E-Yearbook Home Quick Search Advanced Search Quick Browse

Auburn University - Glomerata Yearbook (Auburn, AL)

- Class of 1983

Page 1 of 518

Auburn University - Glomerata Yearbook (Auburn, AL) online collection, 1983 Edition, Cover

Cover

Pages 6 - 7	Pages 10 - 11	Pages 14 - 15
Pages 8 - 9	Pages 12 - 13	Pages 16 - 17

ShowHide text for 1983 volume (OCR)

Text from Pages 1 - 518 of the 1983 volume:

“

,...-. fb X Xl -LU H' , mi E A N-MX M 1,1:.' 25:5-gf fig' 1 MM' ' I-xc T 21 -'1'Ii',', -, W A . - , , .H . ,f j ,fzffiijxi F5 ' gg: XV ' f. - - Q5 rv .ff :L W-'25-lE9F'f ng., , . g ,-9. ,- v f., ,,:g,-1.-iff, -ww, iw hen it came time to decide the book's theme, l drew a blank. The Way We Were, Lifestyles and Spirit on the Rise were themes that just didn't capture, in my opinion, the specialness that make up Auburn and this year. So this book doesn't have one. instead, the staff and myself have attempted to simply describe Auburn - just as it is, without trying to mold this unique campus and untypical year into a phrase or a few trite words. My continuing mental project this year was asking people if there was one word that could sum up the meaning of Auburn to them. Only rarely would l get two responses the same. Rather, it seemed everyone had their own special place, feeling or tradition they would use to describe their feelings about Auburn. The opening and closing of the 1983 Glomerata use just a few of the words that have been used to describe Auburn to me this year. We have attempted to capture the true meaning of these descriptions A U B U R N through large photographs and interesting copy in a bold UNIVERSITY if We hope you enjoy our -L-V'-, attempt - the 1983 1j,f j Glomerata. ESTABLISHED I856 3 ig' Lynn Brown I l I Editor TT T rn- Xe :mn . ' : 1r'i'i?i71Et' 5 ' PHOTO MANAGER Ben Fitzpatfick ,, , , ,. , ,X E Af4t , .S'5 -gE?? 3 '1 f.r':' , , We is A 1,1 ff'fg-'gr' Sw, : ,' .Jr E -6 A Lrg, em f.. PHOTO GO-EDTTORS Bob Gamble all E,-lfeflfrf rfr k '54, ' j f tf f3'1 i,,jf.,. , . , , . 1 . V , av A S iQ.f33Pf..'f' ra Jennifer Johns .1 ' , + ji .1 ,O f 5'M'q1 , 5Vv- , by- A A K, ,v T' A! ' at f Y'541,,.5.',AEuV1tftl,i John Reed ' ,rf f f A ,V I I .sf A Egg ., euslNEss MANAGER ' 5. , , A 'E I A I ' A r-'-,l Q 55 Karen Lovo .. ' . ' A ' . L I If K D'a e Behnke tt F ART DIRECTOR T - ....'i sz A A David Penn t K , 5 XY uburn's spirit is everywhere. It's spirit is the special quality that sets it apart from any other campus. lt's the bond that holds the students together, before and after graduation. The spirit is most easily seen at a football game or basketball game where thousands of Auburn supporters gather to push their Tigers on to victory or console them in loss, for losing proudly is a part of that special spirit, too. It shows up when Lionel James runs 80 yards for a touchdown or when the Tigers fall short in a last minute drive. The Auburn spirit surfaces in less obvious places as well. lt can be seen in an alum making donation to the Generations Fund. It can be seen in a professor standing up for his beliefs, or leaving because of them. Anytime Auburn people gather, by chance or design, the spirit is there. ft- w fffkz-.zsfvizif Si xzwvrfs 11 3 i Si 9 sw t L 'S2?zi1iza5k4?ST:? . ,-, t . P fs sQmgiaiwg3pai:ft: zwfalfzlfzstfrfsimv P we o1...fa.,.5,rg,1ru-visit, wiwaaz-ff .pimps-f. tw. 4Pssr1sm11Qgg1.s.f4. X' ' Q, Qiifafiaibivafi 9533-' rvpkg x a , ,tm 7 W -,.,..,..f,.i,,, . .4 ' 'A I Q? sans? ff' 'ki 1?IQK51l.E' A . . .W we swf? :fir 5 44 'ifiljzlgf , 'L LL P if? .,.. . Sv? Ls -as fe?-:yt s i -1 w -1 cz -'rf of it-. M i is 1.1fggwtg-r5.1rw5g.ga1z5:2+ ,.,,.,Jfa ..i.W.Ws11sc ...X i-.'1..1.f fWw.ff..., ifigmfiaasfae.smvlgwasf. f 1 , f 14 7 Ziifwkzlfsils tfffiw. cwsctrf . nwzs ifiglval 1 ...arm tkt ,.r.,,.r -1725 .. , f, . M ..t... ..t. . .. .. S -. v...i, , ,....r1,.e La ,ear wtf. we-+fsi1f1..' ...fra-mir. are T?sz2..12f4ifi, r'ig,fczi-.wilf '.-.fL:3PYtfR?3Vf!r M919 'f::,z.:'.,'-fi: p r X .. ...... 1 1 -f g23'Fii??f?.QEQv-QT ilK?2r?t5?hCf .ya wwf. W., ifwlikzbgifaifxiiwtqivsfyz f . -,.Wa..Ersa 3355255ftfawgiifitnzsie.rag L, -f. .aGqg?f1m1vf.14ii51 .tru R' trzghzzfcf .f.gt5gg,f:,5??Pgfi?p52.-4.5515..,..i.. , 1' , tw-c..i.we:f .zifrm 5 ,, af. .Mm-. rwfzzgtzwgg ..,,3,T.g,t, . . .. :1.v.e5fsf,f fra- x was sy .wi ,W .. ,. .. Ma-?ii2?'s2!'f-if eff ... 4...-.V ,,,,1a,W f X .Q -as wee: fffifiiikti-eiffifffffil .W S i is -.Mgr-rsgw as we sw -Q 45 :wt i -1.4-irwatw W- 2 2:15325 K P Tilgllilii --xi .. .2311 , N... . V S. .....i.i+,,f ff-- obs..-,..N-..Q.1wsa: .iLlfi5K5't-1 Lihf55.W8 2x 'fJ9V M2491 Vi: W 6iQQrfaiisg-vrss,StQ?fe5'sk??mif3s i, how ya' doin' The phrase is the standard greeting as you walk across campus. Even people you've never seen before find time to mumble the words with a cheerful grin as you walk through campus. Friendliness has always been thought of as part of the South's hospitality and Auburn is no exception. ln fact, Auburn exemplifies the idea of Southern hospitality. The slower pace of campus enhances the friendliness. People are never too busy to stop and chat between classes. Auburn's friendliness is contagious. The instinct to smile and greet someone is with you, even away from campus. When thousands of Tiger fans visited Orlando for the Tangerine Bowl, a nod and a quick War Eagle were the standard greeting for anyone in orange and blue. Try it sometime and before you know it, you'll find yourself answering, Fine, and you? If .4 .41-.1 A, 5,,,- V 'Y Aw- f 1 M .A-W ,.... , .VV W ' 5 I- K' , gm 'K M my V , -.f V A VV ,LQ lg: V . ,., V,-'N - H N . , Y . .. ' - - . s.,,,,tg:-'Vi-1, . , . W N ug: . .,. 4 .,,. ......... ,M M., if g ,N N Y. ' .sta U an - , , W bw v Kfrh , N . 7, , A ' semi- WW, wwf-wg'-1.-mnymqf--.,,. ,A K. . .e f qi.. , -K - .,, F. ,N gk, k -,, fi- W f .,... r Vw.'-mv vw, . f H? H V . nf.. - . i 'f- .L ' ' u7 ' ' M View ' , K V V , . ,!h 31 4 g MV . V '-f.V.-Vw, , A' T' ' .T I, ,. ., ,V , A' ' ,,..i,,,,,,, V I ' - -.M . lll'SJfQL4HL ' - ' ' V , ' -ey-T-u.ww.- 'Mm iQp'0Mwfw.. M . - I A' , M W M A JET, 3 .- A- iv, A Q.. -I E r-up I 'Ww- . V .1 , 1- . , , . , W ' .SA . .r wwf MV ...B 1 X W 'M'M '7k 'TT I, .. ' saw., :Y T. 1. . -'R iw-pr ' W -M , .ff ' K r All .Q ,Q-:jg W ......,,Qj f M W , V N V ...,,,,,, V I . K wgxir-M 'V,k ,Q ' - M W -'l-v w., mgQsW,,,.. 'wi ,'. + -' U rv N Tiff' Mr. - ' V big -I Q V -qi,,,, ,,:j'f wwmfsw ,, ,1,,w ' ' W9 M. f '+ ' -V- ,v g V.,,.,.,gk V ww V , r-0 .' --' ' 0 . f . -' '- ' . ' W fi i- T, ' wg, if ' we . '- Ev lx . . gghvir . A T. A' 4 X Q . , 'Wim . 's. V sw w l 4' ' V ,X mv - - 4 -'Q' LV ,.,,, E A , I L wr-aww., l'f??WWeMw V - . H H l ,rv fs.-....V.. Q A I W 11 .- . f 'rW t 1 - :UN 'ii 5- tram . : V . .. Yi ' ' i Y M N N . if , . ,, wuamnuu... ,..'m- ,. .- .:5.,V.4VV. HAM M V ,V . wsw. V if wmvMm,,w,.W,n use.. . . T . iv fda, . ,. 0' ' V , WV- ' -' - awww uf k FSH- - ' w ,W , -qt,-. t I W v i , V f ,ew A V Mg., flaw. f Uhr' M, . A 'T -Q V 1 ,, N' . 'K X I W VM Wklwf, . ' V ,,-t.V.,,, WMV ,- K it - , Q mummy, ' , awk. g . , l .V 1 V . - f ' , ' A' M X- Hugh, A A ,K wi: A v -www v-- ' . ' sf . r ' ' . V' W 'M' ww .i ' ' ' . . . . , 0, ' ' W' gg E Q ' fFif'f-73' '-5 .. ' 4 ' ' 'W wr' H' ' ' -r . ,Eng -. auf' f , ' ' V ' Z Q.. V' , if . . , -i.,,.,, 'Q j 'F' -..,, ' . 'W A ' firwmw wfmm W, . , , 'W-' A. VV z V . fs, , ' ' J.. . Y 1-f fig. ' WfM 1w' r V , Vi . V fv A , , , W i , if 'i 'is ll fs . . - '73 K . . . -V T .. g ' . VV ' 'ir ,sf 9- V ,MMM r ,V 1 T- . V . ,. . A . imqgg., V WW ' ' M- ' ' ' V . ' 'W T ' f . ll. 1 as , -. W in .,. 1 1 A . Aw. I it li My . r.,w,qQe:kQ,?,, 7 , kk., , T q V . - 1 1 . -V .. .J A M ,i X A I Y i 7 ' if-nf - '. ' ., ' . ',jif.4.'f 7 - - -Vg '--' -.42-' 5?ff'i'g,g Y W 5- Eff-'H1:.p-yvf T-F :1 '1Q'f- 2 '. ,, '- I 5, z.. 1' , .L . ,J 1. -.,'.'.' .x k,, . 51,1 'va .. . ....-In . - 'x ,5.wx?j-- . ,, .-' .,,.- . to ' ..--' . - . V ,W 1 2 -. wf '- f'2 '- HI .' w.x-f r'f-yxi'-i----' ' - P. - ' ' N, . . -, - f . 'Qi x 'If 5,251-, NNW'-'F-.x',ff ,gi- ' iii --,f 4'-?9...' , ' Til' INN? , f. ' An' 1 , . 5- I Ki o 'Q J 'H' 'g' 5, - ,'. .H 19' -. so w'Y.I' K .' 9'-' N 1 ., l ,. ., Q. . -. . -an I, . . Q 3 L XX., .s . f. .-r '41 , . -. . , at , . h :M 3 . . I,.A -. --Xl Oth.. : 'X cgi ' lr-'-'X - - D 1 I o l -f -S ... - - :YQ 4- 1 .E . 3. .Fx . . GS, A i M2 . , I ' I r, 'I ,. 9'-P ,- .5 ' ri: 41. 1322: W fu!! 1, - 5- 'iq -- a , .- .. 4 'WX 3 A ' Q I Sf ' .. L .-- iff! ,Q - -7-f 1 I: iit'-T. V.. Q,-hw.. .V 4. t r 'wvgfgiiif , -. . . q, . Z . x' - ' .H ff' ' ' Vyf- , '19 X 1. 2 gil .g15i' ,-3 , ,, N 5 , , ,..- . 5 , -. H., -1 -, qi , - 1 i--Y. X- . . '. ,A -. .1 ' 1454 ,XL -1 X. . ,rx 1 , -' 91' -...'. M - . 'v'2 2 X f. .-: -s 5 viii ' f 1' ' mn ' 7-:lla ':: .- ' N ' - Y . Ji f 'f' .r if: - 'e . fi V -' . S., - . . -. , , Q., , 1 ' 1 Q . . X , - -,X,X- fAV,.w . ifgy vi . Y .H . . . J -. .- W . -x-J, Vw f mf . w. - I . V- , ', ' ' ' ' ' ' L- nv' 'Q ' 1 - - awww Nw. rf-- ii A Sffv xi ' 5 n,iaumg1'!'7'4-ff 'V f L -, Nvfy jfx' .' X ' ,T ' . 'ye' : SMT fa K ef? .i! ' , fl ,.l' .fi ' ' sw-' f. 1 fn- gffg 1 'ge . -H I' 1 'I , in jlf r . M ,g pd '-' , , . ,, . . Q, Q. J Hi ', I f , 'lil H-v ' ff' f 4- -:LA - ,.' A .QA Y In mga., E .,.:.. ., ,, wx. 5 . . ,I 14 .1 Y- YH -'::?' W fix A ::,. ' 4- ..:-,2572 - u 12 ., 5, -v-.a':'f5'.f5 f QW. - '-V m K ---- Lx ' 4 ,af up 'F 'iq . .TI A - - ,' A 5, I ezmw- ' ag' x -- 1 f '- ' ' at Qi . . ' - . 1 ' '- 1 '?fE:-n:Qqf-f- X-2 fa -- X fx Q ', yM1fg.1E.,. 3.53 Txui-J M K V V - 5 'i ' ' 'L' W , ,.H,,.n-..---.---A.: 1 A A Q W YYY V 15, . ... .,4.u fi' New PafklCRAlG SHIRLEY Opening 7 :fig . , M, ,-.,.. , Hx 0 . , w Frm .. L ',4 xx 9 1 E 5 -N1 - hw- f-- ---A V -- -.. - 5 f l W.. ' 1 hw N -mu -M , 'M --?.,,,,,, -5., - ' ...M -- - +f.......,, . V ,.., . .. . ,-..w-mw,.,we1wQ:f:q-,- ..-.-,-- f- . ,mmm A i- .I , ' Ny- -'F'--:Ssp.gM -- ' W -'-'--,ir Y ,Www - l lla:4'g,-...A , A .., - , M Q Y.-har ww-1-.Tr V V M I mu ' ' W fa, ' ' a g -w V ,T fi - r, f ' n S ff-v'-wgzf gf -H V , ' '- f ' M- M' ' A fig' 'fi' 1 X N .. '- r X . f ,a 4 o 1 ' 5 ' li 2 ii' VI ' Y I I: 4 L' I 5 . , t F' Af 9 V f ' 1 l 'fri' I ' X 1 -. f A -4 fix K L 1 mf. , .jk i ff 1 nqnnuunnq,llll-I 8 0pe-me !i . gf' 15+ ffm e mms- ' L31-A vgifbta 522122653 'iftleifl i:.i3Si 11uf!:-, f-K sf- - --wk- Q 5 'Cf-Tr' weet Auburn, loveliest village of the plaing Where health and plenty cheered the Iabouring swain, Where smiling spring its earliest visit paid, And parting summer's lingering blooms delayed: Dear lovely bowers of innocence and ease, Seats of my youth, when every sport could please, How often have I loitered O'er thy green, Where humble happiness endeared each scene . . . - taken from The Deserted Village by Oliver Goldsmith . ,V, L,,A rlililllfllll T f ,M fr We A Jil.. .4 TIWLQQEW .i f f W ll 'J 2 .fftip I-,T fwfdflff-I 4 ,l . . f . lwlllrw -52tgp::elliilyli.ii'i5r :zgi .lil R f EW I l ' rllaiefltilif' Qillilnlflwlx' l 'i l ltlgrlttly tilt, gil. ltliililillizilr-.-t t, ip5lylii:g'i,W,iir , H'-li lrlilrry l i lliltriilyiy ll zlilllliffllllvllll lllliffiiiflli-I' Wilwiillilbr iilltli,:'-W. lvl: llllitliicliiplf' ff' ' . llil itr,:'i.,l,i-rr, w,:'. 'rifflfiiiwlwi lil1'lifl'ww imiflllilll will l il lil if . iiwlwlilil 'lmlttliillyii5:,t'i:,smy2- lwllhiFlf'Wi3'l-Milli?- itil. til . rllllililwilll iii 'l'lW. lllwtiiltliflliiiflwti llrlifiiil '!'lli 'J'rcl' T nfl l,WlMlI7il'iivlfl'i-fcr Pi -ili l'iftl wi iWlMlllill y ' flilrwlilr-iiif ,l i' i.. :lt'2llMl':ift2'lwl1rif Wwpwwyi .vt i llfllli'ilfil,i'i .twilf ,lrll'.. mir.-pl' tit wulywitiliflll 'lit 2. 'litilrnl-. mi tfftwwyiwl T mtlriglmrfltzilff t rffirmzr yr 14tllt,ll.,',mi.f1r.ml,wi ,Q .sitzfiifvilitizr J rifritrfvlrfm t fi iwiwf: 1 LM .fling will IW '?'ftlj'AEi Mliiwbiii Lmwlh, ' f If .,, Wlgwiisi llgywrgt mam: th W,r.W. fwiiiwiilwi 'Willie wmmlii l. 'wL7fi,'lflli,a , ..,.,i,,,.r. ll ll'rlwi lili,ll-. ,r i ilfllwtilllz-ilrii..ii , i Hilti' .,'1'filtlg wwf ri:Lit.:i.+. iii 5. !iitlir:ilitwiir.iii i llzwllliiiziilrilliwftl ' llill-ll'lrlll.llliitl-l p -it . iiirll'ill'wlliwil f lliiiili . .r 'iii iwiwwl 3 l5:i',W I i-il,filllfilil'llllillfl' ' lllytfl,lli'ii'itrllwill 1 :rf i y it illfjfllitYlyltifillzlilll:ill . fliiifr.ililtirii 1 I MllllW'l'llfi l ,lil-l. I.. pflyillwillfiil :,i iw if li if l'f . .rfitliimt lllgllf i i i ii if rr.. rizggi ,,. wif i 'lui i ,,,, ,ri . l nr.t,i t i t l f N 1 i i fl ull f f 1,1 1 I J v.W,i..i, .H,..i lilsyr .rli'lllil'i'li li f m'I'lwLlilll iwgyiyiggiifii-i wi Milli ir. vim' il' r.!ii'4 iw-pl i'i .frcw-xii. if itilfww' witgw Wy ,film trawl. f'l1lillir.r:'u0li- rui- t'l,l'x',' 11'1 Jllinlif 'Nil 1 wlailwmll,r9ilmiflr't,it llvill ' l 'Qt.2ilil .. .Q 'l 'lr.i. i ii i it ,lm Wy 'fri l i l 'mir '.ll lf fllW mail 3 i'l5?liWi' tn illllillillitf f ir.-ffiitnrf-rim, Mlyliilffttiiilwiii-lliflfill' H fml.fJialr,i .i W L! 'TM ' limit. -i-lvufm-.,l.H: 'H i uplarryl.iil.i.z,.iiimf,...W-,,., ,4 1' t i ti jf tl - ,WJ f- ff lwiwl,ilmlt'jfpfgguiigli I W' ',f L'If n1i' ,ifrhf Q-9' AMF l ' lwlllrfftmliwli Wgtlgl, J li fra.: rf htm Wfiitilx l im, lily .Ttf,f,,i.w.w,i-,gcc itil WW zftlTJ7t1'ilW5tW liliwlwflwilu' if iw it-' Mlm -flies Tu'-vicct ft i Q 1 il-llilf,:mviir,tl titwlffi ,iff viitlnfi f,1M..w, 21,5 f.-tx,l.,,..i' til Wilml ull ws ww, lr: , ' I l'l1'!M l'f7lJ fiiwl'rlmlu'i,. it-llwliw. V- -will' if- iii ffl.Writllfili-iyl,.vl yu- ir i --'il W lzilfl 1 ' ill-l im lwlii' 'M.'-mlm ' illriwttlilwlliticililir1'2rr'l1r itIliwllllllllllit'i,ti.yAwilit ' ri ll:rx.fll2i'iljl,l 'JW' ,pwiwlli wil ill ri 'T WilflWlliliyyll'iilililii l f ' l' .y MSW .. . . . ,ini ,,,, fill :lillylif:'ii2w g2i ' yll'i ,ll 'y irlylwll rltlirllriiiil il il 'tif if lriwilf-'tiili -it l li fiwlll. lift. ,T fwlllirlfli will wily, girl l, yy T l ,rr ,i ,,r,1ir.,li,.fv, v rlwllllllwlltfffiillrlwllll ltr' limitflyili,ilmifilw ill ily. viii, mi'iiwlly'lflrilllilhltii' ' iirtiilwylipi..Wti:t5'twr1rl. Wtiwlrlwitilliltfllwirllfli ltillili'1if:hl.'llrf:iiiir' WW ,J-tiirf, ,Miz it i, r. W.. it .mi yy W, lin will yi, ,,,gtltlQGfl l' lifwlilzsiilill.iiiifwlllf l,WiWiW,....W.i.l,- if N I if A tlriwitflri fillTiiWlliit f5l Wlllflifillzlrilvtifilifilirliirzilwf Will!! Ml, l irwllt. it aarrff 1. fill.ililtlltl:lllffls'rliilf.i:ii:iliiu Wi ll, WlfM.'Wlvk7lii,!t'l f. L WW: . tr' lim-,l ,i,Wrlt.f V mit, --ral i,,g l4lWflli'llitlw:fl2lwlim' hi I'l' lsr. ,. wig Wt,-...t.rgl.i'.mi . f r air' if :'i4l7'iillf'5l fr1 iw' iffilllm-iw ,im-wlwiii1rl -in it I, Wim ..l..,.M,...t7f,r.r.i,y, 1,7 -. T. -. iw L,f l ,715 'ill 5 V t ifulit-rwt.'l.lfil,w.rl.1Lf,wu nlswiniil en. rl to if , V t Q . ,Hi 1,1,,, W, Tia, wif ' T may .gi ,t lwwtwwifldrwwamwl N tl t,,l,.-,'.lf.f,e,. ima J Writ' wi 1 lil I :ill if' i ,'r7 f-t JU' wi lfmwfiiuq -r riff 67'Wlhlwllfm: vl'1'Jllftlk7?n9l2 rrilwliwlui Witt tm 'WWill'mliwicriillwiztf 1 rc' -r ,lw,llrin,. atm ,mtv ' fi. J ill rilrwirwi'wtl'ilQii QlliM4'fill'lm'l:wfw,im:'g,i f M'lf'1llwllfiwhwlwfffilh' y 'r ir ' i ' l ' 'ill will flrlltil M' Still. 'SWTflllliilililwisirlixrr f lrlltlllrltllwwrlifl wi ill i will 11-1 will 'li it M ryfy. fllllylilll,,ri.:...,, l,lllltllllwirplllliillcllipfitil! gli ffwiwlllflii Mlll,W,ilWylll3llylif l W- wwflllMlh1WT'flfwl-FilW2 ,tw .. 'iii Wm r lt! jul. ' i 'V M it iam., .,. liiiisffw' f ll: ,3 5. Muni it ...,l,N...m. .,wit.---- H- liluilwa- U l iw- i uburn is wrapped in tradition. Traditions are as much a part of Auburn as the Samford Tower chimes ringing on the hour. The pajama-clad participants in the Wreck Tech parade each fall keep traditions alive. The Burn-the-Bulldogs bonfire the week before the Georgia football game has also been a part of Auburn for years. Some things we don't usually think of as traditional really are. The rush to Chewacla State Park the first sunny weekend in late February and on into spring quarter is repeated year after year. We buy ice cream at the small Sani-Flush in downtown Auburn just because it's the thing to do. Even sitting on the wall at Haley Center Concourse between classes has become a daily tradition. Few things change each year, rather the events revolve around tradition. And, perhaps, it is better that way, because Auburn, itself, is a tradition. ,um 3 x 3 ' 4 i ' ss, in Vw -... tt -,f SNR ya JAN' ,GL E, uh . N, . 1' fi? bf 5? it 3 'V ,, KI, ' Sw S 5 mfg x 5 7 1 J Fx ' A . 4 li pb 'F -. M f he . -.1 59 A vw... Ai- ff,-,wj 5 1 vw' 1 f fx ge . . A Sk - f f. : ' -. - ,L N . , . , k. . . W , Q . 1 Q. - 1 Y .1 ' - . 1' f ' L Rv ' Q' if 2 pf 'lg 3' A, '- F ,l ' 4 ' 1 Q! ' Q, .ry A - 1-4 . . - f QW? Aj fr V+ -- +' w L .. + ', R' N bt . 2 -. . , 19 W M . Ai V, V z vw. r l MA, . ,Q I 1 .K . ug. J, Mt. Maw. - -5 39 nf, gf, A, M. 3' X -,, , A ff- x . M- 2 .v . , .X,' U., ., -.Q . 54 -f ' 1. I , '51 . ff.. '13,-',.,: Q x,., f f M K f.. 1 V Y ' .w A . -. ?f' ., iixf. 'fa we-Q. ,z af57Z'lg-f -W1 f ,fi - 3...-, 535 ' My-'1 W' 'i HL. fi' N fx ' ' giw: '?0' -F454 f.. A f YP 4 'f-47? . 1 4 .1 f'-ml. fl.. uf' M. X' Q4-6 537 S ff . fin ' . lbw Vffff' wr' l' ' fgkiff, A 457 'K ipffw 5551 V .f '- 'f ' - .A - ,Y ,fa . V pp. A rfga 1 -ff , ,W '5 aff my Mag H- bi. ,, . int, f' k , 4, . . Q .V f . . g Jw... ,sw ,P Vg.-yi: 14 . ' hw wi. Y ., V - J , 4 -. 5,3 114, 5 Y:-'tr , :gi A?,,i.:,,1, . - ' 1. f. MQ- .5 V 1 0 .4 X '-. ' 292 'tw V 4 . 1 11- i ,. ,. ,JI ,Q , 1,9 . ..4: W,,V,,,, Q 11-Lf - fi i:fG,,Je5 k f A . fk L, .- , ,. ,f 1 1.-,f faq. A ff' Vi' .ff 54' gf if W ,' if .L af vii 1 - .V 11' I '.f'wr,'w1?fEv ' 1' . I , 5 ff 'a 'fpffgi '-1 1. uf 'Y , . ff -' f 'yi' ' -1- A , , v.f7,'1..:J.i-. 4' 1 LEA f 5.4, , , .1 .ff , gm-ffw-.f fm, H .Ni f ?:fia,g wr. '. . ' 1. W. 'ww V '. f cd . . a , U- . . .W -V' 2' 'QU' ' :v X HQ,-'se'-' 1 3' '-ff' t , .rx 5..:.,wQL- ,rug 4 f ,K . , .1 '7. W, My ,M -pf - gb , in 'Air-wp f 5 -1 4' 1' QM' g ' . j -, .. 4 13.55 A., Sadr , Vs. Q 1 flkgg., 5243 S hu' ' 1 ,, L 1 f 'fig J dn, '-Q 'gif-, , if if-. ,. A I r 4' If ', -.Y f-M N, ,, ry., -2' 3.1 4 f .4 L -' , ' -,' v, 14:4 mtg' .ff J JM W-K ' QU. 4431-X .5 w R 'N a '11 . ,f 'M X ' - ,A ,:,tfg 3 ' 'Q F, 'J My ,ff - Q' S 'Q 5- J Ja- 5 ff J 1. f' H112 .'f f5 . L ,iq vp ?....fAA..g,.4 Qs, Y W4 : .yi . V. If E , Q5 - 4 1 1 ij 1. 1, J if 51.--ragga, f fini, L: N QQ, I. ,.K.,5',ij1 .fi L? 6 ' ' - f A. -. . ,,'f-w , 1 ' -' 5 A . . ' - 7 fr' ' :Lai J., N '. ' 'ga-l. EW 3 41' .F . , W. oft, 1 f 9 mf' -4 inf ' f 'j.3 ' 1 'A ff' ff' L- +,.M . J f' ' 0 ' . v 4 wwia f ' , w ff' Nr' . K1'.f 4 if f A 1312? . 4 N 1 V ,,.., I . 0 L f if 'ir 5 X , f.. .:4..,t. ,Iv A , In iv.. 149. ug, . 2 R V 2 A 144.3 1 a . W.. , ff 4 4. 4, . . , A. ,r Q- ' ff .KJ k K1 1 .Aw , 53' W. J Q 7 in - J . A 2 , 2 QS' , gf, I' :W ' I K ' 4 ,M .1 ' 5 .M-. if ' 42? i .. . Jn f, . 7 ,ff J N. , 'iff 3 A. Eh- fig r 5 nf ml ,', ,,-tg lg' I W A -,nff.4,. Vp., 'Twain V E- . . -- ,. 0.3291 3-,'f'-.siaemf . 1lg 1f .,1 '-1:7 X . 'A ' ' , In ,.q', N 3 'z ' 1 A. 'V' 'f WP .jp 54. QM. . '9.f'Jf. L. Q ' , X W 1 1 L J .17 ,,.- ' Q V. , J ' if an '16 .fn '-.. Y V-wel - 5' I vv 5 . IJ ,MQ ,i 'N .5 K . ' 3- . , :yn rg: ,' A .' . ' ' ,. M, . V I -' Wi-L, -Q 3, U H I' I F , A In .7 Mr U Y as I I . I U, . , I A .W I A in ' ' f a' , 1 .f' V.. f .. W '-.A h . r, 1 Q -., k V .V , w ' ' . - . - W . Z ,tj ' I G-'Vfgl f iff ' 7. V .ww , . r 1 ' ,, . f f .v' - : 3'1 I 12 F, vga, ' 61' . u .19 : ' ith: I, gl I' 1 f..?.n11w -V H i. Q,-A ,ins . , 1 1 I vel, I f.' . f - . 4-Q. K H ' Ti 2 ral -. fi! , ,ew 22+ Y. X 1' ' I 1 'infix a,.,.,,,u. , X ' . .,, f., . '.,..f .-,uk Mr ,ant . W 1 4 I A I 1 . f ., ' 1 Q. S -5 1 ' 1 -f'W', ' f J' 1 bf We' 'Eff ff.. 1 - ' f 1 1 ' . , r..'m P ,MM f ff , , - N- - A f5'L!3'tlL . . . - i , fpir? ,- V3 Af 'J' .fu 1. . 4,1 .-- f ' G 3 1, f I .Pg 4 ...,'w.' ..-4 f 1. . 1 -E - I4 . W 1 ,fl 5' 1 .. .W -sf I' 1 'V Q W.. u ' x .', I . W '51 ' 'Ili . ,al 15.453 ' f I F' F 4 View Changing dans In wlntorlFlICK HOLL in . ...uf f' 12 opmhg Bioomlng troos and llowsrs In lprInglRUSSELL SCOFIELD S , L. 1 ,f,, Y - .2 A fl y 4, .+. 1 t 1,. ff? -W fa' 'MA Q7 w2f'1'w f1iS'f' bfi V 1 -5 if ,-31 u Q7 v, gf, I 9 , fx 5 ft ' 'AQ R Qi kg ii. 1 M '-M ' 7 I. R' Awanv. L V ,. . fs, W. Q,,,y,' . ,, ,' . . A ,WML JB. x .fy 5 . ' xt' 1 ' li, f' 'D X ' 'f ff , ' f qsgil, ,f , X , Tglghjk e, fg -A. Qi 'QQQBW W 1 Ak Q13 .4 D wwjj WW' 5 xx i i jk 'Y f . 1 . : 4 - AJ Mm., -qflw.. ,, Q... - 1 .filo u Q?--wr ,'n' :- n, Y-T . ' 1 4.1. iv,-. .1 I I R ..,,+-:..',. S -f .,v. ,ms fn- 4 . I. ,. 31. r ,kxraff ,w, -- -sq ' u , 1-an Q.- -L'2 'f'IY:.:'-l L-., Q.: Parties If Mlwyn In lah SpflnglJENNIFEFl JOHNS Y N 'N fy ,Q , Marching Band warming up before game In ' um. HW 3 MIIIBFITZ '24, 2 f VJ I 4 I ,J wi H:-.ki ,M V' .2 tfctgos 51' ' 'Q . -Q F.- ,G ...M K 1 l Q 'F 3. 'L t was supposed to be a typical year. Usually, the seasons were the biggest changes at Auburn. But this year was different. Everything that could have happened to a conservative, tranquil campus happened. Beating Alabama in football and having two graduates on June's launching of Columbia would have been enough to make an exciting year. Any other time, the construction of two major buildings would have made for a different year. The events section, divided into the four seasons, includes each of these stories, as well as features on the Generations Fund with a targeted goal of S61 million in donations, the governor's election which drew nation-wide exposure and a lighter story of the entire campus munching out on two-for-one hamburgers for one week to make our Wendy's number one internationally. The Funderburk controversy, reported daily in state newspapers and often in the New York Times, initiated a visit to Auburn by Time magazine and CBS's 60 Minutes. Auburn's usually laid-back students even got involved with the faculty's campaign for the president's resignation by the SGA voting 33-1 in favor of a resolution asking Funderburk to resign and buying t- shirts. The Plainsman ran for weeks the editorial Dr, Funderburk, for the good of Auburn University, please resign. The section also includes coverage of the entertainers, the players and the visitors at Auburn. Describing the year ends with a retrospective look at the year. The section takes a look at the happenings that indirectly affected 18,000 + students. Student Life - Events Editor Lisa West Photo by BOB GAMBLE 16 Sbring xg B. K, MCCOMBS mhf, ' 1 f- JENNIFER, JOHNS 4 18 Spring Spring is all kinds of fun, they say, and in Auburn, spring is as much fun as you can handle. Spring fun takes on countless forms and locations for Auburn students. There is young, foolish fun on the concourse wall. There is fun in the sun at Fort Walton Beach. There is nightime fun sponsored by the UPC on Cater Lawn. Spring fun is skipping all your classes every Friday afternoon. lt's an established Auburn traditiong everything after 12 o'clock is strictly on a volunteer basis. - by Tim Dorsey Plainsman Editor From May 20, 1982 Plainsman fm JENNIFER JOHNS Dance Theatre! BFITZ Lake Martin!JOI-ill! W Spring At Least I 1dn't Ram Fort Walton Beach isn't likely to forget the weekend of May 7, 1982. lt was this weekend that members of 14 Auburn fraternities and sororities, and numerous friends, invaded the town for what was called House Party. By Friday evening, hotels such as the Carousel, Aloha Village Inn and Blue Horizon were filled to capacity lor morel with students anticipating a fantastic weekend. The sun rose early Saturday morning and with it, a few people eager to begin work. on a glorious two-day tan. Among the late- risers, bloodshot and squinting eyes were telltale signs of the previous night's , activities. lt is said that the best way to cure a hangover is to begin drinking again, and many opted to follow this advice. Two bands had been booked to play Saturday afternoon and evening on a bandstand behind the Blue Horizon. The first band, scheduled to play at noon, was delayed three hours because of a car accident. Despite the late start, the party was a success. When the band finished its performance, everyone drifted back to his hotel room, car or wherever he was crashing for the weekend to rest for the big party that night. Three School Buses Were Parked ln Front Of The Blue Horizon, Ready To Transport The Crowd lf It Dldn't Cooperate. 5' Joe Loftis and the Pinks were engaged to play from 9 p.m. till 1 a.m. A crowd of A about 650 students gathered around the bandstand, prepared for the evening with lawn chairs, blankets and stocked coolers. Unfortunately, though the students were ready to party, the Okaloosa County Sheriff's Departmnet had other ideas. Flashing blue lights were soon reflecting from all directions, and the spectators were informed that property was being destroyed and everyone was to leave. Three school buses were parked in front of the Blue Horizon, ready to transport the crowd if it didn't cooperate. The band was eventually told to leave when the crowd refused to disperse. After several soaring renditions of 'fGod Bless America and War Eagle to exemplify patriotism and school spirit, the people wandered away. M-TV on cable in the hotel rooms would have to suffice . . . and it did.. No, Fort Walton Beach won't soon forget House Party weekend, but then again, tewy who were there will. T , At least it didn't rain.- 1 by Dianne Lively and L.A. Montelth e Party House Party 21 Promises? Promises Student Elections April brings more than blue skies and terrific tansg it brings spring elections and with them, like a swarm of locust, come the ,, plague of propaganda and promises, promises, promises. For one week we are buried beneath it all. lt papers our doors so we can't find the door knob. lt attacks us on the concourse in the shape of clowns or cookies. lt invades our minds when we sit in class staring at blackboards so completely covered with slogans there's hardly any room to write. Haley Center is invisible beneath the signs covering it. The posters layer themselves on the bulletin boards of every hall corner, eventually sloughing off onto the floor to be kicked into the dust. Everyone's got a slogan: Vote for me and it'll put white in your smile! Vote for me and l'll do your homework for a year! Since every campaign poster and leaflet makes the same claims, how does one make an intelligent decision based on this propaganda? Eeny, meeny, miney, mo The average student running for a major office, like president, vice-president, treasurer, Glom or Plainsman editor, Miss Auburn or Homecoming, spends close to S200 legally and probably lots more when you figure in non-deductible items like t- shirts that are sold, not given away. Minor The posters layer the bulletin boards of every hall corner, eventually falling to the floor . . . offices like school and district senators can spend S75 to 5100. Still, it's a lot of money. And that doesn't include countless man- hours putting up posters, painting signs, car windows and store windows and writing on black boards. Then turning around and pulling it all down again. A tough office to run for is off-campus senator. Even though there are 13 senators, there are usually 45 people running. So, how to choose if you don't know any of them and feel it your patriotic duty to vote? Enter the party system. There's Broadway, Wheelbarrow, Mirror, Slim Whitman, Good Times, Party for the Retirement of Bear Bryant, and dozens of others. Being a member of a hastily- formed party not only gives you out-of-the- ordinary recognition, but can help with your bank balance by combining budgets. But a sure-fire way to get elected is a good gimmick. Think Pink and use the Pink Panther on all your campaign material or try Pac-Man posters. lt's usually standard for the Miss Auburn and Homecoming candidates to pick a flower, fruit or favorite symbol to characterize their campaigns. For Auburn students not involved with the campaigns, the week's barrage of paper can be a nuisance and more than bewildering. And just when you're tired of it all, it all vanishes. At least, till next year. - by Abby Pettiss L VT1 Z Z SNHOP 2:l3:l ,N 4: 5 .-s. .wif 'Y WYE if, -55 Gfffgfw -'if' .P ,ing -4 .r 9. 31 Lx: -.1 Rau fit, Ns. zf'f',f,,n S 0 Vaal rf' pf' , J ' f -m m M La-f w-1 f 'W X ' My-ew W MM , an if W W- A . ffglmk X. '- M-fy.g.x V fQ13W2ffJ'g 5' In Wx, -wx ., Ww- was f f Two of Auburn's student senators attempted unsuccessfully to prove that they had uncovered what they termed a scandal spring quarter. Only hours after the initial revelation, students had dubbed the mishap Shakergate. The controversy surrounded the use of student activity fees for shakers which are given out at each University football game. These senators claimed the amount was too large to be spending for lust shakers. But the accusations didn't stop there. In the ensuing Senate Budget Committee meetings, these senators continued to reveal their incriminating evidence to both the Senate committee and the students, who they said deserved to know. These two senators barraged the Senate committee with vendor vouchers and receipts which revealed the price paid the previous year for shakers. It was on this price that the SGA Spirit Committee based its budget for the upcoming year. The Spirit Committee learned later, after presenting its budget, that the shakers could be purchased for this year at a slight discount. The committee decided to simply maintain its current budget and thus buy more shakers for the students. Rather than letting the crime escape the notice of the public, the senators revealed the negligible difference in the two shaker prices of the previous years and the They Employed Techniques Reminiscent Of Watergate iHence, 'Shakergatey . . . upcoming year. They employed techniques reminiscent of Watergate ihence, Shakergate J when they tapped their own phone to record their conversation with the shaker manufacturer who unsuspectingly revealed the new price. The Shakergate tapes were played in the Senate committee hearings accompanied by accusations of possible embezzlement by the SGA administration. The administration had been in office for less than a month. The unfortunate result of this concern for the well-being of the students was mistrust of the newly-elected officers who had, in actuality, done nothing to deserve the lack of faith. However, by the end of spring quarter, many students had their faith reaffirmed in the SGA when it became obvious that the entire controversy had been over, . . . well ... nothing. - by Alan Bannister Shake gat 5 5 Everything slows down and you wonder where everyone has gone to. Familiar faces are replaced by those young kids carrying their orange notebooks. And suddenly you find yourself getting everything done on time. - by Jeff Thomas SGA Treasurer ED FERRELL ED FERFIELL 26 Summer B, FITZ 3 M, k L'L' Qdiiswp 47 f,,M.w,.. . if iw 'wh www!! ED FERRELL Summer 5WIfY5'l Si' ?lf?sfkLf335fr'5'T?fVf?i-ffl'5715fi5i1 ifi2f51f94 , ,VQEWHTQZQZ l V5 - ?k7fQ53lQ4f' L fkTf'A5?95i3i W V574-ff'-WM :5Yi'5'fQW V2292'EiL5'ff4Yfl'1 'SLC :194fffiidm'xF97f5'-fff45Qf'I5-25'ffYZitfAfY9?i7E5,j,-, jl:1f- z3gj'?:EEF5g1jff2jf1'f, 1 L?Q5Qfif'f'f?P44XEw5j?1 -L w?:Q1,Q2Qa5Q'f51f?5:L K5KfvG?Q qQ'f5 'VE ?'l?W'Ef?fl V'?F?ff?m?' Lkffifzgijk f:'3'jif!QI3?ff?'kSFZHQQEQ,?y?,f?i1T?5'?fgQlg23lffuzfyifYW M p H ' X V v'b- N '- f - K wx.,-V .V K A Q1,f-Qefmw-lfxff.,?k,-,-M-:w,5Q,ww-,-NW-.1 , f-L,,yy5, g V fXfM.,Lfv,-MMQf4,i-.Wfqfg,i5,g,1f?f,?,L,,g.,fL,.J.IMMAQgIma,-.M f .hx,.,Qzg4. M, A ,f -Q vfwgp , Af f X -ffm: -wuz-,w m:,fz,A-rw wf,,:y,g.: rf,,-Smwaf---fm-w,fgm.:mymmgxwffi-gwxw. , L4 nQyaLA,,A, ew ye: .z,..Hi, fmfg,p,W,g4m.1,H,.LW1ys5LzjL,s,VQ,,gf,f,Q,,gvwy-if .m1gq,:,7f,1k,,,w.,,,x,,.5,k15g,, W ,,M,M,wy1, ,wfgkg-f .y,,q5Q.mm, fm, , 3 4,,,k,,?M .Q f fffg., I-:f:,::ff,..ff4fx ww ,--1fQg21p:,:n1::z, wf ,vu-.iifliyaigggghk5-iw-f .m2Q,',sfgw51--Sui ,ef wi-qw Mm-4 ,, , .f,,fgQ:WQ,-,gg , , N,--V ,.-fmqfH,,,,,f, g,,W,,H.44,g,0,kR,M,,,,,4q,LQgAL,.5,fggia5d ,A.5.5L,5,5xww,.,,,.,,M,.QV,.L3i.,,,,,,w,,Wkm,,,K K yww, K, uf' -gf-fyfssfrw-fw fw-,awp ,,-fy-,mf-w-u+::. aw-,L:Iffgfilwwwvwe fHv?M:gy.Efbf-11: 405515-f-f-JpKe,','X my fw::w:QJ,,,,Hf wfqsfgeksz,:5q,q-,uf714,-,Az-W:iw5f2:gxQ,7m,u,fyf-Lfv'-- sv- :dw'A'3b5f'?wgL43-.zjmi,f,,,f5m+:y5g.f: L, f ff 1 . 121,14 ,gfmff Lf,ef-,leer ,. n ' z ,f , ' ' f 3, id'Tiff??ffi1g3agw?nwsfif?..i:2Sw1Si5QEsiQ5EE?i!41Sf.41' ff- 51:5 'w?ri,3'::N: -'- ' ffi+?ff2w:f?Tfff K ' - , ' : , , L' :Ak I I 1tigQggig5gp1'- 'J' wgggg,iqh451e3gQgy,Xf.,- in3,5-:y5s,i:fW:1gps,H.4f,5,,ffg,gAq55511QM.,. M1 ,K ,354-g.g,ff' z: , - ---sng1fm,Wxggfggfgg.-:Jmr,:vw3.ga5mgnf3,7 ,gg 3gg3,a,1seg15Qa4qQg'wQgz.3--gg4,,wL5Wagfi,w,555vQg ,ng f- , j,fp,f--faffgaz.,-Q 1'fwfb?4Q2'34Q wc' My Q-:,1:-xrf,-Q ,wg1sarQ,:4- , sfgyywfa- -.fzbgkg Qruaiggz-,,f1, f.-Hflwgguifyif-wp.: ,f-,-1-.f:L+f,Q,- - sf:Qe,fsgg1gv -M jgggspggx,-Q,f1l.-wg3f5ugpws1i?1f,,-,5,,vfgL5r,,-3551.,f ,Qa,,m,,qWM,Q,s,gQ' wQz4,,:,X-Vfyyglfgigy,-y,ffff,qg ...Wxi,-f1?,',m,f,ff,: g315fff,hgf,,1,,,'-qgw,,agi, 'ew A,-pw W t 1, R 1,.f-,-mfg?.,LmmL,5, V 1 fm-,,4,,,, ?M,Q,3.X,gWE?4Mgm,. ,gq,AxR4,w,, :.::,g1m?gQv:Q 1, wgW4,Qf f2'1fuf:Em'-ffz:wgAai's2 , wseaf-ivf.. wlffukfyf veosw::sw2q1--X- 'rfa2wiQgggQg,22,gLfxffiwffgwif.wg-ggf1'i1.'z7.-fy7-.wvgsziigf-Qrlgk-.V-3, ,, ,1g,fQg,yf-ff ,fX:5:,f125ggig- wig.-,Lwg,,,L,5,,w QQ315-M,,1qK.,,,,5,,kezmlm:-,L,,5,1,qa.aaii1:1gy..-5,, , M f-wg-af-isk-Hg .11 wma- xf2:f,5afQfwiam:sm-Efmriyslf 1 f1fnezwsia:iw2+:QQwieikfmfi,1:fiesw+:14q?gmy Awwsfwqv-:Ea-fifwgfszfx --.gjwfliwifwyffg,frm.fagwsgQgfff1f'f'wh f f''iii-Lf-izffifk.w5:W1'Jf'1-ir-gfiamfzzW':Wim-iM,-,f.m1,3w5:PsE5LSf5sf.m xVf ff3Hf62- iL5i,wL'Q1f'Tf'f'-ii Swv-iwxi. fkzf 1zSiu,f. n1l1'lQgfbLQ5Gjfi92'mf'qf,J-vg,,cv-3f.,r - -.aizfzsffigss-4551 sA:LW,e1:1-,-Qvgygysrpff w,zif1pgkx,g1i 1155 - 1AAIfg,w5f.1M2125-:ik-glfg ,f . f , -. Y e .- h' 'k li , , f ' WU- A Aw-f, -1 www, ++',gf f,s-Q-Q 4-f Lfffdff'f1- fr fflfmwwwiazz11:11-'My .hifwz-wwfw72'3w'fazvw-f1'wf fr f, -w ws-min Nywva--7f1,K'+:.w'3Ww1fy 'SA55uySg2wzf,rf3'w1 X Wa kfwf-af-n9pW5mf2ff:wf-5-fp .f WL M ESL-zgfsfawg' Xiiwrigngig,fig-,szgzfwfaiwafmi-wg 'A .fri-1.-Q' wif-' 'D'wsifsffwf-,i.ff3my5Lizsw15Q5Qgs1-42,4355,ffimgfigywgiggjvww,Lm,g,?31,gfy-J-If 115 'Q,lg4Q1Qde3gg,,:L,QfM2AQQ,Wy535r M A ff 7 - Q ' 'fgg my gpalii-.ffg-fn L- 1: fffwixa My , 'QF f lx, . , awe Q -,f ' wfaigl--' . , f2z-asiw-2 .. of . ewgflyk. mimi a..-2,-:i ,g:L,:z1Qxv fizyi MW fgiisegffia. ff:v53i4ffniw:',sg iff: L fri! iii 553223 1 K 'li f'S2?5fXf1.I , 1,,., ,X -. kffklfflrf' -. 1 f ' fads, iffifyfygfqi' f 41559 l.7f5Qf'15F' , . ,L.,, fi ? A. ff,a::ff4Qz-fmf?mf- fiffiigki-M393 L, . Ng K M . uw 93?Q11N tLwe-lfgxgigfzw 22551, X rs' K 5 H if-,,Q,gzagvf a xfzxfgii iplffvi 517' ,, Z WW f,, X,- ,L.,, i ' ' 1 , .is--th' wfifw w1vfwf'ww'12 X mi if ,, , fi-5f:271i'zfif15,w l3V'fi', 'f - f:'?ff z1H5LilJ,h1 f 'x ' WA ,L,,..,. A ,. .b,' ,4.:,. glngw rw, Aiwfsasz' -f L f X 4, . ,-zggp5,QQs5zAh1Lf-1 f' 2 - 'W-A1 J... azzgi-,, ' fmt 1+ ef I ff .... Z ww , my agfmgekj-x,1li5:'y W ,wy,1,,mg?p,g?,h,W.A. .f 5, my W- fs, mg , , W . i,?A,,.L,,5 EHMQI ?lE,fX+fg,ff i.iij,?1v,, 11214, FWZ -1' V 'lf .inf-ggwkwx ,f W 7, i 1., , ,Z 'QM -H -f7i1,25iff5?'CQJ':L'i , f mfw. ', .pmgff-4:-Q 1 ,f wfwslfw-w-,Q, R fffwx,f.,,.wf,ffz -iifvrf-mf w ,f ,, if 7 ff' .fvsmif'ffliizlkffy-515,-Vw: wa-Q ' ' 'A xf5lgigyt5swf5Q:ay L se.: swiggwQ,-gm'ax,Q,5wwf.gf1W:f,,,fQ3yg:f5:Qfwa-,Xz M51 M rx krffbfff Qi A ini? ? -A 3 455'3x A V kkgfffk- Wm :Nifty . Bef 1 :QAM ff ' k 'i v N 4 frzfiigll f'1'-fir. M up ' , .. wk ' ' N ' ....... ' 0 f ' ,Km www- fwafefsif- vi ' ' . 1L.w,gmf1w5,gg,isxf2f-fbfwif-XQNWWSW L Y. J 1 , x 1 fi. f R '. .M f - ' 0 V K' ' x . . f- . -- 1 - f-ffgfysg ,:f:1g,w?Aviw Q-,gf14fqwg5.fgf ,, 3 1 ' ' W lfcrff V f Z, Y . , . ' 1 .' -' f 'r-- :gf Q A , , - . V, .W f----vm V - ,, . if gh 3 U 4, QQ , I .Mg - , 1 .3-F' ' 1 J r ' r ,i 'F S , F ,wif , -4 1 1 , rf A f -V V 1 :If-WWA ' if 5,1 , A V 45 L ,g , ' I . 7 ' 1 Q, ,ff.f-fl w 5 8 Q fc ' f . 'J - ,-- si nm, Q ,, K, ' 9 ' ' - - 1- ' , '- V - -- 1 If , ' 4 x V .5 f , si ' - L ' -- 4 ' 2 f V . 1. X- 7 . ' J ff' 3 ,. ,, ,1 'f- g U f I. -0- 1 USM-.wW,,,P1g1 ., 2-:mm-mmswf, 12 -. , fp ,f H1 -- 1 V N ff-Q 4 -2 -f' - . W ' '- - kgs' 1' 4 - t .2 t ' , - -1+ ' W., ... -V Kam - W A N, tz' J ' W Wy Q A ff, . -v - vu. -,' - .fm f F- - ' -' K -4- 'K .' Af' NW-251' - ' - . ve :JA 5 , -,I , V ug, A M , V , V , K . , .x?v: ' , M , y .af mv.-,, X 15,7 . V E. H':. '::1a.4 win:-k,, 1,+T11H'm,'iey5fp'pf.,f114i,fi:T 1 , fx - ' f' -+4 W . 4 f'x f - - I 'A 'PM ' W N' ' .. - ' ' 7' . f- - V , 92 4 ' I' ' 1 -Imrvf 'vn,,,z4f. -Q. - . sais' x. ' 'NE 5231 ' 1-, IA 1 , W K .A f f -,- f , ' - . , f ,. 'V ga.. 1, . - fc Y ' ' . - . ,, , N, '- 7 , ,pn . nik. '. fx, . ' . X-'Y - M x W lf-95351 4' is fri- - 1- Q? 22.' 412-X -C' f M- , 13 ' . 'f ' 'A f We K, H- L Q.. 4 , , S.,.,,-,ggf-' K f- .gk-H.-. ,. .. ,L-,v ,:,.--fav. - . p --:M ,-5,AQg- KVA, Y Y ,K ' P ,:,,,,,' J . 5 8 , '-iw., . .v gglffi Wh' Q-QFQN . 1 r if - F. , g :-44-Qwriim f w ' F QW W --. ' V ., . A A - x , ' M - 4- Q - 1 H .pf ' ' - K ' - ' HW -V 1 MN Ax, J ,..-.. ,, . , . , V A 1 L ,pak g ' W M + A - mm Wi A gal LS, ' id, W5'pQ 5.. 5tQ j , WWEMS2 x'-'f ' - 525935-fgfziz W f -nA . ' , -X, : W4 .3 ' 1 4 .1 ' Y , V M .fl K ' . - 3 v f' ,154 , zz Qa1fa'43pszfna:qwq:5 f .- , A-, - , f --u ' Q -e-5. - ,.-,,,, 1 gm-2 S f-fr, Xgmsflsffi, ' ' . ' - M K- . Q - 'L I J? ,N - H . -. - hwvifsikfvf-f: ?if' 'kkfwssikfeebfXwv,1Wk-wwe?iw , ., - , ' - W ' ' 135 7 U V ' -f ., f Q, ' V N, 4 , 333,55-fj j ww-'gzapiy ,vaaifcwj ,- . Uv ,, . . - ' ., .rf- ,x 'X -4 ...pg 2 4'- '1 f'4?wS'r2w -P M -Q - M1131 N1M4,s.S31.w,-zfafz Y-Ha, Af - m if , X 5 kk , .. y,,Lwwip,a f5im,,M,fa SS df ' . If f- W .. V W f - K , 'N . zfgmfrsgef:A:05fP2N?fi??wS??ew::wsMisa -QQ? 4 . X, .. . . ' -' - ' - A 1 - ' Q X M a N - , .. .31 ' 1 'ff-' A Pf , 1 , , A ,Q ' 'V- f -- ., - ,. -5 K -f M f. ,, - - ' , - -Q-P A X Y V V V Aww up M , wi N , 455 V ' g ' ' 3 f W Y' Va'M?7SH?w1r -1-fl -W-,2f,,,wAm ' Qgffwff-G ww,3.W,x: na4ww,fi,m,,W,,2f.,L,9,wg,-,,,-wr 3,1 ff R, Q, Lf 5- M 1 W,- 4 - : W f M . ,wwWW5ggw:gwfacma'aQssQ?Qaw22:w:azw:r- ' V Q A -X ' X Q 0 - Y fw f :L All H A Wi Vw-Lil:y.,1Lfs,gfm5f555,g2-.wff4,-ww?--wus?-,, wtf?-,-SRf11P4 .ZSSQFRA gm, ,Q . V- lg , ,fwkacffsmv vm-fLifww?6?fwfaQygmf :ff -.w mv MM - M, rx. MQEXLQQ -- wg ... ,A f .X W ,.,,. .,fI..,.,,..,,, ...,. , ,. ,Mx .,,,, N ,...I , W h .I,.I ,.....,..,. J V .... HW, ,. ,N , W, . . .. , , I . . . , V, ,A , ,. ', ?S'i159q1?Q-Wag, , 2bbQfi5.,Pwg'iS iaa,Mwfggfgifffewfktyz,fliimsf1 , ' ME' wa. f aw e' 5,3544-Aw?? 1 1'bf3g, w '.a J fi 2' , - -,- -fig-f.,f-ww-1 X W-1 X, gwwgwf,4-Kfwmgefssgifglm:-:.'.-wgmsffffiwymu'L-1wqwfzQ:wrs,'wffwev fwfnm?S59g.1 , M K N5-1 wg fffrw -fy mf. 4 5, A my Q 7 - MrwM.W .E3mzaff2f,4fP3f12?g?Kfww:5sIe2fW 5559. - if 1 -..H'-f ef gfek ,W vgmgssfw , fi ,, R LQ - ,g A 1 ff-sp, , , -. +G 1 V K - ', Y :Qs - LM I G +. 432W ww Q f fy af -Q wg fsfg., .,- fs win wigwfzpfm .,fp,.f-mfwfwb Y ,wi .gif fn, mxgffe? QW ,aw-W,p.ffX A251 1 LfA7Q mQQw-av f.ff , . M f- 1 M M m ,- mffwzf fs.ff,MJ, .4 eimswgm ,W M K Em fl-'Aff 4, ., .. 1 Q wsfpiqr m gsw ff T,wwQ5fg,2if5wf M- ,war ,, ,W W 44, , W+p,Q -- Www-fy wal w M x ,ww W M , ,.., ,wma .zum fvwfzxwx -gw-A Msfnmyf 1 an ,. -- - A .A - ,Law-WQ f-Q4 W 1 , , - V- .. 7 A, ,, A ., f 5 ..,. V 7 x'R !w?X ' Afsfiww-fzifzfii' ,R uf? 'WSLEQSP Q' fa afszw aiwifexwe, W A- I WM - Aw - -H Q1-, 7 KEYS- , ' W, A V. ,, A, , M V- .-ef'-A hs - - ' v -sm - A . v V V K V H V 1 ., W . , Q' . , , . U I .., , . . V . A f -, A - .i A. , ,N ,, A ,A ,. A, . . I U ,.,. I, ,- -.-4.41. .rp .... I g. u h A. w. n- A ,A A ,M jf , , 4, V K gf Krew ,-',.-gt? P2111 'pw 3 f f S Wswwifx i 52 ' b + A ,, A. A .W , IIII f g A -f s I f ' l fwfveas - Je Aff - ww , sw ' , ,,-' kif en f W -'A 1 M -- W .V pw. w w f ., mwym g:f2eQ1W,f+4zxX 2wBw5'?Kx51?l'fZ 4 Q ww-:gu-m-- ,mn-.L,,A.w1fs,efQ,QvMwmwwgw yxflagwyfagw ag. ,,'.sS+ A f we . - z --V V, 'Q fyw dai-3354155 ww-M f fm . rg V -X M . A gf wwfme V ,H Mua y , - If ff? . Y Q' V, v f . as -1- , ,mi s 1 Q s 'fi 0, A ' M. Mffmgrv y-11,W1,M,A M, :A Q' gy., 7 Di W - :vmi wwfsff K A mf ---- A Y A wg. me - 'HW ' W 1 J . WB- J iff Q2 ,sfwfu .2 'HY A'bQgf9X2i1f?wfg:fwwQlivgfffffvi--wfvff fgrwsz V, ww Af dr M .--.: +f 2-:ii - , G-.rw wlqmwa . .L I f 2q m: 51 ,i I , Y k g ,Q-mmf . -g:,ww-if ,Q - J - 0 yvmxvir , . - A m J W' Af ' A f flwfwczz. Mxwp -- V .- z ff , A Y aff' - -Y fwfifffi mw l-Af .4 H W f am ' fm A N , , .- .:7 'Q??2 ,gfjii fi .yiffifrvfx 1 , if I J f .L ffgf ' u p E W R i w ? sy ,ssh Y' , , . ,, we Q L w . wx 'W . - . .. . 1 -v-Q: , '.' f f ' 5 ,., ' V -sei 4+ fr ft - X-3123-A , gl 4, -awe 'T F QM Jw-6-,rw - wh.-N-we ff f IL f'-Q - k - f' . . A - M y Ag A -V A 4'-eygffqwg - 1,fQgw2,w1sss22ygfsm4-sqgzfgg, My Qwsgfv ww w ' wwvywbw ffyggggfbgfg ,Q . :mW ,,4 4Wmw,f,i,,6Qm1f M? 5' qi. : f , K f XA' f W 5 - , K.. N ,,,. Q M , .. , , Q . II ,.,, A , , W W L . ., , A, ,. A , W .- . M. , M A W.. W, W -. , . .. V. M , , ,Y ,,, miivgf ia Q5 jizfif Q V R' ki my QWEQ mm www? ,W 2 553? mx QM! fa hmf2 a M WZ eg A ' ' ff ZS ,, mf W fn 'Q mf af' aff ,mg W fxfcfv 1 5 5' Q 5 aw W V ff JY S3 ,L -Q wvkw-' - ' wffjw, -J? ' 15520-Q 4:54 fam D? if f Ya A fi S .1 5- 2 ww Q Q -M Qs H? M8222 fig Y' 5 N 'gig gpm J? LQ if' ellgww 5355 3'?f?' if WZfi7L,?'4: hQ3Ef ' MQ? M, 5, B 4 P, 4,96 '29 if, ' ,,2we-w - -f A MS? V J M X '56 2' f' xiwwn' E V' ' LES? Hwy wwf Sf? mu 9v d f fm Q' ' 1 W' fm -'W J? Q x W 'fx 'vf ve H+ 14 P z wmv .mm 'wmv m '1 Q E 1.312 Qigifg r 'df K5 ,Pew MANS' My ,gg 9 WJ? W 45 K QP f-3? J' PEJDB5' ZH Af mf Kimi fffx fx m- HQ f K J my Q A V, ,Q SX jg, g Z, my S Q P is Vg My ,My was, if ,wig gig? M 5vgi M S mmwhww, :aw-H, . -T W ff4yf,.,fr,14 f?-mwu W, .. .. Z 3, . Jig 7 ..h,,,1iN,.,, 3 6 M ESV' N251 f CN M2 ,Fw in Sfmffh QA 'K fini My 4 My WW Aw 'W N 5 , : 5532 xafimf 'ff QM P S' f f W '25 Aggyfg i 'ww Ax W' Sf? 5? J MW fgammgwggkg y www 1 fm ., anna. iw if . 'd wm wh ff Jw w wf aw if ws aff my wi , Mia A W W W , . w a - V -Q-4 U A5 -vga. Q55M3,?5i,'v f , A EW W: Awww .mfg mwywfw myyafmmm, A , .,wa3,,.,, ,?,.,,,M- -.73m.., m w,.Wgf5i I 3 - ' 3' E '53 H 545 Q ww 45 -Sf Kfwwffw Q,1r W QSM 5 Mfg Wm ?4SMf W E. ?'H mg Q2 Wax if X L Aff fsiwfl-yfy a www Q ,, A W. , 5 , 5' if Q X 4 gffigfigfwggfgg 3, 5j,ga'?fF5'5f ,Q 3 final' Q33 W' mg a mr , 59 ' ff N f A' Q2 r , 2 6 'ylxf x sl ii E' 'Mis me gif 1, Y ' W9 ,385 'eff' M Yfjf 41 3. 2- 'jf ,751 U ? 92: Q59-,E ,af f QL ffffwlfsf ,die W M 4 ' 955' ,YQ f QP gi? Q K, 21 S QW Y y if New ? Wf U1 51.5534 W HW izwa- M iff- ff -- .. .. , V W ., . X' QQ F -U Q .. e ' U L .A,. f , H x W , iw . 1 , .wa . uw--'sgafv a wif, f . Q -Us wif' weffgf 2 g n , A:L,.,.,,W,,, ..,, wif? W - W ... r Wig if Q wwf- -- x g f 5 , 17 A -ww. . Aw: if if 5 , 'L f' , . , f A . , wig, - M fa Im ., . M MMg,fW., 1 X WN. ,E M 4 Ng fi, 525+ S, , , D354 I jf ff ff xg, K 3 y' K, ,fs m?ffQ? L Z' 5 fi, wk K 'Q -kt ii Jr My Q 6 5,5 W 'Q ,E J 9 ,. if s. , , gs 9,111,514 R , af .... ., em A fra ,isQ,:w, 15 f , , M . - , Q ,wave , V- , , Wax. W .,,,, H MM, y 1' . , Lf 4 r m , A -rf' -2 7 A J A ffff b -- ivy Z MWY '- ' A L N'W-HW W-vw M-::1:nfvrza vHLfm- Q 'M' Wwfwvwwmwm mlwezmwwrv 1:0 7 ff 'mp gM Qkmf :mf, V 2E mwif BFf7V' :Lf'iE'f?i51, Mr MW-fffwfz.mMwK.. ' Nif:mfxN?5f7iT7i1 MMMmfoxfv-f' Af K' ' W - - I I l X l 1 w 1 M ' 'Q ,Q 9 w E Q YI? 55 A x.9L- Q ' 3 ig, :- 4 ! 1 ' , , . . 1. , I. b -I ,, yi. x , -. , ,, A . K .V X qt, . A ' Jaw v A .,.., , , 4 ' w A315753RE11,5,lkSEne'1Lga, W ' ' ' ml-i1figf1fglffm.:I- f fa ' ' , ' - x M ' . f I ' ,Q . , Wm. W, 3f5'j1'i wi , ff, Y '44, ' x J Qt' i ' Wu. --, . . , . i MI :mlm :Si f-'w,?'f3:JEiLl?iL.v, -U ' ' ., . - :fL:?If5'fi5Jl'Eif-:fillff w 535'?ff5l'55i255f?-?Zl57f5:-Piiiwi... '- 'i.T,!'WRf fif-l23ff,.:fZ'lY2' ,, U .A ,, -'f-:',f's::s,?1'f,g-vp: '. V . ' ' ' U 7 'f-l iTf: '! zi-Wf 'P fizii- : . -vs ' 'V' M In Q, , . WW F Y age, fs L' p b - s -w 1 S ,gf , -Q 1 , - J I- ,Jn W5 LV 'W ..f,, - .VV. A' if ' f,f.Qg1'1L-fgQ,:,w1Hs:iinrrwiffflchlfiizk' 'lf'g1ff-Y:-Wifi' 11 i'M'W:-rams? Y 1: gm :gh , N A, V -vw:-. flaw' ffiiwhlmbiZiei'6p?f'QiZe2:1mf:1f'M1w2-s A :ffifwvg M 5173, z -1e41i::zw-W: , - L A - -K 4 '- . Lv..A.f---f, , - , . Q-1v,7f.w1,f41-MM,-M.,fm.4w:,fQ..f.-,im Milf-. twfzi-ffi1Q?Eff11afg1 ,. , , .ma1fthwzffigii?:1efaf?f2zf?b2?Qw1453'Le?xwwfvi-g-gy: rW1.:,4Lfmw4.:11Ufwffwfu5sg,ggQ,3hgg ff t L,,L, , AL,,,.,, 1 ,1 1 Q- vuMIm-'1y+w2,4xa4:wf . , W, . , A , W., ., we-1LQ,-1:-awww,W-fwf.,gxv:g Q1 f f- Lfff 1-'f'w1sfQ4ffQ1'1Q ifiawaS1szzwmfm1:s1.esf1 22322 2'Q'-Mig'f1QQfeisx2s2wsv::,Q 1,1 U -r:Q,w:,sg, f wmgwmg 5,w5,gaw,as'-W 2dg5fxg7x11iw4 vm -w,z1mfL:gm,9iggg-.1mf,'.1wfE'55-gQ,gQ,.A 52:4-131.145-',,, - ,f.Q1.1,y.wss2Wkisalsa'-Mqgmg,a,f,m:,Qf,,f.4'Wm-1.1, ifs-ZYSW1 'iisifl , ifvflh' i2fSw1hK'g3I'f3i'. gCM.iLEFfii?ig'5?'Q?f' Vff:?.:',L:eE,FV-P - ' .,i'df5Qfi3 5i75.f'Qffi46z'f 'ffx!if:?I ' sifQi'1'2-3' 1' ,ww1fff'f2fGw2w1ffffMxg?lw:f24:'.:5fz,af1:zff1'v,-swim 1 M ,ks.4, with-i lgwiwo,-iwfsx:ef?:f'2w.w-'62,V,-mfg-'..,if :hes Qg:1.13,.zgfw-s?v4g2f4,fZig3s:g 55g.y,sy,p 1197. 9fnSfUlAi'f?f Jfff1577195-5ft f,Z:f:5'3?i59!1?2ff?''ii?5iXf5E'IYEL 1i?ff.lIY'lkl7i'f'? ' QW-555559,fidillfvEHRi1fg?j93'Aygg:ZLJ-1':Flfxfjj,j A . of 1 'W ,Q :,Q q4i1a11Q2f'Uz fffwf'f 'K1:J::Hh1 U 'irvQvfgmiwiisziggrf qw,-W1,,.tqLgf-15-15 iii, L.,' ,gl V- vJ,- w,,-v KW-, f,A A v-.f My '-f- H , , K . ,. , , ., .A V wg-I lf A J-M-J 5-'I 1'1E2'lvf-15153 'U 4-L, f'iKw,,f , 55,2-ij!-'gf' git sw H.-,qn.i41,,g',, ,VK 'mn fyf- 1 Ragga ,, Q an ' f' f L,-:,.,g,.f' .4 '11 17'-1151 .1 1 .,,zf:ffg:p,, s f, f rw -, fg11:Z:f2' , ,, Z, lar'-.2251--ri K -'v ?'fL5w, 'H::l:':f.-w:-gl- Nw -M HK .e:,'sw:',f1'? -' , Af v -V' 'TVN -. 'L A ',y.u', w: X' 1' H ., 11wstfz,:1'sfH1If1,ifi1'1f4-faxzntig,as -ft -' Q V uf..,.-haf::,11ii1.if:l:if-'s:,. 1. - lt1155535s5'Ef95i'f'fi?ilmiifiif'3ifQ2fflS?Q:51i'.?1i7l7,Z? Q -' 1 .rfb5122252ff45-gig-ggikfsizsfii-gif? -k.1kfj'Qvg1a-me-'Q K.',-gf,'g-g'1I-e,1'j-,-fy, H Y .. . -ffm if-22 2 is-i :l isa vfe:fww:1z:7g. V if 121: f4: f.i+k,s'f:h:,Qfi 3izlmwev-?i,7ff'fbs5i5z ivglzfkfizzsawifklf-QQQQJQVZQQ,2-QM1195535g:g5SLvg1gjz1,51v,:ami v J: fa'vfggw-5'13'mgfcgpngeibxgwgswvrgxfylgwyggyfqg,gg-gL,,w'gg-,gnmzf f, '- 121'-Qfzl-lgwvwyf-WM57 ,.,.,.,,.. W Vg w,,w5f, ,mg ,3,.Q,5A.,W,,r,,A ,,,, , , , ,, L , N, L l l Fall is a new beginning -football season, new people, a better year and excitement. That's football time - exciting, l It was a great season, because when you X work hard good things tend to happen. - by Lionel James Lillie Train 77ger Football Running Back 30 Fall 1 l l l BOB GAMBLE ,mf WWW' M L, X, L... MN af 1 N S51 WW -fzaffwf i i JOHN REED . . v X .2 D- ' my-fi-ale-'l4g,sS1 1 X Wwwsgfwg 'wi . Pau 31 E 53? if xf' lf , 'V . ie 5 if f I 1? . i W Q A 4 1 f V Xklel 2 w i ' 1 ,A iff if .',, A ,, Affijg-iff U i 1 9 , 'J L 5 ' l f-fn Mba 5 -f N' ' , f W? ax Q W i x ,gx Q s. X i ,NL K Eff' f ,W XX if K.. Q ix? -ff 1 W X ' f Q 11 X Q f 'ff M if Y ,F J X Q X 5 .ff , A Q, Pennies From Heaven . . . lt's been said money is the root of all evil, but here at Auburn a lack of money seems to be the true root of evil - or at least all our problems. Auburn University seems to have an almost permanent cloud hanging over it, full of financial troubles. Heads of the schools of Engineering, Pharmacy and Veterinary Medicine continually worry about re- accreditation due to school finances. Faculty and support personnel want raises, students want more services: the list goes on and on. Almost every problem here at Auburn can be linked to that often heard phrase, lf we only had more money. One bright spot in the picture was Auburn's budget for the fiscal year 1982-83. The University received an 11 percent increase in funding from the state Legislature. However, a lagging economy and high unemployment reduced state funds and forced Governor Fob James to declare proration in the state education budget. This knocked out any increase Auburn would have received in funding. The financial cloud, however, has a silver lining. The Auburn Generations Fund QAGFD, headed by Alumni Association Executive Director George L. Buck Bradberry, as of mid-January had raised more than S36 million to help Auburn financially in several specified areas. The AGF is a program designed to supplement state-funded improvements at Auburn University. The major area of support for the fund is construction projects. These projects include two engineering buildings, a 51.9 million auditorium for the vet school and a 32.41 million library tower for Auburn University at Montgomery. Results from the drive can be seen all over campus. The vet school acquired a 3150000 Equine Surgical Unit, and a professor was added to both the department of finance and the department of accounting. The library received a 5300000 donation, and the School of Arts and Sciences received S500,000 for its humanities programs. The drive was launched in late October 1981 by President Hanly Funderburk. Since then more than 3,000 alumni and friends have campaigned for funds for Auburn. Students have also done their part. Close to 200 of them representing 19 sororities, fraternities and organizations raised 590,000 for the AGF during a phone-a-thon held last fall. The drive thus far has proved to be a big success. A target date of November 1985 has been set for raising the S61 million, but Bradberry said he felt like the AGF would reach its goal a year earlier than planned. 'fThe support thus far has been exceptional, Bradberry said. 'fl'm elated that we've reached the halfway point. We're ahead of schedule, he added, but we still have a long, long way to go. - by Patricia Vick fb mvwwwlkfl' G nerations Fund TelethonlRlCK HOLL Godspeed And ar Eagle! 27 1982 of 58 drrector alum until been Auburn. and Hartsfield their d shuttle trip one. Mattingly grew coming to BVI -L . .1 'lf 4415 ,j x .53 J 'L O 7534 if ff: Af fffiff 1' Joe McOu0rc0dale!WlLL DICKEY, Mongtomery Advertiser George McMiIIan!BFiYAN EASLEY In a historic comeback, George C. Wallace was elected to an unprecedented fourth term as governor of Alabama on Nov. 2, 1982. At Auburn, The Plainsman and the University Program Council held a mock election to obtain a preview of students' opinions. Nine hundred and eighty students participated in the election. Folmar won by a landslide 86.6 percent, totaling 832 votes. Wallace received 84 votes, an 8.2 percent total, and Henry Kingle of the Libertarian party received three. Two percent of the students were undecided, while three percent were not voting at all. Despite the strong student support he received from both Auburn and the University of Alabama Folmar was defeated by Wallace in the general elections on November 2. Ushered in by his early supporters of the 60s and 70s, Wallace gained nationwide attention in his successful bid for the governorship. While federally-appointed poll watchers kept surveillance at polling places in several counties watching for illegalities in voting procedures, and the news media from across the nation looked on, Wallace captured the rural, black and white blue- collar-worker's vote to earn another term as governor. Wallace has been in Alabama politics since 1946. Because of the segregationist controversy which surrounded Governor's Election his career in the early 6O's, he became the state's most famous politician and gained national recognition. After a four-year leave from politics, Wallace, encouraged by his many faithful supporters, came back and announced his intentions to run for governor in the 1982 elections. And though the outcome was in his favor, the win didn't come easy. Wallace's past played a big part in his campaign. His opponents heavily solicited the black vote, relying on Wallace's past to hurt him. Wallace had to shake his segregationist image and win the votes of many people who might have had trouble letting the past go. He did. Wallace concentrated on the rural vote and ran his campaign on the pomise that he would bring international heads-of-state to Alabama to promote industry and bring jobs to Alabama. While Wallace was campaigning, two other strong democratic leaders were also mounting campaigns. ln the democratic primary, Wallace faced Lt. Gov. George McMillan and Speaker of the House Joe McQuorcodale. The primary race was close. McQuorcodale was squeezed out of the race, but the vote was close enough between McMillan and Wallace to warrant a runoff. When the final showdown occurred on September 28, Alabama democrats chose George Wallace to be their candidate in the governor's race. Wallace accepted the nomination, while McMillan and his supporters held on to hope until the last votes were counted. While the Democrats fought for their party nomination, a lone republican candidate moved throughout the state soliciting and gaining support for his election. Republican Emory Folmar, Montgomery's mayor, campaigned across the state during the primary, because his berth was the republican candidate was secured. He addressed the issues and solicited support at every turn. He even gained the support of some democratic leaders. including former candidate Joe McQuorcodale who surprised the state when he shunned his party affilliations and' threw his support to Folmar in the race against Wallace. In the end, most of Alabama voted for its famous politician, electing Wallace by a landslide, but Folmar was the overwhelming victor in Lee County and Auburn. WalIace's comeback lengthened his career in Alabama politics to more than 35 years. He was inaugurated as Alabama's governor on Jan. 17, 1983. A political phenomenon, political mastermind and political success, Wallace began serving as governor - for the fourth time. - by Lee McBride Qld News lsrft Necessarily Good News MH ?vQ?i?i!FW+ f Q1 M if , Q -f f ig, 5 .- . ,W K: r v ,. .an , 4? e M , y L 1, w M gg Hi -2 gf- , at e ., M ' 51, Q J , gg .,Si:,zw5.1:J'P Ui' : ef f 1 ' , , ,,.,, ,Q ,K , , W,f+-. WWWQT ,, 51' ?g,l'?1- A X 52' w'eM ., M '11 ' TWH 3? c -1,g -'B . x 1x . ' s ' u fl '1 it s 3155 .va xtzitgvgl r-:NFKQYK 545 'Q 'x-Q' - lh,gx.. A N ' ' xslvxm sm. X i ' N A . x' -1 ,445 it 1, --is-if' I . ? T gzgji ff. , -ii c 'ig' M it we f 'mfs' B. FITZ These pages are dedicated to the overwhelming spirit and devotion of Auburn University students. Their unfailing support, even when defeat seemed probable, motivated their team to its greatest victory in a decade. To them we say War EagIe! - 1983 Glomerata Staff A 1,3 AQ? -f: 'M gp -' 'Vx ' Wwisa We 4z,unu HAMBURGERS Ann NU mum run A rnusw' is An incredible number of Auburn students started diets on Nov. 15, for the week before they had participated in making Wendy's a world record holder for selling more than 42,000 sandwiches. Wendy's sponsored a contest between all the sororities and fraternities on campus and awarded the ones that bought the most sandwiches a stereo apiece. A jam box was given away to a daily winner with the help of WEGL. FarmHouse ate their meals at Wendy's everyday to win the fraternity contest. And instead of splitting the two sandwich deal, the ADPi's were required to eat both their sandwiches when the competition got hairy near the end of the week. The lines seemed to circle all the way back through Opelika at meal time, and these were just the lines for inside counter service. Drive-through customers were stalled on Montgomery interstates trying to avoid the inconvenience of leaving their cars. However, l devised my own system to beat the crowd. l'd cruise through the drive-in about 8 a.m. with three coupons in my hand and emerge with six sandwiches - my supply for JOHN REED the day. l'd eat two for breakfast and save the rest to heat in the microwave. fl'm an ADPi, so l had to eat all six myselfl. Flay Marotz, district manager from Atlanta, said that the students really got involved. lt shows a lot of good college spirit for the students to get behind a business that's not associated with the college, he said. He said that Wendy's made 390,623 for the more than 42,000 sandwiches that were sold, which broke the previous record of 370,000 for 35,000 sandwiches. Dana Becton, local manager, said that Wendy's accomplished what it had set out to do. He said that he is very pleased and appreciative and would like to see this become an annual competition. However, Marotz said that they probably will not have another contest this fall. We had our contest at a really good time because of Homecoming and the Georgia game. We probably won't have another contest this coming year, but we possibly could have one the year after that, he said. At any rate, both Marotz and Becton were high on praising their own employees and the students who supported Wendy's during the contest. They also said that they had a lot of cooperation and help from Rick Froehbrodt and others at WEGL. The world record could not have been broken without the concerted effort of everyone, they said. However, l'm sure that many students may feel slighted that Wendy's has decided against another contest this fall, and they may be inclined to try to persuade Wendy's managers to reconsider. Just the remembrance of two- for-one sandwich coupons, and the thought of chicken, lettuce, catsup, and mayonnaise or a single with mustard, catsup and cheese, prompted my taking a lunch break in the middle of writing this article to partake of the former. Plus l still have a drawer full of pink and blue coupons that I am hoping would come in handy next year. - by Letfa Owens Wendy's V ,- . - fig, - n ' . , 1 ww, ,,,,,A,f.+:Qwa.s,w,.' aff: ,. -1 pu Swwwvcwmnf-,,.f'4awm',,wwez+'wuzwww'-,.nm,,L,,w-maf..' -1, fffaiv-:K ' - -14, , . f Q ' b Winter quarter brings about a relaxed atmosphere where students are apt to study more. lt's also a time when you learn to appreciate the sunshine of spring, electric blankets and hot chocolate from the Flush. April Southard Miss War Eagle a :ered fe, y. l ' T',f'.f',?1 me 5 'I'---fl. 5? 'JL g Z. ggi f, 'Qi 1 ' 'U 1 - N K R . a K 521 .I 4 . x x N' 6' .. ff s we at eeei' 46 Winter .Q we wyg-Mfg,-:Ffa , 'fgdlxdwv s r K Q -: ,W ' as fgg-Sh. 'K . -rw haw K 1 .- is ,,431:,1 W L ' raps . N., 'll A ' i , J mai' - M W'-,tw MIKE WEEKS 54 MIKE WEEKS Winter 47 e' ,QQ W5 an , 2 , I9 5, we if , nm :Ha , 1 QQ Ask Q ' ' U fill-k' 2 I ,4 Q KV M 'ft W ., ' z 59.1 . OJ' U . 'A' if , 4 gf' ,V -sw, gg 1 gt 6 9 F1134 P Q ' A 'L' -VF' V' . ' V 4 ,L ggiifz ,vV!5'Y', 1'-sk :Mfg X l 15'f?'f Wig, , , A : 'fwwf .1912 Tlgrx ,ff 1xk.,,,N- .r ' Hz 2 '1 ' 1 L, 1 , , . , . f ' f y oh' , . 'YV-, 9 ff vw- ,Sg 'i '-'- , ' W ' W' If aljg Y- I V- VL Vsw-Q W- -Vx. vm N2 ' V V ,QV-'VVVV:VV:1. R511 A Vjfff, ' 55 - VWRT -- -T' ' fi' V L ,, A 1' V .X 'iQal.?iVs.3?fXQQl ' ' V ' fa-2:vQ -YVV V ' V. -1 . -- 2-M 'A ww N. 'Y-H' -'v , , f - , i f- -QVQN, Q ,, M.. ,J ., M, - W ,, -V . V -'gnu I aw . 1 , ,W V , ,, , . Q K W ,. W V, ,,wV w -V, V ry ' . , , . W V 5 'P bfi' Qu fy g'5Wa'9' ' ' 4. ' 1 A ' LV Q 'mf 5 .'f-'MJ' S sw , 43 . jki hh - ska I 'V V :-L. E' -Jw ki V 2... V T..:,Bwf5aA 8 H I f ly? 1 N573 ' VV VV V , 'JV i - QV ' W , 1f'2,,Jffsi,,-alia? I M4 5' N' ,V . ,, Umm? 'Y 5- ' W i - '-1 -'Q VJ' , W. '-Nw,-- .. W 4' 1 A -0 , '.w 'a V.Lmf, '- VVS- ' WV: M, V ' VV 'VV3,4 VVV5, Vgg- s 3--3115 V ,K -V W, ,M ...QV W-5 V.3V:.1ug wg ,f . xii - ' 35' V - YQ . A MV 'f W- .-V V -I www 5 Ma A QM' . ,iff 1' A:I' i'f- ' ' f'A T 'Y4fx1w.'.. fa, ' '31 i 5' 'Q'-L f iP' A ' V fa ' 'N Q 'A 'Kiwi' ,J V , -- V' Pifi 1 1- -M . A f , ' yi. V , 15 L 2' ff 5, V -gmf . - gg 'ff-1 , X, if f V J Q .