ........... ..... 254 Charles St., Henderson, North Carolina organ Corporal Bandg Swimming Squadg Cotillion Clubg Episcopal Club, Twin 9 Club. COUPLAND, ROBERT S. C25 ....................... 707 Raleigh Ave., Norfolk, Virginia ' Private Co. B g Y. M. C. A. Cabinet. A 4 4 3 3 3 ucoupn I 5 5 COX, HENDERSON C35 .............................. R. F. D. No, 5, Staunton, Virginia S 1 Henry f b CDay Studentj Q 4 Baseball Teamg Monogram Club. f- D 4 CRANE, CHARLES E. CU ..................... 249 Park St., Morgantown, West Virginia 5 P HBlEdH A X rivate o. . 4 9 I 3 4 N f it if f 4 S S e E 5 S s 5 s 4 3 I I ,Q .....,. ,...... I .,... .... .........................,.... , ii ' A Q S . s t o 3 Q V d me , l . U ....... -. . H-H Hn , 2' 5 5 f J : I . l S Q 4 7 5 , , . . ...................... , , . . N 5 5 i - 1 . ,Q 5 f , . ................ ' ., ' , ' if S f f . B111 D t 4 Z , I . .,, ,,. u . . . . . . 1 r Q 5 f ' . 'U Us Z' . ag .' . . ' , y 4 I . . ................... L.. . ' Q ' ' ' I 5 f ' ' ' u ig.'11 I ' ' S JS 5 f ' I ' . . . . i f 5 ! , . ......... , y 5 Q f , . ..........,....,.. I ,... R .. . . 3 i i a f' 'f H i Q E A , . ' ........... ............ I 6 ...... 5 ...... ......... . 4 , ' I g' ini E I ' . . . . . M 5 , . .... .I ...... J, ......... :lf 10.4. .H ...... I. . .i ........ , 1 5 - - -2 3 , 5 - I 5 I I 5 , . ............. d.....,. ..................... , . 3 , . .............. ,i..,.., ........ ., , pp 5 - - CU-S S 3 . 5 f .. ,, - ' ? 4 H H Q 5 ' i- H ' ' 2 s . -A -I Q 5 . L , . 2 4 -f 2. 5 ' f -i ' ' 2 5 5: 5 S P 555, . s Q D mA'NA 'AVA'fAYA'AVAVlbA'AYAVAVAVAVAYAVAYAYAYAVAVMAVAVAYAYAYQAYAYANAv,ylymRs QV!-Y'EAVAVAVAVAVAVKVAWVAVAVAVAVA AVAVAVAVAUsVAVAVAVAVAVAVAVAVAVAWKVAYf gn .. ' , ,W ...... ..... . .---. ........................................ ........... 2 ....... , J, D jg Q rn I w'6!!!!!!!!'l!!E.E . , 'leQg,go'u1gg5ggggW!J N A I . ,, I , . A 4 P N JI Q, .. 5 f I I s Q 1 fo CRAUN, RICHARD F. C45 .............. R. .B .............. ..... M i. Sidney, Virginia N f H H l Q C lin ' C'Day Student5 A My 5 g 9 5 Baseball '1eam, Monogram Club. I, y 4 z CRAVATI-I, JACK B. C25 ..........., .......... g . . .1029 North Shore Ave., Chicago, Illinois Q Q N eck-Tie N E 4 5 Private Co. UD. 5 4 ! CRAWFORD, HENRY C25 ............ .J .......... .... I-I arrisonburg, Virginia 5 f ic Q 5 CCandidate for Graduation5 ' 5 5 Q 1. Private Co. B , Track Squad. 5 4 5 C 2. Sergeant Co. D , Track Team. ' N ' 2 , . . ................ . .......................... onaker, Virginia N E . - u 0 u 5 f Private Co. MAX' . 'N E 9 5 DANIEL, J. NELSON C15 ............ :6N.i..., ..... 202 High St., Charlottesville, Virginia E e son ' 5 f . Private Co. C, ' V C 2 5 f DARALL, JACK B. C15 ..... ..,..... I :321kNorth McKean St., Kittanning, Pennsylvania N ' E S i , Privat'gaCo. D, - ' vi E b DAVIES, C. H., JR. C15 ............................................... Racine, Wisconsin f Charley ' 5 Z- 1 Private Co. B , Minnow Athletics. i S 5 DAY, ORVILLE D. C15 ................. 1 .......... 140 East 46th St., New York City E 5 Private Co: D, 2 5 DICKERSON, MARSHALL E. C25 ...... .3413 Oakwood Terrace, Washington, D. C. E ll H 5 1 P I C D T k gCan5iidg.te for Gragiuatifm5 3 . t . 3 a , immin u c. 5 2. Cbllpaofal Co. D -, FT:btba?luSquadvil TrackgSqilIa:il. 5 2 DIDDLEBOCK, WILLIAM C25 ...... ...........,..... Philadelphia, Pennsylvania 5 H O e u SH P Private Co. B , Football '?A , Bagsketball A , Track Team. A f 5 DILLARD, GEORGE M. C35 ......................, 548 Mowbray Arch, Norfolk, Virginia . S f George - Pill 4 Q Senior Platoon Sergeant Co. C , Company Basketball, Vice-President Episcopal Club. 2 Q DORRIER, EDWARD L. C25 ........... IEE. 6 ...................... seeifsvine, Virginia 32 ? Private-Col. A. 7 Q DOWNIE, DUNCAN C65 .' ..........,.. ,lb .................... Plainfield, New Jersey unc . a Private Co. B , Swimming Team, Peep Baseball. S 3 DUFFY, CHARLES C. C15 ........... JG. . . . Johnson St., New Bern, North Carolina . 4 Piivei:ncfai'B. P 3 DUNLOP, W. L. C15 .............. ab' .... I ,. . .u.S...d:, ..... 4207 39th St., Washington, D. C. g 4 ' u IZZ3' - pee I ' y D Pri-vate Q. M. Co., Peep Athletics. , 4 5 DUPAGE., R. P., JR. C25 ........................................... Kansas City, Missouri 2 5 A A P B liipocteein 0 h is - rivate an , a et rc estra. y S EASTMAN, WILLIAM A. up .......... 5, .......... 907 Dnnn sf., Portage, Wisconsin f rf f Q ELEY, CLIFFORD H. C15 .............. dciki, .... 1310 Lindon Ave., Baltimore, Maryland S 3 ' - Private Co. D , Swimming Team. 5 4 E . 3 3 il' 1 s 4 fr i f if Rss een RQNAVINIRC AVAYAVINAVIIYAVAVAYIAVAYAYAYAYI 7 YAYAVAY AVAVAVIVAYNVNAVAVNK YNM. . I WVKVAVAVAVAVAYKVAWvAWAVAWVAVAVAWAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVQ VAVAVAVAVAVAVAVAVAWVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAWW'NAWRWWWVAWVAVAVNAWVAVAVAVAVAVAWN in I.. I yu Wtllllll I 05 llllqgg 9 up Q1 mt tiiilb ml sgrgzr l .1 6 FMMETT FREDERICK C13 If d4605 Wayne Ave Phlladelphra Pennsylvama re Prrvate Co A RECAI L Staff ENGLAND E S Q11 Culpeper Vrrgmxa Hot Shot Private Q M Co FVANS L M KID 335 Thtrd St Cheraw South Carolma a Prxvate Band Football A Baseball 'leam Track Team FAIN S T C45 T 214 Avondale Ave Houston Texas ex CCand1date for Graduatlonj Private Co A Radxo Club Buble Class Corporal Co C Blble Class jumor Color Sergeant Co C Wresthng Squad Member A I W Semor Frrst Lieutenant Co A Bayonet Staff IEIMSTER MARSHALL Y C13 M Newton North Carolxna ott Class Cadet Orchestra A M A Mmstrel Y M C A FILES LOUIS R CU Mt Srdney Vlfglnla Louie CDay Student! FITTS ALSTON C15 1217 Umversrty Ate Tuscaloosa Alabama Spasms Private Co D FITZ HUGH GLASSELL S C35 D 31 Umverslty Place Umverstty Vlfglnla oc CCandxdate for Graduatxonj 1 Pr1vateCo A Peep Athletics Bxble Class 2 Corporal Co A Swrmmmg Squad Track Squad Company Athletlcs Busted Arxstocrats 3 Semor Platoon Sergeant Co D Swrmmmg Team Football Squad Secretary Y M C A Cotxllron Club Assrstant Captam Track 'leam Chaxrman Fmal Ball Commrttee Twm 9 Club Socnal Edutor RECALL Staff FLEISHMAN ARTHUR CZJ S 1007 Graydon Ave Norfolk Vtrgmla onny Prxvate Band Peep Athletics Junior Lrterary Soclety FLEMING ARCH C CD A h Pleasant Valley Wheelmg West Vrrgmxa rc re Prxvate Co A Football Squad Basketball Squad Track Squad FRANKLIN E W CU Bluefield West Vrrgmra Eddre Prrvate Co FREEMAN JOHN LEE CU Ik Crewe Vrrgmra ey Prlvate Co FRYE ,I P C11 F k Grove Park Roanoke Vtrgmza r1c Private Co B Wrestlmg 'leam Swtmmmg Squad Y M C A Brble Class FUDGE C13 Covmgton Vrrgmxa Bunk Prlvate Co A FULTON PAUL B C25 Wtse Vlrgmra Ptrxxe fCand1date for Graduatnonj 1 Private Co A Blble Class Football Squad Baseball Squad Basketball Squad Medal 1n Declamatxon 2 Sergeant Co A V1cePres1dentB1ble Class Football A Baseball Squad Bas ketball Squad Honor Commlttee Rlfle Team wr v QBN wi? e E S F 5 5 M A'lNNAVAVNAVIVAVIVAYVAVAYAVAVAVAVAYAVAVAVAVIFAVAVAVAVAYN'AVAYAVNIYIVNAF M ' q . , Q . Y MW W 7 M ........,.. g g .... .. .i ,.... . ,..r... ,. .,..,,., A ' A 3 I U l., -'e- sg A 9 U or ia l I F S I Q 5 1 .4 . , ........... dL...n . ., I ', ' I 2 E hx ' . u ng 1 ' E f , , . . .......,........ 14 .......,. L ...................... , - - - I Q R ' ol . 'In Q S, r , , , , ...................... ...., I - ., ,M - t 4 f ' , u n, t 1 , I N Q l S ' , . . ......................... 'Z .... , , ........ ., , N Q ' ' n n ' ' I ' I l l l 1' - .. .i . 1 - E I la I 1, 4, ' ' ' Q Q . D N 5 N f ' , , ...... 11.3. . .5 ..,............... , N V 1 l Private Bandg Football A g Baseball Teamg Track Teamg Monogram Clubg Bible ' f R P s : . -F - : . H . E. i I D l u y I A , . ................. 2' .... ,yi ..................... . , ln , ........ .........,...... ' ' ' ' ., , ln! l Q o I H .H I I I . I ' I -,F A 1 E , . .... A .... J... 1 , , .- A It Y.: -Q I n u 5 . I u Hs' 'L ' ' Q Q .. I I , . , .' ......... I: ...... Y: .... ., , ' ' ' , . ..... 9 ........r...... , '- , I - -- E I Cl ' Y! , , ' as ng : 2 ' . . . , , . . ................. 4: .... 55, .................. , ' ' I UC-n Q , .......................... ................ ' , ' ' ' E v Q . u UHZDH ,. . ........................ h.......,: ....... , , E ' . 5 ' ' 3 ' ' ' : .... ' , T l ' Q If .YY , . ...,..,........... ............................. ' , - -- E 4 I r u In u ' E - ' - : ' 9 9 1 : E l - Il H ' ' ' ' U U I E . . . 9 , - c , V : : : - 5 RVAWWVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAWeVAVAVAVAVAVAVAVAVAVAVAVAVIVAVAVQ WVAVAVAVNAVAVAVAWVAVNAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAZA'NAVAVAVAWVAVAVAVAVNAVAVAVAVAVAVAVAIAVAV mlm M lllgl XIQIII1 ,gi-sr, 1: 11, A I Q1 - GARBER JOHNJ C21 h New Hope Vlfglhla o n CDay Studentj Baseball Squad GATEWOOD ALFXANDER O C13 R Newport News Vxrgrma L1 t Prlvate Band Mlrnnow Athletrcs CEIMER OSCAR H CU 3919 CIIFE Road Brrmmgham Alabama x Prxvate Co C, Eprscopal Club GLENN C I C3D 526 Bggokstown Ave Winston Salem North Carolina a Corporal C19 C C LP NN JOF H C23 1074 West 4th St Wmston Salem North Carolma Head hght Monkey twm Prnate Lo A GODWIN J RAY CU B Hillcrest Place long Island New York o Pr1vater13ancl C oody Prn atc C o D GOODWIN JAMES C C45 Clifton Forge Vlfglnla Frrst Sergeant Lo B GRADY E D C51 F Norfolk Vzrgmla nc CCand1clate for Craduatlonj Private Co C Blble Class Private Co D Bxble Class Sergeant Co B Bxble Class Rune 'leam Captam C B Rrfle Team Secretary Buble Class RECALL Staff Y M C A Cabmet Medal for Mrhtary Excellence Advertlsmg Manager A M A Mmstrel Ad Astra Aspera Fratermty 5 Semor Captam Co A Chaxrman Cotxlhon Club Presxdent Brble Class Honor Commlttee Y M C A Cabmet Presxdent C1ceron1anL1terary Socrety Ass1stantEd1tor1n Chlef and Busmess Manager RECAH Asslstant Busmess Manager Bayonet Class Valedlc torlan Final Ball Commlttee Rlfle Team GRAVES ROBERT W C25 D k R F D 4 Jacksonvxlle Flornda u e Corporal Co C GRAY CRANVILLE CU 329 North Harrison St Rlchmond Va Grummy Prlvate Co C Boxing Squad Y M C A GRESHAM FRANCIS R C35 G h 428 East Mam St Salem Vlrgmla res CCand1date for Graduatxonj 1 Pr1xateCo A Football Squad Swlmmmg Team 2 Corporal Co A Football Squad Swlmmlng Team Wmner of Debaters Medal Bayonet Staff 3 Fzrst Sergeant Co D Football Squad Assrstant Laptam Swlmmmg Team Edxtor ln Chlef of Baxonet RFCAII Staff GRIMES ALSTON C25 M k Ralelgh North Carollna on Private Co B Iumor Literary Society GRUBB ARCHIBALDI CU A h 6341 Hzghland Park Bxrmmgham Alabama rc 16 Pr1vate Co D lf W 22 . 1 4 S 4 5 5 S Q . , . . . 7 W ' ,,,,,,,,,,,,, . ,,,, .... ....................................................f........, , l 4 lm-V'eggezm'-reef:zfnygulryg. !!jq.mv C S?-:T?f!1n!!l!!e-Qeev'!.l C g5,,.,...,.,.yL3Q,,.,1' N ct- .........,... ...................................................................... - ...vb -' i:,,.,gg4,,,,,,,r,gi,ff 3 If Q A S f Q S S . . ,,er,,,,ar,.,.,.r .... 5 ...,,...r, .,,,e,.,,,, . g r. lr I J ' J I 5 Sq r . If g , - , ..... .................. , ' ' ' C E C ' 5 ' ' Q I 5 E I , , . ............... 26.5, ..... , , CT 2 . . N 4 f , . -. .....,............ H H ., - , X .4 f I - Q . . . . .N 5 f , - , ., . ........ It ..... - - , A X 4 l W. It a r ' , . .........,........ ..., - , . , - ' Q t ' . 1 C . GOODLOE, C. L. up .................. ..,.. J, ........................ Ashland, virginia 5 . ' ,. ., ,, 4 f - , . . y .l , . .,....,,..... 4 A ..... .................., - , ' L J. C. Q H H E I r ,...............,. Q...' .................. , ' -- P 1 . H H, I 1 . 2 1 21 - ff' H1 - 3 y X 3. 1 Q 5 ' ' . , I .4. I o. 5 5' ' X g . . I u 3 .I . . . S 4 U . : .I l . I . Q . I . . . . . 3 . . -.I in E , . 5 . . Q . -11 I g 1 - 2 ' . .............................. . . . ' - 2 .-H I. Q ,. ......................... - ., - , . 5 . ' 'Q g .... ' 2 , . ......................... - ., , - -- 2 H ff x ' - f . -I H, , - - . 4 . . - z I : ' ' : ' - ' : l , ' ' ......................................... - . ' 2 - ..... i ...... U ' - - 2 E . I ' C 5 HNAVIR'IVIVAVAYAVIVAVNCAVAYAVAYAVAVAVAVAVAYAYAVAVNAVAVAVAVAYR'AVAVAVAV ACER? AVAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVQ El x s,X1llll1I, K lluu I nil 'Ill K 5, al CUNBY GRAHAM Ik C2D 107 Walnut St Sallsbury Maryland Gun Prxvate Co A B1ble Class Y M C A Baseball Squad CUTHRIDGE LEROY C2D 229 South Queen St York Pennsylfanza Spud Private Co C C WALINEY JOHN B CID New York Crty Johnme 1 mate Cc A HARDY FRANK A CID 1580 V1rg1n1a St Charleston West Vlfglnla D Pruate Band Cadet Orchestra HARCRFAVE ANDRFW C CID Forest Hrlls New Yor Andy Private Co A Bllly Whlskers Prrvate Q M Co boothall Squad Wrestling Squad Track Squad B1bIe Class HARRIS W BERNARD CID Spottswood Vlfglnla Bunny Private Q M Co HARRISON LYNWOOD CID Rocky Mount North Carohna Lyn Prxvate Q M Co Baseball Squad HARRYMAN GAYLORD B C4D Greensprmg and Robers Ave Mt Wash Baltlmore Md Gamer Semor Platoon Sergeant Co A Presrdent Jumor Literary Socrety Swxmmmg Team HEAP ALLEN W CID 140 Ingraham St Washmgton D C Prrvate Co C HFNDON J R CID Taylorsvllle Road Loulsvllle Kentucky Doc Private C D C1ceron1an Lxterary Soclety HFYSER RICHARD H C2D Majestxc Kentucky Dlck Private Co D 1109 Wertland St Charlottesvllle Vxrgmxa H111 Btlly Private Co A HILL JOHN H CID HIX PRESTON C C3D 603 Redgate Ave Norfolk Vrrglma Peter Sergeant Co B Track Squad HOGGARD R N CID Lewlston North Carolma Hogeye Prlvate Co B HOGSHEAD R C CID Mt Sldney Vlfglnla Happy CDay StudentD HOLDERNESS HAYWOOD D C4D Tarboro North Carolma Turk CCand1date for Graduat1onD Pr1xateCo B Peep Athlet1cs Pruate Co B Peep Athletlcs Corporal Co B , Wrestlmg Squad, Peep Athletxcs 4 Jumor Second Lieutenant Co A , Wrestlmg Team, Peep Athletrcs f r 5 e Q 4 3 4 G NNNAVAVAVAVAVAVIVAVAVAVAYAVAVAVAVAVAVAYAVAVAVAVAVAVAVAVIK'AVAYAVA IYIVR'is ,Q .,,,,,,,,, , ,,,, ,,,, ,,,,,,,,,,,,.,,,,,,,.,,.. ..... Q ..........................,,. C , , ' A at gf ...,,.,,,,.g'Agf,,2-39' D CW- ........,... ........................................................................... s 'M -' ?Z5,,,!51h,m!!Qfi -7' W 4 lf' Et Q Q , I . S 1 S 1 , , . U ly .... I ....... 4.5 ,... 13 ....... ., , : E 1 . p 5 .... 3 . i 1, ' Q , ............. K 1 ..... L.. . ., , - N E , A 1 C s 2 . , . ........... . .... ,J .................. ..... N E x'. LH -H N Q , + ' . ..................... . ' ' ' ., , ' ' ' E Al I ' .I 5 . N 2 1 - , .. 1. ................. ' ............... I , k E . H H D 5 . 'H .,, x 5 HARRIS, COLLAS up ............ ....... A ..... it ................... Staunton, Virginia 5, 5 ' - -: ' : ' : : ' . N f ., . ,.,....,.. S 4 ....... J .................... , - -- 1 5 , .......... L .... :Y ....... V ...... , ' M 2 . ' . 5 3 D ,rrt 1 .DD. ' .r..,,t.r I at., I I I I , Si ' Al 2 - .U In E - , . . ...........................,.. ' , ' ' , 5 A . ii . . S J D .,,.. , ..........,,,r..,t.,.. A ,.,t I I I g .A . y , . ................. il., .... I . H . ., ' , ' 4 I , . .. ................. A ............. ,, , - -- S , - . .............. it ....... 5, ............ , 5 I , . . ..............,.......,.,......,............. . - , - A- g U H y . 5 . ...J ..... I , ........ , ....... , S . ' q . , ' 5 5 :A -:z :ze 1 - S . I . D NV WWVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVAVAWxVAVAVAVAVAVAVAVAVAVAVAVAVAVAWQ .,,?'pnsr 1: 17, 5 l if , l' HOLSINGER RALPH W C35 1021 Wertland St University Virginia Hop CCand1date for Graduationl 1 Private Co D Bible Class Football Squad Swimming Team Wrestling Team Company Athletics Club 3 First Lieutenant Co C Assistant Captain Football Assistant Captain Wrestlmg Team Swimming Team Honor Committee RECAIL Staft Monogram Club Y M C A Cabinet Advertising Manager Bayonet Track Squad Bible Class Freasurer Student Body Treasurer Athlet1c Association HORNER BOYD E C22 225 Chestnut St Clarksburg West Virginia ack Corporal Co C Tennis Club Rifle Team HOTCHKISS HENRY S C33 Westhampton Richmond Virginia Hootch CCancl1date for Gracluationb 1 Private Co C 2 Private Co A Bayonet Staff RFCALL Staff Wrestlmg Squad A M A Mmstrel 3 Platoon Sergeant and Drum Mayor Band Football Squad Wrestlmg Squad Cotil lion Club Bayonet Staff RECAII Staff A M A Minstrel Secretary and Treasurer Ciceroman Literary Society F1na1 Ball Committee HOUSTON G P C15 4834 Linden Ave Baltimore Maryland Private Co C HOUSTON I A C11 Pittsburgh Pennsylvania Ben Private Co D HUDDLESTON W B C35 137 Alleghany St Clifton Forge Virginia 1 Junior Platoon Sergeant Co A Baseball Team Treasurer Y M C A Bible Class Episcopal Club Rifle Team HUDSON RUDOLPH H C25 300 Woodland Ave Lynchburg Va Soapy Private Co. B ' Company Athletics' Wrestling Team' Captain Track Team,- Football Squad. HUMBERT CALVERT H. CU ..................................... Low Moor Virginia a . Private Co. A. HUMBERT FRANK D. Q43 ............. ......... F rys Spring Charlottesville Virginia 'Frank Captain Co. C g Football A g Captain Swimming Teamg Vice-President Student Bodyg ' Vice-President Athletic Associationg Vice-President Cotillion Clubg Final Ball Committee, Honor Committee, RECALL Staff, Bayonet Staffg Monogram Club. HUMBERT, WILLIAM S. f2l ......... 2217 Kemper Lane, Walnut Hills, Cincinnati, Ohio I UBi11H . Private Co. B. ' HUNDLEY, GEORGE W. C25 .......... 1 ..... 507 Holloway St., Durham, North Carolina UM H ' ,, , Corporal Co. 'Tilgg Tennis Club. HUNT, A. B. C31 ........ ............ . Q ............. Watts Ave., N. W., Roanoke, Virginia Junior Platoon Sergeant Co. B g Track Squaclg Bible Classg Episcopalian Clubg I Bayonet Staffg Ciceronian Literary Society. X HUNTER, ROBERT C31 ........................................... New Hope, Virginia , , HB bi! W 3 5 5 5 af 5 5 4 0 S CDay Studentj p . 2 if C3 S12 Q 4 is 5 E 7 5 - . G Ab1e 5 5 5 5 4 5 5 S U' ' W E r 5 ' S if ,............ . .... .... ............................,,............................,.., , , F xg t e a Q f s A s i t if Q ! - , . .................... ., ' - , ' '- 2 E i P f M . H v . ,i 4 . ,, ,, . , . . 2 Q f . 3 - s : : 1 s 4, 5 4 i 2. Corporal Co. C g Football A g Swimming Teamg Wrestling Teamg Monogram f Q 1 4 a 1 fi .. 2---I 5 , . . . . n , . . . 1 5 4 S 4 p f , . ................ . .... ., , ' ' ' E 4 f .. n l 1 2 rf f 3 .... ..,, ' ' - tl P 4 , . H .... H , , N 4 P 1 . . o 1 E s f . .. . l 7 5 ' Z 'g 5 . 3 ' 3 . . . ' . T E 4 1 . - , , ' , 2 . ,S . ' 1 '- ' Q 1 . . ............................ 2- . - 5 5' l , , G. P. U U i i , S 5 T , .,,, , .........,,,... .... .,... ..,,,,, ...... 2 , i 5 3 A .,....,,... ' ,.,.,. y t 1 i sf . H . -f , ' t 4 sf , n ..,...... .... .,..,. ., , , 55 as it M .ttt 2 5 E 5 ' C 1 ' 2 9 ? 4 4 51 2 Z1RfA'N1ifA'b'Av'1ifNRfAV AYAYAYAYAYAYA AvAvAvAYAvAv1yAv vAVAVAYA AVR'AVA'R'A'NRi ' , QVAWWVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAAVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAWVQ VAVAWVAVAWWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVNAVAWW'AVAWRVAVAWVAVAVAVAVNAWVAVAVAVAVAVAVAVAV Mg, ml llmu 1 jqwq Jjl l Q1 , HUT'1 ER MALCOLM C15 H 1517 Jackson St Lynchburg Vrrgmxa utter Prlvate Co B Mlnnow Athletics IRVINE NELSON lx C35 P 591 Park St Charlottcsvxlle Vxrgxma eany Corporal Co B Peep Basketball Team Track Squad JACOB J LAIRD CZ5 k Staunton Vrrglma a c Corporal Co B Football A Basketball A Baseball Team Bxble Class JFNNINGS J B C35 Fort H111 Lynchburg Vlrglnxa ev Corporal Co B Track Team JOHN IRVINE C15 J h 3104 Hxghpomt Avenue Umon Clty N J 0 nme Puvate Co C M1nnowAthlet1cs JONFS CLARENCE C C15 F Savannah Geolgla atty Prlvate Co D JORDAN WILLIAM R C15 H Radford Vlrglma oggue Prlvate Co A Clceroman Llterary Soclety KEBLINGER DABNEY L C25 K Dunlelth MlSS1SSl15jJ1 em Sergeant Co A R1Hc Team Track Team Eptscopal Club KELLAM LUCIUSJ C15 Belle Haven Vlfglllla. 1m Prnate Co C KINLEY EARNSHAW C15 Brlstol Pcnnsylvama 15 Prxvate Band Elnscopal Club Football Squad KIRN HENRY JR C35 K1 k Vlfglnla Beach Vlfglnla an Pnvate Co A M1nnowAthlet1cs Bzble Class KISER JOHN F C15 JS? W Umverslty Parkway Baltlmore Malyland o nny Prxvate Co C Swxmmmg Squad 'lrack 'leam Fpxscopal Club RISER ROLAND M C15 O Brldgewatcr Vn-gmxa cey Pr1vateCo A Company Basketball KLALS J M C15 Q 815 Spotswood Road lXlCl'll110l1Cl Vlrglma anta Prxvate Co B RUHNS WILLIAM P C15 Greensburg Pennsylvama 1 Private C 0 D LALLEY BRODERICK C15 168 Beechwood Ave BI'lClg'CIl01'12 C011TlCCtlCL1t I Bur Prlvate Co A Football Squad LANCHORNE C D C25 Warren Vllglnla, Chllly Pr1xateCo B LATHICOP C B C15 Byrd Park Rrchmond Vlrglma Barky Prlvate Co B Mlnnow Athletlcs LAW JOHN L C15 P O Box 659 Lakeland Florxda Johnny Prlvate Co C , Football Squad, Swlmmmg Team, Mmstrel Club 4 Q Qs, QQ ' Z , 1 WAYS'MNA'AYMIRYAVIRVAVAYAVAVAVAYAVAVAYAYAVAVAVIVAVAVAVAVAVIFAVAVAVAVIYAVNtb 1 4 T A ,,,,.,,,,, , ,,,,,,,,,.,,,,.....,.. ....... ....... Q ........,....... ...... ......., , af, ' 5: ---asQ 1 g J 3 5 ' , - .............. . ........... ., , ' '- C i 1 ll , ' f - . . .. 1' N 2 , . ........... ...... 5, ..... ., , 5 1 , . C f J , ,. ............,..... .....,......J..,.,...... 5 , -- N gg C - 9 1 Q 6 9 ' .. U C Q N 1 f 1 4 , . . ................... hj..l.N .....,...... . , , N E C g . A 7 f ................... it ...... ' ' , ' - ,' , , S E f -- - - . rl Q 1 - , . ............ if ..... ,S ........,.............. , - ' A E 1 - ll' 2 r 1 J . .......................................... A - -- 1 2 , H , U , C 5 J , , ...,... .............,........ -, --- - 1, 3 , ,,5 . , z Q . g n H 5 S I 1, V . .............. hj.,.,3 .......... . .......... . , E , ..... - .......... ' ........................ ' , , ' Q . . RIB V , 1 1 1 .. . .. S , , . u ....... .... it ...... ,E .... ....... , J g - 1 . l. - . . 1 xg , , Q. 4..:.., ...... u .... . ...'.4. 51 Q I , , E ' . ' 'g . 3 3 - I . 1 i u E ' , , . ................... ' .... ................... , 5 . H 5 g . L 4 '., . . ...................... I: ..... 5. .. V, ' , 2 my , 1 ,...,....r..,... , ...,..r.....t,,l..,. , 1 5: I , 1 I. .l ........ S. - u ., ' , ' 5 Y 1 1 , . . ..... ........ I '.......,? ....................... . ' , I' 1 I - ' . . . . G ' ., ,. . .................................... f . , , P H -if Q ' S . ,,: ' G V , . .................,. A ....... . , , S - .u xv. 4 . ' ' . h' I - . , Ie ' ff' Q 5 U 1 1 W g E w gg PA . . ' , , NVAWWVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAQ ygqqigsxmlllllii mil!! i -zwxinl I 51 oe Private Co D LECKRONE HORACE W C35 P Dover York County Pennsylvania erry CDay Student5 CCand1date for Gracluat1on5 LESTER RAYMOND H C15 1400 Third Ave Columbus Georgia Ray Private Co A LEWIS PAUL H C15 Newtonton West Virginia Paul Private Co C LIVICK PAUL C35 Route 4 Box 72 Staunton Virginia Pau CDay Student5 LOHMEYER WILLIAM C C15 Baltimore Maryland Car Private Co B Basketball Squad Track Team Episcopal Cl1.b LOYD SIDNEY B C15 400 Harrison St Lynchburg Virginia Harold Private Co C LUNSFORD C W C25 Monterey Virginia B oots Corporal Co A LYKES J' M C25 12 Remington Lane Houston Texas Bu CCandidate for Gracluat1on5 1 Private Band 2 Private Co B Episcopal Club LYNCH HOWARD C15 1412 Massachusetts Ave N W Washington D C Buddie Private Co D Basketball A Boxing Team LYON BURR C15 Clarksburg West Virginia Burr Private Co A MACKAY R J. C. C15 ............ ........ 1 4 Summit St. East Orange New Jersey Bud , Private Co. B ' Boxing Team. - NIALONE B. W. C25 ......... ......................... 3 29 Jackson St. Albany Alabama Mints Private Co. C g Company Athleticsg Bible Class. MANNAKEE, G. O. C45 ...........,........... 1336 Lebadom St., Bluefield, West Virginia V HBogieH Private Co. D g Minnow Football. MANNAKEE, NATHAN H. C45 ............... 1336 Lebadom St., Bluefield, West Virginia I M:-mick ' Private Co. A g Minnow Athletics. ' MAPP, T. J. C25 ...................................................... Bayford, Virginia' Private Co. D, :E 2 :- E 5 E 5 u n E 5 Mop A E S MARKS, RICHARD D. C45 ............. l:g27kVVashington Ave., Clarksburg, West Virginia Q Q Sergeant Nitajor staff. S Z I 5 5 3 5 4 . . 'e Q Qs 22 QQ 5 5 mildlyIVIVAVAYAVAYAVIVAVAVAVAYAVAVAVAYAvAYAYAYAVNAYAVAYAVAYNAYAYAYAVgyggvgifKi 5 Y . . , . L 5 ,............ . .........................................,....,..........,.,.,,,,,,., ,W P Q saa. .tl 7 X1 1 gm--lg. ..,..- 5 A555551 C. ' -..,......,.... .....................................................................,... K A ' -' e1,mYE:,n .71 . if A Q Q, fb P C ' ' ' . S 5 i LEA, JOSEPH P. C15 ...... ............ l :...,.' ...... ............ M assie's Mill, Virginia NC a r. lt, - J s 2 4 , 7 Q 3 , . ........ A ..... L ........ , , Cr E Q f - - 1 li 2 Q g Member of Y. M. C. A.g Ciceronian Literary Society. . 'N E Q f , . ..... ' ..... L .... 5, ....... ., ' , C Q D ' U U ' Q 4 r - - . .. I I :C . .........,,.,........................... 2 P f . . . . 5 5 f , .................... .I .... ig ....... , , , W E s f , l Q 5 4 , . ....... it .... ll, ...................... , 2 S tl ' - s : 1 ' ' - N 2 b I ' , . ............... 1' ....... .I .... ' ., Q E , ' ' ' M s 1 . 1 I I 1, 2 3 , . . ................ In ..... 5, ....................... . , - -' I g, Z .. ,, e Q . . ...................,.......... ' .... 1 - , 2 s ' 1. ' 2 4 I I 2 4 . . 5 . ' 7 :Z , ...... . ........ H ., . ., , . . 5 5 , ...................... I I .... J, ................ , E 4 - - Q F2 . . . ,. H , 1 , , 2 4 I I 1 1 f f 5 4 4 3: Z 3 9 e VAVBZHVAVAVGZ-VAVAVAVAVAVAVAVAVAVAWVAVAVAVAVAVAVAWW'AVAWVAVAWVAVAVAVAVNAVAVAVAVAVAVAVAVAVAV P Q1 5 xv nllllll K llugy t vim ll I N il' 4.1 MARROW CHARLES K CU T Tarboro North Carolina om Minstrel Bible Class Monogram Club Boxing Squad VIASSEY E D C11 D f Fort Benning Georgia oo Pr1vateCo C Y M C A MATTHEWS FRED W C15 dd 2330 Octavia St New Orleans Louisiana re Private Co D plscopal Club NIATHEWS J H C35 Cass WestV1rg1n1a Hugh First Sergeant Band Cadet Orchestra MATHEWS JOHN R JR C31 200 Ziijld St Jackson Heights Long Island New York att Private cg B MATHEWS J S JR C23 Cass West Virginia a Pr1vateCo C Peep Athletics MAYER WILLIAM C CD 611 Walnut Ave Waynesboro Virginia Bill Peggy CCand1date for Graduationj Private Co A Baseball Squad Football Squad Bible Class Company Athletics Y M C A Corporal Co D Baseball Squad Football Squad Bible Class Company Athletics Y M First Lieutenant Co D President of Episcopal Club Assistant Cheer Leader As slstant Social Editor RECALL Staff Manager of Baseball Final Ball Committee Company Athletics Twm 9 Club C1ceromanL1terary Society Bible Class MELTON JOSEPH C C11 3615 Macomb St Washington D C e ' Private Co. A ' Bible Class' Y. M. C. A.' 'lrack Squad. MERRICK FRANK H. C23 .......... 602 East Washington St. Greenville South Carolina B. in o .Private Co. A - Manager Boxing Teagn' Track, Squad' Company Athletics. . MESSMORE JOHN H. C15 ...... ..................................... U niontown Pa. Johnnie .Private Co. B. MEYERS LEWIS A. CU ...................... ................ N ewport News Virginia Shadrack -- 'Bandy ' Private Band: Minnow Athletics. MILLER, H. C. C17 ....................... 2t'aLongmeadow St., Springfield, Massachusetts f HBu H Private Co. D , Junior Literary Society, Episcopal Club. MILLER, GEORGE F. CU ............. hijxic., ................ Huntington, West Virginia 1C Private Co. A, MILLNER, ROBERT E. CID ............. ........................ Strasburg, Virginia X H 0 H ai 2 E E Private Co. B. 3 MONTAGUE, RANDOLPH CU ....... AMAMVY ..... Forest Hills, Long Island, New York S Private Coli D. 5 5 5' S S 5 S MOORE, CLARENCE R. Clj ........... El ....... Route No. 5, Box 51, Staunton, Virginia H ary!! I . CDay Studentb E ' MOORE, THOMAS E. CU ............. ...................... Gastonia, North Carolina E ll 0 ll ro py I Private Co. A, , Q I Q ing. NNNIVAVNAVIVAVINAVAVAVAYAVAVAYAYAYAYAYAYAYAYAYAVAVAVAVAJAVAVAVAv,ny KS EVAWYAVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAWVAWeVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAQ ,W ,....,..,..,, , .,,. .,,, ,....,.......................................... ...,,,.,, ,,., , n . ' Q , J-l l. 2 Y ' 1Qm.g.,...,..-Plym-3 V C- ' --.. .................................................................................... s 'U ' eL,MQ1.n!Em5:in,F, E l' il ft Q ' s ' E x P l y f , . ..............,. F ........., . ....... , 1 N g C' ill Private CO. A , Football f'Al'3 Baseball Teamg Basketball Squad, Y. M. C. A., if g f 1 , . . ...... i ............ I ...t ..... 5, ........ i ............ I ' , ' N i 5 I ..,. r .. r Q , . .......... JF ...... ,I ., , S E t J . D H ,,: Ey . ' N E r I , . . ................. it ..... V.. .................., , - 2 r, - . l 7 i ' ' .. is: U i ' ' N C ' . H -ll xl E f f , . ., . ,..................................... I .... , - -- l' 2 f . uv . i 5 a - ' . ' . . . N E h I I I. l - H 'Hi ii H-H H l I l N 'Q b I J E ' I 2: i 1 - : : . :- ' : ' 1 34 ' . .c. A. 4 3. - ' - ' - ' , - 5 . . . 1 I u .v . i 4 . Q . ,, ,, 5 . .- '. . 1 .1 i ' E l , . ........................., ., - , . . Q r H H HJ H Q 2 , ' ' ' . . 2 I I - P 2 ' Y H H . ,is u , E 2 2 2 7 AVAVAVAVNAVAVAVAWVAVAVAVAVAVAVAVNAVAVAVAVAVIYAVNAVAVAW'KVAVAVAVAWVAVAVAVAVNAVAVAVAVAVAVAVAVAVAVAVF MOORECOCK HOWARD M C21 H 8 West Franklm St Rlchmond Vlrglnld oge e Prlvate Co D Football Sguad Company Athletlcs MOR1' HOUSE J ELWELL C41 11 North Drxve Great Neck Long Island New Yorl e Second Lleutenant Lo C MORROW JOHN C C11 3044 Klngsbrxdge Ave New York Clty Morrle Prxvate Co B 'VIULLIS WILLIAM C11 1427 South Queen St Martmsburg West Vlrgmla oon Prlvate Co C MUNDIN LEWIS H C31 D CI 3421 Grove Ave Rlchmond Vlrgzma e a FIYSI Lxcutenant Co B Football A Wrestlmg Squad RFCAII Staff Busmess Manager Cadet Orchestra Assistant Postmaster 'VIYILRS HARRY L C31 Mount Sldney Vlrgmla Harry CDay Student1 CCaud1date for Graduat1on1 MCALLISTER J W C11 l2IIIICascacle Ave Winston Salem North Carolma ac Prwate Band Company Basketball Football A Track Team MCCORMICK CHARLES W C21 III Aldxe Vlrgmta o n Prwate Co D MCCORMICK I C11 Mlddleburg Vlrglma Mack Prxvate Co A MCCOY ALEXIS C11 L 789 N W 35th St Mlaml Fl0I'lCla ex Pr1vateC0 B Epxscopal Club MCCUE JOHN C C41 Fort Defiance Vxrglma CDay Student1 CCand1date for Craduat1on1 Baseball Squad MCCUTCHAN JOHN N C21 Chfton Forge Vxrgmxa Mac Corporal Co D MCGIFFERT A C C11 2324 East Sth St Duluth Mmnesota And Pr1vateCo D HDISCODRI Club MCGREGOR G C C41 Haskell Texas Cactus CCand1date for Graduat1on1 Prlvate Co C Blble Class Sergeant Staff Second Lleutenant Staff Captam Adjutant Staff Ad Astra Per Aspera Fratermty MLIVER JAMES R C21 lll Hawkins Ave Sanford North Carolma Mac CCand1date for Graduat1on1 1 Prxvate Band Cadet Orchestra Company Athlet1cs 2 Sergeant Band Cadet Orchestra Y M C A Cabmet B1ble Class Company Athletlcs MCKENNEY, WILLIAM H C31 BII ISISII Callfornla St N W Washlngton D C ll I U U acl, Sergeant Co C , RECALL Staff, Mmstrel Show, Blble Class, Track Squad, Epnscopal Club VAWVAVAVAVAVAVAFAVAWVAVAVAVAVAVAVAVASAVA'bsVAVAVAVAVAVAVAVAVAVAvAvAVlVAVAVQ 'IU E, Imnllllll C my I WNIQVIR I x 51 wJ,pl G it s fe 31 E r r ' . 1 I N A A ,.. ....,.,.., . ,.,,.,............... .. .... 1 .........,. Q ..........................,,.,, . e t Qw,,,!,uII,,,Img9, e, ............................................... . ........................................ b .,,,!IQm!mm!Ix It Z f' I I avi' 2 T . I S I 3 1 ' , - . .... ....... II. ' ., ' , - ,QI I f 11. C 5 . ft 2 I f . 'I , . ..... II II ' , , , Q y I , I 1 d I II f , I , . ,........a,,,y ,.,.. 1 I . I , f f - I. ,. 5 I , . I I I-I I f I , ............. TI: IIII II ., , N E fy , - . ............,....... ' .... ' .. ., - , - -- I 3: fl . . u n . as Il: . H - I .. ' ' 5 , 2 I . , , I I , , , IC E , . - , . ............... I ...,.. I, ..,........,...... - , - -- t- 2 r I P . . N 4 I , . . .............. II II ., 'I , E I . , 4 ssro.. ..1,, ,r...ry,,..,., I r..,..r,,.... 51 . , . ..... ............. I I ...,. ..........,.......... - , - -' 2 , ..,,......,,.....,...... :...1 .... . . ., - I is 2 , . ............... I ..... ' ............,..,....., , - -- 2 UCyH' .I ' 2 , . ........... II .... II ............ I ....... , 4 1 ' , , . ................ II ..... II ...... , ., , ' I 5 . I,, ,,I . I . 5 , . . .....,...., 2 ...,.................,,.......,......., , . 5 H 1' 4 1. ' H, ' . 2 2. I . y 3. . r 4 4. ' , ' : A I ' - I 3 I ' , . ................ II .... II ., , S . . G I .I 5 9 .... 5 e 9 5. f-3 22 5 S M mfldli'NRCAVAYACAYAVIWAVAVAVAVAVAVAVAVAVAVAYAVAVAVAVAVAVAVAVIWAVAVAVA IYIVA Q 5 ' . 4 WAV-'AVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAAVAW.VAVAVAVAVAVAVAVAVAVAVAVAVAVAVAQ wfirll 1: 11, ' A n A ' 4.1 4 NEFF MCCLINTIC C23 K k Staunton Vlfglnla in s Private Band Football Squad Cadet Orchestra NEIKIRK J D C25 33 Liggett St Lynchburg Virginia oe Private Co B Secretary and 'l reasurer Junior Literary Society Nick Pr1vateCo C Fpxscopal Club NICHOLS S E C35 1828 Monument Ave Richmond Virginia Nick Fcneral Private Co D NIESSEN B E fly H Philadelphia Pennsylvania oot Private Co B Semor Literary Society Peep Baseball Squad Tennis Team NUCKOLS HOWARD S CD N k Richmond Virginia uc Private Co B Episcopal Club OFFUTT JAMES C13 Greensburg Pennsylvania im Private Co C ONEILL J L C25 Crozet Virginia Peggy Private Co B PALMATORY JOHN THOMAS CSD T 2812 Monument Ave Richmond Virginia ommy Semor Platoon Sergeant Bugler and Assistant Postmaster Bible Class PALMER A J C11 P Roanoke Virginia ercy Private Co A Boxing Squad PALMER CHARLES L C17 1234 Maple Ave Roanoke Virginia Private Co. B Rifle Team. PALMER JACK W. CU ......... ...... .:. ................ ..... . Washington D. C. im - Private Co. C. ' PANCAKE JOHN I. C25 .. ........................ ........... R omney West Virginia klapjack ' Sergeant Co. D. PARKER W. E. C23 .......,.......................... ..201 Bosley St. Suffolk Virginia Catch-a-Little-Shut-Eye Private Band, Cadet Orchestra, Bible Classg Y. M. C. A. PATTERSON, J. B. C13 ................................... . ........... Staunton, Virginia , u a n V Private Co. A 3 Football Squadg Basketball Squadg Baseball Squad. PAYNE, CHARLES C21 ................... 66 South Kanawha St., Beckley, West Virginia X , Charlie Corporal Co. Ang Football Squadg Boxing Team, Track Squad. V L PERRY, A. G. C15 ........................ JAY., ......................... Tazewell, Virginia ' Private Co. B g Baseball Squad. A .Tazewell, Virginia V PERRY, G. up .......................... in ........................... U ertii 4 E E 3 1 5 P 4 5 5 1 5 P 1 5 E 5 ' Private Co. C. ' P 5 PENNOCK, CHARLES F. CU ........ K.tC.H . .ITG ............. Jackson Heights, New York E S Private HQ. M. Co.g Baseab1aiiaTeamg Football Squad. Q s Q G 9 2 5 3 S TF W l QSM A T22 Q K . . , 7 me ,............ . ....................... ............ . ..... ..... - ..... h .........,,., , , Q E A , ,. .... .-- l 1ls5g.7g'gggg!5ii3 ,. V Q 3 ef Q . H s ' 3 5 Q . , . ........,...... .'......,. ...........,........... , ig! g 4 lr it V . all . Q f , . . ..................... l :f..,: ........ A ., , , AY , .5 f - -T - T - . , f 5 C NEKERVIS, EDWARD T. C21 ......... IZ... . 529 Fithian Ave., Merchantville, New Jersey ,Y g gg , T - v J .,. i 3 4 , , . . .............. K:..'..:,L.'.g.. H ., , 5 4 f ' . . , J 5 4 f , . . ................... at ..... il ................ , ly 5 , K , . .......,.. I: ..... J ...................... - , - '- 5, 5 4 . T A . T . s 4 J , . B ..............' .... I I....,: ................. , ' l 5 s T T I s 5 f 1 , . . ...... ..........,.. , , ,,.... .............,,.......,.. , - -- 5 9' , , E .......... ' ., - , - -- P s 1- H s 4 - ,, , - , - , 5 T , A .............,......... s ,........,......,...,....... , - -- 5 5 J , . ...,....... ..... ., , - -- g 1 , , , 7 Q J H ' s Q 5 3 ' ' 11 ,, 9 5 9 , 2 32 2 5 Pt 2 1 ZINAHR'AVNAMEAVIRVAVINAVAYAVAYAVAVAVAVAVAYAYAYAYINAYAVAYAVAYAIAVAVAVAv,yfygKi WAVAWWVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVKVAWVAVAVA AVAVAVAVAVAVAVAVAVAVAVAVQ - A Av 2 . . , C . AWVAVAVAVAVNAVAVAVAVAVAVAVRIAVAVAV A ? -- ' : ' G ' . I . iqallllif . 1 -. ' j : ' ,- : - Z . nj- . ' . - UU. ,, . I . tj I 5 2 ' ' fi s sf . 52 -- -I 1- 'f . sf ' - . -5 -f ' I f 3 2 E ' D ' . l . I .' - ' . ' 4 gnu, . . . .... Q , , l ' l I ' , ,,,, , A ...nk ' 5 afllfdfari-rA?f14?:'l ' ' ' VAVAYAVAVAYAVRVA'IVIVIVAVAVAVAVAVAYAYAVAVAVAVIYAX'AYAVAYAVIFRVAVAVIFIYIFAVRCAVIWAVAVIVAVNAVR' H ,m x s,1m' lll mu Q p,N'N 'l JK C L QA, F 1 rv PHILLIPS RICHARD T C31 T Lexington North Carolina om Sergeant Co B Football Squad Wrestlmg Team POINTS FRANK M C31 P Staunton Vlrgmla mts Corporal Co A Ieep Athletxcs Eplscopal Club POLE HARRY D C21 Hot Sprxngs Vxrglma Harry CCand1date for Cracluat1on1 l Prxvate Co B 2 Corporal Co C PONZANELLI ADOLPH C11 Mexxco Clty Mexxco Ponzy Prnate Lo A PRABANDHAYODHIN BUN MAR C21 B 28:4 Connecticut Ave Washmgton D C un Corporal Co A Peep Athletxcs PRAT'1 WILLIAM H C11 Staunton Vlrgmla AVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVNAVAVAW'NAXAVAV 1 I rlvate Co D PRITCHETT CHARLES C11 Lakeland Flonda Charlxe Prlvate Co A PRYOR EDWARD M JR C41 1311004 East Jefferson St Charlottesvllle Vxrgmra 1 Second Lieutenant Co A Wreilmg Team Honor Commlttce PRYOR J LOUIS C21 1004 East Jefferson St Charlottesvxlle Vxrgmxa Lxttle goat Prlvate Co B Manager Wrestlmg Peep Athletxcs QUILLIN BENJAMIN P C11 B 102 North DIVISION St Sallsbury Maryland e n Pruvate Co B RAILEY M C11 M 315 l0th St N E Charlottesvllle Vxrgmla ent Prlvate Co C Peep Athletics RAMSAY ERSKINE C C31 E Boxl Unlted Pennsylvania r Semor Platoon Sergeant Co B Football A Mmstrel Show RAMSEY I W C11 Greenville Vrrgzma Janne Prlvate Q M Co Baseball 'lcam RANDOLPH W P C21 lx 22 South Madlson St Staunton Vlfglnla annxc Sergeant Q M Co Football Squad Basketball Squad Mmstrel Show REGAN MURRAY C11 M k Ellzahethtown North Carolma 1 1 Pr1vateCo C REISI' HARRY A C21 H York Pennsylvanxa all Sergeant Co B Basketball A Track Team Bxble Class ROBERSON E Y C21 1802 Ocean Ave Vlfglnla Beach Vrrgmla Prxvate Co C Eprscopal Club ROBERTSON C E C21 R Cambndge Maryland ob Prlvate Co A Baseball Squad Y Mx C A Bxble Class Eplscopal Club ROBINSON WILLIAM A C31 6600 Northumberland St Pittsburgh Pcnnsylxama UBIHH Sergeant Co A , Boxing Squad. 4 W W Q tv S 4 5 zhflili'AVIYA'IVAVIRCAVIRVAVAVAVAYAVAVAVAVAVAVAYAVAVAVAVAVAVAVAYAT'AVAYAVAVKflflfKg AVAVAV WVAWWVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAWVAWxVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAQ AVAVAVAVAVAVAVAWWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVkVAVAWW'WAWWVAWVAVAVAVAVNAWVAVAVAVAVAVAVAVAV f Q0 5 Xmnllllll M llugy tg Xqnq l l Nl! JJ ROBINSON JAMES S C25 I h Zo Waldron Ave Summlt New Jersey rxs Private Band Baseball Squad Boxnng Squad C,h1efA M A Ftre Department ROGERS FRANK flj Kmgston Pxke Knoxville Tennessee ID Prlvate Co A Football A Swrmmmg Squad ROLLER CHARLES S 3rd C41 Fort Defiance Vlfglnla Charley Corporal Co C Sw1mmmg Team Basketball Squad Peep Athletzcs ROPER BARTLETT C25 B 43 South Market St Petersburg Vlrglrna art Corporal Co D Blble Class Y M C A Mmstrel Show Episcopal Club RUNNELS CLARENCE CU N 410 St Clalr St Staunton Vlfglnla 113 Prlvate Q M Co Football A Basketball Squad Monogram Club Sandy Prlvate Co D SAUNDERS ROBERT G C25 Afton Vlfglhla Gunga D1n Prnvate Co A Y M C A Cabmet Cotllhon Club Football Squad Baseball Squad SCI-IONEN BERG ROD B CID Fl Salvador Repubhca del Salvador R Estado del Salvador Centro America o Prxvate Co A SEASHORE MALCOLM D C25 S I 1902 East 'lhxrd St Duluth 'Vlmncsota ea 1orse Przvate Band Mmstrel Show RFCAI1. Staff Bayonet Staff SH1:.RVET'1E ROBERT E ill B k Enfield North Larolma uc Prlvate Co A SI-llPNlAN FRANCIS H C15 Sh Shamokm Pennsylvama ITP Prlvate Band 'Minstrel Show SHRECKHISF RAYMOND CZJ Sh k Mt Sldney Vlfglhla. rec Corporal Q M Co Baseball Squad SHREVE C W C31 B 117 North Jefferson St Staunton V1rg1n1a 1 Sergeant Q M Co Cadet Orchestra RICAII Staff Mmstrel Show SLA'1Flx IOHN G CU New Bern North Carolina Horses Pruate Band Basketball Squad Sl' ENIP C B 5th C31 B k Versallles Kentucky ac Prlvate Co D Mmnow Athlctlcs SLEMP C B 3rd C31 k Marlon Vlrgxma ac CCand1date for Graduanonj 1 l-'rxvate Co B Baseball Squad Peep Football Company Athletxcs Clceronzan Ltterary Society 2 Corporal Co D Company Athletlcs Mmstrel Show Secretary Y M C A Crceroman Lxterary Soclety 3 Flrst Sergeant Co A Pres1dentY 'VI C A Cot1ll1on Club Asslstant Leader lamal Ball Fmal Ball Commxttee Manager Football Edltor ln Chxef Baxonel Assoclatc Edxtor RECALL Assxstant Cheer Leader Secretary and Treasurer Bxble Class Cxceroman L1terarySoc1ety Mmstrel Show Twm 9 Club Company Athletics FmalDebat1ng lcam Q, Surg' barn'NNAVNAfNAVNAVAYAVAYAYAYAYAYAv'AvAYAVAvAvAvAvAvAvAYNAVAVAVNfyggvggi 2 E Tl W S 5 5 Q ll I A ............. .............................. I so Q I Q ,F ............. . ..................... I ,ap I 7 1 l aa f im!,,,,,,m,+fmf2gTf N cl -............................................. ... .................................. .,..,..-S' ' 1,7m2Y?:l,m!!!g!:Q,gf' ll I1 xl Jil, 5 . 1 , Y a n u 3 5 1 Q , . .......,,... .... ., , N i ll llx ' 1 : ' - : - - . ' . lil S Q q f , .................. IZ.: ....... ' ' , ' , lf E I . In H: T It H: '. . 1 X 2 1 r , . ...,... J ....... ..............,... , - -- , E K 'H H. ' ' . . ' I N 7 N f ' ' ' . . . f f , .............. 2' ..... yi. . .,. , 5 . 5 ' .Q . . . .g ' 3 . N 4 f - , . ..................,..... . - ., , - M z, lf ' U 79 . ll lil.. H - 1 h Q C SANDERSON, J. vv. dp .ff .......... .............. ' ......... w ashington, D. C. E y , . ...... A ......... 33, ........................ , 5 9 1 - 5 - 1- - - : : 5 L E 1 R tpptruaoey,ppptr,n 4 1 1 2 nt ', U H ' l ' - s' , , den H - . 3, , . . ............. ' .... ' 1 -- ., 2 - X , . K ........ it ..... ................... , f E . . I., ',, 2 or ,' . . ......... 1 ................ . ', ' Q ., 1 ................................... . - , ' E - , . ................ .... ff ' . - ' - 2 Q i , . . .Q ' 3 5 .. 5 . 1 i 4 1 - ,, . ................ if .,.... 5, ............... , - E 'f Q . E . .1 , 1 . ............................................... ' , E , . . .................. :CII .... I: ......................... , 'T Q . . ' 'I - 5 5 5 ' 2 ' ' Q 4 . l . 