- .- My ,. 4,33 V' K it V. YJ 71 ,, -.4 , V V V , V V as A wi' m W 'li M ' .fb . VS '-7. wwf 595'-1' ' . V , . .V L -,VV -,V ,aw ,af ,,,..,g4.f V i V V Ag. V, V ' V - -2.5 ,V A ' --- ,VW , nzmffe' V v V A - : ' 3 'f . I V' Va fVVV,V..w--' 'F , 1 in! if' Q S' .it-'-s. V u, A ,Lam W WY f 'ways' V ,xg V E H VV Q Vf w V. -. Q nw , ,,Ab,,- ... V-bs-.1 ' fi: k P V W KV., 1 ,gg ,la V Ii, z . ' '. ---Lulmv'-V Q- V V- ,f1.s?fw. 4f' 'f Qi'g5 if Vfagg f j -.. A' N -V .. ,N ' , , 1- -- 5- V 'A , VV VV 412531 K ' W - 'Af ' , fir vi x x M' 57922 f .K wg , Q VV? V,ieV 2V '- 'Z.4,,91,,:4w 9' 'Ba .V-,,,,.. V:'.5,tQfff-' 'Ubi' VV,gV'zV- i - 54 if V , A : VV V-' - . Lf'-of A ,,sVN, 444 ,V . V rs' V 1 QV- -ff' MWA' , V., , :Trl .V M VI!! , . ,VQH .i-1, V agility, X? f ,. V fb M1 L - - ' V .- 'V A - ' JL VV ' . VV mf 33 eff: V ...lg-.VELV ua Wim ,E l y -wt ' E., L. I . 15:-v. x V: 5 ' hi 5' s if 5 -V' w M ,WU f .V 'W' , ww ,, Q 5 -- rg ,Q , N , . Vg,,4gf ,Q M N f V - ' 315 ,f LA, ,pay 1211- 'LV V Vg. -V -R . v V UNLV, - V, I W V L YY: ,K HV ,W l - V. wg V : V i ,yy EULA F5 aw , VLV-V V 25:3 .:. Q af ' ' .,L,,i5v VW 5 ' ,, i ff? V V A Vw: ff V 4V ?'W5,V f ' , is Z if Q Vw ' 'dz V VE? Q W 'lids Ve V V ,dk A V ' . V ,nw V, ., W ff L Va, 5 3 XY V' M, ' V K V K V H V g-at ww J -Mr U g ,Vf V. ? mf? 17' f 'V V' VJAIQMV V, VV V V V 33- 1 ' V, 1 M ig :LV V K K, Viz, , 3345 ,IV-,M ,V 1 . A 'Hg ' iii ff? f+ f 5V f E V f 'W VQV 7 Vf ' - A W'f? , w , L' ' 5 'M4iQf V Q' ' V ? AQ WV, V . N V 23 l 1 A71 'L' ' ,W A A. , gy' ' V, WMM, A V A- ' 2 - .ffl L 'z ' Sffllf ' ' c x 5 ,fr V K - , lf'fMVVf'x 48 Pmin Icing V V, ,mai I f V 5 1 2 V LVV- ' , 'i www' m V WV A - Va- . 1 Vmwmmgifff ,Wap .. K , ,Lim , , ,,.V M It wasn't exactly snow, but for the Auburn students outside frolicking like kids, it would do. On Feb. 20, 1983, below-freezing temperatures turned the cold rain into sleet, ice and hail, making sidewalks and less-traveled roads hazardous. The two-day inclement weather left many people without power as ice-heavy power lines broke or were snapped by falling trees. Auburn University cancelled evening classes, but classes Thursday went on as usual, much to the students' dismay. Although classes were held the next day, rumors ot cancelled classes made many students stay at home and start their weekend early. - Plain Icing N .. l l JAY SAILORS Plain Icing Th In the past two years, Funderburk lost two votes of confidence and became the national center of attention when Time magazine investigated what has come to be known as the Funderburk Controversy. The controversy began when the trustees split in a decision of a replacement for then- President Harry Philpott. The trustees divided their votes between Steven Sample from Nebraska, fthe faculty choicei, and Flex Rainer, a state official on leave from Auburn. The faculty became extremely vocal when former-Gov. Fob James nominated Hanly Funderburk, chancellor of Auburn University at Montgomery. James and those trustees who supported Rainer then voted for Funderburk, seeing it as a highly political move. Funderburk came to Auburn with an excellent administrative record from AUM, but ran into opposition when he reorganized several administrative offices and removed several deans from various schools. Funderburk ran into further difficulties when the University was plunged into proration and depleted budgets which led to increased faculty workloads and crowded classes. Toward the end of 1980, the faculty claimed that its complaints were being ignored and Funderburk was failing to seek any type of communication with it. ln November of 1981, a faculty survey indicated a growing dissatisfaction with Funderburk for doing a poor job of leading the school and working with its faculty. Funderburk was accused of being more concerned with budgetary efficiency than with the concerns of the faculty. Angered by what it viewed as a lack of action, the faculty called for a vote of confidence. Funderburk lost 455-416. However, the Board of Trustees overwhelmingly voted to support the University president 11-1. In November of 1982, after a year of growing tensions on the Auburn campus, the faculty again voted no confidence in Funderburk's ability to lead the University. The trustees refused to ask for Funderburk's resignation, but also refused to back him with a pledge of support. Funderburk refused to resign, saying he served at the pleasure of the Board of Trustees. A group of professors threw its support behind Funderburk, saying a small faction of the faculty had refused to give the president a chance to prove his leadership. The Auburn alumni became involved in the controversy, throwing their support to Funderburk. They referred to one faculty member, who was given three minutes to explain the faculty's position, as a pointy- head stirring up trouble. The student body remained conspicuously quiet while SGA Vice President Flussell Kendrick said, lf Funderburk goes or stays, it doesn't make that much difference to students. ln fact, the SGA hesitated voicing its Funderburk e Controversy ii 5 3 5 E S . Q 1 3 X 2 3 opinion of the controversy and constantly tabled any motion either in favor of or against the president. The faculty also considered asking for a vote of no confidence against the trustees for what it saw as an evident lack of support. ln a poll taken by the Plafnsman, the students were shown to be in support of a move to ask for Funderburk's resignation, but did not favor the faculty's position over that of Funderburk's. In January, the Board made a momentous, and controversial, decision. It decided to retain Funderburk, giving him the title of president of the University System. A chancellor would be appointed to handle all academic affairs of the University. Funderburk would be in charge of the financial affairs. The faculty was not appeased. The reappointment of BC. Bed Bamberg by Gov. Wallace met with vocal opposition by the faculty who viewed it as a move against its position. The faculty had previously sought Wallace's support by sending several members to discuss the situation with him prior to his inauguration. In a second appointment to the board, Bob Harris lost his seat to James Tatum Jr. Baneyfnussg. scoFiEL X of Huntsville. Harris was the only trustee to vote against the faculty-opposed chancellorship system. The appointment came a day after the resignation of the chairman of the political science department, Gerald Johnson. Soon after the appointment, two professors from the English department and the department heads of history and mathematics resigned. They attributed their decisions, for the most part, to the continuing controversy surrounding Funderburk. The president-elect of the University Senate, Curt Peterson, said if the controversy was not solved he expected many more resignations. History professor Gordon Bond, the outgoing faculty president, said if Auburn University did not resolve the ongoing conflict between the administration and the faculty, the loss of valuable personnel woul soon sink the University into a swamp of mediocrity. An outside consultant, Dr. Arthur Hanson from Texas A 81 M, was engaged by the trustees to evaluate the crisis at Auburn. Hanson said the controversy will have a great deal of bearing on the future of Auburn University. if FQ N i ln an unprecendented move, University President H. Hanly Funderburk resigned from his position as the climax to the controversy which existed at Auburn for more than two years. Gov. George Wallace called for a special meeting of the Board of Trustees in his office on Saturday, February 26, 1983, to resolve the continuing crisis. The Board of Trustees unanimously accepted Funderburk's resignation which stated in part that the actions he took to advance the University were unfavorably received creating perceived problems. The resignation also stated that some of the faculty had made a mockery out of the truth and had waged a propaganda war against the true facts. Funderburk's resignation came as the culmination to growing opposition of his unwillingness to relinquish his position. The SGA broke a long period of inactivity concerning the Funderburk issue by voting 33-1 in asking the president to step down. lt also voted to ask the trustees to rescind the chancellorship program which was designed so Funderburk could retain his position, The vote followed an alleged threat Funderburk made to a candidate for the SGA presidency. The student, Pat McLoughlin, said Funderburk told him they would butt heads if McLoughlin used the controversy as an issue in his campaign. The statement was made in front of another student - Donna McElroy. Soon after the SGA's vote, the Alumni Association met and voted to withdraw its support from Funderburk, asking that action be taken to resolve the conflict. A new independent student group formed to represent students. The group formed several weeks before the SGA made its vote. The Coalition of Auburn University Students for Education QCAUSEJ held discussions and debates between the different factions to allow students to become acquainted with the various opinions of the controversy. CAUSE circulated a petition asking for Funderburk's resignation and got more than 2,300 signatures. The petition was presented to Funderburk. CAUSE also distributed black armbands to signify student unrest. The Plainsman ran editorials stating the FunderburklJohn Reed time for eloquent pleas was past and would only run the following statement: 'fDr. Funderburk, for the good of Auburn University, please resign. One student decided he could make a profit on the controversy by selling shirts which mimicked the Plainsman's editorial. The shirts bore the logo Hanly Please. Former-University President Harry Philpott added his voice to those asking the trustees to find a solution to the crisis. After the resignation was accepted, the trustees appointed Wiliford Bailey as the interim president. Bailey had served as vice president of academic affairs and as vice president of academic affairs and administrative affairs from 1966-1972. Bailey was currently on the staff of the A.U. School of Veterinary Medicine prior to his appointment. Funderburk st? uilding A Future 9 For Auburn, 1982-83 was a year to rebuild. Not only did Pat Dye finally succeed in rebuilding a powerhouse football team and Wilford Bailey begin rebuilding a faltering administration, but construction on our new student activity and engineering buildings was begun. In spring of 1982, construction of both buildings finally began after much planning. The next student activities building, scheduled to be completed in December 1983, will be in full use by winter of 1984. The two-level complex will contain seven basketball courts, three which can be converted into a 2,000-seat auditorium. The building will also contain a physical fitness room and a room that can be used for meetings of many of Aubum's sports clubs. Also included will be a classroom, offices, a work room, a first aid training room, dressing rooms with locker and showers, a large stage area and two Concession rooms. The entire complex is financed by the students as a result of an S8 increase in activities fees since 1981. The new electrical engineering building, to be named Broun l-lall, after its predecessor, is scheduled for completion in February 1984. lt was first planned in 1963 and has finally been started. The four-story structure will contain classrooms and a 300-seat auditorium. Until the building is ready for use in spring 1984, Auburn's electrical engineering classes will take place on the second and third floors of Dunstan Hall and in the basement of shop buildings two and three, which were used temporarily during World War ll, - by Alec Harvey 2 f.. , ZH-' ffv-fv 1 , fe: -- 1 f- , Q ,,f.. ,ff l l s- P? gi! X12 3431 fel? -vig? 1 Q, if 'u 'T af? v HS 525+ 3 12 41 W lift We 1 5 W wr gk 2 W , 3: A .. 41 f f. U, ' 34,5 C rx Eff ' Iii Q 2 f . M ,gg ,. 56, V55 , -1 64 , f 123, ,f fe i t ,. f ik f Q01 . Q! x A 1 5 , Q f' ' H z .1 'ff Q 4 5 sf :W 25522 ,,,, ,,..-vf .,, kk -. 1 Q i ! T3 ai fi X X fi , 2 gilik ,,,,,,,,.,,...,,,..wM-W N,,.s.-ww-ani-vi'-o 55318 . ,,,,,,..M.o 5 sf gs 'lfivw A 5 gsm- - 2 Us 2 3 VVh 5 V ff A 'i 'll g . w A L ' -2 fi . 1 ' , 4 2 ' 'L 5 - , if , L 5? 5 X '2 i . i , ' 3 ' :Z A ' , S 3 3 QA , I z ' it 3 K . f J ' K ix X x 3 , , 1 5 - 5 .h K . e i 2 an EM 1.3 ., KP Rx 5 Q i ,z g9p, 54 Visitors V- FNS .5 on fp, M. 5 .iw Q 4 Sv P 'thas P V I Q25 2 3 gc 'fi 51 f QQ J .F fy win 3 31,15 3 i Yi , .5555 it :ff A 45,5 1 2 ig, if, MQ, 1 . X f 2 f ' JOHN REED Up With Peolj lVe William Christophgr 1 l M. weeegggg JAY SAILQES sim ' W' M 15' ,JOHNVIBEED B rother Jed i ' Vistofs' 57 . . f Ka A , .E ' 5 YF' if I , A' , 'W 'sggfmrg M. + , AA, K ,V V., . ,... N, 5 , Mg, R 4 m . , K M . Q r- L . 0 K Jffwi M 5 J 4' . 1' Q- Q V 2 xi .MA b 'W wizf h ,ff 1 W . - ' 'wr w, 5.1 sire, H K 11 1 fa'5 , ,1 , f gy . 5:1 3- -95 ,W 1-Q qw ,,.:,,, ., in Q: -Q McCOMB Many familiar theatrical expressions are: Lights, action, camera, Break a leg and The show must go on. The origin of these sayings might be hard to trace, but can always be heard in the theatre department here at Auburn. This year's productions started during summer quarter with the Summer Repertory Company, a direct arm of the theatre department, sponsoring productions during the summer. The Summer Repertory Company sponsored Ladies in Retirement, GodspelI and The Rainmaker. During fall quarter the theatre department sponsored Life with Father, Diary of Anne Frank and A Christmas Carol. Winter quarter brought to the stage H.M.S. Pinafore and The Student Prince. Ladies in Retirement was a particularly saucy play. The play opened in a wealthy widow's home. As the story goes, the widow had a maid whose two sisters were insane. These two sisters came to live with their sister, the maid, inthe widow's home. When the widow protested, the maid plotted against her. The sisters killed the widow and stuffed her body in the oven. The maid tried to cover up the face that the widow was dead by telling everyone she had gone out of town. The play ended with a stranger exposing the maid's evil deed. Godspell was a musical version of St. Matthew's Gospel. The setting takes place from the time the disciples first met Jesus until his death. The disciples were portrayed as iust ordinary people who grew to love this man known as Jesus. A The Rainmaker was a play about a farming family's experience with a con man, the Rainmaker. The family was in despair about its crops because of the drought. The Rainmaker comes into their lives and promises he can bring the rains. During the stay with the Curry family, he teaches each one something about themselves and falls in love with the farmer's daughter. The play ends with the Rainmaker leaving after it rains. ICODIIFIUBGI ek. Mccomas Players 9 i s ' , ,TL .M J ig: ,, u,, +-'f , . Qu H 4 k gf fwwwwf 2? , , E if is if RICK HOLL Life with Father wasya comedyldirected by Bill Martin of New York. The playis. about a domineering father's refusal to be baptized. His refusal causes turmoil in the household. His wife, the power behind the throne finally convinces her husband to be baptized. Their children, in an effort to convince people to buy their medicine, use their mother as a guinea pig to show that the medicine works. The eldest son falls in. love with a girl, but refuses to get down on his knees to propose to her because he . doesn't think his father would do so. However, in the last scene he does propose to her. - T ,Clfe With Sizfher Clarence Day Sr. Vinnie ......... Robert Smyth .. Whitney Daivd . Katherine Walton Tracy Lee ..... Ralph Thompson Don Speed .... Frank Clem .... Fiona Stewart .... Karen Casteel ..... Angela Powers . Andrea Kloss .. Kate Miller ..... Cleveland Harrison Virginia Tranusue ....John Karl Womer .Avsharian Harlan . ..Cousin Cora .....Mary Skinner Lloyd . . . . . Dr. Humphreys .....Dr. Sumners ......Margaret .......Annie ....Delia ....Nora . . . .Maggie W mf nick Hou. PWYWS 51 J-l.Jl4L.S'. Pimzforc by Gilbert and Sullivan Ronald Bowman .... Sir Joseph Porter KCB Robert K. Grant ......... Captain Corcoran John Wilborn .... ...... R alph Rackstraw Robert E. Smyth ..... Dick Deadeye Keith J. Cox ......... ..... B ill Bobstay W. Scott Stewart ..... .... B ob Beckett Nan Nowell ........ ....... J osephine Leisa Hue ..... .... C ousin Hebe Y Melanie Magee ............ Little Buttercup H.M.S. Plnalore was a lighthearted operetta by William S. Gilbert and Arthur Sullivan. It took place on Queen Victoria's naval ship, the H.M.S. Pinatore, during the 19th century. Gilbert and Sullivan poked fun at the self importance ot the higher British Naval Ranks. The Operatta involved a lowly British tar, Ralph, and the captain's daughter, Josephine, in love with each other. When the captain learned of this outrage he was shocked and forbade his daughter to marry below her ranks. Instead, the captain would have had his daughter marry the Queen's Admiral, Sir Joseph Porter, who had conveniently boarded the ship. The Admiral also saw the marriage as a stepping stone in his career. Meanwhile, Ralph and Josephine decided to elope but were caught as they tried to leave the ship while it was in port. Ralph was sent to the ship's brig. However, because ofthe intervention of Little Buttercup, Ralph and Josephine were married. Buttercup in her younger days was a baby farmer and until now bore a secret, but now she knew she must reveal the truth because ot Ralph and Josephlne's predicament. Buttercup had accidentally mixed up two babies, who were now adults, namely, Ralph and the captain. The operetta closed with Ralph in a captain's suit and the captain in a lowly British tar's clothing. - 62Ployers 5 M PF Sea Jimmy Buffett And The Coral Reefer Band ri l if 5 .',, ,, Q , , ? ,-dw w Q N X -5 I x , X X XKQ. x T ,X pf K 555 , 3 X gs. as Y S fl, I X '35 .. X x ,. ,:'.i .C ., Q 1 D H Homecoming Concert MIKE WEEKS Im l 4 3 Mm ,ff A ,Aft if ww i W 6 I I 'ik ,Wa Q ak' ,,-:::: 2 AA-1 5 , 5 a iz 'lg Wk M.E?'Hz,L Q K ' . K ' , - b f f K 1 . , 5 f ,ff'V - ag A 1 sf' b 3 . V 'Way 'Q A , V D W ' Ou ' ,fir ' ,, 0 cffggfsx al V' f 1. , JF?-1 34 3m A i ,E 8 I , fl HP . . JOHN REED R cl Rider nga Rider 67 68 Pat Benatar Pat Benatar S AQ' 4 .gif 0' 9 Q, e 1 fu ,,.L.f . V 5 2 f 0 1 1 If fly Pa! annum 69 The Year ln Retrospect thenation The dictionary defines retrospect as the review of or meditation upon past events. Thus, the year in retrospect attempts to look at the year 1982-83, and the important events that occurred. Nationally, the world of medicine was the focus of attention. ln Salt Lake City, Utah, Barney B. Clark, a retired 61-year-old dentist, received the first artificial heart in history and lived 128 days with the heart before losing a gallant struggle. ln Chicago, however, medicine proved to be fatal. Seven people died of cyanide poisoning in late September. The cynide was traced to Extra-Strength Tylenol capsules found in the Chicago area. Lacings of poisons in other over-the-counter medications were soon found all over the country. Economically, America experienced a recession. While prices on the New York Stock Exchange soared to record levels, unemployment levels also soared. Alabama topped the unemployment scale as 12 million Americans were out of work. vt 1 ef 4,2 ., M, ff' . very? gf 2, ,, A an WW, f K I ,. , , ,- Wf ,f 2 K t .,, ,Z . ' In-lg OLOI-ld HCIIM CTIHOM 1 4 J . Q 4 y e Y . W , L 1 WORLD WIDE . VW Lg, ,, fjkfljv: 77112914 'f ff' , I v , , , -L , , M, , KM .,.,, ,W 4 . JENNIFER JOHNS The Year In Retrospect theworld as 1 wif 5 s S WORLD WIDE PHOTOS Poland, Lebanon and Argentina were the major sites of conflicts. In Poland, disturbances were between the Solidarity Union and the Polish government. Leck Walensa, the Solidarity labor movement a er was arrested b military leaders tor November. War-torn Lebanon was the site of conflicts between the Palestinians and the Israelis. Eight hundred U.S. Marines were sent to Lebanon to aid in peace-keeping in August. In September, however, a massacre in Sabra, a Palestine Liberation Organization camp in West Beirut, killed hundreds of men, women and children. The Falkland Islands were seized by Argentina from the British. Great Britain retaliated by sending the Royal Navy to recapture the islands. The Argentinian soldiers surrendered on June 2. The Year in Retrospect le d , y organizing the workers. He was released in l l WORLD wipe PHoTc -.-. ..: Dm ,, mm H Sgsiiagmfmagiww 52238522 2 C.l5n5'o.Cc9E3.33-2'Fgggmmw35'CDQL9.O:-I -- moz' warn m..ww-.-- fDfDCO'm:sO9:3 O-I 4171,-Q--. CD1 ,...,.,,-.'-4-3-1 ,.,:m33fD 555,322f'g2U225aaefD2saggHmwK LD ' - 2. rrN,39fm:gg91g3-23225-' Jgzgqgcgggg ON--h -'xl' mm -- :'.-.cuz CQ--mom O-.mm mm co0 :Q 3qg3'O-QJUDJ 'W' :r CDm35-O'o 0? m Q3 NCD3' CDU, 3' O- :L 3Z,sEs'asQQ22LQ33a5 5,-255222353 C-D..,:O O CD,-,g42'I --E EKSSQQQSQU 33253 203413343325 2-3k2'Q,5 sf,,St-59' cggO2.O3mCJ'c35 cn no -. 4-M Q--vwm,-+5.3Q,g7 OCTQDO. 30.2-QUJ-tlc:3-C2392 mE 4 3 -'cr E-Grim CD-'-:G-12 CUQ: 3-,Emir N13 k4E3m3 CDOQ.--0.nJ3DJw -+'-+Q,:qp D- C CD-, LO 2.-1-- ' -1 U'3'mm-42'lrnm3 msggcn ::F,,c3k4g3,5O:-'O DJEQQ3-wbffm' 403' O '33 Z5 :s-, fp f -. cn C raw:-,I..gQ m QX sung .-+-,Ono 0' 3--. 3-,nn mg-v-O.:-Q-3 OD. 305 EDOOQIQCDQD Q' QQQO5-wgg amixna aggaimsm 9, 2 Eugen DQ 3 13.45 3910-5 m5g:E 3' - -V mg- -O. U, Q, Q 3 CSO 2 5'rfDw 05095 'DO- m ff' cn 9. 3: 37 wg: -1 - g cn SUSAN BROWN The Year In Retrospect 1 r The Year ln Retrospect r ' 5 4 1 Q M M W thepeople ,ir I' ff wrwvtf Q - 4, if Tiwj '43 744 2. , ,.1 14 1, rrrr QR ' World Wide Pho Great Britain celebrated the birth ot a new prince and the assurance of a future heir to the throne. Born on June 21 to the Prince and Princess of Wales, the infant was named Prince William. Death claimed many personalities including Henry Fonda, Ingrid Bergman and singer Karen Carpenter. Princess Grace of Monaco, formerly actress Grace Kelly, passed away in Januaryg playwrite Tennessee Williams in February: Egyptian President Anwar Sadat was killed by terrorists while Soviet President Leonid I. Brezhnev died of natural causes. WORLD WIDE PHOTOS WOFILD WIDE PHOTOS WORLD WIDE PHOTOS WORLD WIDE PHOTOS thecillelna The Silverscreen was blessed in 1982 with the arrival of an extra-terrestrial - ET This lovable, funny, marketable creature grossed I y g more than one-hair billion dollars for its makers. The film is now being seen in 15 foreign countries. Seeing Dustin Hoffman in a skirt was a new experience for viewers of Tootsie. This box office smash, introduced around Christmas time, was nominated for 10 Oscars. Gandhi a docu-drama starring Ben Kingsley, was nominated for 11 Oscars. On Monday, February 28, the largest mass of viewers in history sat down in front ot their T.V. screens to watch the final episode of an 11-year standard - MASH. 1 f' A Advertising for the program cost the - companies 330,000 a second. The finale X A prompted Mash Bashes to be held I everywhere. e .,.,,, ,Q WORLD WIDE CRAIG SHIR COLUMBIA PICTUFIES The Year In Retrospect 'Q W' the portsret r'F,g-arg JOHN REED The NFL players' strike was the cause of much controversy and discontent within the league. Players and fans alike expressed their frustration at the length of the strike. When the season resumed, only a few games could be played. The Miami Dolphins and the Washington Redskins met in the Super Bowl, Washington was the victor. In baseball, the Braves, known as 'iAmerica's team with coverage on WTBS, pennant, lost to the St. Louis Cardinals. The Cardinals went on to win the World Series. The national collegiate champions were the Penn State Nitanny Lions, Joe Paterno's first national championship in his long coaching career. The Lions beat the Georgia Bulldogs in the Sugar Bowl. Georgia Bulldog Herschel Walker gave the new United States Football League a boost by signing to the New Jersey Generals. Walker left while only a junior in college for a 816.5 million, six-year contract. Finally, the winningest coach in football, Paul Bear Bryant, died Jan. 26. Alabama mourned the loss of its most famous citizen. He had just retired from coaching about a month before his death. The Year In Retrospect Q w 32, -Q35 W N A Q2 ni' Y Q' H ' H -S ' -fixgifji. K Q' ,5 , , . ' -. 4 Q 2 1 1 4 I mm lr- 4-mwfnmn. env-'zimzmssuz aiusaxmnnhm sums nnmxxwvnm he year was one of surprises. lt was a year of hard work. lt was a year in which Auburn sports began to receive the recognition they had for so long deserved. lt was the year of the Tiger. The sports section begins with a story on Auburn's role in the 1984 Olympic games. ln the past, Auburn athletes and coaches have taken an active part in the world games. Since the 1980 Summer Olympics were boycotted by the United States, our athletes have become more determined than ever to compete in Los Angeles for the United States, as well as for Auburn. Last spring's sports, baseball, softball, mens' and womens' track, mens' and womens' tennis and mens' golf are reviewed. Fourteen pages are devoted to football, plus two pages of Pat Dye's personal comments are included. We felt 16 pages were necessary to cover a season with eight home games, plus parties and cheer of which every student was inevitably a part. The season appropriately themed the year of the Tiger saw the team end a 10-year drought against rival Alabama. An almost-win against number-one at the time Georgia brought a sense of unity and pride to all Auburn students in the stands of Jordan-Hare Stadium. The Tigers' finale was a 33-28 win over Boston College in Orlando's Tangerine Bowl. The year of the Tiger was true for mens' swimming as well. The consistently nationally-ranked swimmers defeated number-one Texas in the coliseum pool. ln addition, the Lady swimmers were also nationally ranked. The same weekend the Auburn swimmers downed Texas, the Tiger basketball team romped over Kentucky, the first time in games to defeat them in Lexington. Ftaked and red-hot, the basketball team grabbed the lead in the SEC several times during the year. Womens' basketball, a seldom spotlighted team, demanded the campus's attention with its national championship contention. A look at gymnastics, rugby and mens' and womens' basketball is also included. Finally, a four-page reveiw of Auburn's true amateurs, intramurals, is highlighted in the sports section. - SPORTS EDITOR Greg Fox Ph t by BFITZ E E-.. E E 11 i-1 71i 1 11 1 1984 - n 1984, the nations of the world will again gather in the friendly spirit of competition at Los Angeles for the 21st Olympiad. In past Olympic Games Auburn has always been well represented, and 1984 will be no exception. Many athletes are training for a chance to go to the Olympics. One man is already guaranteed a trip to Los Angeles, he is none other than Mel Rosen. Coach .Mel Rosen has been selected to be coach of the U.S. Olympic track team. Coach Rosen hopes that some of the men he has coached at Auburn will have what it takes to make the '84 Olumpic squad and have a chance at the gold. Auburn has many fine athletes who have Training . the potential and experience to do well in the Olympics or any international competition. During the 1981-82 year, Auburn had 21 All-American candidates, and these athletes have the ability to compete with the best. Hopefuls for the 1984 Olympics include: Mike Benjamin, trackg Stephanie Bonner, track: Chris Fox, track, Tom Graves, track: Clara Hairston, track, Richie Hughey, swimming, Roger Jones, trackg Annie Lett, swimming, Sergio Oaxaca, trackg Mary Tipton, swimming, and Steve Wood, swimming. Auburn's Olympic hopefuls are not limited only to the US. Olympic team. Our womens' track team has the possibility of representation on the Portugal Olympic team by Nora de'Araujo. Nora presently hold the Auburn records for the heptathlon and the outdoor high jump. This list of athletes represents only a few of our Olympic hopefuls. There is still a year to develop talent, realize potential and decide to take a shot at the gold. At this point, all we can do is hope these men and women can train at the best facilities, receive the best coaching and stay healthy. lf all goes well, when we are victorious over the Russians, we might hear mixed in with the chant USA USA USA, a War EagIe or two. - by Mike Zaleskl 80 Olympics . ' w' -2-. ', mg.eA W ' V' 'I A ifiiiti ' KATHY SCRUGGS KATHY SCRUGGS For Olympic Gold KATHY SCRUGGS ?.? ' LWBQQ mf 1- r WM wg HQ ,Q Y .aw V K , W 5 ' www , iw 5 . p .N M- ig 'Q . . .. X . W if 2 .L wg Y X' f x, A .5 . .-N A . K . A H W ir, E ..x-FE ' R N N Cffensive Tigers Prove To Be A I-lit Baseball I I ithout a strong combination of offense and defense, a baseball team cannot be a strong contender, reflected Coach Paul Nix. The 1982 baseball team represented the case and point to his theory. Even with the record-setting bats, the squad could produce only a 27-20-1 season. Consisting of 17 of 24 underclassmen, a relatively young team suffered a sluggish start. Dropping its first six games, the team was outscored by 19 runs. However, strong hitting began to salvage the year. Five consecutive victories, including a three-game sweep of Mississippi State, lifted the record to 5-6. Nonetheless, it was not until a few games later that the team reached its JOHN REED potential. Winning nine straight and 13 of 17, the squad relied on its consistent defense and productive hitting. However, after a 9-5 victory over Florida State, the team was unable to win more than three games in a row. Consequently, the latter part of the season yielded only a 13-14-1 record. Throughout the year, the club was inconsistent against SEC opponents. Early in the schedule, the team swept a series with Mississippi State, but lost another series with them later in the year. In five attempts, the squad was unable to beat Oe Miss. However, the team split six games with cross-state rival Alabama. Overall, the club produced a 8-13-1 Southeastern Conference record. tcontinuedl 3 an 1, 2 2 PHOTO SERVICES 84 Baseball JOHN REED Although Nix achieved his 20th consecutive season without a losing year, he considered the 1982 season as subpar. However, several individuals and the club's offensive performance highlighted the year. Senior shortstop Doug Gilcrease set school records with 17 home runs, 21 doubles and 76 hits. His talents earned him All-SEC honors. Gilcrease was just one of the leaders on a powerful offensive unit. The group tied the school record for home runs with 57. Led by six batters with more than a .300 average, the team had a .316 season average and 348 runs. Optimism is abundant as the players and coaches look forward to the upcoming season. The entire pitching staff is returning, but improvement is necessary to provide the school with a contender. The team will rely on a strong infield, both offensively and defensively. Third baseman Bob Berry, who led the team with 57 rbis, will be the stalwart anchor to the infield. Second baseman Russell Smith, a .333 hitter last year, returns to strengthen the right side of the field. However, the loss of Robert Sorrells and David Mogentale leaves a big gap in the outfield. lt is hoped that returnees and incoming players will fill the void. Placing the approaching year in perspective, Coach Nix said, lf we meet the challenges ahead, the season will hold promises. - by Greg Fox Success For Twenty Seasons ul, -1' 1 Q, 8 3 Q 3. 'V , if In Q A 'l l 4. 'N , H ' AK 'e .' BU' b 1 AUWR . url 13 l ' lf . .J p '::- if . ,,, . W 3 12 'S ' ,. 5 ,W -M. . 'Q I s 4, -Qifhlu , y ll ' eigzguf- - 'Hsu-w , N . -1 1 , ' V1 23 -5-U ..-535 l .+e I H U5 -le S245 l l Qi- Q We , A W 86 Softball PHOTO SER VICES The Cinderella Teemu is ,, ..-W...-Tvf' A V, -V 4 .. ,,, My ',3,,X't V Vg, A V I 1 I , . l , lg., M ,.f, ,,, ,Wu ef' ., . , W W, ,,y,f'7:a' ga, ?'6i'?',,- , , A ' ,, l vw 'sh' A . , , ' 'I ..v- ,,,.. I ,, f. 'yf . Q l ' 4 , f ' 5 w M M. Y , fy- ,. 1 .., fe2ffb4f ::f .M W M 5 Y vm'f'T l llW,, ,,.gie1l- e , .5 j,,,.. .',w-M ', . if I , n ,, f v . ,fr ,N , ,, , ,, , J, , ,, ,. , ,, 'gr ,W I . n - U - A - ,1 ' iam. ' V ff- nw ,Q-fa-2 ze-,fy e ffl' Q. , f - lf. l if ,,--. 9 iff -' -4 H .. -fx' -it .,, - Q3 f A f .,, ,Qi W ' , -3 . , , .V 2' .-'. :K - . , F . I jg .M 1 4' V lv 'A . f' ' 'Law' ,,' ' 9 ff we . , .V 2, f , i , r gf fr' . -4 ' CONNIE SHIH CONNIE SHIH I I he year was definitely a success, Coach Joan Van Ness of the 1982 girls' softball team proclaimed. Because it was young with 10 freshmen and a first-year coach, few people gave the team much chance for a winning record, especially in the strong Southeastern Conference. The girls did not have a winning season record at 22-23, but the surprise of the year came at the end. After winning 12 consecutive games late in the schedule, the club placed seventh in the national tournament. The outcome caused Coach Van Ness to call her team the Cinderella team of the nation. Discussing the success of the club, Van Ness emphasized the drive and determination of the girls. Unlike most other schools, Auburn does not offer a scholarship to any player. The girls play only because, according to Van Ness, they love the sport. However, she quickly points out the difficulty in competing against teams that are heavily supported by the school. Despite the lack of scholarships, there were several good players on the team. Outfielder Helen Kelchner and first baseman Laurie Nickchen tied for MVP honors. Nickchen, also the most improved player on the squad, is a possible All-American for the approaching season. Luanne Ardovino was the team's leading hitter with a .471 season average. Nickchen was a point behind her at .47O. With a year's experience behind it, the team should be a strong contender in 1983. Van Ness predicts that, unlike this year, the team will play with more consistency from the onset of the schedule. She said she believes the key is to capitalize on the strong hitting the girls are capable of producing. In fact, the returning talent is so good that Van Ness forecasts the squad to be a top-10 team. - by Lorie Joyner and Deborah Woolbright Softball 87 Men' yu'-Sikg. . .1 vmmsw-m ' f PAQ. 1 rack is a unique sport. The success of the team depends on the individual's performance. Concentration by the competitors, coaches and spectators is usually centered on the athlete's approaching event, not on the overall score as in football or baseball. In addition, several events are often in progress at the same time. Considering this perspective, the 1982 men's track season was a success because of the talents of several key individuals. Senior Chris Fox, a 10-time All-American, placed second in the two-mile run in indoor NCAA competition. David Spivey, Roger Jones, Sergio Oaxaca, Greg Herzog, Larry Brooks and Fox were indoor All-SEC. In outdoor track, there were no All-Americans: however, four tracksters, Jones, Fox, Oaxaca and Calven Brooks were All-SEC. Although individual heroics were an impressive part of the season, the overall team performance was strong itself. Because 12 of the 21 indoor and outdoor meets were non-scoring, the ability of the squad was difficult to judge in terms of statistics. However, the tracksters finished third behind Tennessee and Georgia in the Indoor SEC Championships. The team later defeated Georgia by 27 points in an outdoor meet. Despite its strong showing, the team dropped to seventh in the Outdoor SEC Championships. Turning his thoughts to the 1983 season, head coach Mel Rosen hopes to compete for an SEC title. However, the lack of talent and depth in several field events could hamper the team's chances. But in almost every running event the team is filled with quality. Tom Sheehan, who is considered the East's top prep runner, will support Oaxaca in the 1500-meter run. Tom Graves, returning from a foot injury, and signees Tom Fischer and Rory Farrell will replace the graduated Fox. After winning the 1981 SEC decathlon, Reed Montague is coming back from injuries to strengthen field events. Definitely, the team's goal is to repeat the performance of the 1979 squad by winning the indoor and outdoor SEC championships. With excellent recruiting years for the past two seasons coupled with 30 returning tracksters, the team is one of the strongest in the SEC. - by Greg Fox s Track Quality ln Every Stride wr' w PHOTO SERVICES xg 'bf' wx Q ef., my 'avifi JOHN REED JOHN REED Men's Track Youth Provides Excellence JOHN REED PHOTO SERVICES 1 . he word for the future is youth, according to head coach Paul Segersten of the women's track team. The 1983 squad loses only six seniors from the previous year while it lists only four seniors on its roster. Despite its inexperience, the team carries considerable talent in its youthfulness. Several sophomores should provide the core of the team. Clara Hairston, an All- American hurdler, placed fifth in the NCAA's 100-meter hurdles. She also set school records in the 50 -, 60 - and 100-meter hurdles. Stephanie Bonner was an All-American as a freshman in the 400- meter dash. In addition to being the most improved performer on the team, Janet Fluker qualified for NCAA competition in the 400-meter hurdles. The signing of Fawn Young for 1983 only strengthens the squad in the sprints and hurdles. Despite the talent of the returnees, Segersten faces a difficult task in replacing seniors Kris Terpening and Nora de Araujo. Terpening, who throws javelin, discus and shot put, consistently scored points in meets. Although she failed to qualify for NCAA competition, she was honored as the top performer on the squad. Competing in the heptathlon and pentathlon, Araujo earned the title of most valuable trackster. As a past SEC champion in the heptathlon, she set a school record with 5,365 points in that event. The ranks of the team are thin in comparison to other schools. But with the maturing ot the young girls, Segersten hopes to gain some much-needed consistency to counteract the team's disadvantage. Segersten is unsure about the outcome of the approaching season, but he is certain the ladies will score heavily in the meets.- by Greg Fox Women's Track 1 Tough Schedule Mars Year Tennis Team Cnnnininnsniln- i rom the start, the 1982 mens' tennis The Strength Of the team Centered on ,,e,, Aj , i' team faced a tough schedule. Their first two junior Dan Cassidy and senior Bud Cox. 3 'irl f r a, A M5 matches were against iif10 Miami and 416 Cassidy, an All-American, was ranked 14th li M . Michigan. Moreover, the 28-game season among college tennis players. In addition, iii f if . VY' . included 11 top-20 teams, among them was he placed first in the SEC indoor ' srft flgz , T 1, g 42 SMU. Tournament, and in the intercollegiate , 1' y J Despite the difficult schedule, the squad Tennis Coaches' Association Region lll ff, Q . won 11 of its first 15 matches. Indoor Tournament. Cox, an All-SEC ZW M 1 5 1 y Strengthened by its strong opening, the performer, broke the school record for U ii' T V iff club posted a final record of 17-11, and an career doubles victories with 73. 1 fifth 'T .1 ..,g,4 1 SEC record of 5-3. It was against the top Prospects for the 1983 season are good, Q , ,, it QQQLQ ilrr.. ? twenty teams that the squad faltered. although Cox graduated and Cassidy turned f in .Q g ' Dropping 10 of 11 against these schools, pro. Five strong freshmen will provide the S A flt ty g the team was only able to beat Miami in its team with capable youth. With the new I first match of the year. Although the club talent, Coach Hugh Thomson forecasts, ' gi, suffered some difficulty in the season, it was We'll probably go 25 and 10 on the year. successful in tournament play. The team - . ,.,. , n i' ii ii s placed second in both the SEC Indoor by Philm Spiers i PHOTO SERVICE Tournament and in the South Carolina i Men's Tennis MIKE DVOFINAK Men's Tennis 3? QE if ithout the leadership or experience region Bobby the number one singles from a Senior player, the 1982 WOmert'S player also participated ln the NCAA tennis team slipped to 15-16. lt was the first National Singles Competition losing season for third-year coach Pat Sophomore Manusha Perera was selected Gilliam. However, Gilliam was not as the team s most valuable player and top disappointed with her team's performance performer She was a formidable player in In fact, she was impressed by the squad's the middle of the lineup As the number development during the season. three and four player she had a 20 13 After winning its first two matches, the record against her opponents team lost eight straight matches. But as the Gilliam expects improvement just from the season progressed, the ladies began to experience gained in a season However improve. Highlighted by a second-place Michel Bates returning from a red shurted finish in the Southern Intercollegiate freshman year and slgnee Mary Beth Tournament, the team won 10 Of its final 15 Larson should further strengthen the team matches. Earlier in the year, the squad placed second in the Northeast Louisiana Invitational. To culminate the season, two victories in the SEC Tournament gave the girls a seventh-place finish in that event. Two juniors were the anchor of the team Andrea Bobby and Gigi Acker were sixth among doubles teams in the Southeastern 94 Women's Tennis ffsmesifrr Seeks Experience 3 x t ,gagizfrg .--k ,kgk K . 1. ' K A L 'Q . f, K ,.,, -x, M 1 .. K Q M N .MLW , K 5 sf' . ' j x , ,sillill , . , K V1 :lf igg2:izl' - 2 - f w121f1gg15flg 'A fE'rg5i2f T' , Q2525? '- W ' A , , 1 2' JOHN REED Women's Tennis E F 96 GOLF MW! YM' JOHN Driving For Another Championship PHOTO SERVICES ntering the season as the defending SEC champion, the 1982 golf team was unable to repeat its 1981 performance. Because of the loss of players to graduation, the year was termed a rebuilding season. The club started the schedule with a low finish in the Augusta Invitational. In the next match, the Springhill Invitational, there was a complete turnaround as the team captured a first-place finish among 10 JOHNSEEEB teams. Following that, the golfers continued their consistent play by placing fourth in the All-Dixie Invitational. The team struggled in the next four tournaments with finishes of ninth, sixth, eighth, and seventh. Ftegrouping after its poor performance, the team placed second in two consecutive matches, the Southeastern invitational and the Jackson Intercollegiate. However, the final two tournaments were a disappointment when the team finished 12th in the Southern Intercollegiate and sixth in the SEC Tournament. Head Coach Sonny Dragoin hopes his team will develop consistency in his 24th season. The return of sophomore Todd Smith, All-SEC this year, and junior Carter Mize, lowest stroke average this season, should form a solid nucleus. Junior Walton Ashwander, who played in nine tournaments this year, will provide much-needed experience for the team. The group of returning players will blend with incoming talent to provide Dragion with considerable talent. If the young players develop consistency and mature as expected, the club can expect a successful season and a high finish in the 1983 SEC Tournament. - by Mike Zaleski Golf i i Football Searching For Change . hanges are scarce and slow to occur in college football, especially in the tradition-laden Southeastern Conference. Take, for example, Georgia and Alabama, Between the two, they have captured the conference championship for the past 12 years, Neither school has seen a coaching change since Vince Dooley arrived at Georgia 18 years ago. Auburn, on the other hand, has been searching for change for several years. Searching for its first winning season since 1979 . . . Searching to end a decade of submission to Alabama . 4 . Even in Coach Pat Dye's first season, the Tigers only equaled the previous year's 5-6 record. Thus far, change had eluded them. Yet, as 130 players gathered on August 23, their mood hardly reflected that fact. The season opener was still three weeks away. Already Dye had said, There's no question that we're a lot further along than we were a year ago. Eight home games looked promising, including the first six of the season. ln addition, 36 lettermen returned from last year's squad. Nonetheless, Auburn was considered anythinlbut a contender. Most pre-season prognosticators ranked the team fourth or fifth, again in the middle of the SEC. Jennifer Johns Rick Ho W Q' if j il .N 5. ,J . af , Quit: 5' Q29 1.3: war . , V sg. As 59,350 fans filled Jordan-Hare Stadium, a record opening night crowd, the Auburn Tigers opened the 1982 season with impressive style against the Wake Forest Deacons. A style that, though no one would realize it, would typify most of their play throughout the year. Auburn established its dominance early. Halfback Lionel James raced 67 yards on a pitchout: a play which would develop into the strength of the offense. After Ron O'NeaI ended a 71-yard drive with a one- yard touchdown plunge, Wake Forest responded with a field goal to narrow the Tigers' lead to 14-3. In the second quarter, Auburn added another touchdown on a play that would grow to represent the Tiger offense. Freshman Bo Jackson dove one yard over left tackle into the endzone. Auburn led 21- 3 at the half. Wake Forest added seven points to its score before the Tigers ended all scoring with Jackson's 43-yard touchdown run. ln the end, it was Auburn, a 28-10 victor. Jackson had 123 yards rushing while James ran for 118. As a team, the Tigers amassed 508 yards. Defensively, Auburn allowed Wake Forest 217 yards with only 16 coming on the ground. Finally, the game contained one more bit of foreshadowing - Auburn did not commit a single turnover. Foosball 99 Vaulting To 100 Football Seventeenth ln The Nation Auburn's final scheduled night game was billed as a battle of offenses as the Golden Eagles of Southern Mississippi came to the Plains. The Tiger offense continued to be effective, but the defense was pushed, stretched and twisted by the Eagles and their elusive quarterback, Reggie Collier. After leading 7-3 at the half, Auburn built a 21-6 advantage in the third quarter. Sandwiched between two Randy Campbell touchdown passes, Jackson scampered five yards for the Tigers' other touchdown. Campbell showed the effectiveness of his passing. He only went to the air 15 times, but twice he hit Mike Edwards on 47- and 51-yard touchdowns. Two field goals had accounted for Southern Miss' points thus far. For 55,000 spectators, Auburn appeared to have the game in complete control upon entering the fourth quarter. However, Sam Dejarnette, 2 one-time Auburn Tiger, twice broke one yard into the endzone to cap two Eagle drives. The Tigers' lead was cut to 1-19. With one minute, 53 seconds in the game, Southern Miss got ball for the final possession. Collier, scrambling away from the Auburn moved his team to the Tiger 32 with B. PITZ the aid of a defensive holding and an interference penalty. Fifteen seconds remained on the clock. Collier dumped a five-yard pass off to his fullback. The Eagles were in field goal range, but time expired before they could run another play. A substantial Auburn lead had vanished to produce an exciting and emotional contest that could have easily been the Tigers' first defeat of the young season. However, Auburn had bent but not broken and still carried an unblemished 2 and O record. After three consecutive victories over the Tigers, the Tennessee Volunteers traveled to the Plains to face Auburn and 73,600 fans - the first sellout under Coach Dye. Adding to the importance of the game, it was the first SEC matchup of the year for both squads. Just as they had done in the season opener, the Tigers built an early lead. Moving 65 yards on three plays, Auburn scored as Jackson rambled 20 yards into the endzone. However, Al Del Greco missed the first extra point of his college career. Consequently, when speedster Willie Gault burned the Tigers with a 38-yard touchdown reception, Auburn trailed 7-6. It was the first time Auburn had trailed all season. A Del Greco field goal gave the Tigers a 9-7 halftime advantage. The two teams traded touchdowns in the third quarter. In eight plays, Auburn moved 80 yards with the final 32 coming on a James run. Jackson went off tackle for the two-point conversion. The Vols responded with a 78-yard drive in one play: Bomb to Gault who had sprinted by the Tiger secondary. The score was 17-14 at the start of the fourth quarter. However, the quarter was to be Auburn's. Driving for the clinching touchdown, the Tigers moved 80 yards in 12 plays. In the drive, Auburn's powerful rushing tandem of Jackson and James went to the air. James threw 43 yards to Jackson who made a spectacular leaping catch, James eventually scored from the two-yard line. Though the score remained closed for most of the game, Auburn was clearly the dominant team. The Tigers totaled 439 yards, including 357 on the ground. Meanwhile, the Vols were contained. They had 306 yards with 116 of them coming on two plays. In addition, they failed to gain a first down on the ground. Auburn's 24-14 victory proved impressive as it earned a ranking of 17 in a press poll. Football 101 Challenged The Best With both teams boasting 3 and 0 records, the potent Nebraska Cornhuskers entered Auburn for the Tigers' first test against a national championship contender. For the Auburn team and fans, the challenge was much-anticipated. A chance to rocket into the top 10. A chance to prove themselves against the best. In the first half, the valiant Tigers clung close to the strong Cornhuskers. Auburn pushed a six-yard touchdown run by Jackson between a 15-yard run and a 58- yard pass for Nebraska touchdowns. At the half, the Cornhuskers led 14-7. The seven-point deficit was as near to victory as Auburn could come. The Tigers surrendered one touchdown in the third quarter, but in the fourth quarter the Cornhuskers erupted. After an exchange of fumbles inside the Nebraska 20, the Cornhuskers scored three touchdowns while Auburn managed little offense. It was a display of power that capitalized on Tiger turnovers and a tired Auburn defense. After the final play, Nebraska had ripped apart the Tiger defense for 504 yards while Auburn produced only 207. No one could argue with Nebraska's greatness. The 41-7 loss was a stunning and humiliating defeat for the Tigers. 102 Football JOHN REED JOHN REED f .. Q i'V: Y V. . W. M -s ' .Q ,k.. . tm , ' U Y . it it W A H J, tx-E .,' 2.1 7, A A . 'T-EV 41 V X gi . ' .5 V, A , fa., 52' ' ' 2- 1:-W it tg ' ' ' ? ,U yy.. mt.,-a rf-. Y f g- I 1 K' tai, Q C EET WI:-r Moving back to SEC play, Auburn entertained the Kentucky Wildcats in the fifth home game of the season. The Tigers were clearly superior, but a lackluster performance prevented Auburn from having an impressive rebounding victory after last week's loss. Even while gaining 350 yards during the game, Auburn was unable to break into the endzone. Seven times, the Tiger drives were stopped deep in Wildcat territory and ended in field goal attempts. Al Del Greco kicked six of those through the uprights to set an SEC record for field goals made in a game. Fortunately for the Tigers, Kentucky was unable to mount any offense. Held to only seven first downs, the Wildcats could only manage to squeeze a single field goal in the middle of Auburn's six. That was all the offense for Kentucky. Auburn went away with an unimpressive but important 18-3 SEC victory. Long-time rival Georgia Tech was Auburn's sixth and final opponent in its lengthy season-opening home stand. At 4 and 1, Auburn realized the need for victory before leaving for the road and tough SEC battles. Although Auburn's first touchdown came on a Campbell-to-Clayton Beauford bomb for 60 yards, the Tiger offense was mostly a one-man show. Lionel James singly accounted for almost 200 yards as he rushed for 75, returned punts for 104 and caught a pass for eight yards. Appropriately, he added to Auburn's 10-O halftime lead with a third quarter touchdown run. Even though the Tigers added another third quarter touchdown to boost their lead to 24 points, a single score was sufficient on this afternoon. A stingy defense notched its first shutout. Stifling Tech, Auburn surrendered iust 153 yards and nine first downs. A continually-improving secondary allowed completions on 40 percent of Tech's passes and snatched three interceptions. Auburn was 5 and 1, but the home stand was over. 104 Football new vgh, n,..t 1 .Ay , i' 1 2' K 1 st , . .... on f-wt . , K i V. iv 1 ' K in -X ---' if ' N' .. .... J ...,, t . I 3 I Q . at S JENNIFER JOHNS Winning Cn The Boad Despite the Tigers' record, the question lingered, Could Auburn win on the road? Sure, this game had other importances. Mississippi State was an SEC opponent, and Auburn sported a perfect 2-O record in the conference. Still, the attention focused on the fact that it was the young Auburn Tigers' first away game. The Tigers opened the scoring as they had done in all their victories. Campbell hit on another of his scoring bombs, this time to Chris Woods for 49 yards. However, the Bulldogs quickly countered as quarterback John Bond kept on the option and raced 67 yards to tie the score at 7-7. Tim Jessie, playing for Jackson, ran 11 yards to hand Auburn a 14-7 lead, but a 51-yard field goal by State narrowed the score to 14-10 at the half. In the third quarter, the Bulldogs gathered some momentum as they shut down the Tiger offense. On another long-scoring play, this one a 61-yard touchdown, the Bulldogs gained a 17-14 lead. It seemed State was pulling away from Auburn, until Jackson entered the game for the first time in six quarters. The sparse Tiger crowd became ecstatic, and the offense became rejuvenated. Although Jackson finished with only 59 yards, the Tigers poured on 21 points in the fourth quarter. Appropriately, Jackson scored the go-ahead touchdown on a three-yard run. Later, James, whose 138-yard performance was overshadowed, scored on a 32-yard scamper. On his first rushing touchdown of the season, Campbell carried four yards to move Auburn ahead to the final 35-17. Y JOHN REED Football 05 Scents of a bowl game filled the air, even thoughts of the Sugar Bowl were too tempting to resist. Almost two-thirds of the season had passed, and the Tigers carried a 3-0 record into Gainesville, home of the Florida Gators. With a road victory, Auburn had turned from an inexperienced Cinderella team into a confident and seasoned contender. But so was Florida. The Gators showed their strength in the first half. Though neither team scored in the first quarter, the Florida defense immobilized the Tigers. Finally, the Gators mounted a drive against a tired Auburn defense. On a nine-yard run, Florida took a 7-0 lead. Later, they added a field goal to command a 10-0 lead. It wasn't until late in the second quarter that Auburn broke onto the scoreboard. A 19-yard pass to Mike Edwards pulled Auburn within three points at the half. The Tigers Averaged 354 Yards And 21.9 Points Per Game. They Gave Up 329.6 Yards And 15.5 Points. ln the second half, the Tigers looked much more familiar to their fans. After a sustained drive, Jackson carried two hards for a touchdown to give Auburn a 14-10 advantage. After trading field goals, the score was 17-13 in the fourth quarter. Yet, the Gators were driving. Pushing down to the Auburn 16, it seemed certain that Florida was about to take the lead. However, the Tiger defense stiffened and only yielded a field goal, Auburn still led 17- 16 with two minutes, 30 seconds to play. An onside kick was obvious. But with 75,000 fans, an entire radio audience and both teams expecting it, Florida recovered the bouncing kick that slid through the hands of James. The resurrected Gator offense proved too strong for Auburn. With a mere seven seconds on the clock, a 42- 1m Football yard Florida field goal handed the Tigers a 19-17 loss and their first SEC defeat. Returning to familiar Jordan-Hare Stadium, the Tigers faced the Scarlet Knights of Rutgers before 58,000 Homecoming fans. It was the first meeting between Auburn and the New Jersey school which hardly proved a match for a vengeful Tiger team. The Tigers produced 23 unanswered points before Rutgers could score. A Jackson run and a Campbell pass coupled with three Del Greco field goals accounted for Auburn's points. Late in the game, Rutgers moved 77 yards to avoid a shutout. However, the Tigers responded with a 57- yard touchdown pass. For Auburn, it was a day of offense, Jackson rushed for 114 yards. Campbell completed nine of 18 passes for 151 yards and two touchdowns. James once again provided the return yardage. He had seven returns for 103 yardsg his best was a 39- yarder that set up a touchdown. The game was won long before the fourth quarter. lt was only a matter of how many points the Tigers would score. The answer was 303 Rutgers had seven. Auburn was 7 and 2, and almost assuredly bowl bound. WK if 1 I Battling For A Bowl -Ni., JIM FIOGFFIS H112 X. VJ 4 - ig., F BOB GAMBLF GBHH NHOF iff M. B1 Wi A .I rf, The Drive . . . A number-one national ranking deserves respect. So does a perfect record. And so does the leading Heismann trophy candidate. Georgia had all three. Yet, on this November Saturday, Auburn was determined to steal some of that respect. Practice the week before had been intense. Students were determined to turn Auburn into a hated city for Bulldog fans. The situation was strange: the Tigers, at 7 and 2, still had something to prove. Receiving the opening kickoff, Georgia proceeded to show Auburn why they were number one. A Bulldog offense of mainly Herschel Walker pounded out 77 yards to the Tiger three. But Auburn stiffened and surrendered only a field goal. Auburn was able to respond with a drive of its own. Moving 80 yards, the Tigers grabbed a 7-3 lead on a naked reverse by Campbell. However, before the excitement had settled from the crowd, Georgia was on top again. Walker raced 47 yards for the touchdown. As the half ended, the Bulldogs staked a 13-7 lead on a 50-yard field goal. Neither team scored in the third quarter, but the fourth quarter would offer enough thrills and tension for the entire half. Just as the crowd was growing quiet, James took a pitchout to the right side, cut to the middle and raced 87 yards. Auburn led 14-13. Once again, the Bulldogs responded. Consisting primarily of sweeps to Walker, Georgia moved 80 yards with Walker going into the endzone. The 14-play drive had given the Bulldogs a 19-14 lead with only five minutes to play. Auburn received the kickoff and began what was supposed to be the winning drive. The Tigers looked at the national championship caliber that Georgia was. The drive, which saw only two third downs, moved Auburn to the Bulldog nine. However, a motion penalty backed up the Tigers to the 14, and an incomplete pass ended the drive. 