3 V ' Q ' Q . A . . .g WAVWAVAVAVAVAVAWAVAWAVAVAVAVAVAVAVAVAVAVAWVAVAVAVAVAVAVAVAVAVAVAVAVAVAVAVQ AVAVAWVAVNAVAVAVAVAVNAVAVARVAVNAVNAVAVAW'NAWVAVAWVAVAVAVAVNAVAVAVAVAVAVAVAYAVAV 1 Q1 Cv SLEMP SMITH SMITH SNEED Society Y Elms, mullll K llnngr c F5001 S C D Private Co A EUGENE H up 1HoMAs L up ALLAN L 429 Prlvate Co 1 rlvate Co Ollnger Vlrgmla Shorty Jumor Llterary Society 2050 Kanawha Ave Charleston West Vxrgmxa Hxene B Boxing Squad 66 Prospect Ave Summnt New Jersey Smxtty C, Football Squad 402 Park St Charlottesvxlle Vxrglrua 1 I rxvate Co B Football Squad Wrestlmg Squad Twm 9 Club SOUDER ROCER K C13 1105 Augusta St Staunton Vxrgmna Ken Prxvate Co D Eplscopal Club STONE J S CID Wllmmgton North Carolina OC Prlvate Lo A Football A Wrestlmg Team STONE RICHARD F C35 Charleston West Vrrgmxa Fllnt Rock Prlvate Co C STREET BYRON E C11 3310 20th St N E Washington D C Byron Prlvatc Co B Track Squad Peep Athlettcs STRICKLEN ROWLAND L C15 Staunton Virginia Struck Pr1vateCo C TANNEHILL EDWARD L C23 Staunton Vlrgmla Ned Corporal Co D Mmstrel Show 'IATE WILLIAM D C11 3019 McLemon St Norfolk V1rgm1a Tater Prlvate Co D TAYLOR J S C35 508 West Ma1n St Staunton Vxrgmxa Shag CCand1date for GFRCIURIIOUD 1 Prxvate Co B Football Squad Basketball A Monogram Club 2 Prlvate Lo L Football Squad Assxstant Captam Basketball Monogram Club Vlmstrel Show 3 Second Lleutenant Q M Co Football A Asslstant Captam Basketball Mono gram Club Cotrllxon Club Y M C A 'lrack Squad lwm 9 Club THOMAS CHARLES O C25 Hot Sprmgs Vlfglllla. Charlle CCand1date for GFHCIURIIOHJ l Private Co C Jumor Lnterary Soclety Wmner of French Medal Z Corporal Co D Bxblc Class 'IHOMAS DOLGLAS G C45 618 Kmg St Martmsburg West V1rg1n1a '1 ommy CCand1date for Craduatlonj 1 Prxvate Co B Peep Athletxcs 2 Prnate Co C Basketball Squad '1enn1s Club Btble Class Lxceroman Llterary 3 Sergeant Co A Basketball Squad Tenms Club Company Athletxcs 4 Second Lleutenant Co B Basketball Squad Captaln Tenms Team Cxceroman Lrterary Soclety Company Athletucs 'IIGNOR L L Q11 Urbanna V1rg1n1a Tlg Prrvate Co A , Baseball Squad, Eplscopal Club AVAVAVAVAVAV L D , 2 S s WE' W 2 as X Q S I .,,,,,,,,, ., ,.,,.,,,,.,,. ..,,.,.................. Q .,.p.... - .err... t,ee... ...teer , , ' 2 F ll ,ll 'fw!sesv--1-61211595 ...N CIW- ..,......... ....................................................................... . ...ssh il:,.!E11.,y:s!'?:i'5: F 3 s I S ll 5 y , , .141 ..................... L ....... ,Q ................. ..... ' , ' ,ar f flip I - -- -. fl s p, , -Q. ............. U ., , t 5 z Q , -- - . t 2 f ,F . ............. :A .... ' ...,:... ., ', - N h I f , . ..............,.. 6 ...... ,, , N Q f J ' U 77. F ' 1 ' H 77 7 ' ' ..... ' ...... ' ' ' ' - N 7 , . ......... .H .... 3, . ., , L 5 f - I . at 5 f ' , . . ......,..................................... ' ' , ' 5, 4 r . . L. 1 1. . . ,y 2 I , - v f I . ,, L, , K , . .......... tw... ....... 3, ............. . , Q , -. ..,,,...,..,, .,,.,. ,, . ., I , , .C 5 A . ' ' ' ' . . . J' I , . ...... 51...-...yi ................... , S , t ....,.. .... A ...........,.....,...... , - - - 5 I - , . - .......................... ., , - -- 5 ' H nu U S I , . . ..................... .... i I ..... ., , S - 1 . I U H H H . I 7 . I ' . .g X gn . H U 3 - , 9 : ---- 5 : . 2 I , . ..................................... ' , ' ' 2 . H U N . ' V Q ' H yv. ' . ' ' ' - 5 . . , . . 4 - , 1 . ..,,.............. - ., - , - -- Q . ' P I I Q H H .. , . 5 - . 5 ,, ,, 2 ' 4 . . - . . 4 , - . . , 9 3 : Q R 3 ' 7 - , . . .........,..,....,.., ......,.,.......,....... . , U- 4 aiflfli'IYIXVAVAVAVIVAVRVAVAYAVAVAVAVAVAVAVAVAYAVAVAYAVAVAVAVAVQAVAYAVA IYAYY'Ki VAVAVAVAVAVAVAVKV-VQSIAUAVAVAVAVAVAVAVAVAVAVAVAVAYNAVAWVA'AVAVAVAVAWAVAVAVAVAVNAVAVAVAVAVAVAVAVAVAV JV qw x 'sr m u n C nam -153111 l Mil - J no TIMBERLAKE STEPHEN D C15 North Coaltu St Staunton Virginia TOLAR GARRETT C25 1 225 Anderson St Fayetteville North Carolina erapm Private Co D Episcopal Club TRENT JACK C35 k 310 Washington St Lynchburg Virginia ac CCand1date for Graduat1on5 1 Private Co C Baseball Squad 2 Sergeant Co C Baseball Squad 3 Second Lieutenant Co D Honor Committee President Bible Class Vice Prcsi dent Y M C A Vice President Ciceroman Literary Society Baseball Squad Manager A M A Minstrel TREW JOS'EPH R C25 E 3415 Woodley Road Washington D C verett CCand1date for Graduat1on5 1 Private Co A President Junior Literary Societ 2 Corporal Co D Honor Committee Wrestling quad TRIBIN GEORGE C15 Columbia South America Tribby Private Co D TRICE J C15 Tampa 1-'lO1lCl3. Grandma Private Band Episcopal Club TRINKLE E LEE C25 E L Wytheville Virginia ee Private Band TUTWILER THOMAS H C35 T 1488 Vinton Ave Memphis Tennessee u CCand1date for Graduat1on5 1. Private Co. C ' Bible Class' Ciceronian Literary Society' Y, M. C. A. 2. Private Co. C ' Bible Class' Y. M. C. A. 3. Sergeant Co. C ' Bible Class' Ciceronian Literary Society' RECALL Staff. VARRELMAN CHARLES C25 .... 138 2:31:11 lSt. Jackson Heights Long Island New York ' ar ie Private Co. C. VAUGHAN J. D. C15 ................... 4 ..... ..... .............. . . .Oak Park Illinois Duke - Johnnie , Private Co. B ' Ciceronian Literary Society' Track Squad. . VAUGHAN, JOHN L., JR. C25 .................. .. ................. Shawsville, Virginia ' . Johnny - Private Co. Dug Bible Class, Ciceronian Literary Society. WALKER, GEORGE P. C35 ..... ...... t .a. . .J ..... Eltingville, Staten Island, New York Pm ey Junior Platoon Sergeant Co. C : Football Squaclg Assistant Captain Boxing Team, RECALI. Staff, Cotillion Club: Final Ball Committeeg ,Minstrel Show, Twin 9 Club, Episcopal Club. WALL, ROBERT W. C25 ................ E130 West 5th Ave., Lexington, North Carolina H O l, Private Co. A , Peep Athletics. VV WARREN, JETHRO M. C15 ............. ................... Snow Hill, North Carolina ll ug!! S 3: 2 3 5 E 2 Private Co. A, Q ' WEBSTER, JOHN S., JR. C25 .................... 944 Temple Ave., Knoxville, Tennessee 7 S 5 S S 6 S 5 5 ' Daniel Private Co. A, WEST, CHARLES M., JR. C15 ....................................... Staunton, Virginia . Charley Private Co. B. 1 1 W T , W ' G3 in QVAVAWVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAVAIAW.VAVAIAVAVAVAVAVAVAVAVAVAVAVAV,-YQ ,,,,,.,,,,,,, , .,,,,,,,,,,,,.,,,.......... ............... ..... - .... .,.... J ....,......, , r A Q .. A ' 'I .... -. H ' .L ,..... my l . . .. S 1 3 .1 , ' , ..... I Isiewzai ..... 1 . I, , I 1 E K. JCC ilrivate co. HB. U I J, E N 1 , .............. M... I H ., , E AY E f - - ' .- J 2 C , ................ .....4,j...,,.. I ., , N 3 1 1 f 1 T 1 1 f ' , . ' l v 1 ,, ,,E I ' i . . - S . 3 . -l .- 5' E J A - -I - -5 - 2 I '5 7 f , . ............... li ....... , ' , . . 1 2: i I - 1 I . is ' 1 ' - , - I 5 g ' , , 4 ............... D ........ g , 5 2 I g , . ...................... ,Hd ......... , I ........................ , tx 2 .. in -. 5 . 1 I I Q I I gl , , . ................ ll.: .... 6 ..................... , 4 . 5 , . ......... h...i:,., ..... ., , 5 nun gy, , , 1 E U lzt H 3 , , , , 4 1 I 2 2 V 1 5 aifldli'tkftbfliftifAVIQCAVIRVAVAVAVAYAVAVAVAVAVAVAYAVAVIVAVAVAYAVAVIFNAYAVAYRKVK'S WVAWWVAVAVAVAVAWVAWVAVAVAVAVAVAVAVAWVAWXVAWVAVAVAVAVAVAVAVAVAVAVAVAVAQ AVAVAVAVNAVAVAVAVAVAVNAVAVAVAVAVAVAVAVAVAVAVAVAVNAVAVAW'NAXRVAVAWVAVAVAVAVNAVAVAVAVAVAVAVAVAVAV 'rm S mllllln C Hung: t Xmvrq df L WHEARY THOMAS W CU Crewe Vlrgxma Shexk Pr1vate Co C WHITEHFAD Lewtston North Carolma Buck Pruvate Co D Baseball Team Eplscopal Club WICKENHISER HENRY C11 1112 State Ave Loraopohs Pennsylvama Wick Prlvate Lo A Football Squad WILKINSON JOSEPH S C4J 806 North Boulevard Rlchmond Vxrgmla oe Second Lieutenant Band Cotxllxon Club Bayonet Staff RECALL Staff Cadet Orchestra Twm 9 Club Minstrel Show Clceroman Llterary Society Fmal Ball Commtttee WILLIAMS CHARLES F C45 202 New Bern Ave Ralexgh North Carolma Shag Charlle CCand1date for Graduatlonb 1 Pr1vateCo B Basketball Squad Baseball Squad 2 Sergeant Co C Football Squad Baseball Squad 3 Second Lieutenant Co D Football Squad Basketball Squad Baseball A Mono gram Club Minstrel Show 4 Captain Co D Football A Basketball A Baseball A Cotxlllon Club Fmal Ball Committee Associate Edztor Bayonet RECALL Staff Twm 9 Club Monogram Club Epxscopal Club Clceronlan Lrterary Soclety WILLIAMS GEORGE W CU 109 Plke St Phxllppl West Vxrgmla Fang Captaxn Band Cadet Orchestra Company Athletxcs WILLINGHANI THOMAS H CZJ Rome Georgxa Tom Prnvatc Co D WILLS RICHARD H JR CZJ all Arlmgton Road Roanoke Virginia Dlck CCancl1date for Gracluatxonj CDay Studentj WINTRINGER HARRY CID Steubenville Ohio Wmt Prnate Co D Football Squad Peep Basketball WOOD JACK CID New York Cnty Yock Prxvate Co C WOOD BENJAMIN C CU 1615 Colomal Ave Norfolk Vxrgmra Ben Prnate Lo A Epxscopal Club WOOD WILLIAVI A C25 1615 Colonial Ave Norfolk Vlrglma 1 Sergeant Co D Episcopal Club WOOLRIDGE S L C23 Versailles Kentucky Sammy Prlvate Co C , Boxmg Squad WRIGHT, WILLIAM P CU . Richmond, Vrrglma uBlllyn f Prxvate Co B 4 3 4 2 2 E 71 3 ZA AVR'AVIVAVAVAQVAVIRVAVAXVAVILYAVIXVAVAVAVAVAYAYAVAYAVAVAVAVAYAVAVAYAVA'CHAVELg 'Z B I B G ,Q ...r,.,... . ......,..,,..,...............,......,. Q ..,l.....l...., f .,.l. .....l,sl, P ' gg '124'!2:L'!.'22f'lfff!l5'l !QE.Lg ' sc D I I IT: - !31'!!'lQg!H!!!'!!!'!!! g.'l R at-ll ltf rtee g l 5 I 5 J 5 M , .1 ..l,.l,,l...a,.,J...,.l....... .......,,. , --t l 2 K' H' n U u ar 1 I N g C ' . . . tt 5 q . ..........................,..................... , 4 . .. ,, V C 7 J . 1. . . 5 f . , , Q . ' I N, f X f , ........ :'......:,. ., , N 5 f , . .......... , , N 7 , . . .. , I . . . , I 5 ! - as n 5 . 5 . . . I . 5 . . . . D ' E f , . ..... 'lull V ' H ., , l' 2 f . ' . . 1 5 , . .1 . 1 5 I 11, 5 1 I 5 , - ' ' : 9 : : - -, 4 I . 3' . . . . 'I ' ' ' E , , f ..................,.... - ., -- -, - -- 2 , ' ' U, . . ..... :I ..... 'J ...........,............... , 2 I , . ., . ......... K l..:..'L.... , , E , . . I 3: ' . E , ' ........... t l......:, ........................ , ' Q b . , ..................... ll ..... :I ........................... E U H '. U U . 2 , , . ......... 1' .... ,.,....,. , , , . . ......................... - ., , ' -' 5 B'll S u u, ' G . , , , , . 2 V , .P . ............,. ll ....... A ..............,...... , , Q , e , D . Y Q - 1 Q m . ,., x I PK. 5 - HP .f f 2- ! Ying It W, my' , 4 XA 1 v- : 'fr' , sm -f ! fy .2 fu g .igfge 1722 .5 , ,.,. k lp QQ: gf, ,,, 1-QQ 3 Y' m. , .M I x 1 3 l ,J X, 1 '4 e V11 A Vf' 'L 5 Q 3 be-T! ME if 1 pill !fMff,f tffvl i N .M -, 'ni Lge? 521 LEE E5-if Eff ? 2 AI F ,J K. KJ we 531 E'1.C 1 EV? 21:1 LQ--:J SFT. I ffm 5 , ff ix fl E-Q 5 .J,,.i -4 5,53 k V N 4 ,- -1,f......-- -1'-'C--2----, S ff! C '- 7 W N l- NX ' X Ii- ' F. fi' --' -x'f 2 4-. I 4 xx n .ix ix- w. fa- W N f x X n , ' I Wi Q 6 1 I 4 , , le 1 M ,J mr E 2-49? 5412! f f. if . , X il., Ml 5 I , X A NX 3320202020302030203034180Zewwwtotetotozoxoxoxoxozoxoxezozoxoxo ozozoxozoxozotoxoxoxoxoxozoxozoxewtoXOXQZOZOSOZOSOSOZOXOXQXOZO O o 3 3 3 o 0 3 73 3 3 8 S 3 3 3 3 3 3 0 Q 3 3 3 3 2 3 3 8 o 6 6 - Augusta illitlttarg Arahrmg 2 quoctuxs SCHOOLJ 2 3 , Ei 5 2 3 3 MODERN SCHOOL with a country location in the 2 famous Valley of Virginia. Endorsed by the Vir- 2 ginia Military lnstitute and other universities. Army ollicers detailed by the War Department. Junior R. O. T. C. S200,000 plant with absolutely fire-proof barracks. Steam heat, electric lights, and splendid athletic lield and campus. Q 360 acres, cadet band of twenty-four pieces. Able faculty of college men, who take a personal interest in the boys' academic work and who coach all athletic teams. Enrollment limited to Q 275. Boys from 25 states last year. Fifty-ninth session begins September 22ncl. R a t e s 360000. Member of Association of Military Colleges and Q Schools of U. S. f Q 3 3 0 3 Fok CA'rAi.oG, ADDRESS Q 3 3 COL. THOS. J. ROLLER OR MAJ. C. S. ROLLER, JR. l-'RINCIPALS 3 L 2 3 3 Fort Defiance Virginia 0 9 3 3 3 3 e Q 3 3 3 3 o 0 3 3 3 3 o o 3 3 o o 3 3 o 0 OO O0 o o 3 3 3 3 0 0 Q0 C5 Q o 3 . 3 ' 3 o o Q3oxozowxozoxoxoxexo:o3020202020wtoww20203020302020SOXMOXOtot0t030w!0wwS024vX0tetotewtotoxoxozozoxoxoxoxozoxoxoxoxoxow Q, 3 0 2 2' 2 02020202fv2Q2Qw2020202029:ezotozozowsozozozoge. . Ns 6 49 .x , vi ,' to C3 ' .5 d - - n, 4 Q . A X ' 9 I ' m 'v 4 E . . x , IV 'ca 9 'EJ 202020202020202o202020202020202 2 2 V0 0202020202020202020203o3020202e:o:o'o:e:eze:o:o:e:ogQ3ogQ Q39 Q,Qg9,9gQ3 000202075 0 2020202020202o2Q2e2o.o 0.020 eww o Xozeto 020 0202020202020 020 0 oxotoxo 0 0 0 0 0 0 0 0 0 0 0 02020202020 oxetoxoxo 0 0 0 0 020 oxoto 020 0202020 0 020 020 TOWN S BUS LINE 'I-.o xv . M 1- x- ' 7 sr K' '1 K 4 r0?uu6f5gg A gc ! Q oxoxozoxoxoxo:exoxoxo:oxozoxexozotoxoxozo o o otoxoteto 0 o ozoxo203o2020202o202020202020202v20 0 02020 o o o e 0 Q o 020 0 IFLOIREDALE LODGE AWGN? L' 99' ma !NgW,5g? W0 FORT DEFIANCE VIRGINIA 14020 '2' 2 '2203' 22202. 02020202020 02020.02ozo:o2ozoxo:o:e:e3ogQ3Q e 0202G.0202Q2e.o2020 020202020:e:e:o:e:o:o:o:e 0 .. 0 .. 3 3 0 if 23 .. 0 .. 9. 2 O0 0 .. Q 2 0 .2 0 .. Q A I 5 Q .. 2 t. f 3 2 3 Q 9. N 3 W' 3 Y 3 5 '6 , N 3 P 0 1 00 9 .n Q. A .. jk P e 0 x o Q Q 0 Q t 0 Q X- 0 f Q 0 2 2 0 Q 5 o 3 3 3 Q o Q 0 o e 3 0202020202Q20202020'0202020ze20202o2o2o2e2o2o2ozozozozezezo ' ' z 0102030 00020 0X03030X0X0X030Z0!030 0!0IOXOX0202030!0X0! X0!0 0 02010 ew 0 o 0 02020392030 Moto oxoto 0 ototo R22 0 ewwww '60, OO, 0 O0 M o 0 4 O OO . N N 9. o . o . N o . . . . O . O O O O 6 9 O A U N T 0 N ii O 60 4 O O4 . Ef . O O . 0 0 0 owtogoxotoxo 0 o oxoxototoxo ozoxokoxozoxoxotozo exoxoxowxezotoxoxoxef' . O b Eb 9 W '2lI'C 9 9 o . 0 . 9 3 o .. 9 0 O Z 29 EZ 6 9 o . 9 o 29 . o . o . 9 o M 0 . o .. o . 0 3 If 2 6 'Z 3 . o M o 3 Q41 -I I A WEE R nmum m -I O T H S T xoxox V C N X0!Q20X030!0303030 030 W O U B 0totowwtowtototowwto . . 990900000901 -9 O I Q 0- fb OOO ,O 944 AND HARNESS SADDLERY HARDWARE, L I I I B I 'I ll 0 0 n l L G t 8 l p m O C A Q 0 0 Q Q 0 Q O 0 E 5 Q W if Q fi 0 I RE qi Gi fi O 5 GINIA 2 5 Q 92 fi 5 5 Qi 0 0 5 Q 0 0 Hard Co Q I 4 'O QAM J I 5 5 O DING I ERIAL I 0 ' Paints and Varnis ws ' 0 o t0wt0!Q!0t0t0 0202030 we otozezoxoxozoxozo e 0 e e Q oxozoxo 02020 Qwgow 01020 030 0 0 . wxoxoxoxo 02030 . . . .. .. . .. O .. 0 .. 0 . 3 0 .. 0 .. 0 .. 0 .. 0 .. 0 .. 0 .. 0 .. 0 .. O .. 0 . 3 0 .. 3 0 .. 9 0 .. 0 . 0 OO 0 . O . 