1 Auburn outgained the Bulldogs 350 to 288, had three more first downs and controlled the ball for nine more minutes. But statistics aren't remembered, only the score remains. lt was 19-14. lt was a bitter loss. There was not a dry eye in the Tiger dressing room. Dye said his boys became men during that final drive. There was one game left to prove that true. 108 Football The season had not been typical of recent years for either Alabama or Auburn. Auburn was going to a bowl, the Tangerine, for the first time since 1974. For Bama, the year had been filled with ups and downs. They appeared like national champs against top-ranked Penn State. But in other games, their offense seemed inept and their defense porous. The result was three losses and a bid to play in a minor bowl. When Alabama took the field against the Tigers, it wasn't the offense that was shut down by LSU nor the defense that allowed 38 points by Southern Mississippi. It was the top-10 squad that pollsters had predicted in the pre-season. lt was the squad that Bear Bryant had coached for the past two weeks with only one purpose - to beat Auburn. And for the first three quarters, they showed it. Auburn managed to hold a slim 14-13 lead at halftime. A 22-yard pass gave Alabama the first score, but the Tigers capitalized on a Tide turnover when James ran 14 yards to tie the game. In the second quarter, Auburn posted CampbeIl's touchdown run between two Bama field goals. The third quarter belonged to Bama. The Tiger offense was unable to move the ball while the Tide mounted two lengthy drives. The first ended in an eight-yard touchdown run, but the two-point conversion failed. On the second drive, Bama was not able to take full advantage of the maligned Tiger defense as they settled for an 18-yard field goal. Trailing 22-14 entering the fourth quarter, the prospects for victory looked dim for the Tigers. Bama had been dominant. Yet, the slim eight-point Tide lead let Auburn know it was still in the game. lt was then that the Tiger offense erupted. On first down, James took a pitchout, lowered his head and ran through an Alabama cornerback for nine yards. Then, it was Jackson's turn. He broke through the line, cut to the sideline and raced 53 yards. But there the drive stalled. Del Greco cut the score to 22-17 with a field goal. The Auburn defense quickly forced a Tide punt, and seven minutes remained when the Tigers began to drive. lt was a drive reminiscent of one two weeks ago. The Tigers slowly moved down to the Bama nine, but a motion penalty backed up the ball to the 14 - just as had happened against Georgia. On the third down, Campbell hit Jackson across the middle. He turned upfield and hit the Tide safety at the two. He bowled ahead but was stopped short - 18 inches from the goal line. No choice existed: Auburn would go for the touchdown. For Dye, the play was obvious. Jackson diving over the top. The play had never been stopped. When Jackson followed James into the line, there was no opening, so he leaped. He didn't make it by much, Auburn Led The Nation In Fewest Turnovers With 14, 12 Fumbles And Two interceptions. but he did. Auburn lead 23-22. With the ensuing celebration by fans, players and even Dye, the game seemed over, but it wasn't. Two minutes, 26 seconds remained. The Tiger defense was called upon. Pushed and shoved most of the afternoon, they played with renewed strength. On the third down, a Bob Harris interception apparently won the game - but it didn't. A Jackson fumble, on the same play that he scored, gave the Tide a breath of hope. This time the Tigers surrendered yardage as Bama moved into Auburn territory. However, a sack and an incompletion thwarted any of the Tide's chances. Alabama had rolled up 507 total yards and 27 first downs. The Tigers had only managed 257 yards and 11 first downs. Auburn had been beaten statistically. But, as they had learned two weeks earlier, statistics are for losers. The real numbers were 23-22. Football 09 l 110 Football B. FITZ The Tigers had earned their way to the Tangerine Bowl, and Coach Dye planned to allow them to enjoy their trip to Orlando. They visited Walt Disney World, Seaworld and even participated in a beef eat-off against their opponent, the Boston College Eagles. But as the Saturday night kickoff approached, players and coaches devoted their full attention to BC. True, the game was a reward, but Dye was determined not to let their reward end in defeat. From the kickoff, Boston College appeared like it would romp over the Tigers, Heralded quarterback Doug Flutie led the Eagles 79 yards down the field against a seemingly helpless Tiger defense. However, the BC defense could not contain the Tiger offense either. Auburn's first possession yielded a field goal. After a poor Eagle punt, the Tigers captured a 10-7 lead on a five-play drive. On their next possession, the Tigers scored again as they ripped at will through the BC defense. The Eagles countered with a 34-yard field goal: Auburn once again established a lengthy drive that resulted in a touchdown and a 23-10 halftime lead. lcing the victory in the third quarter, the Tigers scored 10 points. First, Del Greco booted a 23-yard field goal, and later Greg Pratt culminated a drive with a 15-yard touchdown run. ln the fourth quarter, Boston College narrowed Auburn's 33-10 lead. Flutie threw for two touchdowns, the last as time expired. The two-point conversions accounted for the 33-26 final. Maybe the time had come for the change, because it was happening. Auburn finished the year with a 9 and 3 record and ranked 14 in the AP and UPI polls, A new score, 23-22, had replaced a time-weakened 17- 16, and Bear Bryant announced his retirement soon after. Following an eight- year drought, Auburn won a bowl game, prompting Dye to say, We could take this team right now and play anyone in this country. Players spoke of a top-10 pre- season ranking next year. Definitely, things were changing on the Plains. - by Greg Fox TIME OF We Could wwf -aff. f- . CHANGE I Play Anyo ,Mx o promote and organize spirit is not an easy task for the Auburn University cheerleaders. Hours of practice, seminars and workshops prepared the 13 members for the few hours in the public's view. After being selected for the squad, their first appearance was at the A-Day game. But then the extensive training began. In the summer, the team attended the Universal Cheerleading Associations Collegiate Camp at Memphis State. With more than 1,000 other cheerleaders, the members practiced from 5 a.m. until 10 p.m. Their efforts earned them Most Collegiate Cheerleading Team at the camp. During fall and winter, their duties continued to expand. Besides appearing at all football and basketball games, the squad practiced two or three hours each day, held pep rallies and appeared at many alumni functions. Contrary to popular belief, cheerleading is not all glamour, said Kim Carter. Despite the work, however, Carter said she believes the effort is well worth the rewards. - by Philip Spiers gi ii Bowl KWALT oisrvsv Pnooucriorvs Dye' I I e began the season with a chance to have a good football team. We had a chance to beat everyone on our schedule, but we could also lose to any team on our schedule. It was up to us, our players, coaches and fans, how good we were going to be. We include our fans in that group because you, the Auburn students, faculty and alumni, played a great part in our success this year. Without your loyalty and vocal support in the stands, we could not have had the season we had. That was evidenced by the tremendous feeling that was evident after the Alabama game when the players and coaches came back on the field. I had heard about the Auburn spirit all my life, but l never really knew what it meant until I came to Auburn. We all came to a new and deeper understanding of it this year. Working together with the Auburn spirit as our guide, we can accomplish great things for Auburn and for each other. We began the season with a 28-10 victory over Wake Forest. lt was a game we had to win if we were going to have any kind of season at all. Wake Forest had won the last two games against Auburn. lf we were going to have any kind of recognition at all on the regional and national level, we had to beat Wake Forest. The 28-10 victory was a fine way to start the season. Our offense didn't make any mistakes, and our defense played well, especially in the latter stages of the game. We faced what may have been our biggest challenge of the season the next week. We had to play a very fine Southern Mississippi team with what may have been the best college quarterback in the nation, Reggie Collier. We played them the week before Tennessee, our first conference game. Concentration was very important, and our players did a good job of getting ready for Southern Mississippi, a team that could win by throwing or running the ball. We jumped to a 14-0 lead, but we had to hold on at the end to win 21-19. The Tennessee game, like the Wake Forest game, was very important to our program. If we were to have any respect on a regional and national level, we had to s Observat o s We've Come A Long Way beat Wake Forest. If we were to have a chance to win the conference championship, one of our goals every year, we had to beat Tennessee. Cur defense played well against Tennessee with the exception of two long bombs to their speed-people. Randy Campbell, Lionel James, Bo Jackson and our offensive line played well against Tennessee. Nebraska came up next and showed us that we were not ready to compete for the national championship, not on that day at least. We played well in the first half and during some of the third quarter. Some key people were hurt, people like Gregg Carr and Lionel James, but when Nebraska got on a roll they were impossible to stop. They had one of the best offensive teams I have ever seen the day we played them. Kentucky was next. We won 18-3 as Al Del Greco set an SEC record and tied an NCAA record for Most Field Goals Kicked in a Single Game with six. We did not play well offensively, but we played well enough to win. Our defense limted Kentucky to a Dye's Record At Auburn ls 14-9, 9-3 This Year And 5-6 Last Year, A Year In Which l-le Missed Being Named Coach Of The Year ln The SEC By Only One Vote. single field goal, and that is always encouraging. Georgia Tech was next and we played one of our best defensive games of the year, beating Tech 24-0. Lionel James had more than 100 yards in punt returns. We completed our six-straight-home-game schedule with a 5-1 record and headed for our first road game of the year. We had played well at home with the exception of Nebraska. l-low we would do on the road was anybody's guess, especially since we were so young offensively. Mississippi State in Starkville would be our first test, and it would be a good one. We won 35-17. It was a pleasing victory in that the offense and defense complimented each other throughout the day. Tim Jessie and Lionel James had some big plays for us. Bo Jackson came in the second half and gave us a good lift. We played our worst game of the year at Florida and still had a chance to win. The game, of course, came down to the final minutes, the recovered on-sides kick and the Florida field goal that gave them a 19- 17 victory. Rutgers was our Homecoming opponent. It was the first time Auburn and Rutgers had ever played, and the game was telecast back to New York and throughout the eastern United States on a delayed basis. We had to guard against taking Rutgers lightly because no one in our area knew much about them. Our players did a good job of concentrating again, and we won 30- 7. We started the year hoping to be in a position to decide the conference championship when we played Georgia and Alabama in the final two games of the season. We got our wish. Georgia came into the game undefeated, untied and ranked number one in the nation. Our players gave a tremendous effort against Georgia and played well enough to win. Georgia had an outstanding team, and Herschel Walker may be the best back ever to play the game, but the game came down to our drive late in the fourth quarter. We drove to the Georgia 11-yard line, but we could not get the touchdown we needed, and Georgia won 19-14. We had come a long way since the beginning of fall practice. The Alabama game has been well- chronicled, and it will probably be etched into our minds forever. We did what we had to do to win. We didn't make mistakes offensively, and we took advantage of the breaks caused by the defense. l don't think any one of us who was on the field that day or any of you who were in the stands will ever forget the joy and emotion after the game. lt made a lot of hard work and sacrifice worthwhile for our players. The Tangerine Bowl and the win over Boston College was a fitting end to a very fine year. We've come a long way, but we aren't where we want to be. Not yet. - by Pat Dye in K y, L34 J x Q V ., 3 Xymfvl s. Ss S v as JENNIFFFK JOHNS M . .Q Dye's Observatnorxs MA 35 , , , ,- .. -.... , .o inf X ' J 'ata W 'fi rf .L' JE ,g:'1x,i . si .,... , H 2-,fl 12.554 f 'V :v'. -14 ' h!'11'tf ', ,Wet . ' I Hr- . 'rr --Q ,ya 5 'U X - -T I ankers Float I o I he I o ieepa-2-ia-. ..... . , l i l i l , l Men's Swimming JOHN REED he Auburn mens' swimming team, during the 1982-83 season, has surprised many people nationwide. Under the direction of new head coach John Asmuth, the Tiger Tankers have upset some oi the nation's best. For these upsets and consistent - swimming throughout the season, the Tigers earned national ranking honors. Coming oft an 11th place finish in the NCAA for 1982, the Tigers upset first- ranked Texas and fourth-ranked SMU. Auburn swimmers also traveled to Dallas to compete against the nation's finest. Coach if Asmuth said that his team's goal was to swim its best times at this meet. That's exactly what the Tigers did. Although the team didn't finish high in the standings, many personal times were lowered. icontinuedl JOHN W x JOHN REED Men's Swemming A Recognizable Threat Skipper Wood is the hardest worker on the team, Coach Scott Reich said. He treats each of the 70 to 90 dives he does daily as if each was part of the Olympic trials. Wood's dedication has payed off again this year. He has qualified for the NCAAS in the one - and three - meter dives. Along with Wood, Chris Rowe f400- yard individual medleyj, Andy Baurer i200- yard backstrokej and Richie Hughey 1200- yard freestylej all qualified for the NCAAs. Some of the dual meets came down to the final event, the 400-yard freestyle relay. For the most part, the team was able to pull the meet out, but unfortunately not against Alabama. Alabama was on track as it set an NCAA record in the event. Coach Asmuth has to be happy with his first year's success and with the team as a whole. I feel good about this team, Coach Asmuth stated, We're swimming faster than some were expecting to, and l'm . encouraged about that. Asmuth has the right fo be encouraged. With the determination and heart of this year's team, Auburn has the potential to build to a 1 recognized threat. - by Mike Zaleski . W ffw My 'wig A M ,. , ,. gtg:-V. G ,, f -- -fm . A A 52. i .... ..., -, , .. ..,. .. . Q f , A A .?'3.Ai2--TSX. r 1 ' A , A AA A A , AA , , Men's Swimming .rm , KATHY SCRUGGS JOHN REED Men's Swimming One Of The Best ax - N- Y . ffm, 1 .,, M if Y 5 ,gf SF J .X , 1 ww mag X Q M , K, K. . wxm .. F ., , :Q xx. , x' J 3 f ,V V- x A Sf gxfff- kyk, x11 l i A ,g3y ,. 'Wuxi' ef 4 3 , g s f f- s I I feelbeheraboutthm seasonthan have any other since l've been at Auburn, prodahned Coach Sonny Snuwias he propheshed aboutthernens'1983 basketbaH season. His statement was not unfounded when examined. With all five starters returning, theteantcarnes expenence and conhdence unknowntoixewousyeam'teams.SM players are seniors, including four of last year's starters. Furthermore, depth in all positions strengthens the squad. Recruits Donnm Butchen Bnan Shepperd and Chuck Person soHdHy a snong bench.lnfacL Smith predicts as many as 10 players in rotaHon. Although Smith feels the Tigers are a first division ball club, uncertainties could foil his hopes. Improvements in ball-handling and fewer turnovers are a necessity for the club to chaHengethe beHerteanw.l4oweven Auburn's biggest obstacle will come from the tough SEC race. Six of the 10 conference schools were involved in a post- seasontournanmnL and 42 ofthe 50 starters in the league return. Summing up the situation, Smith says, We're going to have a benerteanm butthen so B everyone msef' icontinuedi Men s Basketball Better Team 1 i pf KATHY SCFKUGGS cn O JOHN REED Men's Basketball Squad Competitive Against SEC Opponents Y ir Y JOHN REED 1.f,t,,,, i J, 1- 1 ' bf M , K '.'.,ii. . e l There may be a new trend for Auburn basketball. The team had its best finish in seven years and began a journey that Smith hopes will lead to the first division of the Southeastern Conference. Although it finished seventh in the SEC race, the squad was competitive against all nine conference opponents. The team had upsets over national powerhouses like Kentucky, Tennessee and LSU. Of the 11 conference losses, four totaled to seven points. As far as statistics are concerned, the Tigers finished in the top five in six SEC categories. Furthermore, Auburn's 50.8 shooting percentage was second best in school history. And finally, a freshman, Charles Barkley, led the league with a 9.8 rebounding average per game. If the team were to win, the odds were it would be at home. Memorial Coliseum was the site of 11 victories in 13 games. lt was the best home record since 1975. However, a disastrous 3-12 road record nullified the squads home performance. The Tigers, in order to be competitive, must improve their road record. At Times They Were Unstoppable Despite the hopes that had formed last season, Auburn was unable to move into the first division in the 1983 season. The team fared well in pre-conference play, even against strong squads like Houston, UAB and Cal State-Fullerton. The squad posted a 7-2 record including a perfect 4-O homestand. However, the 18-game Southeastern Conference schedule dropped the team to a .555 winning percentage. Again this year, a poor record of 2-7 gave the Tigers a 8-10 SEC record. However, Auburn still produced some big victories, including upsets of Alabama and Kentucky at Lexington. The 8-10 SEC record seemed to typify the Tigers' season. At times, they appeared Men s Basketball unstoppable. They averaged four more rebounds per game than their opponents and outshot them by six percent from the field. But then turnovers could nullify all of Auburn's offensive prowess. Auburn turned the ball over 103 times more than did the competition. Although the Tigers produced eight conference wins, they finished eighth in the league. Definitely, it was a year of parity among SEC schools. Any team could beat any other, and that left a hope for the Tigers. Capturing the SEC Tournament would send them into the NCAA tournament. - by Greg Fox I r- , gg rrf' if +1 QQ. ,.,. - 'N - 1-W me W ...fag in rw. A... - A t X CRAIG SHIRLEY -...Je NH 5, M. 9? H., iQ is ff? ' K E I J? is 1 Lady Tiger Basketball Disfif fat.-. A Growing Tradition hat Auburn varsity team has won 73 percent of its games over the past three seasons, boasts an All-American player and made an appearance in the 1981-82 NCAA Tournament? Unknown, or at least unrecognized by most students, the Lady Tigers basketball team has turned itself into a growing Southern tradition. Last year, the team ended its 24-5 season with an invitation to the NCAA Tournament. The strength of Head Coach Joe Champi's philosophy, Defense wins ballgames, just touched the surface of the Lady Tiger's aggressive play. Auburn finished the 1981-82 season with two national rankings: third in victory margin f18.3 pointsjg and fifth in total defense fallowing only 58.8 points per gamel. Defense wins ballgames, offense sells tickets. Coach Champi could not describe his team's situation any better. The team has gained national attention, yet cannot get a good crowd for a home game. For the 1982-83 season the Lady Tigers were consistently in the top five defensively freaching a peak of number one in early Februaryl. Champi had two goals to shoot for this season. We want to win 20 ballgames and improve on last year's 130 Women's Basketball John Reed defensive success. Coach Champi leads a program which is based highly on the fundamentals of solid aggressive basketball. Desire, discipline and confidence are the foundations which Champi builds his team on. Champi feels that his players will be able to deal with any situation on or off the court. Auburn has one of the toughest schedules in Women's basketball, but Coach Champi feels that his line-up can deal with any other in the NCAA. Scoring has been led by junior Becky Jackson. Power and experience inside is given by senior Lori Monroe. Scoring and leadership is expected from sophomore Debra Larkin. At the point is sophomore Cindy Sagrera who will coordinate the offensive. A major contribution has been made by two freshmen: Brenda Sugar Hill and Pascale Van Boy. The height, strength and aggressiveness of these girls can intimidate even the best of teams defensively. The Lady Tigers have built a strong foundation for their Southern tradition, and if Coach Champi stays around there's Photo Service no telling where the legend of Auburn's lady JOHN REED Tiger basketball will end. - by Mike Zaleskf vw 2.- X WX -R! x ,333 Ftugby - Not Simply A Club Intramurals ugby is growing rapidly at Auburn. After finishing third among southeastern schools last year, the club hoped to travel to Philadelphia to compete in the nationals. However, a solid performance in the Georgia Cup was necessary to send the team to its goal. In the past, the rugby club had not flourished as it did this season. Just one year ago, the squad was forced to borrow two players to complete the 15-man team to compete in the Battleship Tournament. They usually averaged fewer than 20 members. But this season's heavy recruiting lifted the total to 25 or 30. Furthermore, the recruits, according to veteran member Dave Robel, were a talented and competitive group. Despite their recent fortunes, the team faced several deterrents because it is not a JOHN REED University-funded sport, but simply a club. The players practiced and competed without the aid of a coach, all guidance came from the experience of knowledgable players. In addition, a schedule that ran from February to December presented problems such as continual player turnover and financial difficulties because they raised their own support. Because rugby is filled with technicalities and smaller rules, the players were constantly learning the game. ironically, the squad grew stronger by learning from its mistakes during the games. As Ftobel states, We're still learning, even as we play. Nevertheless, rugby is a new college sport, and the Auburn club is steadily growing. - by Greg Fo 3 Ai. fsltfwe P+! Striding To Their Goals ' 4 ' 43 ' ffm! PHOTO ailing short of its third straight SEC crown and fourth consecutive trip to the NCAA championships last year, the mens' cross country team was determined to rebound during the 1982 season. However, the loss of four of the top seven runners, including All-American Chris Fox, made the challenge difficult. ln addition, the conference includes several tough teams, including perennial contenders, Tennessee and Georgia. Nonetheless, the quality of the runners prompted Coach Mike Muska to predict, I think we have a chance to qualify for the NCAA. Improvement over last season is a necessity for the team to meet its goals. Despite the return of talented veterans Tom Graves and Kevin O'Keefe, Muska is counting on support from the younger members. However, he says, Freshmen will be freshmen, which means they are usually inconsistent. For the entire schedule, the team was as Muska predicted: inconsistent. In the second meet of the year, Auburn finished first among 11 teams in the Florida State invitational. Two meets later, the squad faced Georgia and Tennessee, the top SEC teams, in the Georgia invitational. With a strong performance, Auburn placed first. Auburn had another first place in the Ole Miss Invitational, but finished in the lower half in two other meets. After a third place finish at the Southeastern Conference Championship, the team placed tenth from a field of 24 in the NCAA District Ill Meet. Only the top four finishers advanced to the NCAA Championships. Despite an improvement over last year, the goals of an SEC crown and qualification for the NCAA Championships had eluded the team. - fter six years as the mens' coach, Mike Muska assumed a new responsibility as the womens' cross country coach. However, for the 1982 season, the task was more of a challenge than a responsibility. As he said, The most interesting part of the year will be seeing how we can work both programs to be as successful as possible. l'm looking forward to my first season with the women. The strength of the squad was its blend of experience and youth. All of the team's top five runners return, including Heidi Maher. She is a two-time qualifier for the AlAW Championships. Providing the youth were two exciting freshmen. Maria Large and Dee Dee Bailey placed first and second respectively in the Virginia Championship race last year. Although the team captured first once, in the Ole Miss Invitational, the women were consistently among the top finishers. They placed third in both the Florida State and LSU lnvitationals. ln the SEC Coaches' PHOTO SERVICES .. PHOTO SERVICES invitational, an unofficial conference championship, the team garnered a second place finish. However, the team faced the toughest competition in the country at the NCAA District Ill Meet. Three of the top five squads in the nation and several other strong teams competed in this region. Consequently, Auburn was twelfth of 17 teams at the meet. Like the men, the women missed qualifying for the NCAA Championship. However, the team had been one of the best in the SEC, and according to Muska, that was coming a long way in one season. - by Greg Fox Cross Country Another Aspect Cf Learning I n' I - -4 MICMAEL WEEKS 52 i. ab 1 W W 3 Q49 ith more than 6,000 participants, the intramural program has become an integral part of the Auburn educational system. Formally referred to as the Auburn Recreational Services, the program offers students 18 sports under four divisions. However, the program has emerged only recently under the guidance of Coach Claude Sala, Since his arrival six years ago, he has added several sports and involved more than two-thirds of the students, faculty and staff. ln addition, he saw his goal of a new student activities building realized when construction began in the spring of 1982. For Sala, the importance of intramurals has been understated. He believes the cooperation and competition involved in intramural participation are necessary and valuable aspects of our society, In fact, he places the value of his education alongside that of academic learning. fcontinuedl MICHAE L WEEKS ta rural 4 cg, K 1 WI v ,gf 1 '51 1 'wiv H? A, W6 QM , ., 1 J 1 Football Draws Participation RICK HOLL Ithough many sports are available, football is the most popular among participants and spectators. With more than 1,000 players each fall, games are held Monday through Friday to involve every team every week. Teams are divided into four conferences, dormitory, independents, fraternity l and fraternity II, which consists of sororities, The top two teams from each conference compete in a playoff system. The Kudzoo Kowboys defeated Sigma Nu fraternity to become the mens' all-campus champions. For the women, Gamma Phi Beta won the title. Coach Sala understands the importance of football to the program. Referring to the sport, he says the attention that football receives draws participation to the other sports. - by Greg Fox lntram I 2-.1 b :-1 . J ff. Q ' mn X - . mg! :,.wg,4.,:f u -'N-ws, .,,- '1 'Lt.i?'4E'g W W ,Q gg . .N ' l,.J5221iG? f X Tihvikxm rf :- lx SW' QESBYXSAXNX earning at Auburn is changing. Academics, a new section for the Glomerata, takes a look at each of those changes in is interviewed with his comments in the progress and strengths of the particular school. Also, an unusual or special story in connection with the school is featured. With the competition for jobs increasing, professors are being pressed to change their outlook to adapt students to the working world, rather than more of a liberal arts background that surrounded graduates a decade ago. Time magazine's man of the year made changes in curriculum requirements. The computer was used in every curriculum from agriculture to pharmacy. The section begins with a look at the School of Agriculture. The school boasts an enrollment of 1,394 students, according to the 1982-83 Bulletin. An interview with Dean Voitle is and a story about a summer forestry camp in south Alabama, is included. Architecture and fine arts are included with an interview with its dean. The school, located in Dudley, Goodwin and Biggins halls, has an enrollment of 1,471 students. Fine Arts Week is featured. Stories about the School of Arts and Sciences and Business follows. According to the Bulletin, each school has 5,256 and 2,492 students, respectively. Dean Hobbs and Horton add input. The engineering program is highlighted with a story on its Engineering Building I. With an enrollment of 4,061 students, the school has a bright future with its new facilities. The Graduate School section takes 5 look at GTAs. The School of Home Economics features the Student FHCUHY Council. Auburn's newest school, nursing, is reviewed on pages 158 and 159. With enrollment around 327, the five-year program of pharmacy is one of Auburn's strongest. The School of Veterinary Medicine, with approximately 500 students, is featured with an interview with Dean Vaughn. Finally, the top administrators of the Auburn system are pictured in their offices. Academics Editor Eric Gronquist Ph 1 by RICK HOLL Auburn's 11 schools. Each dean SCI-IUDL QF AGRICULTURE More Than Just A Curriculum. 1355 ,.g:g:3:f::5f55 g Hill is more than an ffffz. Auburn student's figure of ' speech, said Dr. Robert A. Voitle, dean of the School of Agriculture, Forestry and Biological Sciences. Instead, 'Ag Hill' is a special affiliation between the students and faculty members giving our students a distinction between here and the rest of the campus, the University's newest dean said. Ag Hill is located on the southeast part ol campus, and most students would say it was composed of Funchess Hall, the Animal and Dairy Sciences Building, Comer Hall and Smith Hall. Our students are tremendously interested in their schoolwork and that's why l'd say the students here designate this as their own special part of campus, Voitle said. However, agriculture students aren't secluded, in say, Funchess, he said. The curriculum stresses a strong liberal arts groundwork, therefore, they do have a number of courses in Haley Center, etc. Since becoming dean in 1982, Voitle has set several goals for the future. My major goal is to provide students with a good, broad-based education that would allow them to perform well technically in a well-rounded, yet specialized manner he said. Voitle said, l'd like to point out the myth saying the majority of our students are from rural areas is false. We are seeing more freshmen entering the school from urban areas, rather than farm families as in the past. The School of Agriculture, Forestry and Biological Sciences offers a vast variety of courses, with curriculums in agronomy and soils, animal and dairy sciences, poultry science, horticulture, agricultural journalism, agricultural business and economics, agricultural engineering, biological sciences, food science, forest engineering, forest management, ornamental horticulture, plant protection and forest products. ln addition to our school, we have the experiment station and extension service - both of which we are very proud, Voitle said. Agriculture is definitely not the same as it was 20 or even 10 years ago. For instance, we have just installed a computer system to complement the students' studies, he said. Our field is rapidly changing, and l feel we have the best faculty and facilities to make the adaptionsf' he said. With a growing enrollment, excellent facilities and some of the best agriculture scientists in the nation, it does seem that Ag Hill is certainly more than an Auburn student's figure of speech. - by Lynn Brown t's just a dream come true for gig Martha and me, Solon Dixon said 'If-2-I-f as he referred to the Solon Dixon Forestry Education Center, the largest gift ever made to the University by a living person. The center, located halfway between Andalusia and Brewton in south central Alabama, was donated by retired lumberman Solon Dixon and his wife Martha to serve as a summer camp for forestry students and as a forestry and wildlife research station. lt includes student dormitories, dining facilities, faculty housing and a home for the resident manager. its focal point is the old Dixon family home which was built in the 184O'-s. Also located at the center is a large auditorium donated by Mrs. Thelma Dixon in memory of her late husband Charles Dixon, Solon's brother and fellow lumberman. Because of the center, the idea of a summer forestry program is much more appealing to Q- forestry students. Students now spend the summer between their freshman and sophomore years at the center getting a practical, hand-on introduction to forestry. As for quality, we're pretty certain no other forestry school in the nation has a comparable resident forestry camp, Rhett Johnson, resident 1 manager said. Students earn 17 hours credit at the summer quarter camp. Earning those 17 hours means putting in about an 18-hour day. Classes, located outdoors and indoors, are from 8 a.m. to 5 p.m. and then, of course, there's always homework. Yet the work is necessary because as Dixon says, We expect to make this one of the finest facilities in the United States. - by Patricia Wok SUSAN BROWN Academics - Agriculture SCI-IDOL QF ARCHITECTURE AND FINE ARTS. Refining Exceptional Talents. 335:iii:1:5:1:1:i:3:f:5': ean of the School of Architecture and Fine Arts, E. Keith McPheeters was born in The Sooner State and grew up in Stillwater, Okla. He said, I always wanted to pursue music as my career, Because of the attitude his parents took toward 'tthe arts and the influence of his sister, who majored in interior design, he chose to be an architect. McPheeter's formal education began at Oklahoma State University, He graduated from OSU and came to teach at Auburn. In the 1950s, McPheeters played for the Auburn Knights in order to earn money to attend graduate school at Princeton University. After graduating from Princeton, he went to the University of Arkansas to teach and practice - architecture for approximately 10 years. Later, he was invited to Rensselaer Polytechnic Institute in Troy, NY, where he was dean of the School of Architecture, Already serving as a dean, McPheeters had an advantage in the selection of dean of the School of Architecture and if Dean McPheeters!BlLL SCHNEIDER Fine Arts here at Auburng but that wasn't in industrial design, architecture and theatre to the only reason. McPheeters chose to be installed, and he would like to see a dance accept the offer as dean because, as he program added to the school. said, l've always liked Auburn, the Included in the School of Architecture and students especially. I like the idea of Fine Arts already are architecture, art, building having the School of Architecture and science, industrial design, music and theatre, Fine Arts be one in itself. offering nine different degree programs, There McPheeters' duty as dean is one of are about 1,500 students enrolled in this administration. To see the completion of the entire fine arts complex, including the industrial design and art buildings, is one major goal he is striving for. l-le would also like to see more graduate programs 144 Academics - Architecture And Fine Arts school of many talents. - by Laurie Nfckchen 'FI:C5231:3:5:' 3325232153 hen Dean McPheeters came to Auburn, he formed a student advisory committee, now called Architecture and Fine Arts Council, to bring about better relations between the faculty and students of the School ot Architecture and Fine Arts. This committee wanted to call attention to the fine arts so they decided to initiate a Fine Arts Week. This annual event started 10 or 12 years ago and has become a special part of spring quarter. Representatives of each program in this school contribute something unique. The art department has a Paint-a-Bod contest. The theatre department performs skits outside. The music students give concerts around Dudley Complex. The building science majors construct some kind of interesting structure. Last, but surely not least, the architecture department is in charge of Beaux Arts Ball, held on the last night of this exciting week, by Laurie Nickchen -PW IOHN RFE D ... ' ,frr,l,,Nm?uL,,,, 5 , r -3 V :5'1.,-,. as W- ,.,. .W ,,,,, gg W M Lg at ,. A 55 xg 51 2 f- :gf Q., 5' l -If ' if 5,51-R .3 5, . .F .t 1 'i'f' 5- - -- 1 Y Acaderiiics A h t ?ctli1e Arid li A l ,fi a L 71 f 5 2 W ' gg 5 M fg. --Q A Q S ,, ww! Nqwl i 2 A WWF' N? ames W Sanders assistant professor of speech communication is the first and only teacher to award for 30 years of teaching Bert E Bradley department head of speech communication held a dinner in his honor and presented him with a replica of an original Academy Award Sanders says he loves teaching and believes that anyone who teaches has to be a ham After all where else could he get a captive audience? He has had offers to teach at Texas and Kentucky but loves Auburn too much to leave Sanders says he fell an love with Auburn and believes the students here are terrific In 1958 he went to Northwestern to do his doctoral work While there he got turned on to film He returned to Auburn in 1960 and began teaching film courses The most popular course he teaches now is Modes of Film Commuication ln this course students acquire a frame of reference with which to judge films Sanders has developed a special expression which has be come his trademark Go in Peace He said Let s try to live in peace to be prepared for tomorrow by Melissa Gresham f5fI:3:3:1:--- -' receive an Academy Award. He received this - in vu - - I Academics g Arts And Sce ces SCHCDOI. CDF BUSINESS Computer Based Progress. 148 Academucs Dean Horton!TOM PALMER f Buslnes. by omputers and their role rn busrness have seen dramatrc changes rn the past decade ln addrtron to the reductron rn srze computers have become a real and vrable force rn today s busrness world Any busrness student who rs uneducated rn computer use wall be at a real disadvantage rn thus competrtrve envrronment Snnce the tall ot 1982 the management department has been otterrng classes rn nts newest master program Management Science MIS JFNNIFFR JOHNS Dr Snyder sand The students wrll have access to some ot the trnest computer hardware on the market The new computer facrlrtres wrll house several IBM personal computers and the Teletype system from Bell Labs consrdered by many to be the cuttrng edge rn the mrnr computer market The department rs contrnutng nts search for support wrth the desrre making cts new program one of the trnest avarlable It contrnued support can be found then the Ph D program whlch rs now on the drawrng board may become a realrty grvrng Auburn students the opportunrtres they need to solve the problems ot tomorrow by Chrrs Gains .. Q XX ,bww ,ffiwn 7' V P y ' pyy, . , t :fffj I ' ' ' 4 T ' ' of n search of excellence, the School of Business is striving to meet the needs of students, industry and the community. As business school Dean George R. Horton said, Our objective is to develop one of the nation's most productive and prominent business schools. The school has made major steps toward that goal in the last 10 years. This is not to say that the school is without problems, however. Apportionment hit the business school, like everyone else, very hard. lt takes a great deal of work and money to keep a school's accreditation. Auburn's undergraduate curriculum includes a two- year Pre-Business Program and a two- year Professional Option Program. The Professional Option Programs are offered through the departments of accounting and finance, economics, management, marketing and transportation and physical distribution. Through these programs, the school seeks to develop in its students the analytical, decision- making and communication skills required of managers who lead modern organizations. The school offers a degree of Bachelor of Science in Business Administration. In addition, it offers programs in graduate work for degrees of Master of Business Administration, Master of Science in either business, economics or JOHN REED management information systems, and the Master of Arts in college teaching. All of these programs have been accredited by the American Assembly of Collegiate Schools of Business. The School of Business is proud to support three national honor societies and 11 professional organizations. These organizations allow business students in all areas to participate in activities related to their particular interest. Given the support it needs and with the leadership of Dr. Horton, the school may grow to be one of the finest in the nation. But as Dean Horton said, just being good, even very good, is not enough. We must excel. Our professors should be teaching today what the textbooks will contain tomorrow. - by Chris Gattfs Academics - Business SCI-IGOI. OF EDUCATION Producing Tomorrow's Teachers. Acadelcs - Education JENNIFER JOHNS ,,,-1' ' 2 , M purple . brat . 5' 5 .af , fr JENNIFER JOHNS l- A very unrque program wrth an the School of Educatron for early chrldhood handr burn Unlversrty Pre School for the Multl handicapped The program provrdes for rnfants to slx year olds with more than one drsablllty These special children come from all over the state for thus free service It rs dlrected by Nancy Burg Two full tame certrfred teachers trarn and teach both graduates and undergraduates who In turn help the children The program prepares the chrldren for a public school envrron ment This Includes games drsclpllne and even swlmmrng The children undergo dlagnosrs speech therapy and psychological assessment They come to school for four hours each weekday Parents can also participate In the program They can come anytrme to be with therr chrld and to help ard the teachers Meetrngs are held twice a quarter to consult comfort and sup port one another by Ann Murrel! -.A NX 5 '3 ,522 capped majors is the Au- JENNIFER JOHNS ere at Auburn there are approximately 2,000 students enrolled in the School of Education, with its highest degree being the doctrine. This degree is offered with the majors of educational leadership, counselor education, secondary education and vocational and adult education. on from the School of Eduation is field experience Students actually become involved in teaching situations at different types of schools Many majors are available to the students. The main departments of the school are: counseling, curriculum, foundation, media, health education special education vocational and administration. Once satisfactory completion of the courses prescribed by a major has been completed and the dean has given his seal of approval the graduate receives his certificate from the appropriate Alabama Department of Education. The main objectives for this school, according to its dean, Jack E. Blackburn, are to provide a quality education to encourage more research and to create new programs which are responsive to new educational levels. Dean Blackburn s alma mater is Florida State University, where he was drum major. Before coming to Auburn Dean Blackburn was a professor and administrator at The University of North Carolina Besides music, he also enjoys cooking, working in the yard and sports Dean Blackburn s sound advice for Auburn students is to try to seek the most knowledge possible and to not be satisfied with the mediocre, but to critically examine all aspects of an education. Predictions for the eighties for teaching opportunities are very good and especially for the South The School of Education is striving to become a respected dimension of Auburn in order to serve today s and tomorrow's students and schools. - by Ann Murrell Academics - Education SCI-IOGI. OF ENGINEERING Growing For The Future. .,: 1f3:-:-:-:-:-:3:5:i:3:3:3:i rtgineers in the eighties are faced with world-wide problems and expectations over-whelming in responsibility yet stimulating as professional challenges. As a renewed interest and need develops for the contribution of science and technology, engineering leaders are calling for greater numbers of engineers. Dean Lynn E. Weaver stated that his plans for the future of the engineering school are to reinforce the training of students in present technology while also preparing them to grasp understanding of future technology. At Auburn, the engineering program is a four-year period involving both the technical knowledge and the broad general education necessary to prepare engineers for their problem-solving challenges. Centered around the physical sciences and mathematics, the curricula also stress the importance of social sciences, humanities and communication skills. Dean Weaver suggested that he would like to see an increase in grauduate students and additional research programs. This would benefit the student as well as attract prospective faculty. He is acting as a mediator, somewhat, between the school and the outside business world. The engineering school, as well as others, is running on a tight budget using only funds from the state. This calls for outside support from industry and alumni. Dean Weaver says he would like to see a pulling together of resources resulting in a partenership of all. After all, the industry would be investing in itself by providing an even better education for students who may be prospective employees. - by Melissa Gresham Academics - Engineering Photo by J. Jo hy would anyone want to tear down an old, historical building like that? We need a modern engineering building if we're to keep our accreditation and the respect of engineers around the country. The lines for the Broun Hall dispute have been drawn. On one side we have those who feel that to tear down Broun Hall would be to ruin the entire appearance of the University. On the other side, we have those who feel that the reputation of the School of Engineering depends on its ability to develop for the future - and its ability to leave the past behind. The 75-year-old red brick building is the fourth oldest at Auburn. Because of its age, Broun Hall - as well as Langdon, Samford, Biggin and Hargis Halls - is on the National Register of Historic Places and receives federal money for its protection. The Historic Preservation Act of 1966, therefore, prevents federal money from being used in the demolition of these buildings. The Bartholomew Master Plan study in fl t fx 1'-. T Ax-Ly I 'V i H ' V 'X V ' -irgqls.-11k ' X-A . 11 ig no l Q 1 Qu.. ' X' Q R' ' A- , mix i . 1 1 y , 1 r ,spa K. -1, ft - Xt., mix-,K .1 .-,ggvf . . af , ' 7 W '11 E fa 't' -' A A3 9 X lr - 111+ we it ' ' Q6 YQ f' ' 1-g1Q?g,.'F4'-?5i'1'i g 1 . - '-' f E 'fi h naval-'Mad P .ny 'lewd XY.-xijx N , i I qv. 4,E JN! A' 10 Yu, El x it A ff..,.2m:!:tsLx A .0 'I' 1- fam 'taxi-' ' ' lqfifiltg-. 2314:-w ,.-i,f2'!QQ N j fi, :ers -.,, ,r ,-3- - ,-- - ., 1 X -, - . ' 71' - ' ' rf, if 1T,- f f 4 9 ' LJ ' ' 1 ' 4311 -3 .Q dv. KT-A ' ,ff -K ,-1' ' 1 M. 1 'if A f f 'X Vw 1 5 'img M, Ga 1 ff'?77LnHXf'Lu 5' fx n 4 A October 1981, proposed razing Broun Hall and constructing a 600,000-square-foot engineering building. The size of the proposed building may be anywhere from 8 to 12 stories tall and 100,000 square feet larger than Haley Center. The engineering department says that Broun Hall is not adequate for the expanding field of engineering and that it needs much more space for offices and classrooms. Some thought has been given to renovating the structure. As one student who worked in the administrative offices at Broun said, lt seems a shame to tear it down, but it would cost more money than it's worth to restore it. However, a group of members of the American institute of Architects discovered that there are many structural systems that could teasibly be put into the building. Broun Hall was built in 1907, only four years after the death of the man after whom it was named, William Leroy Broun. Broun was the fourth president of Auburn, then the Alabama Polytechnic Institute, and is noted for bringing Auburn to the forefront of scientific institutions. Despite all the turmoil surrounding the fate of Broun Hall, the Board of Trustees voted to tear down the structure. And unless the students and alumni get involved in an effort to rescue it, a new structure will be built. Both sides of the issue are valid. We know that as a university we must forge ahead in our engineering program, and this includes building adequate facilities. However, we also realize the importance of maintaining ties to our past, The decision is not an easy one. Only time will tell us if the decision we make is the right one. - by Leigh Light ' Ir'4:'AW 5 g ! li H DOUG BHINSON Academics i Engineer ng GRADUATE SCHOOL Diverse And High Quality Programs. 53 esearch and graduate :-: -4.5. studies are a major re- a universi- ty, says Paul F. Parks. And here at Auburn, men and women are devoted to this objective. Dean Parks, a native of Opelika, Ala., has been at Auburn since 1965. He taught until the late 1970s and then was appointed to his present position as Dean of Graduate School and Vice President of F-lesearch. After receiving his bache- lor's and master's degrees from Auburn, Parks later received his doctorate in biochemistry from Texas A 8r M. Not only can Parks speak of his successful career, but also of the success in his family. He has four children, two of whom attend school in Auburn, one who is doing his residency at Vanderbilt and one who is an accountant in Mississippi. At Auburn, there are more than 50 mastoral and more than 30 doctoral programs offered. Up through the 1970s, the number of people seeking graduate degrees increased. ln the late 1970s, there began a decrease, but mainly because of the decrease of enrollment in the School of Edu- ' O sponsibility of Academics - Graduate School DOUG BRINSON 'A ' ffl ectio. A word that easily QEQEM EEE... describes the lite of a graduate student, espe- cially the life of Liz Brown, a graduate student who is studying for a master's degree in mass communication. After receiving an undergraduate degree in public relations-speech communication from Au- burn last June, Ms. Brown decided to return inthe tall to begin graduate studies. She feels there are some advantages in coming to graduate school immediately after graduating. A person is still fa- miliar with the groove of college life and realizes the application and hard work that studies re- quire. However, she thinks that graduate level classes are more indepth and include a lot more discussion and research than undergraduate courses do. Actually, graduate studies are left up to the student. Along with her studies, Ms. Brown teaches a I section of SC 211, the class that started her plans f toward a career in public relations. She enjoys speech communication and feels that it is impor- T tant for everyday life. lt teaches you how to react to other people and to know how others react to you. Even though planning lectures and grading take up much time, Ms. Brown enjoys teaching and speaks of it as sometimes the highlight of my day. She finds it rewarding to see a student improve throughout the quarter. There is one aspect of teaching that she some- times finds hard to obtain - a good balance between teacher and friend. I like to be easy- going, and l like to get to know my students, Brown said, but l don't want to let this get in the way of grades. After completing her graduate studies, Ms. Brown would like to work for a public relations firm. Her interests are in the scope of public rela- tions, maybe employee relations or publicity and someday even working on a political campaign. ' by Kelley L. Glover Dean Parks!BILL HART BILL SCHEIDER cation. When asked if he perceived a growth in the number of people seeking graduate stud- ies, Parks explained, There probably won't be a rapid growth, but people will continue seeking higher level degrees. At present, the School of Education has the largest enroll- ment, the School of Arts and Sciences follows, then comes the School of Agriculture and fourth is the School of Engineering. A major goal of the research program at Auburn is to gain a better quality of life forthe people of our state. To obtain this goal, Au- burn has created a diverse and high quality research program, which includes studies in electronics, energy, food production and tech- nology, humanities, fine arts, manufacturing and resource management, physiology, medi- cine, social science and public service. The Graduate School has introduced some new programs that involve interdepartmental relationships. One of these programs is coun- seling psychology, primarily housed in coun- seling education, but in cooperation with the psychology department. Many outstanding contributions have been JENNIFER JOHNS made by University researchers. Some of these accomplishments include the preven- tion and control of tuberculosis in cattle and other animals, the design of special hardware for the space program, the devel- opment of two new clover varieites which revolutionized the forage program in Ala- bama and other sections of the U.S. and the development of a coccidiosis vaccine for chickens which is used in broiler breed- er operations. Dean Parks has an optimistic outlook to- ward the future of the graduate program at Auburn. He believes that, As we get more technological and jobs become more spe- cialized, people will go further into graduate studies, especially those people interested in research. One aspect to remember is that, Research is important to graduates because the graduate programs are re- search oriented. The health ofthe graduate programs is in cooperation with research studies. - by Kelley L. Glover Academics - Graduate School :i:1:I:-:-. 5?f?I:I:I:2:2:I:!:I-I-I-'f' ean Ruth Galbraith came to Auburn University in 1970 as the head of the department of consumer affairs within the School of Home Economics. On April 1, 1983, she will have served as dean for an entire decade. Her enthusiasm for research has guided the school in a direction toward professionalism. Home economics involves much more than just cooking. It is a broad liberal education that prepares students for careers and provides a background for home and family living. The School of Home Economics offers eleven programs of study leading to the Bachelor of Science degree. These curricula are found within three school departments - departments of consumer affairs, family and child development, and nutrition and foods. The department of consumer affairs focuses on the physical environment and offers curricula of clothing, textiles and related art, consumer and family economics, family resource management, fashion merchandising, housing and interior furnishings and equipment. The department of family and child development promotes self-fulfillment of individuals and families through maximum utilization of material and human resources and offers curricula of family and child development twith options of general family and child development and day-care programs for young childreni, and family and child services foption in family services and aging studiesl. The department of nutrition and foods focuses on the sociological, psychological, physiological and 25223. he Student Faculty Council is a group of students and faculty members which helps to encourage and foster a more harmonious relationship between home economics students, faculty and school administration. The council is also responsible for carrying out plans for various activities pertaining to the School of Home Economics. Membership in the council consists of the dean, assistant dean, academic adviser, department heads, one faculty member from each department of the School of Home Economics, one faculty member from Vocational Home Economics and one home economics specialist from the Alabama Cooperative Extension Service. The organizations represented on the council include: Omicron Nu, the Auburn Student Home Economics Association, Fashion Incorporated, Student Dietetic Association and the Home Economics Education Association. - by Ji!! Lawhead, president Academics - Home Economics SCHOOL CDF I-IGIVIE EC. Professional Service For Families. Dean GaIbraith!JENNlFER JOHNS economical aspects of food in nutritional status and offers curricula in food service administration, nutrition and foods and coordinated dietetics program. Home economics students have many areas of study to choose from and many majors can also participate in dual- objective programs with the School of Education. The School of Home Economics is involved in various programs, one in particular being Project Uplift. The agency was established through a joint effort of the Lee County Youth Development Center Board and the department of family and child development in the School of l-lome Economics. lt is funded by a variety of sources and operates for the benefit of youth and their families by offering programs that promote healthier interactions within the family, school and community in order to prevent juvenile deliquency. lt is a public service that heavily relies on volunteer work, student interns, graduate assistants and a family therapist. Dean Galbraith provides direction for the school and looks to the future with optimism. What is in store for her? To keep on performing her duties as long as she is able to and to retire here in Auburn. - by Eric Gronqufst Academics - Home Economics SCHOCDI. GF NURSING Professional Preparation For General Nursing. Q22 ocated in Miller Hall, the Z:1'i'5'Zt3:f:-I-Z.:-I-1 Auburn School of NLJVS- ing has more than 200 students. lt was founded in 1978, which makes it one of the youngest schools at Auburn. The school provides a bachelor's degree in nursing. Graduates are eligible to take the State Board Test Pool to become registered nurses. It is a four-year, two-part program with the freshman and sophomore years spent in pre-nursing. The two years remain- ing are spent in professional school. The School of Nursing prepares students to become general nurses to care for indivi- perience in clinical nursing in the East Ala- bama Medical Center and other facilities in the area, including the Lee County Mental Health Center, clinics, nursing homes, phy- sicians' medical complexes, the Lee Coun- ty Public Health Department, public schools and industrial sites. The school also provides advancement in formal study, research and practice. A program de- signed for registered nurses is in the mak- ing. However, so far the school offers no advanced clinical courses. Auburn's School of Nursing has received full approv- al from the Alabama Board of Nursing and is accredited by the National League of Nursing. The job of dean is handled by Mary Woody. Dean Woody came to Auburn with a great deal of experience when the school was founded. Originally from LaGrange, nNqDoll AQ fd' duals of groups. Students receive field ex- JP g- 3-P HQ' GA, she received her master's degree from Columbia University. Woody spent 12 years as Director ot Nursing at General Grady Memorial Hospital in Atlanta. Then, 10 years at Emory University. She enjoys traveling and has been abroad as well as all over the United States. She loves her family and lives on a farm not far from Auburn. Her hopes for the school include the estab- lishment of a master's program. One of the best aspects about this school is the huge opportunity for gradu- ates. Employment for graduates is lOO per- cent because of the demand for nurses, especially in the South. Of course, the School of Nursing is not exclusively for women, and the enrollment of men is on the rise. - by Ann Murrel! here is a very special pro gram in the school of Nursing here at Auburn the Com munity Health Clinic This clinic involves a nursing student a certified nurse and their patient The patient IS treated In the privacy of his own home Patients are of all ages The cllnrc treats the chronically ill and short and long term illnesses In addition to the care given to the patient students also educate and console the family The clinic is also active within the com munity Students interact with physrcans and social workers They attend seminars at pre natal clinics and physical day care centers perform screening for hearing at cams surnrev local schools and teach good nutrition Stu dents assess the community as a whole to understand its particular problems exam :ning its population ethnic groups and churches Some of those institutions in volved with the Community Health Clinic are the Central Alabama Home Health Ser vices Lee County Health Department East Alabama Services for the Elderly and local school boards This program is a part of the nursing curriculum Only seniors who have com pleted the prerequisites of medical surgery pediatrics and obstetrics are allowed to take this course The Community Health Clinic is benefl cial to Auburn and the surrounding com munrtres These nurses and students reach beyond the hospital and nursing home Au burn is quite appreciative by Ann Murrell . . ' D ' ,:.:.'.' I If I . .'.' . l .:.:.:.:.:.:.3.:.'...I-.Ii . I 'I ' ' ' ' I fff' I , - ' . I - ' I I I I I ' f I I I I I OHN REED I ' DEAN WOODYIJ Academics - School Of Nu sng SCI-IOCDL CDF PHARMACY. Enhanced By Active Alumni Support. 160 A uburn's School of Pharmacy is expanding more and more every year as technology advances and new programs are implemented. One area which has aided the School of Pharmacy is that of computers. Located at Miller Hall and in the pharmacy building itself, computers are training students in a relatively new division of pharmacy. In addition to the computers, a new program for an advanced professional degree has recently been developed in conjunction with The University of Alabama at Birmingham. This program will allow students to receive a doctorate cademics - Pharmacy degree in pharmacy and will open various new opportunities to pharmacy students. The area of research has also been expanding at the School of Pharmacy. According to Dean Ben F. Cooper, There is a lot of potential in these areas, all of which will help Auburn's already high- respected pharmacy program. Alumni support is another asset the School of Pharmacy is fortunate to have, Cooper said, The alumni give moral and financial support to their Alma Mater by assisting with the high costs the school faces and keeping in close touch with the school, Open houses are held on football game days to welcome all alumni and to give them the chance to sit in on a two- hour education program. This helps them to stay in contact with any developments which may occur in the school since the time they have graduated. Dean Cooper!CFlAlG SHIRLEY liil,K HUL I really enjoy living and working in Auburn. Cooper said he feels the camp spirit and friendly environment are conducive to academic work, and the alumni support the pharmacy school receives helps out not only the school its but the students as well. The dean said h likes to stay in contact with the students continuing to teach classes and by helpin out with student organizations. He also serves as an adviser and counselor to th students. Cooper is also active as a facul adviser and attends various meetings concerning his school. l-le advises, Students need to get a degree and an education - not just an academic education, but a well-rounded one f by participating in activities and groups on campus and by relating with other students. - by Mimi' Boy fiilzizizi harmacy students at Auburn can obtain an advanced professional degree in their field as the School of Pharmacy, in conjunction with the University of Alabama at Birmingham, has a doctorate of pharmacy program, according to the AU Report. This allows the pharmacy student to utilize his maximum potential in his profession, the article stated. With this degree, it is possible tor students to be specialists in the clinical use of drugs. Students can apply their biomedical science and pharmaceutical knowledge to practical problems of drug therapy, the report states. Clinical training takes place at UAB, which is one of the country's major university teaching hospitals, the article states. Students can practice roles as drug informants, receive pharmacy and medical education, conduct clinical research and participate in the pharmaceutical industry. This advanced degree can help meet the need for pharmacy practitioners to cope with the problems which exist in the delivery of comprehensive health care. - by Mimi Boyer RICK HOLL Pharmacy - Acade cs SCHOOL GF VETERINARY MEDICINE Expanding Through Research. g:g.j,j.f.1.:: 52fS:-.-:- he School of Veterinary Medicine at Auburn University prides itself on its widespread reputation. Diseased animals from all over the country are sent here tor treatment and answers to the causes ot their diseases. Serious veterinary students also come here from all over the country to study at Auburn's excellent graduate and undergraduate programs. Currently there are about 50 graduate students in one form or another, and about 445 under-graduate students enrolled at Auburn's Veterinary School. The Veterinary School is also well-known for its research program, which is expanding every year. The USDA sponsors research into tood animal diseases, particularly cattle and swine. Laboratories are being completed and research is also expanding in the area of small pet animals as endowments grow from the Scott- Richey Program. Dean J. Thomas Vaughn is head of the Vet School and has Mike Fox Academics - Vere nary Medicine Mike Dean VaughnlRUSSELL SCOFIELD served in this position for five years. Prior to being named dean, Vaughn served as head of the department of large animal services. Vaughn was himself a graduate of Auburn He enjoys some of the things Auburn has to offer such as football games and other athletic events although he is more of a sports partlclpator than a spectator The land surrounding Auburn gives Vaughn a chance in his spare time to swim hike hunt log and bicycle Vaughn remains in close contact with the students by lecturing in undergraduate classes and helping out with administrative relations He advises students to keep all options open till they give opportunity a chance to develop after they have graduated and to try to give equal emphasis to all subjects during their studies Don t let themselves get narrow minded or narrow their sights prematurely by Mlm! Boyer if-fe-1' WWM,,...- W .QV v N4 H-Q-... muff f esearch and teaching rn the area of certaln pet animal diseases at Auburn s Vet School is supported by the Scott Ritchey Program Mr K A Scott of Ethelsville Ala and Cleveland Ohio initiated the program in 1955 by providing funds for the study of disorders and diseases of small pet animals Scott had always been a dog lover and avid sportsman and through these interests developed the Scott Research Grant With this grant which also gained support from various breed and kennel clubs veterinary associations commercial firms foundations and individuals new developments were made in the areas of cardiology and neurology In the early 1960s Eleanor Ritchey of Fort Lauderdale Fla was curious about any programs involved in pet animal research Her veterinarian informed her of the Scott Research Grant in Auburn which was about the only one of its kind at that time. A dog-lover herself Miss Ritchey had taken in some 150 stray dogs and was interested in helping out. When she died in 1968 she left the remainder of her 34.2 million estate to Auburn s research. With this money along with donations from individuals the Scott-Ritchey Program was on its way. With the support of industry, charitable foundations and donations, the future looks promising for the Scott-Ritchey Program. - by Mimi Boyer Jennifer Johns Veterinary Medicine - Academics 1 4 GEORGE governor DR. PAT BARNES, acting dean of students A cade DR. PAUL PARKS, vice president tor research Q Il, , DR. STANLEY WILSON, vice president tor Agriculture I-Icrne Eccnornics, 8t Veterinary Medicine COACH PATDYE, athletic director s Q '53 is G. Q52 .r W Yagi eople are Auburn. The students, the faculty and the townspeople all make up that spirit that is Auburn. The people section tries to take a look at the people and their lifestyles. Campus beauties begin the section. Winners of the Miss Glomerata pageant follow. The pageant attracted some 410 girls, the largest number in its history. Judging of full-length and close-up photographs narrowed the competition to 20 girls. Those girls then participated in the pageant in November complete with a slide show and formal attire. At the evening's end, Valerie Bendall was named Auburn's top beauty. An inside look at the student's lifestyle is included next. Young America's newest addiction, video games, is featured, followed by a first person account of the compulsion that led students to tear down the goalposts after Auburn defeated Alabama 23-22 in Legion Field. The nightlife of students on a conservative campus, where bars must sell a 50-50 ratio of liquor and food, is reported in a pictorial essay. The story of Roommates and Roachesf' a fact-of-life for practically every student, is told. Who's Really Who attempts to gather an assortment of what are perhaps the most extreme or unusual personalities in Auburn. A lady rot'zee is interviewed, as well as Gordon Bond, the faculty's spokesman in the Funderburk controversy. The students listed in Who's Who Among American colleges and Universities are pictured, along with their personal descriptions of Auburn. The people section ends with photos of the Auburn students in the classes and composites section. Classes begin on page 230 and Greeks begin on page 254. BE!-xuTiEs EDITOR Melissa Gresham PAGEANT DIRECTOR Pat Tatum VVHO'S REALLY Wi-IO AND LIFESTYLES EDITOR Abby Pettiss wHo's vvHo EDITOR Leslie Williamson CLASSES, COIVIPOSITES EDITOR Alex Luttrell ,4 Miss Greek Week Miss Fall Rush PAIGE HOFFMAN REBECCA CHATWOOD 3, 'A GW 'N u 5 k Je K N . i A my 0 Q r ' 31 s ' 'K . ' , . v I nn is H 'Q gag 5 xv 7 ' - . T . 99? ' ' t ' A - 5 as x in K z-A gig: 1 R x ' .. . A . WS rm ' Q, Q Q fi: B Q it f- : t W 'V 1: 2' 33 x iii, 1 'sg X E ,. Qqw q ,Q l, Y i i ., . if k ,Q 3 H 'f , 5 4 'F J. .' S . ' -.,' 1. 7. - ' . 1+ Q25 M fg Ak ' ' Q ., . ' gzgifi' 'W , . 4, f Q . Y .2,', -' . -Q' , A S Q we .5 gwfiiliiff ff 2 an W sl i .. , , X 5 L15 ..l: 4' x N, Au is , I . -fl? , L' 1+ l A . A A Q W. fy ,, 9 mi ,.-f W I ., B a , , ,:., SQ, , s 'N , U' . 1 ,-4' .Q .7 5 Flaw' 'N F 1 ' '2g, ff, Lsikp, ' 'yy 4. U , ll up . 'fi ' Q ' f , I faq I' ' I tk 0 it , in is ' 'sw 1- an gg . at 3 .... ll Q ' J' bi 4- . it ,, an iw E. .. vm G. QS ' wf 1 E war ' 2. kg., if i 3 IL , 1 UU' Q, L'-' ST' 1 .20 1 .- S 1 L a fin 'Ov-5 25! M M, gm gf: R f a -...W 4 , , 1 ,, -Q Q Y' ,ff , lg f I 1 , f 1 ,eil-553' ' 4 ' nmg5g,2f 4 V gf X, , ,A f M 2 r.qg1gJfg3?ffffXfp , , mf - iii?-:'2'f11s1-1 h -W 4., fi 'Er2?'i:2f'f'f.5 I f n V fziyzwfm'-3 -,,f:zg-yer, -xy . , :W-Y. f W gf-,fwfr-LSA, ,a :fn ww, , 1 2 ' Q 'V b? f- I ,gf ?Li:5f4iffz.wl?' f rf 2 5 'Q 5' 1 1 1 '5 ,fm P H3 ' 6 illfaf? 2 ,- A ,. Ya 44 me Ya I M 14? f. ., M, X MQ M3 i E lzttgll? aai,gs, ' ' 9 :xi 8 -2 4 Q sisisss.' S fiff 77, 1 SHARON KOLA,KOWg?3!BOB SLOAN USHER CHERIE CASEY 174 , Q J , . , l ff Sf , ,i ig, v 6 , i , 15 3. '1 -- , -+ 6 , 5 I ,, 'ly 3 , ' :YC Q :G -' 3 K W ,fy V, i My A ACQZQMQQ Q' 4 M aa'-'nu' , . A. ,, ,w 7 I I 011 , -v 4 A 5.WgL,gii Y' ,, 'r-..,., f ,f 'W' .- ,ff Myf r Q K :ff f,f AGM' www . , M WENDY FRANCIS SUSAN GUTKOWSKI JAN KAVOOKJIAN RUBLE Y First Alternate Second Alternate DONNA TATE PAIGE HOFFMAN BOB GAMBLE I Third Alternate I I PATRICIA WHITE Fourth Alternate PAM SCOTT 11 I-ww f 5' gi f ff' ?S1 ef' ::2sw4,gu,,r ., , -, ,M g -,...M,..f- .MLM2.-ffK:u..,,fm..,'f.5,ff:.z r , - giyryiaq, '32-fm 1 1-fn ,Q A '31 L gigwkfiwi ' S fifwriii' ..,,.,W. M - 5 k-ii..1- , , ' nw? t 'L 3 f 'A ' . 'Q ,Q 1, , , l,Q. f'f , EXE, 3' Q! M' F , - ,. 1, V ,fu , wir, K ,.,gwo.,2,y ,ywiv , H , K amgilrlkyleggivf 1,3 g My-WM Igarkw .f WWE 1- .aa .1 4 3 Wi? M ' VF 1, 1, , CHQ -A HW' fg, -2 X m w , Q? 1 .R Wx r gg 3 1 .14 5 g vamp. 1 A 'gi' ,,,. , ,Q ,WEE l I iff ,M 9 . -, ,L 4 ' Q r,s.M W . W W JW i f -R1 'V iff' f ' few ' A 1 'farm W-1-w Q f lei 75537 , W ' 1 A A , A - C P -x ' WW -M I 'A' , H i I W.. X vw 5 WW, , 1, ' ,, .N , z ' M 'N U arm' .4 T' Wfqiuzem fail! , fix ' . A l fa .Q gg 1 -1, 1 f, wr 1 K .-E ,: ,- : f R 5 g ff P-'Y vi iw T931-9 EA' NEAL H ,- ' xv W , x ff' --,..,,s. 13 .nz WK M mf .xt ? I ,Q f Q fs- f ! 1 If wal ,Z Miss Glomeratal Q45 sg 5? L S 59 T3 A-A Q. 3 V4 J MWA? ' was , ,A , H: iw liiiym 1 M ,gy ga ,,,, , S71- I ff, 533353 25555152 gi .15 7 Lim. QW? w.ww BOB GAMBLE Miss Auburn 1982, Regina Bradford, is the official hostess of Auburn University. Her duties include working with student organizations as well as the alumni and athletic Associations. Regina, a 21 year-old senior from Gadsden, Ala., is majoring in early childhood education. She believes, Auburn is a precious gift from God, not to be taken for granted. - AMY PROPST . . AMORY BENTON F 1nal1StS JER1 PIPES TRACEY MARINO 184 Quick e-JT-if By Brad Mooy Before my roommate bacame hooked we could hold decent conversations and even catch some rays on Alumni Beach. We sat out there scoping prospects and telling jokes. Yes, that was before THEY became popular. Jeff was fine until three weeks into fall quarter. That's when he started spending endless hours at the video arcades, wasting dozens of quarters. After all, Classes didn't really matter. This sort of life went on for a long time. In the late October sunshine, I was relaying this phenomenon to some friends, pleading for their help. They promised to help break Jeff of his video fascination. But the next day Alumni Beach was empty - my friends had discovered video games. The only companionship I got around the dorm was late on weeknights and on the weekends. The arcade closed at 10 p.m. and weekends were reserved for studying and getting drunk. iThough not necessarily in that order.i Come 10 p.m. and they would dejectedly file in and hit the books on the chairs in the TV room for a late-night movie. I was justgetting used to this pattern when conversation trends changed. One day at breakfast: Me: Do you all have any tests today? Jeff' That reminds me, have you seen the new game called Inflation Hghter? ' Adam: That's the one next to Voyeur Blasten right? Todd' lscored 210,020 yesterday. Beat that! Adam: I think that's my lowest score. Okay, so I had to adiust some more. They were my friends sliver 2 235 Q? g E sig gi.-5 -.-1 si s - asia' 5' RICK HOLL and deserved patience and understanding. But when they found out about the All-Night Video and Massage Palace in Montogomery, I decided they were on the brink of insanity. After . several all-nighters I heard them talking about how tar they had gone, to Montgomery mind you! They said it was too far, and they were going to fix the situation. What could they do, right? I The next night after work, I walked in to find tive people hovering over a video game in the TV room. It was just an old battle-scarred Space Invaders, circa 1978. Video games down the street were okay, but in the dorm!!??!! . My God, get realistic, people. We live here! I screamed at them. They stared back blankly and told me new techniques to get high scores. ' Each day it got worse. Another game appeared. Then another. I Always in the dead of the night. Soon they removed the chairs and the TV to make room tor the games. I went home that weekend to escape from the 16 difterent games in our lounge. When I returned, I was amazed to see the ALUMNI BEACH sign had Video Arcade under it. Walking , inside, I saw a crowd of total strangers in our TV room. Turning down the hall, I saw more games and bill changers. The things were reproducing like bunnies. It was a neon hell. That was it. l'd had it. I decided to move out. It would please my friends, they could use the space in my room tor more games. As I passed the quarter-plucking zombies, I decided to warn the world: Don't let the quicksilver suck you down. - SQUDIIGIKSIILWEER 21,5 'QI' PQ I3 Q .. V B CLK QB D H gfg mm w Hi H l f: E U E255 Cl md if 1. ,,4mF- X .Na 1 J J' N53 P1 9 V S? ,n w w ww' . ' a figgfff- ' 1 I B x ,rw , .--W fvgih, V Y Q: :fu lfgyw 1 , , f I,-.pg-T.. Q '-w. 'T , V I, 1 uw hurl I H5 1, nm 1 : H ,171 . , . I 1 l I V' ' I r 1-iii? Gif '- Eiiui ff' 1 . .'i'v-'w ,. .,, , A , .V .- In gg ' f g , a NSN- ' 1 ' NN Af ki . 'f ,, Fi f f fm g A fl gi ,N ., K E L X37 :N 5 Eg . A332131 3, 1. . x fqryw , wg f' W, 4 2 J '.. -' u. .X J Q -s fa 1 5 H J i 5 4 I Q- ,M j ,N f rg. M' if AFX? is 523 js? M ie- , his :da 'I Y: 'Qi' f. MQ, if 5 ,. I 'X fu '5 4,4 ' 55 MWF? SH uQ'k ' I f'3 Aux! MY 5 Q 15 A -W in J MSW qifx. I. A 1 FF Q 'UM 'T3' ,W kr . ,ri .7 I Q 5553, X s r was lip . X ! .. - .jlgtf xl .. x' fl Q If 1 x Q' , I N.I,gg:..L , U 'N i R X Ximgpjx , r . , - I' X, if I 3-- - - Qs.-W 1, .ai A 5. . m- Partying down in Auburn is not something taken lightly. Serious party animals can always find restitution for 190 Nlghlllte their insatiable hankerings . . . x .MV V h M- 1 9 rd m mars I E W u If M- Q o, - Z 0' 9' 54 YT W Q' A is Prime Parties X F . v .Q , . X83- 6 BLAC111 . A-152 A,xV ' Q, 039 17 X 4? ' . , -X 0 Q -fb-as sch ,, 'Y lmv Ei 554' qv gm' I - . .2- v ff' 5 S if sg P Ngm N on faoe GAMBLE mgmme 191 Y F I J V . 'D I ,. , , s . Q. iv -s .. N , f 'NL tfsf,---lx., 13 . KK ,:f.: .:,mf1-Q 1 'f . , -Txsmm, . 'lr 4:-v-V ' ' fw mm. X Wt: 'V ' g bu xx , .u,........ . ji, - N' u V 5. . r 4 L1 , sew f 2 v .V V-' 'V , .ali 'Yi ' n - 5 A 4 . y ' .lx H LQ, -Ll 'T A ' 'las' 'H rf .. ' 'Q' K: K Y . I 'L 11 bun: X .Z':'rF?' 1 H ik X-tk 1 ,A - Bars that bring bands to Auburn are very well-received. There's always a place for a fix of fresh music . . . 192 Nightlife ' ,ff v 3 HJ lb ,. 1 af A Ar' ' f ' ,,' . -.w f' , WW 1 I ' leg! f , . Telluridelwar Eagle Supper CIub!BOB GAMBLE N' H , swf .io I-Q., iq, 2- , 4 3521. f Lf: , . ., ,K w A1 R? '43 ,fw sl' A' N-....M, T, ? M, I f 3 5 Q, M 1 ff ., Q' V1 J x 'X W'fa,,, ' 'ann E 9kf .- H.l5.W? Bars Wlt A Bea -I , I all 1. I 'Q M' 3 U .suv 3 M3776 Q5 5: Chevy Sixlwar Eagle Supper CIublCFiAlG SHIRLEY Nightlife 193 lil? i if' s , ,pw V3-4 l ti a 6 5 'A ef 1 is ,fee s Au , Q Feverish dancers itching to activate their feet find themselves cruising the 194 Ntgmure local vinyl-playing nightspots . . . I JO Q ,.,V VK , A x . r gl QW., is iittt was M ,x , A rue' .rx ' . V Q , 3 Q BX- , Q , . ri - NIGHTLIPE Dancing And Diversions , nu 4 .pv- ,L ,, , 5 .55 iw? ' ' ' 'QQ' if Fmw'sf.1sNNuren'JoHus Nightlife 195 x 7,1 '1'f'J9Q4Qe5yj YU? 1- ,T fy yjyws, sg , -swf H f 1,:fJm,.-Sw-ff'fr,w 9 'f if Hlfwfa, 1'2ZZg?'1 v 'Ulm' 1 f ?lf'f4'T' ffE5i3+?Le7J!fi!'4i.f ' --74 rf L,-:fa ,, v ' ' W- -A , fr fy: Zffiefifwfs 'f ' 1 A ., , X ,W - - 1 .5 r ef 5, 1 45555, . -' as f'i.,fi in 'P V. L I ' ' s M no sw. , Y Hs, pf' '5?f, 1'sf::. 'fl I M' . ' . ,. , , H my 1, 'w .. ':', . ,, ri Auburn, like most small towns, has its local pubs that maintain that close- knit hometown atmosphere . . . - Bubbles and Brew! Jay Sallofs Craig Shirley MGHTUFE J' Posh Pubs mp I P My . N ,, vv' 2? 3 ll 5 mbawW0xw,sQwgf.w fvwfmx -1, w - .- ,, vi .L QHs,,,fwm.,-w-fg.s':Lg.,-N4-,awssfwmwzwuagmfwuhzawhzw,::,Q.1.m1 A 'f ,W W - Leywgfnfwg wqmfmnezQQAWMM-,4,,,Mf---iQ,,,w ,, 1 . 7 ' :mf ,WV gg-W, - -'FK wg: 5 ., , 1, 5 V H., ,H M asa, VV ,. , V .fp , K A S3 V! -, gi, Hzfcjig f mg V w.g ' ' X -,,.p J ,M .,.., V, A , ww, I ,V Q,-, - ww ' ' gm - K- Q , K V ff XX 2 , Velzggg -f' ,, ,51:5,g4ZVes'L:, ,,, ,,,,, ,SQA m 1 - 15 wmizfiigiifzzfuiaiiilimzf,,,,V,,,, , swf , ,M sz L: ,zgwgii222Qigwgmbiizr2sw:Mikasafi23a:z5gw3ZJe2:w,,gg:'gw my , iiazvggwf1,if20g::gggwVwVZwfg1,zg2g,,,1122,mmfiiiieszzgzfgriiwzziwzzgmimzfzQteqwsmi 532521 , ,n 'ff 'L 2111, 9 335 gg, JT 5,546 V ,V M3535 -. V i f221522fiYfQ:, 1 ' - ,V ftirz' -V as , , V, A ,piss ggyff1:Q ,,gwsgwmzs,-2z1,g:Wmilffzmy'wi4LLiq,'rw Miss?1zQgg'1m22.z,mfzfmwfsizkzwwMremails2iaVS21s::ffs4f52fz .Mm . gVH,,A:,,M w ,,5,,,,.,,, 55 V3 N.zg5ggg,5V,-5w,Q:,2gg3gg:.,.VV,:5,4ga Pvgwwwgii mewxwqwflbw wem,-flfflw swgwfwawsgw :WML.lsggvgwxim'L,Lpw2VwvEE'5W1spWgwl.r3 H ,Q ,gag -- Y 1, ,ml was USMZLIZIFWQ Y5S2'25ggfgww h,,gg35,fVLNsmf?v,,w Jai? , Nw S, 4 N4 ff J-fi:'3aL,,M' 'Z?Zi'?31i'?' ,f2im5SZf'17'EM'-f 'M Vfiwfdiwws Y' L gs A Q V -,Lf W ,-by 522232211 wziizgywlfi173,1234USKIy1f2g51,2:w'S'25g,g-,aasiviilzrszglgmmimggglgf, ifVfAzgfgwgi5,T21f:gwofVV.l,V K Qiawiimt,gimzeffiwz I V, Q15 3ff.W:,1,V A?f,bwewV, , ,,,3gwmViQg1'iianew V,i,,l,VgS,'MZmS: ,,,,Wqw1'HVfnVVQ'?:?g',,,y- 4-',V',:.:wa-V,9'1gv gwmmzgg, 'A wi? ifgwp, fmmizigm Z ggfg 27515 gerifuwggggieg:-3wg,V.g,,,,gbg4gHgi3-fQ51gw2,5.,p,,3fgt-Ewjygmirifgwggywwwg, PSS' WMS M3 ,,ZSZgg+8wMm,1LZZ'gg'P5wsz2i1'g.Zg'22 ja ?? S1g3Q5fXv3QS2w,JEEWw1hFHSQZZWQQ,si ,mf sg- f, www mm , Mygw N-,,w:,gw N E ,g,,ww. ,, www W D VymVQw,,W sfm1,,,,, gem MW., ggwm Awww., 23-'1giww.w5,, W fsg Lam- ,Qdpggigmifgg,a,5,ggs5QaZ2Q5,,.3gggf2?e?f SimiQ3255355525Zggggiwiigaiisgtyiwzgeqa 3254253ggu3,bi'3fg,,:,,-,ggiwgsefisSZSEESHMwS?SZ:?3w?swSfVZs5SSA'f25'gg'b im? w 5 MW, , WM, , , , QW, , , 2 M , m 4' 5, 5 5.459 5 MW ww. ,Mm 0 M ,V , wpgw ,Q , PM QE A mv ff' 75l2:5ii7f'g' Hilfimigwi V, ,1,11g23i2Jwif ,A S . mga, VV,m,.,zwV-ym, g:wf1x,VfVVQ, Wy 1f,W4s,g,,,a VV 52 m,,,g,,,w . VV 5 asm. 5 fb 1-Q' ,V ,ff 1 we M 3 gg w,,1,zfgg W ,fgigw wi :gm ff , ,iw E,Qs:,sgggg3m2sfssggqimiaizsfzzsgsgwiszzzlzmwiiawizggggggiiiisywifUwSQ'?3?fzwEzNEsigiasiziggffWV?SwS,5vf'5AwfVwfVwasggqigfbsfzemwg ,W . ik Q I 43212 2rwsmwus:mn--Sfgzzz::rw-Slizmsz-1224262:-'Bmnwifzxaggif1riS:12?,?hiis5f::s::Vzgg,gw.512:22'-:.mQwVffwizmw-fflfsrsszrfik ' , y W5 qV,,k,k ,MM5 Qgvgf ,V,,,,5gpg3g,5aM,,,,, gM:1.,,.,:,,ggggQ.yw,,,:sgggw ,g1yUg3,,g,w ,333 + Vw A fwwpb,-V.: ,f,wMJ.5m'1, an w,:,,Lgig,1 ' mwm?,,Q?, asm :-2? WV! F2571 'E2:EVr,a1EE22Q2w,ff,,,i2E'f,2Vzzv,viQY23'Qs:mQ?i2fMEiigfy??Li4:2V,ze'ifwYEm4lf'fg252i2?:zgfg:,? 52323 mf, xfV,VVVV.4g:,gggmfg1:-,Qmwmwfsizgggswwi,zinevgfgwigfyziiliwwirwifimfanwhy 'rz,awfV.:V1m,,gg'y ffzmfzlg igiwziwifi 0i2fg,,fMVZV25W :iw '21 'M6'b221w',ifgSgW'f1ef,- as V0 wfwwwggmvfm,,,,f,,,. gwM'W12'3z,w' ,W 1932555 5 Q, 'mwssfwv ,,z?'wwV2f:,,m viimgfw mV.:miww 22 gg 2555: szzsiggyigfisiwiszg azsafivfiiggssQmqgggzszssfss2452232552222 1525355223535 iiiiiimgziiwiiiiiif gms sawssagggwggssrgz2ga:23,gigwgflgszigggwgizfszzggazggiggffisfzrzismiigggaziw:ggwwggfxszgaffhsvfiidsfiigv2Q,sigsizfszigzia32S2.2:2:f:fgsg5xS232mS?,S KW, Mig 5 ,,V,,4i,,,.5,5 Q- g,mg,,: we ,K W Q, 4 w,H5,l,gV5.V NV., ,,fgg1WV,-,,,, - 5Y,33,Q,MEx3z ,,+f,fsV21:i:EHggQm Nfigg ww sltwgaygwm ,Q wq,wV:VMsf.,2 12:5 ::::f:sE VVr M QVQQQEESQW , E5 zisfzffgii if ,iw sinrmfg 3557 -'if 4 5 25223 3: ' Q 2 . Eiggg L' mi? gm, 'Q' ggi? rss:zgsgggm-f2sss:gmQwigxzwgigg2wi02:,wgVSVfw.::gi W-Vlffizzaszww222225:232652522xzSgegh?'gVV,:ggf2,1S?ffQis fff:G1:fmmSiS'fff2ime ww - 5 mai mayQwwigfzggfxgwg,ifsmg:ggVffVw:2,:szmswisiysizsgwQifmrzfggvmfifzfevzclggpiiigze,Q,f,2m22s,wz,P5f,p2'saf,:'22mgififgffisi:3'amzME'?s52,E:1fz gm N mfg walVVs3,mgggglmzeassziggwwfsy,sfifzzsggwQmfsssizsagggggfaizgzfGLglfggzvgsi,-gzs mJZ21'2g1wVelzfigziggmais:f4:,g:ga,5w1g54g:2155g5ag2gg:g,:wQg4w my ,nizzzgfyggm M,.,:,:M gggmvzzfggff -gwwwiirwwv A-y,,f.i,JmV 2542 - H MVVV-f1f,2:z':gP'VmSi :gm Nmzixiff-A wVw,1f2e,'-..-Www? 'WN A h Qui: 2 sw -wwizgwww -,,4,fQgwmV,, 1 uwiwsqw wVf,5V.f,Z,gv:f'h ,V Viyigfywf V .,.:'w6,4 .z,z2sw.w,g.,:U3,awVmoaV,:-w A: Vfseqzxiwfw x We - ,haw :,, ff1wf,1 S'LHw VfV,,'1'mW M 1,Zz.aEjfww V 21Lk,3MQff,Vfa1ff1'11 mix, Q H,r+2:fUfw ,VV+,.::,SWvf.V,. ,Nwyiffxw a,:Aw'u wfify- 1 an Wei zflixgw-w2wi:L'21'1Sw Hgibseizmf 2:21:92fafw33XS5,f:m3V2,12:z::gfgwzLgliwssfzwg Lfgg22Es:qg3w24iiSSx -fm4:g:eq, nm, fgglfjs 'w,m,,,,5g '-wwMQjg,2'Mgzww,4 ,',,-,igifg 2' M h3,5,,p,1mY?', 59a2,',,fg'iQz M A-51 Zbfjwwfxay lwfffwmd Mwwiv MASQ, H atmgqifw' HP-fb 35?-,U H:-hw Mug may V5gg55wm3,,.gHVgxmgw,m,gM51.-3wf.,,sg,,'ggm:1,,:gf:W2 W .ki E: WQMSSZSQ wVsfZG?:':f55fmfizqifgfw Vi' ,Q Wgggwn 32 iw? hw gZig15A2W2fW2'fZ,i.Z5rE Zfwaiiiiiiy f Miwifstsgwfj 'Zigi-,ww l2fs2ZZ+isgsgvJtii 2iwhwigzszgvfmmiifw'U M ffwlggiiywf M2ii:ggZq,2,?:.,t :egg V A gg, Wg.-. ,H:i,1gJwV,i,V, Vifqigfgm M ,znzzggggfzzm Q5fg5w::g,:,--Mm,z,:---4 VVEVSQQMV .zsezgmwii , ggg.w,,, M':Q:fmV,i:,,g:g 63:1 mf, 2:55151 33,wwwgg4wggMJVwS15fz2ag,Hu'fgfbs,SwS g,,:, 9f5eww:mgg,MWWMMHQJZSQEQView wg fwwfig:,2ai masfiiitwwwiazszzfwwgW2SM1m', mfsmf ff Q39'4i?4?5 5Z my . 2gm,VVQQgimgmW,QQmsswwig2,HVSmzzggwVA-Vmsiigwig,ppzszzzzggbiiifimszggQQSMMQQQgg??Sg22,:gqgf,ggV,gwg,:,ES:f,gAf,gSf2:vigg1Vss,, W, MQ, , wwnwmxk,-,awwwmfV gggsmfzw fzgwwmm, P? mm., 4, ,Mwmw V 1 mVvmww,,, M ex ., V, aww. Q., saw- w2,.,,gfw M MW V,0mwWm -Vw Wgmwagg mgmaad we M W M, W ,V2igwm,,,,., www VV sn, Mg BMA: Mm SVS, Q, -vm, W NM my W, wm.,fVm,,,gg,miF,,.,,,,,, ggMMWVm,::gwgVVm,,.V,21g,R wS:W,e2,z,,g Wm,m,,:,:4,3g,3af3PSBg,w-gfswgm SV 8. gMsgW,, ,M :M-mfVQ,m,,,wW my iw? 3:5551,M,S,.fs,,f:5fwVVV,V4W,,,gp1 WwVV,,,,f,Vggywzm., 5,13 M-1M,n,,,,gg.w wQ.Va,spW,gwmmggfv,2,w.Q3.2,f,Lwwww .g'2vg5AfM3,ww gg Q M, l mgwm ' Hgy331iv,,z,g,gvizgggwgzyy ,gzgrpngfglgk IVg,mggggiwfweigVQwig':gg,:AQf'V-V,m,.:WgeVV..m,jZ4gfg,5wx.,iLTfriiiwgrmg ,::,g3yww avg me V, ggwiizv ggzgmzgzfy, g gwfiessgw, , H1336 ww,fzxyfgwsuff1gagwwwV2V:1gg,-fregawaiia wUmssiag:.v,f,,s,Hi25:zgwf fVbtmgg:iVf: . V, . . , , , K h , . , ,mi 44 51.2, :,,fwg1x,qwV1sWf -V 28- WsV.m,:,ziwwa we 1- ,J ,234 , Q ,, A if gg3,.,,,,z,,,,,:gm, ERN,mgmgmgw,m,,g,,gg,,,,,,,, Mg,s,:,,,,wgg2v2:5ggFTW-Vaismwgsa,.,,,sgegfQ-gym ,,,sf,,w2f2a,,a 2 5 , ,, ai L Q ,WN gs ez-ffw,MfQ,- iwiww ,,,,S,,g1b Swow-,5,,, aka Q W: lswwg V wwwwiw w,wM,m,,, z MASQ, Vvkwumwg Qykywsgg, E vwiewy ,,, ,ng , W iw SEE?-??f-iiigwiiiglxiwigigijgfggfwig'-21?g2g3g6Q332EXEgQ:gg2?35f53E2g Hggmfsmggszfszssfzzmwi,Emebfsaismszggifqiiszmzpg 5?gz:vg:2E2,,f'm,, MV A. ,Mfg 33,552sf:ze,Q2gggggzgssszzssfriwgimizS:Pi2S?Qmgs:V:zfi22Vgag P3555,ifgisggggggiffswfswggislzgjrf,figliiggxmiafS22fm:,ziXg2s1sf::2E5?222?zif , ,A - , WM ,M Aag,3y.V,Vi,wM,,1g, gwwg ,555 w ,,m,U.v2Z2 w-Vmfa,:f,,1,,vmVVi::,11z,,g ,izggfwggy Q QVSEQVAU was fiipgkwflf wiizfw Qmilwziziabi Wig:- , ,242 , ,V 5fiLv15 V ., ,iwPyzN2:':f,' jilf w ,vizzg-3 ps: i1Z5f1Mf5z', :Wai Zmfmigfx gay 2gS21i,2S3ixgQ2g ,Tie 5zeswmf?C wsir-H' 'SP 'iyif iwxwgxf . we 2221? ,Hz Hwwzzszi m.HS2,:w si-gm ways Q as QmmzffwawQVSSXQSQQEMQW,?M3.,fngm, 1: mfffiimigzw Vw,mw,f:ag,,, 'Y W x M13 isiiggmww,ssmggES1,V,,,V,jE:gwg3V.,w:gzzge S555 :Swissgig2if2ziE2i,2,:Vzfifwm,VView gains,,:aggggwwe2ss:zggggV, EE. fm A-,NM wfzmigqiwsw,zggmgwszzwas1332252122212,igifiwiziegiwgmg QV5z,fgw-ffwwgiggifzzwgpf,Mg fggwwwm,,,,gEgwgWff,,,,,gwVfM,:2,zsKW11 W1 sy, , f,,fg,g,gsywm?w, 1,12-vef,w,,R' Mgw4W,,2g ff nm aS,,h,,5'g,, S Q N?,igggiQLq4 fs M ZT35g:fggw,4, Higzfqifqgg.mpwg-3agV5l,,,,,si ew! A ' H f f-Ili HW: H22 - f H44 Nirzvik fww wimivfwl ,5 siqzwvwUME'5,,fY,,cqfwL-'fl-M, 'aww-N'VzJ1VlffQm3M:Gib,L'f Vw: z111k H1227 wx2Zgl,?fW'wV if' 5:91, bliiig M g, :fm :wig g,::::wmf23gszxm:1,gwiaimq we wilaz aggfxi w hs'224'1-wS1,,TE?'W'1f2'5i33.13Zi:-7i'NM'Si'i'f53:ZiQP5w Wmwwm 2,2 Wwvwas' VWWV'mS?a'miwwsV',Z Wmwzxxrwimnffff'MN-Pfim?'V3'V . fm . Q 3M..,,,, ws W MW, -:B ,W vfgwW.,, gm wmwm we .MW , gk M V ffm. V WW V , 2 www M ,W .WA X amy EVWNV, gym wisp-gW,m,M,x umwwm New .W ,. sw 2 w4,..w,ws, ,-. 5 ,,,wsHw 'NRSV fwmmw, gm W,VMfaQ 4' W-awww S 1. 5 U mm,. V y WW-N, W W M, ,, DV muh, ,gg . , wg, ff, W gg .D,m,,, X, :mv er Vm-,,g?w1gMV,.,,w ig QE ,Mb 1 4, , , M , gay lv-iw ggsV.:'g::.,w'wavtszsgxg 35 :ki-fifiiixfg ww Kass: 'ag-5225 I xsssfwisl aw, 122,32fztsqhgslsifzzisszegws., f WE M, wi iii? E:2:15122meqvzgmgimfgsmgfg5Vg3x,2gSy-1ggfzgmisgg Q01352,,zssggiggwdimsyeazzqig SiissieafmmimwifVwizzaaiivfigM,f,5:igS3w:V1rg'z:ffE,?2 Q., wil Q wfnfnwrqz iff, iiziwiiii if Ulf fl? if 35,25 if ii zfziiiw 2f21:?imfaiff:ff Wim: 2 Qc: :Wifi VVS HV ' i 11 i ' -' 2,1 LQ, awmifffzx31,6V,s1ii1q,:ggz,,z,,fw52Z,'Z,iS2 'Vsiazgigwfgqz Vwxizzzg,wlgT15ag'wV Wi, ,mgwql ,,,,,,,ggVw,,r,,,,, my mms ww W -z :,gLgmM -L g7w5'.,s,S :ga ,,M,,, -yu 1-mr.3g'U fV,V ,,,:,VwfA wk agsffsw fr - , ag: ZZZI2Sgwsisii5iSS.35iZiWii55i3Zi szagiif' gmsm2Qmbggsfssf11z,:5gai2gSg351wz:z:izgfggigizs,zglaffiifagigggssgagiifzzs:ggi-gif-iifgzasszgziiifgwfifzigiswi msg g31321522222siwzwfggiiigisiiszszfgszzgg SfzissszzeggiwsgssgssQgfgwmfismmwiaswgzygfwlSEBfw,az3QZgf2'VV2is:z:ww5252sifzzzmgifiramffzgsig Va -- , , :,5w2m,,,,, ' V 33234 5,g.Vfi5:ggg,e,g,i,V g,,23gggg5wV -1Q,52g.1g3gg,1M.11,:,gSiggggsyYAf5,:5V1alefizfggcgwwVJz,:,f5gP3g,gjgV,11f5AT'if5gg5MZT:v:gg515,3eVf3i::tZ2Q''Qfgzwiiiijgzi,NWQZE , M M L -,,,,,,gwww.ww,.,,,MW, sw.,,W?u,,,mq W wf-w,g5g,,gw,,,,WgHywyv m,,1:w:wgM, sw gfgVwmym,Y,,g,w my g,W,gz:fHwmm.:,wwf mpg, 4,ww-WMV,,2g5wQhMg,,m,, gswiw,-.zgzfbrv wy5sHw1gfQSQ4-anti Q fwwwzVEXMef.' wgm,,,W N M gagg 2,:w:f,gQQsq,g::7::g,gV2Q2sm,,, ,, W 12?1gsgm,,1,, , V WWMM2M:::.g::,ifggzziigiilira . 13513 wi W 'fb L- Q,wV.,,,,,,, Hffsxwzzsf,gji232QQ3Z',i ' 'M5v1f5?5QSi5Sl35Q!zBR0wg5211:5 Y L ifigliiii Mwsizfiw' f, ,5if2gi'1? f,QfY hmfiisiit- X2ifs32i13SY1::,f,:g,E?,2.?1'gi'3,ff,7i33i112 M A W S ,wh gw,w.,., A, Hggwggey WM, ,U ,M A Y 'ez 5 f2ws,,,,,1,sM VggQgxQ5f,VmhV M:gg,gz,fggfV,,VzU .fg,gg73Wgw,:VH,g,gm:4wfw3?,, zwqwaia, wV,Vzg:z,5 ww 3iV2V1::if2g,fggMfmf55115322414 Kb Qmwwfif'-v 1,3 wi www mwifmfsil V awwwsws-,,V?522m,EggfVa ,,.,mg:g5-ggm,, WMM MQESSQQZQBQ:5g2zgW::::15gge,,g,gm,mfiszfizszfmafssiszefszrmgiiiiia2f:5gf2mV2w:s:,e,g20 Ss1,S21fz2fe?Wi2igW:zz1e ffliirmgaiwgez 11,zf:w3Z5s:zaf5?Q23f V., VV,,,,,,,,,,,1:sifz2Y22:,EgQ ,:,2zm2'zWvA HQ- 'wmfmzaizs T'3gJ?2,?P2i5f5-xiii fzzgfwf vigzisffgf gfgflwzgifw zz, Pzmfiimffvl- s V2 33VshE3g'i viifii 2:55, n1i:Zifffm?b2f24:z ww HMM 2f2w2,5g2wxm.Za1, 15,26 ?Q'sffHwVV, ,, X f A r2s3'fMwV-.VaiSZVEWQQQV Mnizsfw fv1inf'VrV,.:::f.w,SffVf ftfffwmwVQ'flwwvwkiz,1,N-Vf':siSMei?3:2i-,f'',wlSsl:w15 -w2,Vg,,,, gwgqwmr, V, ,gm B, M-f.,,,V5g,.4,W,53,,i VA,,Vu,g,gV'Vgf, .Vm,z1g,ggq', ,1V,wE,gggfg,A .,V,,?4pr4m V 1,w,mw,,5g,,wg'wWS,:fvgfM1 7 4 A x 5,4,Vm3,f4,e',1eV,,55m,,,5,,,,W W-Myffwgiigsxz,,,,5s,zgi42hgi?1s,:-1:sfgigiw2:,V,:,:w1sza:z::,1mg12ZV'Zaf:?fw22 - M MVm::e:,,,ggzVwgg,:: ,1a::wgm,,,,,,,, MWWM2-ffggszzzsfssf,f,:,gfggg:2, Q2 Vfgffgzflg 1: Aff-H-mMmV,g,,PzfQ,g,f4wg,,.,,2wgMW,N, 4 :ww ,Q Mpwgzzh W s 25 Q,B,,x,m,,:gzgifz:-igizglliifsiziiiw izfiigfisiigggf yt Vmmmlsgsggggggggqigg 322225gi2W222255533553gif:Zmgg5ga5affVi25?Z5gwaQgx53552, ,if 2-2 ggssgia may-1e,wgw:,:fff gf 5, :,m,g::---,QU-amzzwf Vmmrf MMVVf..,.V,1,,,w,m1.V,.. fl -, -swirfriz tv'-A amigzay 171 Hs, w wgawiihgh-fqvqmgiiib :game Q,-.2iWFUwz,:2,sf3yVwV gg -Vw gps an wwf s'Zj,M q1gZJ,1U'WQ2Sw A Vf?3g5 YW q5?'1'7 fx , mi, wzigziwziisisgsiieXfmfiizzgiipiifmxai wpgafss 15 k - MV mzmwcmfzf gfmw.-.ifgzfiwwv ?i'MfwwwZ if ff M .W mm, , M mm, AV,,,,,,,,,gfgge Mmm , MW gg P21 ,gggzfzamge2was-Q25QQ2:12,3,Hsfssmiflzzwsgifgiwzmsk M ' fu V 3 fiimzwwif ll f zzsmimsaf 5 wifszzwi 55 5gggwvVgtyggqgwigqkfggjf, VV:,sf?gggggf1V 'pgzsg'-j,5,i :V QV ik gm-ESZZSTV-M iibififif' 1V2BxiZ5vW11,51'1 Lvibfaqfffgi 31 ,z,gggy4,:i.13:g5 wmzsg-' ggwizzggwu ,,,2Y:5Qww.Q V Ax vw Um WZ sy pw sa? S, Sig if rigw Al, 1,4 1-Ffa ,sg 2 V gxiigygwhzVzfmgsgip,,:1:,az:3ggEQwZVi',m:zwgwasfifig :V V? Awffisigzzggfegwei Mfwffbsswfmfzafsswiw -1 gggfmgim wmg -wig,,ggezgzewoiiwifszgzvwi 'fawi 55 ,U Vmmgmhm me ww,f::wwM,,,,,VmgEf ,swf Qs ,iifhwxgsqz ,fwkZ2'3wn mm,i2 wm,sVQ21X:3,1 1-1 wifi? Sf ,,,?gMr1f4fV QM, ,f'Mmm.w V, zqiggigw-YV, Epfifgggwww. ,V - g::gw,,,2gg:3V,.,a,V.eXi:3,g . Limggggw, I .wggwwp ul H iw XZZQZMM wV 'iikggwfwiw'fgkiwwiilf, Www, WEN' lisa? ,SSS-smMibf52'SV2'ff:,,g?wli55,5 egaimi QV A ewiiiffdgy,,gf,22V3z?Efsag5m5125:1:::gVggwafWZr:3wz?E53i1zss gg A N ,gr em-V.,,,,,, gxf-Vwm,g.W ,m5Ze,,,e,yfw,..,M ,A Www w:2f:Hg'wwwZ,sww m:i,'sgv YWQMAEG-fgwi sg :gggapmwi L: wfiiffirz 2: TT f pf -mass, VV if wffgzfizzzi MV ' Vwfwgvf V izzgfnfiitv 42'-fiwzmgf 5 gigffzsggyggfi.11s2:5E,?f22z: -iiiijmzzl, f Q: Vwitsgiggg ,QV - ,J V :s,:5Ms??':?,3: im 9213295551 f Q wr?Am2, ' ii :ff wg?Qwagdwwmsfwwww sizagwmtsm-2 sir V M miwp swansfwfwmmazzsfzwfbSuwwfwwwmiiw ar 35 V, 2,52Uggwm,,,,,5,,gkgg,W:,, geygiyMw?5FfggAfV,.,,Mig Q Wg . 21 H11zgzglgfiiigsigsizzWi?33w? 1',W1'fEi:g?ggi-'553533, ig ' A Lf?gf5'f,g?1f4 vzvwgliiggiigr V' fm? ' -.llezgwp'V.f,:,Lf,W,.QQ,,L,z:ggg-,if 2 L- fmfVV9::,:, t'f,sVQ-aivmlz Mwiwa , WV, 1,,nwggwsggazzzggwsassffiegarl Qfigiwiwfeixssffs , Mig, ,,,,,,,s, wQ,,,,,,4,fswWw,,Vw m,VV.,5:gMwN:, 1 W: ,mgfggfg5Zs:.:xgff 5 V335 mis 2 z my V Vn:'swwVV Vvmlzxwe VV :fHrgw!LH4',NNV.e,, 'e Ly L2lQGiegQz,V: ' ,liifw F g i1::xEf f2:, zziigvmsz giim Y ww MVQVwfzwmwfffiyzwgkwffrszwixfwmswr ,az . V,4,,,g23 wg,,,,,,,MsggQw.VQ,,,.,,,s3W,.,U, ,V,gme-Vikw we-WSE, , ,W ,, qgVV,6.,,,5 HWVVML,,,w1m,,,,,,g,1faM,,,gwwf,4 mfg M, aqfgfzrgzzsepw:VwVsz:,pces i. ,nw 1 fy wireiilaffif V 'fiffiffxzw Vfyezwfaa :,V 7 f-Yu wwzw Xziigzw fvwf, Viiai, V i' :iw fwazwfws: fig,-Vxfsim - 1 V 'Q wwf 12435T's?':WwVzefJMEi-Z ?wf1wsf'0f5?'94 X 4352 Qwgaiiialf X ,fm ,Af,VWmV,,,,V V,Ww,,g2,Q,,Vfw,.4, QM, W, f M, ,gizwawawh QQBQMQ., ggNWQmf:2VwE'ipM VE: 3 22:32 gVV,,:+:,gm:,,-wiisifzsrzf :: ?3vS,V::::fzz:gm13z? WV 5 swag mmw5',g2:.zfgggsV2msigiirgwq2wV,,,f:,ffg:w1iZf'H? ,z ngfgggagwjw3zf,:fq,5iZsbiWfVf,3gg.ZzajgPM g ' wr, gigifw '-WWNJQ-f -iiwzwiimnw ,ff:2wiL1'sV::g S ,sim Xwsisgsxzwwwghfszme vwfezV.az:gwWVmifzwmlfzrkf 5 5 2 i,z1ff,,f l , Z ' ' Qi? Q . wiszgyiizzfi 'I M532 Nmaim Kf:wwi:iVKfgg-wwfE,,:2g, 'QNMPSQW V mv iligizgwgw i1qL:3:WfV 'aifllksww wzmiii , fs, fgm,g,,w ylggzmzgg QV-mglgf .,1gggV,Vv. 7532 EWZSZS'-'sz zfw:a,.zaQ:g V iiiwww fV.?vPfggif14 A w W ,Q A iiglslz Qf 1 f W ww SW-' ,g wsiezzisrff-nwimzgiiiswz ,'iZ?5S'1'9:m Sm?-125 MMM Mgmyfug1j5ag,g5ggffQgsf9w,.VMVmm, MS? 20535?-fsfaZ':,?,zf?gsafi3?Ei2S25az:swQ1Z22ZSfw1?25?S2gU2?5fS'-3246 ,M am,VW.,,,,,,.,55,g4g,g,5w3,wmmf,agQ,,,,,,, fiagkgggwWw55,,258w5w,mztigzzewgvitgiawgwQ?g3w.s iiyzmgvwg-W.. WYwwQiViV322i:f::f:siQwW25i'm::: - :riff 2223225152Ziliiiasziiwsfwff:s?2??S:E422Wfi1EgeS3i gmizig '7gzfigfigfgari:gas-mmm, '-xwm:.ig,,, ,gizgggm V . M Im-N '-mggjzgzf5-V-Liaijmgggim DVVSQW wz3gw?21f fg:g'Vww51L:iV',f,wfW,,, Nw, , Hywnlz' - ., ,, 'z Q Migzaw b' V 'Nikita fizszfdii V,:.,zg,fgy -f-Vwfggizggg A-Mbgzgg ,,, MW, 'A WMV 'W 'Wffgmyh iw. wiw5g4V,1w'i,::m94i14.:,,,V ffiwzgiw , pwilrfv VWVV: q5m.g,,Vw igfgmwmw, 6 Vxfwzaggpgg'-V 1- fL,,2L,igg',YfwV-Vww, , 'wil ,:,ggiw?:E1:,,w5VS1?Smii'Vf 'fiS2':3:Zgg4iVfVV,,Tf2SfzZs??,il Sag, ,,1f-wiiwgmz zfgffwsigzf, --,pgwqwititkrifl,xwV,2,z1w fwflizw , W kfzfzigpmiigLvfggggwmg:f:gg,,,,,,,,,,, 3,555 gwg hfisgggm,VlafggygeeiiqIgwgasjggz, wsslizgfwvl ,NM ,,v:g,y,wF,V,,,L-,,g,m,wMg,.V. g,.wbwV,1,.,,,,,ggg,m,a,,,V,,1 m2M1:p,wVfVV,H,,m, , 'wWw,,,,s-mwm,,mgg,,1 fmgHVm..W mm ffQ,iwiwQ:gg::'ww 'NWKWM-2: gwhfnwmsiw ,My ,g.,.,,g,x-,M-3,,,.,m,.,s,yf55,,.,.N,,,,gwM .W ,,,,,V..,g4,gWf ,,.,,g,ggWf.,5Qgy sy,Ww,.,g,ggxW,, .MW 1 fiwwmgmm ,' wwwm 5 wmfw, W W1 , wgg,,wmmf:gsMv'2 15,3515 Qowimzfgww 92:2 W S g,,,.,,:,,, lg3gigw,,:::f::1gz.szQ5?f.,m,2:,:za,ggggiiizswzwmgmwzhz5,Vgwxsgzgzmgiawsagw,q:gaa?f,m,V:m,,,,M .VM,zwsiiawgQsz:zziziqwiwlimfmmfw H 5355? Eigiffmgiziz2E2255225255:Lf,WVfwsimiwivrziwgiiiiq Fam. X ,w.,,,g,,,,wsg,,5N.,,.,Q,,,,,,,,mgmZ,E,,, ,V5mAw,,5,,4,,,m.MV.f,W,,mu,W,,5,,ggW0,,,,,Eg?g,wpw,,,.,f1gm,,,V,,,sgg,g1w,,,,,W4 V,,,,,,,,,,,,g,wwwmV1,,V,MMgfg H NWN. ,, Ygfwv VzsksggwaasmMp,,,,5s1w.mfz1:eew?m:w,,'wmizlzw-Viz ,BMWQ QA H 5,w3,,,g g4zygz-wmgm,,,W,, ,pf w3.v5Wg,4,,.Mq ,ay--Q N ww-fwqq,.,2'?fww.V'x,4,,,.,f 0 mw,,,,9 ,Pwef.3, ,fffwwm-m,,gQ Lwawufmsa, 'wwewklffwwwzwg um, Sid vMw,,,:,,., , ww: umm Pwxwf ww, GMWW ,,M2Uf3wm,,' wMf,.?W14 m,,m,fg, s,gwmm,,:1g:ggmm.,,gQ,gg5gwmw.3 .ga5?0213f::,g,hg-,fV,,,s:gwqV..,4,2g5Q2W,fV,q.1ggigmgffizfg,fPf,imf.45Sf'2,:::U Vw,,,:g:,w,,,... MwV.Vm4'Sz,.,, 'M3wmV,,.,,,:i,zrVWV-W , ww ww2,?:ww Jwwww V,-,hiwmr w1VsS'?za1 X ,, ' V' fk-zefgqgifsb XQiu:,,5?VV22if -lwiwef, wllmz :1 - fzlflifzisist ,, , N' fMVii:z:ir 71 Mzww 1 ffffrmzsqfg f,f'35f?s:,, w,M1,1v:m miwifzz, -,eigzgiizfwz , ,,::,i,2:m:w, k,424:izzg11 , wlwzzzvl., , ,, 'M,:,::mgwV, :::xfkfg ,1Wfw1V5x.z ',L,Lk3Z:WrWV.1'zftfmgfy Y V ,, ,, ' SemiA2,452SsamzgiwwwmsfzsfzzgffIfwffifzefszgsw 42:25,-:sqwe1ei,liwszizmgsaiiiiezzzifzimwm , ,, 6 f 1 W ri ff, A 'MW1wVlf ',,'5,t-Mimi H , ngipliifw wifliizgzck Viwviiyizzzhl AW'3wS.eiZ43 ,,::i,yih'12V ikvilzyf- .layriszsgg-VV hlimwz M3Va5?fgf,gE,:W-,f,V1d31',::x55, Wiiilgw mf -1-war Vdzlfw emi! ' 'ASW'-wmj, Mg NWMV, ,V V,1g'Nww,p,5,,',3' f'W'b-wiwm J'i1'5f1 E'vf4K WV J -f4,.mfiivW- w2Qf.i,j'Az ,l WvMIV,gL., '-Yvfffwlkmi ' Z, i'fW0vf:Q, l.+Y51HBM G'W 1 Jlsiifwf 'wjflkfliqlfl N,,,'fM35Q'I 5554529 V - f,fmv.,,,Z,p -V1,M.i,gM ,,g-gqw.W,.,,.1,:lgggam,,,.,mVE2,sw-V .VQ.,,,Vm.7x wwmpl,.,.4,,,:ww,VV,,aV ,Qzzgwmq,VVWWEZQQHQQHV aw.-V.w'gm V,:+w.Qa,, V,wfwV.,,.fWsw,.,,g ,,f, :Q 1 5252395 33 :2 .gsmggzw gg, V gmzfqfggfzzzg 1 raw wgiiqgf szzizggwwi V 5ms,:zHg5g:g: wake? :mr 1,: Zs:L2ff2 52123222 ' mi , , ,, f Huvmfiiigg 1 zfgzlaisggiewalv5322122525314ff-Vgisgzzefmg,fz:,:::gggf2f22:a , ,afedVgg,QHVV'f' ff WWM,,,.,gg,,,Q,4k3,Q,5ggg33g'v,f,3gm,35f,frVf, gggigfgg A gfafgggtysf, SSW! .y jzffk 4m,,,.., , M,Q,i.5LL'V7a:fiizgigffw M,,,,,g, , 5 Wm,'s',-,- V,3,,g,-,,f ' :QQ Wmg V mg MwmV32,VmV. ,V,,ma:g:, 'zzswzipsw ,fflaiggkfh IM ' Mmfw-'iw , - wwf: 2113: HS WW ,H 4 Vszgw 1 .aw w,..yW A , fi Sssfikifiiggf 5'?H,1,f Ziiggspsigfggsz 13225 WV,QV,,w,g53.,w,F,,gg3y51 M ,,,,, B00r'nmayeS And R 5 V 01-lches oommates. And roaches. T When t came to Auburn, many decades ago, tt seems, t knew t woutd ' 5453 g v probabty be stuck wtth both. t needed a roommate tor compantonshtp, tor t S those tong, trtendty tatks tar tnto the ntght and tust generatty to have fjy. , , 'iff yy 4. Q someone to share the exctttng cottege expertence wtth. t A A y :A ' A fyfi,I Actuatty, t needed someone to spttt the rent wtth- The roaches were atso tnevttabte. 1 W VL' ' A . y t don't betteve there are any apartments tn Auburn that don't have o ag, tu , A L 1 roaches, because cottege students attract them tttae a dog attracts tteas. I 2 , Bastcatty because, as a rute, students are stobs and teave vtrtuat teasts tor T o . ' the tatatng. ' ., .iw J ' if. r Anyway, tatt quarter started and t moved tn wtth my supposedty tdeat wg A mmate and the roaches. Three weeks tater t W 'ttdeat' he reatty Was. He tNaS atways d the room and teavtng dtrty . chest. tNhen he g And he ' roo tound out ho y throwtng ctothes aroun dtshes under the bed ttor the roa took a shower the bathroom ttooded out. s drtntatng my Dr. Pepperst d htm. Gtutchtng a tentte, t totd otce that he' d better r do tt NOtNt 6 VL,5ki?fri5-M5227 ff, , 1 HN AW' MZ, fmt, wr 'wrwmn rr fs. ' f '19 fb, 1 rm Qi 4Q1iH'114L, f Hwffwfwwfl rr was atway t ttnatty contronte d htm tn my best Peter Lorre v A ctean up the apartment and he'd bette f t-te tust smtted btandty and satd, Sure tNhtte he was cteantng up he potnted out that hatt Y the shtrts on the ttoor were mtne and he tound dutte . a tew dtrty dtshes under my bed, as wett. t hate a smart ateck. Actuatty, my roommate had hts good potnts. He was atways wttttng to tat the bttts sttde unttt t had the T money to pay them, and he'd tatae me to dtnner f somettmes when there was nothtng tn the trtdge and g g t was broke. t-te woutd wash my teans when he H washed hts ctothes and save me trom havtng to do them separatety. t-te coutd ttsten to me grtpe about my ttte and sympathtze. Stttt, tt's more tun to comptatn about my roommate. tt's atways a great toptc ot conversatton ddWd'Q 2 among my trtends, when we ptay Whose Roommate Does the ttltost Btzarre Thtngs'? d!'r N f So, stnce t had resotved my tmmedtate roommate g probtem, tt was ttme to start worktng on the pesky 7 rtftr, ryttp L ,g A creatures who ttve tn the corners. rlhr Y r Ctutchtng a kntte, t totd htm tn my best Peter Lorre XlOtC6 that 't'tG,d better ctean UQ the apartment and he'd better do tt nowt These darttng creatures, whtte they had become such an tnttmate part ot ' had to go. They were eattng us out ot house and home. brttttant tdea ot spraytng the doorway so at teast no torgot that then none coutd teave etther. obtem ot roommates and s been the hardest ' ed to our ttves, tust My roommate had the more roaches woutd move tn. tNe Gompromtse. That's the sotutton to the pr roaches. tt's a hard tesson to tearn. For me, tt's atway part ot adtusttng to cottege ttte. tt was tust a matter ot getttng us every part ot my ttte wtth a stranger and ttvtng tn the mtdst ot a to keep remembertng that these are the best years ot o shartng roach tarm. t have my tttef' 1 by Abby Pettiss and Brad Mooy DELAINA PANKEY 'L .... fy I mfj 655 S 'ls X ,- f.f . ff ,ff , fir - 3 5? ' 1 . as ,QQ N L . g , f,4,,... . :ax r - - I if - ts P' USU R I 'KAR U51 gags wx - 155122 . pwvwww u 1:V,:V.Va.V .VWVNVV VVBQVVQVV 33i'9iX?K2ssrfsg-V VV: sw. V Mimi! V3-tiwffikmg whim:-ga -NV V V .2 ::sQmm?Q:eV V,Z:zfszV:asaga V, V ,V . ,, WVV-V . V , .. , MVV.,V.V,f.Vm g, .4 g:VVaQ:.3iMVwVgz1V-AV, .V.4-Vw ,QV - if V 1 -'299'e5eV1f1gwWwW-WV . VV .. -'mp MG -fgL5wgeM.VV-WV..VK...MW . . V , , .V . VV :gag wif'-'Q VV,imgiVfrfp Vgaszgagaxg :zga mas.:-V. , Mraz:-me .V fNfVV.V2V.gV1ga::ggg.3 qgmgwmggm.4g,iSf..5gi3gf:zi-11' Jg VU yi, fzM.x -VL. V V. .VM Mavis:Vfzggg,gg5ggfggggg53m55Vqmpg.1. ,:..VV. VV. ,gzggg-gigi. Vksssilwxszzi.. gm 1515235 YV'VgeVwV:24wm.VVV2. ,M , V A g ,ww WNV.131-.gggggfgmreg-V VMS-:V'z.g2VV,,VVV ..VVVwmm6V:4iVg5VgsgVg-.-V- 'YZSXJSVV' -:www QV W wg 5 5 mW.g:Vg':.,,,w.i-V V Vfgww: z -VH-Vxww-VV lm V..s.m.':.:11:2svi-1V 2.ww1VVVfV ' wgwssiiif V-wliiziiirfff Vi V-:Www,w4VQQ2VZ-.cgi-32.2243 img . V E VVQQVVWV V.4,m5g,g,,-MV 5Vw?i.sfM,Qy.VVVVQSQVVVVEVVVu,V,,Vz5,m1.,,...- A,gV-VVVQ5 ,VVZVMVV-VV31wygVw5VVV1-V?1VVVVZa?V1??meVf..VViVVm,VViV.VV.V .V ,fctW.2gV: Vi:-fVVVV,V V. .SVSSWVVVEV?imzVV:1Vs.s.QZ..Z.:4:VV 'VV-M-1-is ,W 'fV::?VVVVg:V -VV'aw:zwz6wgMqVmfVm mVVV1V-.- VV V, V W . VNV... ,V,,V.,.,..,,,L 1... V... Mm, V , V .fwVVVV.V,,..,,g,.2...m. V .,,. ,. ,, , . ,,,.,.....,, V, V, VVVVVMVVR.. .VM VV V wi f 1.rm:gm---VVQVVQVVVVQ-VQV-fVV.:::,:3gmw:.- V.V':ww:VV,VVVmVV.WV..f..V2fV14Vif2Z.g2iR2VsJr- fav:-Vz. ,VeVWVVV,-,.w,:2iZiz?P211rV1-VgfggggwV'- if WSVQEQVMQQEzgVVwgVVgfV-VVVVfVm-View-ESM ui ., QV gg,-,L-,xv-QVVVMVV-VV.: gVzm:41r:f:g:2VwVVm ,VV.V.sw,:V gfggggwgg- V VHVVSQV-'V-V VVgVVVVeVe5s'M::--VVVHVMVWW:Vsb1...gg:VVi.f1isQt.V.L . QQQV-7-11.3 ,V VVVVVVVQVV-VVS V,VV3gmwZs.VV2zZ3V 2, V.1T'f-VhzVwVwf--VV V2 wfwf efVVyWV.if:Z4f: Vfqagfsiifrmzw-V1f5'fVi.VV'iPV? Q., V --mffggg V VCVgmVVVgV1.4vV.Vf,gfggggfV.gm,g1- , 1:5':VSi2V21-VLVVQ-:ms::f:gVgVVV2mLVVmVVVV Wizmzz? V, V - VVAVQMQV-VVVgV-VVVZVVVVVVVVVVV:sma::zf.:,,--,V--VVVLVVVVV .:fws:::V1 VQVVVVEVVSVVVwf-2,2-:Ve::VVs,:V:gVf:,s2V Asisw -' V 05112222222V2:2f3wVVzfV?VVVVV2V 2:VV,VV1V:1:fV Veg mgVmQ.Vi:g::szgsaV:.:V zefzzzzzfsgzg -VV-Vwifggie-VVVVVV:sfa::sms ,V ,Vw . Vw?--'VVVVV'VfiY22VW2P'1- ' f-VVV Pw a:VVg.,:2fz:V:.z Yi ' We-sewage. -gVfVggg2V3Vg Va Vf 1z:V:im12wV 1,VVV.3-mwnng, :..i5MWV..,.VVVVVwgi,VWVz.LQQQVZZZZQQELQ-.,VWVVQVVVQV V 1LPtVViv1r:i: .... . V,V.V.M. .. . ,fzmggiggGffgffggzgggfg, V..V:s1..,g.:,-z :yfgggw s5Vz:V5.,.g:.g.?2.V. . gaxlisizi''1?V3Qg35125igEQQWQSQQQQEQQQEQy3VSizVgf?,V.iSg'Zii.,55f,f,g,.Vggg-5351115,'y-gguyjggiayawj , V - - V-VV-HVQWVWNVNV, . V :.'z3::Z?i3s3 -VVVVVQVQV ijfizg-w:VgjgafVg,Vgy. ,wfg,V.Q- V..wiV15VVg.E.gZ:gv,23 3-Vg 'www eww ,V1V,.v.VE.VV.VVg..g,.3g'V:k.,.,?:ETiZ:' .55 ' ' H ff 221155: . lfiflfl- Va:V1?V2Ez::ff2VVZ:Vgim?f2Vtff2m-ffmmfffn V- 5 Vwgflillff 'ffggifiilziif:s:::g2?VE?E2'22l11-.Vzzzzizixfss,fm.flifiiiflfih A ' .Q.1353zf'1 , 1215: 31521222325 'iiwfghilililikaaiiitifzai-:QT V-45753352 U Fgfil-M2NVf'VxfVfiiwiiih5V1'5?iZrx:ff'VVVfVi3Vf1fVV-H511il- V ..5.QVV55 f'--VVVSsgggmz22?2:-sz1s:ggV,g.VVVVg,e.Vszg:VQ::,a::-1:VV, ,,if..Vg:V V :-VVEVVQQQQVfs-Vagmgigggifegifz :VV VmV..VmwV V :.::.g.Vu:z.. :HimJ:f'2-:NVVQ.VVV.VWV.M?m1Zlk5i:2msVeVVVVVV. -.xi.':z2iV- , , V602 VVW'-.ii,:fgnVVf 23 .H emsww Q 5-vw-V ww . . Q .bf.qewMVw . V, V 5 -Vwngwmww. QMVQWVV AP N'-1 rP1wVvV.V1, ,V - N MVQMV... V Y PPP WVWWQHZ W V,1,VVs.V2QXS..s,VV .gV 235252 5 ,--V-V.-.aww ,i VVVMM-VVVVVVmw'iV2wM'sfVVfVVVVv1wwVV.VV.VwVim-KV -- -www... wwg5'2mVV..1V -H VVVQ-mwvvwx.,Vg,gW'M,,gggig- 5- V.,Q4eVwq.wVe , .jgVR'gf,VVVV V- VwwfmvahbQZSSWFGZWYQNEQWVVVMV2f',.1?f?AZVV WV MMNVV, Z 'ZH-,wxwawz Q? ,zz ,s:V,Vf::V:Vs-:VVV..V...i.V sz1VVVVVf..V:V:esr-s:f::,.:VVVV - 1Vif2'W2V VV-' --3fV2iWWV1f -. V VV V V1 ,. VVMV., .V1.112-:f:':sf1f'VgqwVVVVVVwVmVVzzzmm-,1af,V MMV-V1VVV :-Fig::s'Veii-V- V-VJ2e.Vq:VVgmVf was we-a?V,.wVVs:VW.'iiVfE i:1'w, f- , , ,, V V ,.,, V...,,,..,, V ,WV V . V ,a,n ,4L, . W., . ,V F. .V ey QVVQVVVVVVVV VliismzaizzgwiQM?VVWaVLV:.:,5LV:s.s3f:-g:sz.:-VIVV? gf . ' V 2 V ' -Viilgigx 'V V V . . V 2256 Q? VF Lf 222552325 W W 'Y .V mwwsvfimilggH-':,g.gg:,gk3 V-VM V '57ifiiyzzg-VfVpV1bs--eR3VVm Vw,,iV's2wV 5'gVvs--VVQVQMVQZT 'VQVQVVVVVV 1V1L'mf' xzzgiigg - ffgs fm.V2.V15WV , f gp -V VS V -VV V :VV V V -V if '--' WZ?-izfllj32-fwwiwiailiwfil2L'P 'g? ,UV-'w lkiwfV.,g5n'l.1V'f ffm-'NNWT--fVzifiiifiiziliih'WSE ew AV wL'lL W'V if.?l i -was MV V -ffl 25 ,VVQNVJV VVMVw.VVgV.Vi .Vgg:525gVgg,V-wwV-V..,4.s.,1g,-H VVMVW . VV.,,1i.1--VwVVV1VVm.V.f.m..,...z,,V-VWXQVWQWVVVV.VV.V.,:.m.V,VgLi , , VV, fuzz:-2 fmeffgfSVs3VSf2?s:pi':::ga,f-Viigfif 52 LL .izszzzsfvfy OVifiilTf?37f'?VwM?5miA:is 0V1iQ'3.SHQfV?fVVVggVVyVu3!i X Qgiiigiiigz -,Vim 1 fVf.z:,::::- Wi: gV.:w1fV wV.vw.2,VVV. .1 g- -1VVSsZ:'i':3'i2?z::gw,,g-MVV--V22Ef:isV,..,WWfz:V: I-,zgmxigiz 'IQ?.3?f::iig2:mw'MMV wwwil 2, -VV., - V,i.,.V....,. V :w:Vgf,f- V VV Vim: V.1fZe:sf:zz::i?.VsV-VV V V --V. W V:VVV3W.., fmV.VVVVF:1,gV,f:3i:V V - V --VVVVVm.,..... mt .V V125.VVV-:V-VVsw:5VsVi,... VVWV-if 'QQVSVV-wr VV-em' 'f lx --X V A ' -- V ' -,::- 5 Vu-:,gVs.wV2.,,?52f?zZZZ1,V'.'?VwVFf-Vww V V'1-Lili?-1f::r7,:zs2V,,N,,SiV'iEi2W-VV' ,VgVVVVVw24s:---W1V5V- .V2?1ZV3SfVm5V2?-'fwg ,, , MV, I ,mg wxamzwwwpemqgy g VV www-V.. ,Mi :'2:,V,-- f'wVVVwV-ww Vmwih WWVIVVMVHQ-fe-'-V'vHV . .VW Vs--Q V --VQVVVVQVQVVV UP-2 Q -1 VVVVVVV- ., . wVgVwwVVVQm vm.:-2V.V.Vwwwm-V-VV . 2 . ff s- 1VVVVMmyV.,QV.-VQVVVQWVVIMWVVVW' sz.V'VVVffVVV.V...V.5zf':1 V V f...M..1V V-wwf ., VV f:VVV- 5 V V. :f'V.y3-zxzzwg gVVww.L5,:gg5gfam,Vg V 2VaVf1PQ' V' ag VVVVTJQQM.,V.TiC2s:f:mfV.,gVM-V2?'Q?5iz2z1gV wVV1VVVV2'KV-2V.'. .V-gVygV:ff 'f'V:.f-5-iff V .f 'V V V N939 . .,z.?2V' - VV j WV ' QVgV5'VVfP 5L'2i31iZg'3i'2i211i:iigg'5,:3fggigEf5-ZVVSTSSZQZQEQQQMQQV253553353332 T5522?.SZZii52?Gf?T2?2'g3?ZZ1?i2f'fVz?:?f'E:wri,L537-'lifffri Va VV ,wf 'i V gg 5V .V.MMV..a.VVV, VVS f +f2'w'eVVwwmWV:- Na if-VVVVV -VVVm.V.V V. VVVVVW-n.,5 aww VVm..VfzV:V,.Jf- S-.ew Vfffww , g Y - - ,L ww.. z,1V3gggVVg,VVV -gm?-VigtrmifzzwgV25-VVi?5?w2?Z2Q-:Z-zfzslili -V ' V 2-:V Y VA' 'A '-'- VSVJHV1-lim., . iggiiigwffsziefgeiis . J g Vw?:s:a.Vw1f g,aVVg.,g-V inizsz-QV:1:gs.w..1.V --Vim Vf:1Vu.VVVgVg,5V5fVqqVgVVV gm X-'M,,:gggwVzVVw:Qw .:..Vz- .g,XZ56g'l'1- V -w5VZ5flT.Viiiim:w: V ' V ' V5i2V1szsss::V.w:fV-SSVZEVQ5-24.22-'age-VggV.VQVQVZQQVQV1. Via:ie:,N2-VVVVJVVZVQSQ-'QV V V. , V,,,. ,,,, it Vt W, Vmm W.-1.23:-VVfw.g3VwwVV.g,..qvVgQVVVVMVV-..,V .gzw-QM VV 62:54:51--wVV.V.2.waw:Q mwVVfemw.... VVWVVVVVVV. Vs,,m,, V A V- ,, VV VV I .,:,, ,VVWRSSQQW,wigs-55,1-VsgVV,gqgVg2.....,g gggYgVfV,VVV,V.....g,g:V:a-gy V ..wmwq:,,aVV---V.MmwsS:Vz2z'V9VVVVVf2gwmV.. .-Vw-VfVg:VzgVf'f .VWMV -'Ra A f ' 'V mu gtwia-QVVQH'--3V3f Vw-z:L.w'SfSw4V?g-f'awViwmVVt4:tw--fVwwVfwV- ?:vVV,:fWV- A si-WM-VZVVV-VVLBSQMZ VVSSVQV-z22CAVV,1ES.fSV-s7:Vi?i . ww-VN , 53,5 AV.,,g5,,,,g?.,g, fVf5VVg.VW:VVW5VVzi3V:s5W:V ggggme-a1w.g,g.gggQ, W ,3VV:zfafg.., :Vl5'55ZiZS7V' gwgwmfiwiezgzzgfyfgwaw wliiiegzzgfzg V- V ,V V Q- 1- ,ggi -'VV!msS?r::zmVS555QRQVEZMQLmzsmfgzzm-Vai.4:immaV- .-'zszazpgm n2V2:zW2mfiV'1i?V2m:S2 ,V V : .V,:zVgVV5VV:vvmfVVVVVVqz..,,.V,V.V:,..- -5VVVwVV..VVV1.:1.V-QWVVVVmwmgp-V.5fg3,,...zz:1VV-VVVV-VVmV2.V.-.V.vfww-SV-V2 if-VVVVVV2f:?,z-ggwv-V-4 ., A , V . SVsV,g3bgg.gQ-g-ggggggyV.-V..,5,V,.V.. -ffsfsaawaimw 523252 Z, - , - ' N, iifzsi5VVgigVVsg2ggygVmiazgzi-QQZQQQQ:11.553 gg?-VVVV2 5 V4 a'2imuWV-I5222HiVV.W V1izV3:?:fVV1gw -.:'g::.is::-Vi: lVaiZS:1.V.:22:sffieffwfiE Vfiiiiigkwifif fV.iF:wV12i.fe2t V?-VVVZVV-3 ' ' ,, V V V , V V V V -V V:r.V3e3s.9i:H:-2:Vega-zmsiggzV3:1:,z:VgVfVsfVfV -.f,.VmVS.Vt.VcVVwgVfggA,5VxVsjf:im2:V2:gx15gg,:4?VV.VEQVVWVSIV V- VVQVVVW, ww ug 4.:mzmVV-:VM MM VV1,'1:zz, V. Vw ,wa VV,,Qz.:,:W:S1'. f-VVVVWVVVW 1 f-MW- W- VVWVM W iw SERV wmv -' VVcm.,,VVVf:ff-V.- ' SQVQZ2-1223152111-Vg V V--VfsV.,V.Vf'V-ff-.VVVV5VfVVMVVVVVVg:2:ww,V,V53VVV:VVVVMWMV-ZNVVVVQV,VV. -V--:MZZQMVSVVVVVQeMVVfV?iZVv5XVZ'i 592. Vw VV ,,,,vV..... Q V V,,V4.,4,VVVV w,fV,,g- awk, g.V-VVVl..VVVV,V,,V,.,,,. V-VVVmQwM..V.V.VV5Vi.VVtw V2.5-V:-VSQMVZ.-.mvym ,bWwVfQVf'Vf'1fV4 ., .H V,g,,,,- V 1 ff'-VV-Vwf-4wM5VVVVNEV3'5 8.5 Q: M K- -' V ' Zziiwim g45VRV2V22i.:V1gsfVs31,5V2 .-75 -V5VE-VVWVY2VQi921Zi?3Ssf2ifZ1Q2ff2?132m5iVF2z'V--.-1-1:V?ff:'3?2 -iffT?5if25k:fi:-VQVHIHfiwfwmls 1. V , ggggggV5V.VW..V..V. A :fV.sVi::iz.szs af3fgVVVVVVVg3wimizi.2sgS2zj-,r-ggmfVVVVV'1.'m:5::5:,:fe -mf-mga.fgaifggzgwgg V. SQIUWVZVVN 4VMVViVa,a.f:'VwSSixzVV--VMWVVQVV , VVVVVVVVM-V NTuZEm Ej.g1?:'jg.'Vi mV:Q3VVwQ2VL:5V-MVMQVVVVWVVVVVQ-V'mkf-:Vw V V4eVV,V.V-V-WV w .. . Q. ., 1V3Vivtmmzefgmiggimxgef..imwggfgg gzzv f V5f:.VVV25:V.,: . 'VZLVTQZSQZZZSSZZ?S1iggggggvggggzigiiifigwgmixigigggL5-13I',5LfQiQf,'1ig3,. fyVVQQQSVLVEEYQSN21339,4g,gZ?i?23gigQg5ff,,:gZf,3ia52lgmizzisisrzzg -QMVVVMQV5 .. Q, V - k - .zfzgrzgggzzg .VwV.VaWi,VV42:Q:zg,YVV5?:mwV5f:V5ggwVfZwVVfV-2V:izg?.:'55gg:.7VV--V-mga,-',f.:,girwwsgwQ..m-sgg:m7ggwVVd1V-:V V:,5,i,?::Q1g,Vg5 ' ' -V -V --- --, V . Vzmsaggszmz.5VVV223's:zsVsxgz:5ggVgf3,f2w1-:ggigrg:z:g.gVVggVf--' V:-VzxrzglxfwVV-iss::mfafV:fwVVsQWVg5?2'a2i'aV1if2:,fgsffVf:V?3jgVVV - - ' ggg-'JVXZVQQQR-'Q.' V1-5335133 -Vziiiivigzifzgqwg wal? ,.,2g:g,g,Qgm5V:EV251g '-':V7zggVgf3fV1Vf2?32Z.:5QgV3Z2::www -kiwi ,132 VV.Va:i:,,.,,,2:s:ig. V-MVVVVVVD V :fw:V-Vwzfff1525325.33223.cwVVwlsmitisfzxz,,,V:VVzViVVf2ZZ2.fVI , -VMVVQVSEZR-:V-1Vwwsffw-VVsVVVa'?:ZZ?m'a53gi2ggg,PfV , aww ffm..-Vw Vg-VVNQVVW.-V: Vgffvsg-:Vgg-:ww .Vmfg-MQW www.-V.g:gV-Ven,-V1-VVVVVVVV. fvcwfw VVVV.5gegVVMVVVVmW. wig: X .V ZgwsfgwswsfV,V...4sf1ggvVVVVV - ...,Weg..V, VV-.wV2WV53.V-V.V..m,g vvgsggfwarzwxV,.wgWgw...V . V.-V V .VMSBQKVVVQ-WMS?-VVwf Sw , Qkzgg wasggqgggiws.-VgV,,Sii?i31:,,p4.Vm:.M :.izb3,fgVg-1mV5VVVV...'sVfV' Vu., VVfVyf,,VVV:s.V.V'sV-S.V.52ag-gigV,mxswfizz News?-VL Vi.L2mP5:f-MSW? , K N , X Ez:agg2iiigmgVgzg,5,g3.-Q55..am5:3V.z.Vsmsg:g 'VVggwgzsgi,s:1iV:??EE2i-:V5f?5V3s2y:5zEgQg 33355131gV3::VQ:ggz.ggg5,VfV Q:i::VggpgzV:gVV.pimgifziizzz V2WVfV'.fi5VV ., .5521 113-QM, gwVw63dX':,1S,Z,., .3452 6gw4S32l '?:V2Q,243iLhV QVEVb5ZiSS2VViQ.ZLEigflimfsw ZHAFYZVY WV '20i'WWW35 Z5 'if' fV:wJ.VE2Q5sf.ZIZ1C?' hVvi3fiVwf2J5l XX .- .,.,.Vg.+V VVVTVl:Za2:2T1Q:wV Vw.,'wV 1331 31:2 ziwfwlwlwa- gmc--VVV1S22::12:VffV:VV?VVff'Z2E'2V:EV-VVVVVWVVQE mmzmix M Sw ?75fZ?w1Z1,.5V 1-- 5 V, V z X V V V VVVVV V V V V, Q QS x' Y . .V MV' V. ,,gggwggwg2izgfqgg3mE.g:VVgVg.:gg,gag5wgVg53-gV3.gg,.3:53fB1iza. fggi-VwwggwanQiigzmggggsggggwagsiseitsgzfggw-WWC. -VV. fQ.lSiiifgg,5gV?sV - V - V,,.-Sw2!V:1:VW.VQM NK igfggwg VV?iWV:..g,g:2gV1gVV-VV- -V VVVQVJSVQVZ Lg: 1--Vw V-V.,.1Vy:V fm, WMV-VQVVVW SLZWZW'-'V-VVVVSVVVQV V VVVVVV S X V V 3 V W,,,, , V,V.V,V:5m,,Vffwggggw,mr:::,,,,gwfyg,mggsm: Vfwzwf Vw:Vzf,::z::-asfififsiiizlffVVSVVEVV gflmzifs ' Z2'Qy:g:',Vi UA wlfiiligg-il M, ' 14wwsze-'iw,2 EQFW3g3YM3Mq qz.V'i33gf'VgfMvN5 - -V -N. if'iE3QZ21, -V 1m'ZSf3i',231513'2Y32r wwaawiepvwfgfmfhysw QVSNMQ BV f Y VVg2..,VZ..::uV.: VVAVMW. V:,1523:W:wV-Vi:VVV53-2S.?f3f,ggwp1m'wS322,..2vsz3'2:VswVVVV.. zgqgwVVV-fm:aVVV:wfgmV-VVVWVVZB-'WVQW Wf-VVMHV 4 mmfazsaw - .V....V:?VV:z:gV::::,gVV-VKVVVV?wzezsififfgg-:fmVVV:fs:.fV:gzVf-1 ,V-Va-.mx-5sV :V2VsV:V.wavafzgfgxiiizgwiiizm zzmmzgz . fsazgzafzaz-1 4 - V ,132 lgililja - V avg VV ii fi V-VQVVLQVVVV.:az:3.2:g.gagsgg3M:VV1'iVVs V..V32iiV-eww-VV 'V f:2:L5:.::?V4VVVVV2z.:,.H.z':2:tV2--36522431222 V:'?-VV-VVYDVQVVVSWWV .fVV'qswVsV2--V215 Vzfzzsgii 1 554-VV :VV 2252122 V f,,VwV2V- 40 - f V iw ffzffff amifw 2 : VWWSZVQEI ...Vw iiifiillil?-. , g,1g'F2VVVVV 3V6g'V2iW'2weii'ZE 3V'L KW?fiiWWZwN5ff1I22fV1- iazzhiwsilf-12-.ZiSfiSZETig?WV?iVgffQsV-Vw fsVVix 'L1f'VE V . ljcc--ft' V A My V--VVVg5fVVWlV'2waVVV.-V6-sam, 3-s..sa2zW2V252?e22Vfszzmefam V ,QM rug, wggyfi 'Viiusizmegagggg-V:IL-ii-smsf.,.,..,VVeV V . , 'wash nw 62:3 5, gym. -' VV VVMQWLV ymiiqf-V -0gfvf9'gVffvgJ7g 4Zg3w.s?fJZ'3fS,T , Vwgwmw.. V ' ' .3l'3..iVzCV VVHwvivwv,-wwQ5i'rWf'WWf:X-Q VV...Zg3L5Z5ff,'4','V VVVJVQJWVMJ, V 5'5HWWN1V'VV ffwSw Vs 'Mil '.9VL'WVQHPMd'419'NV- 4-'fif' All .V WNV MBV . J A... VV. V..,. Vwwnhfm.VV.?.m,W..V,V..V. ,VVVVVVWVMVV gf .V ,Q-.,f, VW.VVVmV.V,, fa-gwVwVVVV.....W 1 VV V- VV V- V-VVwVsV-VVVV4V.VVVWfg-VK VVW VVwVwVVVVVw-XVVVVVQV WH '--W M-Vwiimfzg M, W -nf-AVVVVXVVVVVVVVVQEQLgzxafgzwzgggz-gg Vw2.2VV3b21.:.z V VVVZV-VW wget- M , V,.g.a:SV2's5..'i1ay - V -,g,..smVVVV ,, , -VVVVV..,.W SV My-'eVV:,gVg1,VgyQV,V , WN. , QQQVVVQQVV ..V..:p,,g,V V vm V-Vmwmagw my g-5,19-.W 0,V.VV.'5i54VgVVzw:Vf' A'K::1?:mVVVV 'V 'WE V5 2:iI1Y'QW'wVV HwVV.jsV.ti2 aw? :V VVVVVYVVVV-VVVWQVV, V-zfzfegmq-,-V .V,VV...,., . , . . 1ZV435225556gaVm5VVsgsEg,::g:ge VwV1sVz:.,V:. P26 Vp V-VVVVVVVQVV 1V.-V::??iVS5V?VVfQVVV2VzasszsfifzewmfV- .VN mfs, V V2:Vg.g. g- VV-VVs..,.M.s.V Vq.VwVW,V..,,W Maeu:....,. V. W., V-V3Rf.VVV.VS..V.V.V.4,V Q . . w:,f.,,g,, ,.W...,. VVV1VVfM.Vf VVLVgvfggVfmmQ V1.VmsMmV.mwb-WVVWWVVV -vS'1i'?M W'--V VVfsw,:V,.fg4igwfVV.V,,.,.:gm,VV,3wpfVw.V., 1251? -:z:--- L ah 'f V V V VV awwwVVVVVMLVVVJQASVQQVMW,.V . W'-VN -V-MV- :.4J:Vz:5wV- Vv.w:mEZV'Sm?V:L4:- VV VVVw:VVVf.V-- . f:VVV:MVVV-- V iziwwf VVVVVVV,.f,f.s3f'-gAV2fVvVwfVwzQ V.Vw.W351?'HifVfc-WwwwVV.VV.3w5WVfV: VVwVSVwsVV,Hf:-,'-ww Vaiimseiiiiwg -1-Q-K, ' 'AVV553?3??V?f-STZZSZQQVEZLWVV1QVWSS:f6:a-.VVV,, , f fxzzwaf'-K::fVi'V2'1ifV?RSQilf1z2iiE51V3?V'S'2f1-' . sV:if2FVVf-Y-iV5::raVz:LEef- f325:wziszmzfgigfQS-f3gggs2g:E.32i:V1wgVVSQESZVISVVV -VVi2z::::V51-:VG 1i2.zsfs:V.-am-.2-::V:iVVi23g :iii ,:..: my ,M M,,m5fg..i.w:,,g,,.m.c,,Vfb-gggww., W Vmw-VVVVVVVV VggQVz.:g.,.:1:,wggV. 3gVs.,i,14gVV :V51Yq5psVfStgsVmggfV m51m2e'V,,, 'fcV:eg.,VfVV1.s.zi3l,,:2? sir,-. M2'VPif2SfV-VVQSQ-.gfw MQQVVTZYVZV. .wg 2? 235225 VVVVVVV.VVzV,mfg.-VVVMZLZVJWQ, , -VVMVQQ.V.:V::Vgfgfgmg2VVV VVVgQ.z:,:f:Q:. .-Vmssfs,-VV VzVV.:35:...:m.2V.VV.iVVVVV'3'5VV.f2'f3:m Nm f5V2zq V.V,,..n,V,4f.VVz:::fms:Vf, V--W., VVVVVVW-w1V2Hi:z2X:zg:V, -VTV253522218211sfzzifwiSiiaiigzszziiisiififiClazmgzegizf 'Vfisfiiziifrizi1-V,VVVwV ,Miz ,mi MZ., .fii,113f.ll- . VVWVVVVW. - V V-'Vgiggrlg-wgs-V,V. .QgVqgg'3gmc'VVVV,VzVqSV,S5.'f2L:':gg5VVVQfM-VVV.iQ,ig,z,:VVVw?sP. Vy.vV?.1Q15f::awVgV-V-- QV---5325? ......E Wig iw., . V, --wfwg-V V wVyVfVV- VV,.VwR,,V,w, VV..sSmV.i.V3-EV'z. VVyVV:VV,.VV.VVV'.-. 4V.5XWf5g'55V-VVVIQZ.2253 57V-VHVQZQRZQM 5EigwhVwwVVzi.29miiSiQ:-V,--www- V gms as 5:51 ' ' fyfiiz-ifiv V1-LV,:e1gVV.e:'53fl'22'i'FSzV2g2g5,.,3.g.g2il-litiggwzszzgff-125521 V ,V E V, ww VV ..,i.Zg...iz,VV 315 Qgwmg.gbimygmglgnfVXVV Q-Laws:-,, .V.V..,Sp:Vfgix,Vf5g ,V..Vm,.z.9z3,y-3556 ,yMV,V.V.1V:zefP5 ,V JSM gm-5 VV- V- :VM6-2,5211-VgVVVVVVVQVf2VzVfVaVzwgggsbgw-VV,V .gpzlgggz-:VV-VVV V-Vva-253954252V2-VV-2V62ff?'V:i ?'ftKz:-VVVVH V A VISA mg iw 2-2 -- V M53 gg,-,V. MV.. V ,Vmrmm-VW.,Vww,gsgfV,,3zg:2'f1-VVVagqigisiz V -VMQVVM. V VVVVVVVVwVwVV...t5,5H0g:MV X, 1 sg .VV aw 2'sKW.'2w:,-Q-VwmV,VWw::-25-WVQMVVV.. :Vi-iiQSQi:VVVf ,.V?2iJ, V me :VV Z 22:23.22 df Y 5- V V . 2. SV QV-V-V-Vff .21-MSMZJIV iffMQW-wi5515222222152VW-M5VVVf1e52L2e2Q2Es:- gg., I ?V ,Vqgi ,. ' 2.m.::.V5z::: Vww12VV-is,sa:.mi:iV::, VVVVSVmV.VaV:g:.:g2:mx:V:?ggQVVVVwiip Sigsi .wwf Usa., amy Views? wvfiAS5ZS'S3W23ZE2i'+VV5ixJZ'SV1SnZLi'., -LLSVTSVEFQV .VgfV?,fgwQ+VVmSiViV'-Swmzii 1' V V mm- Vw.: A-2VV . VV. MVVVVVVV.-.Q s,w,VgMi5fz2fV1w wrVwwV.V:mw1H2wMV V VVVJ:Q?..Ei'.f-V-'VVAVVWNHQV Vim WV , -- V VV - Vis. W.,,-VWVEVVMVVVV.,V..g5mV,fgV'g,V- V--V ,V:..V.W,V.VV.-f :Www 323: sm- mm 5 VMwgwi-wwVw:mwgVgg513V14Zgizwzgf-'M-YW'-kiSTC2?2SffiZ my sgfgy 1' gV.V.4 V ZQVVVVWQMVVVQ:3m2mQQi.fggVVVVMVV W mf ww , , Vfffszigmii5.wwMVVfi-fsVVVVV-VVVVSSZSZWS' VV VVMV ,V , eg- WVVVVVV VVVV . V.. .VM ya wg? V Km , , V QM , 33 33 .V':?V:z2g,?VgVgEg5Mg,gVV-- VVWVVW., ,. VQQEEEQZZVQgg-3VPVQVV5i2?Vg,3'Sf45kW:V:i.Si:,32?2V gm 3132 ' VVVV 1 f eg. g3wV.V..VVV:W:5gsS2SVVisfi-::1:ss,V:zfxs2Vf:5VV-VVQf12J2r-.r E V ' gag fm 2422 xi 1 3 Vu V VV V 11amaze:1111as1252-2mgV31sVV::Vgm::z,Q-V. . VVVVVVVLVVV-Vzfniagisrsvf 2.33.5 ,gwgf Vsazgi -:Q V ,V , iggggwmVM..V.,ig5g2,.V.WVgggzgxwggggyw..Vmsgigggggyf- VVVGSQQWZIVE''fwf-VV-ggV?wgW ma wwf VV - V ' , ,.SVSiITL'Tf'H-w MyzSwmg..VZ'W, ZW-VVVw.w,,1,1Nj'g, gVVV .VVV,,V+,,... gifq 5,54 ww ., ...W ,g x .V du V , ,V V .VM VVV.VVMWmVV.,.?,5ggwVg5q,,Vg3VfVwmpmfg, VMVHVVWWV -.1.,,1g2,wVVVV:fV2 gsm gg-2 Vw: V x . - i V59 VViEi,:5Vw-VV-VwV--1 ' Lf35xaz,i-2.213-fVigVVVQ2?sVV:V2.21Z?33VSWfVV1QwrvfwsVu--Simzfisztigif. VVggViEWgV2i2 gig V 0, Q 3 :xii V252 Y- H' . ' 1-V1 V V sygg- 555: gf--QV V J - Vmmwi.is:,g'z:V:,:WwVVQ--VV 7 7V.i:'f:Vf1fs? VVV2i'iisfe1SVai:ieVVVViVV2VSVV .gm VV. ,gp 1, , p, Mai., MQM,,gu,sV,g,VVV. ,.,.V.W.,V, , . . 5VVggV V VVVVVVVVWVWQ,.V.grggwVvigw ig.: 2:1352 ' wg 'M V WV Viw:1z::2ffVV:iffVfffggEEViii riff- Nm :ffl-f mpg ' ' 'iam ,f5'V1 Vmimilwmfyfgxs- V. .:::g?:f:.Vl-'5 biiiifiwviiii 215:21 ' MVWWVVM V....?:51gg1Vy f Vein.-:,:3?V:f1f V555 fam V M- VV gggmz .Wal V ma r M m.V,.1m,gV,,g,2-MMLQMWVVVVVVVQWMVV- V wg I V Y V ws-V -ff gwzzfmsf-mV-1Vy1?Vi'24a S2zV'?