0 .. 0 . 0 . 0 . 0 .. O . 0 .. 0 ia 39 0 .. 0 .. 3 .Q 0 .. 0 .. 0 .. 0 .. 0 .. 0 .. 0 .. 2 Z .. .Q 0 OO 2 3 0 .. 0 .. 0 .. 0 .. 0 .. 0 .. 3 X 9. 3 0 .. X 0 .. 3 0 .. 0 .. 0 .. 0 .. 3 2 3 8 0 3 OO 3 0 .. 0 owwwww 4 O Q 4 4 0 4Qo0aeo90Q'0'9 0 . . . .Q.0:9.Q.WM.0.Q.Q:Q:Q:Qzo:Q:QxezezezezezQ:Q:0:Qz0:oz0:Qsoz6:6:Qt6245202452Q2020293029:0'Qm4':0'Q'Q'Q'0' ' ' ' ' ' Q 25 4 0 Q Q Q Q 0 0:Q:02Q:o.Q:Q3o:0town:0:0302020203Q30303QWw'Q'9'0'0'9' 0' ' ' ' ' ' 2 'Z 0 so 0 H 1 o E if sf 9 oo N 0 3 9. P 0 6 2 C i o 8 5 2' 7 5 'E I 2 Q, I 2' Z ri Pm 2 Q CD 3 l1I 0 oo fl ts r1 Z 2. 3 2 23 2 2 oo 111 Q Q Q e X.. .5 0 2 ' E E 5 E 2 3' 2 FD 'ii 3 3 'U .. 3 T e I'r'4 3 DP '6 ' '11 Q o g- .. r-4 3, gg oo J H 6 M O ri of Q O Q '5 fi 2 3 3 ,-1 2 m C: 3 3 . Q 2 M U 2: '6 4 f . Z 2 cn 2 gg 3 0 ' oo X - -A H fa Ii U cn 2 22 A p 2 I O Z' 3 rv 2 3 :U 0 OO Q rw CI f-4 3 I n-1 'A 6 3 -4 1 Q4 2 .-4 2 - Z E Ei' I 'Q C'D 5 0 pf- N 5 Z P-3 Q ,O Q E '13 0 Q 2 ii' G' Q P-1 Q 2 5 Q 3 b 2 0 0 N Z of 9-4 o 0 7 0 t-I A gg Q 3 r-I Q 3 0 Q :U 2, H E11 .5 9' :U m 24 4 rn Q 3 o 2 6 2 2' O O 2 Q .. 0 is Cz CID 2 gg 3 if QD QQ 3 III! 8 3 3 N 4 o o :U 3 -4 3 3 6 -4 oo 3 zz fd zz 3 P4 2: cu fa fs 3 ' Q 2 3 8 Z , 3 fs fa 7 Z' 3 2 P oo N 0 3 -2,3 3 :Z 5 g 4 4 2 . SQ.Qo0o4,g9'Q'o'o'o'0'0'0!62 30 .3 . .vo 44909949 ,.oovv 2? . . . . . .Qto.Q.Q.0.4,.0.6.34,,039wgQg0g0zQ:ozezozozozezozezotozozoze2Q2o:ozo:o:v:o:o.Q.0.0zo.o. . . . . . . . Q ezowzozozezozezozQzez0:0:ow:0zQ:02020202020f0'Q'0'Q'9' ' ' ' ' ' ' to Z0 . 0 N 3 3 0 Z' '43 Of 3 if OO 3 'ii 23 W 3 0 o 3 e 0 Q o 0 '45 0 '43 o e N o fl' OO e 0 M 3 0 3 M o N ii' V0 3 e .. 3 fi o .. 3 0 3 N 0 '23 3 .. Q .. Z' OO o 3 5 3 o 0 0 0 g 030!0x0:ox0xoxox030X0!0!0 0802030 0202020 o o Q 0 e exe 2030 SSE sz 32 VAN PELT'S FILLING STATION fi' 5 2 A NICE CAM!-'ING GROUND AND LADIES' REST RUUM. gi 0 1 7 oo fi VILRONA, N IRGINIA 2 0 , , . 'F gg IN Tl-ll: V,A1LLExf OF Vllemfvl,-1 0 Q .. :j g .. 3 Q NVHICN IN TROUBLE, CALL AT Q VAN PELT'S MIDWAY GARAGE 5 Q .. 3 IEURKICTUNVN AND VIERONA 2 .. 3 GARAGE M- VFRONA .. . 3 3 BETTER SEIGVICE avi 0 E,--IIRER PRICE 2 3 5 Q Q 5 K 3 3 0 3 0 3 A I l HEWS 81 FAUVER 3 3 8 3 3 3 , - - V . 8 ji -HAHI'.RUAbHI'.Rb- Z 3 3 ov X g HIGH CLASS CUSTOM TAILORING 5 g 27 lanst Mam.St1'eet 2 lVlANHAT'l'AN AND IQCLIVSIQ SHIRTS 2 8 5 FRANK SCHOHLIC HATS MIQRTGN CAPS 2 .. 3 2 ALLAN A. UNIDICRVVICAR AND INTIQRXNUVICN HOSIICRY Q fl? Staunton X111-ginia Q 3 3 8 3 3 :0:0:0z0:0:0:0:0z0:0 8 3 EZ 22 22 0 .3 2? 0' .. 0 .. 2 0 2? .3 2 0' .3 0 3. 2 5 3 2 0 69 2 31 OO 0 OO 0 O9 0 00 0 OO 0 0' 'Z 0' .3 3 2 3 2 0 .3 3? O0 0 .3 3 2 2 0 .. 'fe 8 .3 2 2 S 0 Z' 0' .3 3 3 0 8 .. 2 2 303030:0303030303030 0 It you want youl Llothgs LOIUIUQ to us 03030 3030 30 . 3 303030303030303030303 -1 I F -I :B .. ... FJ 4 gf A ' M z . ... .-. ' Z1 .1 A.. L1 C :E . .. 7 :P 3 A r- -. v- 'F' , . .. v V :ta 3 - .. c ,A A f- 1, ' ... N - E C '34 ,Q A J 3 . jx V in - -I -. 'N - A -T' 5 r ' - ' fl 5 ,. - -J r- ' ,, rg H 4. 1 ... ua H .. H G , J I -3 H , C E H -' ? A Y 7 E N E L - .A A A 04 7 15 V'- Q ,.. Z C T '- ' 2 - - 3 2 - JU I L, - - 13 E 5, ' u F: Nl , ' ' rt ' . ' C ' - E. 'L-5 L ' : -L+. 1: . . 7 , 6 :I W Q A ' an Y I: 5 ' ' Q -S, ..a ' E: .. , C ,. :- rx - L' Z3 H . ,., 5' 7: 2' ' ' . C 7? ' 'c A. . J 2 ' - 2 '-v. C C ' :T I f- C ' YL. 1, M 3 C -a . - . ... -3. - 3 gg . LT' ... 7 L C 'A 203030XOS020S0202030 It is limg not only to rgcall plulszmt mymorius of t'1'iLmlships formul, goals rulchul and strides t'1kLn whilg in thc. uniform of Almw Mwtu' but it is timu to 1102111 the 'lll1IlitiO11S, callings :030303030:030:0:0:0 C E W A .. .-L C. :I P? '04 1-P T -: C 4 4 I A .li , r- .. -J 'J A ., 7 .. 030303030303030303030 and tuku on that of tlfxl grunt 'lrmy Lvu' mzmrching' towarcl suc- cass in the lmllldklcls of CUlTll'l'lLI'CL or prufussion it is agwin :0:0303030:0:0 A, : A :- P? A V 3030303030303 75 FT! 0 DP L- r- 30 3030303030 30303030303030 0 t1'1t XUI I IINI' 1IlN'llIlx Cluthgs ll2lVL won zum for um 020303030303030'0 020:0f0:47SOQ02030 1 fair uc 'ol' lift' fL1l'S. 5 5 f Q ask 'ul' ou 1'LC'lI '10 'uc rl' wg zum thu homv. 0' ' t 'lt is mmvn to DL good for lXl1'CI'iC'l s lmst cl1'css1's. 03030303 03030303 KUPl'ENI1EIMER CLOTHES 30303030 30303030 MANHATTAN SI0Illx'l'S STIITSON HATS g0:0:0z0:0z0:0 I ' . E . 71 , :0:0:0:0:030:0 :92030:030:0303030302030 , T 302 030:0202030303020:0 P7 'ff 20 cn 0:0:0:0:0 I m 1 E . 2 0 1 0, : 'Z m 1: A . .. 1-J E :0:0:0z0 4 0 00' 3 3 3 33 0 33 0 5. 2 0 3. 2 2 0 33 0 3. if YS N 3 0 3 2 2 2 8 .3 3 'Z 8 33 3 SE 32 0 .3 0 3? OO 2 2 0 N 0 .3 3 0 8 w 0 33 Z' 23 4. 3 0 0' 0 3. Z' OO 0 .0 2 2 S3 53 3 S? OO 0 33 3 3 0 003030 ve,-v - WX. .1- 1 ' I'-V X N V, .wi 0 gt03Q:Q2020Z9w20!0w!02Q!Qt0t0!Q:Q:Q:Q:Q:Q:Q:Q Q Q'Q.Q'Q:Q2Q:Q Q QQQ Q Q Q:Q Q3Q:Q3Q3Q tllnm Spnut Zinn F0111 DEFIANCE, VIRGINIA BREAKFAST LUNCHEON DINNER ACCOHlHl0ddt10HS for TOHFISIS -Special Arrangements for Parties-- PHONE STAUNTON 93-F-14 2 Q OO Q .. Q .. 3 2 Q .. Q .. 3 2 2 Q N Q M 2 N 2 Q .. 'Z 8 .. 3 Q 23 2 OO Q 3? 2 fi Q 'Q 2 2 23 .Q Q .. Q .. Q .. 2 OO Q .. ii 2 Q Q' N Q .. 3 3 2 Q .. 3 2 Q fi 2 Si 52 Q Q .. 3 Q .. 2 020202020303Q30293020Z0XOSQSQZQQQSOZQQOXOZQXGQQ 0XQ2Q:Q:Q Q.Q2Q Q Q:Q Q Q Q Q Q Q Q:Q Q Q Q Q otexotetotototoxetotototoxotototoxotot-sto o o 0 o o 0303030 0 0 oxo3ozozoxozowtoteww!Qxoxo:030tote2oxoXOX0t0wt020X0t0XOS0t0 3 3 0 0 Ii A Bank Wltll Your Interests At Heart And 3 3 fi: ABLE T0 TAKE CARE OF THEM 3 3 3 3 3 3 0 3 OO O9 3 ' 3 0 3 Farmers and Merchants Bank 00 90 3 . . . 3 0 W 9 of Staunton, Virglnla 0 0 OO 3 3 3 Capltal .. . . . . . . . .. ...3E100,000.00 3 3 Surplus and Profits .. . .SB185.,000.00 Q O0 lf 3 3 3 3 5 Lommercial Accounts bare lJC1JOS1l. lioxes 3 . . , 0 bavmgs Trusts 0 0 3 6 0 Q ezoxotototoxoxo QQQXOS030XOXOSOX02020S020!0!0 OXOXOZQXOXOQOXOXOXOXG 0202 3720102020X030XOXOXO!0XOS010XOXOXOZOXGSGXOXOXOSOX :Z MARY BALDWIN COLLEGE .. .. ' A N n 3 3 3 3 5 MARY BALDWIN SEMINARHY . . . 3 Q ,lxstalzhshed 111 1842 3 0 0 OO 8 2 ' 1 T ' ' ' ' 1 ' 3 3 l'Olx YOUINL1 LAlJll'.5 STAUNTON, VIIXGINIA Q f 12 4-Term llegins September 9th- . . . . . . . . . . 3 2 Located 111 the lleautitul and Historic Shenandoah Valley ot Vlrgmia. 'Z Unsurpassed climate, handsome buildings and modern appointments. OO v . V 5 Three hundred and sixty students-session 1925-1926-from twenty- Q 3 four States and two foreign countries. 3 gg Of 3 3 Q COURBES: College, 4 years, A. ll. llegreeg College-Preparatory, I2 g 4 years. Music, Art, Expression, Domestic bctence, and At7hlet1cs-- Q 3 Gymnasium and Field. Small classes and thorough work. Send for Ig 'Z catalogue. 3 gg O9 5 0 0XOS0!0X020SOXOX0!020X0 0 030!0X0!020X02020 03030X0X0!020X0X0 03020202020302020X0!02020!0303030X020X020 010203020 02020302080 0x0x0g0x0x0g0:0:0z0z0g0g0 1030303030 020 030201030 0301030302030 030x020 0:0 0:0 0:0 0 0 0 0 0 0XOX0!0X0 03020 0t0S0!0X0 0 0 00 0 0 P I . O 0 0 2 2 n I O 1 0 2 .. 0 .. 2 P 2 2 2 2 . I 60 0 .. 2 2 2 . 2 2 0 .. 0 0 I 0 2 0 2 2 2 3 3 3 3 3 3 3 3 Q W I I Icul-1 Q Q 3 . .. H 3 ji 13OYb AND GIRLB 5 5 S of 3 2 MICET AND GRIQIQT AND TREAT S Q 8 8 2 3 ARE Q KOMPLIMILNTIH 3 3 HERI2 3 TO SERVE 3 O F Q 0 3 X Y 2 0 0 5 Y O U H 2 U 2 WASHINGTON Q Most Dvlzcmus .Soda Wll1L'7' 33 5 and S011fd'ZUiCl10.S' in 'flu' City Q M K A D E T S 7' K E N N E D Y A N D 5 E L L I N G E R Q2 T110 I-lomc Lzkv Drug .S'1'm'c 2 3 3 3 2 . 2 2 0 0:0 0:0 0 0q0x0x0x0x0x0x0S030 03030302030 020 03030 020 0t0X0t0 0 0x0z0 0 Q 3 3 3 Q CONDENSED STATEIVIENT OF Q 3 ' 2 3 THE STAUNTON NATIONAL BANK 0 Q OF STAUNTON, VIRGINIA . 0 0 5 IJICCIQMHIQR 31. 1925 3 Q IQI-zsummcllzs 1.mmI.I'rncs 3 Loans and Investments ..... S 812,576.36 Capital Stock ............. S 100,000.00 0 , Q - U. S. Bonds ............... 81,000.00 Sll1'Il1llSZl11!1P1'O1:llS ........ 71,138.59 3 I l1l'1111l1I'C :md Fixtures ..... 20,378.63 Iliviclcncls paya1IlcjaI1.Z,l920 5,000.00 +2 Vash on hand ...... 24,818.88 C'irculating Notes .......... 81,000.00 5 Duc from Banks. . 88,699.43 113,518.31 Rcdiscounts ...... . 17,500.00 3 Deposits ........ . . 752,834.71 5fS1,027,473.30 Sl,027,473.30 0 0 Three Per Cent Interest Paid in Savings Department 0 fi 3 B. li. VAIIIQIIAN, Prcsiflcnl J. N. 1X1CI:ARl.ANIJ, Vice-1'rcsiclcnt 0 , , 22 lu. NV. RAND0l.l'l'I, L':IshicI' Fm-:Im M. 1:l1 1iR, Assistant Cashier 0 :cf . 6 X 0:03020 0 0t0z0x0x0 030304020 02080!020t0x0:0:0x0x0x0x0:0t020x0 0803030 0t020!020X0202020t0t0!0t0t0X0t020t0t0t0t0t0x0 0z0x0x0 0 0803030xoxoxo:030303039xoxexoxezoxoxoxoxo 0:02030 oxoxotoxozoto ow eww ox030:ox0:oxexoxo:o:0x0X0!0X0t03020!0t0t0t0!020Z020! COMPLIMENTS BRISK BROTHERS -CLOTHIERS- Street 50111 West 60 NHVV YORK CITY o 0 0 5 ff 5 Q5 0 N 3 0 N 5 N o .Q 0 M 0 0 0 n 0 M o 0 0 0 3 o 0 0 .. o 0 0 0 o 0 o N o 0 0 .. 3 5 3 Of 2 3 3 0 3 3 N 0 N 0 0 0 0 0 0 0 N o N 0 0 3 0 0 0 0 o .O 3 0 N 0 N 0 0 o M 0 0 cy N of 0 3 o .. 0 .. o .. e- 0 N 3 3 3 0 0 5 3 3 if 0 .0 0 3 3 Q. 3 3 3 0 .9 0 9. 0 .O 3 0 .. 3 3 0 .Q o 0 o 0 0 0 3 - to to 0 0802030 0 0:02020 03030808030 0t020X0!0203oxe:o 02 0 QXOIOX to 0 0248030202020 0 o gQww:e:oxex0S0xo 020 02020t0t0SOX0t020 Q O 0 O O Q O O O O O O . O 1 6 9 O Q 9 Q O . . . O O O 'QO0O9090O9990.999Q0ogO0.90OoO9oM0O?obb.o40.3o 0 ougonenouo QMAXONQNONQNQNGNGNONQ o.o,Q O 0.6 0,Q00006000,Q,GO0Axe.0.0,0,0rio'0,0,00000vo996000,0'Q.o.oN0,0No.Q.0.oO0 O O . . O . 9 O 9 . 4 O , , , O 0 , . 0 9 0 O 4 O O 1 oxexQ30xozowzoxowxotoxoxotoxoto 0 020!0X0X020293920X0 0 020 020202020202020 020202020202020202020 0202020202020 02020802020 G. W. BROWN 23 VY. Johnson and 21 Central Ave.- 'IOI-IN DIQIERIQ FULL LINE OF IMPLFIVIIENTS Stuclelvaker and Brown WYHHIIIIS Papec Iinsilage Cutters New Idea Surcaders Syracuse Flows and Harruws DAIRY FIZICDS I trro ZIIW Protein Sucrene IOMW Beet Pulp-Oil Meal---Oats I?OUI.'l'RY FIAYICDS I gg Mash 'I'ip Top Scratch I ittlc Chick Sucrene Scratch ICVANHOOK IIRAND CANNIQD FOODS AND FOOD PRODUCTS Ripe When, Packed- Packcd Wl1l77C GTOZUII EVAN W. HOOK 8: CO., INC D I STRIIS UTORS IIaItimore - - - Maryland 020tewwx03ozexezoxoxoxozoxoxoxozowxoxosoxozo exe ow 0 Q Q Qwwxezoxoxoxozo 0 oxozozoxe Q o ow 0 ow o o o o o o ew roi. COOD LII I' AND IINDOWMVNT INSULANCI' t UAIxANI'IIIID I ORN .Ix A T I' S S 'Ii . CUIXTIS I. IIOWIVIAN I+IN'1AI.A'Z. LIFE INSURANCL COMPANY of VIRGINIA Iitauntfm 1: :: Virg,in t GEORGE W KENNARD D 3 I :L L: AND OPTOMVTIXIST Z5 West Main Street Staunton - - Virginia 2. . 2 . 2 I 2 T 24 2 44 , I I 1 A I I I' W I' If R I I r 4 1 , . I 1. . 1: 4 , . I I ' I J , . C I I R til' X'I 2. 2. 5 1 r It 2. 2 2. .. Qzoxozoteww 0202020202 020202020202020202020202020!020!0t0 o2otoxo1ow:Q3030202020X0202020202020towtotototoxoxozoxozoxo o wteS0zoxoS0!0wwwwwt0t0t0 0t4vw!0wS020w!0t0tOt0X QX08ot0SOt0tot080Sorow!oxototozoxoSoxexe:o3o:o:owwwX03030t0 03020 0065.0 0565 O I 3 0 6 Q O O O 0 N90O0OOOAYOQOOQNOOOOOQ?900066083200on30.60360330530800QOQNQWQMQOQNQOQOQNQOGO93939006 0.0noNew0099990.9n08.Ay0003033396038383008 IUERCE TAILORS IPITIIQRS EN - R U 'LT U I G S T M PIU. Y E A I O O Z 3 .. Z 5 5 .. 5 8 8 3 9 8 0 6 6 8 6 6 6 fi 42 Q fi 42 . 0 4, c, . . . 6 O O O O 9 O . . l HA YOUR N T O N IC OUT . . von NG M ' C ot ling Furnis zings Huis GER 'IUERCE I M M E N'S S H O P ' 5 T A U N T J N I V Q G N A . 0 HA 199 Vhom. Strut liuvurluy Iiast C Q33 otetototoxo exetotototexoxoxozoxozegewgowgog 20 2020!O20202020XGXOXOXGXOSOXGXOXOXOSOIO 0 020 030 24 Q Q o o Q o 4 4 Q 4 Q 4 o 4 9 9 53 E9 9 ? 0 o Ei '6 o 0 o E 3 ov 5 3 no 3 3 0 oo 3 3 8 3 3 2 3 u 0 0 oo 5 as 0 Ei 3 2 29 Ei 3 0 oo 8 0 oo 3 Q of 2 0 0 so 0 or 0 no 5 oo 3 3 0 oo 0 oxetozowwt to o eww F C 000M0N000MG.QueueNOAVOQOQOQOQQQOOOOMQOQM0OO.0NobonoweNonouoNOOOOQOOO0.0.0.Q000000N6N00900no.000,0.0.OOOOQOO400000'o4OuOuo.o.0.0.e.eMo.o.0QOOQOQWGNQQOMOOQOO.OQQOGOOMOQQNOOQNGOONOQO 1 I CH fi' 9 9 OO 9 5 .. 0 .. 9 0 .. 9 9 9 Z 9 0 I5 29 9 9 9 'E 5 0 00 0 Q0 90 'S H 55 El t 9 9 9 9 9 9 9 9 E 9 Za .. 9 G .. 0 .. 0 .. 9 9 9 9 9 53 CO 9 0 . O .. V .. 0 .. 0 .. O . 0 O 0 9 . ii 9 9 0 9 9 E3 . 9 0 . 0 is O 9 9 0 9' 9 9 9. 0 . 0 .. 0 9 9 0 . 0 03020302020X0202030203030303010202030302030203034930f03930303et 3020302030 30 202020202020!020 Spaldin Ihletifi If Goods I 202020 0303030ZOZ02020Zo Ep 2221 I ' um If , , A no 4 If , II W I I gfthe World L, 'g?gg? since 1876 M5513 I M Vmmxv fwmmhu- Nh XWWWWWWM 0 Iii I III X I 3 I ,fn IA I xl I' 9 : I I X f X I' X , g ,f K : U I X' I I ' , 5 ffffm IN' 302020202 N U -----. 1 I K I WSG: 'whiwhfigfggb 20 imqm' 15223 to 11 :.-1 - 3403930202020 Calalqg qn request I- - MQW I I ' I A 1338 G St., N. W. 3 XIVHSITIIIHIOIT, IU, C. E etotototoxoxexozo 02020XOX02020XOSOXOXOXOX0 oxoto 0 0 0 020 0 0 0 0 0 0 020 0 030202020Z0302020X020202 C 'U COIVIPLINIITNTS 202030Z020!0202020X020 H.l HEINZ AND 30202030 CCJMIHANY 03473020302473030202030X0!03030 -57 Varieties- 0, 0SOX020202020SOX02020X020202020202080X0!020X0!020SOSOSOXOXOIOS0 02030203020393Q203o30to:o:o:e:o:o:ogQgQgQgQgQgQ .gQ 0 020802020to:ozozotozezetozozozozozezo 00 2 3 3 O9 e 3 2 Q 2 0 2? '5 e Q M e M 8 2 00 o .. 2 0 2? Q Q o 2026303020202Q2020203020w!0203 Sozetozowzezezezowzogetozogozc:egQg0g9gQ,QgQgQgQg CONIIPLTMIAENTS OF YVAIQLIZY TOIIACCCJ COMPANY if DY QTAUNTON VIRGINIA ' MT .IMVN ' GRJKND FURNHURE COMPANY M AIXIIIRO I Perl' Suattk VVZ1QI'l1l1LfI0l1 02020 0 0 02413020to:Qxwotezexezozo:Q:mozozowzotezozozototozozozozezewgogQg0gQgQg93QgQg0gQg0g0gQgQgQgQgQgagogqm, 20202030towtewto2020202024803exe:ezozozozozozotoxozozozo ezozezozowz 3 0 3 .. 3 2 3 .. 9 .. 0 .. 3 O0 0 0 .. 3 2 0 0 .. 0 .. 2 2 3 0 .. 3 3 0 OO 0 09 2 0 .. 0 .. 3 3 Z ow 50 fi 2 3 3 .. 0 .. 3 3 0 OO 5 09 0 .. 0 .. 3 2 0 O0 0 '6 .. 3 3 3 0 .. 0 2 O0 0 0 .. 3 fi 0 Mn0Nmnmnmnmmmumnmumumumnmumnw' fm . f'N 91' - ... A X fs v -I W , A -f ,-A -, f I. J A W . 'J 1. , - W Z ' IIE T' ' Ax .. I KA rv J f .1 -A ' If 530 0 ozotetototo eww 030xoxo30xozoxozoxozoxoxozoxozoxo moto o 0 o Q ow:oxoxoxoxQX0to!or0XMOXOSQXQXOXOXOXOZOSOXQ 020 0348020 03 0.0,0. ,0.0.000 0.0M -I I P M J C C Q 0 O . . Q . . . . o . 9 0 Z' 3 . 9 o . 9 9 9 0 . 0 . 0 . o . o . o . 9 e . 9 9 Z Za . 0 . 0 . 9 o Q o . o . 9 0 CADETS IA IN RG I V ST WE 0388no88033eggN33333233003QnenouognononouououognaongcnouaaonONSOMGNOHONououougouonougouonono 330023630330308233800333ouongouoxugooono . O 4 0 . . . .. ' 0 3 5 40 8 06 Q 8 3 3 3 X .. .. 