-zfsszzigvagwa-VVV- V.:4w--f . V. .V SAV , ,,g..g,,f V.VVw,....V.g......,,,,,,,,,V.V. ,V Y V 5:9322 Y AWS'-f2-Vf':Vi:-1 ..VVVVfQ2f12wif2f.g 5533 gm if?QsiSv ..,,,.,.,13Mi G , . gags Q3-Q2 :im V34 2.'22:Vzw?2 sm-V V.:V:,Vf2 VW ,gag ggygg VV V V .2223 QV,.,4..,V.,-VV-VVVQVV-VV. Vf,g-,ggVfVwfV- isfrggafVMf2sVQsm3::'Si:.2:Vf 5522: ww Egg.. V mfmz, V VVVIVVMVQQ: .35123331?-Q1?f21VziszmsV,:.V,gf?5 QQ.: 55-553 jzgwg. 1 ww S 2. M... -gLSg,qgiEgjV53f5fugE VV- -55:2 W ig,V,g,, , f1s15Vs..ga::w5VVi 5 EV 23933 555 231 5, , 537-asf M295 33552 Vi--VV 'V sw V22VV2fi.f2:1..ggf1:Vg-Q-gyVVVV V1SV1:.ffi-V 'fVuWZlz'2.t.VVLVVVVMGVF'wVi'y5i12':.sZs5ivWJK1 QM iii 4539: N wzpfg ww. wir. VV1V:3f'S.wV:-ff-'V ':z':z:PVgV. VV f1zf'sz'iV:f1fi.1:fVVVs.f.m,VVi1VV2i.3a52: V112 YL :VM VV :.r:V:2VVmVVfV?VVffV2' . V:VVV1,fV- - p:f:VffVV:V-'V'V1aV:sV2::::mw.VVf 5453 V , .V...a:iz1VVggiVV3V2BVVVV2'- . .::V:1:::?-'V Vcfzeisszerifffh -1' Mk i .QPQQ gjgif L U 'Q M'VMMg7.X?5? 42,327g,vAgjggxlf.-QV-KV.VV- Vjgfgjqg-337555 V- 2: , Sf' WzfV:fV.:V-VVVmVsVt..:2VJ: -VV--Vi. ,pug 7 -V1 viii I-W' ,yggg LV Vw X 'V fwfr-Vw,, wwlmgggfgiwwvwhib Aw ..3'g:Qi'1V-VVVVQVV 353- QM new ww: -gVVwg,gggig-55 V. V1 .g,gggfVggVg4Vg6 VVQVQZWEQ-23413. ,VVVV..VV1V,fSVifi.L-, -iw igsi V 'VWMVVVVVVVVIVVv1m.::Vsz::u ,N , Vffi V53 we g,m,V..VVV. V W-'Vz:V-zasaffwifVV1ws2?2s1rsiV:V3fE31f 'Mfg 28225 PM V5?vaZwVV3mE'iVEziiggfrgggggggzfVVVmQI.S?iEiZ3'i2ii :,w2:PV-5 zijiffiffw -Vi?f5i'3ii'i:1?Z2!gai'3l5 'ii 22522 My fc, V -:fV:VegVVf .VNV V:-VV 1 1 SVQWVVVVVV:svfmsvfszhtipzfVVVVVVVVVVMVVL V-1-VVQMMV 'fim- , .L MV V. . wmwhl V Vw 1awM,Vi'iQ EV45f'.5!Z1 V ..V.iV5n3iZZt'xs -..M VZEE- ig, 5gw:ggg,qgVV.V2hg?m.. ,. , .VWfiylzyzfkg5V2VsVg?eV:,mVV?faziiVgfgVggVggggVVV1VVV:.i::: VV S wg V.V,,, , ,..,S,.,. ,. X-VVw.Vm.,,.V.WmfsV..'!S1S.g25zz-LgwiwzmWt-iz., Vrgw Viffiligsfgze--Vw. g-V. - wif 2 '-WWW' 'VVzV,V'fm.,. V-VVVW - f 'WZIEQQ V ggggg V' Agiixw ,V 353. 55 V .VM V,VVw:-VVVVMVwmwmV1sm?VVWMV-VMVVVVE. VV VV WVV V, wi M014 g www... NZQZSQW -V-fww 1.1 qw., V2 WW?'fvA1-WVWRV ,V.n,Ef'W V, 3,453 favs Mafia ...W V V wg ,V g-gg? xg 2 sf MV 'agVVWa:V:V:a.,..am V iw 5:3235 W U 'wmm M:g:fVVV V . V -V ' 634 :SQ f ATWVMVVV-.,, V2 an ' ' ' wax ,Mig :1+fVwV-ww . V:zg5Q,VV56wV ,, 4 ww '-VA:'i'gViV:f-:VVV Mi. avizizy-z' VV V. W N . 5 M -igggggx msgm I W VVV. V- i'V:22Vmg.g .VVz,V....VVW - V1 :li Qs QE' am ..,, ,,':I'.5f:: 11 5 ,. 3w-V,,V,. , M gi wLZ.,,,ii 2, :fa A gy Zgi,,,,:p54VqVwA,-fwihfiii 12:5 V. , '!5', V V VV w yi QV zziiglwiifl gym WZVTV - V--hw U -V , Qlfil 11 .g.:.gV5.N,- V VV rw -Q -QAVMQ-W u4.V.V,.. WV-VVQVSZMMQVVVQAVQEDSWXMVRVVV,.MFXWMV -V VV-VW.- V ? an V gwwwww V V wvVg.Vgw,4.QW:,:V'V' --V-VVVVMMVVV , , .VV .M 1 22--Msg ffiigw' gzgfw-VV,. wg-Vgz-,V 'Wm-Vwwmizvigggg-VM32236155153'-V:V-NVSVVVVVMVVVV.,.V,,, , if 3'sV?5SiE'siVVw V2 W wma if: Qi5VaZ2fzg,-M411 VV--VV Viiiptifii- V .N..V.,,VfVwf V m i ZVDEWQVZM :M .. V V V252 4 VV mag A , V ?:2L5:3g.,2,,gg . W 5i.r,p?ggkggg,gg5ZV,,, V,.::s::2:i,VV .,,.Vgmzm-LinVig.VE:5,Sgg32iVj5fZwwrgg-V:5fg,,..,, - -f:ffbEEiR:KiNQiEy g,.VV-VV fV,.,:.JV.:-1 VV ,VV gg3,55VVW5MwJV,VV.,gg,5a W.55..W VV. ,M..2 ,,,.,mW5lgg5V,?Vw..VW. ,VM-gm5mV,V..zg,Sgg ggWm,VV..:V2f2:'Vf awgmgx.w.zMVW...,,Mm4 V .Vm.V.,m,,..,3,, wfgfifg zVgg2q:gbVV-V.,m... .. , H- VggsggigVfz,:VVVfgf,3g::V5gQ,5,VVWWVVN... ,gm-VVV,.V 5 Mg f5.,,.ggeg-,VV gZ,VgVfVVfVV,,V, ,,i,,M,V7.wV ,m5,,Efmg,,3 Qgw W1 g,.MVm,e5LW5xf3VVV ,.VV:u.2s,V,g VV- V- V .HV VVw...,..gag:gVg2ge,,EgVVV-VV g.WggVg3,gVgg.g,gVg1VVfVQqmemv.. . 4 .VVV.m,,g.VpwNg JSM. V. V7 1:'5'5Qr:'gVVV,, .V.V,,..VV.,,.. whV.:5:f:SsVVVVfVdV-VVVQVMQ-fri'QS-asf.-12.VV. V. ..V.V,Vy.,iw. em,VVQ5s,g?V.,.gaV,g5gw5QVwV,.gfV1,VVgm.V,mm..,ggzgggihgif4ggVVVV5.y3Vf,5V:a:egzfVgV:VVVVVVVVVVW V2gsmftiww-VsVVVV..a.V2VVwr22VzVVV.5,. ., .,.V.:mV:zeVzfs::zgV,, .mQg..VV. WWV 4,V.,..:::fVVVVVMSSQPQSSZQQVgf.-VQVWVVQQL-sim.zzVWVVVVVVV 5.5.9 gggVVVVVh.3 gQV.wMVgwgWg5,g3g3g:g V,o.VV..1.S'-323:13:YJigsaws?zwB:.,Eg.,,gfgg,g-5-3mW,iVLZ2,5s.2,Z5Ei,zr--L VV,MMVVV.222iii123252222V59sqafilwziizggzsz::EsgSwVgVg4Vz-V, x::Vsz::2PaVgV.-- V.:m5ass:V ,.,.WfVVffVVVVVV'2iZf2i4iV..,VVW22iz':2wVSVVVVf?QVw2,- LVQQQVV f 'EQ2'2mww,VVV4ViZ:fs ixa.,,VaqV3V1V.aim:sgZg V ww QVQSVQSTXQQ V:??QwwEgwm.q2aVVifkzfgggkfwibv-VwnVVV.Vf.:.E'gi2-'ig-V335ViwxgssggiwwzizyzfggfgggwagglSisVVaQ5Xg'if'fV'--VV V-VVsfVw.9VgiVViSVGV.agQPgVgggg,ggP, VwvV1sVnf3fsV2gMZ.:2:gQVVVJVVVSVZVVVV- V.:V-VVg2f:VV-- - V-VmwiiiiitziV'-9-w3gww5V2JSQr't3:S,:'f3V2,:. VVVAVJ-V-VV .VVVzVVV2V3f'X'VL3L'V2f V-VWMVVVQEZWVMWVQVQ P ww ,gg -Vgfvawq ,VW ,MAN V pw my g A-VJ?V..VV,, 'TM ffwz U .w , VV -Q, QV Q W 1-uv ,NX QBQ2'f'fN- Hmww. VMSVVAVEJ 0 VV Wfmiw av:wwM.s.,,.2 Ewvnff W. :Su 1, W. VV- aawmmgm V-4 vw 1-www--w.wmS3 ,uiw LM' WW'H0W'V'-V Q' 3bf'N'- ZV5'3wS?T'Z12' Mwwfi .22 wif 9553 'ww 9.5.mmQ5,fwxwgmp:V9Vf Q., if 3gV1wVswpXmV?iZfg22g,V5gg ww: f,M.,.Ew-2 'V3iJZ.mVVHHMVHVSVVVVVVVVLJWZQBS-Wmiietgifwi-w VV wVfHVwVV.V ig'.:,W2z: ,QWVVV V VVV1g'f5,5fw i1sS?3f'?i:i:?2VfV1 f Vi? H .V::1V:::'2?.:H' A - VV3f2'V5V MH?-Vi? f.fVf:W-W z Wi Sw: MQQQE E SQQVEEQ 523322539 ESM-VzVf,fVVNE53EV..g,mgVfxsgiawifwiiggiiwiiiiil:WiVziz5i2:':,z'VVlV5ii?i2?1VfFVV--1 bi1i2Vsv41V'V Qi-z2:::VVVgwVVVVV5-21 1V.:gV.:v:QV:V vm 1,-:ga V ww w: Wig 0 ,,4wV V ,VV gggmggwg, -gkgfqgrmzfm V.,..VV.gW, fl egg Veg MV,-Q 3.2 V,mgwWVV.VwV,x..V,s,,-11'!tf fVg4,Sf:iQgfVVV:qq qwy 4.2.4. 3-Vgzzwgy wmV5VVwVV- gygggVi-2Vf?0fL1?'5V 'ii'lEZ:2: ,V-VV-VQJVSELLVQ VV VV A-Tflwfzwiw .. Mm iw' 53-12-'Vi fV fV:VVVifhM2i1agf3s?YVfh?ggss?V:gVV 2VsVggV1:z2iz55aagV-:.'-1255?-?V2'2:VV?5 gg-VVywwV:4tmw::.2s'. wvfgggwgxsizzgzg U wimgzzgggggsg-WVgV..Vmmwwlisff VV.gmggqpiisgizitggggzgfgg2 ZQQVQVVLV -,fgggigggV-- VVVVZSVSEV-125' 5Vgifbgwiwiiwlwiigiizffxz-'iz uitzwf-zifffi ,ww LWV,V,,,0r,,V..,..,,V,,WW ,, , .. MVMW, WV V., .,V,-..V,VV..mVVV.V,,VQ VVW..wVV,.,., www V ,V QV V , M ., V V - -VV -w--Vw Www . ,W -www WV V.V.V..Q.,g V VV-,VVVVVVV N VSV. WVW., VV-www-V VQMMVVVVVVVV VVWQVQQV :Q VW 5 an 'V Vfowwpffx VymsvgggVVV-V4V:VVVVM.VgV,,iQgyVm,S,-.p5:s4,2:w kqVqVzu5Zg5QV,i,ggggwgiwW,V..V ..,,yggwVwPV,V V. VzegwvwgwsamVQVZwwgigihs?gzMggvgVVwwM1VVmwiVV.VVm.VV. .- V, ,V-Bmw V VV VffwwmV.VVVm.V,,i22i'2-V-ww-Vwe-VV V Q QVMVV V --VWQVVVV ..NVIYQ-212W-VVV-VWWZVQVS Va- VV.V.,:V:4:,VVVVV WS' www -VVVVW - 011-rbfwl-QVVJV, 1 V 'Www .Q -VV. M w. QV VV 1 V U21 HW'-V-VVVVWVHV ' VVV aww- V VVV..WN,Pa'fVMw.,,.9,V Q fw cw-MVHV 4 Q W, V ,- .VVVV V' f Lfwew. Q-UVVVV .W V G, VVV Vwfm www. ,J V,V::f.- - . 2 V VM? VVVV Vwww Minn UVQQFVW V 3225232233 VV.,wg3.Vg.Vsfz,V:VVVVV-V.VV.V..zazf:VQf VV--VWSVWZ-V:ms-im..w,fs:f.zf:iV55VVQVVVVVVVVMVVW,.zm:gSV:-.V V..VV..V:zVg,::gffVVVV. maz::VVez,,VgqVVVHQQESXSSVVVV...VgVVgzs:,.:..V.,:,-,,V- VVrmgfszzzzlVQVVVZMVMVVV-V V :V:p,?:V:w11f Vm.VVmVVVV-QVV-VVW.V:VfVVV 'VV Vizmsg f:5zgVVygV2VVV1ffm-ggf-,:,:gfVVVVVVVaVVg2..i2332ES2m:f1wmgamc:g:w:,VgfV'2-iVVV:?:mamV:-5:V?PQV-Zig-Visitiizz':szVVgw.VQm..,,,.12.12222V,, L5i75'f f1F : :gf-mga zf1::'Vg:.V-:f:zi:VV?2221::VP'VmVf.fg:2if VVNVVVHW....2:23ggg2gV5VB:3:::.VVggViiVVMs2.V-VtwVVwfVmt1g ,:VV,VV-VgV1QVV3s:'5iL:sv-WGwgVVySfVV.Vz2V1Vf'i252sQ,Lsgf:VVVgmivlw viii -5v::VVVgwwwVzz:-z5mE?VVVVHyVVVVeVV2m'5s525522i12f:V2Vmggw-VV ...V:Vc.V-VV. f:Ug5WfefV'-:VVi.ifgyggswwiVzEfsf:Sf5fQ5'LraQg1-V-VVVVVVw-VV VV:::z':V:-.V Mzmm..GVWWV-VWQVVQQVF 352 -1-QVVV-:mm hs. :aww J' mffu::VVfrwQ:::sVVw- VV-VV' Xtliwisz VQNVVVVVH .V V sV VVS VMV-V1-V'.f.V.'V2:-:2i:fV-- VV.Vmi0,V4:S:.:.w5V am V, VW,f1Viw::.fg., xzzm, VVVVVVVFVVVVV .- -midi' fffi' -VV H- SV' -VV -W .Q mwggg QVMVMVVVV-.V. VV.,VVV..,.w Vw Q QV wg - VV wgmvj. mV:5geVgg,,gmV5m.azgzzgmmmgz 42211315 1ziif.VV?faV11Qfzt 1V:1::2f5.im:'EZ:12fs'::f:ze:Vsz,zsVV V miami - liiixzfifffsfif .:V.VV4ssz:Vg.f.VaVPVffswzszziweiiisssfiigiiglf1:V14marks?Esmfgfszz-:sig.1 rrfwsxw 1: -iVs:f2H:VzwQ-Vfer:-zgrzszsazm, ,. .m1:f J VM wp-V VW, mg,,,V.,VV Vw vgmwqww 4610 W 'www' -V ,V wuz- -V V-VVWVEMV V:V.ywmV,VsVV , :gsmfyamgVmfi:V2awaVg1.wVm.fzfwg V my w.V.w.VV VV ,.g,51f1V,V Vw.wqwwVVVV,V.V,5,,..,.,fg:V. Wm-V. Vw-VfsVV VV VV.w.4QVs.,.:mV-VV!VISVVS-mfww V. VV, :pw 2. QP V. V.sVa.,:-':- V VV V-Bmw ,,,f ,. VVV2..f2WV..V.,,, ,,V.V.VV5V.,,,,i3m,.3,gMmf5,3?fV2??,z,,wV.myW.,VV.,V.VV,, ,V VVWV. . VVVmVVVVmVVf,ym,Vw as wW..,.,p,gfg.,VV W W...V. , V-QV-V .VVMNVM VfV...m5.V.i,.g,V-wV.VVMVV.VVV 4,VVw.V V VVVVNWV... . - Vww.wVfmnwVVVVm. VV -V VW... .W V V VVVwxVsqgwms:53Vwgvw.,6..'2:1V:V3w-VVfgf33-V,VVf,ss:f5gw,'.:V::V-V1fgg.gV1V-V imitizfzsfwg V g4Ye2'm'if:2LV?yfififsi?SS zzzVVMgVV?VVVV!smzV...:QVw::2s- 'V-'aivfwa-f VVVVVQWMVVVVVVgf2VggVfVzHgfVgVw13.-VVLfSi2is V VV.-Vfwgysg ei5:22221-g-5551-'afVVwfeE5.s2!V.1tZiZ-weVV-Vwgiwisgv .V..,V. VQIVMVVVWVV New UMW V, .xgq wi... V e , ...V.,VW,.,,,V MV. V,z3,.VQVV .W WVW, --,VVVVV - M.. Ww,,,.m. ,K g..,V..V,fV V...,.,,..V.,V, ,, VW . ., ,VNV VM... V, . ,Vw M 4 .:.-:g,VaSmVVifVVmVf1VgifmggwgV.:.r.:Vzg3gVw3y V- VVV:VzV V VVVVsVV.msV0.VfQ:gfVwg2gf?.2:s:gVVVV..VVw.V...V. VM.:-f,f,V mmaffVVVV.:VV:f5,,:V-:z1g5,,5VVVV2V,1,wVVV-V.V V VVV-VMS VV .V Vgaimzaf. WVSVVV-VV-V24253-'Vz.gzggV :V.V:fmVsngz-ggVVwV wmfzfzgf-.zggg-g Vgfgv- -Mfiilii., -- V-WMV -wgffVVzV-VfV23x U 1994352293:-FwiizgtzVXVVV-VVVVVVVVQV -V-- V'-:.::'1Qz-':VVfV 1ffizV:f.:zVrV 2312 V 1.:.i5gilV. . 'EV NVMMVVVVV' ZiziwifmVgg25sV3,..me,,5V,gg:Cam'iV,.::g:WVg,J:::gV:, .. , Vmg-VV,. mmfizzsgzweVi2V1J'imL1i:g:z-qw. .VV . V' 1 . 'V VVSVFVV .maxi-,z..?VS:V:Vznaazzz-gE2VrVfff,gVVgVgV5V.s,1szizf::-xi.:,V.VfwVV2VVV :::.::VfV,, gm - V 1271- '--1215522233111fzsfiiiwff-Vi'QV--SHVVVSYV -VW V QV .VV,V.V..,.sVVWV,V3V.,.g.VVfggfgzasgzpa . 6222912225:wVViff.f:m:g:V:,iV,V . :- , . V m,.Vw1V: : 2iz2::2m:?i2 Ej2Si.V2 VV- V U V WwMwa.wVV,1'Q -W V- VV VV::VV,g3VgVVV.V.Vu:a V -VVVVVVVVV, ever mtnd that tt was Tuesday atternoong when t heard the mustc cranked up and saw my roommate standtng tn the doorway wtth a cotd Stroh's, t knew tt had to mean onty one thtng. Boadtrtpt Eddte Beau, my roommate hottered at me and the apartment comptex. Pretendtng to be exasperated at hts tnsptratton, t tossed my 25-tb. backpack through the open wtndow and grabbed at hts brewsky. So, what's our excuse, Eddte-Beau? t downed the beer betore he coutd wrench tt out ot my hand. t knew about Eddte Beau's excuses tor roadtrtps. They had to do wtth surptus women, surptus beer or surptus cash tn the checktng account. Hot 'tantat Now, Attanta ts my tavortte town. When you come trom a thrtvtng metropotts ot Ptne Appte, Ata., you grab any chance to go to the Btg A town. t coutd tgnore a tot ot responstbtttty tmy phystcs test Thursdayt to dance tttt dawn at the Ltmettght and crut-se chtcks at Contettts. Ot course, my gtrttrtend, Leah, wasn't gotng to be too thrttted. Leah took cottege very sertousty and trowned upon roadtrtps that weren't ptanned at teast two weeks tn advance. tt was usetess to exptatn that a roadtrtp ts not a roadtrtp tt tt's ptanned. t've got an tntervtew wtth one ot the Btg Etght accounttng ttrms tomorrow morntngj' Eddte Beau totd me whtte t searched tranttcatty tor a ctean shtrt. Naturatty, we need to teave earty. How does now strtke you'? t shoutd have catted Leah, espectatty stnce we had a study date that ntght, but t chtckened out and tett a note tetttng her there was an emergency tn Attanta. t prayed y s e ,Q she'd understand, but t knew she woutdn't. A ' A t Eddte Beau had a gorgeous sttver btue 280 ZX T EXCWJ-SCS FOX' A SS that went ss mph att the way to Attama. We R dt.?r'ps T R d Not. That You NeedLThernS c A 1 . But. Thegfre Nice To Have. An Auburn Tr-adjtiOn Attanta tor ctvtttzatton I good tood I concerts! sertous S A . , ' shopptngl Wreck Tech! ttytng the trtendty.sktesltntervtews tor itqigeissvxiglffwii xlsagggxsf fhgks 2139 Rm the Beat .3oblLtmettghtlStx Ftagstldrtnktng on top ot they: X danced Wm MS of wud Women XEG eau Peachtreeltxtew Orteans tor Ntardt C3raslSUGAB ' . . . ' BOWLIMcbtte tor the ortgtnat Fat Tuesday and Joe Catn mfxhxgxs vii?rixee2O8ah,ifQ :glide gyfggeifge' Dayltltortda tor Fort Watton Beach! Daytona Beach! , gneim had 3 das, and , ming ed tb to K Ortandoltlbtsney WortdlJacksonvtttelPensacota!Gutt t im Ovgmx ,mere Wag 3 ,Own 03,336 Aubufge Breezemesttnlneed t say more'2,yGatnesvttte tor chomptng Egme gems memew Wem You N when Gator rneatiLake Martin tor tntense sun worshtpctose to me asked mm when he ,armed Q30 fake NS homelTuscatoosa tor sem BAtt!tAlBtrmtngham rot ze: r GPYA he asked mem H hs mu had to me H , aetxttttttttutttt Montgomery mr when thete's no where arse to Wash ,OO Comdem abou, msycmmes for ' golAthens tor extreme rowdtnees tn a town where theyftake Qemng me .ob mek paywmg Ven! Senouswlopewa my ' ' ' What? ESV He was rather depressed so when he passed t A out on the way back, t had a bratnstorm. We had a tank ot gas and two botttes ot tegutta, we woutd go to Ftortdat Okay, so tt was Wednesday atternoon, and yes, t dtd have a phystcs test the next day, and sure Leah woutd be mad, but you're onty young once, rtght'? So, what the heck. We tound a rowdy watertng hote tn Jacksonvttte, and some rowdy women to go wtth tt. Thursday we crutsed down Ftortda's Attanttc coast tooktng tor the pertect beach. We dtd detour over to Gatnesvttte so t coutd use the KA phone tEddte Beau was an Auburn KAB to catt my protessor to tett htm my mother was deathty ttt. Eddte Beau then wanted to keep gotng to the Keys, but t tatked htm tnto stopptng tn some town catted Stuart near West Patm Beach. We tatd out on the beach and turned Auburn orange. Saturday morntng, we both dectded to head tor home. To tett the truth, we were both mtsstng tt a ttttte. We made tt back to the apartment Sunday morntng earty. t started worrytng agatn about Leah. Woutd she ever speak to me agatn? tThat's the troubte wtth road trtps, they have to end. Beattty must be taced and phystcs, too. We atways have to come homet We stept att day, desptte our mtserabte sunburns. Eddte Beau :woke up depressed and started studytng. t dectded that was a good tdea and totned htm. Around mtdntght there came a poundtng on the door. tt was Leah. Ttme to tace the mustc. 204 t was so worrtedt Are you att rtght'? ts Eddte Beau att rtght'? t was so worrtedt She Ftoaamps was crytng and ktsstng and tovtng att over me. Hmmm, maybe comtng home trom a road trtp ts the best part. f by Kyle Pettiss ,,', , 43,5-O E A I ' figs, I LO u-was W Q N s--1'3::N:S Q ss' 3:15555 B Ex I e XN I I Ibn x Ai RN Q 5 1 Wx ,oiiig-.Q ' 5469 -563 . . OL Q, u ' ulbweg Q 60 H NEW URL f A . 'NLS S I 0' 3 ' 43 Q-L , v,' Q os--.s 0. , Q .0 '0,' 0- 'QS Q ' Y U I S n C 1 1 X 'fl want - to be an Auburn tiger N Allotted two, and only two, SGA shakers For your MRS degree Dacquiris, A liberal rag not a Tiger 2m Auburn S CMPOSITE An lUn-?l Typical Auburn's Student That good ole Auburn friendliness Add-a-beads, for that prep look l've got the beat For that Cutsie touch lady's drink game would be complete without an orange cup Photo by Jay Sailors and John Reed STUD E Look At Bodies Shake her . F Button-down for that just- got-out-of-bed freshness Checkbook for producing insufficent funds A year's braggin' rights Auburn spirit That distinctive Auburn jacket Prerequisite orange and blue umbrella, guaranteed to turn inside-out in strong wind Bookin' it with a backpack For the real beer lover Study helpers Photo by John Reed and Jay Sailors Portable bar and cooler A b Student if 529325 f if 07 Z'2li, IiYi?t 3 U 5 . - . W., . . W , s s 1w.a.w.Pfstm sm' Hwang W.,,.f ,ww-. .5-S is .3 Msg.. U s .w,..f -Mw5,'v.., t game 4,.v,w,., V .N ,. ,qfgesi Mag-,,eg3ig,saM,.gzq.sg,1q,g,....3, fy, Q, i t if . ss. . f ,e to iii.: 1 - , P Q 4 an if ww e ,ZEN-1g'hasi .'w 1'2'gui'2 sfgri Yfwvlwl-.ff Envr'32mMf4Z1gwEiir,'wf wflfs-v 'l ' . 'a5N,2.'A Nssf'4'i,,,w. 1Qa Q 2 'fl lurks, 'H Ueifie-if-s yiwg2'S Ye'.5fm25KZzsvl,g sffiiglfiwnvi ,swf-i5flLZ2wiiymv'sz 'Z N N,mggQsmsV7Q.n 'jH,ss2H'5,,i,v1gfw1W' mg'g?yrw5M7fQ.M?2l31 iw 1wwgrgC,,s3jt5s. ,, .N V twig , .sf wmsejw Us D+' 4 we '4 M Mwsgivgg, M V 0 3,s.1NlM:,,y iijM:wwwffgg ?.zs1L.,,,,3feft5,,2w .slwfgiarllfyamsamsmwwqy fagfiv, .11 , if-4 . fwisKiasmau.a:qzazit1't.3.1g::a.wg.s1wg, .gm W ,W 3 .W ,,.. Q my , ,A r,z,.ffgz1.t.,.,,. . 1 yiefzaagwwew, ,gjggww . 2 JT 2 v .73 I. i sgigt mxisai. .i,s5.a.1?, U: f 'Ji73'Qif1'?i45i3Lfi fag Litas, Q riwggzw f f H34 MX thai? wi' wifi if .yarn ' 0' gf. W. i,1i'2fgE,li zsilfsizif. iii sem? frzalfwiiirfu' M3223-'rwisliwvziiil lil ziallgmff 421524 ,1 'vftiiiizf' U Xt lzfifsrqibft ,atwgiivw 1 ,?wj,15i L- MM' i i' t E'wliirfisfwrfkikwxtmimgii i1EviET37fiZil5':sfliigiliyslil tw fi SUlf'5i9E4G'3 uj...v2is.iiZmqy,. Vwimzy ,,fMi1.v -r l ff Mfwmr' gstfggi.-4531, , tgwgwrt, , grit' z.: f , :.wfgg.ffmvwaiiwiwwtewss 1rg,Q,w:',.W-me Saw. -r :'Q..wS. ,fr ,is-fzr --tiimsiiwff Atv-vitifgeaggivzztm lzfalwxi 5321 rswrziw 5 31,2 as 'fwmw ,r .l.ffsw5Q.... msg' sgfmw ,wflav V .M.wff'i sgmsgzsgigrgsapgwiztgsryzmst.. wgaiygi. wgaggwwg-.., Mvgg-rfwigg, awry. va' ggez.i.q1w..Wg ,,.,,wjgi4g,jgZfs my er- gowgstti- W ,, M :a,,z.w1 wmixatgz. 2 .savggza amz H- si 1, fn 'QQ W 'Q 2 msg:'Nww.2s.b .gg,.fp..,22Z.2. sfs,'m5,i.ff' 'i'1wffZt fist.: W3-5 fw?m,:iflagw if 'iii1E.iigw iE4Euf'5'Qn3gjZQQZDg':'13-0 gg. 7 ig5,jS.,ii:2Nmw W W A ' 'N 7 H af if: 1, assi? -.5 ..fi:.51vzZzt:,ae2fZsk.11.1Qiiefitsewuwmlrzerlrsafarw :..Le.um.M...' r.,.wf1iv.'iUs'm.e sm,z,.,., .., . W W AT 2 ' iw Savitiwiiwf ii W ggdiiwqy .lf P A 'fs 'flew .MZ . aug ...f,.2zs,f,..zzl. .. 1335 ,.fMii1M, .rs ...Q 552 siiiiiigif ge 3. ' fiiliaiifii Wi new swim i M. zzzlsiiik? L , 'U F sg W' 1 as . 1-was W Q 7 XM ,li ,fa me 4 me M1 A... eff ?wW'1'U 4 s ww ,N , 1' sw 'tg W alfskxik if 'V j P, ts, Q it Q. .5153 ,sm .5 aiiiaiffzzliw 'J-1 ifizfgt QQ Q, at Www Wai if Z K was via Q M Z av Q M 'Q Jim e M , , sf . 4. .Q 'Sai F A fm ml v swszmfzg .. 'Lg2iE2i2iL4 B132 i,z'2fi?QEa: anew wzl ,M 12? 1 wi sig 2525 1 Q Z 'ta an 5 we N , MM rain f L is was ,Awww sy as 125, sei rf 'fi 1 , bk A 1 1 W Jw rm. 1 if xg, .gy ai 9 t, zimwwm m 4, Wvasw N v at gi? .2 ei 5 Wi L .2 A msgs. 8, .1 what W' M --fr sl ,Mistyifbgxqfgt,Qiyl1m5,,,.-fq'gs..wg,,,.xw .N . as is Elwgitlezfzii M: ,. ls. rwlsgimegt, guizam 2' . M it L ..2,'iz.v, . WN i se Zigviawg 3,5231 gi QQM .iq 4 .,. 1 m Q Aff' wlgxt. Z W sez: 5 wr v are Q , is fa . , N 1 k 6.h.,,,a Q R i 5.382 5 it 1312 Ma sr af lil? . 1 .1313 :E we if VZ W ww is 'ZMM 1:27. 'wigs 2. .ggi fs fc if aw P. ,ai Q rr 3 ,,z2f.z1zz1t 4 rig cl ,www L, iam . .5512 Ti Q if Asggyi 1 '3-53514274f,,.zQg:e1g22in- 353. f Ars,..,. ,,,.i..,vl as may . , ws. 1 f--' 4,33 'bagging as .322 3 1 tw I Q .. M., .. ,ia I -, JiLixttigggggfiiigezsmwftwi,iawlzzmmm wH.Ul:r:.w??:2sww :1 we .W .Wifi 5- A pfziqfqifk- ,zifigig ws2Ef1zz2Mi.wv11 1 :sqft f ws:-:ya 2 1' ' if 1 Zywflsiifwfiiiif stliwtfi S153 W t NW7 his 031 551321 iifwggb,-ti 'i2',i? w 1'-'silt aufzggaamiilffn. -e.. ,, ,..-was 1 it Sfif siiikiii ,em L,'vf,,.zif - ,Ji Q ,fu 4 i':'f Wj,..yifgigzfzilgzi-5,f.zc:255..:iriQwilgizm 1' Q ti S f i tzimrzfiiiy wi' Q M - ff 2-155212314,wif-22gM::f.m'L2iT ,JW if.. ,fi S, L' we - at are ,pgzzf -1wifi1f,1vwzzSe12fgm.yg1:Swat ' 5' fit Q , ' is i v W 2' V ., U ,. 1 -1 f is iwazizw, .if J 5 :XM X aziifls' 'i iiilii L1 Fifffw f' ,,1-253532 Lx, viii in ii' 'tiki ZH 'f,iJ23.wi':Zli i 255532113 135,252 Q 1 er ' Miss ' gs.1faQfw:'.r at .im-mwgiwtif Eeazz?ities:M.fwa1'w5ftwraw V5 it t- ,.,.1W6 fz? Mggfgcqf ,ics , .. . tfzigsiiss it 22557 ' Q, 7 J . Wi I 'mf we . wVQ51,Lg:15gzLg w54js.:g5:.:' ,fbi M- ,Q jga ,lx U . 4 Y , gg ,QW , v,,,p.l ,,,g::5.sw322 'rr i f'fi ffezzlifii 1 Lf' A ' iff fi 1. N W 4 L'a2fW:Sififs:i: Jaznsifigr fl 13 1 H ir B E 'lfi1i7'i1f?355L?7'izzlzfi 21, ,, lil-1 w . t tif 4 filiigiigi22Zi'W55i?2 w53E 'oi as Mr rv gy? 1Qfg,.ZwMf?.,Wf.g:L-3. nt.-3, ilfzgviftn A an Q33522.iigs-zjiijfgaigjszwas ti l A ' jf, vi, ,gsigii J it W tiiiwm :.?Qim2f.v4'gEz13Ezf14 M 22gz1'lg2Efii' wwwwsz - ' B211l::2A1wz2'?s:,'.1'l as iw: ,izlqzifiic it7-fsiilzsiifisiffazifeggiawxe.,gixwi Qfiwgm, itwazlxfggaamgzsig rf-gas: , 'i ' Her Er' Z W -f me A- , amzgwgiww 511. if wgwftii QW sgqwzftgrgglmzilv, . A N A f P 9 . f- .1115 wifi? giwizgiiaiig sb in it ' V A Pr my ifiiisileiv 1212 M it iv . 4,gm,-f,z1ztulgzfass,gu:.gf,g:::w:,s,,--,. itiwf , t za. , atemgfzizzi. f::m.mt,',,i1,..ft.l,z.a....gg,,..ms :sais 1e,.Waswm.Sr.g.,iiwgzasggz .gg i..ts.q,Wf .,grzwarwi3fs2.2.ma Imlwizgm wmtwmlmuzwmiifft Wim I :il .. wi' Wirzzirwa vjiwrfall '1,mzgg.:1322f stsigishliiiwfigr'awggz2l?xtm3 . , iwzieif Meme-,afar -1:'imiiwgitislbl:21W3'tiL'1Xi2MiawJa.wrt wiiifwwiwi .sw irl . - , iw xr g f wrzswwf - 1.. W:sw,i.Ww Mszskwgs,..ws.w'g.,Mg,g,. wafers vw. tis M.. D ,hQ,..W,j -:Military,,f,z1sfsKgr:',A gizvgzuffv.-1 ifrgii agsz...ifgsz..z gjsggggtm. ,tgps emi U s - W . ,gun ,zg1sZif,gs,5 fig::gf,tgg,,:iQ,.'ilnsiiigr-f-. s fl 1 gikiyqQ1e?2Zg.a's2fgig22Ei z3f,afl.f1l.,.eassawflMifWQ . 53 22' , if A , :hal l 1 ' 'fwxawgiffrmt-f:l1 'i 5iS2irta'.S2w5'ZWmi -wait gi i miaiwitr f'Hi,:4 , , 211' 1 ,rf 121125.i17'ftwassigxgjiigzeifiligaffgizatimeigemE szmma25SE.:'tzizi2f 51. get f we .,.s-gi.. Wx W, .Wu-3,a14g,fsafag.,,Q M, Wwg4:,,,,w5wa www 2 mgygw ,sghgwrgiigl aw gap j v . ve . .M 2 , 2 lj. .2 ,i W , ,A gig. ,of My-img. 1 PM ,1g1,,qg5,qE1g'j,,. ti? 'H jr mgvrtgiii It if V 9, 3 g- 'kzgtzzit' N 1 W W. . t , U . . , ...wma 1- . 1 it it W S G wzsmv pawiieiztw Iffiwgitfaif-gal fkewerfmwi ,W ..'iff.i .. Willie A55-B'sf'wxsQr.Z15327-5225Q lil? 1 3355? 'Hifi N-,ijlffszziwqvffginfegfifaigsasvijztlzeiili .lfijsggixw Q32'i?7153QLWZ'ZQi5f SfsQg. uf-.swt wtf K 932.1551 ffzfafiiessif sr13223205lsfmltzzialzstiif wlzgl- 5 ,ig i:.fw-Q-ww-f4x2'sWi'?fi ' ffilwwib Um'-Us 0 1-1' Ellttivi 6530 at witii? 502' ee ebllifiiv Qlysw is f vWi tW:ag.siw'i.w eggww. fyaafigmi...,gg,,.3gt,iv1Tfz5fw.ssmfim...gee,mf6'E,,.wgy qwwsbfgisi NW. -..aj lvffiwwsm imfsysz fmzamw wzxaatmbm -gm., ji , Mm? ag. 3 2 My . . .fgww .fzzyfzij iiwisv is .isa 1... va E :W Wsrfrfwg'sggwwytsowwghislgszvs 'ATQQLITV i ' Wqziw N. - ' ffgfisaiziimq, fmqifixz. gwwg:L.,r, ,I sszilvglggasmvgiigzsssagggmgw tzgb. yt r W3 . ftlssgzzw pqiifygsil 4122133 P f.feu'..1.a4zfzt,,i's, az?65:kjsE1,v2Sbzz1.L12wy3Fifg , .V -r ei 'iWW'WrMi Efsiiimif ,li1'imr2iil1EL3z'i'2::L1?g ai1qaiS'i-tit-fflwitlili'will f ,iSL2i,Qgi2?Eqr Gisiiiii 'E v is 'rVWt5jffW -wages. ..wff,gt5'W iygtwgmlg 11125 2 'lf ' ewgprgfvtzzzi ,,,.t3smw,, S ,ati ., . Q.. wizmsr r .A 1 wi. ., .lr .11 ..a1Fg:2,,,:..i',..:ff..21 .-v:....ir.,:r s . 4 'K L if 3 2 4 'Q Z.fwzla E,miz,1i,1issws1 .,sZwgmlN1zQw wc 7 , gQy,,s..gyg ,..w,mlwf,'N QW1mewgwgsi.,,wgzi,f:g,,svg. bg... , Lffwkifiiivzaii' r '.z+-rfeataffzltfvasim s.wgtlflfifzziwgwezzzz-rmtwsssv, -,,.,.wggi.v ,.,:,M,.,3i7,.5 ,viz ,Q M35 at . ififi .iitiiilie 'A eziifase,iafzfwxzariizii as x f zigglfgii M .fm .V .Mme i if i 1 S V ,, 3.s.2gr'Hzss . 3 .W , my WM Mjiggsligg Z3 v K '75 W Q V Wei 1 .ii W r .N .W l 7 wkiirrfifkiekif fwigfgij. W as., s. M2 0'i'Xw21E3iVi i W ,mm as? jk gg.2gbza22fa:mi211:f2,qig5sss:zz2' -J . ' -A 152 5.r1ggf,:fc.:j ' ' tram' K r - if N . ,4Hsgsimgf1112322xY'n'akiiiizaknfazwlszizsiizU . - www H, sfifsrmii as wma. wt it ,rm Witt? , j . ,M ijimtiftkjZ,5?ggQ,ggWi.LIV ,, ' ii U ia zfiiiiflia r. gt , gil fzlvwfip H ' U , .K-:llwfst - 'i?1?iiSki.vs.ff .Q .Nags A gs.. ji , . t, LL,, . af... .1 HW.. ,. w,fmt3?giis5.r .zywggg ragga .,,,..h5-.wxw,.33,,,.,j3,g bww, .am ja :.,.1zf:ijl3:iii tn., .sive ,lml-i,,,..QMf JENNlFEFl JOHNS , . .. W, , . Q , iIWSW22252315:wt37+2iS1E2S2iM.5:21? .uigfzsigzv-vt. L. 'iifziifliwfiifffliziiiisiiiizeziilisiiitfifgmi,, Qfttfgzz , . U,g1i2g,f,5i35gfg:fgfhfggbfgiiiwliitiligggitlig .Mvmsaxmvs 53v.m...as2:z:..w.s1.,.,,i:w,1.s,efa:.aae1l,w-:.1..if.mwwn.r.a't.,si.sv1i..-..ffxc:tQ1.fa.mts..fllz.,.0ve.f.,,m1M v ...vm -sms Y 1 ...L A .,ss.g..r.,,..afQ.Mf...,mVQ..,w1LMm.M.m..cMm,w.Mv.w-sa.w,,.i.vf.a...ml,.c..sw,sb:M...a, 4, wiziwvii .A rites ,Q mm rims. is 1 .sweat 'igggigxqziwtxfgitftzgair ,.M-,wr . ,Wy ,s1,1m.-,,u....-Wax QTE?5E5?37f3 ,... . fgif-as Mitzi . w E 5 sw W' tiiiftii i ' L it .. a H. tw5A,pQ'Wv,v4 s A 'Wilder gif1'35!ffe ipbH1iZiw ?2iwg? zr2v:ffaz,,,..f vw pSfXefs.ro.1- .w ww wfif was ww fmzftmi tafsieezsiff li Q 4 3?13W?'iE'2i lilfifii' 352 iii 33135 7 V V 135222215 .ta asian? gina. V W msg. .:f.ggsmif.z aww v Q :'i,sfW1.va Q ziafwiiiz as P5224-1 V s . .Rs iiisw' i . 41 swiss'-12 't'M,:a':f1l.p2ii4YfeSWz'.s2i Qziiibtltv 1 122122K1fgiz2fQ.F2s:zj,g,:21ln , as . lui my :.jgm.wsz:.ya M ga. smisfzm its ' 1+sqa1g,E'iazi2.'2g: 33... Q ill - r ixmqth itwgi mfgwiif as-fl? LT 53553 53!2 V5'lE3 7 Ei W l . f u l Nt :SY:JwasSHA::.21i5fim2iisift3tx:1f': X ,.-its azfiveaewfffzwwma? if A Q vi 1222232533 32: fai , . A ,ai taawtgtistggssigpzzyrsyzgssrgzafm , wt 'm.m.., ws 1 .,'wst.,, 21i'1ia::M,tg2?Eie:r2 4 . , .sf-ll, ,. .,,..51p.,f.w:g.ff . csc.. ...W 12:12 wma.. wa 1 N asv H10 mwgilist Q M J, izwhiwast .4 2354? - fx ff ii r,g'.:f5,2s.:1p,s.v.r3j Q. li 2 sl Tbtjli 'r ' i 3 r J lawsuit? gg .L 7133 22? cw fesfw www 4'-2 Qkatieiiz' fl 2 aa . r 1 :Law lisa S Q f , ,AB if .Ei , ys.ffV.gave'f1wkrJ,l. we 'Q - Mg3MWa5MgZ,.'t.,..t...l, .ewggiegitiiflkiseswebw-itrr' .ue gag m?ge:a'gm: .1 52110 . was it:iiQ:t2rf5jzazatE,...ji,i Tiffsfiiiizz Weak? W1 iz,tim2'sflKw 1 .2 Q. Q T?2:Si?:3t fi 141221535 MQW WwH.,t f,1:w1:wa-. ri ' rlfvizfkwhmwvv - 'ww M . Mwrawwt,,.gi,.wz....4f'f Jaw A X 5 TY , kiwi , W. wfzsv- ,.fg5.4wgt'm Q21 . .,,i'gt-egg Ei2w1,zi.swf YS P asgfiisamaf 1251E3'fix.1mr,i:a2Ezg3ig Niki 1.1522 f 3216 gbffgalggghr, Muzi, Xfgfviilt as rwmg ss 1 Q3 iss? 5. . . 2,151 A if mai , . ii mais f fi 2'HirlQiwg:,1Mmzwgzwz- 215,155 f U wiggzxw gg, eg gli ja fiiitii .ww ,.1:,fz:mgs'.., .lzgzzyst . rites? miiwfealzmzfl ww W - r new A Q , gut. Nj! b girl cm QM,sE?fifj.g5,gQw'99ii X s sr M12 sigiksi w 'S ' X ge... 2:21157 :WTF ti 9 iff,,l,t,...r ,Mi We 4 J A was ,- :g,w,5,.- g..f,g-jg f 31 1 2 prev s, abil 32215 V, . V i :V giifvfi if i 2' tl .. . is .. fW.it.W,m1 vi ,,Wg,,.,Wg i.3s2wmf sy-,QW .Qu A sa if? S 51, is . .egiw2:i ...k,...sw Q lwwfgziie t3i5,gff2.jei,' l we amz., X we W W ,. 'iiiiwzm ' '15mQ:,rti'1E1v. lgswii.. - is 2 4 - 1 Y V :.,f,E'ifjQ2 - rzviwliw tw?:ea'1Eawi: iii 4 . l wwzwzlw ..:,:-.wizwtan .fr.sag,,m1.g.',,,twi,am meats fi lr ,mfsf0s...- - Q 55w1wf,,.f-U' -l'1LEwawwi.e,22. K, 'iwelzpvw eawzjiywr , 'NLR Q , 1 ., Q Ak.. ,si stwmfii. Hiatt. x V i AZ my . fuss ,G if r L. i gxthrttswz at :emi ' :J f 1 F i iilif r ....,,, Rah-Rah By Abby Pettiss There's a bizarre mystique that surrounds the Auburn cheerleaders. A massive majority of Auburn students seem to consider them as not quite real, deserving a ranking somewhere among the gods, when they're only just students trying to have a little fun in their years at Auburn. Overheard at the CDV Kitchen: coed ordering cookies for roommate depressed over the football team's recent loss to Nebraska, Clerk: Your roommate's a cheerleader?! l didn't know cheerleaders had roommates! Coed: Well where did you think they lived? Clerk: On a cloud? Obviously, some people are confused. Cheerleaders are really mortal beings who leave the top oft the toothpaste just like anyone else. They have to go to class and major in something other than rah-rah. Michael Horne, a computer engineering major from Alexander City, is an example of that. Last spring, right after try-outs, we had practice three times a day to get ready tor A-Day, he said. We had to go to class too, but sometimes it was secondary to cheering and that's hard on the GPA. Since he now has a serious girlfriend, MichaeI's trying to resist any advantage that's thrown his way and reform his devil- may-care ways. l can still have tun, though, he added, and according to his fellow cheerleaders, Michael still does. - Wrvvaslaff wr. Wigsssiuag-f .eww 1.215147-q.ifa.-.airags ,LG xii. .. 'K .frgmr 'i.f'ff1a3'12H2i1l ffwftfaliiirzeik fl wfftzimz S lizifi' f wi,zx22ff,zeg.lEia.as1'Qkr2.Qszjgmh1 as msgs DHA lzffltiibb-ag... ggwfezsf - t'rr1iw.Rf.L' . -riiltzr Wwziiw razxiwemis gzwifwiiftiwvigmfzf''wi we gin- :wr 1. iris r' Swami? 134-ffsriit 1, ffzaiiti . M .NES ii,iwi3Qa8i'iii'i I til' 'il r' -, 'L i2EwiqquZl.i' a'sZi?,.,tQlgzrlzaigzrtggfrttf3 ,Qt1l1l..ii , g., 'wiaswi-,,g122yfZqztiags is ' - i g5i.t2Et3zzr1g:ag5eEqS1 .0 uzifgmii ,L , . , , 1 ,. 'wixziif.1i'.1:iiff2?1Q.fLf.xiii:QSe,mzfw2,z:f2Z,..:x22,are ffet1..7ff rffwrwfw iglzvm ' ,,:15,Q1' lflaigeziw is 'K fiffffgiiyii f IM 7-,iw Mfg..,,s ':,..'w,,.w Wzwzix, 4, fl? if Pit: K K K Q if 1 'f Qiwzia-trail ' 1 fi rm A 1 2 I 2 if Siamfi:i3+g11,3izw,f,.li: r i' V A I M l l l , l l , , Joan agen ,sa 'iygi' ' .. is g,v1.:v5gl.w,-. i ' ' 'Tr:aia?f:l,if sawkgwgwsssess 44,,44 aaa ,K -w-fm lxfl Q fsggctffns it A., to ,Q Y My ,, M ,V ww it as it 2,2 ,mia gfZZ.6ss.4E'52f g?t1A?'32wfgPSggag,gts .f mgwgvygi y .2s'rV'6g1gni'6 it sgsww it 1 5 rr' hfsvtstgg sggvgg'r ff6'wm'4 gift rem ' Ng' .t:. - 1 , twswjfs 7, if rw wg W was , ,ww ,af r we M png mr 4, A W W ,mg V' ..,. cw fa ff f4a4gg3ggzf+3esa'vr ss4s4.sEts:4 is rsatasliiag Magma,-it-1.,,gg2ggg3,,? 5s5gg ggssisa.s.f,gazta43,as2st:,.1wemgz4s,sggfs:aaaeiaaza23r,r assi, Sisaket, if as fat: .su gg ,gg 1:i.:':1:sa,, rgsftibr 'wxwaf,ta2Magssgsaimiifaazaatrttaaertsasrrrarwanzat afszaifirttastlfdar NW'b?'. W6f Wsviff'rswSffrtt'fr6i1'W6t2.5Vif isriigais Mfiigifass Wes? etwsz2se4iM iafrsrwlfw-flfyafaxwiti an I 12 Wests swamps: eff-fr fisheseyrffzzlstzs..-get r'WritesiitwsfftiizQwfmafsksizazy mayifttstawssgiatastsi4iWsiw6tsf:fw sassy 4Mmraz61.s??wsgfr:f rgfwittkie 2225 sszWttisgQ39Hgr5Es55,64W 2525325 ssmwi W Qgzttsiisfmwvstfrttgs aae'5fwaKf'fr?6'fts wawww W Sitiwiiiif tt5ti?r'ttrfs2?6?ttftrfatt 61:zf2aar?2itw4i1r' W at at ye rrwssgasgis gggirrtix atrwiiiswarsisssvisf twins- aifwtwtt 6 W i , Ms 4, Q4 f :H wtf' ,mg 5 .www Wham ,rinse 5 , tsryga wg-asf, i Q, 4 ., ,gt sf M if 2133, wr, is gg My M M ,fag 4,- Qty sg 3, Q . er , la w s? 5.4.5 N .s ,..:. ,. A ,gg,,,ygMsgg,,, M iff sttwfisiitffrw fists: Sfsffrfsigfii Q 'ef ,Q 62 3 X S awww eg? Q:-3.3. 1 sgffs Vis if fgffi.fiytwghgsqiE,g272E:tW:,3Eg:5ZZf35?s gt 35235 SS Wg we hwyfgt Qing gqgyibtzgfgvgti. S :gif 'H wig A ai M5355 if gf. ., www.. 'iw 4 wwfass Bama, tQ'a sfy?Eg?i?Egs2Tgt2?rstwis5at KtiE1t37gg4?Q2QfssiE5szvR f ti 2 Q age Q Q 5 as New .4p. 4 alike gong, rf rs Ms, 14 1.-wif .W its 4 it if rttfsrtafia ff WYEN6 assert? zzftstmfwwsaizr tri rf :4 at 2 15 E?w2?21S??iifZrw6rzKZtziiagkifti 123131,15:5532Qwaitgagaggggzgrismftisiizgsssgiigeggfsiii egg ,S 292 3 6' Party For The Retirement Of Bear Bryant By Darryl Moland What if there was a seemingly endless list of candidates and you were between classes and you didn't recognize but a few of the names and you were supposed to vote for thirteen of them? The answer seems obvious, doesn't it? The brainchild behind the name People for the Retirement of Bear Bryant was the meeting of two ambitious and creative minds. These two minds were juniors Ken Guin, from Carbon Hill, Ala., and Greg Bull Schmidt, from Fort Lauderdale, Fla. At first, the two came up with the Vote for Me party, fairly good, but not quite what they had in mind. The idea that stuck was successful in a big way. Not only by winning the election, but by leading in votes, Greg with a little more than 1,000 and Ken, second with about 850. After deciding on the party's name, to avoid libel, they thought it might be smart to let Bear in on their scheme. Ken called with a little subtle persuasion they convinced her. When the winningest coach in history found out about it, he agreed to have his picture made with both of them for their campaign posters. But the elections by then were too close to coordinate a time and place. Instead, Ken and Greg went with the typical profile - a houndstooth cap picture of Bear. The posters were hard to keep posted because Auburnites were snatching them up for souvenirs. When the elections were over and Bear heard the news that they had both won, he had an article published in Alabama's recruiting manual entitled, How to Win an Auburn Election, - Editor's Note: This story was submitted on the Glomerata 's first deadline in early Novemben before Paul Bear Bryant's retirement and untimely death. I decided to ew sa M W .4 was was: X v viii! i4,.f 4 34 '02 ,4, Q M 5352 32? 59,53 iii it . at ' g Sie it i is if i it ti 4 af E 4 St tl it Z ri gg ,gif Vg . , ,X , r AM44 My 4-as Q 4 ,sm 4 .awww ss W-4 55 .s .tag vases -A Wm gain wars was .tr Wamwtzttm News rm swims? 3625512 ::6w34kww 4 if Q 1 'iifff?WRi'5?W9 'W atv 7 tseztr W HW it 4 is r lf ' '4 Wana iwwgrswfa ..4wM 4s ts. ,st 2, .i,,4a4,,, ,,..,a4,w, ....i4s444t,m..,4-was ,,1f.,44.Wast,.44,4..,i41 .4m4i,-:rgggf stZy.a4swf-fret Q ,vistas Q :ten-t an Q s2s.f3sa'Si4 mam NM, 4, ,Warsl sy,,g,,4t4.w s,.4Vsg4. 4Z,.WY4-sm.,Usm4f..s.4,4,,swsgggtss if was wg .tsawfggl ,4 may ,,,,s,Mwggw,,g,5, N 335,.wgg,5,,gxittsAy,t,.,,,ri, ,Ss 4 ,gg-:sr .EQ,g,.44Mt. w,iN43? t t xt .gg H. .A g,a5,,2,.amgg,y,s,zst24.rmr 1 iw 'SQ-fr tw 32 eww. sf, .,,,fws1i?56ffts4 W '5 6 ww 15954 stag Eggs.4sagem3,Qgg,,5?i5,,5ggggggs?35,EQ ig?w5qs,E1q,iEs2S2Eas,t.Zag-tivggg 2. 5s,g4 27 fide Haisffgg if was age .was S f rmgttfgsat 5226ffS?2m 01323552 ?6f':Z25iwir?4Jf 121 ssvifiifwft 3.,25g'px44sszwwfNgir 'tame it 4 f Wt? Q4 eff Q- X fits Ev' t6 izrgtfgg gjljsgisszzzttt Q, Stggfjgiisity .1 5-5 W saga wggsggtiewmiAUvve'fs3.qrSEggvg?gg'QQg.iss52g2g0? E15Sagtvsgawwggggshaaagsgggigeiwgv'4276g32gEstx xgizfgg?59gf,ZE+,jf Hggtfrzrteitsismr .Sigma sfpyfm Ea A kg wit? is s 4-ti, gist? iii' ftiiwtttiia team Rig?Ewwwfiiseetkxllgiiveiaifrsrtlti titiwiggfrfifeistiibriftfiigrjiir E iw 1 4ia,agQgg,affa . 1 -famgsggwrSizfggtaiiititfggiztsqstgwgg wits 2 tt fimvrifipyfif6i?M1Sf16',,lN ,aitL'finys1syr 6 ft:i4ssw,QwP,t 6 ft6yQel'HM?g :j., sw ,s W if 3' if 34 -smgzrwliwcfgsssaggi Ji? ig X ss X sp. amp fffijr rig at 4M44fegu ,.. 3' Us e wg .i-4 . ik Qi ... . 3 3 as f .44 V-.,..a.4,44.w ., s ----- X Sie 'Y E 236,44 . asa M we Riva 4 .Nami ,sstzstsmaf eg Wg asww H we 414 aww ae. Hrs: sfrt:..2E'Zi5'v5 it as ' fag ft, M-.gas viEWgs?a14ZQgQ agsya ,aysw if me ?A 4a 5292535 W4 are w4tf3,4w5,i3?a'ib v5gN'ig'WQI,S? Q U 5 6 sae 4 if itg is it as.',0'..gStm A Q6 - . t ., A as wg G- Ai, TQ at if zzgf aww Brig it Z3 i f if QSW- P :if 2231.1 i triisfgi swfti, tip, 4 K4 a wtrttfsasssiassfaha his is frfwrlit '53 twisiwtel P w- sq W Q 514171-raids'wdeisfiswwbbggigitfit'iliiiigsiikefg s. is A,FEELL'5i3?Z4?5Q,Q?'F 5fSELZfflfZ3izf '35 6,2591 xgaitfvtwfii 'val Mitt' SNES E as 6,71 ,gt igaiigegiiaastfssgsggrysagggr gsggiigstagwiafaiwaafsgagwwfgfgsggigjgggp E 3 ,iiiwifiiiiifzvgiiigglxfs 3 Ewa iz rr 6585356 Qiiaissrwiagfgizatsrigtti,Etgggrttfi fewsW.w ww 4VWQs.f W4 'rw-ew-wm4W W4-444s wif an :v 1LMr'Q4t1gaw'w'2W:zt W we wtf Q54 t:,fzaa1apigi 4tssti 52gggggsgEt is-tvs? X W F' .4 lwiswfiiefwl'siiilifwwp FE, T? awe 4.4s,Q,,.,4.,.4.?r ,4,.,.44sgii, sy ,gas , .,.t was asfattszfa ri asf 222 sts we t 3 2 'M-faefrrmzaaa wfrtvgtigtassvss , -::': fi, iaaseagg, s w is 5243. 2 www ,aww gsm gzgtggiitrttiigiSiigitttiggiigi aegis sagmgstevsfiiis 2, Z? ,stty Q itsfzgigr waiiggg 2 Swiss? its ia egm5 8 ' 'Q si at if ti Q riis rw 65 ' is sage? sms. at , ff.,S4f-M a. st iitiitiiiiibwasiiiii vfidiggs ' -:E it N32 gsggw as Q 5 S' gg? is 5 is ag: ittgzsi wi 4 K is was A 4 2 as r arising. . V 'yrwgfttziik wggj is it s H aiwttmagwz ggiteeze 295 -.114 'H lgfggifsisgyfrrggtzgiw4s51iQi2EgEw4 JEQ, wawwgqgs is gm sgrg QQ W? are sis t 5 Mya eggs. fitttgggwgaf 65 Qwigk twg , ist! , ..,.. .. img sgyggmktt A it .14 4 ' f Wkw 235-f4ii+,sf'vw?E ' iff? Q? Y 5, sb s ass fps-wpg,5g g e.: :Q- Nw Egkgsggtjf Wie , ig ---- rfsmtggiit 4 VZ 5 VfW ' f f' S as assi i' i tiaga ,Eg f, yt A4 Q 4 ,taste rflttttwi ss it z.11 1f1 .s-zg: - 4 Wi. Q it itsfiiitfawesiS2Et.Pis'aWmQ,s'0 Tir? 233147 tf5?wQ'Q3sr Wit tai V35 My ,f 4 QE EQ-.2 K -ty. is 0 ' an M4 . f at: wgrss g Q gk figxsfr r s 4 Etgggiyigge 5gsgQgg qsiisg3Esf? gigtgggatgg tgqt 14 - rr! eh - W 6 .55 !i1! Ea. it W I'QE'I: .3392 2 F20 Q 2 44,.-as a we 4 t agffi ftk war gat i gssait ss igt .fs aiat agfiwt -. 3 1. :. - 2 as r 'af wi. aff f ' ?gt2Q5i9g?Efsfi tg? f .H. W 3 f -.,.. t ft is tw gsg':I'E. 519 Swim? RL 41 'rw was 1 E , 2 A satis 1 t .4 .. ,a ssist , , . . . 24 te Q ,Sergey his Office and Bea' wasnt 'nr but its keep the Story 'n the book to exempfffr the secretary listened. Ken said that she effect the Bear had on people - even at ' - - ' f ' - lf 'filet is j t it 3 ,XL ifaat ra is Tigefs Dad ,af By Kim Judkins Down on the sidelines next to the cheerleaders, behind the team benches and occasionally hidden by the crowds of Drunk Tank, Auburn University's eagle mascot attends every game, accompanied by its ever-present trainers. Although the trainers are often ignored, their job goes far beyond minding the eagle four hours on football Saturdays. Charlie McCall, a senior in industrial management, is the head trainer for Auburn's eagle. Along with his other trainers, Arnie Cobb and David Weise, McCall is responsible for the feeding, training and performing of War Eagle V, affectionately known as Tiger. McCall works at least twenty hours a week with the eagle. He often handles the bird without gloves, and Tiger loves to play frisbee and swim in his pond. Tiger is the property of the U.S. government, and any harm done to the bird is a federal offense. However, Tiger can defend himself by beating his powerful wings, or by ripping with his sharp beak and talons at any assailant. Although most students take pride in the mascot, McCall says a few people do torment the bird by throwing rocks and trash at him. An average home football game day starts early for McCall. He arrives at the cage three hours before the game so the public can pet and take pictures of Tiger. The eagle is carried over to the stadium right before kick-off and then leaves five minutes before the last buzzer to avoid the after-game crush. It's an honor for me to be trusted with such an important part of Auburn's tradition, and l wouldn't trade this experience for anything, McCall said. eussstt scorieto War Eagle, Chafiiei - Quay i S5 0 54. 5 gm .V it .g 5 .4 ..,.. q, ., W -4 f Q: ,aim 1 3 ,ities 5 'fr t i evfs KF sgsizi? Q , 2 if 2 X igsz 2:52522 1 Q fat t t. iv.. a Klart . ' if 2 iw My as. ' tts? Q ,,Ea,4a ,55 s,4fa,f, Q gag spa m -i 625 5433552 l it it as seas . J sem: rw '-Ei .. it- 3535-v' -'Sv If 4:2 4 A f W S 2 'L i if :if ,. a gggmgg i gg asa -1 2. X U' fi? 'is 'iii .... it at traits ar t' pe ffgqy ig 6 4 as fas ts' it .ita t .- '1 - at i3ig5,,iaji2istgfA5gg2ur '-' 224 at 1,.3sas.QZ,g his wr, X sv ' tw rms ff 5 , gag Q A the gg - Zfagiifss wwargei iz, -ww twist 1 r - : :::ig::: 6i ' tw - g:: 5 V Sa as ty a sgg, 5 i ts i E . 1 g e t ii .. .. .451 at .fra--:. .g5ggg i . gag E a i jig? Ss' rg it was thi ,R Q' s -ft' sgiiigwtjg gtg sam EW,,, ,1 :fggf-tsaifttfifzizg 3 S 5533323 if Q, gt i : iff at saw 1 H wg P: V .. a t at' if ig if ass i this .ag gig 24132 QW ,A '55 4 ag Q56 if as 11:-2 W1 14 r vi --ss.. 5. Vs 46 -5:.':.': A A 3111 Sr ,, ..,. W , -i f: fiffff f if 'tif s gisyi , ,rs M.. 3221252 as fasts? 363253 'im W sie ii fist taigaitttgitsg sw Q 2 ef-agsiws ass, ew.:w+wzsi4see,,wtfst Gigzgffgivgiggs, M, as sg .. .... . g 3 , 'Z J 31654 is : 3'-'15 fem 1 bib, A its f gs at if an tai fa at S ' W 4 .,4 if we 154323. r A, 5Q E4iQ Q3 mg. 6 E Q N E at .tw exist 5 4 tt mittee V irK5iHH,5 65ai5!EE?f 5 :jg Q G2 stasis-5 s iggifgggfsztvtfitfmsgit Y::b4qf5g4 4 'fiery 4 N ' gggwvwi if 45 6:w1.6wygfx2t'fs g,y,a4 2+ 2 4 44 'fs s 'T W , Us 5551445 sfwiagggxassvsgaw 6 2 iggpsiga Q 'wa it ,2,'t'fS,,,'47?awfl iiigigwjt tiff? 3 his 35? 3 r r was 554 grits SE? gg, ,Sz iisswtgggswa saggy 6534 4 tw ?ff?X2?lJ 4 My M L Q gg x g ,m?,a.?,.,,tmW4.sm.sWi4144s-aa.44m4aw.,et.,4.4t444A44?,s4i444,,4,.a,4,,4t4a,,,,,..W.,,s,4,g,s.,.t44mv5:2as,faggg5g5ggg3t2gi2gSt 6t t 4 .,a4s4,a,w 4 L,,44We.i .W 4,,taa4.,,, M.ta.4it4f,f.,. AW,,,.2iiWe if swiggtvsa .Qsgz,,.22?sa.ggZWhg,m,.4sSa.r..m,4.s,ya, ,k ,,ggm t fgggygfw Ewenfwiiri wart s6:mQiirr 2 S fi 'V Zf6Y.5r 44 0-lewis it W4 W mei Wsiigharigrtsii is . 4 . . 44 sf! it vs gt it J x qty? 5. 4 .4 . .4 ti ,. 4 Q 44 t is 4 4 rgt 2 grS,J4t 5 if if , t4 4 4 if 4 gwswh 1, Q s is -t we wists itiisiriei 5 ,r WW fault wzirwrwaz gras wiitffef rr w6t21ttwrH rrrrttwti ei rrstzustifit fiiaiussimv 5 4 it i ,Q W4 asf, 43 W H -42 tw? ,sg ,f stile-tl PZ-'ZZ sw 1 M use .. N, N'at4.a4ea4.,,.s W4-4 gwmsi Q, gg ai! ., .sa H Q, gggia y?Eg5,e::Ei22i4Q9552113222433 QQEEZ: 4sas s2E2g. -figiw M MZ: A Q. W 4.a4f 7 ' 133341zyswyfiriirgggigiit 1-Qgggriszgsggzmwf was 4 is if K ..gQ,1it... , iz+r ???gfi ft T 12' it a 5, Eg? is igzygiawgg N1 gi 11 S ss ir fasft. f s as 21? elseif ll gifs? agsg tags 5351183 1 W 1 av Y taser as X Y A E .i . 11 1 .Et 'gf mg 553 2535 1 f 1 sn Ig, 22 't e sift Eiggw 2325333 31 r .: ...- 5 --:. 5 ssii ftf w 'g V gifs? it igggiiw s - gg est 1 H 1' .1 SS +4 5 35.132 L, I If T S1 if t-5221255353 ESE gets s if s 15,41 s z Ift1st1tj?l fr lj. tsl ll isgggztggg 5 t st? 1.5 f gzgglgi Els? .ME 5 si st E ?35g E six 3 gli? sgsi W i tail, 12l X fn' .: zffs- 'V Ms? a'ef :W rits wr' 1.1 rsW'WT1 raw ft55t? wf11.1Wf' ffmfg. F WW W iv' ta. ' 5-,311 -1 :.- .:r.' : ,:g'5 ,1 f EE1 153. f11.1 .rE.s.w11a,.gtWa1tr f me - fag as ga gess1xt,..tM rf:fstsfi:Jf:s1tf'111ws:fi?:m.1ff1'iw3r:?ess:?:fg.21 fr. s.1ngs.1:f. gms S1 age t 'tt f is-ris z t fwi sis 1 -. 1 11111f11s?ffsw a.1w..E.1s1:w?'l11, as E.s a,l 1mgws atm aff-:stage1wwz1ess11.1W1s1wtz:1.ss11me 1t1111er.:wa1 ek 11m.fmeesis1.st1 1fsl me ---.. 1 1 , - --1,11 st eewsraasstfsxtszffgwww 'ft ssgwgf 111-1?gsers,1tr.i2sffwa A-We i2'.2t ''SNswsw1'ws..w.:sMssw1w:wifi::sssa1'sfaM1e1e3mt2wzfsbwwasg 11.11-- - 1.4 is 1. was Vi fmfftsvszis spy fw 11Wa1fsz.t5szs:1.s1ss1111.a1w-IBQ1sg fs, itz. wg'1visas1g1ssg3gs1e2tgfggl3gsgg3s:.s. ,1wsiikgiwgaazistswgrsggfggwgtwsasrfrwvfggsqsmsfas1s1i1m:..3s11w12zsms,..1 Sweats 11113 f?'ss.. 1 1 :1': :.:..1. - - -.-- . wwe s1,gwi':ssQ?ssiQ3fa Ql i stswfswwelsigti- gifs rafeffgfg 1: Q s fkiilissffxzrsirftlsssitziriomfwss Qty iasgisgfer sgststgstkliatityswi 3' iZ'REgvK3 Sgr Ms2ssZii'5?iXfiwgcs?f'?.. 3225? Srv:'QSs w55g tK ,ff v he . 5 ffaf. ----- Wt 1. g,fi,:?r Ffttwsg XQ11. ----: WSW' 0 grrrggzfsw bvfsfgfsififfr 115921 sm.. f, 1? 152 2 1g 4 554 if 1:2 1 - 3 Z Q ..... 4 . 1? 1 if VIN 1 2 1f.sz..gwzgt 1 . s I .Ziff -1-1 1: N 11 Q 1. 9555151 21 1- 1 -. 'mst ' 4 '5f'i:f:E,1E: 2-11 f 552.-:. 'ta fl f as 1 mf... , a s '1 11 .sfttisf 111 'v t -.1 1. 1 , 12. 5,1 -1' w w. rg 5' f a as 1 11 B' 1? 1 .- w 11w1l 1l. lr .1 i 1 .11 ..... 1 E rt E -v-- 1 21:51-'EI Best f Friends By Sonja Baucom and Abby Pettiss Most people might consider two star running backs on one team to be fierce competitors, both on and off the field. But that's not the case with Bo Jackson and Lionel James. They're friends and not afraid to say so. Lionel has really helped me since I came to Auburn. I think of him as one of my best friends, Bo said. Since Bo and Lionel are suitemates at Sewell Hall, the athlete's dorm, they spend even more time together than most best friends do. But the pair are definitely different people with different perspectives on a lot of things. Lionel, at five-foot seven-inches, is known as Little Train, but his size never makes a difference in how he plays football. Bo, on the other hand has the large stature of a solidly-built running back. For Bo, size does make a difference when he's plowing through the other team's defense. Bo is known as Auburn's freshman phenomena, but people treat him like he's been here for years. Sometimes that's confusing for him. Being a football player doesn't give you instant maturity, he said. People have to remember that he's just I K ' Lionel has really helped l me since I came to Auburn. ' I think of him as one of my I ni 1 W ligl - , , 1 best friends, said Bo iii Jackson. 119 sos GAMBLE a freshman, Lionel said. It's not a pile first to see who had the ball, he said. ,,l, n W , .ml . .,. d.. ,, n . b K n mme,nottatguy. ereboth ,nfl 1 113 disease, its just a temporary con ition. Bot running ac s ave a great runnln backs and We nave the Same For instance, the Alabama game was just enthusiasm for Auburn. Lionel is the most numbg, but We,re not the Same erson ,, another game for Bo. As far as he was confident of the two as far as the past BO Sald' p ' 553 concerned, it wasn't do or die. That's not to season was concerned. Wnlle'BO doesm dale much he does get l 5 - 1 1 1 - 1 11 1 - - T I I I I say he didnt want to win, .he just didnt U I knew we d have a winning season I what he Calls ms lust letters from female .ljjjggljggg have the experience of losing every year, he just didnt know exactly how many games fans llifittisl ' . ' . . - eXR?nnei'l b l n l l t H Lionel is a social fellow who likes to get '? l-fa alma glam? megan anw Oli O Most Of the QUYS on the out and find the good times. He loves to ll as I N ' l , Efsfggigstt l to me' 'Qne Sa' ' Ve een ere ree 1 1 I dance and hell dance anything from rock sis Qigiiiftff' years It's like most of the guys lat Auburnj eam are na Ura Y C O59 ' - - ggsg pfl n ' b l 1 Al b S .l, . l . 'n' roll to punk rock. He likes to kid about agelnevelg isa in ta ami' L.O' 'l S an Smce We Spend SO much wanting to marry a rich woman when he S ME 43.322 . 1 1 - 1 - ' igEttt5..EQtttS1 un e'eVa e eemg O Wm' . 'One Sa' ' tlme to ether Sald I-lonel graduates. Although since hes in electrical As an old veteran of interviews and Q 1 englneerlng ll may be the Women that tif' 3 is . . . . . , publicity, Lionel gave the impression of James Come looklng for nlm lllsl - ' - ' ' , , ' relaimg alfihiaetvsrug guggog Ernedduurnng the we'd win Coach D e worked us rett Despite an thelr differences' the two exe' emen rl: n e Im rl Q Y 1 p y running backs remain best of friends. Which football season. He s a personable, hard, so we knew we d better have a good ls probably good lor Auburn loolball Since articulate man who doesn't mind talking season, Lionel said. We Cam have two Ol Aubums Star lumlng about personal things. Since Bo is a freshman, naturally it's the . ll ll ll th I u ss most o I think l'm bi er future that he's lookin toward backs Qrowlmg at eac Ot er W en ey g e Upel pe l H QQ ,, . Q . ' face Alabama again next year. - than I really am, Lionel said. You get a I just want to keep playing as hard as I different impression of me when you're have this Yeaf- I Want to keep improving S0 sitting in the stands than when you're sitting the team Cafi improve. he Said. next to mel he Said, Bo keeps in shape in off-season with both '95 gggfifiw 53:52 , , , , , 1 The Florida game is still a sore spot with track and baseball. If S in track where he Uwe was compared to Herschel Walker again. 1 .fgmssii 11 - - The Florida game hit me really hard. The fTheY both Van the Same track GVGUTS-J guy kicked an on-side kick. l caught it, HG dOeSn'f mind too much the ' film. 353' - 1 ' - dropped it, scooped the ball up again and comparisons between himself and Walker. fell on ir. The ref was making me can while I He'S Confident that he plays 33 well as he had all those guys stacked up on me. can and doesn't give much thought to The referee should have unstacked the trying to be another Herschel Walker. 1 1 1 1 . 1 1 1. 1 1 . 1 5if1fs?g?'gE Ev rig Ei?tf?'2ffW'ffM messwfstrawsessfzrfftissfiskif15553252251 offafwflitlsis 'fktifststfsfgtitiastiwgftgissriiitaitsfw sites em: . UW. 223 Q55 f -1 ,wsgwswsz'm'si fewest? :wwf M. '.fg:wa'1zfg:i'it141i t W. tw 2 s if. mit? 1 g Wgzgzgisg , wf:.usf..f.:Jfegfw5,qgyf:fgf'ffrZ..,ii wif. iggzzigggfyiiiiawww gitetfffmsiggziiif Gift?-fmfsff 'twzniiitirrrf , - .inswfs vsg4l?S:Z -'xiii 'Jimi' --aiwv ssefgfirzilg Q.,-twyw-lww-f':g? 5 isirliwmum1w',ff:1fihAs.f 23 -:wwfi Q teritfffffxf WIN.-ii'mvKristal?Lssriiiwbwwefsgsffgttftstismit-ts, i wwstffzssfftA221111-tww' is 232555 wwf' -ww it Miftil'',3Zftt3z55Qiv'fkiiigwwltitwviZaw??wFwww'bs if ami.. -mf' Www-wewi.:tiswsf't ,, . f taste5isSiirwifbfit-fettftzvwfrwif' fr f . ' ,gt we f f-Uwe:'Wft:::Li:rz:,z 2-:fwtassignswiwasaifiimtififff-M ,, , ,J We ,st use A sw 9 2 was Neff- ':.,.,,... fm-W1-1Wf,2zs.i.issQ..t Q QWitttflswpwl-vitimwav.www? I K 'i ' mfs. ttf .tslaziii-M631-'14tzwfggitsisisiifittitww,2 M visit'-fbiizffwtwvf:1fsiuw-3121.225 S 't Tails- . Qtwftiwiifw it ,, .. . X2 5 i. ' lazy. iff' ,.m:.i..iTiLf ,,gc::.e321v.2rS-W ziiziiiilsiriwziiitiflv iiwxsfiriiifixfs We-utszzz aft ifzxizmflt :Qmi?9322.233fwswfQssaktetiwtifffisswe r re....rs4w,tfsf:ssL:tWWWNris its :Zz fa ew, t -fe ,fe ' H H5227 Spare-time Starlet By Brad Mooy Many Auburn students are involved in some type of extra-curricular activities, but few are involved in the same type as Susan Holbrook. Susan is a 20-year-old computer engineering major whos sings and plays keyboard in in an up-and-coming rock group. The band was founded after the UPC talent show. Susan was singing as a solo act when Skip Welsh and Steve Maher caught sight of her. The three joined forces to form the explosive group known as SAGE. The group placed third in the contest which, encouraged us to shoot for higher things. The trip taped a few songs and took them to various nightspots and received two offers. We practice four nights a week for about three hours, but I organize my time to provide adequate study time, she said. Susan has been playing the piano for ten 1 f, years and is just mastering the keyboard. The group is comprised of a lead guitar - Steve: and lead singer - Skipg and Susan of the keyboard. l'd have to say my personal inspiration or favorite groups are the Police and the GoGos. We play a few of their songs, but we tend to concentrated on mellow rock 'n roll, basically because we have no drummer, she said. S When asked if she would quit school for a professional rock career she commented that anything like that was too far in the future to decide now, and that she is trying to concentrate mainly on her studies while she is at Auburn. Flight now, l'm really excited because everything is coming together so fast, Susan said. A success in the making? A success now! - f ci 'W'Ws gi zigwgg Es: :wmv stay list? ,Was XM- :zine we tw fggtqz 5:2323 t gggteggfimt game assi? Qiiflk X X Zi' me 1 ,asa s.w5.i5g33333 3:2222 it eww 5332, 5323 as , wt wo m ' SFU? 213254 1 shew A ' sg, f R N 1 is 1 tg f it I: Q 5 if A E sir is fit S 1 it av s ,Matti is 'Sf tititli SS is N wg .. sm, it . zz raiszegsstsf :i.a.2m5i 12 m1125233 'iliieiggg , .W.,..W. SUSAN BROWN 55525325243 , . , , ,. rw-fi, ,gt 1.11315-,fa farmsgwwaggrgsgwsrasgggsivgwegftzzzfzSiggwggzsteszaersvfgse,3':'fSfwezwfWigsqzfizgtzzvtmszliyggwrfmeMrsghiwvafijrgw 0 swissgffsvft it tffrffttsttfstfw, wigs e 4 t .W ...,... ....,.,.. , . M., , ,,,...,., W .,.. W. , M5,,,,,mm, i3 555535' 1322165 - ff sip if ,., .. f A .5 -f 2 1, Kwai ' 5 . ., 1 Q. Wit - 5 .V fwee . .n H gif Www? b if I A:-7' 7 , j ff' I ,s MW. .... . ,, , ....v,D.t . . , f. By Monique VanLandingham lt's as if he's created his own time machine. More than 'l,OOO albums line Dave Gibson's shelves, marking the hardships and good times of his nine-year college career and with the flick of a switch he can re-live them. Gibson said he started buying albums as a freshman here in 1974 as a locally-owned record store, Above Grounds Records. He said the store bought used records for 754: and sold them for a Si. In his first buying spree, Gibson recalled getting the tour-record set by Chicago which he still owns, but has only played a few times. Beside the irresistibly cheap used albums he bought at Above Grounds, Gibson said he got a lot of free promotional records from radio stations where he worked. Since his freshman year, when he became interested in broadcasting, he's worked at WEGL, WFRI, WAOA, WJHO, WAUD and WLSQ. While working at WAUD, Gibson said he acquired his only single. It was a one-time Beatle hit, Money, re-released by a group called The Flying Lizards. At another of his radio positions, Gibson said he was payed in part with albums. l'd get two albums for two hours of work, he said. Picking used records is an art form, he said. lf you get burned a few times iwith bad recordsj you learn, he said. He said he has yet to decide what he will do with his 28-foot collection, but he admits, I could stand to sell three-fourths of them and not really miss it, Gibson HGV A i95y'?332'i3tE3'1? 5152 ggggm 5 Blast jswigyriizszzti Siftzftitiiriftit its A ::,a::1:mxy3 tszzfafgzgfzzztgi 525135223-i tl xiii Q 5212 5223111 P2 .1 si N23 N sisters S2314 251 22.1411 bltisglz kimatssa TMW H 5 2183 avec M tr FP? 'irq it ,552 sms Q .sm ,, mrs 32333323 Slam rwfmt 53,591 , , .. tgmg it sztisf i E35 Avia H 2:51:32 -L1 -is it twig ge H it EES? 4 Y gg gt: 5 Q : t M 3 S 1 4 2 1, :W f fiiwmav f is v my M Q., - 1, 5' : 5' .:r:fvrfY1'22g3' gtg f mint, fm, his 7: fa st.. fswigai qg'..zfzz1m-w tZZ'5 eww .Es 'mfxgrwzwstsii SL.-sgg3f:.,Ws, Eiipsszzs. g:2,.'i'ZKfSf at 9ii3?'g h sx sf mit 1 twist 25? z fist . Liiiiggsg sgggfszistftisitn if i2l2Eg:i2Lggi'? swf-rff.,..e.m Qwwtj Zlllsaazasfl- 2S:S'?t'fif::fz.ff 23555 ' ,against ,wall gi ,Jak mggg ...MQ Mews it :fig AYEVL ,Q . 5 www. - gggi35st?ZSQt' JAY SAILOFIS 3 .V V ,W so ,r . Wu.,,,,3,,,-,.,m.,Y-,MWQ . fs-.4 .V me Www-fmm mms' Q-M, .4 ,mf'-'r.wmmzgz:X:n.:W, :wwwis:-aefafrfrwmfyrmir':mf Q wtgggit Mzfff..Qat3a2t,2gg:fg:4sS33i X? 5' 'WM WW Witty? U' g fivegmt:-rgszmiezwggg. fxgzsggggA1ggg5,g5tf,gggg5gwfg,gggszs3s gzzwwsfiffga ,ifzizww-assztstt-fA2s22t'. stemztwvgiwimwzf .tabfmwsusztitfiilsiisrefs . gfsizriffsffii distrau- rtm WY Wwzf-.fr'2:i1L'. W ' ewzgitls azz! Q' mrs. sms Sbzwiffkst,4isWwN2'ttf2i...'-ws- ffrsmlf t2t:m:.'tW1vw-1wlM-tz'i5:'Emf2wft et Pt5'2ltZB3tsw?3wst5?ttttifiwfw'MQWM2 WFW- be-'fMwi'.,i.1sx:.vt'raw we :sis f .MW V 5553-,mlismalgiffzgwisestw3gfs5?,.i,5Z.-efggmtgzrotpwwgggf,.,f tigftfmgsggig-',1g3.w wswswft wqfrtsirtiwvwef-tg: Sifigfiviiiss. we-wwfaiiivaww-wwr,Jigs .,ist-swgizw-mgz,iZ,.,:,.Ww:4wwf , me t ii I .mg 3 S fiery! . . 2 g fmt- a. .41 35394 :sieve ggfmzw as3tgg,,g,,gggti5.:Bs3tg,,3gg.:2mgsizggisgzwzkftititiiwpggtggi 1225, g'1:5:Q5wfff?f-1-wggsi1.512512weWZ22ittzgiimitwygtgszzeit tlifittitiagtqezgygfz'mfitff'were N MSM U ' , gggiipwtmnl'jgtfhg,ZA-USWR55252sZ .Z'0xelsbbfiiitmlyiiwnvfwxl? 3T.fwfMffs'.' Mvi f- ww- -.7?Ug,f , belief- 'stasis t'P'2'HiiXi2e.w.' - WP 'M3253w2'egfF1'e!sWfW3:,27w.NYY-''7 W t wi5f.7tJf'.7--iw.f 'FW '?gfF . itz: in swf swat-fat, ggisetswwfegfgsiwfsw W'-flrrfmttfiiwlgigfgt . wltqggtt --Ha'-it WisnerQ'-2:21211efr'Zi? 'ZSww2M tts? swf'5Z'WS?f'.iXE.f 'WET ' fiii f New Zskltw -vu-si ' if 4 izitsswilswew 1 M .' hiv not X wisest: 2 t WWW ' V 'User t sjT',2'1-5 FWF' ass, A V W2?Q,X' tmfwawt 'b3'tY2Hw+a Q mm 1 ses Smit .zsstmswt sszizsztmi awafweg :.Ww,,w.9aW, '...i.ms,.t szwsw tm-rz:s,.tZz.hf,.ivw'ffxtxfl' Rtgmirtw ..w5svmw:.w:sWe it ss S it ?v it mt if J, .. 5 EA I 4 E if , xl' 35521 I F tit, i is Blige 'z V552 4 S 5 .af I at ri at 5 si I it S I Q, jig .f ,tall Q we Stir F E av . itil it xi? i we was sd, H its 3. t s Wt tg t 2322 I if 545 lj I fit 1? I 3 1 v rg? Q it jeg tg its al ill aji Sitter H r gl . . . Ig t it it fs? M 9 W ill it I stir s 25 22 fig, sz gt lit? ,rg - it iii ng we is-is i :.s:.-: 94 'V '. Q tgt i I ,Aggie N it iii S, r git Iii Iilf ii' kb 521 Giga iii as me it wrt? isa it , S j jig? it 523235333 iii? it ii 4 r it sr 5. A I tt fy xg ,ji I t., . 3 5 lr Q ta iii is? ri 5 stiff It It .I its I Sill. jigs iii it . gig' 2 it iltjttr 594 if Iii I ll 3 zl I tit? li il Q21 I it I gi E is I iii gg 5 .I si Yi ,I Q, 155-151 , I -'at I egg I , r il ij 5 tit Q is ig :gl , Ei? s I I I I r K E 5 5 rl 3 i is 5 I t gr 52 .- lj fir 25? lift iii 2 5 3 nl it ii fit I tl? is I .ig gs i i ei tai Eg f it I E 5 Ili t. Q 2 I -nr' iii ? 5 I2 I IE 55: 2 ii ji 5 E j I if ggi its AZ j. It y ,ig ri? 25 3 I I ji it S ri, rig at 9 I t ra E Egret f , it E7 ig! SE ti tits ii? Sit ji eg I I I i I Q it i ti iii ,jg I Iii? fist ti? iii I I. .5 ,R E ,855 il sit its .ti gr, . ig Q t it tg? ,, 2 ji ti it I Stir: 525 l at it ii iii gill 5 2 tif E 3 ,jj it ,, M. if E3 aw w- ------ ti f fades ' . JT' ' ,.,m ,. .,.,. ' 5 ' H? H W 7Me1w N if 'W' A .... 1 2 1- em if? wwwrmaewim Nagezawyf'-1-N NN-W ,,,,,,,,Mm,,.,,.,,.m W .. ' WW.. mwmr 'fffmrww ---- f .. A .cms-I i f Wi l' enamel ,ttsW..,.,.Q.wf-as r A A fr M .,,,. .,V,.V,.A, . . ...., - 1 mi -Bait' .....- f.. '.' .. .-.Zf5'2:L.t, Mew g , .,hiwWqvT:mgNI- ..... - mf: --A 'W --N -.-,- We 4 ri ,,i Q4S ,geastWg.ij,,.Wgsfeye .... We- fm-fw.ff.,. ,EXW ....ri5iWi,.isIiTai 'N M ami. A Captivating Character By Sonja Bauggm and B,K MCC0mb5 main key to OVerCOlT1ir1Q any qualms that might I started out as a math major, but when I discovered theatre, that was it. arise when going before an audience. lt's all in how you look at it, she said. lf On a path that wasn't always straight and yOU keep Saying 'Oh, my God, oh my God, oh narrow, Glenda Chism has finally arrived. my God,' you're bound to have stagefrelght. Only not in the math field, but on stage at the But if you cope with it and practice and do the Telfair B. Peet Theatre. Chism started at Auburn in 1973 and after a brief appearance as a math major, switched to theatre. I did a one-act play for a directing class, said Chism, then I found out I could get a minor in theatre if I went summer quarter. I had a part in one show and the lead in the other and toward the end of the summer I best you can, you don't really have to worry. We're Really Just Like Big Kids In The Park On A Sunday Afternoon. Hollywood doesn't seem to hold much decided td dhandegf glamour for this aspiring actress. Chism said The petite red-head dropped out of school Shi Df9fQfS 'We fheafei- I U to reevaluate several decisions including l don T Wefflt TQ be 3 Starr. Cmsm L school. She returned with the decision to Commented- Their personal l'VeS are DUDIIC Complete her Studies and get her Bachelor of dorflaln and l don't relish lyd falhel' have pine Arts degree. a good role and the respect one gets by doing When you go to apply for a job and you only have three years of college, it's to your disadvantage, Chism said. I ddn't give myself a chance. College was a loose end I needed to tie up. A performance major from Deland, Fla., Chism feels Auburn offers a good program for theatre students. The schools in Florida I looked at didn't offer as much as Auburn. At one school I had already had more theatre courses than the school even offered. Also, the theatre building itself is a tremendous facility. I don't think the students realize how lucky they are to have it. I Can't Wait To Get Out On Stage, To Hear The Audience React And Get Them Involved In The Story. As an actress, Chism said one of the main keys toward good acting is to develop a good technique. When I have a role in a play, I want to understand what the play is about, where it's going and what it's trying to say. I especially find out how my character is involved. Sometimes I feel like I don't do that enough. Chism seems to be doing something right. She played the lead in one summer repertory production, Rainmakerj' appeared as Margot in the fall production of The Diary of Anne Frank and was stage manager for the winter production of H.M.S. Pinafore. When asked which side of the stage she liked best, Chism chose performance. I like stage managing and I enjoy hanging lights, but there's a speical excitement in performing. I can't wait to get out on stage, to hear the audience react and get them involved in the story. As an actor, you can manipulate your audience and try to get them to think your way, Chism said. Stagefrlght doesn't seem to be much of a problem for Chism. She feels preparation is the his job weIl. Live theatre is different because you only get one shot at it. It also helps increase you concentration level, Chism added. Future plans for the talented actress incluc graduation and thoughts of graduate school. Right now I'd like to go to Yale. They ha a good curriculum for theatre and lots of exposure, Chism said. After that, I want tc work in theatre no matter what. Chism said, You try to think of acting as spell you are weaving. All of a sudden you're not on a big black stage - you're in your j living room or you're hiding from Nazi's. lt'sj like stepping into a transporter and beamingj up. .lm . i Hg ,,,,, g MM M ., . .... . . .. .. . ' 3 MW NWT I 2 f 'WN ' iff I f j il I ,.r .mtg .. .N,44x,, A V, - --'.