2 .. 3 2 5 OO 2 OO 8 .. 0 3 8 ,, 8 0 0, MRNTb 8 .. 5 8 0 F Zi E 6 O 0 5 . . fi 0 5 5 5 6 N o 6 6 ' oo . . . 0 . . - 4 . . . . . ' o . . . . . . . O 4 6 . I O . . . 0 b . - e o eww!otototototvwtowtv oeooowo 0302 X0 !0XOX020!0 0 0!020 020202020!0X020XOX020XOXOX0 0 0 0 0 0 0 0 0 otototototoxo 0 0 3 .. 3 .. 3 4 3 .. 3 .. 3 as 3 ITE A .. 3 . 3 . .. 3 .. 3 .. 3 no N 3 . 3 .. 3 .. 3 .. 0 .. 3 .. Q J 1 1 1 0 oo 0 3 If A 0 3 .. 3 1 w O0 5 5, .5 0 .. 3 1 1 1 1 ,, 3 A 1 . . . 1 1 . . 1 3 3 3 . 2 N 3 1 Q .1 1 1 .1 3 .. 3 .1 y 1 1 1 1 1 0 8 1. Q .. Q .1 0 1 .1 1 ' ' 2 . . . 'fe .- -- st hsh. comtorlzthlc :Incl SC1'VlCC2llJlC, of thc ri fht cut and color. ' 3 - .1 3 . 0 .. 8 .1 0 .. 3 . . . . . 3 Q A 1 ' 1 . J X 1. 8 .. 3 u . Q 1. .. . 3 .1 1 1 1 A 1 1 M 3 . . 1 1 1 0 3 I , . . I 1 1 . ,, 0 3 3 1 N I 1 H ! D 0 3 8 If I , vu 1 1 , u OO Q , .. ,, ,Y , , . , , , 5 I I rr ' f 1 ' 1 1 . 04 00 0 3 o . N 0 oo 3 .. 3 f .. 3 . 0 3 l I I I 3 1 ' 1 ' .. Q . 0' oo 0 .. . XYQl 0 ozegogowwgogogogo 029247 oxowxo O o2o2o2et0XoXOX0t0zOzo202o otozoxetotoxoxo ow!ot0:02O3030303030103020202030X0!0t0802020 GOOD APPEARANCE Is NO LONGER OPTIONAL BUT QU NECESSARY PART OF THE FIRST IMPRESSION THAT COUNTS FOR MUCH TODAY Good Appearance ust what is good 21IJ1JC2l.l'Zll1Ct. F That olcl question hohs up again. And what is stylt F Soczety Brand Clothes The wiclu' shoulders, narrower hips, shortu' coats, full trousers- thtst arf. some of tht naw ftatures. And of course 'I ptrftct fitting. Knox Hats One of tht iirst Elllll most noticuablt things about man s attitu is his hat. lt must hw. the right shaulu, and shapt. WL havt thnm. Florsheims . The shots arg one of the most important factors. lhey must Manhattans A hanclsomt soft plgatecl skirt with stparatt collar to match, or plain or fancy stripul shirt with 'lll.E1Cl'lLCl coll'1i'.--Silk nuslctit. Furnishings Thun, of course, that Zll'L othu' small things such as lntcrwovtn Socks, Chtnq Tits l'II'is Cizirters, V'u'sit3 UncleI'wL'I1' :Incl P'lj'll1lZlS. H71 hour all flu ilzings filo! uno' to malt 'Good .flfvfvtcirzznct ol any prim youd likt fo fog and wlzattvz 1' ilu jvrict youll In ' .mf I o o la l CV' nzomys 'wo'11. J EYZSCS NSCO THE BETTER STORE l-lARlxlSONl Ulxfqi - - V - VllxClNlA O oxow 3z3:Qxoxox3z310x3w23!3z3z3z3z3t3!0 030 020803020 0 3 ow 41 o o o 3 O o O 0 O O to O20 o o o o otoxoxo O A Y' 6004060 59 0' to o'ozo.exo.o Q o o owzote 0 o e'e:Q:o.o o:o:o'e,o:o:o:o 0 0 0.4: me e o ozowzo 0:41.41 0,0 Q Q Q 0 Q 4, Q Q ogg 0,0309 9:9 A39 6 A 4, Q O 4, 4, ow 4, Q 9.9 9 0 0 9.6362 030 0 0.0.0 0.0'0 0 0:0 20 0 0 0 0'0 0 232233 ' 'Q'2322Z.32223Z20202020!020!0203 2 3'.2E2 Q 3 3 Q 1? CD Q 0 Si N O 0 : D- 3 P ii Q gm 3 E pt 25 li S , -1 A .5 P Q O 3 .Ig QI Q' Zi Zi m fl 2. I ' FD Q - .. gg CD 3 .4 .J 4 Q Q' AAA: in 5 L - V1 A pl: .Q ' A hi. Q .A I A 1 3 r - .. : CD 2 ' - .- ,Af 9. f Z' 1' .A I 3 H f - f. 3 1 YA 3 A A' I o 3 'A O0 . I 2 . , 0 .4 1 I O 2 0 KA 8 I A - rn 2 Z? . , 3 J A 8 I E f S 2 IA E 5 13 3 2 Q -4 in Q 3 UD if - O0 Q Q . N Q . . 3 ..'. . ... t223t.t t.'-.2 2Q:QtQ:Q:Q:Q22Q:Q:A :Q::-:::.0 0 02Q.Q2Q.Q'Q.Q Q Q Q Q Q'Q Q Q Q Q Q Q Z r -I dv r14 f 1' E fi U' 'Q.Q Q Q Q Q 'Q :Q 'Q.Q'Q :Q:Q:Q MANL I AC ll RFRS OI 0 0 0 I-IICII CRAIII UNIFORM CI OTI-Ib OLIVI DRAIN SKY AND 0 020 0 0 0 0 0 0'020 30'0'0 TOR 0 ARMY NAVY AND OTHI R UNII ORM PURPOQFS tg AND Tlll LARGTST ASSORTMTNT Q 0 AND BEST QUALITY K 203020303 fl IP U 'Tj Pi fi 55 D' P4 CD 2Q:QtQ:Q 3 3 3 3 Including those used at the United States ' 5 Military Academy, at West Point 2 and other leading military 03 to 3 schools of the 3 ' Q 2 country 0 ' oo W 0 .. 4, 0 QQ .. 4, 49 0 8 3 8 2 3 , I , 2 PRESCRIBED AND UbILlJ IIY THE CADETS OF 3 0ZQ :Q3Q AUGUSTA MILITARY ACADEMY 020203020203 '5:Q'Q'Q'Q'Q'Q'Q . . . . . . g:Q: 0 .. 0 .. fi: 23 .. 3 fi 8 0 .. 0 .. 0 3 5 0 .. 0 .. 2? Ei 3 2 0 .. 0 .. 3 0 .. 0 .. 0 .. 3 3 0 .. 0 .. 0 0 .. Z' OO 0 .. 0 .. 2 0 .. 3 2 Z' OO 0 .. 3 S2 0 .. 3 Z' 23 .. 2 2' 00 0 .. Z' 5 0 .. 0 .. Z' 8 vb' so G 02020302010 0:0 020X01030202030102030202030:0x0x0x0z020x0x0z030 020 0X0!0z0 0:0 0:0130 0x0S02020z0t0:030!020X0X0!0X020X0X0S020X0 3 3 3 3 3 3 3 . 3 5 BARTH--WEINBERG AND COMPANY 5 O0 3 3 .... . . 3 Q Th1s estabhshnaent IS recogmzed tar ancl wlcle as style leaders Q .Q . , 0 tn Young Men's and College Clothes. Q That IS why the Cadets of A. M. A. constcler our store then' Q O9 OO 3 headquarters. Q OO OO 0 U . i 0 g Clothes by Hart Schaitner K Marx, Kuppenhenner, Schloss 5 Bros., and The Frat. 40 OO 0 , . 0 Hats by Stetson and Mallory. 3 3 ' 3 Q Emery 5l111'tS, Patrlck Sweaters. I-loleproof Hostery. 2 06 Q An excellent hne ot butt Cases ancl Travelmg Bags. 3 3 3 3 5 BARTI-I--WEINBERG AND COMPANY 5 3 . 8 -.S'TzIUNTO1V.S' LEADING CLOTHIERS- Q 5 3 Q0 40 0 O Q 0 OXGXQXOQQXGXOZOSOXOSGXOXOXGXOXOXGSOZOSOZQXOZOXOXO 020 4802020292020201030203020102010202020 OXOZOXOXOXGXOXOSQXOZO20263020 Q 3 3 3 3 40 OO 3 3 3 3 T H E S M A R T S H O P 3 0 3 3 . . . . 8 .flu Bxcluswc .S H O P, Handlwg The g 3 3 Q Fi11c.vf 1lfCI'kL'.Y of 1llcn'l1am1'isv for rl-I 011 Q Oo E 0 T . , 3 ,lg Nettleton and J. P. Snnth Shoes Q Manhattan and Harry Berger Shirts Knox Hats and lnterwoven Hosiery 5 wif: lNv1'r1z vom: vATRoNAm:1c ' 0 3 3 T H E S M A R T S H O P 3 3 Q SHOES AND HAISICRDASHICRY QQ 59 0 0 no 3 3 3 Q . 3 0 .. Zwwgsgs 0:03020z0x0:0z020302000S03020X0t0t020X0t0!0t0X020t0!0 0t0t0 02010X0X020t0203020t0x0X030x020:0:0x0x0z0zoz0wgQwgQgQgo 20 0 Q N0N000NonoM0000QN9n90oNeNQno0600Nonowen6N6nonAvuonouenenonononoueneweOQOQOQOQQQOOXVOOOOOOO 0 O O M . 0 . 0 O . O .0 ogyggono 2323330 900230ngonogxNagaouongaougaou003033300080 0 0 O 0 W M MW W w Q MW 2 0 O 3 W MW Q w M ,M 0 w M MW N W 0 0 W. S m N WW R w 0 N w M E I M 0 z z T 0 .M E m M M z 9 R 0 MW W . t H S 0 A S W MW MW -I w M ' 0 M Q r R 0 8 w D A J D W M 0 Q R y R MN 0 A E E t 0 8 . i A M 0 E N H N 'M U MW 0 X 0 0 R H U w M H T O Q Q MW W D 0 M C G - A 3 0 W N N E M I O 0 O 0 H W M T W M V' . T J N R MW 9 W N U U M X A O 0 Av U T Y :A M MW S S MW xl I A I M W A H M MW T T K M X MW S i - H V M 0 3 V Q w A N MW E M VJ- 3 MW 0 0 w X I 7 Q MN A - Om 0 It .5 X ' O O z X H MW - J .K 0 'L A My X ' V 0 5 I 1 mv. 3 D 0 A Q nw 1 A H 2 A 0 .2WM320uoggnog388808320M0noN0N00000N0N360000heN0N63303883000300u0no00030u0ngeguexnouaogngao 0M08Moggxneuonaonggon 0 M0M333oua3eN0N00o0x0N20 MW zoxozoxexotozo oxozoxozoxezoto 0 ototoxo 0 ewwxo30tow!QSQSOXQXOXQXOSQXOXOXQ OSQXQXQXQXQXOIOXGXQZQXQX O OXOXGXOXOXOZOXQXQ 90000.000.ogy0.0.660.0666Q.o.0.0.0,o.Q.o.Q.0,0.0.000.900.0.00QQGOAVQQOOQAVOAVOGOOOQQQOo60.06O'oO0.0.0O0.o4o QQOQQQQQOQQ Q9O.0.0OQ'0.0.0.o.o9o004Q.Q.0QQ.o.o.QMG.Q.o.o00.60o?V.O.e,O,0 7ITZER LER- E CIAL STORE - WATCHES YOUR RTERS TOVVN Vil'Q'il1iZl. Stz1u,ntm1, 203030!02030303020202030f02030303020302GXQXOSOZOXOXOXQXOXOXQ2. O OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOGOOOOOOO9000900009 00009 050,660.0 0900000 OOO O 000.00 SW L. -JEWE TH CADETS OF FI R 0 F PINS - RINGS MAKEIB HEADQUA WHJENIN Struct M 21111 liasl 19 Qwgawwzowxetotoxozoxo awww30z0zezozowxototototowwte 0 o . Q 23onon00606'QNONONonononouONOMQNOMQMQMQNQNouonoueNONQO006w0nQ000000000009000009000006Nen0Nouououououonenonenononoueuo QMQNQN 0 new 0 NGNON0n0NononouououononononouonoN00ONGMQMGNONAVMQ 020z0:02020:02020 3 .fa 0. 2 sa sf. 0. sz sz 2 EZ' OO 0. 0. .0 2? OO 9 OO .0 as fa sa 0 sz 2 sz 2 0. sz .0 sz 0 2. fa sa .fa 'Z OO 0 ze 0 if OO sa 2 2 zz E? O9 zz sz 0 fa Z' OO sz .fa 33 zz 6 DO sf. sz 020 0 X0!02020202et0Ze2 20zo:03o2o:o:o:o:o:o:o:o:e:4v202 JACOB REED'S NS NIFQRMS 202030249 020203030 FOR OFIPICICRS OF TIIIC ARMY, NAVY ANIJ MARINIQ CORPS, AND STUIJICNTS OF MILITARY SCHOOLS ANIJ COIIIZGICS 0303030X0!030'02020 0.0.03020'020'0202020'0t030Z0 we exo'o:e:e:o e o.e2o'o.o 0.0.0303o:ozo:Qze:e3ozo:e:oxo:e:o:o:o:o:o:o:e:o:e '0 20 0'0 02000 0 0202000 20'0202020f0f0 0 0 000' 002020202 020'0X0.0'0:e:oz0:0:Qso20zQ:oz0:ozezezozewzezowwzozo: 6. Q0 02 6 C1v1I1an Clothlng SACK SUITS, made of H1011 Grade Pabrlcs ln Accordance Wlth Indlvldual Measurements and Physlcal Requlrements 31850 00 10 fHs75 00 14241426 CIILSIIIUI Smut I'IIILAIJI'LI'IIIA 0.0 oe' 08020303920 tote 03 1 ' - 1 ' . . . . D , .. Qwzoxezoxoww ezowwzowzoxozoxoso 0 e203 t0S0 Q 020 020wwwwzo 0 0 owwww ew 0X029303030!93020X020 ewgogow oze:o3Q:o:02ozew:otozozozoz0tezozezozezozozotozmetotoaozo ozozezozozezezoso:o3o:o:Q:ew:oze:owze:ef:Q:Q3QgQ3omgegog93Q34,g4,w3Q:63Q:036:4,to3Q3020z030348920wwwwgowzozozo ow Q 90 3 3 2 3 0 .. Q M 3 2 Q N Q .. 3 o 23 N 0 .. 2 O0 3 3 3 2 0 .. o Z' 3 .. o N 2 Q N Q e 3 '35 OO 4: 3 .. 3 2 3 e .. 3 2 2 3 'EE 3 64 3 3 e 22 o e 3 Z' Ii o '5 0 2 0 o Q E Zi 3 o Q .. 2? Ei 2 9 his 'S not to t i to Clvertise 4, Qgog Qwwgexo oxoxoxozozezexoxozozoto ototozoxoxotototowt etowwtewww 02010203080802020!0www!0!0t0t0wX0wt0t0t0t0 Otewwwtotowtotozoxe Qzewxowzewwwwww owwwwwwwww Qwwwwww Q 0 Qwwwwwww aww ow iii Qww ow Qwwwwwwww ew ew ow aww Advertise Virginia ur being from 6 8020202030202030S020203030202020202QZeieiewtetetewtozezote Q20 Qwwtetowtewwtewtowwwwwzezewwwwzawww: wwwwww 93ewzowwwwze:Q:ewwwwwwwzozowzowx wum QXGZGXGXOSOXOZOSOXOXQSO 030XGXQSOSQXQXQZOIOXQWXQXGX OSOXQXGSOXQWGXOXGXOSQSOZOSOXOXQSG 080202080XOX02020!020XOX0203020203030 QXOZOXQXGXOXGXOXOSWSQXQ 0 020XOZ020X0202020XOX020XOX0202020X0202OXOXQXOXOXOXOXOXOSOXOXGIO to 0I020X0Z0X0201010!0202OX020!0X03020!0X030X0X0X0S0X0 020303020 AVWQMO0O00no00N003300O00N3330Non9NQMQM33033nonoN330NgQuQ00M308300M80MQ0N0W00830Ngggaouonooouoxg 0M0gngonouaggaaggoWone06MQgnouaaognouonogge . . . . . . . . . . . . . Q . . . C . . Q . . Q . . . . . . . . o . ? 9 o . o . Q . f' 0 . o . o . o . o . 0 . o . o . . . o . . . . . O 0 C . . . . . . O 0 . O . 0 ork W School To evoted D lant P ntire E TT E L IP SH E. WE AIM TO PLEASE- DRY CLEANERS A M A 0203036 010Seto2o20803020ZOSoto!0to20toxoxo2o2ototoxexoxoxoxozowgowg Q 5 Q Q .. Q Q Q 5 2 09 fi Q Q Q 0 2 Q .. Q Q Q 42 42 42 42 42 Q Q Q 42 42 Q Q Q 42 42 2? 1 42 42 42 3 5 42 2 0 42 Q2 42 42 Q . . . . . . . . . Q . . . . . . Q2 Q2 . 3 C Q Q fi 42 42 42 42 Q Q .Q Q 42 fi 42 42 42 42 Q 0 20262 OS-020201020202OXGXOXOZOSGXOXGZGS-92 Nzezoxoxoxozozvto 6 00200336Notmgwmone.ano8no3HmvHXQUAxX0N?oOomvnyeXn0Non00600NO0000300030032003000u000XN0H0030N30N602003303033320N3390300363000333383333336 W X MW MW 0 MW x 0 0 4 X 0 MN 0 D 1 MW 0 W w W U W w 0 Q M. L u M W L 0 MW 0 H W w .M 0 X W M MW 0 . U 6 MW 7 0 3 9 S t S Q I 1 w M V U 6 M N Xl Q 2 ' J M L g O M MW ' W IM L M M M F M Q M J A m e 0 6 I R d 0 MW' O U E n 0 W P T N D 0 M 6 R VV m W MW 0 t O Ll A e MW Q I I C F t 6 w 0 T U R i M 0 H N V h w 9 I I N G W Q 3 . 2 W T T A ,M 0 k O M H M 1 I ' w H N G M MW 0 ut lk L 0 X I t 0 Q4 I I Q t I 8 8 6 H t W w a w E P MW w W 0 wb 0 3 S 0 i I 0 3 L 2 0 a 0 M H 1 0 M H W MW MW h r M M Us 0 MW x . I x 0 I P 0 M V M 2 . 1 t M K M X . 0 Q Q M M 3 M M M 3 0 , , Q S WW 08 3980083803one0203033833333080830N238ggagug33838083ugagouononaoggnaS3330 3300303 333633330333303803333????30 0 O Mon0NQNQNQN0000Queuouonouonou0MQNQNOMAVNON00Q0QMQNQNQNQQVNONQN0M000000onQNQNQNQNQNON00606.900N60ononeN00ouououououououonONQNAVNGM0N000000000Nou00000N0we0OSNQQNQNQxvnououonouoneuoV 6 Av 0 8 X W M x MW MN 0 MW 0 0 M M 0 W 0 w 0 MW 0 0 M W w 7 w 0 W W J MW w 0 w I 0 0 9 M M MW S N 0 w J 0 W I A 0 MW 3 A WM 0 I C N 'f 0 t X. w ll A Q 0 .M 0 1 M X Y I M I 5 T H 0 w Q I S 0 MW 1 E D ,X 0 0 I 0 00 towtotoxotoxo 0223030 0S0303exe:otototexozoxozoxozoxoxo o 03 '23 OO 2 OO 0 .. 0 .. 2 0 .. 0 .. 0 .. 5 OO 0 .. 0 .. Z .. 2 2 2 0 .. 2 0 .. 6 .. 0 .. 0 .. 2 2 2 2 5 OO 0 OO 5 OO 5 09 2 0 .. 2 0 2 O9 2 2 2 2 2 0 .. 2 2 0 .. 5 OO 2 2 2 2 0 0 .. 0 2 2 2 2 0 . 6 . 2 5 O9 2 0 .. 0 .. 2 2 5 40 N 2 2 2 2 2 2 2 2 0 0 kv K V I S U 4 I C X :A I NETTL AN TH I SM st ,I X N U X020!0X020!0S020 022202030 030303030S030X0!0SOXOXOZ0303030XOS0 Qwtvtexoxozexoxoxoto o o ewtowto o oxoxoxoxo 0302020 ow X832 totezoxozozoxoxoxoxozoxoxozozox xoxoxo oxoxezoxoxozoto ozoxozo 0 0 PHONE 138 PHONE 138 3 O 04 3 q 2 3 3 3 3 3 7 3 3 3 3 3 S? 3 Centrally Located 0 0 Of OO 0 0 8 3 3 3 0 0 3 3 3 3 .. .. S3 I I I 5 OO OO 3 9 -2 f 3 3 - W' XX 3 ' 'Tl ' .SL-0 , OO I ' O0 Q N -A 3 -- f 0 me an - an 'kg 8 :Hi . :fp 23 3 .ww 1 - XJ 1. ' ff- 8 '27 ' -ze 3 3 3 3 3 Q .. 3 3 3 3 3 3 3 3 3 3 3 3 'is fi' ' 3 oo . , oo 3 -Let Your Wants Be Known To H1m-- 3 OO OO 3 33 99 , O0 3 ' 3 Q A. M. ARN0LD,P110PRlEToR 5 Q9 OO 0 0 3 18 North New Street OO 00 0 , , - 0 5 STAUNFON - - - VIRGINIA g 0 0 aw:ogowwgozoxoxozozoxoxo www!oxoxoxezoxototototvw 0303 ow o QXQXGSOXOSQXQXQZQSQXO 0202 30 o QZQXQX SOXOXOSMO 020802 2020!0Z0!03020!0 0202020 0Z0!0!020X020X0X0X02030S0X0!0X0X0!N T5 Q o Q Q Q Q 4 Q Q Q 4 o o o 4 o 4 o 4 o 0 6 o 9 9 0 o 0 26 I5 fl Eb 0 Q 0 o 9 0 o 9 9 0 Q 0 o 0 4 EZ o 9 oo 4 1 0 Q 0 o 4 0 o E 3? 9 0 oo o CE IAN IA o o .. 8 6 6 6 OO 2 5 8 6. 3 5 O9 2 OO 6 6 6 6 00 2 8 5 6 'fi ii 6 6 6 6 6 6 6 6 6 6 Ei 43 o 91 6 6 6 6 6 6 6 6 6 . . . . 9 O . . O 0 6 . . Q . X . i . O . O 6 0 6 . . . 6 . 6 O O O 0 'Z o 0S0X0X0X03030X080X0208030!0S0S0t0!0!0:ox6xozeg030wgQg0w3'5 0 Q t X 4 P O O H W M Q G M G T D R W W I .M w T V vw 0 R X X 0 MW 0 t 0 F w x O MW M 0 3 MW W 0 x M Q z 2 0 0 2 8 0 0 1 z Q 0 X M Q z M Av 3 8 0 w M W Q 0 t M MW 2 0 0 t 2 0 0 3 3 G O 2 M 0 t M 0 2 X 0 O 3 X 0 0 z 2 0 0 X X 0 9 2 MW w X 0 083333 030QN030833008200030O300003300N33003onQN330M383000033Q03ONOH3300833333009833033820New000023333382Xagggonou00030303 W XOXQXOXOXO 0XOX020X0 0 030 0201030x020X0X0X0XO202010f9:030 to OZGXOXOXOXOZOXO OXOXOZ020XOXOZGXOZOXGXOZOXOXQXOXQXOXQ 9 0 gxoteto I I N A I I I Q I F JR , 1-1 PINS SS LA ' C NGS I LASS EWELRY F RA1 ERN1 r Y INGS R ENI , 0 0 G K C3 0 STALNTON, VTQG N A 1'AJ,QLA2T'Q5 C R - ' J A.M.A.S 0 R 0 Z O 0 Fu L' f .1VI. A. Jewelry Z Z 0 1 , 1- H 2 0 0 O 0 Z 1QAJLAT N Z .. .Q ., Z ' 0 0 0 0 9 0 so Z 0A 8 in l l ENS lfVHEN IN THE CITY- IN OU4 D I N llliy- - U xl K E U 5' VO U D C I C o QQ o QQ o QQ o QQ 0 QQ 0 QQ o QQ o QQ 0 QQ o QQ 4: QQ o QQ Q QQ o QQ 3 3 0 QQ Q QQ o QQ o QQ o QQ o QQ 0 QQ o QQ o QQ o QQ 3 0 QQ o QQ e QQ 3 e QQ 0 QQ ' 3 o 3 O5 o QQ 0 QQ 0 QQ o QQ o QQ 3 0 QQ o QQ o QQ Q 3 3 5 3 0 QQ o QQ 3 Q9 QQ OO QQ QQ QQ QQ QQ QQ Of QQ QQ QQ 0. QQ QQ QQ QQ .9 QQ QQ QQ QQ QQ 'O Q0 0 QQ Q 3 3 3 QQ ST LA F5 'l'lIA'l llf G Of 42 3 3 5 QU 5 3 0 3 3 42 e QQ 5 QQ o QQ 3 f f 5 QQ 3 3 3 e QQ 0 QQ 3 Q QQ 3 o QQ 3 3 5 3 3 Of o QQ 0 QQ o QQ e QQ o QQ o QQ 3 o QQ o QQ o QQ e 3 QQ 5 Cf 0 QQ 3 0 ff 3 3 5 ff 3 Q QQ o QQ o QQ 0 QQ 0 QQ e QQ 0 QQ Q QQ 3 o QQ 0 QQ 0 QQ 5 3 3 5 Ii 5 0 5 5 .O 3 o QQ xoxoxowww!0Xoxoxoxo:oxoxoxo!o:oxozegogogQgQg0gQgQ,gQ,w3'f O 020 QwgQg030gQgozo:ozo!oxo o o ozoxoxozavtotcvtotfvtfvto 0808480302 exozotexowxoxowxozoxoxoxozozexowwzo oxo:oxoz0x0x0 08030 20 0 0202020202030z0:0!0X0t0t0!0!0t0 Q' !0SOSOS050!020Z02020!0 0 O 0 MILLWORK LUMBER 2 O9 B U I L D 1 N G I s U P P L IE S lb O9 3 3 ' 0 2 Q . 3 Q We will BUILD ANYTHING you want for your house if 90 R , ' OO we do not have it in stock. Our MILLVVORKING PLANT 2 ' . . 'f IS equlpped Wlth thoroughlv modern skilled mechanics and 55 99 ' v OO gf artisans. Q 2 5 3 8 0 O 2 Q . 3 0 A E FS IH C 1 C I' 3 ' Ei - 2 - 0 -Phone 768-- gg Staunton - - V1l'g1ll1H g v O9 5? 3 N 0 :E Ogowgogewwzo :ozoxoxoxoxozowxoxozoxoxozox xox0:020xoz030t0S0!0 t080!0808020308020!0!0X020!0!0X020Z0202020t0x0toxo3o:0 I3 Z 2 42 3 K , Ei fi , fi STAUNTON, VIRGINIA 0 3 S 3 3 2 Episcopal School for Girls, maintaining best Virginia traditions of refinement and culture a 3 ' 2 Q f TIIOROUGH COLLEGE PREPARATION 0 3 3 3 OO QQ :E Varied General Course Outdoor Life bg 'Z -Eighty-Thircl Year Begins September 14, 1926- Q 0 Fon eA'rALoo, ADDRESS ' 2 if fi: I MRS. H. N. HILLS, PRINCIPAL , 5 3 3 3 0 . Q . Q eww ozoxoxexezozoxo 0: 020!0zozozoxowzo:0xoxex0:0x0x030 02 03020 03020 0 0:02020 0!0t03 ow:oxowzoxoxoxagegogogegegg' 3 otetozozo3ozozozo202020Soto:Qxo:e:ezezezozowzezozoxozozoz0 0:ozo:moto2030tow!03030!020202080203020302026302020'otot0:Q:0:o:o:020t020t0tG202Q20302030ZOSOZQSOWXQSOSWQSO202020 v 3 3 3 Si o O 0 3 3 3 3 ,Z U2 m ,Z 2 ' rs 5 C .. as 3 , 3 T1 Q. 1 x-1 G-4 3 2 .. -4 Q.: Y , M Q 0 ' Q .S- P, LU J? O 0 oo 23 Q f-+ N 2 3 ,T OX S- C1 L-4 fb 0-4 m 3 Q A o ... ' Q. -I p - 0 23 : 90 Q Y 'T' : 3 2 3 8 ' L- Q' Q tl .-4 vi Z 25' 0 'E J S N O O 1-5 A 2 ,,, 0 m fi .2 2 9 rj Z. ,... 2, jj 'Q 3 ' 33 Q N 7 T f+ N o Q '6 2 2 A - Q, v .J f f-r ' 0 3 3 Q fa -1 as G :Q rn O 0 Z! 3 Z 5' 3 IS f-P su '-' Cn 3 3 2 ri 4 3 ,M Cl F1 Q. ... :x 0 5 3 K4 Q Q 2 H o ' O 3 w '- O 0 U7 8 r- ' w FJ -. : O 2 .. 2 Bb Dv 2 5' up Q S. z H S g 2 0 L-I U3 0 A f-9 ef Q U' 2 ov -H - m-H. U1 Q sz - 5 N ay 2, -4 m 'U M 2 M 2 I-4 ab 52 9. I 3 U7 Z 3 2 C 5 3 oo ez 2 2 f-4 fi Q 2 cn Q 2 '5 U 3 Q 3 54 ze ze 0 P ga ox020:036:020:02020:ozo:ewzQze:o:oze-3ozo2030302oxoto2Q3020:020SGXOSOXQSOZOZGSOSOSOZOXO 9 ,, D .. .. 3 Z hu gh .Z Q. P P Q cn '-' 4 ts ., F-1 N N 1-0 P ff si f' 2 E P 2 2 K3 2 5 S Q 9. I-' U3 3 H- 4 Ui W zz p '-1 .fa Q - P1 2 Q P4 0 :S C7 '4 0 25 Z '5 '-' Cf '11 cf 29 3 ,... E 3 O ,-, F1 ... -I he 3 3 U U2 sg 'U OO K 3, m -1 ' Z L.. 2: V 60 5 Q-r 3 F .. w 0 P1 :1 z gg 2 fi 2 O -- 7 O Ib O 3 fi 3 5 Z :D Un Z 3 Z Q 3 2 2 G C Z w L V3 3 2 ' 0 25 u-1 '23 2 so z . Q. zz N 0 N9 -- '-4 K5 ...I 3 3 3 .. cn Y Q x In ,, 3 3 Q.: gf L -4 Z in J 3 3 0 xx rs -1 Z CD Cf' Si Q 0 fb In NU 'U 0 N fo I Q-e Z W pu 3 2 3 4 UU Q t-1 N 3 0 --- Q b- A 53 0 Q '-: sg ,. N 3 0 73. S' :Z 0 X 3 1-1 Q 2 OO O6 . Q 9 3 ' 3 E3 Q 9 H 9. Q 3 .fa 2 .3 o 0 ,, 3 Qzegozogo:ozQ:0:ez030:0zozozetozoz0:ow2020:02020wwt02020W3680:ozo:ozo3oto:etozezozetote:Qzow:0:MeccaQ2Q20:oaozotetototezozotowt0xozezezezexoxo:0zo:Q:o:e:o:0to:0:o:Q:0!o:o3o 0 0 939202020202020202020202020202020202020202020202010202020 ow o ewtow!Qt0t0t0S03ewwto2QSQt0S080IOXvwtototeiotewtwvtoto 0 0 3 3 3 3 3 3 .O 1 1 ' 1 1 1 1 1 1 2 11' C,A1J1',TS 1'.V1LR C11'.T HUNGRY-we've heard somewhere that 5 . - , , - M A ' Q 4, J Q . A . ! gg 1t's the tirst call that fvlvcrxcx YOU and the recall that jvlca.s'cs US, for 3 0 - f- 1 1 - 1 5 then we know that you were SATIS1'l1'.1J wlth our 140013 and our .. SERVICE. Q OO x . 3 C1 7 Z 3 J . 5 2 1lI'1S estaurant 8 ze 1 . 0 3 6 South New Street 0 - . . . 3 Staunton ------ Vmrgmm - 0 2 Q o ow otot02otot020totowtotezozozoxotoxo 0 oxoxoto exe 63020 oxeXex020203oxoxox03eww!oxoxoxoxozoxoxoxoxozez :Q 0 eww Q 3 3 8 3 3 8 8 N no oo 8 25 . . 3 J. L. BAUGHER WILLIAM S. BRYAN 35 4. 3 3 sucwlfzssola 'ro PARKS 2 O9 00 02 8 2 3 3 3 2' 09 ' ' I I A ob 0 Q 1LV1'.1xh,T111NG 0 S O IJ A jg Y, 3 YOU NILILD IN 3 5 C, A N D Y 5 5 0+ Q 1'U11.1J1NC' Q 1 C I G A R s ' ' 0 o o oo , . ,, Q 13I1.1.1ARIJS if 00 2 fg 2 ? 3 3 ' Q - so Q Q -Phone 615- .2 OO 0 . f, 8 , . ., 23 3 Corner New and johnson Streets gg 114-26 South Lewls Street 5 3 . . . . 2 U. , . . 2 5 Staunton : z :: Vlrgxma 2 Staunton : : Vlfgllllil Z 0 o 'S N or oo 0 o e 3 3 3 202020 20202 020 they do fvlcast call on US C,a11 1 ART Y and OI T1 N and we lmow 202020 20202020 02 that youll 202020202020 X0 020 20202020 ozo2wexeww:Q2otoxex02020202020wwwwtowtexozozoxozozexoso oww2Qxo:exezezQxoxozoxozoxozexewwwxozozoxegegogegagegowgo 030302020 e 0 otezezexoxo oxoto oxotot totoxexoxexoxo 0 xozozozoxo o oxoxoxoxo o o 0 e o oxoxo o exe ow 0 Q 0 EAT MORE IMPERIAL The Cream of all Ice Creams IMPERIAL ICE CREAM CO LAMBERT MANUFACTURING COMPANY ALI KINDS 0 .. .D I MATIIILICAL VVAYNVSI UIXO otoxotozoxoxe o oxototototo 0 08030208080 02020 030 0 0808020 0 ozotoxoxo exe' oxotowxoxozo ow oxoxoxoxoxotoxoxoxoxoxoxo e 7 RANGE lvalxoa ICED' TEA 215115 FANCy A C oRMlcK 8- C0 M CBALTIMORE USA Banquet Orange Pekoe IS the Choicest of true Cevlon hill-grown tea famous for the fxnest flavor. the most fragrant bouquet and arlclp w1ne-color xn the cup Wlth tmkling ice, sprig o mint and SIICC oi lemon that flavor is even more brilliant and refreshmg DIRECTIONS FOR MAKING Always use , anquel or earthen-ware lea- pol never In a metal leapoi. Scam one- hab' leaspoon ul to a cup. Use fresb waler boiling hard. Sieep 3 lo 5 minules and re- move leaves. A WONDERFUL FLAVOR In air-tight cans-Pounds halves and quarters MCCORMICK 8: CO Baltimore, Md Importers and Packers JUST TRY IT ONCE-ICED B Q E null X HH X 34 3 2 0' 2 3 0 if EZ 0 5 3 0 ov 8 0 2 GG 77 3 0 2 3 0 0 e 4 e no ,, 5? 3 Z 2' 5 a ' oo oo 3 0 3 3 0 9. X 0 3 2 0 8 0 0 0 0 4 OO 2 Z 5 , . 5 0 It U 1 1. N C, 5 3 0 3 3 0 1 W 2 3 0 J 2 2 0 2 if 2 5 Q , 5 2 . 1 ' Ei: 59 40 0 oo 3 2 V I R G I N I A Q N oo so 3 3 3 9 0 0 V' oo no 3 0 o 0 8 3 - ,Z 'f X 1 fbf.l,gj1f 1551, --:--:thi 5faiI2f.:'2'f6 an Cf' Z 5' -- Eg- HQ- .Q D -if I II A. I I I I '3 I' 1:31:i3V.2, ,F :'f I ,QF 13133 3 fllfigaiffi o 1 . - - , - xx ,.-1 W u I -VIII!-Ill! , 1 I ' 1 .,...... ., ,- um ' ' ' I N u f- H 'S A , I , A ' I l v J 9 1- xa 1 :g3'-14,3-vi. 4 Q --fffj ' um mm ua,u.s,nv.om 'W' mn f ,y , -..'ff? fEEEifL I E f . ' Beautifully Appointed 0 0 02QXQ2Q:Q QXQXQSQ!Q2QxQtQxQXQ2Q:QXQXQ:Q3Q:QxQtQ!QzQtQtQ2Q QXQXQZQXQXQ QXQXQXQSQSQXQXQ QXQ Q Q Q Q QSQ QXQ QXQX-QXQXQXQSQ Svtauntnn, Hirginia z Q EUROPEAN PLAN ABSOLUTELY FIREPROOF M oo oo 0 iilntvl Svtnnvumll I-Uarknnn 20 0 Most Modern and 2 2 'GPZOXOSOZQZQZQZOSOZOZOXG 2 In The State of Virginia A. T. M O O R E, PRESIDENT 02020 0 0, 20202020202 In The Wonderfully Beautiful Shenandoah Valley fi Q N Q N '33 00 Q N Q N 3 Q N Q .. Q .. 53 Q' N Q Q 'Q Q Q 'Z O9 3 Q if O0 'Z 'Q Q Q 3 Z' O0 Q .Q 3 Z' 90 fi Q N fi fi' OO Q .Q Q M fl' 'Q Q Q Q Q Q '3 00 Q 0. 'Q Q W Q .. Q Q Q Q QZQ 3 Q2 2 Q N 3 2 fi Q N 8 SZ 8 Q N Q N 2 Q N Q X 3 Q N Q N fi Q N Q N Q N Z' OO Q N Q N 2 Q N Q N 3 2 Q N Q N Ei' OO 3 3 Q N Q N Q N EZ Q N Q N 'E 23 N Q N Q 09 2 Q N Q N Q N 2 Q N Q N Q N 3 Q N Q N Q OO Q N Q N Q :Q 4,3Qgowwwwgowgow3Q3030wgQgagQwgQ30gQ3Q3QxQzQxQzQzQzQzQxQ QxQ:QtQ:Q:QxQzQzQ:QzQzQxQ:QxQ:QzQ:QxQ:QtQ2QtQtQ3QtQ2Q!Qw!03030 0 Q O ,, Q -Bryan's Department Store- 3 BUY 0 0 so M 1 . . - 0 0 Staunton - - Vu' 11'11Zl X 8 N M 3 3 MD oe 3 0 Avuss 3 N 3 3 HEAD g 3 N 3 T0 FOUT 'E KANGAROO 2 9 . N 44 OUTFITTILRS Q , , , ., Q ARCH SUPPORT SHOES 2 V1s1t Thls Store 8 5 tg , . , 25 K 9 3 When xn Staunton 3 5 ft Q if 2 2 8 f Q 0 ff -You Arc Aiwa fs W'Ic0mc-- . .. K 9 L 3 11011 SAL12 0 oo -Bryalfs Department Store- Q 0 oo 0 UNDER 'rim TOWN CLOCK Q .F '1 r u 1 Q. y- -1 O. if Staunton - - V1I'g'I1112l RX ATL GOOD DILALERSH 2: 8 5 OO O9 O. Q Q Q 19 fi 32 ' QZQXQXQZQXQSQ!QtQXQ2020308080308QXQXQSQ!QXQXQXQxQxQxQxQ3QtQtQ3 xQ Q GXQXOXOSQZQXOXOSGXQXOSOXOSQZOXGXGXGZOXQXO Q:QxQXQ2QxQzQ 5 eg 3 eg 3 V I l I U I Q E Q 22 1rg1n1a 1l1tar Instltute C' as 3 . 3 TEXINGTGN, VIRGINIA Q 0 . 0 Q 3 187th Yearj 3 3 8 0 .. Q 'O . . . . . . 0 Q A IJ1'OgI'CSSlVC eclucatmnal l11Stl1QLltlO11 whose enviable background ' ' . . . . . . . . 3 2 ot f1'ZlClltlOI1 and aclnevement QIVCS It natlon-wlde patronage. 3 0 . . g . . . 3 Q Technxcal and arts Courses ot Tull colleglate standard comblnecl Wlth 3 ' . . . . . . . . , Q Q a Tlgld mllltary svstem WhlCh has always recewed the hxghest ratlng 3 ' . . .' 9 ot the Unlted States VVa1' Department. 5 3 3 0 0 Q . ' oo Q lfor Pll7'f1C1t!U7'5 z1dd1'vss 3 Ei 50 ' g GENERAL W. H. COCKE, SUPERINTENDENT so ' 3 3 9 0 0 Q - 3 0 1 zewtozetowwtotetotetotototewzogegogawgogg S TRAND THEATER HO M Ii O F FI NIE PHOTO PLAYS !Q3020303e3o:o3ozozozozozozezego I STAUNTON VIRGINIA 020302G3G!030Z02020.0202020X02020302472926!02620Z0.0X0202e2o 039245249gaggpg0g9gQgQg9gQgQgQgQg9g930:Q3Q:Q3Q.O 2 2 o .. o .. o .. 2 2 o .. o .. 2 o OO 2 0 .. 9 .. ii 3 2 EZ' 60 fi 9. 3 2 Q .. 0 .. o .. 9. o 2 EE 2 ow:0203030Z0tQw20Z0t0Zozototozozezcazozozewtezezozezeww3034.gQgegQg4,gQg0gQg9gQg4,gQ34,34,, 8 9. o .. 0 .. o .. Ei 3 Q .. o .. 0 .. 2 2? .. Q .. o .. 0 .. 5 O0 9. o .. o .. o O6 3 o .. o .. Q .. o OO 3 o .. o TIMBERLAKE DRY Goons Co. DRY GUOIJS M ILLI NERY RICAIJY-'PO-WEAR -I'I1one 211- Stnunton Virginia HA RICK 81 COMPA FLORISTS IIOXVI RS IDI LIVI Ixl IJ ANYVVHI RI BY VVIIx 18 Wcst 1'ICfIL.llLIx Sheet Qtaunlon, Vllglllla Our lflowus fllwayv O11 Drew Parade 0 3 2 fi O .. fi' OO 0 .. 9. fi' OO 0 .. Z' 3 0 .. 9. 9. 2 0 .. 0 .. 0 'Z O9 fi 0 .. 0 .. 0 .. 2 0 0 .. 9 2 3 3 2 fl' OO 9. 0 .. 0 2? 3 .. 0 .. fi 3 0 .Q 'fr '6 3 00 0 .. 0 .. 0 .. 0 .. fl 0 .. 0 .. 0 .. 3 3 fi '5x0.6.Q......... Z. . . . . . . . . . . . .6.0.0.0.0.0.0.0.6.0.6.0.0.0.0.0.0302036262020202020302030202020202020203020:QgogQgQgQgQgQ3Q39gQgQ2Qwgqygqg4,393934,36:934,3Q:Q393959:Q3026.9362020z03OQ6:oz0:Q30:9:9:9.9:o.6.4,:0 i 1 i. ?.WC'.' i 'Vi Q E .'Ii A -1 xxx' ...A - ... . ban f H , , , I , LL- QXGXOZQXOXQSO2020X020X020I0X0X020X020X02480XOSOIOXOXGXOXOSOZOXO 020I0202030202020XOX020XOX020348020XOIOXGXGXOZGXQXQXQXQQQQQQQ 026XOXGXOXOXOXQXQXOXGXOXQXQ 02020202GXQSOXQXOZOZQXGXOXQ 020892030 GXQZQXQXOZOXGXOXOXQXQX08020802089XOXOXOIOSOXQXOZOXQXOXO 0 0 0 559303039393030393030303Q303030303030303W03 W36303030303030 302Q202Q2Q202020202 202024,2itQ2020te:e:Q:e:o:e:Q:ewsexe:wezo:Q:Q:Q:QsQ:Q:ezQ:Q:Q2oz0:ow20sozozasesezozowzezozesow 3 E 23 0 :P P X 15 rr' 5 2 2 C' 2 - 0 4 E 2 2 1 T 2 2 O Q 0 3 5 H Us . 1 A 2 O w 0 3 Q A 3 O i-Q 2 V A F- 8 :U O 2: X' I, ci O4 L, -1 O 3 4 Z Z 22 Q Z Z1 .4 L' 0 - f- 75 Q 7: 3 Q P-1 3 - aj G ' -. 2 'z rn 'U .. .. C tg b -'I 2 'Z 3 ce Cf 2 C O -1 Q f-3 K-4 O 2 pg W C7 2 O ,.j CW 22 iq '1 O F Z 2 2 s z FP U 1 5 +-i F 5 Q Q Q 3 gg .L - r w gi' ,Q 3 P' 9 -75 E t-' F: Q Q-4 CD '51 , K Z in Cl -s 'Tf rp C O 5 23 9 2 E Z N f-r ' vo 2 4- E E I m IP Z 51 3 Db iq 3 3- , .1 2 , 3 - I I t- Q Z JJ 0 7:3 C5 2? 2? 5' O 3 69 -no O0 0 Q 47 .. c. . ., 9 0 1 O6 Q2 3 Q 0Z02otototctctetetewwtvtctot030242020202020!Q2Q24fw2020302Q20tototototozozosozozozoto Zyetotezezo:Q:egewg9g03QgsgsgQgowwgQ30wg9w34,3Q3Q59:634,t4,30w:4,30:Q:9:o:0w:o:o:03o:Qx HOGE BERKLEY STUDIO -PI I OTOGRAPHIER- 22 lfast Main Street Staunton - - Virginia OFFICIAL PHOTOGRAPI-lliR FOR A.-M.--A. S02020XOXOXOXMQSQSQXQXQSQXQXQ o2oxoxoxoxototexexoxoxoxoxoxo COLLEGE of WILLIAM and MARY VVilliamsl1urg-Virginia VVINTEK AND SUMMER SESSIONS Regular courses for Bachelor and Master clegrces. Special courses in Teacher Training Pre-Metlicinc l rc-Engineering Home Economics jurisprudence Business Administration Physical Training, etc. H. L. BRIIKIES J. A. C. CHAN1m1.1ck Rcgixlrar Prvsidvul CA'l'Al.0ti SENT UPON RIQQUICST O to .. 0 .. 0 .. .. 0 .. 0 g O .. 0 .. 0 .. 0 .. 0 .. 0 .. 0 .. 47 0 25 3 0 47 O 8 .. 0 Z' OO 0 .. 3 0 '6 .. 0 .. 0 3 '5 wezo:ezez0:02Q:020ww:0to:0totezesetowzQzozezozowaozozo Qwwwzozozozozozezozozewzf-.ezozowwgsgegswgQgQgQ,gQ:ogQgQgQ34,2Q2Qg0gQ,0gQto3Q303,ww:4,30g4,:0:w,:oz6mQ:Q:Qww XQ 0 Q Q Q Q QxQ Q Q Q Q QxQ Q Q Q QzQxQxQ:Q2QsQ Q QxQxQ Q Qt OSOSOXOXOSQSGXQXOSQXQSO Q QtQxQ Q QXQXQXQXQ 010303030 QtQtQ Q Q 2 E 2 is OO 0 oo 3 8 x 0 oo 3 S2 Q 3 X 3 3 Q 8 'fi Q0 . 5 C O M P L I M E N T S 3 ov 09 o F T H E 2 .. X 2 QQ Q 3 3 Q H 0 0 0 2 0 0 9, OO 06 2 3 Q N Q ' O6 ,, .. 3 3 Q . 3 3 Q 3 3 .. 2 E Q .. Ig The Most Up-to-Date Q .0 OO Q 3 Store On The Post Q .. 0 3 x 3 .. Q 2 Q I-I. BOWEN, PROPRIETOR 3 O6 '. Q 42 Q X oo X 0 oo .. 4, O oo .. 4, 2 8 ji Asszslalmt Clerks Q QQ Q Q 8 ' I 1 66 jg R. Bowen-VV. B. Huddleston-W. W1ll1HmS Q 3 8 0 3 3 3 8 6 3 3 OO Zi 3 9 0 as Q9 2 x 06 2 3 Q 2 3 Q Qc 3 3 3 3 2 QXQ:Q3QxQ:QSQ2Qzo2QzQ3QxQzQ3Q3QxQxQxQzQ:QxQxQxQ2QtQtQ!QtQ!Q2Q2Q QXQSQSQSQSQXQ OXQXOSOIOXQXQX Q2QxQxQxQ:Q:QxQgQgog9,,,w,6xo xi 0202020202020X02OZOSQXOXOXOIGXOXOXOZQXOZOZOXOXGXOXOXQXQIOXOXOSO 0 0 4308920202020 0 0 020 0 0 GXQXOXOXGXGXOXGSOZQXQ 103010 Q19 .. .. 3 3 22 0 2 0' 0 0 3 SPROUL AND CROWLE STONILVVALL 3 jALKbON 0 0 ' 2' 5 3 H OTIzL .2 53 SHO P .. 1 N 5 U RANQ12 AND A-'M- A' ,S 2 0 0 0 3 , , 3 1 1 J ' m FllJl',1.lTY RONIJ5 I' A TX 'I V- 'X 0 0 Q oo oo 9 3 3 '45 PRQM PT AND COURTIQOUS 3 3 3 5 5 3 0 PITOHL' 158 x , . 3 2 5 MZlSfJl1lC Temple M A X 3 3 0, 2 Staunton Vll'glHlZl M I X Q 0 0 3 '23 32 OO C0 6 ff 3 0202030202020 0202020203020 020202020 02020202020202020202020 0 020202 202020202020202020x020802030ZOS020ZOX0 0202020302020 2 3 0 3 3 .. - 0 Q 5 fi 12 0 0 oo -1 3 .. 3 0 ' 3 3 32 -6'The House of Fashion,,- 2 .. 3 c'1.o'r II 1-ls ov 3 OO QU 9 0 .. .. INDIVIDUALITY, DISTINCTION, and ATTRACTIVENESS 2 0 ' K OO O9 0 0 -for the woman who cares- 22 0 0 If 9 East Heverley Street 5 0 0 ,. 1 v 1 1 u .. Q Staunton - - V lI'gll1l2l 2 0 X Q5 05 0 0 95 'U 0 0 5 Ei '20 020 020 02020 020202020 02020202020202020202020 02020202020 02020202020 020202020202020202020 ew 0 0 0 0 0z0z0z0x0z0xow:- 6. .- '55 QQ 0 0. 0 .. 