-. ' .,-- - N ' g-55:52:55 vu-wr'-f-.:zs' - s , -I . ...-Q M I I A I s J E it Q-uri , It ....- l . ...,.,...,. . M, 1 ,.... , 5 ..,. I -'.- me 'W' Mk mmmwiiuf it i ' ' 4 S E ... . .. . ,S it an I I 3 ,I l ,Q it E H I .i rililrii i E-W? I ..., A, , , I f ?'Zmm rN :,: mwaim w V I W--A 4 is ww-tm m I .wwf , far: Ln. B.K. MCCOMB W. H A ,,,,,., MBE -D-557g sgkggzig V ,mg 1 Mfg, .. FEE.-I 1 1 :sam . . --1-iw-wwf 35:1 Win - M'if5'3':: ,WMM 'Z Q .. ' ' 'l i m 5 3 W ig Ml? t uf .'.. M. -ylgj. me ' ,cg i I 2 ,. -,,-g:, sf,-: if .. -A lp '-' ' M9NN'mm ew psf :err :gg:g:::::.,, mg, 2:2522 5 iff: I ww x Y'?'i .,..s..tu:,mr:m M I M new I-awww W .. . ,i ,..a.. r,,mMme2im1 rTrE f?5:ti WMMW I .vs N Ee Q F? if 3 E Q, 'ef 3? :sk W 5? :SX Eg 'S SZ 5? ,X 932 :S 232 5. ii 5? 35 R Ia 5 1 4 1 fax M1 V4 gi E3 591 :ii ii 3 :Z 4 'Q -ww Q 2 Q f A 6255352515 'if My N A357663 H3 Wi? 55235 2-H ,Q . A - i WW nw we 1 fb 2 1 1 S5131 EL Z, , 1 v 931351 Q 3 . A U 1 M11 FMS Y H L 7125355341: we ' Q W 3101618 7 1 i 1512 5252.592 z s f Q fi? KWSN!! . X6 212535 5355 U 2' if P23393 55 Li T2 A935551 iw U f V X E NEW Nl V l41.fLliZJ'5l,nU V 1 'WMV Q' - 12.2 2245 221' . -A . 54 v vvwzed 21 Q2 E23 555554 C E525 1115555391 iw F55 2323125315 tx Y Y Z 553232321 1 Z 54 E' f W2 if W ip' 3 ' N535 A 5 B .rss si 1 f. ,wi ms: i 2' ,Q ,Z sem' ,- ,Jg Na am...- ,xv r .iskfrbwqj 8Mw,q5 E ,0WZ 3a5,,gX,3,4 'i wsswv 3120 is tzsssztii,.1MQ??:sz:::G-Zzztsgsismiiwisgiiiiw.QS. g . 3 vabgg.: ?g?43..,,...Wtmg sqgwwzsvvissisafssewig may wig N .mn K f, 35553555 ,:gggga.s,,3.,.smHi23s ww, :mme 'ffMsz,:4,1. rw :wage:fr3:ts:g..,i.:.-.,.,.Wsyf.fM.'wggs,1 . .gszirif ,ss Q' ...f5.swm1' asus V stats.. i .sf ,., ,. ....,...sJ f wwf? f :1,f.fQQf hx i Q . Br Elia +559 3 M 2 ,waits X S Y V5 is if we as t iz fi. 1 w P Q wsgazgi swcsfzii. w gs' ..,,s.wi.2sX.. S 3 Funderburk s N By Brad Mooy and Darryl Moland There has been much controversy surrounding Auburn in the past year. . Hanly Funderburk was the center of the attention but there was another character in the scene. The protagonist in this power play was Dr. Gordon Bond, the chairman of the general faculty who acted as the faculty s voice to the world. Bond said he believes his position in the Funderburk issue was a legitimate one, but 9 IIIBSIS he believed the position he was taking should be considered conservative since the faculty was trying to preserve the University in the way they thought most effective - the resignation of Hanly Funderburk. He felt that in a situation such as Auburn had there were few solutions. Either 752 faculty 13 deans and all the vice presidents had to go, as well as a variety of others, or the president needed to go, Bond said. w3eWii.,gqiwe'g,v5agf'ZZ afssa..5re.-.sss fwfr Mfw5ggpe.',..,, .wg-. :wg 5 ML we ,sg ,sn-,ws5g:g5gz'g1 ,.yg5,,.s, .Qs tw ,a.m,qssm,w. J Z rziigww.. 35-:K H1 2 gr tr f , . zz: . .. .gas . , ., ..,r .,::1-asf , . . ., . ,.,,,tsffy.Q., f WSZM W ft ,J 3 it 5 2s.,.,....,.1t.i.., :ff'a' 'trees fast? wwibif ,Mara,v55s0sm,:a:t:,.sis FED Q +v,ws,ts....i ...fs..ss,y .. . .. Q , 1, ,,2,,2b,..m.v.ms.?.fm1yias.s,ggw,,,., ,mast ..fqswgg,f,, M. ..s.,..s5ii ...M .,...yW. fegm iammgg sw...mswg,,,,gs.W..t..wg , ..s ra , v115,.,,. amass Msgs.. assssgsg i:t..:12122222511filewwfwzwttififff5fZ?ili5fPfff2l5Asrf.t2fiQi2,2tf52s2?Z'wUwiswzzfrzz.-.zaiziisbh ,wifi f-fgfgiizr gg: 635533523ggggs.gsmfg.iwrgsg:ts, ggsgzf 5 .,,.1,y .,wsizsl.fgi,Zz:f:t.zs,,,.,. sri....5,w2ffM'?i:tZ:'zsg.fa.?2sMfi:wHzt.2z::at51ifsimtsf,.2Qgzg?zz.iEz'5zt:5235..Zwwffzgsgas' ., ..s,.Q-IW,geffgggziztfiigtziwwf if . 4.,.wm,,,, ,,, yzgfggii .. f5:..... . , . H I . ' M 1 - A is -wwf'-wM2 '.32f'r1 tiiigseiu,ir,wi5gv5wfMQPg2f'5Y?s.,a.wa,..,wwfww sr ., . ,,,?.f,s, , ...f--.,-faaxsff wex-ws-fwsz45.,.,M,,,.M..vwwe ewf?is..m-s.ewsaws,,.., MW- -f :si3.:,,,,.W.,,m.m.4:wH A-ww...-.., aw Q 1 5 it me i 2 www: 1 fs, ','m?g,g,s..g4f.s..,.... s.,..,,..qH ,Ji isifzgsisssf Q.i..a.w..'ggr12fagf mf .. .im mga-A crisis.. Mg f i1wz?w -'fszfsszii51-4tz2i.z?ts.M.wwffEgg1zf:.:i6.'s5a,i.2r..i Ls:fsi',gt,:.,t...g...Wsf. gg, wsffrisfgzwfzstfifazzgz.... , 'sf Q isWx-ff,...,Wffirwfrirsgr..gfw.z., tma....i,1s1,wwwrf'f: Q if ,. mm, warns Milrbstfsg. limaiti-as sas's1f11fzWPs?5l'L'ZZ'ii, aw. zsfi WSSYQ-, iii ,Zin 'AWN' 'Nm44W'5?35HiE'iY'i?iEiiliiiigfiiimiiaifliiMWBZFA'if JJQEZ5' .AZAQM tis 'gg' 55fgggagasswifiLf35?,?gt2qggviggg.::2t2f:asSsi23gEgg'ggi z :i.:s.ssl':slg:.. 4 ,gsgszm ,,:.,5g5.. l aM'gr3'SS5.::r 3i,i:,vf'f-' reassign, :132:s.-www .zamgrzzgitnzf fww1'i1z:.1..1,szsssQ,, E 'W-'ugl,W,.. . ...Digg figfm., .,,,.sg:!,1y, ,g45,.ast.17.k5 ,:3.W.X...,i..qgmggafigjng .igazzfif r f . 3mjwgwggggggilggggssz. .z-Mgggg, Qizitszff jeff! 7i'SSZf?ifjZ'IifIg2gaag5gg5 e' 314 .. .assim- f.rrz:.s2iYf'lllfiietfffirWifzfsizfw fiiffzifq 'rg5s:'. S 't:x:.5am,ff.:szgzimzig Dr 1:s1EEi,Sam-Lf,.f,Wwg::iris.,g.Lw,w- 1-'wtf-zz. wziii. V 4.wr..Mf.wMg.2i1i:L,QtSw 2 gg. .. .. 'Sa . as 1.,. .. ..,. , , . , .ss , affwz. ffNu.:.,s,s..,.,..,ag 2Tif5'1'22w1f--isizzsszl,4::::.2z3.J14-mfsisszzti::s:zgs'wff1rfwwz,.. .4.1t::mr t.:m.- .. .,,,.5g,gf'.f.fw,:4f3 Massa- Wm M.4,Ww2,.,,s...s.ww Q6-wg,-rmgwg.-gg...zs...,s.W- fassiwgzip. gzx,-W., ...mi if XP . vmirwdfisrtazaszzz,:mm,....mw:rwi::.z.'-refsV .-,tmwf r Q 'ififfv - iff W as ,, Q M , t ifj.:fJtm,?..,.3,.Dentists1IiisaiiwifffzrisqsggggszizZistiifsiwfwwwiiigg if H is ,s f ig .5 3 LZ Mi we .W t getty ' Maw'wirssggggirgggfgsgzq, 3 Q x. .Q ,if eggwsf .ftqg'.2.J5.,f5sf-swg,s2:s:i:,zf'Sm,.f v wfssfza,-.f::z::L.3zr zfiasw A 'L g ,523 r Y S.altstsgfiiftiitifisgsrssgzzszisisiiifiitimkssf.f.gtsgigszwfzzfgiggil ' . , igggmggft azfzzsazswzt i r .2222 ig , ,g,,g.?ff ravi si ff .smiwil v if QW s if my fi if W ff 'L G W ' V MW W fs x 4. rzazsztsgiaffr Efigwflexxrsft samsaswwbwawsss .,. ....,mmf.,,. amy: -...sz Q M, wgw:,?f sstssstwtaa tm, .X .ts is ,agrggggffzgffe2azg??tfgt,22iefggf.ttt51::s:..fg'gg3gm gen, A . D' ,. .. M .,a.Mf.., ,Nm a,5rwwwt'v?Ww Nibpszsgw,-w'U'h'3'. srfrfiifsiitiiif is:sf::.:f:vii:fz25.: W as Qgzsggmsfzslrliimweme- gt 13:5 52.4. ' :sr ifrzzfzfasf Pllifivffgggtv ,z fssgtiszggziszsgtfssggigg yg,wmz:,::f.:: E 't,q.,,gU.:,r,'a.,.r..m fg igfaslzifsi i.s::s.,ft1f--migimsiffzz.15i.S'wwMQ asrasigsisiitss smsvsw wyggzzzggw satis , 22552 :ag :,il.QiiSSQirfE'i 635534521 LST: :ss T551 frgttzagg 1 .QLZQEYQ-Izsfistiiiviis if wtgfiiiif 5??gi2E:a:zi.:s??StBs3sz .. . Y . L ,.,wcsuEw-,vw GTHQZQQQQWQFSSQQ, 155133 an -sgggfgi 11222205501 SZZSZA-Sggg5jf5ifgiZf.,2 fs ?.., L ..w3?y-'- 1j5f'335i5TL'lYSUw1 frizmrmzzegizz:gfzssifzsiissgzsssiagizgzzixggzssilisisgszssssfsssr,mg.gsigs::Qzz..gtzgss:.f' L r :arises H-3233 1 Q! 1 Y5?Z,s.,wgzf. Us gist: Tzisfiisassm .3,,iwzsg2g25,,f 3g'g:i2i'QSLs ssawsgg gsasiiilf If 1 MW . ..,.:31i5'ZIf . sgggnfzzt 5 iz . xggqgzsztzg ,ss fs :mc WZ?2Z32wffw2rz5:,:f.?if52221225 5 Q: we Quixtar: . wi ,ifgiiiilififlifigsgiigi 1551? a.a.mm.s? 535,25fgz2mfi,..,,.,..s..,sm5,mg,,,,..,. . fs..W..-,,:,,-,4,5:::,.... ,..,.,.t..5,5y..,gw,,... ,..,.,gVt,w,g. 1'5HsVsW5222?'lwi5wigswiwwgwmwfefvgtesiwas awaewrai 1-lwyjgjgitf g.,5.s,M,- 1. gig . ...awwitim ,r.,HsgZ.5Ei1ws 1232225221itms?-sz:Eggfsis2235tistszassgagggsggezgsilrz4Lis:i.s,3,,.mg3szf:Q2g: wwf.. r 1 :sssgz rfitff V 31:32.15 :.:.::.:.si w. , i Q2riiw-remixes,isssemwssimfi' 'fg,gqfmsstZfSS:a3,.Qzr.:wF,z , .5.ff::iIi:.:q::,. ...um 3, L-X.. vwrrfegga 3. smsisfias gwgigg mga s.g.,1..,.Js..,..s5 .,,,sifQ'fggg,Qs,f.,.,,..,,,,i.,f,,,M.-ffsegm .,.x...s,' , gZ3y.:m.,fs.Swf,....fiiw2...,:nss ,.,.i.,2.., a' is is fm missy... ....W... J 5 1: , J .r., ,... .... . ...., 4 , WS , , , Nw. i . f Q Maw- W ,assi1.233993Srzwmifisrwr in L, xg grgsstztzfgfssiigiisiigigfggstgiiffggsristizf S111-wmgf.zf, ,Q t,:. 252152: , sam.sswwwtrggsgam sW.s.,,eiwgUwMs3+g.,,.t,. may ax.W.,wgz,.s- , see: atszsgfr BESIZQZZZTSMQ 'Z , essex zz ' Sim: iii Q basses. , sw wsfiilt-e',S?1.s' :Eesti 1762.32 heist::1.'LfYfm,mfi1'EE . .,..QYZ5,,,.,...,......?M......w ,: M1 1 iv f ei wfiiffflifi if ii iiifiiiw ff fi . ,f iii s g, .51 'r 5 1 T' 2. sgftg.:z:aizifs5,.., M2530WtisttltiziiwswQ wrwifgfgasie..JbMw.WrL-5-55gij,g53,,'jgffgqm egyggigrsnw frgsgfii rmqiiiliig gs.s.ritg2es:wgezwtita,,:1s5SwEwggr.,w:r:..:z...fea we gf...f... fwawstf tmzizsaaisrwrr,,g5Emgzagszgggs.ss:,:sfqgiggizsr :ga .msg -.,.f:::z:'a irf-aa fU.iisg2,Si'3f77i2l2e2Hit:i?:.2t.,,si2sf1'ZZikitaggmgsa. ,A iw vw,:.Wi:5,3gig,i,..,..1SL.is5, ' ' 1, ,..aW,,w,wssMrssi ,.fmwwifw1g,W..s Q .s,,..s..awsM--rw fgsi.. Q A . ., ...Watf-'ffp:f::..sfz.,.,...,.-WW s...W...w. Mwfviiiim Wg was-wgf - Us igztfgsziiirigl s ., time sie.: gtzaiiww ft.. mt: ...sg s..f.Nffs-B-M,w 5 21... ,tm H at-fwgggtr.Lg,J.15L2'w', -'wsyzg gfxssfw 9 --gff:2,.t'iwZ'ff5it'....WwHf ' ' .Miss wasszsg U ' as M cuttssisg ,.....u..t.m.,.,,.i,'.sy-1g,gzZa.,. 3753335 ..,f..,,,sW..s,., .. t-, .... ......, swam B P 5 is an , fe 2 ....., www- -ma M F, -. ... X abs s. ..,,M.,s. ff r fwfszszpzi 2: ssaziiwi gssasgsgf aiivf +1 straw 121' .........wg.ftmsssfrizf-zpzmmw-Sww:.:e:is:tziss.st.aa..si mafia its wrwe:'tis4.W:wh-fxgzwfr. 3 Q 5 4 t X iv? .. Mxail .WERE was A get fszzsrigzfxi ifzisesffsrfitgg 5: f miss he admitted that he might not have been as visible in the controversy if he had not been faculty chairman. Whoever was the chairman would have been privy to information and would have been, even if he was reluctant, forced into a leadership position, he said. Bond has been at Auburn since 1967. He has many responsibilities: as a full professor, as a father and husband and also as the presiding officer over frequent meetings of the general faculty. During the controversy he said he also received probably 50 to 60 calls a day. Bond doesn't like to be thought of as a radical or a revolutionary. On the contrary, For a while it looked like the former would happen. Three department heads resigned. From coverage in Time to the Plainsman, the crisis seemed deadlocked. Finally on Feb. 26, 1983, Funderburk resigned as Auburn University president. Bond was pleased that the controversy was over, but still worried for Auburn's future due to bad publicity. Still, he believed he had been right in his stand. Someone had to stand up for the integrity of Auburn University as an institution of higher learning, he commented. Bond happened to be that man. - WSMUKTT.. N, fm ...wwf U my Wzs:zs:.z,Wwff--L we ......,..,,,,, ,. ,, M... .,,a,...,3,,,i,gft:.s....s,.,...,..,.r.U,ffweff.,a2.,.. ,.. was,:fm.sst.......t...,wwrweg,q, Q5,jgg3BwbE'iiiSZbiZEv3 Q '1'XZL.'ZZlFQZfSifff.r,,i ,gsqfqggrr ftgsijjiilii Sl?IilF4isifg':T fgyizgjgggg 53034 sga5g'Z17Z1Z52i'?'ZZi5Z:il21E5ol5 rysgiisiss11335355525gfmggsgggrsi:z:s:sf.,1,5z5:ffgigsggfzig:misGr,,Q51gggfztifiysgszissww ,mitesezirzxisigiasififtfiwsssizwszxzsslffzzQ'tziiaifislfi-WEsiiiififriwwii . rcszsqgffr-ggziwafas: , 1 :ssfzssriiiifzzgtzzaszszs.. igzssli-f.:frg:.,s2SSllt, . ..,.g.f: fe: 2 .fuses mwemf , 2 of w 5 fi W wififzzss 1,:,mff A H911 Q' A2wwe:f,:w:a.,mgbff,ma :aww ifisit-5:51S:5.,s14iri.s.zass+sfaE2ass322f, 5fEEEizE5.iz?J.2isaiWEw.isaa2itse:.azs.swwa,W.Nas wa... Maas.. ....,..,....wa,,a,..,esa:.,...,si.z.....a..:.,.......,, ,.,,,a..,,.,,......s.z.,,,,,, g . .......,....,,.ssff..it-...... , , .,.....,. E 12253 swfwwii' gsa.fEsi::4.:zg:.2 ar. - sm-s.2w, .1 assi? W Q zysmsw si.. A f sfSVfJLs A5353 mam, . Q. 42.-rg.-.gy we 'fs swzztxznsss Fsissswfm Qwgrf 1 isis .zigzag gasses. rt ,QW sn ...,....,.. . ...W sssisasiesslss Q. tmsgq, agic Man by Kim Judkins The strange, the bizarre, the unexpected. sw, sz zz.-22 msf'Ersli:.w ,s.,.... , , ,am ...s.w,-:ss M. ...,, S., ,M ff-f mf f':....v. 5 P9 Qilflif S me-sg . rsfwtiztwa ., Qs.:.s.:.. , ...Agia Wilfiag 1 1' 1: 4 5555! its 9' ...S S ,WSE .5 .igfffisw ,iss .zzz 5 at 35.22 Z7 QESQQEQQQQ 'S'1l?EZiZs slew 'S W9 - l1.,.f::,swW2rg4f 3 ' -wzmzsz is r QL2w1W'f:3f::.si 33225 2212233515 his SZZLNQ at-fflssw as btw: Q., .saws Swv. . W . . 2-A 211i 115.2523 -'SBS Z xitgmxeef 2 1 1 sv ' ' gwmoifjr SY 5 'Via v 3 W'?Wilu'ESSf wwgsfzi wwilw, si, start mm. . . Af... QwMf2.tlEsZ.asw .,.biwwQ,, ,.s,.mi 11 . , is 1 , W Wm..,., ,Je 5 is .9522 gsfgf sas..,.,swg iflsmzervgggg 3 , fs .si Wggggirizizswi wigggtg.. ,,,...,i. sgssgssk. ,,., W kiss ...wwzzfmszssl ss we , JM. ...Mfg W, : f wifi 1 ff , ,m,,W... 3 Msts21Z5'1'if.SNe .vt-arms i i was ms.. 1,1 H ,, ,, , mt fwzsszfzzzmiwf M., ,,,,,..a.,sW iii if 5:1227 :S ft 12515529 :iii ESQ? U ik mggggi, W gggrggiiiizig , .Q sdswvji wwssizsassi ifF'f'.'Efz:::::i ,v,,fgeqgf.:Q: a. 1fsssa.1w:f.ssf Bit .::22-iggigegw if 'iitissssigitigzsgz gzssisiiszg. , This is how Jerry Dunaway, Auburn student and professional magician, describes both his magic and his apartment. This 22-year-old pre-med and chemistry major has been performing magic tricks since he was nine. His apartment is a magic place, filled with tricks of the trade and posters of Houdini, Blackstone and other famous magicians. I was introduced to magic by a cousin who did some card tricks for my family one night. l laughed at hime and he said, 'All right, smarty, you do it,' and I DID. That was the beginning, l guess, he said. Jerry does two types of tricks - close- ups, like slight-of-hand tricks and stage tricks. His favorite act is making the audience think he's messed up and then to recover and surprise them even more. I also like to get back at hecklers, not for revenge, but to make them laugh at themselves, Jerry said. Jerry collects the props for his act one at a time, and his apartment is furnished in Early Magic. When he says he doesn't like the normal, he means it. He has a human skull named Hadj and a crystal ball with a real bat in it. He's created a computer that controls the lights in his apartment by sense of sound and built a telephone in the binding of an empty book, Dial M for Murder. With at least three shelves full of magic books, Jerry is still learning new tricks. One more question - can he saw someone in half? Of course. The strange, the bizarre, the unexpected. Eg I ...is llmsn KATHY SCHUGGS gisggzsssqgggsggzsfssygziiygygggy,a5,...is.mzggggg,Qt 'Zag W-.agvg 'f 'W-gggegggg: 7 iiygg. Nr' args L.,f.,wg,157353:ht,g.5gg5?1:221,:.sM,4..151, ..4,5gsg,g M Mafia..-swisffsrssms ...aww-ss:szfzswgmw , ----eg.. 4:55. , . ,gwv ......sJ, ...M . gg.. f 4fcSW..., .Ue:e.si,,,.,.'rW mn.. U ,mv Q zfiafggzg.gp-:fsisgyggzmzasgggffiggigsfsisiszftistfgszs K t F'-t'-15152wgpff-.gzsazr 322515-, 5:2 2 f.1Ztgs:.,2,E .sgzsa Kilim 5-Sifflffllff Q .iiflfiwwf ' ' 7 51'?ww'NiffiififkliFw-dafvfififffsflksshu , 4.t..B2V?3Z'??5ifs--CSLQZF-'ZiaFZAIWZHM-. . 1Z..f' W , as , 6 3 .a J vfwyegiji. -iqizsiilfi-. .fffenff . ,, iiflwtl.. W' A 'llifaffaitf T ,..,wg5gg. . Q ' 2 as . f's-A-Wfwisklfazfi ww-rH4.v?fW9g2'g:' g,sz,'f.:1,,.,'5,t.iw1f','.L f.s2SW:w li. -32557, EziitlifgwizifLgszsi:.:,,'--rff:Z,ti- is .sr - .::::a3s1z23AQs.Wh0'S:?3b8l5Y ,. . .. .....zzmzizfms,.:,.s5at2s::zwziza',ssf.g. . . . ' my:.:.sss5fa.,:v.,s:sW,-W: Us w f wsgssgzwswwgi:::i.:s:mgzit:...faxes.-wr-,.f..,,gggsiz was --fff ffsszif3t?gszisaiswsiwiggggziszQ mszzfs.-sf .iz ,:e,:.Sf.2'N M Eigsygggggit2125?-5ig,g3:,iLi3lSi?tf?2geg5g1Qgjiiiggiiiiffffgisigliil ,5,g?S'LT?., ...f3f.g,:fw.5'5ftg5g,3-Ig35qggggj.3PLs5::9?gZsgg,M 2 :2:,11:i?Q35ggg12gg,gggg332.,5wgggs:it2.,i,,,,igfgg,..-, -'sim f 5. ' feizits . rmgggggzst t2g,zt:2'Wi 2 Magis,-fztitgiff ag ff1mars.:111i-Yiflfzrfif ..1::g, , wfzzs. S ifiliggggggiilitiifg gggigsz :afimfggsgz.212liwfggigl.1sigZ52w 2.gzzzgsgsgisisrlzgssamt--1..:3,s,.a..sQg5,zzfggggsw .,,.s,w,35i :egissgtgmgtgs siiiiizggssiiifgggifgsqsiiiiagyzf 'f1,l42:Vf ffl 117 1,.ggg:.2i.,,3gg g'752,SZE?fs5g33a. ,z,.:,.,a.,..tws2s.,...,s,,Naam....t.ss?-mist?ztiiiiitlizmaississ...,q,,z.g.....,, .. z ,Mags...,.wimefgft.wewi..,,.mwz2.. wc- :sam ,- ,- f. W f 1 , 'i' ' i Q ' Wfsiifiti siiiihiwfsatisii QE312tiiwfmiiiiiifsiflyfiiistrtH2dw'2+GfSNt5i?ft?1tti'?'?i.'ftiw5M'X tisimiivs- 1556219 'itLtfS?i?5?QW'fs'2lWG-ft QisZfiiifislifsgiiwnwiasftstgsxiwiiiftifkiabiifitfitthtf ' MQW5'5W3iff'ftmm'fi5Wt?,t?2Swift?LtWZ?M3b151tfQf?42i'VZ.44EWt'1?J55H'rfV 2 5 'ssigasiwfsp V Z 'iszsswwgtssgfgsrsg,3sm.w1gtz2f2ww'was ssmgwiitszsvvmwtf: af ,SWSLm +'5wt'i1lwfs'tR'fwf2::..sgisww1,f as:frmMwgszsszsgl-16.620542 V ,,..,.,,.,:wy.1m,5, . ,,ggMgft.,,.ts..m,,g,...w.ygts,.,..Qg:Qggsass.y,,,-5g3,.,,..,..,.mgg..Q, . f m...r,,giQ. ,fQ,mey:swMgmg-gsmigwmgg.vWS2E1,.g5gww .ssgwfeisizis ww was2:2awismf'-tismizisiiwwwwsr gas..-was ,gss f ,..1awegg,ggrg,v-ftwcsyssatazmwzaizwftsfzssizswwwqgszzzsNews .if . -wsfsssim .wmztwiwfssszzesmstszssss wwe: ewwttsfsfsawwwasriliwwbit -w'ztiqiiQY2gf V Wwfg.fs:..N .Wanwgnsg.,msis?IsgQ.s:stemsisQ3eswwr5e1.,,.Mswgsz:,sweg5e5gt ,Lessig 422Lisfs:twatisQzsfszsiiftsgsgiwttasifts fifwfsiiwwfsfsszsss smgitiitifeswwitf Miviztz.'?s1SMS?5ffWs'ii1wN Zmfffsifisf VWQM2. . Pit-fs? sims Wgggf,,asm.ms,mg5fsssqawt5.wfwww..f,e1xww3?w4m.f? ...ztmesssasqwsa Wswwi ...,..fwfwfw.swc0aw ,mskis -ex sigfm ,,,xiiwsfeb,.,,mw2s,,m,sQwms.- ,Q,,gL,?swXq, N ,s,,,,,g,WwWWsgeg.,,g,.ufwgg4,,t,t 1 Wggwzt,- V , If M1g,.g3,,.,:,wawQ,g f.. g ffftwttssww we ,gs '.Wrffi2fg.Ww'sg Bssswzwwgg 'WmMv.2:,f-' .aw ,ftsfwmzftkt 2 fwfs1ii3g.rsws'3N rams? EZEQWEWWM Jie w5M2st2'if'sW fis wif-Wisityiii Uwwiiiff Tie-W t WL VMS' 'ffmli Hwwfi 4, ' . .xssgwgg gg , +sy5yggg11.3j W gtw,35vgg55Sgs y ggsgggzmygg gzgagzgggz52,5NwgggggggszvisifggizgzUs tjggifigrfissiysm Tw ggiirsg g:'5.,3gS2w5Wssg2.t,q Q' Q sfitwgwysztsitfzpmJim45gaMs'g,ig23sS,smwgfgc1fQmiZig .M Uyssggsgstigatgswrm ,,f's'5,525gt':s iQ' . - . Wm. S -sw N wfgfmtse Vfgj.,WQf+4g:z,.wi M ww:mmm....Qg1l,.sW,we,gg ,J ,ws it ffgei ,wg SZQQEQEZEQQQQQZ-gggfg,fgtes,..NAME,. 1 Q q,s,m-y...... . M S, -1. msn A W WWA H 1 Qigggwgvwgigggvgssisi wget, 2 ig 1. 3 Ww55g,,,,y wwf, sl 7 A if QSJZUHUEZSYES' l'l'?353 fi fi if fiwikzitiwliliigatdia 0 6' 55 5 k 'gfskfif Qs g?fWg,wf22:3 z ww as Q2giiggiftssitisistiigggzaaiwg 9 E . 25 fr 2 wtf? twirftsihti :mf EN WWZU4? A qiisvavaizwwttig Y x 25 QP ' -' ' 5 .. - ,. l-.txsixsfkgggciqMswwwbhywmfs' .A My Mswmiggfggfrzi V 'QE-Wemztatwwirzii 1 gg -4 iysmsiisggaggai 1,552 Q .5 W5 4 wg X gig W Z 3 1 ...ini Q f..Wf.gi,gA,gs.s3s.wgQgs:,ii 1 .A wffrfwlslfml wwwffifg if fe MQW?W'.:BsSwt?22'ZagawNwt1Wx'53 swvMKf?VZ.5r.t.w .lsewsftscssss-M-:sv-1125 .wz:i..wHMt:Ms M-wwiwstii fmggmrwm g,MMW-mwszazwtsswlr:Mama- tmfwww .Www Q 'D W ww Wwvltfwk P3 was swwfszlitswg Nlfifswfv xfxtt-fSQis27r,W6tfLn Ps Wkssww- . 'M 1-'H ,zz Q53-z st 1 X 1 22,1 .QFEQ es A 7. 2335.35 gg mi my M1331 ,1 GN fig X gt 7 enzgfiiigigwszstass gsm A 2521331565222 .4 ws eg: mf is3szssbiittgigsrizggissswiwrist?212 5157? iasstkiifiiirleftlifiifiy f W2 1 M si :Q iff:,z.:2iM2ff? ' :ws . ,gsggggggzgzeggggggfsggiztii 5: L W.. wwgeggggsifiiiat insists tis. 5 .misfit 55213 Wig gg?g3giegg2gg,2i, ft f s tc isIQ5gsezitzissiwfgtifs:ww352 nf 1 T.. 1 rigs: raggssmzzgzggighsesgggiifigaiagt M Q2 1 ew.: wi ,S tt ' :fr we . Nfw:ii2r:,.:t3L1'itutws::ii' cn,-.ie SHIRLEY ,eff . , at r f . ,. .A , -.. ...W .M .,. ...U WJMQ W... qi.,, nNqu.,v.,i .....,..,,. , .x.,xY hAMk nH,, . . -11 ggztzzswzw ,assspgggeg zsziksw 'wrvsifii zzazsigrs or d At IS 11'1g91't1pS 5:13 By Brad.Mooy Mike, however, is certain people seem to For Mike Jones, a sophomore from think that being blind is associated with Pell City, Ala., life at Auburn University is being deaf. He gets shouted at often and seen through a totally different pushed, instead of gently lead. perspective. Mike excels in many areas, When I was a freshman I partied too from watersports and wrestling to training much. l use to think everything was an animals and tutoring children. The only occasion, he said. Now Mike has thing about Mike is that he is blind. settled down somewhat. He wants to W Mike was born with glaucoma which start emphasizing his studying-,more ,rg blinded his left eye at the age of four Already, he puts many extra hours into .gil months. He was then able only to see his classes. He takes a tape recorder to through one eye until he was hit in the classes and is usually given oral tests. - I - - 2' ,mil back of his head with a baseball when His textbooks are shipped from some he was 11. This unfortunate incident where called Readings For the Blind. He S fi M detached his retina and thus changed his doesn't have too many braille books for Y it life. the simple reason that braille is not a Mike is a special education major who very concise language. His copy of 'i raises parakeets and enjoys all types of Webster's Dictionary is 35 volumes and Q , water sports. Beside these activities, cannot be carried to English class easily. Mike is a member of the Rehab Club and Mike commented that the greatest We a member of the student council for problem he finds with Auburn is exceptional children and also finds time Auburn's unawareness of its assets. to tutor an elementary school child who Auburn University does not realize is also blind. where its real talents lie. lf it is This 19-year-old doesn't hold many Engineering or football, rah, rah, but the grievances with Auburn students and university doesn't seem to know about said, a great, friendly grouphof people its highly respected Fiehab department, who are generally Interested in his he said. handicap and not afraid to ask Yes, its apparent Auburn University S questions. One thing that ClO9S bOtheI' doesn't know about its real treasures. - lf? SUSAN BROWN V 5155? 4 KU p ' ' ' 11522'U91'?gZ'f?5'3f3Z?W5iWf2i:'25ii55E9S2515SJSi?WiW3S2?'s555W??ES5i5?f'ff M's333ifY5i3:iL.!2E?55i? ..2Yil3f5i3iS-53i5?'l33wf wwf'Ws my ...LBFZAGSZM Kfffsssisll we t isis... - Mimi? ' + siege 2t:..sSwwgggf,igs ii?L4Qwif',,'tYf'w swsbfzfiwfi 132 1 testes ,Mm ,WW W1:,..m.-K WN, ,..,..WWf ,Z U M. mfg: Q t 7.3M,,M .smwwstze rs ,syswg ,mass .,f...Wtgg:gg.:E'L,.,WmgEg13.4 .f..s..m. M' . .srr 7' P X X Z?iZ31M1P3Bea X WW 5fi2s.sML23?:fe,,,, -tiswcsywfr , ws, , :tmsmMsi'1zx..-. Q.. . wg. -X K f 1 A '.'- 5 I Fifty students from Auburn were chosen to Who's Who Among American Colleges and Universities by a committee ot both students and faculty. John Reagan Moore, SGA senator and Omicron Delta Kappa president: Clay Brown, War Eagle Girls and Plainsman president and a member of Spadesg Russell Kendrick, SGA vice- president and a member oi Spadesg and Bill Godwin, SGA president and also a member of Spades were listed again recognizing the accomplishments they achieved during their senior year at Auburn, Because, indeed, these students are active, we were unable to find three of the titty selected students. We regret we could not get a photo, but have included several of their activities. Those were: Ann Charlton, Beta Alpha Psi, University Singers, ODK, Mortar Board and Pi Beta Phi: George Jones, SGA senator, War Eagle Girls and Plainsman and Campus Crusade for Christg and Karen Lovoy, Glomerata business manager, Plainsman copy editor and Mortar Board. Dell Barker - ' Dave Bean Mary-stone Allen SGA director of elections War Eagle Girl , Squires Plainsman managing editor Eetabgausmpha Soromy Mortar Board historian Plainsman summer editor am a 'gma When asked what she has learned at Communications Board Mortar Boafd Auburn, Dell replied l've gained a Qmigrgn Delta Kappa EU 2913 Pl sense of confidence - both in the Squires ary- tone says, Life is too short to abilities God has given to me and in D - I- - Settle fOr just getting by,' Everyone the talents of those l've worked with. ave' 8 puma ,Sm majpr' Stays should get involved socially and academically to make the most of all Auburn has to offer. JENNIFER JOHNS JAY SAILORS Auburn is a major university with the spirit of a small town high school. JENNIFER JOHNS JOHN REED Dennis Collier Afro-American Association A Club Dennis, majoring in electrical engineering, describes Auburn as a lovely campus and a great place to meet new people. He said he has learned how to get along with many different kinds of people through his activities here at Auburn. Who's Who KATHY SCBUGGS Marty Con ry President, School of Engineering Spades, Mortar Board FarmHouse fraternity Marty, who plans to attend medical school this tall says that Auburn has the prettiest campus, the prettiest girls and the friendliest people. M. WEEKS Connie Delaney Morter Board War Eagle Girl Alpha Gamma Delta rush chairman Top 5 Miss Homecoming Connie says, Auburn, the university and especially the city, has the nicest people. ln one word she describes Auburn as warm, SUSAN Mike Dobbs President, School ol Architecture and Fine Arts Lambda Chi Alpha vice-president Omicron Delta Kappa Mike describes Auburn as a wonder place of opportunity where success is attained through sacrifice. agina Bradford nicron Delta Kappa Lambda Theta, educational inorary ss Auburn 'ten asked to describe how she feels lout Auburn, Regina said, Auburn is very special to me because here ere is no real pressure to conform,- rtead, you are respected for your iristian witness, which is the most oortant part of my life. JENNIFER JOHNS , fw,,..-L,,,,,.- 4, . .i. . i , f . . , ,. t 5 4 ,. ff 1 , -X XX L 5 2 Al, ,,,,,, A . la. I g, ,,,, ,H 'Vk , , ,, 1 1 JENNIFER JOHNS Dorminey year letterman in football a Lambda Chi an outstanding player on the n football team, used the word diy when asked to describe n. He said it has a special kind of ess and a warm atmosphere. Lynn Brown Glornerata editor Plainsman assistant news editor Tiger Splasher, ODK Alpha Chi Omega sorority When asked to describe Auburn in one work, Lynn said that word would have to combine tradition, friendliness, beauty, and unity. She said, You simply can't! Theres no such word! CRAIG SHIRLEY James Carpenter Naval ROTC Afro American Association president James, a junior in mechanical engineering, describes Auburn as challenging, and he says that persistance has kept him going through many of his hard times in his academic career at Auburn, BILL SCHNEIDER Tim Dorsey Plainsman editor Plainsman technical editor SGA Senator When asked to describe Auburn, Tim simply said, lt's a great place to grow up. He said he has had a lot of good times with some good friends, JAY SAILORS Rick Froehbrodt General Manager, WEGL-FM Alpha Epsilon Rho Alpha Rho Kappa president Rick described Auburn as a quality school with friendly people. ln a word, he called it 'personable He feels he has gained a lot of practical experience while enjoying his time at Auburn, John Classe Sigma Chi president ASCE Campus committee on fraternities Order ot Omega A John, a senior in civil engineering, says, Auburn is a university with a traditional background, a proud student body and a tranquil atmosphere, JENNIFER JAY SAILORS Amy Gaddis Kappa Delta sorority Student Government Association National Collegiate Association for Secretaries Order ot Omega Amy says that being involved in various organizations has given her the opportunity to learn to communi'cate with all types of people as well as making many new friendships. whos who 217 Vanessa Elaine Gilbert University Singers Mortar Board Alpha Delta Pi sorority Omicron Delta Kappa Vanessa says that as she goes on to greater challenges, she will 'Trust in the Lord with all my heart and will not lean on my own understanding. That in all my way l will acknowledge Him, and He will direct my paths' Kate Gorman Allison Hamill Nursing School president Secretary, SGA public relations UPC horizons director Alpha Omicron Pi sorority Omicron Delta Kappa Phi Gamma Delta little sisters Student Nurses Association president Allison says that although Auburn is Auburn is my home away from very special to her, it 's a lousy place home, says Kate. The void inside to find a parking space. when you leave your family is quickly filled by your friends that will stay with you forever. BILL SCHNEIDER JENNIFER JOHNS Clayton A. King Omicron Delta Kappa Mortar Board Alpha Tau Omega Association of Graduate Busines Students Clayton says, Auburn is both an experience and a challenge that l wish everyone could experience and describes Auburn in one word friendlyl 218 whos who l BILL SCHNEIDER 5 K ,' N. - xg,-' l -:Q , I-zz - ssgrez stars- sr '.-g Y JENNIFER JOHNS Jill Lawhead President, School of Home Economics Director of intra School Relations Order of Omega Jill says she has gained the ability to work with many diverse types of people, gaining from them important knowledge which can be applied to her own life. BILL SCHNEIDER SUZ8nl'le LHWFBIICB 1982 Miss Homecoming Omicron Delta Kappa vice- president Angel Flight Commander Lambda Sigma secretary Suzanne describes Auburn as a place where one can grow in all areas of his life, learning to be the best he can be, part of what God intends for him to be. John W. Hargrove Kappa Alpha fraternity president President, School ot Arts and Sciences Spades John says, Auburn provides exposui to a wide range of thought and expression, but it is tradition and the richness of her past that makes Aubi what she is. BILL BlLL SCHNE Hector E. Llorens Beta Theta Pi president Omicron Delta Kappa Mortar Board Hector comments that, The professorship of any place of learnl its most valuable resource, lt is my hope that Auburn will look to this direction in the future. Ronna Kay Hickman klyce Heggeman Gary Hughes Delta Zeta treasurer Omicron Delta Kappa SDGGGS Phi Gamma Delta fraternity War Eagle Girls and Plainsmen president Gary described his greatest learning experience at Auburn as working with outstanding individuals through different activities. Xlpha Gamma Delta president Iommunications Board Drder of Omega LGA art director llyce describes Auburn as 'comfortable in the sense that 'veryone has a place and feels at ome. in one word, she describes it Mortar Board SGA secretary of student life When asked what she has gained through her activities a Auburn, Ftonna replied, l've learned how to work with others in achieving goals. She added leadership and communication skills to ,, her ache t . s colorful I Vemen S . Monique Key War Eagle Girl Squires Lambda Sigma Alpha Omicron Pi sorority Monique says, l've learned to appreciate people for what they are and for what they can teach me. f J ,A7 Qtr . i at f fy f f 4, r, K JAY srxitons BILL SCHNEIDER JAY Simons v ar 'i'NN I ,Ti K 11 in ri H JAY srtitons r ggV f r 3 Ron Martin r ' fr rr Af JENNIFER JOHNS , A ' , ' David Mann, Jr. KappaAAIpha fraternity i , SGA director ot student lobby JENMFERJOHNS JENNIFER JOHNS , Project Uplift Volunteer Barry Mask y Loard AU Band Drum Major phi MU Alpha president When asked for a general comment C t Ch I ' about his years at Auburn, Ron said l IFC president ppa Delta sorority Once' AO have searched for meaning during my First --Aubieu r Eagle Girl Auburn Kmgms Qrchestra Yeas hemp To Offer Wwe' when my 1980 National Mascot Champion - - rot er is t irst ' nherremc presldem David quotes a scripture from b h ' h' y, to cry when he needs O d f O f d of Om 3 Ecclesiastes 3:1 to describe Auburn: the fears, fo question when he fs Simply r er O mega' Gun er er I eg H I .rigor everyrhrrrg there rs 5 Season and a Wrrrrng to accept: to pray when he is Daffy, an active leader at Auburn, feels advises her fellow students, Don t time for every purpose Under heaven. ff Cwsrng, these are wha, r have round to leadership is action - not positron. so wrapped up in activities and be rm adam ,, He describes Auburn as the hope of OO! that yOU neglect yOUf D ' the South and the South as the hope tionship with God and your friends. of the Nation, Stan McDonald Secretary, SGA political affairs ODK, Spades Lambda Chi rush chairman Campus Crusade for Christ The one thing that has impressed me at Auburn, says Stan, is that l firmly believe that the hope of our nation and for each of us individually lies not in man 's efforts, but in the power and grace of recognizing and accepting Jesus Chris as Lord of all Y Z Y BILL SCHNEIDER Kim Overstreet Omicron Delta Kappa SGA director of spirit Capers secretary Chi Omega vice-president When asked to describe the university, Kim said, Auburn is unique in that it is a large university which possesses the small university atmosphere. BILL HART Jani Pipes War Eagle Girl Mortar Board SGA secretary of academic affairs Angel Flight Jani says, Auburn is a university which people attend for a variety of reasons and to face a variety of challenges, but they all graduate with one thing in common, a devoted allegiance to their Alma Mater. ta ss JENNIFER JOHNS Jeri Pipes Top 5 Miss Auburn Angel Flight commander Mortar Board Jeri describes Auburn as a university that offers more than just good academics. She has enjoyed interacting with the variety of students who attend Auburn. t .gt x X 'X x 5 K X x XX BILL KATHY SCFIUGGS Todd Rubley A-Club president DECA vice-president Fellowship of Christian Athletes Todd says he has 'gained the Auburn spirit of competition on the playing field and in the classroom. Because of these situations, he says he has also gained a respect for fellow players and classmates. 9 JENNIFER JOHNS Tommy Shovelton Auburn Tiger Rag editor Tiger Club editor Auburn Circle business manager Tommy describes Auburn as a place where people come together and share their thoughts, ideas and feelings. He says, Some leave, some stay, but the memories last forever. we 3 BILL SCHNEIDER Eddie South JENNIFER .JOH MOFTBF Board Jeff Thgmag Omicron Delta Kappa PIII Eta Sigma SGA Cabinet Battalion Commander Army ROTC SGA treasurer Eddy says the University offers a challenge with its academics and the freedom to develop into your own type Mortar Board Omicron Delta Kappa of person. He describes Auburn in one 'Jeff Says' Hit is so refreshing I0 See . Word' Htfadmonl ., individuals more concerned with helpir others instead of promoting themselves. He describes Auburn as 220 whos who unique Q Amy Propst Alpha Delta Pi SGA executive secretary Omicron Delta Kappa Top 5 Miss Auburn Amy admits that although it's been said many times before, the best way to describe Auburn is to look at its people - students, faculty, townspeople and l. ,R t JENNIFER JOHNS Paul Roberts Mortar Board president Omicron Delta Kappa War Eagle Girls and Plainsmen Paul describes Auburn as the ideal place to be a college student, He also calls it heaven on earth. JOHN REED JOHN REED ura Wehrum appa Kappa Gamma sorority JAY SAILORS Nancy Wingo Auburn Singers vice president War Eagle Girls and Plainsmen resident Secretary Omicron Delta Kappa ortar Board secretary micron Delta Kappa i Delta Phi ura describes the university as a ace with catching enthusiasm. In a ord, she called it a warm little ace. Mortar Board Nancy feels that Auburn is opportunity - the opportunity to develop your potential through interacting with others and by taking advantage of all the University has to offer, Maria Rogers UPC assistant coordinator Auburn City Council Civic Enrichment Committee Auburn Chamber Music Society member Maria feels that, The classroom is only a minor portion of a university students education. She says, One should be educated not only through textbooks, but by cultural events and social interactions as well. BILL SCHNEIDER ..T........ D. KATHY SCRUGGS Alpha Psi fraternity president President, School of Veterinary Medicine Order of Omega Mark borrows a phrase from a sociologist in describing the University, 'an island of sanity'. Claire Rohs Campus Crusade for Christ Mortar Board vice-president Kappa Kappa Gamma sorority Claire describes the university as, the perfect place to 'stumble up the back steps as a freshman and walk confidently out the front door as a senior' KATHY SCRUGGS JOHN REED Steve Wood Varsity Swimming, captain Assistant coach Varsity Swimming AED member Steve says, Auburn is a place full of love and spirit. His one word to describe the University is spirited, whos who 221 2 'Z 3 514 3 if New Graduates 81 Seniors .. QTY ii Qi Jr 1A , 3 1 4 m'1 t'u Kg? wi Tix ' Vi v 2 M' 4 39 Q wiv, mg , wfsnffifl 235 mr N151 'rf -v' sim' at T ?,3 WJ ' Q 1 3 i ' ,. -gy, f A, , xv , ,. 7 3 m fi Q 5 . , 4 Q 5 1 ',,. , rkr: 76 L77 , 3' ,,?1,,, , ' 8 Q' ' A i w J,, i 4 N .. Vrykf K . ' A H . 1' 5. K K -f1. ? fr ,. E I ...M HM - CRAIG SHIRLEY .ACM 3 ' ,L E ' ef . mA'LA ,Q ii- Q I VE J, N fe. Tin.. - . -5 -., ,. . - -ff - + 2 5 . E, ft, , , it ,, 5 , - , V I vw ' -1 , I :M , , f, . ,, , ,,m,. A fb V LA. , N A. X - sf .1 - :ff I' , ,A - e' - ' ' 1. -.V ,, .I .tu 'a :.,,i. , t- - al X . . A ,tl ' :.f,:..: X - - f. -L. -a' ' H- , 1,1 . 1, -,, , 5 . L I Q , X 3 . I r - tv ' , .I , . ., Q 5 W ' 715, w - I, IA. . ' I I -'-- , rms,-A I .- ' 3 IQ 1' - . N - -N -tai? I f- -4 , ., xv' i,..:f..'f, I 4 A Elf-X3 F. I IINAXIE Pt is 7-V x iffiaf V Lex' .., , ee 1, AS A? .,BfsstE- 5 fy Q e..sA,. A fs Q- - L. . 'is -1: 5 ' ' 'Q ' 1 : :E ,Vi 1 .x.. ..., , I is st- are : A-' . QS .::.. , X - , A 2 ,, A . , , ,Y 7 - iv V . L 4.5, ., , V , , . A M - I tw , Qi ' - - . ' ,fa S H . , ' ,, -: 1 ' :- '--,fzfwfi A , I ff it , ,,W,Lx . , ..X.WL , .. . ,fL,' I hhh - bh ' ti ,, 1 - iw ,: -xhh . 1 2 Yi 54 , .,. ,K -K ry E .. L -tw: !!! mi: llll ' ' - ww- ., was . 5 fkef A15 ' -if Q A 'NI . .V amine E ,sew e :::: L., W7 gl-'if Es:i?F?5?T 'g ' if. fQf? Lis K , tt . . A Q- af '-- Mishiim :nnis in :nu ill V S: . .. - - xi. vi Nz: Y' H . ,,.. W. . , 1. Lggnf if-,NS get pain nnf' f,!1l:::-nn: . u r f1:Isn - f2 ' s B X Til 'Eli V' T., AX , my ,fl ,-.wx E - 5 e .f,z:, I L an Q55 MSX 5 ,Viv A . , S. L 'MM llhr llll1l2fru.4 RV , 4 iii R. .S i. 2 .W .-.. -w YK: mf f- '5 at .3 . mm., ,t . 5, V fi , ' A' .Qu Vg s 1 -eg , - i . --Z J I ' 23,-. . - , , T I - : RW, . ,, L. S,:Af S . 1 , , , JY . ' ABOUJAOUDE, JOSEPH: AFI, Bekennaya, Lebanon: ADAMS, CHARLES: EE, Auburn, AL: ADAMS, LISA RENEE: CHE, Talladega, AL: ADAMS, RHONDA: PUB, Sylacauga. AL: ADDISON, CRAIG E.: FLT, Pensacola, FL: ADKISON, BILLIE G.: AC, Slocomb, AL ALDERMAN, SUSAN: PB, Plainville, CT: ALEXANDER, CHUCK: EE, Wlndlield, AL: ALEXANDER, STEVE: PL, Auburn, AL: ALLEN, FRED H.: ME, Molino, FL: ALLEN, JELINA: MK, Decatur, AL: ALVERSON, JEFFREY M.: TE, Auburn, AL AMMER, MICHAEL: EE, Pensacola, FL: AMMONS, LORI: CJ, Dothan, AL: AMOS, STAN: ME, Auburn, AL: ANDERSON, PAM: PIR, Hatchechubbee, AL: ANDERSON, TIM: AR, Troy, AL: ANDRESS, MAXEY: VAT, Satsurna. AL ANDREWS, BARRY: IE, Lafayette, AL: ANDREWS, RHYAN C.: EE, Opelika, AL: ANTHONY, PEGGY: ME, Jacksonville, FL: ARDOVINO, LUANNE: HPE, Birmingham, AL: ARNOLD, CAROL: FLT, Auburn, AL: ARNOLD, GARY BRUCE: CE, Selma, AL ARRINGTON, RODNEY: HPE, Woodland, AL: ASHLEY, KELLY: CE, Fort Payne, AL: ASUNCION, ERIC M.: VAT, Lafayette, Al.: ATCHLEY, SHARRON: PRS, Guntersville, AL: ATWELL, GINGER: IE, Huntsville, AL: AUSTIN, BRENDA: RSS, Enterprise. AL AUSTIN, MAX: PS, Tilton, GA, AYER, LEE: PY, Bonham, TX: AZBELL, RICHARD: CE, Auburn, AL: BABB, DAVID: EC. Ringgold, GA: BABB, LYDIA B.: EEC, Montgomery, AL: aAcKus, susm: voA, Birmingham, AL BAGGETTE, SUE: PG, Mobile, AL: BAILEY, CHARLES: FI, Birmingham, AL: BAILEY, GREG L.: FY, Americus, GA: BAILEY, HELEN: SSS, Wadley, AL: BAKER, DAVIS: LA, Birmingham, ALI BAKER, GREG: PB, Auburn, AL BAKER, SUZANNE: IE, Auburn, AL: BAKER, BRIAN: MBA, Auburn, AL: BALLARD, JAMES: EE, Columbus, GA: BALLARD, PAUL: ME, Birmingham, AL: BALLARD, RANDALL: CPE, Saraland, AL: BALLARD, STEVE: AC, Sulllgent, AL BARBER, ANDREW: ME, Mobile, AL: BARLOW, KATHERYN: GJM, Houston, TX: BARNES, ALAN: PUB, Huntsville, AL: BARNES, JOSEPH: PG, Chancellor, AL: BARNES, MARK D.: BSC, Johnston, Rl: BARRAZA, LOUIS: IE, Huntsville, AL BARRETT, ANGIE: PY, Lalayette, AL: BARRY, DIANE: PFIS. Alexander City. AL: BARTON, DONNA: PY, Chattanooga, TN: BASILE, KATHLEEN: PIB, Scottsboro, AL: BATCHELOR, CAROL: TMT, Alpine, AL: BAYLES, RANDY: GC, Monroeville, AL BEAIRD, CECIL: INM, Loachapoka, AL: BEATY, BARBARA: CS. Louisville, AL: BECKETT, PAUL: CHE, Auburn, AL: BEDSOLE, MICHAEL R.: CEE, Oneonta, AL, BEDWELL, CLEM: VAT. Flobertsdale, AL: BELCHER, BILL: AC, Brundldge, AL BELL, CHRIS: CE, Hueytown, AL: BELL, DEBORAH A.: PRS, Thomaston, GA: BELL, MICHAEL: CHE, Mobite, AL: BELSTERLING, LINDA: INM, Montgomery, AL: BENEFIELD, JEFF: CE, Fort Payne, AL: BENNETT, BETH: MK, Brentwood, TN Graduates 8. Seniors BENNETT, CYNTHIA W.: SC, New Hope, AL, BENNETT, FRANK: HF, Albany, GA: BICE, MELISSA NEAL: AC, Cullman, AL: BICE, TERESA: EEC, Alex City, AL: BING, JIMMY: TN, Morrow, GAL BISHOP, BELINDA TURNER: LT. Auburn, AL, BLACK, ELLINOR A.: AES, Auburn, AL: BLACK, SCOTT C.: MK, Temple Terrace, FL: BLACK, SUE: HHE, Birmingham, AL: BLACKBURN, CATHY: EC, Georgiana, AL BLACKBURN, PHILIP: ME, Georgiana, AL: BLACKMON, MIKE: EE, Dothan, AL: BLACKWELL, REX: MH, Birmingham, AL: BLAIR, BETH: MK, Birmingham, AL: BLAKNEY, CAROL LYNNE: CHE, Auburn, AL: BLANCATO, NANCY: PRJ, Stone Mtn, GA: BLANKENSHIP, KATHY: AC, Auburn, AL: BLEVINS, KELLEY: HY, Marietta, GA: BOGDANY, DANNY: AR, Longwood, FL: BOHNER, JACK COLLINS: IE, Dunwoody, GA BOLEN, TINA: INM, Enterprise, AL: BOLLENBACHER, JEFF: CH, Huntsville, AL: BOLLER, JOHN C.: AC, Foley, AL: BOPP, TOMMY: PRS, Montgomery, AL: BORDERS, LARRY: BSC. Montgomery, AL: BOSTWICK, CYNTHIA: CPE, Arlington, GA: BOULTON, BILL: EC, Huntsville, AL: BOWEN, JAMES: AR, Birmingham, AL: BOWER, SALLY: NUR, Nashville, TN: BOWERS, DAVID: AC, Birmingham, AL BOWERS, TOMMY: AM, College Park, GA: BOYD, MIKE: EC. Fairburn, GA: BRACKETT, JONI: MK, Gadsden, AL: BRADFORD, REGINA: EEC, Gadsden, AL, BRAND, KATHY: AC, Wadley, AL: BRANTLEY, DICK: EE, Montgomery, AL: BRANUM, CLAYTON: IE, Montgomery, AL: BRAY, WILLIAM .L: BSC. Columbus, GA: BRIER, JUDITH: FLT, Mobile, AL: BRIGGS, NEILL: CHE, Sessemer, AL BRINSON, DOUG: CHE, Warner Robbins, GA: BRINSON, ROGER L.: CPE, Pensacola, FL: BRISCOE, BEBE: OMN. Decatur, AL: BROOKS, KAY: MK, Lalayelte, AL: BROOKS, LIZ: HSA, Greenville, AL: BROWN, ALISA: CSE, Evergreen, AL: BROWN, FRANCES: CEE, Evergreen, AL: BROWN, JEAN: EEC, Roanoke, AL: BROWN, MOLLY: AM, Dunwoody, GA: BROWN, ROY: BSC, Montgomery, AL BRYANT, ROSIE: VHE, Lalayette, AL: BRYARS, GEORGE: FY, AL: BRYARS, MICHAEL W.: ME, Pensacola, FL: MATT: EE, Albertville, AL: BUCKNER, DON: AM, BUFFORD, KEITH: MBI, Auburn, AL: BUFFORD, AC, Auburn, AL: BUGG, ALAN: AN, Wadley, AL: NANCY: RSB, Big Canoe, GA: BURDEN, BRAD: PIR, Birmingham, AL Bay Minette, BUCKELEW, East Point, GA: VALERIE: BURCI-IINS, BURETTE, TERRI L.: HSA. Clanton, AL: BURGESS, CONNIE: AC, Boaz, AL: BURNS, CRYSTAL: GL, Florala, AL: BURSA, DEBORAH: IE, Fort Lauderdale, FL: BUSSEY, KIM: CJY, Talladega, AL: BUTLER, JUDSON W. JR.: INM, Phenix City, AL: BYARS, LISA R.: MH, Summerville, GA: CAHOON, KIRK: OMN, Birmingham, AL: CALDWELL, SKIP: ME, Birmingham, AL, CALHOUN, R. DALE: EE, Birmingham, AL CALLEJAS, J. RICARDO: CE, Metairie, LA: CAMPBELL, KIM: LT, Brownsboro, AL: CAMPBELL, SARAH E.: NUR, Crest View, FL: CANNON MICHAEL L.: PIR, Cusseta, AL: CANSLER, JOSEPH: BSC, Apo San Francisco, CA: CARLETON, SHARON: MU, Grove Hill, AL: CARLISLE, IRA C. III: FY, Toxey, AL: CARMEN, JOHN: EE, Columbus, GA: CARMICHAEL, LYNN: PE. Milton, FL: CARPENTER, MARK: IE, Wedowee, AL CARTER, ALAN K.: CE, Warrior, AL: CARTER, CHERIE: INM. Palm Coast, FL: CARTER, LISA: ADS, Madison, AL: CARTER, RHONDA: EEC, Fyfl, AL: CARTER, THERON: ME, Ariton, AL, CARUSO, BECKY: PPY, Fyll, AL: CATES, DOROTHEA: AE. Melbourne, FL: CHANCHLANI, NARENDAR: BA, Sion, Bombay. India: CHANDLER, LINDA: CEE, Talladega, AL: CHAPMAN, MIKE: AR, Decatur, AL CHASE, WALTER H. III: AM, Columbus, GA: CHENOWETH, ROBIN: VOA, Pelham, AL: CHESSER, JAY: FY, Perry, FL: CHISTOBAL, GILDA: NF, Auburn, AL: CHU, ROSE W.: IE, Auburn, AL: CLARK, MARCUS: Fl, Cullman, AL: CLARK, SHARON: FY, Birmingham, AL: CLAY, EDDIE: HPFI, Opelika, ALI COLE, LAURA: CEE, Albany, GA: COLEMAN, WANDA: HSS, Childersburg, AL COLEY, SHIELA: VOA Glencoe, AL: COLLINS, MORRIS: Auburn, AL: COLLNER, CAROLYN: FSW, Cocoa, FL: ME. Homewood, AL: COOK, JEANENE: VHE, Jackson Gap, AL: COOPER, LENORE: CSE, Haleyville, AL: COOPER, RENAE: NUR, Ozark, AL: COPELAND, GREGORY: AEC, Boaz, AL: COPELAND, JENNY: EEC, Boaz, AL TE, CONNOLLY, KEVIN: INM, Florence, AL: COOK, DARYL: CORDAY, GARY: RSR, Warner Robins, GA: COREY, RICHARD H.: AC, Boca Raton, FL: COWART, PAUL R.: LA, Lineville. AL: COWART, SALLY: EEC, Lanett, AL: COX, MIKE: INM, Huntsville, AL: COX, TERESA: AC, Montgomery, AL: CRAVEN, JEFF: EE, Birmingham, AL: CREEL, CHIP: VAD, Decatur, GA: CREEL, I DAVID L.: EE, Gadsden, AL: CREEL, PATRICIA N.: VAT. Florissant, MO Graduates St Seniors A W Z rf 'Z' V ' , I Wren: A 7, :mm A rr,-. W V A A -, of 12 : , , far i Z Y. 'fy - E' -X. .1 , ,Q ,., g A L N f r . , A , .. if i'I' ., .. ,, n -X14 1 , ,, 4 at , ., r: - fm, fr ... an gr , I V fi I fs' , A , X I f I ' ' ' V47 f, 59351: ,aigtf :, V - Q - I M ' ,f W ,Q ,, 5 l t'::::i :::tT2!- - gf, r .,,,, 1' , 1 I ,, . W f rf-r ,wifi r-ffgrgw ,f- f . , U e Q f f at .v-' II H M I r I 3: ,. ' ,iff . ,1 ' L. giKfn?W? 1 2 f - 'A 'S to : if .4., F r: ' 'lf I ' - f I' :W :Z f. - ' - ' : ' :ff : 4 if I , S: C- : If xr' ', grit' I s ' Ji 14 . J, ,z , f . K, m4L 5355 it,,:ni'f1ti i , .. .. . P-f Q, wfrwfaa wwf f My 3' , , ,,,..,, I f F V 4 J l ' str, , M, I gill 'W K , 1, Z ' ,f ' ' Wm W' .V 'mm rl? I ,f efgwwwf f 5' :' I s, A I 4 4 xr' W 2 My X if 'Q Y '10 1 f f ,Ne ff 4! '9! fur I, f, - ffrvf : ,,r. f- . 4 , f . fi' f ff aw pf .,A A gg I Sy, . , ' L -2 i 4' :W'mMW:wWe W We 1, ,',,- , ,3 , ,V . it .wi 4, ma. vi r.f :rat I Z: E. .E ,zz i - , 5 fi. , ,M W V , . X 1 ,y r, , 4 , 7 , ,.,. 1 , at , t . ff' ,- .z , 4 :f L- f-- at tr-51,0 .f f ' 3 in gnlxlf' Q , I 3 1 ' l- 1 f 5 , ' X . , ' W ' wH,tW ew eefe.aaM, lsrllr , :. M. rr I 77, fe ,, wb 'I ,f'- 'V gg Xa ' if ' X Zffll-IL A' ' 1 iii! 5 ., A M 'W l nw :fx J -' nf , W ' ff: S' . , f , 5 -fri ,' g Z, 4, L . ,, M . :gli , Z' , , ,, t , ' r . ' ey,,,xQ,eez Q ff- :A ?Wrwr,, f 2' I z :g . wa ' -f 4 f'f ., ' 1 T l : .. ,y ,, , 'lf' ' rxjfiv - :f 1 I3 W'-. 5' :itz , 'AAQ W L s! V' E I ,ggug 4 W ,j 2 . I ..t:.'.-: :-.,.,.., A , ,f : ' I 3 l i i . ' : I ' I 'Lf I'ii ' 9777 ' . -I, - -,,. V ,. 5- Sl ' r I. ,g , . ? W! P no fi 8 F' - gi, 1' B 3 f '. V if 1' il V ,, I W I , H , H i . 4 ,:, in , ' 'T . y ,, , ff r, , , 1 : fr, - 1:-44, f lilo :MA f -, ,-, , 4 , :kj .- ' ., f , : f , . f M ' , ' r ' : 51543: , ' ' A ,H -,ZEZ WF ?l 'f':' L 'U ' .rl . ' H ii ' -, ' 1 fl. ' , .f,:,i:,i.,Sa,,i,f .r 21V'1f:lr I' , . W: I I e f I f- Qu.:-f2 '::H: , 3 -. V V :: , .-4 . - 1 1 l ' , ta :- Y I ,., ,r , -. 'V Q t f- 1 ' Q : , f -ff. - 1, ' ' Z: 41 ' If'j3,:g,g,r,fi5 i is T' .1 9 W' 'f ri, 1. - it r. f f wilt: i , Q 5 . ,a H -Ng, mi H gf' f ' I' 'ral rf.: 5 F 'Yi . - i- rr' , .,....,,..,. ,, 'ff . La , we .f 4. 5 :enrinre lllll f ti: 5 q': fl , ,- , ,I A ' f r v ,1 , l 15: III5iI'lf4 tu- -.. , r .1 ta, ' , 'fm gyirrfrn , - 2: in wff'W AEE ff 2 ..,.: . Q y:l ,, f a 5 ., ,:j,:' I ,I I A :tif r r 'J Gif: f T 'i f' 'E J' - : , I 53-iii f , yay, ,j ' , j' I ' ,- ' ': I 5 ' ,Q 1. ' ' I , ,gig Q :ff A r-r , :A 'fmrfwf V awww? ?Q+wfq , , , eff' . I fy, ,,, I :gy 1, , ,V ff , . . W 2 f Y ,Zz : . Q , at A E , 1' Ja , 2 .' ,4 ff 5 A 1 11 I ry, 255,11 ' 4' 'Q 'M ' ., - : ' 2? , -, I f A 4 - . . f' f' ,. ,,t , ff 1 ' U , .:. : 'M A W : 9 'f --fn: . f, 2 a, A H--he . K, .W tt- tl iv 1 , Q 74 r if : f it 'af f 1 2 'S-I I if A V i if Zag . gk df Q fr ,Q ff x I 1 tw M Awww: 0 1 2 5 fr fu? L 4 I 7 r ' ' Z 41, L 4, 1 ' f A, I 'I' if f . fl a L1 f Yi if V.. V.: ,.V , , rg 4217? ' 5 , 4' V l 19 ,VV mm A V ' Wil? - V' RW ' Q, V V . .W . . I ' ,VV ' - ' :S ka I' .1 . V 'V gm V e ff? H- fe ' .F L 4 ' ' 'V ' ' 1 A V ' 521: V ' LV VA- ' VV .VV 73' 5 I Q, V , ,, . V ,gp g V 4 A, VV ,,.. J, K V ,V . I AV ,'f1,,'n,,x S V. 7 - ,' 4, 55 V P - N,,, . A 'VV VV VV .V '. V 'V - ' . VV VV 'V fl in V .V f ' V V. fV . u V . V V ,4 v if ' V ' V, , Q ' . V 'V V , - V M- sw 'I V', T ' Q' 3 V .ef V 'fi' V ' : ' :IPW Vx-QTYS VL ' f . ' r V iff 2 V I P V Vw . ' ' .15 f ' '1 ' W NW' 1 6 1 ' i, 'Z' - 4 - : ,245 V4' ' 5 ' fi . V ' -X MV 1 - , A if, V - 2-1 :V V,gg:fV.: ..,, f V M, . - - vw ' L ' fi V ,Y . 7' ' :' .Wa it V' Ir' ' L, .. ,..,,.,...-q,-9F,,,,,,, s ir VF? A i IiE1':'::U 1 N 5' 2. ' A V 'W 5 5 7:1 5 ' N , , V-VV,V V, V,-V V- .VV ,V ,. V, 7- psf: V, i M ' V V 1 . V V -V V S .. g , 'LL'L ' V ., . If . :V ' ' , ii :ff 3 'r ' a,. 'YU 'V ' . - 1- ' 37 VHEV , iiiim f' it I W Vt f 5 f . K V J 1- ., ' vt' 's 1 f f'V. I , A , ,, . VV . , .V . . ,.V V V- V5 V .ww W 'V VV N V I f ' ' . V V ' ,... f y' V V V wr V ' ' V 4' , 1, V. ,V I V V YV: I Af I V V y. V ' ii :V I7 : V :QV I fi V. ' ,V. ...V :VV QV ,V 'M 4, A . ' K N' ' XV , ,I f ' S K ie X F V 7 i K ,331- . 1 A X ' it 3.4, f iw V KV? as ' V L ig. , ' V? Q H ' N an -f ' .. , ' M f VX V g , -- : V , ,,., r ':- i V r .gf lV ' ggi 4 -V:-ef ' ,A 'f f ' wr 4:2 ff ,fir If V .,,,. A 5, , . ,,,Vg,,.gz5,,k,,,,i,f ' flip -if 'Q A . wr:-.. . 5 75565114 +I V 2 4 LW' :t ' ' I 1 V V V ,, ,f .V, i , .W , gf ,, , , . -V V f I 'i .r , V i L Gif? VV , - -, Vg .J I M gb :yew ' Vw. - 4:-V '. , A ' '7 J: W'kk ' ' ' yt XV., 'wif' .' ' A' 4 ,V Vu, ,V M ' , ,W , gfijgjvf Q , g ga y A , , ' ' ' '-.gf V I I4 I V ' I 733' 'V YA 4 f M529 V Y 'VV' :Q ' -I '7 'f L LL V, x g r F ,Af 3 ,. fi Y, BL-,QV - , if J, G, rr ' i V ., ' ' A ' '- V' V ff .V g V.. If V V V ' ' y ' I 'I A U V,-W . T., V , I , f ,A VV I V., ' , .::: E., V .. L V1 '-lVMV- FA- T - .. V ' . . - . V , V 4- -I i '11 5- V E? -' - ' 1: V L -in -V if VV - r .-VVV , ew' . , V.4 V . . ,, -VV, V Vw V . , , T., . i , ff, QF: A ' ' fl ' ' V,VV V ,wif -i ' V 4 1 i ' UV 2' if ' ' W V 'V ' C 'i frzcfllllsi .. V VI V ' ,VVV . Vw. V .,,. ,,.V . V V':V V QW V 5 :Riff i'?WZ'QZW QVQV' .- V I . ' -' f V' ' ' ' . , . :V . l V f f TY 2 4 wr: .V V 1 riff: Q A ..- .: - I x V, ,,:, -. A V , ? n V i A4 is . .A 577, ,V - V ' 1 j 41394, E Q 'ffl' I -aa.. .V -i : , I 5 V I A :QV V A VG. ,V VV I -' f V.:' :TV-V .-I 3 -fi-- - 'r,V.,,,jgJ?VH:iW n m! H4 ,A f , 15,32 ' . 1' 1 ' ' ' Ti K 'NW h ' I I 24' ' . A , . J ' . ' V ' 2 , - sa ' 5- V ' ' ' V A V, ', V T 'iff 'V V .' rt Q' 459: VV , Vp VJ V VU , V V UV: gf V . 1 , . , ,gw , ., V 'f V-:V-A ISA VV greg V . 4 V. 5. M E , I . V I ' ,,yf:' Q' if fs V V :- ' r f V 0 M, 4 -. Q V-Q'V f V ..V ' . . - In ,x K 3 . X-'ix' r i 5 - V 4 Vw V- e f' V VV.. ' I ' . V V f .. V V WV , V .. . ..,, VV 44 . VV ,... V., VV. 1 A ' V . ' ' ,Cs Vr -Q -, Y x7 , . V ' ' 2 1' :M ' :S 4 QV. ' f V 'V V V I . , M . 42-A Y : .gh V . Q .kV M 4, V' ' 54 'ff W A +!,:fjff++ ,. W. V , ,ir , . V- V4 ,, V V 4 ' W' f f V, V . ,A Nm,,..., , V .. . ORISTOBEL, TED: CDP, Auburn, AL: CRITTENDEN, FRANK: AR, Decatur, GA: CROCKER, RONALD: CE, Lawley, AL: CROFT, ROY: CHE, Pensacola, FL: CROMWELL, CHRIS: ME, Selma, AL: CROSBY, MARGARET: CSE, Baton Rouge, LA: CROWDER, LAURIE: AR, Lanett, AL: CROWSON, SHERRI: CEE, Baker, FL: CRUMP, JIMMY: PPY, Mobile, AL: CRUZ, EDWIN C.: FAA, Manilla, PH CULVER, ROBIN: FM, Birmingham, AL: CUMMINGS, BRIAN: ME, Winter Park, FL: CURLES, SHEILA: EEC, Albany, GA: CURLEY, KIM: MED, Double Springs, AL: CUSHMAN, CHRISTOPHER: EEC, Warren, NJ: DAMM, LINDA M.: AC, Cocoa Beach, FL: DANNA, LYNN S.: SC, Miami, FL: DATSON, CAROL: VAT, Enterprise, AL: DAUGHTERTY, JAMES R.: WL, Alexander City, AL: DAUGHERTY, STEPHEN: EE, Gadsden, AL DAVENPORT, MIKE: BSC, Birmingham, AL: DAVID TERESA: HRA, Birmingham, AL: DAVIES, RAY: AC, Montgomery, AL: DAVIS, MARIE: VHE, Samson, AL: DAVIS, RICHARD: EH, Montgomery, AL: DAVIS, WILLIAM J.: HPR, Ferguson, MO: DAVIES, HEATHER: OH, Triangle, VA: DAWSON, TOM JR.: CE, Pensacola. FL: DEAN, GLENDA: CE, Atmore, AL: DEAN, KIMBERLY: PM, Huntsville, AL DEAN, MICHAEL A.: BSC, Anniston, AL: DEL TORO, MAGDA E.: FLT, San German, PR: DENNARD, TAMARA: IFE, Birmingham, AL: DENNY, K. SCOTT: PM, Nashville. TN: DENSON, BOB: IE, Deluniak Springs, FL: DEVORE, ROBBY: FY, Citronelle, AL: DICKERSON, JIM: CH, E. Tallassee, ALJ DICKIE, KAYE: JM, Ohatchee, AL: DIGMON, MARK: TN, McDavid, FL: DILLARD, BILL: EE, Hueytown, AL DILLON, JOHN: EE, Huntsville, AL: DISMUKES, ALAN: PB, Birmingham, AL: DOLBOW, FRANK: AC, Pelham, AL: DONAHUE, MIKE: MC, Montgomery, AL: DONALDSON, LYN: AC, Enterprise, AL: DOOLEY, PAUL A.: ME, Westchester, PA: DOOLEY, TERRI: AC, Huntsville, AL: DORMAN, BRAD: INM, Opelika, AL: DOWD, CHUCK: EE, Montgomery, AL: DRIVER, MARK: AE, Deatsville, AL DUBOSE, STEVE: AC, Evergreen, AL: DUCHOCK, JEFF: ME, Brookside, AL: DUKES, DARBY: NUR, Pensacola, FL: DURRETT, NANCY: EM, Atmore, AL: DUTTON, MICHELLE: RSS, Mobile, AL: DYKES, SHARI H.: AT, Auburn. AL: DYKES, WAITE: CH, Auburn, AL: EADY, BARRY: CE, Birmingham, AL: EASTERWOOD, JERRY LEE: CEE, Fairfax, AL: EATON, BETH: INM, Orangeburg, SC ECKMAN, GENE: EE, Thomaston, GA: EDGAR, CLAYTON: BSC, Deatsville, AL: EGGERS, MARK D.: CH, Auburn, AL: ELLIS, JAMES H. II: MK. Bartow. FL: ELLISON, KIMBERLI H.: EEC, Douglasville, GA: ELMORE, BENJI: FYE, Gordo, AL: ELMORE, ELLEN: AEC, Gordo, AL: ELMORE, STEVEN P.: ME. Jacksonville, FL: ENGINEER, KERSI: Fl, Auburn, AL: ENGLISH, MARNELL: IFE, Montgomery, AL ENNIS, BECKY: RSB, Atlanta, GA: ENNIS, JIM: INM, Auburn, AL: ERWIN, JOHN: INM, Decatur, AL: ETHEREDGE, SHARON: MK, Montgomery, AL: EVERETTE, EARL: AC, Atmore, AL: FAIRRIS, STEVE: CJL, Ozark, AL: FANT, DAVID: PIR, Opelika, AL: FARINELLI, TOMMY: CPE, Prospect, PA: FARMER, DANIEL JR.: BSC, Auburn, AL: FARMER, JOHN: PPV, Piedmont, AL FARMER, MARVIN: PPY, Talladega, AL: FARROW, JOEL J.: Oxford, AL: FAUST, CE, Gadsden, AL: FARMER, MICHAEL R.: FARRAR, JENNIFER: JM, Huntsville, AL: AEC, Selma, AL: FAULKNER, MIKE: AC, JEFFREY B.: GFL, RedkLeveI, AL: FAY, JOHN: CHE, Brewton, AL: FELICIONE, LIEZETTE: MK, West Point, GA: FENDER, MICHAEL S.: CE, Clearwater, FL: FERGUSON, WILLIAM B.: INM, Harpersville, AL FERNANDEZ, CRISTINA: FCD, Miami, FL: FERNANDEZ, FRANCISCO: AC, Miami, FL: FERNANDEZ, HECTOR N.: FLT, Coral Gables, FL: FERRIS, JENIFER: HSA, Birmingham, AL: FIEVET, NINA: VOA, Birmingham, AL: FILMORE, REBECCA: RSS, Brewton, AL: FINCH, RANDY: AR, Vernon, AL: FISHER, ROBERT C.: EE, North Granby, CT: FISHER, STEVE: INM, Miami, FL: FLECK, BILL: AC. Birmingham, AL FLEMING, SAM: AE, Oakdale, LA: FLEMING, STEVE: Fl, Bear Creek, AL: FLETCHER, DEBIE: HY, Fairfield, AL: FLETCHER, F.A.: HRP, Auburn, AL: FLETCHER, KEVIN S.: AC, Annandale, VA: FLIPPO, TAMMY: AR, Auburn, AL: FORDYCE, CHARLYN: PRS, Lanette, AL: FOSHEE, KENNETH: AEC, Horton, AL: FOSHEE, WILLIAM: AEC, Horton, AL: FRANKLIN, BRIAN: EE, Montgomery, AL FREDERICK, SUSAN: AR, Birmingham, AL: FREE, SHEENA KAYE: VHE, Samson, AL: FRENCH, MICHELLE: VAT, Roanoke, AL: FROMHOLD, THOMAS: EE, Auburn, AL: FULLER, LISA: INM, Long Beach, MS: FULLER, NORMA: MU, Russellville, AL: GALLE, MICHAEL: EE, Daleville, AL: GAMBLE, BRIAN: AY, Columbia, AL: GAMBLE, RUSSELL: EE, Webb, AL: GARCIA, ALFONSO: EE, Guaynabo, PR Graduates 8. Seniors GARNER, JAMIE: IB, Stuart, FL: GARRETT, PATRICK: EE, Childersburg, AL: GASTON, JEFFREY L.: BSC, Alexander City, AL: GATLIN, SHAIN: PPY, Citronelle, AL: GATLIN, TONY: EE, Athens, AL: GENTRY, MARK: Fl, Orlando, FL: GEDRGIOU, GEORGE: ME, Nicosia, CY: GIBBONS, CINDY: EEC, Auburn, AL: GIBBONS, ELIZABETH: AC, Deatsville, AL: GIBSON, CINDI: CS, Tallahassee, FL GIBSON, MICHAEL A.: GL, Auburn, AL: GIEROW, ANN: NF, Huntsville, AL: GILBERT, STEPHEN K.: EE, Pisgah, AL: GILCHRIST, LAURA: FM, Gadsden, AL: GILCHRIST, PAM: MED, Opelika, AL: GILLASPIE, PAUL: OMN, Auburn, AL: GILLIAN, GREG: CE, Pratville, AL: GILLILAND, JOHN: OMN, Kellyton, AL: GILLILAND, STANLEY T.: Fl, Robertsdale, AL: GILLS, PAMELA: AE, Seminole, FL GLADDEN, BRENDA N.: TN, Huntsville, AL: GLOVER, LORRI: JM, Dothan, AL: GLYNN, ELIZABETH: PIR, Jackson, TN: GODWIN, TERI: AM, Decatur, GA: GORDON, PAUL: FI, Marietta, GA: GRAHAM, EDWARD: AR, Auburn, AL: GRAHAM, JANE D.: EEC, Oxlord, AL: GRAHAM, KIMBERLY: VAT, Enterprise, AL: GRANT, RALPH: EE, Titusville, FL: GRECO, REBECCA: FT, Huntsville, AL GREEN, KIP: MK, Auburn, AL: GREEN, LINDA: LT, Birmingham, AL: GREEN, RHODA: EE, Montgomery, AL: GREEN, RUSSELL: CE, Clayton, AL: GREGG, MICHAEL S.: AM, Auburn, AL: GREGGS, JULIE: Fl, Silverhill, AL: GREGORY, ALISON: IE, Greenville, SC: GRESHAM, GLENN: HY, Wing, AL: GRIDER, DAVID C.: IE, New Brockton, AL: GRIFFIN, CRAIG: Fi, Birmingham, AL GRIFFIN, EMORY, E. JR.: INM, Macon, GA: GRIGGS, GLYNN: MK, Dalton, GA: GRIFFIN, KENNY: FY, Remlap, AL: GRIMES, MICHELLE: PIR, Titusville, FL: GRIMES, SCOTT: PB, Dothan, AL: GROOM, KENNETH N.: ME, Enterprise, AL: GROSS, KATHLEEN: CEE, Phenix City, AL: GROVENSTEIN, TERRI: RSE, Newnan, GA: GUILFORD, PEGGY: VBU, Auburn, AL: GUILLORY, ALLEN L.: BSC, Auburn, AL GULLEDGE, REBECCA: FLT, Birmingham, AL: GUSTAFSSON: RSE, Mobile, AL: HADDAD, AIDA: TE, Auburn, AL: HADDAD, OUDSIEH: FCD, Auburn, AL: HADDAD, SAMEER: EE, Auburn, AL: HAKEEM, ROBERT: ME, Bartow, FL: HALE, JEFFREY: CJL, Muscle Shoals, AL: HALL, KAREN: SY, Enterprise, AL: HALL, SANDY: VHE, Brewton, AL: HALL, STEPHEN: AE, Opelika, AL HAM, CINDY: RSS, Albertville, AL: HAMBY, ANGELA: NUR, Opelika, AL: HAMMACK, LISA: PRS, Birmingham, AL: HANKS, DENNIS G.: OMN, Phenix City, AL: HANSEN, KATHY: HY, Birmingham, AL: HARDIN, S. HAMILTON: EE, Eastman, GA: HARDWICK, VIVIAN: VHE, Abbeville, AL: HARGROVE, DANIEL J.: FY, North Port, AL: HARRINGTON, MARK: IB, Auburn, AL: HARRIS, JIMMY R.: EE, Monroeville, AL HARRIS, STEVE: PPY, Talladega, AL: HARRISON, GARY: EE, Monroeville, AL: HARRISON, GLENN: EE, Hartford, AL: HARRISON, JAMES: CS, Orlando, FL: HART, JOE: Fl, Naples. FL: HARVEY, MARK: ME, Bradenton, FL: HARVILLE, ROGER: PIR, Sylaoauga, AL: HASE, JULIE: VHE, Sumrnerdale, AL: HATCHER, GAMILLE: VHE, Pensacola, FL: HATTON, ANTHA RENISE: EEC, Sheffield, AL HAULMAN, DANIEL L.: HY, Auburn, AL: HAVEARD, BECKY: VOA, River Falls, AL: HEARN, ROBYN: PRJ, Roanoke, AL: HELTON, CAROL: Fl, Birmingham, AL: HENDERSON, CYNTHIA: AC, Opp, AL: HENDON, STANLEY: BSC, Lineville, AL: HENDRICKS, MARK: CE, Springville, AL: HENSON, CLAY: GSC, Chatom, AL: HENSON, SCOTT: ME, Birmingham, AL: HERBERT, GINA: SCR, Opelika, AL HERMAN, LISA K.: HSA, Magnolia, TX: HERRING, ANDY: HPR, Montgomery, AL: HESTER, SAM: PIR, Auburn, AL: HEWSTON, ANDY: FY, Marion Junction, AL: HICKS, T. DWIGHT: TN, Fairburn, GA: HILL DAVID: EE, Union Grove, AL: HILL, ELAINE: PPY, Millry, AL: HILLIARD, TRACEY: CEE, Grayson, GA: HILYER, JEFF: AC, Opelika, AL: HIPP, BECKY: ADS, Arab, AL HODGES, KAREN: SCM, Athens, AL: HODGES, MICHAEL: FY, Columbus, GA: HDFFMAN, ROBERT: ME, Raleigh, NC: HOGAN, WILLIAM C.: CE, Auburn, AL: HOLBROOK, KATHY: AC, Gadsden, AL: HOLDER, JAMES M.: INM, Stevenson, AL: HOLLADAY, SANDRA: PPY, Hartselle, AL: HOLLEY, LORI: Fl, Montgomery, AL: HOLLIS, TAMMY E.: FCS, Opelika, AL: HOLLOWAY, TRACY: PIR, Mobile, AL HOLT, PAULA: MK, Orange Park, FL: HOMAN, TIM: IE, Jacksonville, FL: HOOKS, TENA: MK, Gadsden, AL: HORSLEY, BRIAN: ME, Remlap, AL: HORTON, W.K.: AEC, E, Brewton, AL: HOWE, CAROL: NUR, Birmingham, AL: HOWELL, BARBARA: AE, Phenix City, AL: HOWLE, KAY: PRS, Ranburne, AL: HOWORTH, DEBBIE: PPY, Selma, AL: HUDDLESTON, DAVID: TN, Sylacauga, AL Graduates St Seniors .Z I wt. zzf' 2 1 fy W AA ' A ' vlr- ' - . V, .V : X ii , . 1 A' A ' if V ' Y .4 :A ,,-, tl: L, . ,. 'fi' . 