0 M '23 90 0 N fl 0 0 0 M 3 0 3 0 N 3 0 3 0 Q 0 N fi 3 0 3 3 if if 0 09 2 3 0 5. 3 0 M 0 M 0 N 0 N 2 0 .Q 0 N 0 Q. 0 W 0 M 0 .. 2 0 M 3 3 3 0 N 0 n 0 N 0 N 3 3 'IE .Q 0 3 3 0 N 0 N 0 n 00 3 . N 3 3 3 3 ' 2 .0 I , 2 .. a Youlx CHAS. HOLT, INC. I 0' . , . f fg PIaRbONALI'IY Q 14 lg A D E IQ S 1 Ig IS RIQFLIECTEIJ Ol? Q IN vow F A s I-1 I 0 N 5 .. ,, . V . 0. .. ,. Q C,LOTI4II'.b 'Z Q 39 3 .g 5 LADIES, 4 w - - ' if Y D 1 7 5 IQI'.AIJY-'ro-VVI'.AR Q if IVU .Solzwt I our Pcziromzga 3 M I L L I N IE R Y E 3 3 ' I 8 3 J . ' . ,, . . ' 5 GRIFFITH AND BROOKS 3 I IXY Goonil anna' Nollmw g oo oo 1 fit. N IVIIQRCHANT 2 CV, fuk 3 T A I L O ll g 3 IIRIAINS RAII'.IxII'.h 9 2 ' x . 0 5 0 ., 3 3 2: 3 3 3 N . ' 1 Q CHAS. HOLT, INC.. ' 5 blillllllflll VIl'gll1lZl 5 Staunton :: Z: Vlfgllllil 5 0 0 3 3 3 oo no 0 0 0 O 3 i 0 OO 5 Q303Q30wg03Q393megQ30303Q3Q3030303030:0303030:03030:030S0S000102030X030X03020203020202020202020t0!0t0t0X0X0x0x0!0x0:02020 2 zs Q Q QNS YOU Jwllfllvy .IICIVVUCI1 Nulv lllzlvs lfrom. fl. III. xl. 3 3 Staunton and I-Izu'rlsonIn11'g 3 Q2 :Q on the Loc Hlghway stop at H 3 Z' 5 5 oo . . 0 N fi Grand Caverns SCPVICC Statlon W H A T Q 0 0 . ,. ,I - , . . ' 5 A I7IzLIL1H lI'UL I IaA ROOM 2 3 wwe smev:-1 YOU 3 5 5 I-roNI:s'1f, QUICK ANI, RIGHT 32 5 H Comnzvdmux l.adzv.v' Rm! Room 3 Q 2 INIPORMATION GLADLY GIVEN Q2 w YL OLDE F ORGE 0 ,, , -1 - - - 5 IHI-, 3 Cwottocs - - VIl'gl1llZl Q Q -1 Q r . .0 Q RILIJ I-I R I C, K STATION fi Q IN 'rms fam:-:WAV 'ro 'runs c,xvlcuNs 5 5 3 .. 0 3 . . , 2 A I E 8 5 I N L I, A I Ix ig Aclmss mvm: FROM ILRANUQAVIQRNS 3 Q OILS ANIJ GAS 3 l 1Nli.S'T ll O M If COOKING Q 0 0 3 to Oh 42 . , 42 3 3 L. A M I 3 3 3 GROUNDS 2 0 . ' '- 0 5 g O V I' I' N 5 Hfxmw W. WILSON 231 Q l ' I I I' H I fi ,, R ,, ,, ,, , ,Q ,,. 0 R ALLOMMOIJAIIONS g 2 3 3 3 2 5 Z if 0 03020 02030302020 0t0t0t0t t0t0t0t0!0!0 02 30!0S03030X0!020!0 0t0S02 !ot0!0!02020 020202030 0 0303030 0202020 9393039 0303036 030!0!0X0t0!0t0ww 080Xow!020808Q!0t020w20w20X02020XeSo!o o Qt0t0ww20wxe ow e 0 0 Q e oxototoxoxoxoxozoww ozexozoww O 3 3 3 o o ,, .. 3 3 3 3 3 . 3 3 .. Q , 1 A , , 53 THF INJTTLIS THAF HO17Db 2 AUGUSTA FRUIT AND 2 lg THE A N 5 NV .IL R TO TI-HRbT 3 3 2 A E5 PRODUCE COMPANY 5 DRINK 5 5 3 Em Z wllol.1':sA1.1a Q 3 A V A A. . M t 3 FRUlTb AND PRODUCE if ,, Lz::1?:::1.iyf:'. 0 .. 3 A I 3 3 3 ' t f 3 . . 3 Q ' I HH Q lL.l'1'l1lA'l'Z'l' .flymzls Q 3 u ? . . H ' ' 3 'QIIVNOVV .SPECIALU Q 3 , 0 oo . , , o 13 111 lmottlab jg U U L. 7, at U C 0 .. 3 3 DICLICIUUS AND RICFRICSHING 2 Q J . , J , , .. , 3 Q A ILIIL lmvuagv. 5 Ilhonc 371 3 .. .. Q Bottled Hy 2 I4 johnson Struct 3 OO g STAUNTON COCA - COLA 3 gl 1 V. .ni 2 oo g - - - ' 2 Q BOTTLING WORKS. INC. - gl l ,, oo oo Q - 3 3 H 3 3 2Q3020xQXQX0:exe2030toXQz0wie:0x0toxoxozQ30ww3020X080202020:30SOIOXGXGSOIQWXOSOXOSO Owl'-W033303333 3333333333333333333333 3 oo oo 0 3 3 3 3 3 3 3 0 ,, 0 , .. ,, 0 V W . 4. 1 4 T .. Q 3 ' Q T TP ICL 2 5 WALTERSS QU1CK IAA ILNG ,R 5 xV Q 5 svlccml. A'I l'l2N'l'l0N c:1vlcN 'ro LONG TRIPS 3 0 .. 3 PRODUCE HOUSE 2 . 2 3 3 F1-:fc and .S'a'z'cu 3 4, 3 . . . 4, 3 3 1'arvvngcr Cars 3 0 3 . . O, 'w -1 '1 Q v K K Ig FURNBHILD ROOMS 2 5 NV HOLl'.bALlz 3 ,. , 3 3 .2 All, Modern L onvcmcnccs-Hot and gi 5 2 Cold W'atcr, Steam Heat, ' H 3 Flew-ic Lights 2 0 o o I 8 . E. , - 3 a HIGH-GkAlJI'. U J. H. RANDOL 3 1 , , 4. 4 K A F . 5 3 Ig I'lxUlTb AND VLGETAI LLB 2 Phone 9-1-5 2 3 2 No. 21 North New Street 3 Q H Staunton zz! :: :: Virginia 5 Q S 'I' A U N '1' 0 N 5 1'Assl':Nrucles cAl.l.lQ:n role AND 5 3 3 llliI.IVliRlill 'ro ANY 1'Ale'r 3 V l R G I N I A H OF 'l'llIC crrv 3 3 3 3 fi 3 3 60 3 OO 302 do Q Q. Q Q 2? Q Q Q Q 9, 0 3 3 3 o Q 'Q 3 3 3 23 N 3 3 3 OO 3 3 2 8 OO 3 Q Q e 0 2? o Q OX 0 2020 0X0X0X0S0X0X0303030!GXOXGXGZOSGXGXGXOSOSQXO e2020S0202020202020 0 0 020 0 ow 0!0t32020202o!o2o 202020 -1 2020202o2e2 2o2o3o Q o 0 0 0 oxozotototowxotoxo 0 202020262 3 - C A N N IT IJ 5 jg A. T. HIGGINBOTHAM 5 4 3 Q Q G O O IJ S E o 3 3 Ilczms g 9 0 42 .5 5 Tomatoes Ig 3 . I . . 3 8 XfVHOLI'.SAI..Ia I'IiUIJUCI'. Apples gg . .. , 3 5 1 N 1 Q W 1 1 q Apple Sauce 5 Q I'RUlTS, C,ANDIIzS, IzTC Q 2? x gs , is 5 3 Q 2 l'Ac'1uNc: FDR scflloous Q O0 O0 Q Q AND cfo1.1.1-:ul-:s A 22 OO OO 5 SI'ICl'IAl.'l'Y Q5 if 3 o 0 X I 3 5'AUN'0N D. s. THOMAS 1 1 1 1 .O Q V 1 N cs I N I A 2 Ilrulgcwalcl' - - Vurglma Z o Q ' 8 3 3 3 .. . ., 0!030X020X03030X'57XGXGXQXOZQSOSOZGZOXQSOS49 0 0 0303030393030X50630X0X030X030202GXOXOSQXOSOXOXQXOXO exesoxoxowwzowwwwzo Q 3 0 . , , . .1 . . 9 Q IMPORTRRS IJILSlGNI'.RS 3 o N 3 3 if CVCHS- ep Cl' OITIPHH 8 St Sh C 3 Q INCORPORATED Q 3 X 0 . 1 1 1 1 1 8 Q SUITS F011 GOLF, the jackets wlth plam backg Kmckers or the correct . 3 fullness 1 . Qs 2 SACK SUITS fm' summer wear in Iinen, ctc. 1 ov 1 1 - f- 1 1 Q LIGHT WEIGHT GOLI' HOSI', ' I 0 , , , 1 ., i , , 0 5 DUCK AND LINILN KNICKILRS TROUSI'.RS FOR TI'.NNIS, ETC. 3 0 -1 1 -1 1 1 1 1 1 1 1 - - 1 5 SPILQIAL SHIRTS III Oxiorcl and ISIQIIIII VVc1gI1t Fabrics for Sport and J 3 I OLIHUC Wczll' 1 3 ' 'H I - 0 0 5 NILQKWIYAR Ill Imported Prmts, etc., 111 varlcty 5 . . . 1 Q Spcclally Dcslgnecl HATS and CAPS 5 3 X 0 0 0 4 GENTLEMENTS DRESS, LOUNGE AND SPORT CLOTHING ' 0 . UNIVERSITY-VIRGINIA 1 y 4 zowz wxo owzozoxowzozozexoxo 0 oxexo o o ozoxezexowwwte 32023202323 32023X02020232020w2o o e Q 0 A A 0 oxoxe-wgogs A 0 130802430 02020X030X020!0X0t0t030!0X0t0t030!0:0 0302030303 030 0:0z0x0x0:exe303030:0x0302030:ozoxexoxewgowxezogo 03020202020 0 O 3 3 3 3 3 3 COMPLIMIENTS ART NVORK 3 8 3 0 If 3 . A .3 5 THIS BOOK 3 3 3 'Q 3 X 5 DONE nv g MONTICELLO HOTEL 3 8 3 .. 99 O0 00 0 0 0 R. W. Johnson rs 5 59 QQ 09 0 0 0 gg Q2 DESIGNER and DECORATOR Li 0 0 25 c'IIA1II.o'I I'If:svII.I.If: 5 , 0 0 3 S'l'AUN'l'0N 49 40 OO 0 0 0 VIRGINIA VIRGINIA 3 3 3 3 3 . . 3 3 3 3 0 0 0 0 oo oo 3 3 3 3 3 3 Q 020248089XO20X020202OXGIGS020202020262OXOXOXQXOSOXGXOXOXOXOXO XOSOSOX02020202020202OX020XOSGXQXOZOSOXOXOXOXOXGXO 020202 20 5 3 8 04 00 3 3 00 STAUNTON, VIRGINIA, THE QUEEN CITY OF THE VALLEY 0 0 0 Q Kznd F rzends :0:0t020:0:0:0x0 3030 302020 20:0 WIC IIAVIE THIE IIICST CLIMATE Wli HAVE THIE BEST SCHOOLS WIC WILL KICICP YOU COOL IN SUMMIQR VVIC WILL KIEIEI' YOU WARM IN VVINTICR XVL WOULD LOVII TO HAVII YOU IOIx A NIIIFI-II-101x NOW IVON T YOU CO'VS'f1DE,X THIS OFFIIIL C L E B ROT H E RS MANUFACTURERS OF ICE AND FUEL DEALERS gi . 2 ' ' 3 2 2 2 2 2020202020-30202030 3 3 0 8 3 0 3 0 3 96 ' X 3 3 - 3 3 I 0 3 O N 0 3 0 0 0 0 0 3 0 3 0 3 . 3 3 0 3 0 2? 23 3 0 3 0 3 .. 3 f 0 3 O 3 3 is . 3 v 5' A 2 A 3 Sf, - 3 O 2? 3 3 0 A E 3 .. 6 OO 0 3 0 3 3 -a 3 0 3 6 3 0 3 3 0 3 3 3 2 ' 2 2 :0:0:0:0:0:020202020 0 0 0:0:020'0 0.0.0 0 0 0 0 0 02030202020203Q20.0 O 9 6 onogxouo. 0 , M . Q 0?0.20300N0nonog0832303033e.e,o'o.0, O 6 O 0 Q Q .?Qg0o,0'0' . 3 O O Qobnouqeuo. 0 0 0 Q .o.?9NoNo6'q . X 0 O OQOONONOOQXVO . , Q . ' '0.o.00000'o'o'0' O 8 O O Q OOQQNAVNGOQXV, O 0 my O . .?39uoN006u0u0.05. . Q M M 6 O .939003326038830 0 0 x MW M w X M W MW MW 6 MN Q M 0 z 3 Q MW 6 X 8 Q S 0 X 0 0 t Q S Q 0 X 3 X 0 w w 6 w 0 3 0 X 6 3 0 3 6 X Q 0 3 MW S 6 X 0 MV. O X X 9 2 3 Q 0 0 M MW 3 O M M MW X MW S x ,Aw 0 3 E O Q 0 M 0 MW N 2 x 0 A E 6 0 3 MW M E w 3 Q M B O 6 M M M 0 0 9 M I F Y MW . R 0 0 0 2 F A 0 M 0 B 2 P B MW T MW M M M 0 M W, T S MW M x X , mv. M O w E w M W R W M C H W W t 0 I 0 W M E M M X 6 V 0 M M . M MW M E Q A .M M 3 z 0 w w M WW .M S 0 MW 0 X MW 0 W W 0 w W MW W. W M 3 X X 0 Q w M M Q M MW MW MW M 0 MW M 8 Q M X MW 3 w MW MW 0 Q WH M 6 9 z 0 X 0 5 3 X 0 oo 0 X 0 X 3 0 3 3 3 3 44 0 3 3 3 Q4 3 3 0 3 3 X 3 5 X 3 3 3 2 X 0 3 3 3 3 X 2 X 8 3 3 3 3 X 0 X 3 G 3 3 3 3 3 3 3 3 3 3 3 X 0 44 0 3 Q4 0 3 3 Q Q o o 4 4 4 4 Q Q o 4 4 o o o 4 0 4 Q Q Qpyggotogb .36 9 0 0 0 . Q . Q 9936.30.99.0.0.o3.Q8.Q 02014340301020203GZGXQXOZQXGX03OSOXOXOSOXOXOXOXOXOXGZO 0202020202030X030X03030SOXOXOZOXOXOXGSOZOXGXOXG 0303020SGXOSOSOXQXOXOXOXO 0 8 1'INI'9'l' CI.I'ANI'Q'I' NFATEQT Q g A ' ' A ' ' Q SINGER BAKING COMPANY Q 3 X - 17-.19-21-23-25 5 ' N th C I I A 3 ' 3 OI' en I I venue CI-IARLOTTESVILLE 3 1 Q 0 A - - - 0 0 3 btaunton ' ' ' ' V1l'g'll1lZl 3 R E S T A U R A N T X 3 0 3 0 3 3 3 3 K 3 Q TI-IE 5 3 6 MOST HQME OF 3 3 - - UV-T0-DATE NIOTHI-.Rb BREAD 3 0 . 8 IN CITY 3 5 3 8 2 0 Q Q 8 3 8 oo 3 3 Om' of the Largest, Best Eqmfvfvcd 2 2 2 'f AMERICAN Coors 0 and 0 - 0 1 u 1 Q I . 0 3 Tr Us Todo Yozfll Lzkc lt 3 Most .Samrarv Planfs In V In In-za 3 5 8 ' ' 3 ,, oo so 0 0 0 3 'S 3 40 8 3 x02o3QzQxozoxozozoxowzoxoxozoxoxo aw!0www!0S0www!02000!0tote:ezexozozoxozo:oxoxoxexoxoxexexoxowwtototowxotoxe o Q 0 ' .. 3 3 3 Q 5 B. Sl W. BOOK COMPANY 2 I2Iu:,xIaAI.I.IcN,JIz. GEII. 13: 'SNIQAII 3 Q 3 Prvxzdczlt .Sea-I reax. Q o 3 0 40 0 3 Q IiAs'I' I2If:VIf:IcI.I-:Y s'I'RIiIiT Q C 0 M P I I M T N T S Q ,, ov 1 o S'I'AUN'I'oN - VIRGINIA Q . ' ' . 3 , 3 3 OI E 60 OO A 0 ALLAN AND SNEAD 2 5 IIOOKN g 5 STATIGNERY 5 1NcoIeI1oIzA'I'IcII E 4 ,, , ., , , 40 Q0 5 OIIFILV, AND SCHOOL Q 5 3 . Q, P - 1 I 5 5 X SU' FUI'-5 2 II If AI T 0 P Q Q oo I . T , Y, 0 X 4 4 X. -, 3 Q I IC,TUIxI'.5 3 3 oo , , N ov Q PRAMINCI Q ANI' 2 O 4' O5 5 3 V- -. -. 3 3 .I N 5 U R If R S Q .. tg RNGRAVING AND PRINTING 5 5 .3 ATHLETIC 2 108 North Richmond g - 0 . . . . 5 Q G O O IJ S 5 7th Street Vll'glUIH If 29 0 Q 3 3 3 Q QgQ20303eze3o20xowxQ2oxoxoxozoxozoxozowxoxotetotezowwxew ezotozozoxoze exe etoxoxoxo o oxoxozozozosoxexoxow otoxo:e:owtotor0wtototoxotexoxoxoxoxoxozexoxo:etowt0t0w80w QS020803OX02030t0XOX0w!0!0t0X0!0w'0t0 OXOXOXOXOXOXOXOXOSOXOXO . 3 3 K 2? 3 3 2 Q 3 '23 H X 3 . 3 3 44 LLSIMPI I SERVICEU 8 L. . .J 5 X oo 33 13 0 op 0 Our Model Method of H 3 Q LAUNDRY SERVICE 3 25 O, I I C Wlll Dellght You Of 3 NQTIWIING HUT THE .IIICST SUPI I.II'.5 AND AN AIIUNDANCIS Ig' 95 s 6 .. I 1 N .. 5 OF IJURI2 bO1fT WATI'.R U5I'.IJ Q 3 3 3 3 0 23 3 X 0, 3 . . . W ji -A Trzal Wzll Conmnce You- 2' 5 0 0 tHUntO1f1 teaffl aun I' 5 S S I , d OC 9 3 Q 221-229 North Ccntral Avcnuc fi 3 8 0 W 3 2 SISAUNTON VIRGINIA 2 9 3 E 3 23 3 5 a OO x 3 3 oxotetetototoxoxexexo oxetoxo3ozoxoxo3o:oxoxoxozototoS020!0XG30 oxexoxoxozoxoxezoxoxoxoxexoxotozoxexoxoxo oxo30gegQgQg0gQg4,30 202020349202630S020303030202020693039302030!02024720302020Z026 0249202020202O303020S030Z62620349.9202020202030202472920302020303030302492929.0Z020302G'2034730202030ZGXGZOZGZOZOZGZQZOSOSOSO School Catalogs and Illustrations T.eatI1cr Dance Favors and Covers Dance ,Programs and Invitations Ifratcrnity and Class Stationery The Chas H Elliott . The Largest College Engraving House in the World Commtnccmcnt Invitations C, I a s s My I rograms ,flass Tins and lxings Qcvtntli Struct and l.t,I1igI1 Avtnue - l.AIDIf. ' a NVecI4Iing Invitations 'Iiratcrnity and Class I Calling Cards, Menus Inserts for Annuals QxQ2Q:Q:Q3Q:QsQzQ:QzQxQ20:QXQ!Qto!QX0 Otewwtoxotetotewtvtot0wt0X03030X030XG!Otewtotowtetototototo QXQ2Q:QzQxQzQxQ QxQ X53- N my Compliments of T H E B A Y O N E T 0 0 I 4 J 1 'C 7 I i l'lll +ll'IlIA Wx ,Qx L' ,Yi ,ww CP' -U I - . s f Ewa ' , QAOKRT 4995 X , 'X 2 QzQ:Q:Q2QtQxQxQxQzQxQxQzQzQxQxQ!Q2Q 02024802020 OXMGCQSGXOZO 0X0202080S0S0203Q2030X0X02QXQXQtQ3QxQ:QxQxQzQzQ!Q!QtQ2Q:QxQzQ Q .. fi 2 Q M 3 2 Q .. Q 2 3 3 Si Q N 2 Q 8 .. Q 'Q ZS .. Q N Q .. 'E OO Q .. Q 8 Q .. 3 2 'Z 8 Q .. 'ii 5 3 2 2 3 Q 2 Q Q .. Q Q Q 2 OO Q .. 3 22 2 'Z OO Q .. fi Q 2. 2 Q OO 5 3 Qwtetetezo 0:020tewtotewtotQtQ:Q:Q:Q'Q'Q2Q2Q:Q:QtQ:Q303efetowtetetetetetet020:QR9302ffSoto:Q:Q:Q3QzQ:Q:Q:Q:Q:Q:Q:Q:QzQ:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:QzQ:QzQzQzQ:Q:Q:Q:Q:Q:QgQgQgQgQgQgQg. 3 wt' J, '. I Af: iw X owxoxowxoxexo oxozozoxowxoz oxozoxoxozoxototototetotewtew OSOSOSOSOSOXQXOXOXOSOXGXOSOXOXQ 08020303020308GXOwXOX0w!0!0 0 O O fn 8 3 3 3 0 e 60 3 3 3 X 3 . . , 2 .2 School and College Annuals have comc Q Q. wr: . . . . 0 to be recognized as an institution. Year by 3 J. V X '41 , , , , 3 ' ' year they are growing in importance and in 2 mfg number The are frowing too in beaut 2 ' Y ff ' ' ' Y fi? 'V and character, so that many high school an- 2 nuals now excel the books issued from colleges a few years 3 . ou ago. In this advancement we have had no small part. 5 ,j 3 3 A Fu 2 3 lr 3 ' . h r Q For more than fourteen years we have been helping . I l 0 cn create representative annuals for schools throughout Vir- 1 ginia, and have won a position of recognized leadership ': 0 i , . . li among the printers of annuals. This is one of the many Q Q printed by us. .3 . 3 ,ii Ml S i. Not content to rest on laurels won, we have worked out g 'Y' f 0 9 S, h , Q plans to make our service in the future more helpful than Q ' . 3 . . . ever. Editors, business managers, and faculty advisers are Q ' S ' invited to write and give us an opportunity to explain how 3 Y 2 . 3 we can help fhcm pubhsh the best annual they have ever had. Q 2 'S 5 3 2 3 3 , 5 - 'fi 8 a 8 3 3 O 8 O K, . . ? . 3 OO 'i ' ' 3 'Z The MCCLURE COMPANY, Inc. 3 . . oo Prmtcrs : : Bmdcrs : : Engravers Z 3 Q ' NINETIEEN WEST 1fRED12R1cK STREET 5 STAUNTON : 1 : VIRGINIA Q 2 3 8 3 3 '6 3 8 3 ' 3 gg .. iw., ,fa 5 '.,,, -- 020X0!Q20wX0!0wXOXeteiowtotetetewtototo otoxoxoxotoxoxowzo xoxoxo-xoxoxoxexoxozotozetotoxozoxoxoxoxexowgegegowwgogowfg o ,1- adv '.- Wi g. , ln- wp' f 51 .f ' 1 'Wax 54 wr f. ffiff: 2, ' - ml gl , H if '. g +'.-w-QI' .3 ' ' . Q ' ' ' ' .Q if Lam + H ww ' 1,5 mx ,- . .1 -3 T f . f, 55-11, ' r , - ' ', 7,11 '7', ', ': Us 'fatjl F. ff, , , 1. . , , u an - , , a Y- . lr I . A ' lg Q mf- , .Jn-' Q .I ' N 3.1 ,W -' . ' 4 Q ' I Q f ' ' .. ,,i!.,. ' ' -. .5 .111 ' 'P Q 'Af .- I . v h si ' . 4 ' .W ' Q, , ' mi ' Q' 1' A- -, . , 49 wr ., -'tw , ., Q Q .. .Q L 4 I N' f. A -a YY' ' J 4 . I , , 4 A IV. Y L Press of Tl1e MCC ure Comraanll, lnc. , ' - Q Staunton.. Uirqinia N ,- -5 X1 w':9f.,,, w'- fuer f'fN.'i:i-fa 15' mm' ' ' A M '3lf'FaQa'F?rw3fQi- . 1 9 3 .1 t , I . ' y . ,fx I Q. , ' 'U A ,Qi . .gi N4 - 5715 5 , Q L Y f XIV' ,Ag u - Yfi ' 1.7 . 4 .ug -' '33 sr t Y. 1- 4125 , P15 . 'fiv Q' -.r Q1 4, 4 V .J , 5 f g rg ,fi ' ,.f ni+ ! M ' , ' '-WLM - Lg . rpffiflj
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today!
Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly!
Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.