1 yi , af , V ,' ' ' , 1 jf I. I c 1 A V' 55: , .f,, . l , ,, ., . ., l ,V , I 5 L, . N, , .- .1s2.:f- M f Y ,Q 'Ai A' .1 ' , ri 2 , . trap., w ry. . ' ,ay AW' ef, 1 , ,g C,-' ' .ii ' , ff -' 5 , ' . I ' . I f . fqgf: f- , , if f Arg, v w, st ,es ' 1 3, , . A off i 'Q-,' Ar., .. . . . , A 1. 1. If ttf' ff ' 1 . 'tivffzea , . ,. :,., ,,,,,, ,.,,,, vw . :W y wyfy, ,mm f' . :va ,r Meth-..9 , , , mf- . ' f ' A' . ' ., '1 4 V , , V rt rw ,,: 3, Z M1 xv f-A Q 11, V 4 V , ,t A ry 5 ,, g 94, ff V W' f ' f' ' W A 'f4 if 'T' ' 4 X272 ' Ep ' M , M ,ze I l ' 5 A' 1? 1 r : : f i ' ' W ' A , '. , ' ' ' , : l 'fa 'Y ' ' ' f ' ' . re. f . ,Mi iff! , 1' - 3' A ' 23 ' ' , 11 ffm , . fl ' ' 7-5 .1 ,WW ' ' , I r ' 5 ' 6' . A at 1 , 14 I we :if 2 fa r' ef YH: , f d, 1.151 A' QA 1, 'AW' A f fe g:',.:w'f2, , ' .A ' . ' l. . , -, C 'X f ki , r i, A i mg 'ef - I, -A V Cr X Q, Q l . 3 : I M 1 . , ' f ,AH A 5: T W' gf i . ,, ,. 1p-- l- I Y ' V ' . I t X vj ,,,.:,fjf' , ,fy :A f, I . V qi? . W Haig, V ,,.,, Ai 'r , ' , ef, , .. , , 4 f , ,V,, 7 , A ,AX ,lf Y. A V .A . l ,, ,, . - . H . 1 A A- ' 5 Jar ii ' A 'i A , A 1 I A , W A , J , . rf W , A :' ' 1 - v t, AA 4 . I' A 4 : ,, ' 4 ' 'I 5 .I ' 1 , ' ' F . f w '55 Q ' A if : i' f ff , ' .:f',1, ., it, ' ' 5 .1 , A ,A 'fa L ,, .A r v V' 1 I 7 M f A f U N K A 1 . . I A Wim! A it L :A I Aff' ' ' H . .,:f' A . A' A 5 ff V ,fi - :fi t H , 5 , ,ff i ,V N , 5, ,f ffl, 'fin . ' 9 ' :x 1 5 1, w 1 W gff 5 . A , r, ' f . 'A ' r . f ' H . , V , , ,A , :qfgzgu If , l rf -A ,A ,A A. , , A It f A fs, AAA- gi rl: : w . . A . 1 5 A 'M it 4 A 5 'P f- 5-1. ., , ,,,.. , . . , , , ,, F 'I ' , ' A A - , A fi I' ' S . wi .? ' , . : ' A' .f f v ' f ' i .2 . ' . 'rr 45 1 ' 'f lf ' I , H . f ir A : , .4 ' A 4 1- rf 'ff - A I 2 , J , A ' . 5 . ' .l ' 713 iz ' 1 'P . Qf Aj ' , fi ' ' 'T- '7'l - v ' 'A , A ' , .A , f A,f ' , 'aff ,,,, + A V y, y,-'Aa .P mr .,.s , tg , 4 gm 1 , , AA. i ,, 0, f , , f ' . iff 5:5 :fbi -9, M . L :lt J 2 r l .159 :A-af Q15 rrl- : if t , . : A l JH . , r, ,g iyqf' v , A V. I g l am' if 4 ,fr f , :iv L, .., , 4, .154 if ffll V +A, A, W . , ' . j ' -, ff' ,,.:g ,lag - 1 1 I ' W , I ' ' fi ' 'J .A'A, f' i r f' s' .Y fi, Q ' ., 1, if V: . , ,, wwf A Q. - f ' ,, W I , . . ,i .W i A A if lm' f W : . r g ' gf 5 1 , , W . ','1gw'f ' t::'F-- A jjg g ' , . 1 - I a2 F?l?P:f: if-nin a. V AM f1:f5V+, 4.04: ' in v i ii , ? Sr-A MMS ' yfvl, . f A any A :far , f I: t 1. af f fa, V' 7 i gg 7' 4? it if Mag a d f A Q ,Q iw , W -.. as i gf ,e A 1 3 4 ,, , A Q 5 4 2 x i Q , 4 ' , ' ' i 2 wifi f ,V A LAW ' ' I f El I ,,: .sv , ,, 4, I S '4 y-I x A I M i if Q . rf V V it Q T Q W I . ' M, in , ,uf at 1 1: vi 'T' -' ' , .,.ef'f,r ' gtg: , , K Vi, .ia ,, 'f ,W-i. ' , If A QQ ,, : ' f + 3, f li K ' i . : I , I i I f' i, ' f. M , ,:,, .Y , ,,f.,f,. . Ii ice: vi f.,, iff 'Q fvf ' 'A i 'V V fg-' ' ff' , :rw in 1 M: 'ggg ifgfifs I. wk .4 ,ii ails: i HUDDLESTON, TAMRA: Fl, Ftanburne, AL: HUDGENS, RUSSELL: PM, Mobile, AL: HUDSON, MICHAEL: CS, Auburn, AL: HUEY, LEISA L.: TH, Birmingham, AL: HUFFMAN, RON: LA, Bedford, MA: HUGGETT, THOMAS J. JR.: AFI, New Orleans, LA: HUGHES, TWANA: VBU, Dadeville, AL: HULSEY, JAN: HHE, Haleyville, AL: HUMPHREY, ALYSON: FS, Birmingham, AL: HUMPHREY, RICHARD P.: EC, Birmingham, AL HUNSADER, STEVE: ME, Braddenton, FL: HUNTER, GREG: BSC, Huntsville, AL: INGRAM, BILL: AFI, Birmingham, AL: INGRAM, VIRGINIA: HPR, Homer, AK: INMAN, ANN: PRS, Birmingham, AL: IRVIN, MELISSA V.: VHE, Opelika, AL: IRWIN, ALTON: INM, Birmingham, AL: IRWIN, MICHAEL: CE, Knoxville, TN: IVESTER, JILL: VHE, Bainbridge, GA: JACKSON, FRANCES: CJL, Demopolis, AL JACKSON, JANET: FLS, Birmingham, AL: JACKSON, SHIRLEY: OMN, Opelika, AL: JACKSON, TAMMY: MU, Thomasville, AL: JAMES HARRY: AFI, Trinity, AL: JAMES, KEN: CSE, Hartselle, AL: JANOSOV, JOANNE: EE, Jacksonville, FL: JARRETT, BRENT: FY, Newnan, GA: JOHNS, JIM: PM, Huntsville, AL: JOHNSON, DEBRA: FCD, Attalla, AL: JOHNSON, DEBBIE: PB, Smiths, AL JOHNSON, DWAYNE: LA, Boaz, AL: JOHNSON, GREG: AM, Fayetteville, GA: JOHNSON, GREGORY A.: EE, Pensacola, FL: JOHNSON, LAURA: RSS, Horton, AL: JOHNSON, LYNN: TN, Goshen, AL: JOHNSON, MICHAEL: AFI, Albany, GA: JOHNSON, NANETTE E.: PIFI, Humboldt, TN: JOHNSON, TERI LYNN: RSS, Alabaster, AL: JOHNSON, TERRY: OMN, Chamblee, GA: JOHNSON, TERRY L.: AM, Lowell, Ml JOHNSON, TIMOTHY K.: EE, Birmingham, AL: JOHNSTON, DONNA: SC, Coosada, AL: JONES, BILLY: INM, Perry, GA: JONES, BOB: INM, Auburn, AL: JONES, KENNETH: MH, McKenzie, AL: JONES, PATTI: HSA, Scottsboro, AL: JONES, TIM: OMN, Opelika, AL: JONES, TIM: VED, Auburn, AL: JONES, WILLIAM D. JR.: EE, Jasper, AL: JORDAN, ONEAL: AG, Frisco City, AL JORDAN, PAIGE: CJL, Savannah, GA: JOSEY, MARK: INM, Birmingham, AL: KEAN, STEVE: PL, Maxwell AFB, AL: KEEL, HARRY L.: HY, Lafayette, AL: KEEL, TAMMY: PG, Auburn, AL: KEENE, KEVIN: EE, EI Paso, TX: KEITH, ANNA: PBS. Birmingham, AL: KELLUM, KAREN: IE, Birmingham, AL: KENNEDY, LYN: LT, Birmingham, AL: KERL, MARIE: FS, Huntsville, AL KERR, DIANNA: AE, Auburn, AL: KEY, CLIFTON: MK, Hopkinsville, KY: KEY, JULIE: EEC, Smiths, AL: KHAN, NAMSOOR A.: ME, Auburn, AL: KHATAMI, AFSHEEN: CHE, Auburn, AL: KILGORE, KATHI: VBU, Fairburn, GA: KIMBER, LYNN: OMN, Vincent, AL: KING, KIM: AM, Riverdale, GA: KING, ROCKY: CE, Ludowici, GA: KING, SANDRA ABBOTT: EEC, Auburn, AL KING, WILLIAM G. JR.: ME, Atmore, AL: KIRBY, MARK: EC, Selma, AL: KIRKLAND, LEANN: Fl, Tuscumbia, AL: KIRWAN, GLENN: BCS, Rockledge, FL: KNIGHT, CLIFF L.: RSE, Auburn, AL: KNIGHT, JOLYNN: MH, Alexander City, AL: KOBOR, KAY: TH, Auburn, AL: KRUEGER, MARTIN EDWARD: INM, Lutherville, MD: KRZYZEWSKI, STEVE: EE, Harvest, AL: LAMBETH, ROB: RSS, Flomaton, AL LANE, VALERIE: CEE, Colquitt, GA: LANEY, LAURA: HRA, Clearwater, FL: LANGFORD, DAVID: BSC, Marietta, GA: LANGFORD, JULIE: API, Decatur, AL: LARSON, DONNA: VAT. Milledgeville, GA: LARUE, ROBERT: PH, Blountsville, AL: LASEWICZ, TIMI: PSS, Huntsville, AL: LAUMEYER, DIANNE: TN, Daleville, AL: LAWRENCE, JIMMY: OMN, Auburn, AL: LAWSON, CAROL: NF, Eastaboga, AL LAYMAN, SYLVIA MARIE: GAN, Cantonment, FL: LEBLANC, TERRI: IE, Fayetteville, GA: LEDBETTER, CRAWFORD JR.: EE, Opelika, AL: LEE, DAVID A.: PD, Huntsville, AL: LEE, KAREN: GSW, Cullman, AL: LEMBECK, ANNE: HY, Crestview, FL: LESTER, BILL: PM, Auburn, AL: LIKENS, DENNIS AL: CSC. Tuskegee, AL: LINCOLN, DENNIS: CE, Berea, KY: LINDHOLM, JEAN: NUFI, Auburn, AL LIPSCOMB, NIMROD D.: GSC, Auburn, AL: LISENBY, MARK: GJM, Lafayette, AL: LITTLE, HARRELL: FY, Hartselle, AL: LITTLE, LARRY: PIFI, Decatur, AL: LITTLE, MIKE: IE, Fairfield, AL: LITTLEWOOD, DERRICK: ME, Burke, VA: LITTRELL, MARY ELLEN: BSC, Decatur, AL: LOCK, ROBERT L. III: EE, Guntersville, AL: LOGAN, DAVE: MFIB, Auburn, AL: LONG, DONNIE: PG, Orlando, FL LONG, JUDY: AFI, Butler, AL: LONG, ROSE SCOTT: AFI, Union Town, AL: LOWE, ROBERT: EE, Detroit, Ml: LOWE, SANDRA: AC, Roanoke, AL: LOWERY, BARNEY: FY, Century, FL: LUDERS, RICK: PUB, Spanish Fort, AL: LUHRS, DANIEL: BSC, Arlington Heights, IL: LUNSFORD, KENNETH S.: MBA, Auburn, AL: LUTTRELL, FRANK ALEX III: EE, Brewton, AL: MABEE, SCOTT: EE, Huntsville, AL Graduates 8. Seniors MACKEV, STEVE: CHE, Gadsden, AL: MAGEE, MELANIE: VAT, Gadsden, AL: MAHAFFEY, RICHARD A.: CPE, Bessemer, AL: MALON, MARK: ME, N. Palm Beach, L: MALONEY, FORREST T.: CHE, Tallassee, AL: MANGE, PHILLIP: BSC. Anniston, AL: MANN, DAVID D.: MED, Manchester, GA: MARSHALL, TOM F.: ME, Florence, AL: MARTIN, TIM: Fl, Slocomb, AL: MARTY, MICHELLE ARNOLD: FCD, Huntsville, AL MASSEY, DAVID: OMN, Opelika, AL: MASSEY, TAMARA: MK, Miller Place, NY: MAY, DONNA L.: RSR, Waynesboro, VA: MAYES, LEE J.: EE, Brimingham, AL: MAYFIELD, LUVENIA: AC, Roanoke, AL: MAYS, CONSTANCE: PIR, Foley, AL: MAYS, SIDNEY: MK, Opelika, AL: MCANULTY, MICHAEL: EE, Cottonwood, AL: MCCAFFREY, TIM: Fl, Birmingham, AL: MCCAIN, MICHELLE: CJ, Athens, AL MCCANN, JULIE: Fl, Huntsville, AL: MCCLENDON, KIRK: HHE, Auburn, AL: MCCOLLUM, SUSAN J.: SC, Lanett, AL: MCCOMBS, CHARLES A.: MBA, Auburn, AL: MCCOMBS, LAURIE BAGGETT: VAT, Auburn, AL: MCCOMICK, TERRI: Fl, Duluth, GA: MCCORD, HELEN: EEC, Lineville, AL: MCCORMAC, JOHN: AR, Fort Walton, FL: MCCORMACK, MIKE: CHE, Tuscumbua, AL: MCCORMICK, MIKE: INM, Auburn, AL MCCORVEY, MIKE: AC. Albany, GA: MCCRORY, ALEX: AR, Forest, MS: MCDANIEL, BRENDA: Fl, Enterprise, AL: MCDONALD, BELINDA: FM, Valley, AL: MCDONALD, DARRYL K.: AR, Milton, FL: MCDONALD, THOMAS C.: MK, Sea Island, GA: MCDUFFIE, TERRY: CE, Newton, AL: MCGEE, ALAN: AM, Fayetteville, GA: MCGHEE, MIRIAM: IE, Tallassee, AL: MCGINNIS, ALMA: EM, Lagrange, GA MCGONIGAL, ROXANNE: PG, Grayson, GA: MCGOWAN, KERRY: PIR, Daleville, AL: MCGRATH, PHILIP: AR, Vestavia Hills, AL: MCGUIRE, MARK: PUB, Montgomery, AL: MCGUIRK, TIMOTHY L.: ME, Oxlord, AL: MCINTOSH, THOMAS C.: BSC, Auburn, AL: MCKIE, MICHAEL: HY, Americus, GA: MCKINNEY, LAURIE: SMH, Atlanta, GA: MCKINNEY, ROBIN: AC, Birmingham, AL: MCLAUGHLIN, JEFFREY: HA, Selma, AL MCLENDON, ROBERT: EE, Lillian, AL: MCMILLAN, MIKE: EE, Huntsville, AL: MCMILLIAN, JOEL: TN, Saudi Arabia: MCNEAL, PRATHER: CHE, Eclectic. AL: MCRAE, JACK: PO, Attalla, AL: MEACHAM, MANDI: EEC, Sylacauga, AL: MERIWETHER, PAT: TN, Mobile, AL: MERRIKEN, STUART: PB, Norman, OK: MESSER, DAWN: EEC, Roanoke, AL: MILAM, STACEY: GSC, Decatur, AL MILLER, BOB: FY, Montevallo, AL: MILLER, RUSS: VAT, Arab, AL: MILLER, STUART: BSC, Naples, FL: MILLS, BRUCE: PRS, Maxwill ARB, AL: MILLS, GLENN: CJL, Auburn, AL: MILNER, JULIE: OMN, Valley, AL: MITCHELL, DENA: RSS, Savannah, GA: MITCHELL, WESLEY DAVID: IND, Fairhope, AL: MITCHUM, KEN: MH, Roanoke, AL: MITCHUM, TALISA: IFE, Riverview, AL MONGENTALE, DAVID: MK, McMurray, PA: MOODY, DAVID: AG, Prattville, AL: MOODY, TERESA: CHE. Cullman, AL: MOORE, BONNIE: RSS, Lee, FLa: MOORE, DEVIN L.: IND, Lutz, FL: MOORE, RUBLE, H.: INM, Smiths. AL: MOORE, VICKIE: HA. Section, AL: MOORER, LEIGH: GSC, Hardaway, AL: MORGAN, MARK D.: PY, Auburn, AL: MORRISON, ANNETTE: INM, Alexander City, AL MORRISON, JAMES: GJM, Huntsville, AL: MOSLEY, BENJAMIN C.: ME, New Ellenton, SC: MOSLEY, TIM: FY, Birmingham, AL: MOSS, GINGER: PRS, Atlanta, GA: MOSTELLER, BARBARA: EEC, Mobile, AL: MOULTRIE, PHILLIP: FI, Albertville, AL: MOYE, RAY: ME, Kinston, AL: MUMMAH, KEN: INM, Auburn, AL: MURPHY, CHIP: GED, Indianapolis, IN: MURPHY, JULIE: HRA, Birmingham, AL MUS, SANDY: VI-IE, Birmingham, AL: MUSE, JERANNE: LT, Scottsboro, AL: MUTH, WILLIAM: IND, Worth, IL: NALL, CAREY: EE, Auburn, AL: NEEL, BETTY: FCD, Birmingham, AL: NELSON, MARGARET: Fl, McRae, GA: NELSON, PAGE: FLT, Auburn, AL: NELSON, STEVE: AC, Gadsden, AL: NEWMAN, JULIE: GSW, Ozark, AL: NEWTON, TERRY D.: AC, Lanett, AL NGUYEN, HEIDI: CHE, Montgomery, AL: NICHOLS, SCARLET: CEE, Atmore, AL: NINAS, LARRY E.: MRB, Waverly Hall, GA: NOBLE, LYNN: MK, Greenwood, SC: NOLAN, LORI: INM, Jacksonville, AL: NORMAN, SHARON: HRA, Wheeling, WV: NORRIS, F. KENT: DBI, Pensacola, FL: NORRIS MICHAEL J.: AC, Quinton, AL: NORTHCUTT, WALTER M.: PIR, Auburn, AL: NORTON, DENNIS: FY, Dothan, AL OBERT, BILL: EE, Ashlord, AL: OBRIEN, JIM: PM, Phenix City, AL: OGDEN, JOHN E.: IND, Snellville, GA: OGLETREE, JOHN: TN, Sylacauga, AL: OKELLEY, NANCY: CEE, Sylacauga, AL: ORILLION, LISE: MK, Huntsville, AL: OSTEEN, ANN: CEE, Pisgah Forest, NC: OSTEEN, MARK: INM, Lake Wales, FL: OWENS, ANDREA J.: AC, Westville, NJ: OWENS, CINDY: Fl, Brewton, AL Graduates 8. Seniors A... Q I .V ' 'r 5 fi' M-:5 'f' , , 42,4 ' . ' ' , : 'Ili' ' I yi .ff fl . mfr? ' '5 Q' - .'e:?!?w A -I - ' ' A- 5 ' :fs 141' H y : : ' iii' L 3 1. . 'fm f. .f 'E W' r ,- A ,Q V .f : ,G 1 ,V I f. , ,Vg M - Ji: , B- f, ' 'gig , , -1 V . , r H A 1' 7 l W 1 '- Y X V . A 7 lf' Q f ' 4 .1 . i :A I. , I f 1 if . f. ' haf: be 4 'S 1 , fyirw Wear' f ' offer .9145 I 1 K I.. V f I . .. A f J 1 Af . f' .Zag ff: t' , v l ,t 7 4 A -ft v- . . if .I-. ' 1 I - an +4 'r sf ' 5' , I-f ,I 24 2 3 Lf ' 5 2 V 3.4 , . , f' 1 -A 1 2 L.. t i. ,, I e ' It F W H I A L If ' , A z' , , 1, , .,..n,,gr, , g W - A, L I ,, fi, , ': - ' ' . ' - ' 2 T' 'r A I- f.:. - ' : 1 - - 'I I , Y I, - 5- . it . - r f 51. I .1 ' ' 4 of .gv w if 91 , f rf I n A ' ' we ' nf V... f i , , tfiigfjii ' K, - ' r f f 'fffl '--. H Q 2 ' ffiikff f. ' wwf? . I mv, . -C ', ve-law ' H ' -.5..,,g 5, i- zaagqugwf ,WV135 , .L 1 .. f . I ' A.. A fi J' I 2' ,f ' r. - 1 f 5 .K . , Q.-, ' :av , J' 4- ,fy r- , i- ' , I Mg . a A F 2' 'V ik . if . f:' , - 'A :jf I l V, 37, 1 3 . . E - . X ' ' lf' 12. .GL, ff : Q, - , ,- nf IL fi- 4 i vt I 9 1 a .1aQ,-Aggie? .w My .I ,a U W ,. . ' '42, f 'ig ' I 'I I .-'fi , K , 2 i :wt 24 fi -.c1f ' rl: ' i fi ,rv . i ii: ff I I ' , ' t' H ' c '.,: '. . f z Www Wa, ,5 ' M.. Lf ii' ' A L VL I A me A. 5. ' - 7: 'A J , W V. - ' ia: ,W-'Wi 1, I vm H K P- z 7 7' , I - K . I . , ,.: ' ' ' :'1'ig:ggfi:., fi QQ., 1- x 5 .. 1, , I ', wlsl- f if f' aff. ,V an .,... ggi, H ' ' ,' 55 Q- 'Mi' Es I . , t- 'M ,f - A ' ' at an ,, -' f 1 - - ' . ' r I 2 : il: Q M, g A . A Q36 :- 'fi '- f ff: f My t I - 5 xv 3 ' 4 . . I. 1... 1, I A- H, - - A , gf -.e:rwus.. .gi:ff' f Q I 'W ,N -' ' Hi 'ir :T ift W2 Z: Ear-2 ' I .,.,. WM. A Myra, , . My A I V. I, . .., w g.57 3 rf , A I -:ff 3 : y : , L. I I f W .. , '-.i , Wap .: We . V A f f API I.,-WW jf ' ' 41' if , F ' - wffgy I 27 , ', , ,, 3 I 1 ' , . V, 4 . - :R 'Q fi -it . ,, '-- A ', -,, I' ,f ' , q.',.s' 1 -- -- 214 , K1 fz. :egmf-,:', , ',.!4,g4,5.5.f f - -3-. A-qrfawv .' i : , I Q hu .. :iw-5-5 1. 4:7 Q . ..:91'.2. , .3 f li: f Eff? W. K we .uf I Q f f. , Gif' f f ' Wx: ' ' f F H f Ha., 1, A' ' WW' 'Q ir if '34 V f 31 A 'Z if f ' -'X :3 , xl , r 4- W5 . V 1, ' -x I r, Wg 4. ., ' , :i , i , ,V , , y , , , L 4, ' I - , ' - , '3, iz. K. 'I f 1 ff , . 1 ' ' ,ri ff? . ' W Q3 fd :J . H 9:-gg .V J' Q 'f F- L ' j ,. L I-fy 4- LQ - I 777:5 7 .- I ll , 1 . l N fi, ,. W , i W We V nf fl fi - I5 ,V . .. f :,. , A . W A K . ' K f 'A I ,,g,f y ' ' 1 ws- M ,, fr, ,a 7. iw, gf, - , 'ff 1 . .2 . VM Q, M, , f' - ' 5 5 if cial: yi 'ii - Mwg ,. - -. .- I I ,mf .: M. . ' :' .fa-' i , I- ff fi , lint: ,'-' ' V7 ' ' I z - ' V ' ' ' ' - I if ' 7 : V' 1 'ff ' J ' 1. Q ., 4. , . h ,, its Wh . 1 i P ,iv A 3, , .. , , , .fr a . - A , - f . 'z , L ff ' .. L Q: ' ,si .5 gf-f , I , qt, 45. V ,ij , K . ' 5 i - V SL' T I h E' 'I l f--1 ' K KK , K ' K' ' 'V gQ:,,, V fig? . -S ., -3 'vw I V' I 1 Xka if A 3 X 'll ,- V- E , 55 f -5 ag :LESS - Av- I 1 is fV:3?ii f5.lfVl I T I , L1 V .Q - , V' 'B' 'kkk N - x ' ' . ' ': ' . I . VVKVI 2, A -.g. gh! 'sr K ,F Q. r. , 5 , ?,QtL,k W VA: 5 .: f f , ., :k,:i, S ,, V j K V M gf ' V - I' V Vw S . ' . ,V g, ' ' KN, A I ' f . 'f -: ECI! , 'El 4 ti E r h. . V V , , K . ,R ...A S if.. . A, . A g,LL , g Z , , it , , , L lg WLLQI, L , ' 4 ,, ef.:-'Az K' Af... 'Sai ,ff ,mi yi, ii, rf: 'c...'-::. 3 .I ' K , 2 ' uf? :gal 'I U.:-:zz 1: ' V ' V ' V ,L ,- . Q - . V N. 4 . - , -f .,,L , -V fi - X - .. V V VV f ,V ,,. V , . :K -3 , 'K- 4- P V . id --Il' -IT' ' H A. S rt, Xi: f W- .':: T T i :Q . I' 6, ' gf i 1 I K If 3 - l i' lv- ff ' x :, EA , IQYG. 9 ' ' 'I lf' .S V 1 : V X 6Mf'3 7f3?Q- I i :am . be K - K - ' .I .V 1, KI .. W V I Q V KV r - I... V -Vo' I , , . 1. , -.wr - - ff' gf. 5 fun' V ' '- ' - V ,.V- 5 A fl, X .. A A 3 VIL I fx.: W '-if ' ' If '-': r 'Z Q .1 , L , V VJ v gg xabi f 5 ii ky ? W , , K K V ,Q . , t :gf P ff Q: A ' f I I I 1 -. ' ' -1 K A I as I ' 'V ' l V- :V 4 , , I ' V I' K J A , V: ' I I . ' A , , wx.: V I ' ff V - , .3 K I , , , VV ,,,, , 4, K7 . K ' W9 V '.'. ,V- I 'I V ' Q ' V , P., 'V 1: ' r . 1 'UN -' ' r. 'A ik -- f 31:-,::x:.l:::: I1 : :fa -V --WV I VV A ,. ' ' ' - . W I . -' ,V gh fb, , V , If I : 4 if 'rf 55 , 55: I, , 'pr I ' , ' 'f W' 'ZW . , lr-YV' ,V L 2- W V ii V f. rag: Q.,,r fr 1: V3'i 51 - Vg, ' ' - tT4, j , ,V . V f r 'ggf if in , V 'V ' WSVVV- V V V.: f A . . ' ' ' ' ' 5 1 - . ,,Vi,gV5 '-' Vi , x .. U K- -, 'V V K :. . V w g, K ,,. , I , ,H ,, . ,C 47, , , xt... A I M , Q 4 , , ' VV ii ' . ,V ' , V , fn: My I 'f Z ,,, . ' V ',f y V' I , ' 'r . f ' T : ,,f If- J I ,, :f .V V I .,-fr. ' . Cl :V ' 45 1 -. fi I ' 'X V' A VV .VI f.. V , V I I ,. V-V , r - V :JF I' .. .A : ' I ' 2 A S' w 'III f f f --'a - f'ff Nt21' : fff'5fFffE1 if ' .zV.: 7.,1:2, ' Mwffmff: H Jaya' F 'f KV :f 'I 11. , G-' ,ag . gkw nx in J V: 4 W A ,V VM!! A . K 6 1 I :tg ,Ji my , l 7 I . ' ' ' V 4'K'iV'1- ' i 1 a ' Q ' I 2 E ' f- r 5, ,. VV.- V 1 r V cr- f W K ' I -1 -if wr L--, :V . , . Q. f : : ,,f,: V N K I ' 'K I , - .. . . ,V,, X , . V . i A K - -' 45? J. ay: r t .f .ig '- 2 if ,A .9 , , TQ. ., L. I ' Q . V , A L ' f ,' . ' ' T' - , - r 'K I V , :V ' gf, - r 'S , - f : f . , - ,,-Lf ' - .3 IQ, ,f M ,.. V' 212: ' , . , ,f 53: ze iz' . A V , : 5' , gi:',,5i:? , C K V K, v 'V I, , 5 V . ., V - Q V A A . 'K K V V ' 1- '61 , ' f r f am. yifflii 4 71. ,N V fri, if V ,ywwff ..,, ,, ' 0 , '4,,,,,Qlgf2g'j,,,, 4 XX V -my ,LV V K 1 V ps rt: i 'fgygqt ,rj ,+V is JV C r :V.,:,:.. N... f1fV'm--fn ', '- ' . ' - ' 5 ,.'i.. :L ral- V' 113111.11 R? 'X ' W L... , '....g L I 2 : PACKER, JAMES M.: EE, Gasden, AL: PADGETT, BUSTER: AEC, Union Spring, AL: PAGE, DAWN: ID, Miami, FL: PANIK, PAUL III: BSC, Ft. Myers, FL: PARKER, GINGER: MBA, Ozark, AL: PARKER, JANET: HY, Birmingham, AL: PARKER, PHILLIP W.: AE, Crane Hill, AL: PARKER, ROBERT: EE, Fairfield, AL: PARKWAY, JUDY: PL, Opelika, AL: PARRISH, CONNIE R.: EEC, Chancellor, AL PARTAIN, JENNIFER: VOA, Gasden, AL: PARTAIN, JULIE: LT, Gasden, AL: PASCO, JIM: ME, Jemsion, AL: PASEUR, STANLEY: CE, New Market, AL: PATRICK, LYNNE: ERG. Athens, AL: PATRICK, RICK: FY, Tuscaloosa, AL: PATTON, CARLENE: MB, Montgomery, AL: PAWLOWSKI, CAROL: FCD. Mt. Laurel, NJ: PAYNE, WILLIAM R.: HY Gasden. AL: PEACOCK, LISA W.: EH, Prattville, AL PEARSON, WES: MK, Opelika, AL: PEDERSON, PERRY: EE. Longwood, FL: PEEK, BETH J.: AC, Montgomery, AL: PEGUES, MALCOMB: AY, Browns, AL: PELL, RANDY: CE, Fort Payne, AL: PENCE, PEPPI: INM, Birmingham, AL: PENNY, TERRI: OMN. Leeds, AL: PENTECOST, SHAUN: VHE, Alexandria, AL: PERDUE, J. BRUCE: PS, Selma, AL: PERKINS, MICHEL: HRA. Tampa, FL PERRY, ALAN: MH, Boaz, AL: PERRY, DAN H.: EE, Elizabethton, TN: PERRY, DUDLEY: PIR, Franklin, AL: PERRY, SALLY: CDP, Wedowee, AL: PETERS, JIM: DH, Huntsville, AL: PETERSON, BRET: ME, Auburn, AL: PETTIS, W. CRAIG: CHE, Dunwoody, GA: PHILLIPS III, WILLIAM: AFI, Mobrle, AL: PHILLIPS, KEITH: INM, Auburn, AL: PIFER, PEGGY: PIR. Birmingham, AL PIKE, BARRY J.: CHE, Hartselle, AL: PIKE, EMILY: GJM, Dunwoody, GA: PINKSTON, ROBERT: IE, Montgomery, AL: PINYAN-HILL, KAREN A.: VHE, Holly Pond, AL: PITTMAN, LISA: HPR, Birmingham, AL: PITTS, LLOYD: CE, Brewton, AL: PLAZEWSKI, LILLIAN A.: IFE, San Antonio, FL: PLOTT, DAVID W.: BSC, Montgomery, AL: POLLARD, DAN: CHE, Huntsville. AL: POLLEY, NANCY: PRS, Enterprise, AL POOLE, CINDY: IND, Wedowee, AL: POOLE, TIM: AEC, Andalusia, AL: POPE, KEN: BSC, Elba, AL: POPE, TODD S.: PUB, Opelika, AL: PORT, DONNA: MU, Oak Park, IL: POSTLEWAIT, EILEEN: CEE, Sylaoauga, AL: POTTER, DWIGHT: IE, Huntsville, AL: POTTER, JEAN: LA, Huntsville, AL: POTTOR, VICKY: GJM, Auburn, AL: POWELL, SUSAN: PG. Birmingham, AL POWERS, CAROL: TR, Tucker, GA: POWERS, DEBBIE: Fl, Tucker, GA: PRESCOTT, LESLIE B.: FLT, Macon, GA: PRESLEY, PHILLIP: PY, Enterprise, AL: PRICE, RANDY: PIR, Athans, AL: PRICKETT, KENNTH E.: PM, Fairfield, ALC PRICKETT, KERRY: PY, Fairlield, AL: PRICKETT, MARIANNE: GSC, Valley, AL: PRIM, HOWARD: CE, Mobile, AL: PRIMM, ELIZABETH: PG, Nashville, TN PRINZ, SCOTT: Fl, Miami, FL: PRITCHARD, GINGER: INM, Dadeville, AL: PROCHASKA, TERESA: IE, Robertsdale, AL: PROCTOR, LISA: PL, Tuscaloosa, Al.: PROPES, RUSSELL: GGL, West Lake Village, CA: PRUITT, GREGORY: IE, Attalla, AL: RAINES, STARLA: FM, Brewton, AL: RAISPIS, JOHN: EE. Scottsboro, AL: RALEY, RHONDA: VOA, Titusville, FL: RALSTON, SAGE: AEC, Selma, AL RAMSEY, LYNN: VOA, Birmingham, AL: RAY, GENA: RSM, Birmingham, AL: RAY, JANET s.: PG. opp, AL: RAY, LUCY: CFE, Pensacola, FL: RAYFIELD, LINDA: CEE, Union Springs, AL: READ, CAROL: AR, Wellington, AL: REAGAN, BRUCE: HSA, Birmingham, AL: REAGAN, PATRICIA: EEC, Birmingham, AL: REARDON, MICHAEL: BSC, Auburn, AL: REAVES, BARBARA L.: CHE, Lincoln, AL REDMON, BARBARA J.: EEC, Phenix City, AL: REDMON, LISA: IE, Phenix City, Al: REEVES, LISA: CEE, Ocoee. FL: REID, WENDY: AC, Gadsden, AL: REIMANN, PETER: Fl, Birmingham, AL: REITZ, MALCOLM: CPE, Mobile, AL: REYNOLDS, C. JOSEPH: EE, Mobile, AL: REYNOLDS, CAROLYN: CS, Columbus, GA: REYNOLDS, LAURA G.: HPFI, Shawmut, AL: RICHEY, LANA L.: VHE, Geraldine, AL RIEGERT, RUSTY: EE, Dothan, AL: RIVERA, RAFAEL: BSC. Mobile, AL: ROBBINS, ALAN: FYE, Mc David, FL: ROBBINS, CECIL H.: AEC, Auburn, AL: ROBERTS, KAYE: PY, Ft. Lauderdale, FL: ROBERTS, SANDY: CHE, Huntsville, AL: ROBERTSON, ANNA C.: NUR, Langdale, AL: ROBERTSON, DAVID: LA, Talladega, AL: ROBERTSON, DAWN: HPE, Robertsdale, AL: ROBINSON, ALAN: ADS, Auburn, AL ROBINSON, CATHY: SSE, Dadeville, AL: ROBINSON, JOHN: Fl, Melbourne, Fl: ROBINSON, MARY: EEC, Foley, AL: ROBINSON, MARY C.: CEE, Evergreen, AL: ROBINSON, RONALD W.: MDT, Phenix City, AL: ROBINSON, WILLIAM D.: AEC, Auburn, AL: RODGERS, JAMES E.: ME, Pensacola, FL: RODGERS, M.J.: Fl, Montgomery, AL: ROEBUCK, CONNIE: PY, Mobile, AL: RODGERS, MARIA J.: EH, Moultrie, GA Graduates 8. Seniors ROLFE, PAULA G.: EEC, Bossier City, LA: RONEY, ERNEST M.: TN, Samson, AL, ROSS, JULIE: MH, Marietta, GA, ROSS, TONY R.: EE, Keysvllle, GA, ROTTA, DARYL: CPE, Cocoa, FL, RUBLEY, TODD: VED, Davenport, IA, RUCKER, JIMMY W.: AC, New Albany, MS, RUFF, MARY ELIZABETH: VHE, Thomaston, GA: RUSHTON, WINDY K.: CJ, Birmingham, AL, RUSSELL, SCOTT: AM, Hickory, PA RUTLEDGE, CHARLES JR.: AG, Hartselle, AL, RYAN, EDIE: CDP, Pensacola, FL, RYBERG, MARY: GL, N. Palm Beach, FL, SLATER, KEN: PM, Sylacauga, AL: SALTERS, SUZANNE: GSC, Auburn, AL, SANDERSON, STEPHEN R.: AEC, Hanrest, AL, SANFORD, BOB: AC, Mobile, AL, SANFORD, IDELIA: IE, Alexander City, AL, SAWYER, KATHY: PY, Monroeville, AL, SCHALL, THELMA: IE, Charlotte, NC SCHARNITZKY, ELAINE: CJY, Brewton, AL, SCHAUER, TOMMY: GEC, Birmingham, AL: SCHILLING, JOHN: IE, Mobile, AL, SCHLAEGEL, WAID T.: AE, Selma, AL, SCHNEBERGER, SCOTT: INM, Reynoldsburg, OH, SCHUPPE, STACEY: NS, Mobile, AL, SCOTT, BEN: INM, Winchester, TN, SCOTT, HOWARD A.: MDT. Birmingham, AL, SELL, MICHAEL: HPE, Auburn, AL, SERECIGNI, ELISA: OH, Miami, FL SHAW, ANN: PFIS, Birmingham, AL, SHAW, LARRY L.: GRL, Virginia Beach, VA, SHAW, LARRY: MC, Opelika, AL: SHELDON, BRUCE: LA, Lakeland, AL, SHELL, DALE: AE, Opelika, AL, SHEPHARD, JUDY: MK, Lake Worth, FL: SHIPPEY, LISA C.: PY, Huntsville, AL, SHOOP, TED A.: AM, Lithonia, GA, SIMMONS, JACOUELINE: VOA, Sardia, AL, SIMONTON, BONNIE: PY, Decatur, AL SIMPSON, NICK: AC Wedowee, AL, SIMPSON, TIMOTHY WAYNE: CE, Wilsonville, AL, SIMS, BETSY: AC, Birmingham, AL, SIMS, JERRY: OMN, Selma, AL, SIZEMORE, JOHNNY: IE. Glencoe, AL, SKINNER, PAM: FCS, West Point, GA, SLAY, TIMOTHY B.: EE, Birmingham, AL: SMILEY, RICHARD: AM, Key Biscayne, FL, SMITH, BRIAN: CE, Oxford, AL: SMITH, BRIAN: PG, West Point, GA SMITH, CALVIN: TMT, Opp, AL, SMITH, CHIP: INM, Fayetteville, GA, SMITH, DONNA GAIL: Fl, Selma, AL, SMITH, FLORENCE: VAT, Arab, AL: SMITH, GINNY: PRS, Doravile, GA, RSS, Atmore, SMITH, JEAN: ZY, Auburn, AL, SMITH, KAREN: AL, SMITH, KERRY: FS, Euless, TEX, SMITH, MARY: MED, Auburn, AL, SMITH, MIKE: EE, Gadsden, AL SMITH, NORMAN: EE, Graceville, FL: SMITH, ROY EARL JR.: BSC, Montgomery, AL, SMITH, RUSSELL: MK, Birmingham, AL, SMITH, SANDRA: CPE, Birmingham, AL, SMYLY, BEVERLY: EEC, Smyrna, GA, SNIDER, PATTI C.: HPE, Anniston, AL, SOLOMON, JANET: HHE, Alma, GA, SOULEN, JUDY: FM, Atlanta GA, SOUTH, BARRY: HF, Mobile, AL: SOYERS, BETH: RSS, Auburn, AL SPAFFORD, TIM: AR, Mobile, AL, SPEARMAN, JIM: HA, Sulligent, AL, SPEIR, DEIDRE: BSB, W. Palm Beach, FL, SPENCER, LISA: MU, Daleville, AL: SPLAWN, JAMES: AR, Huntsville, AL, SPRUIELL, JOSEPH L.: HSA, Aurora, CO, SPRUILL, WESLEY L.: CH, Tuscaloosa, AL, STANLEY, KATHY: IFE, Thomasville, AL, STEELMAN, PAIGE: AC, Montgomery, AL, STEIN, JOHN: AM, Paducah, KY STEVENS, LINDA: PY, Rome, GA, STEVENS, WELLINGTON III: CE, Vero Beach, FL, STEVENSON, STEVE: PV, Tallahassee. FL, STEWART, RODNEY W.: EE, Auburn, AL, STIEGLER, LISA: CEE, Huntsville, AL, STILL, CURTIS: HHE, Fairfax, AL, STONE, GINNY: FISH, Florence, AL, STONE, NANCY: ADS, Brewton, AL, STONER, MICHAEL L.: CE, Birmingham, AL, STOTSER, R.: EH. Auburn, AL STOVALL, BRIAN: CE, Oxford, AL, STRACHAN, GREGORY E.: Fl, Fairhope, AL, STREET, NANCY: FI, Gadsden, AL, STRICKLAND, DAVID C.: INM, Ft. Walton, Beach, FL, STRICKLIN, CINDY: EC, Brewton, AL: STROUD, PHILIP: GL. Auburn, AL, SUER, BARBARA A.: IFE, Dunwoody, GA, SULLIVAN, JEFFREY: ADS, Fayette, AL, SUMRALL, PAM: MB, Auburn, AL, SUTTON, MICHAEL: CHE, Auburn, AL SUTTON, RENEE: INM, Nolensville, TN, SWANNER, JESSE: FYE, Athens, AL, SWEAT, ROBERT: HA, Huntsville, AL, SWETT, ERICH: AR, Pelham, AL, SWILLEY, BRYANIE: MK, Arlington, TX, TALLEY, STEVE: INM, Alexander City, AL: TALLY, PAM: CEE. Tuskegee, AL, TAN, CHEE KAI: CH, Auburn. AL, TAN, LINA CHEN: IE, lpoh. Perak, Malaysi, TATE, MARGRIT: IE, Jasper, AL TATUM, SHELTON: INM, Monroeville, AL, TAYLOR, CAREY: FLT, Newnan, GA, TAYLOR, ROBERT E. JR.: AE, Auburn, AL, TEEM, ROBERT: CE, Summerdale, AL, TEMPLE, SHARI: IND, Huntsville, AL, TENNANT, SHARON: CEE, Roanoke, AL, THIBODEAUX, DWIGHT, D.: AE, Opelousas, LA, THIM, ERIC: Fl, Auburn, AL, THOMAS, BLAKE: PB, Orlando, FL, THOMAS, MIKE: FI, Plesant Grove, AL Graduates IL Seniors 5 'Q F I.. X S L ff - Q A L dv I I It ' 5 ..t. I, .,, , I V V L I I.. 1 .I - ..., . '. I V ,Ie f I' ,ge III, F , . I -III . , If , be , ' , A arf' 'f I 3 -311 fig S ' I ' It f f ,I If ..k' W 'Iiaf- 'M . f 'W 'f x L II f a . I . I 'Gf'Fffff,iI T714 NZ 1 ' -':' I ' I I - 1 . My I- I . A - ' -I . I, .M-,I -r II . We 1- fr, ' E: , . ' ,I I. , . ' I' 'I ww , W Ik? 1-Laci? z I F I Senza' If ,. I ' It , L 1 'B If ,,. seg, ,f ,J I fr, . 4, ,I . .IV ,, ge. , ., In I,II,, , ,Q I.,,.. We .. - I , I if I ' -I ' ' -LII I e I UI Zi' , 'fr 'I ' , , . ,, I' ' ,, 1' Zi, I ,. - N if I. 1 '--:' I I I r I 4 W V 92 iz, .,.,V,,, ,VV V ,Vi V 5,1 qv. ' ,wr I , . V ' I pf, , ,I I 'I ,I ' ,, S, ,I I me H gi-it 3 51: ' 1iEQlf':f ,:2 ., f 42 2? f j,Q1jf3,,3?34 s w . , I LI 1, ' I ' , ' ,L ' , LI 'II , If 1 I ,,, J I f :SQ ' 21 ' I' N ig -I I I, I I :I I ,ZZ - I , - 1: I 'L F WE? ' ' W2 ' :iw 1 'f 9 .. ' I I, wi I 'G' ' ,Jw 'veg ft., , aef. ' It 'MMI -'Q 2' I, ' '.ff .M I A: f : .2 i ' I Ii 'Ag IV Yi! A22 15? 's Y , I ' wp If ,. .I I , I In. fI ,II i I 3 V V I V , ,V ,VVV?I VV h. V ,IV VVVVVVV I f I' , I . - 1. ,I I , A :V . 4 .,,. V VV V I'iW,I.e,?FiIswm , I' ' , I 3 'W fi? ,I.,'If..4' -. 2 I I ' :st al , ,,., .Ie 1. ,A - -.-- I I 1, .,-., :gsm ' H it- 'ai' 5II.5'I15 il f ' ' -'AI . ' J' S ' f--pI A- ff H I I I I I I I -,QTL V fjji , Q Ii Nl ','1F,g--IV, Q : Q :,fj , gg 32.7 , i 5-'m.: ,s.' C 5 -Q I, ,. , V V. 1 ,Q Vr f' V : ' , 'I izx .5255 .If 'N , ' A E I I J - Z, V V ' ' , Q-75:f..,,f , VV A V .,,,. JV Qs .I V I:-Ifcpq 'fre I.: .. .. I.T I,ii'iyi'ffIqI ,, , ,' ff 1.:,I II , 5,-g, -1 I If I ' ,Rf -I 'I I -,II sz, I g ' , .. .gg 5, -, .2 f, - VV- 'I I- I I L AI , 4, I If , :sa I QI ,. I.: A - - ,., -I 1- - 5' 'III ' Qu, -Q I ' I. , . fr I - T ffl I I ' I I . , V VV V gf, , ig, , Ia cu V V I V: 4--1 1I 'K . 3,5 -F .A . If I L 2 - I-f I. IHIII2 - 1 Q f M Li A'- 1 i ' WIP Wifi T21 'TEM I , I ,iii ..'- 1- ' 2 i Lf 3 A if QRARJIIJS I f ,. ' I . f I . ' '- ' If. 'If - . I 5 II, X I- . XI . 2 I LBS II :I , I . I X 'I I I . xxx 4 I v I N w In S- O . I if ., 'ki 'ill' , ,Q 'Q 3 F ' 5 V 1 . V f , ,ms :Eg -Q. :Iss gigs I 'I if Y I , V. all if F, E ' - ' VV s i X ...S V I r S I V W: .7 VV5I,f,.I V I IIsg.,, f1i I I. ,,.., f I I t I , 2 I III - . S 'IT' Q' r ., 1- I I- i f I I - ll . LII ' fa I ri . AT Isai, - ,f V' . ' . I T :T -Y . I' 'A f I vi B-:if-Skin I 2 g . - L1 A A ,. .,.tq.L,, V, ,,..,, . is V . ' A . Q L ,Ig f' I. R 2. A , . II .S , .I VV . -.., V .,,,V , 4 . . ,, D , .,,, ,,,, , .. , , , , , ,. ,, , ,.,,gV if A If,F':'fEg . I II, ff Q V , , . ifetgg? ' , A ' if W F' ,I::,., , . 1 S , Q43 it . .3 I ,.V I t s . A 6 H ,I A it 2 W . 5. : ff ff: i - ' .- 53 1 - S . . y ' it . ', .. s ' K ye ' W .. of W, . X - qi ,. rg 5,1 -.,. . - : A , Ly- . . . i ..r,,. ,. 2 in QA ,, ,. - A g,, A , K 'f S: 'Af ia I2 - f ' S , L-:Ev k ,, ,Q - Q E -. ' 1 ' . - Y - , Q .7 31 ff-Es. E5 . '-greg 4 . 1 1 it . . xv ' if ie. is ., 'I I 5. . S ' s ' Q- n c f .5 H x--' ' 1 - 1 -.r-2-Q . -1 : . . ' ' T V i, ' : . ik N V' A I IY T X: .fi nv 4- A A ' vs-r: Y' if I -' 2:1 - A f -::3i'i53' -'F' A . A , .r M- , gf--l. ' 51 5 ,gi .. f , A . W - . , . . ., 5 . ,, we s 35' amass I ML' 9--M a 7155-'ie 1 I -. 1 Qi :ff 1 F' . . . 'K gg ' . ,- fl' '- . ' . -f S V G G f P S 2 - -J e 1 sive g KW .. , sl, I - 5, , , ..,, :lffffi 1 ' g x, 5' Ag Ai fl. I ' I I 5 In X ig I X. f. F1 it ' ' ' J' ' J A X ' ' , 2 iv r-2:32 li1jlEfl1l,E.,.Iii :iIQ:.1aj,,':s:1 , A , 0 55.5 . ji .IIlirfQf'Ei' lxj A '- : . i' ' , 'I ,, 3 ,gi W. Iiiealx i -' - if - , 4 ' .e - ' - ie. ' 1 W X , -y A I- ,. ,. ' X I . ,y . .58 , -' ragga : .' . 5.1. . , . - ii: : . f 2 2 :iii 1 : meswmasvzsi J i - . fy errr A so ' S: J ' ., . fj E . fy' '- , i nf? , V . . 3-'K I M :cv we 1. : -- . .i i . -' . A , , . r - - .ff I A I ie-I 1 1 D. , W, g ,,.. . V S, I P Q , fps f I' f . Q' gr , I. I, i . ' -A Q . 'gg' I 1. . ' - - .H ., - .. I - - , 1, - . , . A x.,- :f- -.rv A Yf V . sf , ,x ,. r A 'b w 1 , Q ,ag M Q 'I if 5 L , I Qs Wil i : X 'I 4 ' s ' I' If if I A - .M .rv -M... f i I 2 af.: -- f .wwf Y ,wffwc v- fr: V ', f'TfiS1EilZ Wf5 11 1 ' ' .1 ' 2 ' ' r P' A A-'h I -. . - K , Q: ' A i A: ..' - ' 42,1 y ' 'Q . gy L A if , ,.v, r '. 122:33 , , I-I 'U ',f', ,if ' - ' , P5 T' .2 ,W ' -, -fff J , i , Q. 'G , ' i ' - ' gf rw , 5, gi fy, Kg , A . I K. V ,ij Y Z I Y ' in - l , I Y, ' , Q ' I ,:: .,,:' ,- fr V. 1.-Qe ' ' : ,li :fr A , ., If.:: . r , ' ' .v I i I y,6l:s,fggngbf bg I Inq mf I P-rr-'rf .:ff..,,i : M W. sr. 4 I- - -I I w so ' . My ,,- H . ' , ' is 5 2. . 3 'IV 1 , 'f-, f ' , z. fi 1' - M- , i r ,,,' ' 5 1 ,,,, - , ,. K. W, e. in 5 . ' M , J, 4. :- z . , AV. Q - , f- ky at VV 'rl V. . R ,V , I I IT f .., Xi , I .sa 'ti fl , I 5 , A 1 : . , 'iv . , .1 J- '11 if as-37 t I is A ' . -, , 1 . r. w q 4 A Yr ff: 55:2 A V - ' I V I A, , I. .iff f, V' ig ' 2 ' f' in ,A IT , 1 ,ew . - --veil: i , . ' r ff , i f 1 -I i . ii 1 , T 'I' ' I, . , a., . T T' 3 5' A ,A ff fs - , 1 A ill 1 ' ' -1 9 ' '- f I ' I - I I ri 'ky' I .7 fi! wr' iii , - ' I' I I , ,fr - , - ,,,, f , f, ff V r 'IW' W Wang: .-'- 'f 4 H1 . . - A--,' ' ' f ' ., . vt . 'E . W. , U. ' 21325 f L- ' : 'iff f Tl ' J. 1 :gy - A 570 0, ,, , if ,rx A '5 zz' m .K,VL ,.L - ' , h 1W I' , 1- .,,, iii if T f 597 ' .fgit ,1' ' , , f ,- 1 If: ., . 1- fi.. x ',K ' ' f A ,. -Iwi? H iw ,, . I, ' ' I ' : ' ' ' in : sri iw '.-wx.-'iii f- - , , ,: -is-:x.u.I-ZA. ,, .E .i:wHff YIUZ..-5 351,- 1 Y rv, jj'-?::i I Inztkm-I--ful! THOMAS, PAT: PL, Pleasant Grove, AL: THOMLEY, SHERRY: AC, Dothan, AL: THOMPSON, BELLE: AN, Boaz, AL: THOMPSON, CORNELIUS K.: INM, Birmingham, AL: THOMPSON, DAREN: CHE, Prattville, AL: THOMPSON, GREGORY L.: BSC, Huntsville, AL: THOMPSON, KEVIN: MK, Norlolk, MA: THOMPSON, LIN: CEE, Birmingham, AL: THOMURE, JACQUIE: AC, Homewood, AL: THORNTON, FRANCES: VOA, Eclectic AL THORSEN, GAVIN K.: OMN, Pensacola, FL: THREATT, MELANIE: CA, Pensacola, FL: THREATT, STANELY: PN, Sylacauga, AL: TIDWELL, CHERYL JAN: CTD, Oneonta, AL: TINGLE, TINA M.: EH, Griflin, GA: TITTLE, MICHAEL G.: CHE, Auburn, AL: TODD, JOHN W.: FY, Hope Hull, AL: TOMBERLIN, STEVE: HY, Opp, AL: TOMLIN, JAY: ME, Gadsden, AL: TOMPKINS, MARIAN: FCS, Mobile, AL TOUGER, LESA: CSS, Birmingham, AL: TOWEY, TOM: AM, Mobile, AL: TREMBLAY, GARY: MB, Southbridge, MA: TRENKLER, SONJA: EH, Daleville, AL: TROWBRIDGE, SUSAN K.: PO, Berk Heights, NJ: TUCKER, LISA: OMN, Birmingham, AL: TURNER, JAMES: CHE, Huntsville, AL: TWIGG, STEVEN: EE, Cocoa Beach, FL: TYNES, TOMMY: AC, West Point, GA: TYUS, JANICE: CA, Selma, AL VAILES, JANET: FM, Waynesboro, VA: VALAER, ALLEN: MDT, Ft. Rucker, AL: VANDERGRIFT, TERESA: AC, Auburn, AL: YANDERWERF, JENNIFER: CDP, Auburn, AL: VANDYKE, MARK: CPE, Fort Walton Beach, FL: VARAGONA, DONNA: TN, Birmingham, AL: VARNELL, ROSEMARY: IFE, Fiogersville, AL: VAUGHAN, GREG: CE, Birmingham, AL: VEIDT, JACKIE: FM, Ozark, AL: VENABLE, DAN: IE, Signal Mountain, TN YIGNES, LEON: LA, Mobile, AL: VINES, LISA: VAT. Bessemer, AL: VIVEIROS, DAVID: CFE, Prattville, AL: VOCE, DONNA: CEC, Decatur, AL: VOSS, KATHLEEN: NUFI, Metairie, LA: WAGGENSPACK, JOHN: CS, Baton Rouge, LA: WALDROP, AMANDA: CPE, Huntsville, AL: WALDROP, VAN: PIR, Hueytown, AL: WALKER, AMY: IE, Alexander City, AL: WALKER, MELANIE: VOA, Glencoe, AL WALL, SAMUEL H.: CE, Forest Home, AL: WALRATH, NANCY: BSS, Marietta, GA: WARD, ROBERT J.: PRS, Knoxville, TN: WARD, SHERI: PIR, Roanoke, AL: WARNKE, TAMMIE: PBM, Falkville, AL: WARREN, JUANITA: CS, Lineville, AL: WASHINGTON, RICHARD: IE, High Spring, FL: WATSON, ANGELIOUE: BSE, Franklin, TN: WATSON, MARC: EE, Auburn, AL: WAYNE, MICHAEL A.: IE, Middletown, KY WEAVER, ALLAN J.: EE, Steele, AL: WEAVER, LINDA: PY, Robins AFB, GA: WEINGARTNER, JILL: NUR, Indianapolis, IN: WESTBROOKS, BARRY: IE, Auburn, AL: WESTERHOUSE, WAYNE: EE, Birmingham, AL: WESTROPE, JEFFREY C.: CJ, Huntsville, AL: WHITE, ANN: BSB, Cleveland, AL: WHITE, JULIE L.: PY, Brewton, AL: WHITE, PAUL: BSC, Auburn, AL: WHITLOCK, DAVID: HF, Auburn, AL WHITLOCK, JERRI: CS, Senoia. GA: WHITMORE, MICHAEL: PFIS, Prince George, VA: WHITTMORE, BECKY: HA, Auburn, AL: WHITTLE, CECILY: CEC, Albany, GA: WIETSTRUK, ERIC KARL: AE, Silver Springs, MD: WIGGINS, SANDI: PY, Bowdon, GA: WILBANKS, RICKY: ME, Fiogersville, AL: WILBANKS, TERRI: AC, Dadeville, AL: WILBORN, JOHN: MU, Montgomery, AL: WILKS, FRED: HY, Phenix City, AL WILKS, KEVIN: BSC, Henagar, AL: WILLIAM, KATHY: PO, Phenix City, AL: WILLIAMS, DON: SY, Hope Hull, AL: WILLIAMS, GREG: FY, Millbrook, AL: WILLIAMS, JOHN E. JR.: Fl, Auburn, AL: WILLIAMS, LORILL: FM, Boaz, AL: WILLIAMS, MARILYN: AC, Phenix City, AL: WILLIAMS, PEGGY: CE. Hartselle, AL: WILLIAMS, T. LEE: CHE, Enterprise, AL: WILLIAMS, TIM: AN, Boaz, AL WILLIAMS, WENDY: GSC, Homestead, FL: WILLOUGHBY, DOUGLAS: MK, Leeds, AL: WILLIS, SELINA: PRS, Boaz, AL: WILSON, CYNTHIA: SSE, Langdale, AL: WILSON, MARLA: FLT, Albertville, AL: WILSON, PHIL: VED, Auburn, AL: WINFREE, PAUL K.: AE, Lebanon, TN: WINGARD, BEVERLY: GSW, Auburn, AL: WINTERS, MARGARET: AR, Auburn, AL: WITTER, DANA: OMN, Jasper, AL WOOD, ALAN: HRA, Pleasant Grove, AL: WOOD, JIMMY: IE, Gainsville, FL: WOODHAM, JILL: VHE, Midland City, AL: WOODS, KAY ELLEN: PM, Jacksonville, AL: WORLEY, BARRY K,: IND, Tucker, GA: WURSTNER, DAVID: ME, Fort Walton Beach, FL: WYATT, MARK: CSE, Mobile, AL: YANCE, WILLIAM E.: TN, Dothan, AL: YANDO, DAVID: OH, Tullahoma, TN: YATES, DEWANA: BSB, Goodwater, AL YELLE, JEAN: NF, Huntsville, AL: YON, TERRELL H. III: ME. Cocoa Beach, FL: YOUNG, DAVID: INM, Montgomery, AL: YOUNG, GUY: TN, Foley, AL: YOUNGBLOOD, TANA: VBU, Shawmut, AL: ZIPP, ELAINE: HA, Union City, TN: ZIPP, GREG: TN, Union City, TN: ZUSCHLAG, FRED: CS, Morrow, GA Graduates 8. Seniors Juniors Q I :M 1 . zu ef fav if in , Chewacla at the rocl4sfBFITZ 5. .Lx . x - ' it - ,. wx , E . , LIAZ A . . . ' 1 .f - '-iiiiif 'fi-5-if V: 1, R , Q N ,, sg.: L r ,I glighfg, ' .f ld-4' 2 : Z ri: - 1 warsgrf, . if T - Q, -'X S :I W. 1 ' I gage -. --K- 1, 1 ,M V w , . ' ff.: , ' t 4 U . , l ' nf 'A Q ' 1 - , .- -A was L. -- X -V-' :Y l 't.1iz?fif,. it i f 1' . E. ff Lv-4, xr -f K: Teil, , ,. - - Q yd , ,N - A , M ' ,fi-.f1.iL:1 Eg . S, Sel ig , H gy , QL ,Z , t ..'. ., , , . V. ' is . ' A W 5 1fff-.N H l Q -s. w ,. . , E .kkr M C. J .L sh .353 XE.. . . , 5 KM? Q I uri... . L- . . ' ' r . - , W xKA' .. .. .Q -. .15 f ...rg .,- . g g, X ,X U N , .. A f. . .if ' . 'X r, 3 , , .. 11.. , . .. .M Af , . 3, S' ,4 - ' ,.. 5. 1 ... .'. fbi . ,,, ,X ul, 1 .45 -J xl, - - -,'f-'fTwv.1.N:7f'- . A h Asls f A 1 ll tl 'Y Q X , f. L . . . af clff: . A 1M , 2 fe S if I I 7, i ,tj . Y A . s lit:- f ' : N f : :.3.5..,' . 5, W, 5 5 ht 1 is .riff 'Q' 1 ,:, . -S -tt f A M , .fs 5 + ,Qs , ,,.. if Q-1. l- A . , A 1. ' ,.' ' S 'f is if 2- F . 9 C A f f z' . . -if . 5' ' I A- --if ,A- ' . ' lg...,,,jv.,'I'g, 'jf' xi 1 4... 4 nf, W :Q I ' T3 A K' ' . .AVA +A E ' sf, ' 'Q ,K , 5 gan. E-- ' f E: .Gigi V sv 1: fgiiigv Nigga... W '- 1- ' g f ' l gl, f4f,gnlI' Rm, ,' ...S . . ' - A. . Q X E xv rg, 1, ei 5: ., . S it is + 1 .. 61. .... is . -f -Q , L fill? N . ' - , ..- ' Af- 3, 'S ' ' 'S , . 4 . 'SEEK ' Q' 1 5 i . S535 I . I' - , 1' '1 A S .,w:.1Q ,N ,. 5 T . ... N' f .EE?if3'iE: t -- rr Q ., :seg ' - ' .Lt . N '- , , ... f l. A . - ,::::.i,n?Z?ffTZf5f? W ADAIR, TERRI: ME, Montgomery, AL: ADAMS, DOUG: OH, Waverly Hall, GA: ADAMS, TAMMY: NUR, Arlington, GA: ADAMSON, SUSAN: BA, Graham, AL: AGEE, SUSAN: AC, Decatur, AL ASHLEY, WILLOLA: PO, Montgomery, AL: AKIN, DENA: AES, Oxford, AL. ALLEN, DONALD: BA, Union Springs, AL: ALLEN, LESLIE: BSC, Columbia. SC, ALLISON, TERRI: NUR, Winchester TN ALVIS, MARY: ADS, Duncanville, TX: ANDERSON, DEBORA: PB, Auburn, AL: ANDERSON, JIMMY: ZY, Hillsboro, AL: ANDERSON, SHERRY: AC, Huntsville, AL, ANDREWS, ALLEN: EE, Kansas City, MO ANDREWS, LAURA J.: GC, RAFB, TX: APPLEGATE, JILL S.: PRS, Mobile, AL: ARMSTRONG, DAVID: GC, Pensacola, EL. ARMSTRONG, LISA: PY, Albertville, AL: ASHBY, VALERIE: CPE, Gulfport, MS ATHERTON, ROBERT: BA. Huntsville, AL: ATKINS, LISA: AC, Charlotte, NC: ATHKINSON, JONI: CS, Ft. Walton Beach, FL: AUSTIN, HANK: FI, Wetumpka, AL: AUSTIN, TAMELA: lE, Opelika, AL AYERS, BRETT A.: EE, Florence, AL: AYERS, LISA: AC, Huntsville, AL: AYERS, SYLVIA: AC, Huntsville, AL: BAILEY, CAROL: AES, Wadley, AL: BAILEY, GREG: BA, Cullman, AL BAILEY, RYAN: VAT, Lineville, AL: BAILEY, SHARON: NUR, Birmingham, AL: BAKER, JAN: ELS, Columbus, GA: BAKER, LINDA: CE, Andalusia, AL: BAKER, ROBERT VANN: VAT, Auburn, AL BALLARD, PAMELA J.: SEC, Opelika, AL: BANKS, STUART: BSC, Prattville, AL: BARBARE, FLYNN: ID, Birmingham, AL: BARBER, BRIAN R.: AC, Huntsville, AL: BARBER, DAVID: CPE, Odenville, AL BARCLIFT, DAVID: LA, Florence, AL, BAREFIELD, JON: EE, Newville, AL, BARKER, CINDY: BA, Eclectic, AL: BARKOWSKI, RON: AE, Las Vegas, NV: BARTON, DOUGLAS W.: EE, Jasper, AL BASS, BILL: ME, Alexander City, AL: BATES, ANGELA: EEC, Sylacauga, AL: BAXTER, SUSAN: GBl, Huntsville, AL, BEASLEY, JENNIFER: BA, Birmingham, AL: BEATY, RACHEL: NUR, Louisville, AL BEESLEY, RONDA: CJY, Montgomery, AL, BELL, DEBBIE: BA, Huntsville, AL: BELL, JUDY: FCS, Scottsboro, AL: BENCE, KATHY: AC, Alexander City, AL: BENSON, JAMES: ID, Shelby. AL BENTLEY, JEFF: FY, Greenville, AL: BERRY, PAT: PiB, Elat Flock, AL: BERRYHILL, BRAD: AC, Birmingham, AL: BISHOP, LUELLEN: AC, Langdale, AL, BISHOP, ROBERT T.: PY, Centre AL Juniors 233 BLACK, KELLEY: MB, Richardson, TX: BLACKMON, BO: EE, Lilburn, GA: BLANCHARD, RICHARD: CPE, Melbourne, FL: BLANTON, DEBORAH: MK, Opelika, AL: BLAYLOCK, ROGER: CE, Auburn, AL: BLISS, KATHERINE TUNA: NF, lndialantic, FL: BLUMTHAL, KURT: MK, Pompano, FL: BODDLE, WILLIE: EE, Montgomery, Al.: BODLEY, GREG: CE, Hartselle, AL: BOGAN, ANTHONY C.: AM, Riverdale, GA BOLTON, EDIE: PRSIGJM, Theodore, AL: BORI, ROGER P.: PB, Florence, AL: BOSHELL, ALAN: VDE, Jasper, AL: BOSTWICK, BETH: VAT, Arlington, GA: BOSWELL, SALLY: VOA, Tallahassee, FL: BOWDEN, STUART: MH, Birmingham, AL: BOWEN, BEN: AC, Birmingham, AL: BOYANTON, KELLI: PY, Huntsville, AL: BOYD, LINDA: GFL, West Monroe, LA: BREWSTER, JAMES: AC, Atlanta, GA BRIGGS, KAREN: FLT, Bessemer, AL: BROCKMAN, LYNN: SSC, Birmingham, AL: BROCKWAY, LISA: PM, Vestavia, AL: BROOKLERE, JOHN: PY, Birmingham, AL: BROOKS, ELIZABETH: ME, Demopolis, AL: BROUSE, SANDI: ID, Panama City, AL: BROWDER, GARY: CE, Auburn, AL: BROWN, AMY: PIR, Tucker, GA: BUGG, CELIA: HS, Auburn, AL: BURDETTE, BILL: ME, Birmingham, AL BURNETTE, KATHY: AC, Childersburg, AL: BURNS, ANTHONY: IE, Brandon, FL: BUTLER, CELINA: CSE, Daphne, AL: BUXTON, SCOTT: EC, Auburn, AL: BYRD, DEBBIE: RSS, Sylacauga, AL: CAMPBELL, STACY: PY, St. Louis, MO: CANNON, JENNY: EEC, Huntsville, AL: CARLAND, RENEE: CS, Fort Lauderdale, FL: CARLETON, TRACY: TC, Dadeville, AL: CARLISLE, BART J.: AC, Thomasville, AL CARLISLE, TRACY: PY, Orange Beach, AL: CARLTON, ANNELIESE: RSS, Jay, FL: CARPENTER, KITTI: TMT, Alex City, AL: CARTER, DEE: PUB, Huntsville, AL: CASHWELL, P. CAMILLE: PLXGJM, Marietta, GA: CATON, SHARON: BSC, Montgomery, AL: CATTANEO, BRIAN: ME, Maitland, FL: CAVERLY, CHIP: AC, Atlanta, GA: CAYLL, DIANNE: PY, Satellite Beach, FL: CAYSON, DEBORAH: CEE, Blounstown, FL CHAMBERS, CHERVL: CE, Auburn, AL: CHANDLER, GREG: lE, Andalusia, AL: CHANDLER, SCOTT: CPE, Mobile, AL: CHARLTON, KEITH: EE, Dothan, AL: CHASE, JEFFREY E.: AE, Auburn, AL: CHASE, LEIGH BOWEN: MK, Auburn, AL: PY, CHASON, RICK: EE, Opelika, AL: CHESSER, LORI RAE: Enterprise, AL: CHI, SANDRA: PG, Republic of Panama: CHITWOOD, JAMES G.: CE, Fort Payne, Al CHRISTIAN, JULI: PRS, Birmingham, AL: CLARK, JANE: NUR. Auburn, AL: CLARK, JOHN, M.: MK, Auburn, AL: CLARK, KAY: INM, Lineville, AL: CLAY, HEIDI V.: AY, Woodland, AL: CLEMENTS, KAYE: IE, Enterprise, AL: COAR, JACOUELINE: GSW, Phenix City, AL: CODY, JOAN: NUR, Opelika, AL: COKER, LEE: IE, Atmore, AL: COLE, JOHN: GED, Bethesda, MD COLLINS, KATHLEEN, V.: RSE, Lake Park, FL: COLLINS, LYNN: GED, Thorsby, AL: COLOUITT, JEFF: IE, Columbus. GA: COLVIN, JOANNA: FS, Albertville, AL: CONNOLLY, CHRISTOPHER E.: PIR, Florence, AL: CONSUNJI, REY: CPE, Jacksonville, FL: COOK, PATRICIA: GPA, Mobile, AL: COPE, BRAD: ME, Birmingham, AL: CORNELISON, LYNNE: PO, Huntsville, AL: COSTES, PAM: PM, Troy, AL COULTER, KELLY: OMN, Ft. Meade, FL: COURTNEY, ALLEN: EE, Shalimar, FL: COVINGTON, MIKE: AE, Enterprise, AL: COVINGTON, SHANNON: PRS, Wilsonville, AL: COX, BARBARA S.: EH, Auburn, AL: COX, GINGER: CPE, Huntsville, AL: COX, MICHAEL E.: ZY, Auburn, AL: COX, STEVE: INM, Huntsville, AL: CRAGON, ALLEN: HY, Franklin, TN: CRAIG, BENJAMIN: CHE, Atlanta, GA CREASMAN, WAYNE: AT, Birmingham, AL: CRIST, JIM: BSC, Ft, Pierce, FL: CROASMUN, JOLENE: MH, Birmingham, AL: CROWSON, BRYAN: PRJ, Brent, AL: CUGOWSKI, YUKARI: RSR, Pensacola, FL: CUNNINGHAM, CARY: AC, Selma, AL: DABROWSKI, IRIS: GJM, Albany, GA: DAILEY, TRISH: CS, Williston, FL: DANLEY, DEMETRIUS: FLT, Florence, AL: DAVIS, BRIGETTE: FLT, Montgomery, AL DAVIS, BROOKS: PY, Linden, AL: DEVINE, YOLANDA: MK, Bay Minette, AL: DIADDARIO, DAVID: PS, Lawerenceburg, TN: DIBENEDETTO, MIKE: AC, Birmingham, AL: DIXON, MARY ANNE: AN, Auburn, AL: DOANE, SUSAN: CA, Montgomery, AL: DOLLAR, PENNY: PY, Tuscaloosa, AL: DOMINICK, ANN: CEE, Homewood, AL: DONALDSON, MARK: PY, Carthage, TN: DOROUGH, MELANIE: NUR, Birmingham, AL DOUBERLEY, JOY: CEE, Montgomery, AL: DRAKE, CLARISSA L.: PUB, Phenix, City, AL: DRAKE, TRISHEL L.: IE, Birmingham, AL: DRUMMOND, KENDA: EEC, Nauvod, AL: DUKE, WILLIAM: CPE, Birmingham, AL: DUNAVANT, MICHAEL: PB, Rainsville, AL: DUNNIHG, LESLIE: Fl, Opelika, AL: DURALL, ELIZABETH: FLS, Daleville, AL: DURALL, JOHN: PUB, Daleville, AL: DWYER, BETH: NF, Fairport, NY 234 Juniors f A .5 M NSD :il-wr ff: : 'Ls If .1 E25 S. .ne , 1 ' -A - 'iii' . Lf if ,Mx V A' 1 3, Y fy ,, is ' f :. ggi 1 . . - f ui 1 rx ' -xg ,. if xii 7: ... 9 5 K' S., V VV V . SV V 9 Tix, f- - ' 0 l Q I 5 4 A Q , iraq ga, ' , '3 V ,. ..:. V VV: . V ri ' Nz 3 i A SE 1' . H R3 1 51 . 15 i . :..,,, 4 X :fl fiiisffriti 'l ii A 'ii 1 kim. i in Iii ' . A' '. 'KEYS ts - x ,gi 1 , shits I Q- if' 4 , 5 s X X ..: is 'Xe Q Q L 5, ' 3 r t x Q W.. ,,,, . - V I 'X f .. V ij , 'f: .Q ?fii ,,,. . .. A .t... 2 11-aww-me ? T Ei? ' ie . . 'ff . QQQ L e at . ' .,. 1. ts. e 5-t '- Q. : x .9 t . . ,TV .. . , A a -A f- , xx, .Af f- ' r- M i ' - , : -s . .1 f 'Z' ff: .- f T ' X Ng V . it ,ttt , ij. . . . .. ,. .tr .... ,. : fi f ,,:: A .. A Y f it ::': gs . il 3 - f . A .. A. . ::': -w if K - -A ' l - 1 F5 . V 1, : V rt-,Q 153555 ,-,f-5- V, . C . , . 1: r Q , ,si ,i .. .151-3:-, es ,Q .... 5: V - - wg x gg . SMJVEQV Page ' Ev' i' V . in i A N ieee . '-x 'if . R. 'L 4 -4, , - ., 'w fgzfft '::- Ji , v . :wife 5 X ii ' is ii 1 v' .1 1' J. .3 -. Y egg, Q- ' Q ' ' .. , ' -: f.: I A A Air- ,Q ., ., .:: - Y -Q V L 'Z-5, :W it ' '1 4 QQ: :iM:s.see::e',eHes ,sci 'sfff::fi1.: I , A 5 V XV 3 , .Q 'Yi ,f ,. em? 2 : A I 5 X A i .. . an i rf 22 ' V , V VV VV Q - L Q r I 2. J 'J - ef Q., ...E 'ii ,W ni -V' qi? XX Nt N99 U15 nt,5.iED5.n,a! 1 , ,. , g - 1 . . ' .--x 2 A -- - S :ig ., f -- - '- 1 W - K , i . , Q 3 .1 - A I 35' -' g - 3. -V ws ft. 23 - ' ,, ,... . a., .w.:u: fe 'A ts . . '- .M ai a- V my 1,-. 3 gist. niyV'if..:a i MV , ., X ' 1 ,, , . V I V V ix, . , .ff ' ' lg, Q , Q ,V VV gk V .E V. : X371 ,., VV. gy Vg if V . ., x yr V f .1 Q. gs A V' V V A .V , :, isp. VV JVEVVVK 1 f V ' r- . :..' - v- was ,. I Nia: ' ' A - 1 .m wtqq i 4: M. : .if : : ' .. ,,, w:SwWsw we ewlawveeawe si 1. .Y , ' 1 W' ' 'r N .::'i::- ' 1:- , ' , 1-'fig ' . ei A111221 ff. 1' 1: . ig , : 'i 1, - .fe is , 5 gi 1:1 1 , ' 2 - - -at - , .. . : fx :Q-5, . ,- ' , .. . 5, A. . , ., : :Q 5 f .I,g.s N 1. 1, ,Y - S .V . .,.,, V 9? : ' ,Wiki - 'X , .::. 1 'liwtbj , rv Y . M - m g 1 ' Q. 1, iii' J' w, ri ff' -rt: 11.5 :Aix A.--. v ii' X .L . as ies. ta, . - .,: . ' VV , . -V V' L J .... . .V . li i ' Je, :iff ' 3 .gif A xr. A we K W gs 'ri F it :wax ? . , S 'ie 1 X Q XV Q ' A t - T A X 2 .. 'N r A Y A an I ,N Y ,dt N va A, : riff , ., es ya - :fy 31 a ,, Q, gjxylffr V sg ,ii-11. 2 2 2 - : N, ,V 1 3 5. i 'f ' ga ' ' ,i -: if - , ' . as .,,iV'S.s-.gig V, V V., I, 'V 1 - at. 'Sw , -F: ew.: , ,T , Eli? ' r -fQ1i:1t': .1-T: IES: 5 'il L: .151 l..iir-i ' f A J ' A 'ff-QE 1 , .15 .. A :, V V R 1 .. Vi, . 5,1 A -I . .A :waz -A EY - - - K ' .g h . 5 L.. , fx M., . .. , l y 'ii ' fl :fx ,- Y f- ' i 2. : i' : Wifi f ' ,A 'tin 'N 'ii 'gy in M :R -.1 .. Q, iff. Q1 ,v ' 5' sary -2 . Y .,,. 1... . Q --: fd . . V. . VV L Wilf- fpg is 'I 4 I .Vg V ff--fx , - ., , 1 of 3. V , eff ' S3457 N A S-L i f : -- +1251 Qt -. -Q tt 4 EER' A Rl 5 K ii , , i. we X x X A 5 2 ' Q 4, ' V ' ,V N EQ ff ' Q T -.W . Qi' XJ 3 V, X . A il .,, , f L 'W EAST, TAMMI: ADS, Leesburg, AL, EcKERT, KAREN: GGL, , 9 A L ':', rf , Peneaooia, FL: EDEN, TIMOTHY: EE, Warner Roorne, GA: L 5 if 'I 4 I 5 'Z ffl' EDWARDS, GARY: Pa, Peachtree cny, GA, EDWARDS, TAMMI ' I - if A - A . A L X f 1 s.: OMN, Mounrre, GA: ELLIOTT, ELISA: RsE, Roanoke, AL, QQ , :Q in r 'A , ,L f A ' r Z - T- AL. A ELTZ, CAROLINE: VHE, Birmingham, AL: ENGINGER, LINDA: ' r A , ,..,,, ,, I t' , L ' ' PM, Doman, AL: EYLES, EILEEN: Pa, coiurnous, GA: EZZELL, gk .e- ' A ,, ,Q Q H Q - Q i TIM: PL, cnananooga, TN 'A' il' QL' N' L . . I A VL P- L Q Y g.1::,.,, -f few I' ,L Q' Q w w-Q 'r FAGAN, LYNN: PM, Triton, GA: FAGERsTRoM, CHERVL: BA, , -5 Q' :Q r 1 :LQ Q , spanren Pon, AL, FAIRCHILD, RANsoN: AM, strne, AL: I A Q ' - ,, ii? , II 1' lg, ,Q 7? ff' FARMER, DANNA M.: EE, Eutaula, AL, FAULK, TERRY: PPV, ff 2 i 1 ' ,Q r - A :L -, -kj, A xi Pnenrx city, AL: FAULKNER, LILA MAE: EE, unron Springs, AL, A 'r W 'Wa 'if 'C QQ r ' ' in-I 77 r tx ex FENN, OPAL: ME, Florence, AL: FIGH, JACK: EE, Montgomery, A ,, '- 1 :L V' A if w .Lf 5 , w ,,,:qr, . - , TS, EVANS: QQ .Q i, ,ai IQ QQQ Q L QQ Q42 Q :QE ELZEZBZQRIQWILSDN. IND, Moorle, AL FIT 'r A I A I 'ef A L P ' :L r N, Q , 1a1gfr,fis.f r r QQ igg: ' ,gg ,ggwjg-3514, I ' if its SW-ei . Q - - if L J ' . A' 1- f - f- . FLANNIGAN, RAMONA: EEc, Hareyvrlle, AL, FLEMING,-1052 if I I I . Q I PV, Birmingham, AL3 FOREHAND, DAVID: OH, Wetumpka, AL: Q1 A W , z.Q Q-M , LQ 1 Q , , .ez ' Q , L FOTHERGILL, LAURA: FLs, Mlann, FL, FOXX, WILLIAM: ENT ' L . ., ,, I' f , : It f 'Q iff' -31, I Q Decatur, ALQ FRANCIS ROBYN: FLs, Tampa, FL, FRANK , 1 ' Q' Q-Qi, A I Q sTEvEN A.: INM, Enterprise, AL: FRAZIER, KENNETH: EVE, 5 - - QQ.Q,Q QQ! ,L 3 In I ,Le 'W ' f - ', ' Larenceburge, TN, FREEMAN, CAROL: MK, Columbus, GA, , f , ' . 1 A I ,, I P f , FREET, .IAMEs A.: Fl, Stone Mountain, GA 2 , A -, ' Q QQ H ,,,,, F if A . Q , A L , A A ,,., FRY, KATHLEEN: ELT, aranaon, Ms: FRVE, MARY BETH: PV, L ,, V ff: I . ' - ' 'I I ' r Anniston. AL: FULK, CONNEEI PY Auburn ALI GAg'ERr 'fi ' . L- . 5- E ir: A - , AL3 GARCIA, ANA H.: , I N ' I :QS , A ,L f I L ' 1 Q' si ,:1: I Li , I I I!gFDIV3Lagz??IACKIE: MK, Atlanta, GA, GIBSON, Q , ,:,- 5 Q r , QQ Qi Q QJQ Q A. Q i Q, Q Q QQ , , :Q ,QL RODNEV: ACQ Anmston AL. GIBSONQ THOMAS CQ: AMQ If x , M Q .L , 5 ' J A. 324, L fi' xhkhr Huntington, Beach, CA GILMORE, DARWIN: EE, Marianna, FL3 I Kill' Q -, Q L, 'Af GINANNI, KATY: FLF, Murfreesboro, TN 4 - . L -, 2 E ' L W -' :ze --VY ' - . , fr :ff A , : ,.,.L. , , j r ' Af L A ' GLENN, SUSAN: ID, Arab, AL GLIDEWELL, CAROL: AC, L, r. , 5355 ,.- 55, -A-gp . :L f.,-L, r .,,:-A 5, , GL, . us-:, T Q F , ' ' - - -- , ' 'P Blrmlngharn, ALg GLDVER, KELLY: PRJ, Huntsville, AL, r M ' - G, 'SN A- L 7:1 -'-r ' -Q r -5, ' . Si ,1 ,L , N :LQ ., ' I 'z 3? ,J:. ' E .A : r-L L - .- My M f- f -L - A' AP E f GODDARD, CYNTHIA: Ac, Decatur, AL: GOODWIN, DONNA: ' A 'I I 'X 1 Q -r ff A Q- ' -'N I ' - AES Sylacauga AL: GOODWIN, DOUG: HPE, Sylacauga, AL, , , . I f ,Q I i QQ r Q., - GOODWIN, TRACY: HA, Mount Olive, AL, GRABEN ROGER: , , :-'P Q f 'YN Q Q -gf , A 'iff , ' PY, Lineville, ALL GRADDY, ROBBIN: PY, Brewton, AL. ,- L A Q . L GRAHAM, Russ: EE, seoneeoro, AL 4 .1 L '- kiiix 1 ff:-A - fm :Sf -,, 5 , - , :::: , ' ,, -A L , Q QQQ QQQ : Q ,V Q A N ,. 4 Q I ' t A - GRAVLEE, BETH: Ac, Hunreyrlle, AL, GRAY, JANE: Ac, -Q QQA AQ -, - Q - I iii' 1 Q A i :eff Opellka, AL, GRAY, KAREN: NUR, Auburn, AL, GREEN, LYNN: E f f - fe, , I . in ' ' A, , Q QQ, 3? . ' ar AEG, Roanoke, AL, GREGG, SUZIE: Ac, Pooerraoaie, AL, : - L. ,,,s,r: I Q' A , -':' f f' : ' I , 3 GRIFFIN, JEFF: GGL, Auourn, AL, GRIFFIN, KEVIN: HPE, L , ' A X A Lflnv if , A Gadsden, AL, GRIMES, BETH: AES, Centre, AL3 GRIMES, LL ,af ,:, -, fg-, Ls-1 r L - V' 1Qf',' - Q : ,, 'f , 1 I , -A 4 I L. LINDA: CDP, Hollywood, FL, GROSS, JULIE: INM, Madison AL E, , U r, 1 I A 2' ff , , F 2 '-A, .Q ,, I Qygftu : Q-A ' i L, If ,::.A.,:,.1,L ,i I -A 'A - M- s o I' I Q G QA QQ ' QQ AQ ,A I GULLEDGE, ROBERT: PV, Flobertsdale, AL, GUSTIN, LESLIE: L Q, Q ,, A ,- Q -L ,r QQ 5:5 Q, if 'A - - ,L PV, Moorle, AL, GUSTIN, SUSAN: VOA, Brrmrngnarn, AL, HAAK, L , .. ,, ,L :A - X I' ,f-- Iig, :H -A I :III 5 SUSAN JUNE: CHE, Auburn, AL, HAAS, MARGARET: LA, , ,gf ,IQ - , TZ A 5 W r , 3, r:::, Q Q :QQ Danby, VT, HADDAD, HAYAT: PV, Auourn, AL, HAGANS, I ' , , I 7 I Q xg - W , RICHARD c.: PG, Opelika, AL, HALL, CHRISTOPHER FI.: cs, 5 MTE? V I I X , L Qf4G'f??'j r I' ' A 1 Gooowater, AL, HALL, FRAN: PG, Columbus, GA, HAM BRAD: I ' '52 A. Nfl- ' AMH, Alb I 'Il , AL Q Q, Q . L LKQ , ,Q Q EQ N er VI e ., YE' - A I l ' LLLEQQLQ -r,-- L: ,',- A it Sani Flush Q Q Doug Brinson Sani-flush, as it is affectionately , known to students, is the location of many informal dates and late-night splurges, The little wooden structure is located downtown and has been an Auburn tradition for decades. Juniors HAMMAN, JUDY: An, Boaz, AL, HAMMER, DATHAN: INM. Stone Mountain, GA, HAMMOND, CYNTHIA: GA, Roanoke, AL, HAMNER, BLANE: AE, Townley, AL, HAMNER, CLAIRE: CHE, Prattville, AL, HANDLEY, BILL: ADS, Camp Hill, AL, HANKS, VALERIE: LT, Huntsville, AL, HANSON, STUART CRAIG: ME, Lawrenceville, GA, HARBIN, TERENCE: GL, Cullman, AL, HARBOUR, LISA: FM, Powder Springs, GA HARDEN, TRACY: NUR, Phenix City, AL, HARDY, STEVE: SSS, Decatur, AL, HARRELSON, JANE: MK, Dadeville, AL, HARRELSON, MICHAEL: AG, Elba, AL, HARRINGTON, FRED: AE, APO Miami, FL, HARRINGTON, JACK: ME, Montgomery, AL, HARRIS, BETH: AC, Lineville, AL, HARRIS, CHRISTOPHER: CPE, Ringgold, GA, HARRIS, JAMES: INM, Montgomery, AL, HARRISON, HOLLY: AC, Birmingham, AL HASE, MARTY: CEE, Huntsville, ALL HATTON, ELISEA: EEC, Shetlield, AL: HAYWARD, ERROL F.: ME, Clearwater, FL, HEARD, EMMETT: AN, Roanoke, AL, HEFFINGTON, TERI: CPE, Huntsville, AL, HELMS, JOHN: IE, Clayton, AL, HELMS, TROY: ADS, Deatville, AL, HENDRICKSON, STEVE: IE, Jasper, AL, HENDRIX, JEFF: GED, Double Springs, AL, HENRY, LORA: ADS, HopeHull, AL HENSLER, TERRY: AC, Hampton, GA, HENSON, CINDY LEE: NUR, Birmingham, AL, HERRING, MELANIE: IE, Auburn, AL, HILL, BETH: NUR, Spanish Fort, AL, HILL, PAULA: CSE, Ashford, AL: HINES, JIM: GED, Auburn, AL: HOBDY, LETA: AC, Birmingham, AL, HODNETT, NATALIE: Fl, Birmingham, AL, HOGGLE, RHONDA: AC, Selma, AL, HOLLAND, AMY: AC, Signal Mt,, TN HOLLOWAY, PHILLIP: CHE, Panama City, FL, HOOKS, BRADLEY L.: PRS, Geneva, AL, HOOKS, GAIL: PPY, Auburn, AL, HORNSBY, LISA: CE. Troy, AL, HORNSBY, MARK: MU, Tallassee, AL, HORVATH, DIANNE E.: AC, Decatur, GAi HOUSTON, THOMAS: EH, Montgomery, AL, HOWARD, LYNDA: MK, Montgomery, AL, HOWELL, RANDY: HPR, Notasulga, AL, HOWELL, STEPHEN K.:'ME, Mobile, AL: HUDDLESTON, CELIA: PM, Madisonville, TN, HUDON, DONNA: MK, Milton, FL, HUGHES, ANNETTE: CEE, Pisgah, AL, HUGHES, JOSEPH: PRS, Montgomery, AL: HULLETT, RENEE: CEE, Oneonta, ALL HUNTER, STEVE: EE, Auburn, AL, HURST, DAVID: GCL, Birmingham, AL, HURST, WILLIAM: EE, Gadsden, AL, INGRAM, ROBERT: CS, Auburn, AL, JAMES, BRENT: EE, Trinity, AL JAMES, RODNEY: CHE, Cherokee, AL, JARRET, JIMMY: PRS, Eatonton, GA, JENKINS, ALAN: EE, Harpersville, AL, JERNIGAN, DAWN: AC, Brewton, AL, JOHNS, JENNIFER: CT, Stuart, FL, JOHNSON, ALAN: INM, Athens, AL, JOHNSON, COLLEEN: PB, Smiths, AL, JOHNSON, DEEDEE: IE, Huntsville, AL, JOHNSON, JENNIE: AC, Auburn, AL: JOHNSON, JIMMY R.: GED, Arab, AL JOHNSON, JUDY: FRM, Arab, AL, JOHNSON, LISA: NUR, Auburn, AL, JOHNSTON, PAUL: IND, Monroeville, PA: JOLY, LINDA: PB, Florence, AL, JONES, CAROLYN: CS, Opelika, AL, JONES, CYNTHIA D.: PB, Sylacauga, AL, JONES, GILAN: EEC, Red Level, AL, JONES, J. BRYAN: AR, Oak Ridge, TN, JONES, JO: EEC, Evergreen, AL, JONES, KEITH A.: CHE, Stevenson, AL .loNEs, KENNETH: MTL, Huntsville, AL, Jones, LEE: CHE, Dixon Mills, AL, JONES, LISA: CE, Huntsville, AL, JONES, PORTIA: FM, Opelika, AL, JONES, SUSAN: EE, Milton, FL, JORDON, JAMES: GED, Birmingham, AL, JUNO, ANDREA: Fl, Plantation, FI., KALEMBER, DUANE: AM, Stone Mt., GA, KAUFMANN, THOMAS: AR, Alexander City, AL, KEATON, CHRIS: CHE, Colquitt, GA KEEL, ALAN: HPR, Albany, GA, KEITH, LESIA: INM, Ozark, AL, KEMMERLIN, CANDI: IE, Woodland, AL, KERNEY, PHYLLISS: EE, Warner Robins, GA, KILGORE, CATHY R.: ADS, Nauvoo, AL, KILGORE, CYNTHIA: EEC, Anniston, AL, KILGORE, MARY ANN: AC, Gadsden, AL, KELLIAN, ALEXANDER: FLT, Mobile. AL, KIMBLE, BUTCH: EE, Florence, AL, KING, KRISSY: AC, Sylacauga, AL KING, RICHARD: AC, Birmingham, AL, KIRKLAND, LINDY: CE, Chipley, FL, KIRKLAND, ROBERT W.: MK, Vestavia Hills, AL, KIRKLEY, KEN: PB, Auburn, AL, KIRKSEY, FRED: IE, Saraland, AL, KNAUSE, CHARLES: HSA, Daleville, AL, KOON, MELISSA: PB, Rome, GA, KORTAN, CARR: VAT, Atlanta, GA: KUHNS, LARRY: EE, Sebastian, FL, LABRAM, ERIC: CS, Huntsville, AL LACY, CAROL: PY, Phenix City, AL, LAING, CATHY: GED, Huntsville, AL: LANDERS, JOHNNY: PY, Florence, AL, LANE, NANCY: INM, West Point, GA, LANGLEY, LAURA: AE, Woodland, AL, LANGNER, DEBORAH: PB, Odenville, AL, LANKFORD, SALLIE: IFE, Huntsville, AL, LAUGHARY, JEFF: PO, Fairmont, GA, LAVACOT, MATT: AN, Auburn, AL, LAW, BETTY: MED, Tuskegee, AL Juniors We A ZI , .-l- I II I ' I ,I ' II ' ,Ii i' ' ff' Q Xi, I I f Z ' QI - I' I , M, I-up I' ,, fx Juv 4.4 V ,IIIII A :L II, , . I A A sa' I I 9 I VV i , 'V G V I V I , V 1 V f, I., X L, I A If ,., ' Y I 5: ' 5 ' 5s I III4lI V ,,f' IxI , ii ,I ' I 6 ' fi'53,QZ',fft5-VCI , , 3 If W , ,5ggf,,g,,,.2:l,g 4,35 grzgn, I. , .V I, I , If , i , I. ' - I I by , I I , ,,.- f ' If I . 7 I 5 ,' 2 I I I ' ' I II I A 2 ll If A, II I? ' , ' I, I , ,,,, .I I .I ,,,, I II,, I 4 . I . I I A 4 ff f W 44' 'I T 'M ' 'L' 4' f I ,gf F. ?f '54 A -ff: I:-1, 1 'Q FW Z 1 . Ili: ik, L Iv ,,, , Q , - , , jj' A ,,,.,g ,,f','0,,2Q:: 5' QI , I ,I W --7Tsf 'T ,, 1 gf 'i'i 'gg I rf :QI:'QI:, I f, 'r T1 Ii I ' 'II If I ll I Q, QI 5 K A t. Iill I I I W, I. ' ' I ' ti '1 7 2-MI Z - , IIS it If 1 my u 5 I ,I- I X I 4 I f I , I v I , fp - W , ' : I w A I' ' -1 I K, III I I I A I I I at - ,,jjI ,,,,,,y ', I I, If :gg I ,, i' i - I II f I- f e. I , ' .I I ' H 42 I I ' I T , A L I I I' L. ' -I I f , f i, GI ff ' iI I 1 f-III 'V , I V A ZW' I ' L , ' Y I I ' 4, I I , ,I , uI.I.,,,,,., -I M, Ag, . . I,-.,,....I. ,I 'f fIIi- ' A ' 'M -E'IZIg?,, 55:5 - E 3 Aka, I ,f, iff' ,, ia? ' 1, ,ZITI I JZ, 'W . w I. I r. II WI :IMI of I9 ,M If W , ..I III, - , - I A , ,,, N J vf,IIsII I , I . , I, if I ' ., ' 'T I , I 1 , I I - . I - I I S I 'f I- I - :fu , .4 I' g f ': Y if s in f -. H ,I, V. L, QI , 'rf , f. I ,MS L - ' ' T ,fu If I , I II, . . ' ' 'IX I : I , P ' , ' I I I : . ' V' '1' I me IAEA .f I 1 ffl? 7 .1 'A ' ,, I, ff . If I I I , ' I ' AII, .I I I I I ,I . itz' .I I L - II:-1' ' Zn fy M I Ie I I I ,R I 4 f I , I I , : f - - ,. , I :III S U ' ', I V, QMRIIJE 7 d ' I I ,I - IIIIII1 If I. 1 III. I: ' WI I I- ,I 1,25 I 591 'fe 1673 ' 4. milf f - ' I ' 'I .,- fs 'S A - Q f' ' af .95-O V ' I ' 7 '- - M ,fc QI' vu, .I I ' - ' I . I-HII . t f 1 , I VII S I II IIII I I III - I f WA ' 4' ,fi I ' I ' - I I. 'I ' . I' ' 1 ,. . I I I V III' -A ,,Qv.I,v ' . ft, H- I, I 0 . ' ' , , ,j ,, f A I I , , 2 tlflg jfff ' ef I ' ' I I 'I ' I I, I I 'WIEI IIIQIIJ 'I . I f II A w Z ,, 5 ' I I , I , If fifwkiz ' W lit . I ' I 2 . V 1 I I .I M I-II, III . I W4 IIIII I IIII L,,.. , ,yn . , II I III, I 2251 I ,i,,I. I 1, IIIIII' . ,I , 1, , :fa '. I ,I S., :sq - - ,. gs. V.. f ., za, .I V, , .' I I 1 ,,,. , , ' M F I I I R ' I A ' I I' to A ilu, ffiw :I 'Iwi'- I ' t I :II v A 1 ? 5, 7 L 27,3 gf If f I ,,, ,ef-A fi :I If I, It K' I. M Ifi ni- I 5 I f .,, rf ,yy me 'fWQ +f,:, ' F. - , Wig- r ' ' Lf' Q' ' ' 'ij .' , ' ,, if if ii.: f ii - I f , .. ., 1 . , , ii f A 4 A - : .A Vw nf L . , Q, i . 3-I A J' , . I ' ' ff: Q-'ir' : xg ' I . ' .. fffg 'V 'sf E- 1 Q . X. -I 'i 1 ' . , I , , ' :fi '- : .1 2' mul -, ' I E.. f 'A ' '1.2i.:f.:'J:,,i.P,i'5 .,,., - . . , K I rw ., ' ' - ' . ' ,,. I Q, L . 1- ,Q , E A 1 . L 'y . l VV- . Z 3 't .my TW, 7 ,f Q is T 'I , ' A , : -A ierr A . J. , 4 r V . LL,- . 1 , , 1 sw' ', 'r-ww' - ' , r , 1 Q' my .. . -: ' f I- li: ' ' Y' i f V ,,W,, 'Lf e yf A .. ' -f-J' ' -efl 2 ,Q :ii53EiY.'i ' VV a. 7 --' - If H M, I ' .rs '- 'i ' V I: :. fi af' ' . i ' -1- . . I I X W I I 2 Z' vim ' 4' I ' ai 'J' 43146, 5:4 - ' ' I: 1577 I. , N f A A ' I :i W, . ., H, , E LH L lv ,K , A y E ' V W . I , ,, A . ,,., ,, Vg In N' ,. F 1 . ,fy V g :T 3 I.. . r .' A . , W' ,' .1 - .-. ' I ' -7 . -gy .- f, fr 4 rf: A rr' .iii W. ' - 'll' A X .'fff:i.M. J ...--- 1 -. f , -. 1 1 ,M , 'r qfzg iv-'fax If 'S If 4. ' , g . --1 fy gg V. 54-5 , iiisssssiftfislirtl , lp . J A f , . Y f f ,r f. . if , Q, 'f1,,, , -nr il, ., I is , H gy , , . at : , f W T :I ff M ga, ' if -ff g Vg Ah I f - 6 ' My VV Q . if 4, .A 1 Ilwff' , , If I ' 1 :fp , 2:,,1,, . 1 r' ' ' W My M ,, L4 IA 1 f .VKKKV f .W ,, ,Y 1. .:- 1 1 fr . mf , f ,.., f , few ff C, A , V if ' -., 1' f ' ' -,, A f- 1 gtg,,igg, ,r4nff,f 'Qr , Q , ,,,. ,, ,,,-,f.q3,.i.,,,, - ' va Y , : I S w :zz fff, .23 .X ' 4 - I 5 Q'I'f1Zga:? ?E' ', H: ' . r 1 ' 'S , H , 'Y -' dm! :ftv 'W . 'I I 'E 'r 1 V: , 's jf? 'i V, 7 'EQ f ' Q '7 K , A A rf, f . '- ' ' as A at Q , , rv , 5 , V6 A C M, , V , :fe Wiser' . - ' ' - ,,, ? f f ' -T? L-,Q ' 'vp ' I A V , - N I 43 . v,tQ.,,,,' ,L f A ,, . , .9 1 I' YA? ' 'E' 1- A 2 ' A 3 ' iff A 2 f :Z J ' Q, , - :V . A y K, V' 5 , N L 7 rf, 'I . ,II : 9'1 ' I 1 ' Af .A . v. S --A .f :' 5 f A - i' ha, g 4. I Fir' L' 5.3: , Fl .- ,A ,V ,X 'f Tim, ...V :5 , :V 827-LAVR, . , I .t - ' ' ' ' 1 , H P ,, . , E l , 'I V A , V, 5 ,,.+ , . , 14 ' ' ' I , -r , V L, , fr K ,L-if 3 T ge., . A 1 , H . we ,' , f v . . ,' ,' - v , 1, ,4 ,'Mfvf? . L. . i V, Q52 gs f-,. Iz'r1r',':, .,- . 42' if T , ' ' fp: Hare, .MI l, is ' A N 'I' ' ' . - ,, - , ' 4' Q ' V' LLL ' v A 3 'I Si 5 'P' 1 L. . ' H mf., ' F1 'f - , r fr ' . ' Um , - ,, ' ' 37 f' iff 'h I : M P ' I -I ' . M: -' f' - ff' .v U' ,V 4, :fs 1 ,f 1 ,- I 2: .ff ' W ,,,,V ,Q H. , gf: 1 wir 1, , Q A, W xg f A fi' V -4 N' . , 1- ' W if ' 1: i . '55, , ,r ff arf fvffwf 2 ,.,. A -f ,-f'a? f W . , .t ., 3. , , 3 ,A A 1: ' ,,,: - ' , frw m If i 7 , VILW ,V 5. M y . . A 7 'S 'M 1:--.1141-.:..: '- ' 'O 1- 7 n 1' , ff- fy ' fi :,7f i'f' ' . 5 it . Z LAWSON, NAN: FCD, Eastaboga, AL, LEE, JOHN D.: AC, Valparaiso, FL, LEITHAUSER, DON: SC, Rome, GA, LEMASTER, NIKKI: FLT, Maxwell Air Force Base, AL, LEONARD, WESLEY: PO, Smiths, AL, LESSLEY, BETH: RSS. Albertville, AL: LIVINGSTON, MICHAEL: PG, Auburn, ALI LOGAN, BRUCE: GB, Tyler, AL, LONG, CHRIS: ARIBSC, Lake Allred, FL, LOPEX, nlcl-IARDE: CPE, ora Hickory, TN LOWERY, ROYCE: EE, Sulligent, AL, LOWERY, SCOTT: IND, Hueytown, AL, LOWRY, RUSSELL: PIR, Montgomery, AL, LOWTHER, SUSAN: CDP, Smiths, AL: LUKER, LESA: CS, Phenix City, AL, LUNDY, BO: AC, Huntsville, AL, LYLES, JIMMY: ME, Thomasville, AL, LYNCH, MARGARET: CTD, Woodstock, GA, MABRY, DONNA: PRJ, Panama City, FL: MACKEY, SARAH: EE, Lafayette, AL MAGAZINE, KIM: RSS, Baton Rouge, LA, MAGEE, MELANIE: ME, Baton Rouge, LA: MAKI, HIROYUKI: CPE, Ozark, AL, MALONEY, LARON E.: AM, Auburn, AL, MALTBIE, PAMELA: AES, Boaz, AL, MARCINOWSKE, EVELYN A.: GJM, Auburn, AL, MARSHALL, SCOTT: AG, Decatur, AL, MARTIN, D. PATRICK: GB, Auburn, AL, MARTIN, JENNIFER: EE, Enterprise, AL, MARTO, CHARLES C.: FLT, Atlanta, GA MARTUCCI, SCOTT: CPE, Clearwater, FL, MASON, LEE: EE, Cleanrvater, FL, MATHEWS, CAROLYN: PRJ, Lineville, ALS MATHISON, ROBERT: EE, Aiken, SC, MATTHEWS, SHEILA: NUR, Huntsville, AL, MATTHEWS, WANDA: MDT, Getzvllle, NYL MAXWELL, JERI: FLT, Mt. Olive, AL: MAY, LYNN: AES, Union Springs, AL, MAYHALL, KAREN: AC, Huntsville, AL: MCCARTHY, PATTI: AES, Orlando. FL MCCLURE, LEISA: MDT, Henager, AL: MCCRACKEN, LINDA: CPE, Montgomery, AL, MCDANIEL, ROBERT L.: IE, Alexander City, AL, MCELHANEY, CINDY: CS, Tanner, AL, MCELROY, KERRI: PIR, Miami, FL, MCFARLAN, DON: ME, Tucker, GA, MCGARITY, NANCY: CA, Birmingham, AL: MCKENZIE, DON: WL, Decatur, AL, MCKOWN, MELINDA: PB, Huntsville, AL, MCLELLAN, BRUCE K.: AE, Fairburn, GA MCELWAIN, YVONNE: IFE, Mobile, AL, MCMANUS, CHARLES: AN, Woodland, AL, MCMILLAN, KELLY: AC, Huntsville, AL: MCPETERS, GLORIA: MK, Gadsden, AL, MCWATERS, CAS: PM, Vestavia, AL, MCWHORTER, SONDRA: PM, Harpersville. AL, MCWILLIAMS, APRIL: EEC, Birmingham, AL: MEADOWS, PAUL: BSC, Langdale, AL, MEEKS, TERRI: PV, Bessemer, AL: MEILE, JOHN: AE, Montgomery, AL MERCER, ALBERT R.: ME, Montgomery, AL, METS, MICHAEL: EE, Niceville, FL, METZGER, PHILIP: EE, Titusville, FL, MILLER, ALAN: GSY, Arab, AL, MILLER, CHILPEY: VDE, Talladega, AL, MILLER, SUZANNE: VOA, Huntsville, AL, MILNER, TINA: SC, Riverview, AL: MIMS, MARTHA: MDT, Birmingham, ALL MIMS, TRACY: EEC, Louisville, AL: MINOR, DERRICK M.: AEC. Clanton, AL MISSILDINE, SCOTT: CHE, Springville, AL, MITCHELL, KATHY: FLT, Auburn, AL, MITCHELL, MELINDA: FCD, Guntersville, AL, MIZE, BELINDA S.: CS, Cullman, AL, MONDAY, GREG: ME, Dothan, AL, MOODY, KATHY: MK, Montgomery, AL, MOON, SUZANNE: CPE, Mars, PA, MOORE, GREGORY J.: EE, New Orleans, LA, MOORE, JANET: HSA, Bessemer, AL, MOORE, MICHAEL B.: ME, New Hope, AL MOORE, RANDY: AE, Montgomery, AL, MOORE, RENEE: NUR, Winfield, AL: MOORE, ROGER A.: ADS, Winlield, AL: MOORE, STEVEN D.: CPE, Florence, AL: MORA, OTTILIA M.R.: NUR, Auburn, AL, MORGAN, DEBBIE: AC, Woodland, AL, MOSES, RAYMOND: GC, Fort Walton Beach, FL: MOYER, TISH: IND. Auburn, AL, MUNDAY, DAWN: RSE, Monroeville, AL: MURPHY, ANN: AG, Abbeville, AL MURRAH, SARAH: Fl, Ozark, AL: MUSCOLINO, DONNA: RSS, Atlanta, GA, MUSICK, MONICA: AES, Albertville, AL, MUSSLEMAN, MATTHEW: PL, Florence, AL, NAGY, STEVE: AC, Enterprise, AL, NALL, KIM: VAT, Alabaster, AL: NASH, BUDDY: AC, Decatur, GA, NELSON, LARISSA: RSS, Gadsden. AL, NESMITH, JODI: FLT, Birmingham, AL, NICHOLS, BEN: IE, Selma, AL NOBLE, REX: ME, Plantation, FL, NOLES, JANET: GB, Dadeville, AL: NORRE, MICHAEL: CPE, Alexander City, AL, NORRIS, LAURIE: GC, Decatur, AL: NORTON, KATHY: GB, Florence, AL: OBERING, SUZANNE: PL, Birmingham, AL: OGLE, LISA: PY. Muscle Shoals, AL, OLIVER, JOHN: CE, Smyrna, GAS OSBORNE, MITCH: PM, Mobile, AL, OUSLEY, LEE: ID, Birmingham, AL OWENS, CLIFF: GB, Childersburg, AL, OWENS, GINGER: VOA. Monroeville, AL, PAINTER, GORDON: CE, Auburn, AL: FARMER CAROLYN D.: GB, Kissimmee, FL, PARNELL, BRIAN: CE, Jacksonville, AL, PARRETT, DENISE: EEC, Sylacauga, AL, PARRETT, JANICE: FCD, Greenville, AL, FATE, JEFF: MK, Jasper, AL, PATTERSON, KELLEY: MDT, Childersburg, AL, Q, ,, A-I , runs, LUANNE: Asc, Fairfield, NJ , Juniors PEARSON, SHERI: GC, Signal Mt,, TN: PELLEGRINI, NATALIE: PRS, Auburn, AL: PEMBERTON, KIM: IE, Huntsville, AL: PERKINS, LAURA: CS, Chlloersburg, AL: PERRY, DAVID: PB, Opelika, AL: PERRY, PAMELA J.: AC, Roanoke, AL: PERRY, ROBERT J. JR.: PY, Selma, AL: PERRY, SHERRY: FM, Tuscaloosa, AL: PERRY, SUSAN: AEC, Wedowee, AL: PERRY, TINA: PL, Jasper, AL PESTO, WILLIAM: EE, Alpharetta, GA, PFEIL, SUSAN: SRG. Hanceville, AL: PHILLIPS, JERRY: HPR, Ashland, AL: PHILLIPS, TED: ME, Brentwood, TN: PHILLPOTT, DOUG: CHE, New Orleans, LA: PICKARTZ, JANICE: PIR, College Park, GA: PINSON, JANET: AC, Newnan, GA: PITTMAN, TIM: IE, Opelika, AL: PITTS, JOI-IANNA: MS, Greenville, AL: POLLARD, TONY: EE, Huntsville, AL: POPE, DAVID: GBI, Dothan, AL: POSTLEWAITE, JAY: CHE, Jackson, AL: PRESCOTT, CHRIS: ME, Macon, GA: PRICE, KERRI: AC, Auburn, AL: PRICE, WENDY: Fl, Birmingham, AL: PRICHARD, BETTINA: PRJ, Warner Robins, GA: PRIDGEN, KEITH: PB, Opelika, AL: PRINCE, LEWIS D.: HY, Cbildersburg, AL: PRINCE, SUZANNE: CEE, Butler, AL: PRUITT, ANDY: INM, Pittsburgh, PA PRUSAK, DAN: MK, West Redding, CTL PUZON, LISA: VAT, Birmingham, AL: PYE, CLIFF: PPY, Smyrna, GA: OUIMBY, JENNIFER: CPE, Flomaton, AL: RAABS, JEFF: INM, Montgomery, AL: RAMIREZ, R.P. JR.: CH, Opelika, AL: RAMMEL, RICH: PB, Roswell, GA: RAY, ANNA: PY, Oneonta, AL: RAY, MELEAH: LT, Munford, AL: RAYBORN, KARL: PY, Brantley, AL READ, RAY: ME, Wellington, AL: REESE, PATRICIA: CHE, Auburn, AL, REID, LOWELL: MH, Gainsville, FL: RENKL, MARGARET: EH, Homewood, AL: RHODES, ROY: IE, Enterprise, AL: RICE, DAN M.: PB, Phenix City, AL: RICHARDSON, MERIT: EEC, Auburn, AL: RICKLES, DEBORAH: PRS, Huntsville, AL: RIEGLE, MARY: NUR, Auburn, AL: ROBBINS, JANET M.: PCD, Auburn, AL ROBERTS, JANET: CS, Albertville, AL: ROBINSON, RANDY: CS, Birmingham, AL: RODRIOUEZ, CLAUDIA: FLF, Johnson City, TN: ROE, HOLLY: AM, Calhoun ,GA: ROGERS, DYLAN: ME, Cullman, AL: Rogers, Katha: FLT, Dalton, GA: ROLAND, TARA: PG, Dothan, AL: ROSE, ANNE: EEC, Dallas, TX: ROSS, LISA: FLT, Marietta, GA: RUPPENTHAL, MICHAEL: GBI, Flosewell, GA RUSSELL, MICHELLE: PM, Centerville, OH: RUTLAND, HARDIN: MK, Guntersville, AL: RYBERG, BETTY: CHE, N. Palm, Beach, FL: SADLER, CHARLES: HRA, Montgomery, AL: SALTER, DAVID ME, Vestavia Hills, AL: SAMS, MARIAN: AC, Atlanta, GA: SANDERSON, CYNTHIA H.: IE, Auburn, AL: SANSAM, BETH: FM, FI. Walton Beach, FL: SARTAIN, JANE: ADS, Birmingham, AL: SASAKADO, TOSHIJUKI: MH, Wedowee, AL SAUNDERS, CLAY: PB, Chipley, FL: SAWYER, CHRIS: PL, Jasper, AL: SCARBROUGH, BETH: PFIJ, Atlanta, GA: SCHAD, TAVIE: GHY, Plantation, FL, SCHEIDEGGER, KARL: FAA, Mt Horeb, WI: SCOTT, ELLEN: PY, Greenville, AL: SEGO, JAMES: ME, Florence, AL: SEGREST, MARY: SCR, Huntsville, AL: SEGREST, TONY D.: PIR, Tuskegee, AL: SELF, SCOTT G.: EH, Trinity, AL SELLERS, PHIL: Fl, Homewood, AL: SENKELL, JEFFREY N.: Fl, Jonesboro, GA: SEROYER, NOVELETTE: RSE, Opelika, AL: SHARITT, DON: PIR, Mobile, ALQ SHAW, DEBBIE: CED, Savannah, TN: SHAW, PAUL JR.: PL, Birmingham, AL: SHERRY, NOREEN: VAT, Marietta, GA: SHIH, CONNIE: CH, Huntsville, AL: SHUMAN, MARY F.: VAT, Orlando, FL: SIBLEY, ALLEN R.: AC. Hartselle, AL SIDDLE, GLENN: ME, Birmingham, AL: SIMMONS, ALLEN: GC, Birmingham, AL: SIMMONS, SARAH E.: NF, Malvern, AL: SIMS, BERNETHA: PB, Salem, AL: SIMS, TYLER: SY, Belleville, IL: SIMS, WAYNE: MK, Chielland, FL: SIROIS, LUCINDA: FCD, Auburn, AL: SISSON, KEN: BSC, Rome, GA: SKIPPER, JAN: CEE, Bainbridge, GA: SLATER, SISSIE: Fl, Mobile, AL: SMITH, ANDREW M.: AC, Ozark, AL: SMITH, ANGIE: ZY, Boaz, AL: SMITH, CYNTHIA: LA, Huntsville, AL, SMITH, DANA LYNN: BSC, Blakely, GA: SMITH, LAURA S.: PY, Tilton, GA: CEE, Lithonia, GA: SMITH, DILLON: DUANE: ME, Valparasio, FL, SMITH, SMITH, LOWELL: GL, Kingston, MA: SMITH, MICHAEL: PB, Oxford, AL: SMITH, REGINA: CS, Russellville, AL SNOOK, MATTHEW: MH, Brandon, FL: SODERGREN, MARK: PO, Auburn, AL: SOUTHERLAND, SUSAN: CPE, Birmingham, AL1 SOUTHWELL, LILLIAN: CDP, Smiths, AL: SOYARS, GREG: INM, Auburn, AL: SPAULDING, DALE R.: PB, Auburn, AL: SPEAKMAN, MICHAEL: PUB, Auburn, AL: SPENCE, MARIE: CEE, Eufaula, AL: SPENCE, RUSS: MK, Powder Springs, GA: STARKS, CYNTHIA: AC, Brundidge Juniors 3 ,VV f VSV .,f .4 lv ,, A, H. ,i Q, , ' V -. VV , :iv V V A ,,g, Vi, 5 VVQVV7 V -V , xi V ' ' VVVVVQV az V V: 1- V VV : gy , , V, V ' ' - , , ,, i' V VV 9652, 1, , I :V ,I A V , If- , f VV g K , L , K , 'A 4 ,V VI VV5: if, .Vg V V 2 Vff, -V A V, V ,V V g? , ! ,691 . fn , , , , ti, . ,1 . I V -- Vf,.V V5,V, V V VV: Vin' V Q'-. .gf - V V A VV , Vg , ye VV V Q, ,VVV,, I5 bl , NV A V . V, , A AV, , V, VV.,V V A , , H A V VLMV, VV rt, f 1, V ,V V ,, 435- V M, V ., , V, ,V VM: Pegg VVV V,VVVVVV., . , , g, , :VV 7? :Q--V1 g V . Vi V, M45 V , V5 : ' , . V V -V -V ' I i , iff . iff, ' ff' 35' 54 ,:' 9' , - Q ', 'Q If ' Q25 ,,,VVfVV -V VV . V- VV: ' ,, VV-:V V V mf Vfli V ,, V f , , - we . Vfgm :VV VV? ' V wa ,ian -,M y,.,, 4 -V . i Hi J W 1 ,rf , TV V- , VXVV ,gefe5gfs:iVs,ifiV L VV VV V'f V?: VT' .' L me V , , . . 1 Q, 3 A 1 , W V' , V ff V 'H' ii wif V ,VVVSJ , ' V , , , , ,,,, y , I V ie. wwf V' V ' V 'V 5 V :Vg Vf V , 1 , ' z V- '.,, , V V , .1 ,KV V ,V VKVVVVV , ,Q , ,Vi 0 V- - PAVNQQ, gf V, EV ,JV GL , , 'Vsaiilli2: iVi la V V 'll ' 'f f' . V :I , V :LV . , L . ' . V V V V ' V V' V ,f -I 'Q 'V TV 1- V , V 1-1 , , V , V, V V' V . V 4. VVVQVVV ,, VV Q , EV VV V ,I , , .' . WV V V , V V V L . -V V , , W V iff, V ,VV , V VV Vi V jfgfiizkil l , V V Q, , V ' I fe I V'?:,,, .F ' I ,EL ff' V . . , , 5 A ,V :M --J' .fp xx, , i V I V mf : ' Z' , Ve. i ' --f ., - , V if :Z -V ., V -QVVV ' li 5 . V i I ' V 'a is f f V. I Ig,g.,VV , ' i ft ' ' -V :+V ff as f ,, ' ' ,H ' V 1 FV , , ,. ft - - , V Vi , V , ' 5 -A, 1, - fu . ' , ,. X f V V V 1 M V ,n f , VV ' V .VI V V , 1 g Vt ,, , VV af N ,Q Vw. ' I ' V V.- fl :' 1 fgwV f ,, ' V K A ' V lf? V , V, ,VV I A Vff- , J , V V V. VV - -f -V iggggg- M ,, , .,V , :V ,,, 'xy V V .VVVef V I 1, V 5 :10 ' 1 -lf' V, .- .Vm V-V 533 , 'L, g V,f V A , ff: V ff fgmf-V if fi V :new :gg V , , J. V V' 6, VV ,V 4, V, V QV , '. ' V , , ' - . V, , VV V , 1V VQV f :-- V ,, . , -VJ, V V 'V ijggfffa. .QMVZTZV 2 W VV f 5 V I V-,.f, ,,V., 1 Vfi, V, , BW Q ,,,, ,,, V ,,.,, f , , V . V V , , V , V 1 'V ' : i ' , ' ,V VV V , , W, ,,,, A V,, gg, , - V K - .V V,,,V V -' , ,Vg . 2 , . 1 Q I V p 1 . . . . V Af V VV H V V ga . ,J t, I 545,15 Mi 1' ', , 4 s '- Q sr ' V' V Vg, ,J if se ffgmi 7 -' ESVI ZLEE h Q Y I aBn?f.52izzZi-fffflif in: fi '-:1V i - f ' -' V fi :W -W' 'WZ ,TA ' JVM , V' 'N ' V :V ' .', f ,- 7' EEL , , Q V, V V V -V 9 ,. , V f ,V I , 1-,. 65,9 ,LVVV ' x V V V Q ,,, 5, -V , ,2gE,,V ,V 4- ', V21 5V A V1 ,, I ,G .V My VQVV , fe , . , V-' ,if V, V- , --V ,V , on .5 ,, .A .. .. ,V - V 5 ,. '. ' SP F: 9 , ' '22, 1 , Vi , 39 'I 1 5, VL, , VATVWV V: W , ,VLVV . , , JV , A I - ,-,V ' V , , i, i .., V , ., . , 2 VV - , V . W V 1 - V V, ,, . 1 , V W ' V e' ' V iw Z' V . V, ' ,, , Ii , t V ,VVV VV VV V V, VV, , , VV V: V , VVVV !M.,V V.,. , 3, , V V V V V 'Sf Vi I V gf V 1 fig , L' 5,, , V- , r ,,,V, ,, .. , ,Q 4. Vg I , V : ff, V V V , - V V I Jo, VV ,, ,V V VVVXHG 1 V. V' , V I V V, 4 ,,V- ,V f ,f V , , I 5 I F :Q Wi. . V , gif, - 4 ,V V V 4. iw 'f' V it 7 '1 ,V V' , -, ' 'Q1'Il72f3fl:lE? .,,, f V , V V' :V .,V' Tf,7e,' V, , .. ,iii A ?, V ,V V- I VV V WV , ' , -,, -VV V, V V' ' V I -'ff V V, . VV V V V+, VV if, V V, , , V, V I ,M Vg, V VVV VV. K K V , -, , V ,-V, ,,,, I V ri . V. KMA , , H V V ,V., N ,v V V ' ':'- V V g Q, ' 'Sf' : fry: -VV- V V ,, V, . ., V 2: :VV ,VV::VV' ,xg V21 Q Wi ,. I ' V .V V 9 . V V. :. f 72. f ' ftgmr I wr 1 V V , , V ,: wi V AV: V,,V . .V V V, ,VVM-, V V ' VV VI, V .,,, iV i gi 3 , , V V .23 H V ' ' V! 'Q I , fm I V W , rf V,V.?ifV- : 'M A 1' ' 'fteilfgy V 1 , 1 1- f . A V ff :QV VV 5 ' Q I V ,if fy A 3,,. fFf..? i :, ,. - , W 'Iv . - ,. wr' I .1 ,' ' - ,Q I' F f 2' . , A z 4 ,, 1 ggi - I I f' ,Q , ' I ' , ' ' fi Q ' '. ' ff.,-,, 'if' .1 Phil, . I I 'im ' f,,,i :Hg I , -- I ,, ' ' ' we ' i A- - -' vi - L.: L , ' , -, E I ,Q V WIMWI. 4V-i I . L. I I , I W I 1' ig' , H 14 , 'L I,, .If I' ,, wf - ,-, Q' ',::Ijg,Ml , .1 ., Krfgrax , -.I , . ,,. , - . , 2 .I I- 4 If - , ., ,,, 4 , , ar. IX' Q gf ', I 'I sf: : I' ii I . l I .Ar if: Q ' if ' ,, S 'fij ,, . We ' i Ir? , Y- I '- ., I i? '7'1 fm' i I' ' - I I 'wif llf' J Ir: I I -:Z 'r ' ' 4 ' 'J' . , ,, fl - ,III W 2 VVVV :, ' f' ' ,, J , , , A . i ',,, . 1' r -' 1 f Q , ' ' i ' ii., I ' A I r :E ' 5' I ,ri - .1 ri' I' 1, ,iw ' , ', Ti? T, W' , .fs I , I :If my 1' UF I 2 :I It 1 - ,I . U- if ' , I ,fff - 'I fr .7 61, . , I ' 1, r f , ' I V 'X I, ' z -4-- If ' 4,,, f rf ,,. ' if'Ei+f,f ' A ii ' ,, 'Ifr . ,. ' : -e ifgwt, fi N, rf: T II: I, M I , , , , : A 'I A , I . ' ' ,. ' 4? ' I Q , we-I,af:' , I ,,- 'x- , ,, f Q ,fi f I . ' f ', , QQ., : ' 275' ' ' : ' 'q ' ',,, , if , ' , 3,I. H . I 1, '41, 1 fi 'f I -M: - 2 , -I I I 1 I .. ,3- ur , M- ,If ,,--5 A ..,, II, ' I .-fi' .. .fu ,' ' ' wr ' -, 'Ia ,, ,,,, , 55. I II, -I T , I I , K! lg-.,, V ,. , . I. 1, 1 If I '- I- ' f' ' ' M ' ' , , .,,, V , :I I , ' - I. .1- g, A f , 5 . UU- I if I I- f. ' WIII 'Q ig: f I U , ails.. v r , f I ,-, ,I I ' A I, , . ,' A: I. If , ' - i ' 1. 41 'fri :I ff: f 'fit' ' -f i': ,1. , 1, ., -1 Hx. , ' 'I .I JI r IQ . Q , I ' ' 'I A ' ' iw ' Y .- 'V' if ' A , A ,rfififi iI 5 I I-ffxlii' 'S3' T ' f' IWTLL W,a:,?fi!i ,rf 'ffzv-i . 3, ., I - ' fi I , ' I - 4 :uni ' N i L ,,,. , . - I fI ww af. , 742, W ' 1' 'T' wt. A I: r- 42, ' QI ' 1, I ,, y ,I V I ez rm., J 'ww' , I A. V 71, AQ , 'M f 'Ia , NI Q :Q ,,,, , :I V 40 V I X -4, 21 I je 5, r ' 1 QQ, I ' ,Mg 1 'Im II , tr A , ,f , ' , , I 2 . ' 1 I. I ' ,Irs I- .I:'w.r.f -v.vv ' f we ' 'I ' H WNW. -V 5 V w,,,,74 ,V I ,.,,, ,,,,,,,,, H M. I, ,I I fr A . I I ., ,g 2 ' I ,, ' ' r Z . , I - .ff - 'I I -w-- , , f ,, ' 43 :I I I- ' ' ' v Q ,I I4 iff lf , .mv , I: 1 I fr H ?f':ff. 4 ,,, ,. , 'wwf W 2 f Il I: - i . ' ' I ' I ' - ,. .:. 2,2 ' iff ' 'ef F' ' V' I, ', .231 ' :swf - ,, ., . ff b' Q',, .1-4-A ' 5 I: ' , 1 -- .I .V.. I, .. A, , . 'N N , K' J ii 'I I V A 1 AQNI I, 'A ' 5 , ' 3 ' VW W, I f 'f': ' I f . , .I - 21. ae: I, . .yr f ' - iz- , I, 2 H ,H ,hers .mx II' f: II.II :sf 'eh - -'A' V N I M 'ti ag fwuyyv I ,, Q A f , 'M' - ' I Af t . . ', , 1, , I 25. F - Av Q 'f ' I I-1-1 ,, ' f' ' ' 'II, , I 'I , ' A : 25 if 'f ' :1 V , f 5, Y , gy: : ,,. if ' 14 ' . ,,, , II, Y ,, , 'ii ' 'ffi' ' .i 1 IF' :I s. ,- 1 AZ :ff ' ,Q 8, -'I:,,, If N ,if kg 2. ,- 15 , AI , rf'-g ,, , ,X : ' ,, Q I ' A' . ,, fe, 0 ,fry riff, ,Aff 'F ' r ui in Q 5. I I iii 'ii Z ' I..V 'L . i 55 H iq W .21g,,hi2 . . :If 67, A v f I Q ,RI V ,,,,,I ,, V, 5, V IZ N ui-awk - 3 f S, 1, f 4 , . 4 D A , ,X ' ' 4 ji' 1 ' 'ight ' ' . 1 r 1 ??:::,.-I , : ess. fl , ' 1' . .I .-- - ,iz I. I V . ' ,. ff I 'N ' ' : ' , . 1 , A ,, -Jain -fezfzff i I,I,,, I, J , . C STECKLER, CHARLES T. JR.: PHS, Auburn, AL: STEPHENS, GREGORY: AC, Auburn, AL: STEWART, CAROL: LT, Fairfax, AL: STEWART, JAMES H.: BSC, Fairfax, AL: STOKES, BRINK: CE, Dothan, AL: STOKES, PATTIE GAYLE: CS, Marianna, FL: STORY, DAN: LA, Sylvester, GA: STROUD, LAURA: IFE: Auburn, AL: SULLIVAN, CATHY: AR, Pensacola, FL: SULLIVAN, HOLLY: RSS, Birmingham, AL SULLIVAN, JOEL: FYE, Fayette, AL: SUMMEY, BYRON: IND. Roswell, GA: SUMRALL, DAVID: BSC, Mobile, AL: SWEARINGEN, KEITH: EE, Huntsville, AL: TAFFET, TERRY LYNNE: FM, Indian Harbor Beach, FL: TALLEY, PAIGE, FCD, Knoxville, TN: TAPELY, DAVID: AC, Eufaula, AL: TATUM, KEITH: AM, Brunswick, GA: TAYLOR, CAROL ANN: CHE, Albertville, AL: TAYLOR, JAMES C.: CHE, Mobile, AL TEEM, DIANA: PB, Summerdale, AL: TERRELL, TINA: AC, Cullman, AL: TERRY, DONNA: FYE, Fayetteville, AR: TERRY, MELANIE: GSW, Moulton, AL: THIES, BECKY: PRS, Birmingham AL: THIGPEN, DUKE: CE, Birmingham, AL: THORN, STEPHANIE: CPE, Muscle Shoals. AL: THORNTON, SHARI: NUR, Auburn, AL: THRASHER, DAVID: ME, Gadsden, AL: TOLBERT, DWAIN: WL, Daphne, AL TRAWICK, JANET: SMH, Headland, AL: TRUEX, SCOTT: PV, Orlando, FL: TRUSSELL, TRACY: CEE, Auburn, AL: TUCKER, CELESTE: CEE, Cullman, AL: TUCKER, TRICIA: FM, Gadsden, AL: TURNER, CLAYTON, JR.: AC, Alexander City, AL: TURNER JULIE: TC, Raleigh, NC: TURNER, MARK: EE, Gadsden, AL: TURNER, TROY: PRS, Dadeville, AL: TURRAN, GORDON J. III: BSC, Wetumpka, AL TURRENTINE, PATRICK: ME, Hartselle, AL: TYLER, STEVE: CH, Sylacauga, AL: VALLELY, TIM: CJO, Opelika, AL: VANCE, JERRY: TH, Prattville, AL: VANDERZYL, JIM: AE, Huntsville, AL: VARGAS, BETTY: PG, Tampa, FL: VARN, THERESA: CE, St, Petersburg, FL: VAUGHN, ALAN: AC, Marietta, GA: VAUGHN, SUSAN: PY. Pensacola, FL: VEAZEY, BUTCH: EE, Anniston, AL WADE, GLORIA: FY, Double Springs, AL: WAITE, BETH: MK: Jackson, AL: WALDHEIM, LESLIE: FCD, Winter Park, FL: WALKER, CINDY: CEE, Sweetwater, AL: WALLACE, SHARON G.: FLT, Eastaboga, AL: WALTERS, CARL: ME, Montgomery. AL: wmv, LAURA: IE, Huntsville, AL: wAnD, VALERIE: CHE. Brewton, AL: WARRINGTON, DOUGLAS: Fl, Fanwood, NJ: WASSERLEBEN, CAROL: FCD, Theodore, AL WASSON, NANCY: MDT, Jacksonville, FL: WATERS, ATROCOA: AC, Miami, FL: WATFORD, MIKE: EE, Eufaula, AL: WATSON, CRYSTAL: HRA, Ft. Gaines, GA: WATSON, JANE: OMN, Alexander City, AL: WEAVER, CHERYL: ELF, Mobile, AL: WEAVER, KAREN: CEE, Andalusia, AL: WEBB, CAROL A.: NS, Cullman, AL: WEISE, DAVID R.: FY, Mt. Pleasant, SC: WELLS, PAT: CHE, Muscle Shoals, AL WEST, BENNIE: HF, Birmingham, AL: WEST, STEVE: BSC, Huntsville, AL: WESTBROOKS, TERESA: PY, Auburn, AL: WHALEY, ALAN: EE, Birmingham, AL: WHALEY, THOMAS: EE. Alexandria, AL: WHATLEY, EDWARD: PBS, Ft. Payne, AL: WHEELER, VIC: VAT, Arab, AL: WHITE, DREW: BSC, Huntsville AL: WHITFIELD, GREGORY: CPE, Milton, FL: WILBOURN, JAMES N.: AM, Huntsville, AL WILEY, DIXIE K.: AC, Opelika, AL: WILHITE, PAUL: ME, Vinemont, AL: WILLIAMS, DAVID: HPE, Rockledge, FL: WILLIAMS, FERNIAND: EE, Mobile, AL: WILLIAMS, JEFFERY A.: EE, Brewton, AL: WILLIAMS, LISA: CPE, Boaz, AL: WILLIAMS, MARIA A.: AC, Phenix City, AL: WILLIAMSON, ALISA: RSB, Ashland, AL: WILLIAMSON, MICAH: PB,Gadsden, AL: WILLIAMSON, TOM: ADS, Birmingham, AL WILLS, SONNA: SMH, Ashland, AL: WILSON, MELANIE: VOA, Opelika, AL: WILSON, SUSAN J.: PRS, Jasper, AL: WILSON, WES: PB, Marietta, GA: WINKLE, JEFFREY D.: AR, Scottsboro. AL: WINTERS, BILL: PB, Opelika, AL: WINTERS, PAMELA: CS, Columbus, GA: WOOD, NAN: PB, Sylacauga, AL: WOOD, PAM: MK, Corral Gables, FL: WOOD, TOM: CHE, Butler, AL WRIGHT, JUNE: MK, Ashlord, AL: WRIGHT, LESLIE: NUR, Phenix City, AL: WURSTNER, KARL: EE, Ft. Walton Beach, FL: WYATT, KEN: AM, Trussville, AL: YAGER, MICHAEL: FLT, New Orleans, LA: YANCE, PERRY: AG, Dothan, AL: YANOCHIK, KAY: FLT, Marietta, GA: YOKLEY, MARK: CE, Edmonton, KY: ZARTMAN, ALISON: AC, Baton Rouge, LA: ZIGLAR, JAN: MU. Florala, AL ZOOK, LEE M.: MTL, Beaufort, SC: ZUCCHINI, SLIMY: VAT, Paris, France Juniors He ag BOB GAMBLE L ,Lf :X me - LQ. K 6: L at t Q :X Qt Q , . . Y L Q N t Q 5 2, A N A i A 1 A 4 I x if 5 Fixx: Q' I I N I M L x ' . Y X x If M 1 A .Q W ' g S 1 ' .X , ' : X - it , Hg I it ' Hg. , ,. - A , L, - vga I - I f I in If -- , .. ,- v .:.. - 11 P Y' . ., A H-. Q . k y Q I ' ' -LLM-. 'rf K sewn: V, . .. . .. ' , K .,.. . , L12 ' A EK: K2 2- EFX- ps- - : 'I :e:: of' we: . :'K - Y .L fi- li 11 ' K !j,'v.gnu S if . , gg. . an X ..., . E +-rf: 'er-Q-A L, . ' , 95 - I' ' P' I v I. - : ' I . in L- L K an . K ,E 5 r , K K 1 :Q Y qv ' ,' k . , Q U ' X , .. -LJf:..i- K i nf f ' ' -'ti' :fl-2: 'SE i ' N. '--P s . 321' 'F- .REGIN- A . ' ' , K .-1 - . ig H, gi wg fa . .. - -, , .,:' ' ,ggi gy, ' :EIC , - 5 A I tx' K5 A , - .. N- zu. f is 1 ' :,. ,r if -Ivy :S - -f - ' mv K 'fl' . x v? iiigi 4 2' -S2 L' A .s ' . L Iv7iQQ'?,I:Iu'II37'IE1it Q 4 t 1- H1522 , h Nz: ' 1 Q R- 1,-:,t,,5i:N 1 ' --si 'h is . . - 'J . . ..... - 'tizt , -. , K.. A--, .Q A. ,.,g -:L it . , Q A N S '1 11, K '. -- -. Ks LE' i -11: Q Q in qbh A bqbh Vi ,Nik hbq ,ii -1 Q , l,..,K1: 4 ,ati , s g A A .- L A , f . T f -. , A 1 TF , , . if -' 2 ' . .9 4. ,sv , L :- P' 'K 1 .615 . . 4 Q. , 2' O W , r If it it K 5 .55131 5- iftiffzi 2 I -: K 'W : 'i:7S?? rf 1: 'IW er tap K .11 :fm :ff:a-f-eel,-.ss . V I ,Q my .... K ' 3- .12 : 2' . 5, ,:,i'J,,v M 'l t -i t-1-2 1 'i if . I :liao .,: .. aa - 1 f- .,s,,1.:-A .serve N , -lizi Im X X X A Ng A QM . ?' is S , , ,..,. , It A Q .... L XX lee: . . L L KI B t. H f L ABBOTT, DOUG: PN, Stirling, NJ: ABEL, SUSAN: PH, Tallassee. AL: ACKER, LAURA: AC, Huntsville, AL: ADAMS, HOLLIS R.: PB, Arlington, GA: ADAMS, MITCHELL: PN, Sheffield, AL AGAR, KARL H.: ME, Mesilla Park, NM: AGEE, KENNON: EE, Pine Hill, AL: ALLEN, LORI: GJM, Atlanta, GA: ALLISON, AMY: CEE, Jacksonville, FL: ANDERSON, AME: PL, Camden, AL ARMES, DEBORAH: PV, Decatur, AL: ARMOUR, SALLY: VOA, Luverne, AL: ARMSTRONG, LEONA: PV, Pell City, AL: ARNETT, VICKY: PM, Hueytown, AL: ARNOLD, ROBIN: GC, Huntsville, AL ARRINGTON, LUANNE: VOA, Gadsden, AL: ASHLEY, JOHN: CHE, Mobile, AL: ATKINSON, GREG: FLT, Sylacauga, AL: AUSTIN, TODD: EE, Montevallo, AL: AVERY, CASSANDRA: IE, Birmingham, AL BAGGETT, KRISTY: PB, Fiome, GA: BAGGOTT, CHERYL: CEE, Dothan, AL: BAILEY, BLISS: GC, Sylacauga, AL: BALL, ROBERT P.: PN, Thomasville, AL: BANE, KAREN: PN, Nashville, TN BARNARD, CAROL: GC, Birmingham, AL: BARNARD, STACEY: PB, Atlanta, GA: BARNETT, BRADLEY SCOTT: PY, Atmore, AL: BARTON, ELIZABETH: PB, Sandersville, GA: BASCH, JULIE: CHE, Huntsville, AL BASS, SONYA: PN, Chicasaw, AL: BATES, JAMIE: MU, Sylacauga, AL: BAXTER, COY: AC, Chatom, AL: BEAIRSTO, BEAVER: CS, Hixson, TX: BEAN, CARLA: AC, Cnildersburg, AL BEAUREGARD, MARY: NS, Miami, FL: BECKHAM, VICKY: VAT, Clayton, AL: BELL, LYDIA: PB, Atlanta, GA: BENSON, LEAH: NUR, Greenville, AL: BERGSTROM, MARK: GC, Mobile, AL BERRY, BURNIE: ME, Atlanta, GA: BERRY, MICHAEL: BSC, Decatur, AL: BEST, SHEILA: PV, Montgomery, AL: BEST, VICTOR: PV, Montgomery, AL: BETTS, IRA: ME, Montgomery, AL BINGHAM, KEITH: AR, Oakridge, TN: BISHOP, ERNEST: EE, Sheffield, AL: BISHOP, LETA: GC, Valley, AL: BIXLER, BRENDA M.: PV, Russellville, AL: BLACKERBY, PHIL: GC, Chelsea, AL BLACKMAN, TERRI: GSC, Alexander City, AL: BLACKSTONE, BILL: EE, Huntsville, AL: BLAIR, REGINA: CPE, Five Points, AL: BLAYDES, KEITH: PB, Nashville, TN: BLYTHE, AMANDA: FM, Alexander City, AL BONDS, CONNIE: SEH, Shelield, AL: BOSVIELL, BART: AC. Greensboro, GA: BOYLES, SUSAN L.: PY, Satsuma, AL: BRACKETT, CAROL: CT, Gadsden, AL: BRADFORD, CAROL: PB, Dickinson, AL Sophomores ,.. BRADWELL, JOHN: Go, Montgomery, AL: BRADY, NANCY: f fi- . Q I NUR, Birmingnam, AL: BRAKEFIELD, LAWRENCE w.: AE, Paim , ' S 'Q' Q ,QQ krxx ,Q ,Q N Q file A A Beach Gardens, FL: BREwsTER, MARTHA: PB, Rome, GA: 'L X , QQ, - 'ii , , QQ S, Q ff f f in f f ' , Q Q aRINGAs, VALERIE: Go, Miami, FL: BRODNAX, PATRICIA: PB, 5 s : ' :Qi glib, ' opaiiira, AL: anooxs, JOHN: cPE, Bay Minette, AL: snowu, A Q A m, J Q , ' Q , 'aam - I I Q I LISA: Mk, Fayeneviiia, GA: RRUNER, DEBORAH: Ao, i i . ,, aaa.La 5, ,gxxk , M ' Montgomery, AL: sRYARs, sHEILA: IFE, Mdniia, AL i 'm, QJAAA ' : I ,,i , a A BUCKNER, CHARLES M.: AE, sadnabdrd, AL: BURKETT, ' - I ' , GINA: FLT, Mdniia, AL: RURLEY, CHRIS: PB, Mdnrgdmary, AL: if A ff X1 ,Q , Q ' Q . BURTON, LINDA: AM, oaiifdn, NJ: BUSSEY, ANGIE: cDP, Guin, I i ,' ' ' A9 'Q T' rlffsf ' y fa - i ' AL: BUZBEE, SLVVIA: Pv, Spanish Farr, AL: CALDWELL, ' A I r A: Q. ,.5,.aQ , ,Q :,a Q Q Q 5 ROBERT: AE, Mariana, GA: CALDWELL, WALLACE: AM, .KL f . Q '- i , A ' ' Q Q rr I I Riverdale, GA: CALL, KERRI: PB, Huntsville, AL: CAMERON, QQ? . :A i QQ QQ QQQ f E:-,Q 'Er HOLLY: ZY, Huntsville, AL i QQ Q, Quhz Q A Q A ..,,. ,,,, .,,, , cAPE, JASON: CHE, Mdniia, AL: CAHMICHAEL, DON: PB, , , 'mi' ', Birmingham, AL: CARTER, MIKE: PL, Selma, Al.: CASE, f , 'Zi N X 5233, r A , i , Q . P Q A Ll. FRANK: GL, Birmingham, AL: CENTER, GLENN: CPE. Cape :Li Q, QQ Q , . I at ' I A 252.5 Q' cdrrai, FL: CEROVSKY, RANDY: CJ, Mdbiia, AL: GRAMDLEE, 5 'TES i -5 Q , 3? ,,,. 3 ' ' ALICE: Ao, onidnia, AL: CHAMBLEY, GEORGE: PN, Fairfax, fi ' A if A ' ' , ' , : AL: CHAPMAN, COUNTESS: GC, Rdandka, AL: CHAPPELLE, S figs? A iffilifi ,i i LEW'Sf GCI Se'ma- AL i , it .iii?i2iEf :!?ffif cRA1'MAN, CATHERINE: cn, Laiayaria, AL: cRAuDRoN, 5 ',ii A A ' if A: ' MARK: PPY, Ediay, AL: CHILTON, DAVID: PN, Winter Park, : M , QW A r, Q ' Q, 2 Q ,LQ A EL: CHRISTY, LAURA: HA, Huntsville, AL: CHUMNEY, P.: PM, A , : Q iw A - 'Q Q gf 13 if ' 5 ,L A, LT Cottonwood, AL: cLAusEN, DDN: Go, Andaiuaia, AL: 'QQ ' ft ' , 'T , Q lx, 'Q gp Q , Q QQ, CLAYTON, ROBIN: Mu, Gadsden, AL: cLEMENTs, sANDRA: , . ' ,, .:-i 1, A J EE, Birmingham, AL: cLEMMoNs, CHARLES T.: PN, A :r Q ,Q Thomasville, AL: COHAN, BETSY: NUR, Oak Ridge, TN kt lhi ,,.: Q Q Q Q QQ .. QQ N E COLEMAN, ANN: Rss, Niceville, EL: COLLIER, CAROLE: csE, if , ,, , 'ldk ., , riiiiandma, TN: COLLINS, LARRY: cs, Gadsden, AL: COLTER, A 1 - QQ Q ,Q I L ,Q -Q . . DALE: AE, Stone Mountain, GA: CONN, WALT JR.: PB, f - : .Q 5 A' 15, f-r - :fr f , ,A , ,553 - E, r Nashville, TN: CONNER, 1'RAcY: Go, smnna, ALi coox, ,Mir 'iff A i ' , x: .J 'S ,,: A ,. . , , , JIMMY: EE, Aiabasiar, AL: COOKE, DAVID: EE, Slidell, LA: , MQQ ,Q Q , ' QQ , :IAI r 'I A f 1 if coPELAND, LISA: EH, Mdnrgdmary, AL: cosHAT1', cRAiG: f A , ' if .gglgf . iii' if fr a ? A - 1 :iiii , :AAI PB' HUm5V 'e' AL ' R : I f I I q :tit 1 I I 1 I S l 1 1 1 l The Foy Union Desk mangers provide information about students, faculty and the communit to those who dial 826-4244. They work at the information desk at Foy and the recreation room and serve as projectionists for the UPC. The managers at the desk have set an Auburn tradition for their inability to say, I don't have that information. Sophomores ,Q sf :xi ,Q ' ,, -' -, li .,.. , 'M' ' - 0 -. '- . -A . , - . 2 - 1 r :gli f - 5. 53 fl- , ' C J' .s Y E . ' M' E'-' ' , all-. f T , I ' . Si: Y S . ls: - A ': -f' r, . of . A ,, .. - , - , . .V . .. . - a . 4 frff: fr'-LRF 4- ' . ' f .-ffl, r 59 . H'-., - ., - L -. --f - .1 -. - is I it - . if-I '----'--- 1f,. -gg.. -1- af ,j 5 . -,r f f W: -ferr' Jfffafaffi, L v ,A ' -. I life 5:1921 i:rtiE.1.l L tr . i 11 Q' : -. . .. . L 5 , . I , .if -as 2- Yr, :gs 1 1, ,..W - A av H ,,., ,z ' ': if., 5, :M msg , . :Ms gs K . ' f typ 5 . 1 Q- , ,,f- 1 - ' - V- . 1 1 PSF- ' - J - , X..A Us ff' f , L - f I , , .Q . t r -L '- my A ' ying ::e:p.a:f.4s:.: ' : 'QPF' ,,..f5 1. r - :. z' ':' Xggzasfrgrr E sesjs.,--515. - . QW --, ---' Q h M' t, V 1:1-K 'ff 'f ' If 1 sr- '-- A X - 11 - .J , C Q . f-if' - - - ' ev ' 314: . f W, 1 ': X , , ', fr 2' Q fe 'ff l 1 i ' I I I I gf- . -I FTF ,L , L, r : A . I I R E .g K V rs- , ,. f, ,. F 5 1' .' T- ,, ., x . -- ,Q - -5 . li, ,Q 5.1: in Lf 'J iv 7'5fi:T:..rT.ffSg:' f ' ' f I V . ' I -1 ,W ' , ' , . 'Xia .L ' ' :S -Us - . Q - - S in : ' 'ii' . 1' 5. - - . :. ' . . . 'E' ' 1 . -1 .fs A r 5 Q ' S -5 K K g L , .Q , 1 ' , - - jig, ', Q, ,,..y,': . , K1 . ,I , , . , -,geo . ag L... . L . V , ' -35:0-.3,5::,.g-,-3.35: A - . 1' .: 'i Q- T ., - 5 ' .. :Q . 'F - - ... ,, ff- is . K - , T x - x 1 . . , ,. . ,of :MLA 'ffm sw , , V, . .. 3 gf . L' -,A 1 i ! !'l7 S rrviffii ,lf 3. A 'N :T i 1 - ' .K .,. , ff- ' ,Q X . . ef., ' i -- ' . A '..'i f 1. gf r l ,, 2, Q75 'g ,f -4- l- 1 M x .,,.v.:l - -5 sg -. r , - ' f 6 ' ' as - ' AAAA' s' ' . f- . 15 -' 1 'f ' --'v' T ' . . ,, -:gif elle fi - , - ' . 1 ' T , .. ' in i Q? 4- ' -fi-1 tal . Q12 ?,?63'l': 3?-'fi in v ' H 3 .S , A Y K F LW, . 5 Q , is: x g ' t F- -, - .,,: - 6 - l - ,-. , ,. A 'I I - .950 it-rl! 'f ' fsiixilss. . ' -if-..i . , . il. 1? 4 4, - I' J: . , - r A -f ' ' 1 if ' . i - . il . ' Q is g W W ' ' fy, -Vg.. .' . 3.-,' ,zirigf is Wk X lf? 'I I I .. it I ,-- ' . I - ' L J 'ly v 'L H .. . H ,T A ,M p k 1 xc :A 1 f , .... ...g fx- g. ' 9 : , M 'W . ,. . , ff . I , - ,, ' T QjSlll19l3f5itiIIli , 'im , - 1, .J f ,Q -:as frm I . -s., rw r.. - v f. , , 1331, -- 3 , -1: ' ., ,gy F e- - :W : ' Ta P 'sf' is V :si - . ' '- g- , - , z H -, fe .. U-, 'I 2-1 I . ' 1 .. M' , T , ' f like-, , ' ' A .,,i si 'L 5- V N 1 -A A . . 3: , C .. , g . +4 I - l -- ' l I I ' ' -L f ' - l - Q ' ff, i I , . -' 1 i-f ' ' , - V .--' , E, ,:, . , .s I , , :- X , , , A - , ,, Q ' - f -- ': N ' A ...al l I f i 2 -, :ffl . . I i t .1- ' , self f ,, ' A sa - -l f .. ' -' - Q- I L. i 'f fi .-- 1' , Y 2 . . - 1 f -A A ' . is-: , ,ff f L ' .19 l' Q... ' ' 1 ' l rf- : s' ,t Q ' 1- I Q ,A -- Q, . X 1' 'Y - .. -- SL ' i' , . I Va' - ' ' i - . Ei O 'f L- A F? t is ' i 'Q -P: ,- 3 , , ,aww . - , 'i 351, - - li? , , ' -, 18. 2 2-'.-9'-',,,:i,gQ, 3 1 1 , ,, 45+-:jp-rg - -fl -' 'G A . - L,-f gp . , ,... F Q Q ' - g 1, 5: ,. . s. , K. -. . 2. ' P if T R T if A + s .r H A if '! ?s. ,:2ig ' g f K K , if Y 5.1 ., W' ' SY- I 51, - gi K ,Vi ,xg ., K it A x -,L , - g, ,L . , E., , 3 -' -- I ' K - ' ' -'X xt . . ' ., s If Z ' ll ' 2 sw: of 'lil if 1 : - 1 -Iii? 5 I -T 5 l COUCH, JANET: MK, Lanett, AL: COWLING, JAMES: EE, Mobile, AL: COX, CONNIE: PRS, San Ramon, CA: COX, LINDA: RSS, Huntsville, AL: COX, LYDIA: NS, Foley, AL: CRAIG, VRENT: EC, Town Creek, AL: CRAIG, THERESA: PRJ, Montgomery, AL: CREAR, GLENN: AR, Birmingham, AL: CREUSER, JOLIE: RSE, Atlanta, GA: CRITTNEDEN, RUTH: PB, Decatur, AL CROOK, DAVID: ZY, Tallassee, AL: CROUCH, SHERI: CEC, Seale, AL: CULLER, ROBIN: PB, Tequesta, FL: CULLER, TRENT: PB, Tequests, FL: CURINGTON, DONNIE: CHE, Springfield, VA: CUSHMAN, KIMBERLY: CEC, West Field, NJ: DAILY, CHANTEL: NS, Birmingham, AL: DAVIDSON, DANNY: TH, E. Tallassee, AL: DAVIS, ALISON: VIA, Rome, GA: DAVIS, DUSTY: RC, Auburn, AL DAVIS, JENNIFER: NS, Huntsville: DAVIS, TATE: PPY, Thomasville, AL: DEATON, TENISE: AE, Owens X-Roads, AL: DE FREESE, DONEL: BSC, Thomasville, AL: DENDY, MICHAEL: GL, Huntsville, AL: DE PADRO, ANNE MICHELLE: GC, Fort Lauderdale, FL: DERBY, VIRGINIA H.: PB York, AL: DIVITTORIO, TOM: EE, Nashville, TN: DONALDSON, TIM: PUB, Enterprise, AL: BOROUGH, TRACEY: GC, Pell City, AL DORROUGH, SCOTT: AR, Montgomery, AL: DOTY, SHELLY: PL, Ormond Beach, FL: DOUGLAS, DONALD P.: PB, North Olmstead, OH: DRAKE, KYLE: MC, Opelika, AL: DUBBLE, DEBBIE: CHE, Pensacola, FL: DUNCAN, PENNY: VAT, Chelsea, AL: DUNN, JEFF: FY, Daphne, AL: DUNSON, JEFF: FYE, Cantoment, FL: DYKES, TAMMY: CEC, Phenix City, AL: EASTERWOOD, LISA: FFIM, Blue Mountain, GA EASTIS, DEBBIE: IE, Merritt Island, FL: EATON, DESIREE: FLT, Birmingham, AL: EIDSON, DENNIS: PB, Birmingham, AL: ELIAS, LEAH: ME, Oak Ridge, TN: EMMERSON RAY: AE, Birmingham, AL: ERBER, DONNA: JPE, Birmingham, AL: ERWIN, BETTE: HSM, Leeds, AL: EVANS, CHRIS: OP, Ft. Walton Beach, FL: EVANS, DAVID: PL, Maplesville, AL: EVANS, JOE BOB: PM, Pell City, Ai. EVANS, MARY: ID, Albertville, AL: FASANO, ANNE: MK, Orange Park, FL: FEAGIN, MARK: AC, Birmingham, AL: FETTER, TIM: PL, Stone Mt., GA: FINNEY, DAWN: RSS, Oneonta, AL: FITZGERALD, MIKE: AFI, Elon College, NC: FITZPATRICK, LINDA: AFI, Fitzpatrick, AL: FLERI, MICHAEL: AE, Miami, FL: FLOURNOY, JOY: NS, Birmingham, AL: FLOYD, JOHN: EE, Opelika, AL FORD, GREG: EE, Gadsden, AL: FORD, LISA MARIE: IFE, Titusville, FL: FORSTER, RICH: AM, Chadds, Ford, PA: FOX, THAN: EE, Marietta, GA: FRANCK, MICHAEL: AR, Florence, AL: FRANKLIN, KIM: NUR, Birmingham, AL: FRANKLIN, MIKE: EE, Prattville, AL: FREDRICK, GIBBY: AM, Atlanta, GA: FRIZZELL, MIKE: CS, Fairhope, AL: FUNDERBURG, ERSKINE: GC, Pell City, AL FUNDERBURK, TARA: GC, Marianna, FL: GAINES, JENNIFER: FLT, Pensacola, FL: GAMBLE, J.W. BERKLEY: PY, Sheffield, AL: GAMBLE, LEE: GC, West Point, GA: GANN, JANN: PY, Geraldine, AL: GARDNER, BARRY: Tl-l, Jackson Gap, AL: GARDNER, MARY: PO, Auburn, AL: GARNER, MARTHA: PPY, Florence, AL: GARRETT, DOUGLAS: ME, Childersburg, AL: GARRETT, JOHN: CPE, Enterprise, AL GENTLE, MARGIE: PBS, Auburn, AL: GENTRY, SANDRA: PY Hickory, NC: GEORGE, JANICE: CPE, Gadsden, AL: GIBBS, ALLEN: CHE, Marianna, FL: GILBERT, NATHAN: BSC, Vestavia Hills, AL: GLIDE, JANICE: NUR, Plantation, FL: GILDE, JUDITH: CS, Plantation, FL: GILLILAND, JIMMY: GC, Anniston, AL: GILMORE, DANNY: ME, Birmingham, AL: GITTINGS, ALLISON: AC, Dadeville, AL GLENN, DONNELL: PRS, Rocklord, AL: GODWIN, LEWIS: AR, Smyrna, GA: GOLFOS, DEMETRIUS: EE, Spanish Fort, AL: GONCE, NEILL: AT, Stevenson, AL: GOOLSBY, MARIAN: SMH. Auburn, AL: GORDON, TERRY C.: AE, Guntersville, AL: GORE, DEBBIE: CEE, Lafayette, AL: GOSS, DONALD CRAIG: GC, Tallassee, AL: GOTTESMAN, ROBERT: PL, Auburn, AL: GRECO, LYNNE: PB, Huntsville, AL GREEN, DEIRDRE: PM, Smiths, AL: GRIFFIN, WARREN: EE, Auburn, AL: GRIFFIS, KERRY: Fl, Huntsville, AL: GRISWOLD, TIMOTHY: BSC, Dothan, AL: GROVE, VERONICA: PN, Lakeland. FL: GRUETTER, KIM: PT, Powder Springs, GA: GUILL, RICHARD: AM, Conyers, GA: GULLATT, GREGORY: MU. Huntsville, AL: GUTHRIE, KATRINA: EE, Union Springs, AL: GUY, LINDA: GBI, Oswego, NY NADDOCK, WADE: CS, Florence, AL: HALE, BRETT: EE, Birmingham, Al.: HALL, JAMES R.: AE, Fort Carson, CO: HAMMOND, JOHN: EE, Brewton, AL: HAND, DEBBIE: EH. Birmingham, AL: HANSEN, DAVID: ME, Vestavia Hills, AL: HANSFORD, TERRY: PRS, East Point, GA: HANSON, JOHN S.: PB, Miami, FL: HARBIN, WINSTON: AC, Mobile, AL: HARDER, MITCHELL: CHE, Mobile, AL Sophomores HARDWICK, ELIZABETH: PRS, Abbeville, AL, HARDY, SANDRA: PN, Auburn, AL, HARE, SUSAN: ERG, Montgomery, AL, HARRIS, DAVID: PB, Winter Haven, FL: HARRIS, DAVID: AC, Birmingham, AL, HARRIS, JEFFREY: ADS, Auburn, AL, HARRISON, ELLYN: GC, Marianna, FL, HARRISON, JOHN: BSC, Talladega. AL, HART, JERRY: EE, Peru, IL, HART, WILLIAM F.: PB, Naples, FL HARTZOG, DEAN: PB, Selma, AL, HARVEY, SHERRY: RSS, Sylacauga, AL, HATHCOCK, JAMES: AN, Auburn, AL, HAUSWIRTH, CHRISTINE: AC, Birmingham, AL, HAWKES, JOHN E.: MTL, Gloucester, MA, HAYES, TAMSIE: CJ, Auburn, AL, HAYMON, RODNEY: PB, Ft. Payne, AL, HEAD, ROBERT: ME, Skillman, NJ, HELMKE, MARILYN: PO, Auburn, AL, HENDRICKS, TIM: CE, Springville, AL HENDRIX, TRAVIS: CS, Fort Walton, FL, HENLEY, JOAN: GC, Smiths, AL, HERRON, CARLISLE: CE, Brentwood, TN, HICKS, STEPHEN L.: AC, Birmingham, AL: HILL, JOSEPH M. JR.: FY, Miilry, AL, HIRCHERT, DALE: CS, Titusvllle, FL, HODGES, CHIP: PN, St. Simons Island, GA, HOFF, DEBORAH: GC, Lineville, AL, HOLBROOK, SUSAN: CPE, Huntsville, AL, HOLCOMBE, MARGARET: CSE, Bay Minette, AL HOLDER, JENNY: PB, Loachapoka, AL, HOLLINGSWORTH, FREDA: VAT, Steele, AL, HOLLOWAY, CYNTHIA: RSS, Lalayette, AL, HOLLOWAY, MIKE: CE, Riverdale, GA, HOLLOWAY, TODD: CS, Elizabethton, TN, HOOPES, LAURA: FLT, Marietta, GA, HOWARD, JOHN: PB, Clinton, AL, HUDDLESTON, LEAH: CSE, Auburn, AL: HUGHES, DONNA: PB, Columbiana, AL, HUGHES, WILLIAM J.: CPE, Montgomery, AL HUIE, JOHN: PV, Oneonta, AL, HUNT, DARRYL: AC, Birmingham, AL, HURT, KIMBERLY: PRS, Atlanta, GA, HUTTON, THOMAS: GL, Wheat Ridge, CO, HYDE, RON: PN, Eclectic, AL, IMSAND, JOE: CPE, Auburn, AL, INGALLS, GEORGE: PB, Ft. Lauderdale, FL, INGRAM, KELLY: PB, Birmingham, AL, JAASMA, JENE: IFE, Dothan, AL JACKSON, HAL: AE, Birmingham, AL, JACOBS, ALLISON: PB, Birmingham, AL, JACOBSON, MICHELLE: PN, Montgomery, AL, JASINSKI, JIM: AM, Columbis, GA, JODIS, THERESA: CE, Auburn, AL, JOHNS, BECKY: HA, Huntsville, AL, JOHNSON, CATHY: EEC, Huntsville, AL, JOHNSON, GLENN: FP, Roanoke, AL, JOHNSON, JOHN A.: EE, Wetumpka, AL, JOHNSON, LINDA: VAT, Burmingham, AL JOHNSTON, LIBBY: PG, Opelika, AL: JOLLY, BRUCE: AE, Valparasio, FL, JONES, JASON: AR, Tilton, GA: JONES, JEFF: PO, Auburn, AL, JONES, JENNIFER: CS, Huntsville, AL, JONES, JOHANNA: CS, Miami, FL: JONES, KATHLEEN: CS, Wayne, PA: JONES, KEITH: PB, Daphne, AL, JONES, KEN: AC, Sylacauga, AL, JONES, STEPHEN H.: PB, Auburn, AL, JUSTICE, TIFFENY: ERG, Bon Air, AL KAHALLEY, LAURA: AC, Mobile, AL, KAUFMAN, JULIE: PB, Birmingham, AL, KELSH, KAREN: PB, Panama City Beach, FL, KENNAMER, JAN: PB, Morris, AL, KENNEDY, FELECIA: OMN, Huntsville, AL, KIMBER, BILL: CS, Vincent, AL, KIMBRO, JOHANNA: NUR, Ft. Lauderdale, FL, KING, SUSAN: CHE, Jackson, TN, KING, SUSAN: CHE, Jackson, TN, KITCHEN, JO ANN: EEC, Midfield, AL KIZZIRE, TAMI: PB, Birmingham, AL, KNIGHT, ANNETTE: NUR, Alexander City, AL, KOFSKEV, MIKE: GC, Huntsville, AL, KOOBY, ROGER: CS, Roswell, GA, KOSKI, KRISTIN: NUR, Birmingham, AL, KUZELL, THERESA: PB, Huntsville, AL: LADD, WENDY: PL, Huntsville, AL, LAIDLER, MARK: CPE, Auburn, AL, LANG, CHARLIE: PM, East Point, GA, LANGHOUT, JEFF: IE, Huntsville, AL LANGLEY, KEITH: CE, Roanoke, AL, LANGNER, DON: PV, Odenville, AL, LANGSTON, TERRI: PY, Jemison, AL, LARRIMORE, LEE: ME, Brewton, AL, LAURENDINE, ANNE: IND, Mobile, AL, LEAK, DELENE: NUR, Arab, AL, LEARY, BRETT: BSC, Montgomery, AL, LEDFORD, DOUGLAS G.: ME, Columbis, GA, LEICHNER, TERRIE: IE, Adel, GA, LESLEY, SCOTT: VAT, Birmingham, AL LESLIE, ROBERT TED: AM, Greenwood, SC, LETSON, MISCHELL: ME, Madison, AL, LINDL, BRUCE: ME, Panama City, FL, LITTLEFIELD, JAMES: IE, Montgomery, AL, LLOYD, BETTY-ANN: AC, Huntsville, AL, LOPEZ, JULY: FLT, Dothan, AL, LOUGHRAN, SARA: GC, Walnut Creek, CA, LOVE, RODNEY: AY, Alberta, AL, LOWRY, LINDA: CPE, Musella, GA: LUMMIS, BEVELYN:'PRS, Atlanta, GA LYTLE, DEBBIE: HPR, Huntsville, AL, MACHEN, JANICE: CH, Sylacauga, AL, MAGEE, LINDA: PT, Apo Miami, FL, MAHER, STEPHEN P.: AR, Anniston, AL, MAJORS, GREG: PB, Hamilton, AL, MARTIN, ALYCE: FLT, Peekskill, NY, MARTIN, TANYA C.: CS, College Park, GA, MARTIN, TIM: VAT, Piedmont, AL, MARVIL, AMY: PB, Montgomery, AL, MATEYKO, TRACY: GC, Huntsville, AL 244 Sophomores Tis, r f. . a ' Sgwgff .qwwwa -- ,v, ai :S S YffeS.:Q. S Nm1'. aew'm? - - , - , -A , - - - . it . - '- ' ii . ff 1 - i S . . : 1 2 , ' ,- fawg . . ' Sw t - , 1 ,pa 'LX I - .I E , I - -Q : , .. . . . I Q,-. X if:-it - : R ' .I I 4 :ws ...geme see Sfememfefawegeem.: SWS ' ' If W . ik ' i ' - IA ,' Q, ff - -1 , t, J' ' ' it . . 1. Ma - ' Ss Ji' u 5: , - . s .L 'dm S: -S I 'n ' V' v f 5 P- 11.- L J' S5 I .ffifi ff I .' . . ' -Q Q, , ,Y .,.., A .. Q. . , , . - ,, ' n 1 I' ' I ' 3: ' ' , . - 1' ' .Ig :S AZ, Q -Jie , , SE: , '1- i ii- 5 - .... wgk X . Q ,Y S . . , . ,V 4 A A. Ei. X. il ' ,. X ' A' X' .. Miers ' f i : ' 'W 1 .' -. Ni: 1. 1 . J, ,.,,. .. . , f it I , , , , I- xii '- 'fi -' n- , ' A . . .' f out ' .L A - ' I A. A 1 . -Sw 1 Z . ' v s ' AQ SWF ygsiw- lv :wig QS is S f . g .' QL, .L A , , 1 mug: E' f., S- gs: .. Q, g ,,. :za -:A M w -A A '1 w , 4:.11:1::.-gqgg x I W was Ea S i' -rf,' ' ,ez T: ii-' i' Y N ' . N 33 4.3, ek I f V: ' 1 YAQS zzw igr L ,Q - -ff . 4: . I., A :M .13 O M A I e 4 X., Sw :IW W' ftiii I wi, we :..: se.e:: se ' ' - - A i . .1 1 3151 A -4 N 1 -3? if i'-5 .iii 5 'Ei 'I f , J ,W-9 , Qf85 ,, 35 1 1 1. .I . 1 -. ' ' . : , f w, L Q. It 'TW ' ii, ,rs . A jg If. Auf: . ,-: ar, '- ' t .. ' -I A I - it A P 1 . fg5,, , f if I, P ' I! I :iv . . XS Ke s .L Gt S N X. , 1 55: W- 1:1 G V ' J A IEE T ' ' A 51- f-cl . I F . .. i ,f 5'Qg,f.'--::'?l'1, - - - 'f.,,,.,,:,,m:ie mg if A :R 2 ..,, A -. - ' ff :if 'ffiawt' ,, ..:.. fuss I i Vx.. . fx- XvA Qi'-4 r WSE R ti- wx A iw Q x i - ffgj Q Sees W :wut if 'IE aBea,Lsi, S, - ,.i ' f' i :S 'fi'ifig:f 1' A X N r 3 A Q 1 ' . I I--,-' ,. . Q ' 'rf ,,'f, ' ' 3: is . ' 7' ' - ' I z X , H in A . 1. , , , A A 'A it v x ' LQ? J , ' 5-, '5' :IL 'fe , ,THQ . ,. H i, i: 1, ,M H f' gg, .V . A -4. . it L L A 5 I ,S ig., N N11 'z ,' 1'-1. II . t iyziizf . i A ', T. ' .., - ffigggi l f, -' A , F' rre' I -- r g Y xiii, 5,3 Q I f it h X x X : 3 ,fx -. 22 Q 3 E 5 xv i 9 r XX 1 4 ' .isis -I. H , ' ' Qi: i?e+ef'qee,see4,Se:, Q - -.gg ': .sv wx. . s 5 ,i -1 -. 1: ? I ' , .. Q . 1 if . ESE i' I 1: X it ' I fs 2 .- : . A . f 1 'A . ' ' 5 I 'fn ,,,, g I Q ' i s 'S I if ' A 1 J A E X l S, f-me kt. 4 A - i I. Q z is A .. f Q S sf , fn' 1, -Q ? Q , au. gba ,gif 55, NN M . , ,ai,:s:, 2 i i lwgi l' .ne A ' ' 5 ' i?.Fi'Ff?f22IS'E:i X ,,3-.4 ,1 :S - V X gsm: fr ww X R 5 it 5. .en fi it ' . s gl 5 if Q? pg: : A N l :F . .I A ,Q L A ' i i L xx ag i . ff, ' ' ' 'X is Q ,I 5 , N :YE A - F W ks: wi xwuqgxvll wi A Q xx SAX I A' if x x X Qs 5 X gs V Q X ' J ng 4 I ze S ,,, I it A P 'I 2 3 , ' ,' A 5 Vw S it ,X gg ' .3 L K V Q , F ,,Ei L. le 4 I 1 -- sfsug , x 2 . . Q S f :E f it . -sm N ?.--A-Q Ilgff ,. QQQ, , Cf' - :gf 5533 -vs 7 ..- Y' , X ' , ....., s WN .. -' -V ,H ,. ,. - r I . x I- -I : .- A ' 'iqfffi I . . fi' 1 I' . fi I'-' Sl Q f' .-'IX 395 , A , - A . if-5 ' - I - If . A: , ' a QA ' . 2' 'Ili 1. Q if I I A ' E , ws: , X , rifij: -- ff ,I ' ' Qi l ,. I ' : X ff -QP . : II: S X' W: f . -. ' - .- I ' - I' sf, K 'Q t H3 qi- W N. 1 h Q . , , -, -, A 2, fy. I ,Q vi' I C . Y : .3 314- ' T1 ' - J i '.'. Q I .4 - .v- -I' H 'W'b Iv : F- LLLL ' : , ' Q. ,, . 1 R ffm.: I A . V: ., Q , , Q: ,, . Q Xie :Q 9 vi Y ' 1 was if .,1-X M N Q . . Q57 I I ' Q Mu' hz- 'VR X 4 I . 'H ' Zi: AY g i - t -I .' X X i. ,, . : II ,, I I . ss., ,-1. - - . . - , ' 1 :- .J , .. r A. ,R s Lf .. -. N I I I, ' f- , . I 5, I I 'I Q 1' 5 i wfzi n ii 5'Sgfs ,:' Efg f QSwws?SS:xWS vws,:a . ' 6 f 3 ' , ' - ' ' . - ' 1 - - J . , ' -- . -al -l ' i ' I 'g- -, 'Pg 1:2-I: it: - 2- IX I - ' , F , .- f . fi . A W 1' E .i : X ., ' 9 -- j:'I,-,,, : ' 'A ' V 'Ili ' , ' ' I ' ' 1 i's ,,.,- . , ' -- --11-1.-5 37 I K jf' f,.I,.5-,fl i -Q A x . I X '47 V .fy X l .'.m:!: .x ' - '3'!-iliftvx .iilmfi I' IU... f'J::::::: ' I Ag I 'I , I I: .-':.:r1'wf. 2 ' ' 'P . Pin t 5::Izzful!:::5- v fix: , - ,Y sfgiff K . .. .1 B, a I . . 5 ,z:.'a.6. sf' ' 'ii .2 1 WN w e :is IY' . .. lx! -SE -, lf ' frm . e' Q? 'tt 5 N 5 . . A vii? if 9 I 2 if N' li I I I i , If-.. . sg., 'I ET. It gifts? , , :ff gt , X? ,A N X4 Iii Q X ki 'X T! 1- , W, I ' il I: I '15 My tr 'g-gl: , W ' .. -: 13 - ,Qs K Q , X li :1 . . ' : . tg : ty I I ml , 5. . y , Q V11 is I 'eps-. . . si j 4, ' it . Q !Iv'K,, :J 2 ,- .Ii -I Q-... . - :: .. . X X six Ig N 1:-. - Wir? F g.-isgtieifig , -X - X .Q Sir' . .f l Q2 t..- QL1. -X N., I, Ogg . X XX X XX X X ,s -I - - t. N X I X RS f Xt 'X Ek 5 si N X ' . A fi I exft I l . . ls ,. :Mu - I Q. it A-I :gb ' . ,wth :til : ,S 3: vi ,, f N5-' I ff! X 'Y'- fl: 9 , Ei as if I' . 3 Q Q, Ss. ' 'H - NS.. f t I I :' L .s' , Xe- I- If :Q M .,,. SF' is Xa K N CX 1 F. . . J' Tri: .. -L -iv: ,N wg . W., : 231 T ., I '-if :fix 'Z X ,Q XXX, Ist sing mis: .f,,?fT'f'f . XTC ti 5 xt ,, . . Q P X s t N Isa s .S ,X -A - ,- .,,.g. 1, ' Z , f 9' f U 3 - s:Xf..??-. . XX u. ..X I :Xi S NX N X :aww MW .ZH Z f Qt., . I i fi- . N -.-1 ' . . . F fish? ' - Q- ' , ,,.. JM , ,IA f ,A , 2- Y.. i g, 'X I :1II,v5:x 'git , 5 , wife. : , V af 7 , , 2' . a i .. V r y :.,Ifi,, ff, ,I-gm: sf5:,::p,,, , , 3.7, Y' 1' - ' A It '- ' I . 3: -.2 Ibn ' ,, Ml V A YI .. : ,i If Q., 2 v --1 , , ' , 1' X A . r . , , , -I, ., 59, I A ii ' IW' ' If If H . ' ' , , ' ., I I,5-gif K 'I .I ff: I 4 If I , . , ,L - -' ' f W 1-L1 if , . A, ,,'Y 'Qii' ,A A , if, . f f 1 Y ' 7 IV . fy i ' : I ' f fi 'v I' ' TM 'fl QW , 2 -fffII, 1-we :ww I i- ' - f f V I I , I ,. A . ' - '. ' f I 'W . I '-'f f V I- 1 ' f' ' I- ii ' I ' , 'I f ' f , II M Q, ' .17 - . . V I ,,,!: i, ,reg f- I WI, Ay X Z. . K A .M ,',. l 5 L ,Q I 'UI ' .I 1. , ' , 1 f - I. If '. 3 ' ii - . ' :i 2: 1 I A f 'I af' ' A -If yi x x6 , ' I f , . ., ff ' L A i i. I : -f' '. ' 'WF if ' Q' ' - ' :I ,,., Q 5' ' 2: A 1 45A , fl If ,A .1 F I ,v-If, I IW' t I fm Wa ,, f M5 i , , WI, A 3' :edt 5' W 1 c I I ' Q. I s m Ska, sm fi 1 ir My ,, I ,y , ,. ,, 2, , I, 'W X xwgsl . i,::5?,g,, If if . f , ,, I1 , :f , fi , , ,M Qxf, ffrf-,.Ha , . 6 lp A n a Af? y 42: 1 ,K X . 6 ,L , tm MAY, MIKE: AC, Union Springs, AL: MCALISTER, JILL: PCS. Rocky River, OH: MCCAMY, MICHAEL: AR, Cullman, AL: MCCORMAC, SARA: CS, Ft. Walton, FL: MCCRORIE, DAVID: CHE, Pleasant Grove, AL: MCCULLERS, LARRY: GC, Columbiana, AL: MCDADE, JON: IND, Orlando, FL: MCDONALD, TURNER: BSC, Chattanooga, TN: MCEACHERN, DAVID: PB, Atlanta, GA: MCELROY, MELISSA: ERG, Florence, AL MCFARLAND, MICHAEL T.: PM, Stuart, FL: MCGOWAN, MARY: GC, Childersburg, AL: MCGRANAHAN, ROGER: FS, Decatur, AL: MCGREGOR, CARLA: EE, Madison, AL: MCINROY, JOHN: MRB, Plantation, FL: MCKENZIE, JOHN: GC Evergreen, AL: MCKENZIE, SUSAN: PM, Decatur, AL: MCLELLAND, LAUREN: VAT, Auburn, AL: MCLEOD, BETH: PV, Pensacola, FL: MCMULLAN, VICKY: PG, Atlanta, GA MCNAMEE, SHARON: EE, St. Cloud, FL: MCNEAL, GREG: PN, Aniston, AL: MCNIEL, MARY: RSE, Huntsville, AL: MCWHORTER, LISA: PM, Midfield, AL: MCWHORTER, MELANIE: PN, Huntsville, AL: MEAGHER, MELISSA: GC, Murfreesboro, TN: MEHAFFEY, DAVID: IND, Lanett, AL: MESSINA, JEFF: GC, Metairie, LA: MICHETTE, LOUIS: PB, Huntsville, AL: MILFORD, CALVIN: PB, Five Points, AL MILLANDER, CHRIS: EE, Gadsden, AL: MILLER, GERALD: ME Gresham, OR: MILLER, JENNIFER: NUR, Huntsville, AL: MILLS, AMY: PV, Muscle Shoals, AL: MIMS, CLAY: EE, Jumison, AL: MISSILDINE, JOYCE: EE, Springville, AL: MITCHELL, AMY E.: GC, Auburn, AL: MITCHELL, CAROL A.: BA, Birmingham, AL: MITCHELL, DANIEL: CPE, Arab, AL: MITCHELL, JOEY: CPE. Decatur, AL MITCHELL, MARY JANE: CS. Marietta, GA: MONDA, STEVEN: PB, Lilburn, GA: MONTGOMERY, DAVID W.: PB. Birmingham, AL: MONTGOMERY, JEANNIE: IFE, lndialantic, FL MOODY, SCOTT: EE, Huntsville, AL: MONEYHAM, BRENT: AR TROY, AL: MOORER, CANDACE: PM, Birmingham, AL: MOORER, SCOTT: AEC, Birmingham, AL: MORGAN, DEBBIE: ERG, Catherine, AL: MORGAN, MICHAEL G.: PO, Birmingham, AL MORING, KEITH: EE, Valparaiso, FL: MORRIS, JIM: EE, Florence, AL: MORRIS, MARY: TMT, Blountsville, AL: MORRIS, SUSAN: TE, Opelika, AL: MOTT, LARRY E.: PB, Valparaiso, FL: MOV, CHARLENE: CHE, Ft. Walton Beach, FL: MURCHISON, MELANIE: IFE, Bay Minette, AL: NANCE, SONYA: CPE, Huntsville, AL: NASSIRI, HABIBOLLAH S.: CE, Auburn, AL: NAVE, CATHV: AR, Sevierville, TN NEAL, JEAN: BA, Marietta, GA: NEFF, DAVID: ME, Altamonte Spring, FL: NELSON, KEVIN: PM, Birmingham, AL: NELSON, PATRICK: PV, Decatur, AL: NELSON, WES: PH, Chipley, FL: NEMEC, ERIN: IFE, Lilburn, GA: NEMEC, PENNY: PN, Lilburn, GA: NEVILL, JOE: AM, Humble, TX: NEWBERN, MIKE: GC, Roswell, GA: NEWBERN, VIVIAN: MRB, Red Bay, AL NEWBERRY, DARREN: Stapleton, AL: NEWMAN, ERIC: BSC. Miami, FL: NEWMAN, OMAR: GED, Cullman, AL: NEWTON, IESS: EFIG, Greeneville, AL: NILSON, HOLLY: MDT, Huntsville, AL: NOE, MICHAEL E.: ADS, Birmingham, AL: NORRIS, ROBYN: FM, Phenix City, AL: NORTON, MELODY: ERG, Lake Wales, FL: NOWAK, CYNTHIA: FLT, Atlanta, GA: O'BRIEN, CHRISSY: AR, Chetiield, AL O'CONNOR, DANI: AC, Helena, GA: ODEN, WARREN: CPE, North Port, AL: ODUM, VANESSA: VOA, Florence, AL: OGELSBY, RON: AY, Talladega, AL: OLSON, CRAIG: EE. Prattville, AL: O'NEAL, ROBERT: PN, Montgomery, AL: OROURKE, TERRENCE: ME, Riverridge, LA: OWEN, VALERIE: CHE, Cocoa Beach, FL: PANKEY, DELAINA: NF, Boaz, AL: PARDUE, ELAN: CS, Birmingham, AL PARKER, KERRY: TH, Leesburg, AL: PAYNE, RENE: GC. Marietta, GA: PEACOCK, JANET: PB, Hartlord, AL: PEACOCK, KENNETH T.: PN, Clermont, FL: PEACOCK, ROB: AEC, Mt. Meigs, AL: PEARCE, STEPHEN: EE, Hixson, TN: PEARSON, JUNE: PB, Tuscaloosa, AL: PEDDRICK, MICHAEL: GGL, Lillian, AL: PEGRAM, LILA: PN, Tullahoma, TN: PENNY, TIM S.: EE, Richmond, VA PERRY, LEE: Fl, Andalusia, AL: PETERS, CAROL: PPV, Huntsville, AL: PETERSON, MICHAEL: EE, Boaz, AL: PETTY, RENEE: FM, Alexander City, AL: PHILLIPS, DAN: IE, Atlanta, GA: PHILLIPS, DONNA J.: PB, Auburn, AL: PHILLIPS, RICHARD G. JR.: GC, Dadeville, AL: PHILLIPS, SABRA: VOA, Columbia, AL: PIMM, CARMEN: AC, Huntsville, AL: PITT, JIM: PB, Scottsboro, AL PITTS, EDDIE: PB, Birmingham, AL: POOLE, JOHN: AR, Fort PN, Albany, GA: POPE, SUSAN: LISA: PL, Laurel, FL: PRICE, JOHN: PB, Huntsville, AL: PRINCE, BARRY: GC, Birmingham, AL: PUGH, CHRISTOPHER: LA, Montgomery, AL: RAGAN, JAYE ANN: VBV, Birmingham, AL: RAMSBACHER, RON: HSM, Birmingham, AL Pierce, FL: POPE, CINDY L.: AC, Franklin, NC: POWELL, Sophomores RANSBOTHAM, CANDY: PT, Smiths, AL, REAGAN, MICHAEL D.: AM, Wetumpka, AL, RENKL, BILLY: VAT, Birmingham, AL, RICHARDSON, WENDELL G.: PB, Lanett, AL, RILEY, MARK: VAT, Skipperville, AL, RILEY, MAURICE: EE, Anniston, AL' RILEY, REBECCA: CEC, Cullman, AL, RITENOUR, LISA: ZY, Fails Church, VA, ROBERTS, WILLIAM: CH, Dothan, AL, ROBERTSON, APRIL: PPV, Northporl, AL ROBINSON, CYNTHIA J.: CEE, Phenix City, AL, ROBINSON, KEITH: PB, Melbourne, FL, ROEHL, KAREN: HPE, Niceville, FL, ROGERS, CINDI: GC, Eutaw, AL: ROGERS, ELLEN: PN, Biloxi, MS, ROGERS, SANDRA: CHE, Huntsville, AL, ROWLEY, KEVIN: PL, Macon, GA, RUSH, DRU: AY, Cragford, AL, RUSSELL, MARK T.: CHE, Florence, AL, SAILE, ALLISON: PB, Huntsville, AL SALLAS, NANCY: PN, Sylacauga, AL, SALTERS, THOMAS: GC, Auburn, AL, SAMPLES, RODNEY F.: AC, Brooksville, FL, SANDERS, PAM: lD, Birmingham, AL, SCHERL, STACEY: LT, Gull Breeze, FL, SCHICK, MARK: EE, LaGrange, GA, SCHNEIDER, WILLIAM: EE, Clearwater, FL, SCHOECK, RICHARD: VAT, Columbus, GA, SCHRADER, LYNN: PRS, Hollywood, FL, SCHRENKEL, ANGEL: PPY, Piedmont, AL SCHUCHAMN, SABRA: NUR, Birmingham, AL, SCHUL2, CINDY: AC, Birmingham, AL, SCOTT, ANTHONY: AE, Birmingham, AL, SCOTT, AUBREY: RSE, Crabapple, PA, SCRUGGS, BRYAN: AE, Flichmond, VA, SEAY, DAVID: CPE, Greenville, SC, SHARP, JULIE: PB, Eutaw, AL, SHELL, BECKY: NUR, Montgomery, AL, SHERER, MICHAEL HIGH: GC, Montevallo, AL, SHERRILL, J. SCOTT: CPE, Hickory, NC Auburn Knights The Auburn Knights Orchestra is a working dance band composed completely of students. The group plays for dances and other engagements throughout the Southeast. The band is not financially affiliated with the University, but has been on campus for more than 50 years. The leader of the group is David Evans, and the business manager is Charlie Kinzer. The group has played at numerous fraternity houses, i club parties and the pharmacy school d3l'lCE'. Row 1: Carter Norton, Laura Self, Jeff Graves, Billy Beusely, Kyle Caldwell, David Grider. Row 2: John Brewer, Steve Armour, David Mann, Jay Davis. Row 3: Jon Smith, Jeff Jones, David Peters, Louis Barnette, Todd , Shiver, Roy Duncan. : v . iltl fm if f Q 5? 1 4 i f lg? f va 9, Y - f f g, M 4 2 nf aj Q l I 7 1' i ,. M m , , 5 fy, , ,, ff SYS? iii -wig ft' i t 1 ,-le: 246 Sophomores V . S 'YF VV ' . . VV-A f s f ,' i ' V- .2 1- . 1 V . . , 9 ve ' ' i- . ' . r: V l ffff i . H A A A A Q A I ' :V IV.: . QV Gsm .YQ .Q ., 7 'Hx H: ' Y- 'SEQ .W fu-11 I V SE. . Ki it ' : f Wm. ITIS il - . i - . - V s Lf V ,125 .V 9:15 ,fe-s V . ' V . VV ': V-A o r - f ' :-' R V' . : - lj ' 5 'El 1 f '- :ii S , ' ' : :' ,V A I V I V , V - ' I 29:31. if Pt : A gf: Q f . ' Q : 12 13 IV- PM ' ' V C' KY: V3 'Hi ' CIS q . Q VV - 4, : VY '11 :Mg ' N J: K V ' V s 1: V V f :Vp V 2 f- V ,, fL-. - , ,, : V. . ' V V VV ,, ' N X, . K :Ji , -Qu .H . : . :VV V ,, . :. g i S, 5 Sai L s ,st , ,. f s C .. V ,, ..:.. - V ' V T,,. -E -M :ls :i , V . - ' , V ' . V . .- - A S' ' 1. . V.: r ...W Q .V :refs 3 : : :V 9' 5 A. :F h S. .5 . 1 is - ' 1 . .J ,. .- A S.. in f V' - -1 -'-- .- . , - .. V Q ., s , ,'.2.li' l'ilii5fS!.S1f1 - - ' 'f W : V V f X RM 'B S' w : x ,r, -V ' I at 3' ' Q Q, -'-kh f . V if ...fm W ' . . N x :ii 1 1' ' 'fs X.. v '. I TIL.. .V 'L TFT ' 3 -3, si ' 'g - ' A E ' ' V ' ' lt 3' 3 ' V ' X. f ' :M 'Z 5 4 5.5 - 3 ,V. - QV 'f Hifi. Y V V I I .. 'WI ,. . .., V 5 V- 4 ' , ' Q: V ' A' A I , . : f- , - ..VV, . . V L E ,F g V 2 I H, - :iii A 11 i ,, :V K ,s KW ' .. vb . Q by : f 1 ii VVA. 1 Rf V 'S .. :V S .V , V '- I ' , ' ,V-f V: 3. :. -sg ,.. .,,l.1, 2 wi., V 3 ,V g:,,f,, if 1' ' ' P X' :V V ,f . . 3:3 V V, Vx - V :s ' s C ' - -- Y ' SN 'C L ' ' A 9 ' 'EE S f QV E if '. ' A-V15 - ' A : s .V F x QV ' , ' 1, 55 ' 1. ri -'H P. K. 1 VV.V t n Vfffi . , ' 1285: 1 X. ' p ?. 1 , , '-' ' 2321.4 12:9 Sunil? ' :is V. WV: ,SZ V, 1 f , gg s A- V A Q 'a f we f , . ., .Q . ' . -1' . f f r j, :K : ' a g . .:,, .. .V .Va f 4 .1 ::::r.::.:fE V- l -Q rsV,C.:,...:. .V ., ,, - F' 'V ' ,. . VV if VV , :,, V , K , V V , 1 , V V9 -Q X ' ,, . 'V 'jx ,qw ,4,,v':, . 1, 'W ' VV 'V 'VQV V . , ka., ,W ,,, ,V . : . , I ,,, :K+-gg 3 . 1' , A V t , ,M , . ,V V: ., ,Z A pk. V ff, V , VV .K '. ,g , 3 I vs, t' 1. I :X :V :Q 5 i V 'I 2' ,Q r ,iz f s l 'N f ' ,-13' .lz . N5 f' V V V , :Vg ,V -V: Vey : .V-ff V .V - Hee, Vg, ,V V 5, ,eff -g 'A fs fi: ,V , . ' ,,,:,. 7? ' 9' ' V 4- My .4 if f -M ,Q fe, 5 ' -' V, 2. , , JM, . y if W .Vw , A V,1i, V Q, ,V . , Ib, V ,aw ,. . L , A V' :, : ,, , VV r V, V. , ' ,,V, , , AV ,QV y , , , ,, A V ,f My , ,V , ' V 5 V f IZ I , 4 . 'ET V T 'V ' : ,. , A :V ': :ff f I V ju V, 1 1 . 1 :V V, ga: .1 V - V' . f V- S J V , V: S I: ,, V , ,, V - .1 :,, .. - ff, , ., .f V 1' , 2 f i ' R ., V2 . V ., 4. ' V HVVV 'fgmif 4:33 5 1, e. -, -:wr ,'V ef' V V I'g?i151 vZr3Eif V 'Hwy I at V V I 7 V.-1: , L - . ,, ,Qf ,, ,. ,Vz,. A .r K ' r X . r I re-w f. Q f any-' li V A V , ' V .4 f-r V 'V tif A. 1 V ,V , , 1 , g V: VVV VV V 1 . rt j ,,gg,V1 . , V ,V ,V '- f V' 5 qw 1' V V V V , I ,, X 'g Ll , if I f' . ,ig igffii 1 V , ' I S i .V '- A ' V : , -V V .V , vi . e 'I V V 4, V V ' E ' ' r ' ' 'V - :f?7l A 'Sfir V W 'V' V 3? V V V if: 4 o , ' Y Q fair? ,.::., ,,:5 Tr I A lk , - fi.: , f fs. x . -,S V VQV 1 , . 1 .. V , .,.V r- I , ' . , - Jiri ' 1' ' ' 9 I. 'il , : A ,V , , A L . Z M' , V I N ' ii W - K ' ,m A SHERRILL, MARTHA: FLT, Sheflleld, AL: SHERRILL, SUZANNE: FLT, Tucker, GA: SHIELDS, CAREY: GC, Gainesville FL: SHOEMAKER, CAROLE: GC, Childersburg, AL: SHUBERT, MELISSA: GJM, Jasper, AL: SHUMATE, BARRY: CS, Clarkston, GA: SHUMOCK, CHRIS: SY, Mobile, AL: SIBLEY, KERRY: EE, Russellville, AL: SIMMONS, GREGG: CHE, Centerville, AL: SINGLETON. PEGGY: CEC, Birmingham, AL SINOUEFIELD, RAY ALLEN: EE, Columbis, GA: SKINNER, KIMBERLY: FM, Shelbyville, IN: SKYORZ, SANDRA J.: PN, Madison, AL: SLAUGHTER, RICH: MK, Chattanooga, TN: SLAWSON, SALLY: AC, Knoxville, TN: SMIECH, GAYLE: CEE, Clearwater. FL: SMITH, BENJAMIN D.: PN, Abbeville, AL: SMITH, DREW: BSC, Montgomery, AL: SMITH, JAMES P.: CHE, Wilsonville, AL: SMITH, JAMES T. IV: BSC, Atlanta, GA SMITH, KIM: GC. Birmingham, AL: SMITH, LORI: VOA, Huntsville. AL: SMITH, LYNN: FM, Demopolis, AL: SMITH, MELANIE: PPY. Decatur, AL: SMITH, ROGER: TE, Anniston, AL SMITH, SHERRY: GC, Valley Head. AL: SOESBE, DONNA: PB, Foley, AL: SOLOMON, DAVID: AE, Clearwater, FL: SOWELL, DENISE: PG, Panama City, FL: SOWELL, STEVE: HY, Fort Benning, GA SPALDING, JEAN: GC, Auburn, AL: SPALDING, JOAN: GC, Auburn, AL: SPEARS, JAMES B. JR.: CS, Madison, AL: SPEEGLE, MARY: PRS, Cullman, AL: STAFFORD, CRAIG: ME, Huntsville, AL: STALLINGS, JEFF: PY, Daphne, AL: STANLEY, JAMES: EE, Thomasville, AL: STARNES, KEITH: AR, Montgomery, AL: STEED, LEE: VAT, Birmingham, AL: SPEPHENS, BRAD: BSC, Talladega, AL STEPHENSON, J.D.: ME, Riverdale, GA: STEWART, SCOTT: AR, Andalusia, AL: STIERS, KAREN: MK, Bay Minette, AL: STONE, JON: EE, Shalimar, FL: STOOGE, CURLY: EE, Loachapoka, AL: STOOGE, LARRY: EE, Loachapoka, AL: STOOGE, MOE: EE, Loachapoka, AL: STOOGE, SCHEMP: EE, Loachapoka, AL: STREETER, ANNE: CEC, Opelika, AL: STRIBLIN, FREIDA: CEC, Woodland, AL SUNSHINE, BUD: EE, York Town Heights, NY: SZELISTOWSKI, BOB: EE. St, Petersburg, FL: TARYER, CATHY: IE, Phenix City, AL: TAUNTON, DAVID: PM, Birmingham, AL: TAYLOR, MITCHELL: CHE, Riverdale, GA: TAYLOR, PAIGE: PY, Auburn, AL: TEPOOL, STACEY: AC, Huntsville, AL: TERRY, RONALD: PN, Montgomery, AL: THOMAS, BENJAMIN: WL, Lafayette, AL: THOMAS, MARTIN: PRS, Chelsea, AL THOMAS, TANYA: ID, Mobile, AL: THOMASON, AMY: CPE, Knoxville, TN: THOMPSON, MICHAEL: Fl, Miami, FL: THORNTON, ANDY: CPE, Auburn, AL: TIDWELL, ANITA: PS. Marietta, GA: TOWNSEND, MELANIE: MED, Newark, DE: TRIESTRAM, DEBBIE: MK, Pell City, AL: TRIMM, VICTORIA: CEC, Potomac, MD: TUCKER, RACHEL: CEC, Coleman, AL: TUCKER, RICKY: AG, Autaugaville, AL TUGGLE, ROBERT: DH, Perry, GA: TURK, ELLEN J.: NUR, Huntsville, AL: UHRICH, DAVID: EE, lndialantic, FL: VALLARTA, BIENVENIDO: EE, Montgomery, AL: VAN KEUREN, KIRSTEN L.: PB, St, Petersburg, FL: VARMA, USHA: GSC, Mobile, AL: YARNER, LISA: NF, Fairborn, OH: VAUGHN, LESLIE: NUR, Birmingham, AL: VINCENT, CURTIS: CE, Trussville, AL: YINES, PAMELA: PO, Camphlll, AL YORNAUF, KELLY: VAT, Huntsville, AL: WAGNER, TOBEY A.: ME, Snellville, GA: WALDROP, KENDRA: NUR, Grant AL: WALKER, CHARLES: OH, Eulaula, AL: WALLER, JEANNE: VOA, Birmingham, AL: WANTLAND, SUZANNE: HPE, Oak Ridge, TN: WATSON, PAULA: BSS, Mobile, AL: WATTS, JENNY: NUR, Demopolis, AL: WEINBERGER, DANE: AE, Tinonium, MD: WEST, C. BLAKE: CS, Cullman, AL WESTBERRY, JIM: EE, Wetumpka, AL: WHATLEY, MIKE: AB, Albany, GA: WHITE, DAVID: PN. Anniston, AL: WHITE, EDICE: AC, Tifton, GA:WHITE, WILLIAM E.: EE, Florence, AL: WHITEHEAD, CHARLES A.: ME, Birmiagtllam, AL: WHITEMAN, MARK: CHE, Melbourne, Beach, FL: W EN, RUSSELL: PN, Sheflield, AL: WIEBKE, STEVE: AC, Albany, GA: WILKES, RACHEL: CEE, Birmingham, AL WILLIAMS, N. GLYNN JR.: AE, Selma, AL: WILLIAMS, STEPHEN: AM, Huntsville, AL: WILLIAMS, TAMMY L.: EH, Hodges. AL: WILLIAMSON, EMILY: FM, Auburn, AL: WILLIS, JAMES: AR, Huntsville, AL: WOLVERTON, SHANE: AR, Greenville, SC: WOLVERTON, SHANE P.: AFI, Greenville, SC: WRIGHT, ROBIN: PB, Huntsville, AL: YARSBORO, CHRIS: AM, Birmingham, AL: YATES, GARY: PV, Birmingham, AL YATES, KIMBERLY: AEC, Woodland, AL: YOHN, DAVID: FLT, Eufaula, AL: ZIMMERMAN, DONNA: VAH, Montgomery, AL: ZUMBADO, PATRICK: AC, Gardendale, AL Sophomores .:.,V ggzej ' 71 BILL SCHNEIDER 2, V 5 A 'XB F g A I 'I I r- r iifizl, 45:33:55: r. 'rw . f-If 'A r 2.5 ABRAMS, CHARLES: FLT, Stone Mountain, GA: ACKER, MARK: EE, Auburn, AL: ADAMS, RICHARD: GC, Knoxville TN' VV 1 ,V 5 , VV V. A 1. , V AGEE, CINDY: PPY, Decatur, AL: AKINs, ANGIE: RBC, Laneny, Q :, 111-1: I .:EE:. ' . .. .A AL X '- MS, , KEWJIIL 1 I Yaii- ,, .,Bz : f f -LI-I' ' . - ' Z f r ,, A L Q , ALBRITroN, JOHN: PL, Brawign, AL: ALLEN, MIscRELLE: PB W Y - if , ,K .I ' f :I Decatur, GA: ALLEN, WILLIAM, R.: PV, Penbroke, Bermuda: ig , V, V , : f ALLREB, JAMES: CHE, Byron, GA: ALsoBRooK, LEAH: PN, II I - ' Y: I I Huntsville, AL - E '.:' ' ,. . 1 w A , , :jg V E, ,, ANBRETTA, NANCY: PBS, Mariana, GA: ANDRY, TERRY: CPE, :aaa -I , il , Bucks, AL: ANTHONY, BUTCH: ZY, Seale, ALL ASH: A , Q , ' ' f,gL 51,L V I i ' ' 1 MICHELLE: NUR Birmingham, AL: AuREo, JANET: Rss, IX I -:fu ' :I B'Im'n ham, AL , A ' ' 9 ff i,,::s,3: , A I Iwi f-gffIEkx?55 X ' . ' V:-ga - . . - A A AVELEYRA, DANNY: AE, Manassa, VA: BABB, KAREN: PN. I1 W1 '55 - X , 4 if I I : Shawmut, AL: BACKSTROM, TERRY: CPE, West Point, GA1 Q, A A WJ , V, BAILEY, MICHELLE: VM, Opelika, AL: BAKER, ALLISON: oc, I ' , II rf. I' Birmingham, AL , Az? I- f I f ii 'ii II I I . I 3 ff ' A: ,T BARKsoALE, AMY: Bc, Augusta, GA: BATTLE, JURALDINE: Ig ' A ,gnc ' ': CPE, Hurtsboro, AL: BEEBE, BRENDA: CHE. Pensacola, FL: ' V xilg , , BELL, JENNIE: PN, Huntsville, AL: BENTLEY, EMILY: AR, V' ' I Oneonta, AL TA , W: ' E51 , N Y A , ,. .. -:r.,,- .-M... L:- : , , V:V: L' ,B T' I 'fl 'i v ' V' .. - BENTLEY, RICKY: ME, Scottsboro, AL: BERGMAN, AMY: NUFI. L-1 'I f I 1 'Ia ' 4- av- Birmingham, AL: BERMAN, CINDY: cEc, Marietta, GA: ,, I - , : :: BEVERLY, ELLEN: VAT, Birmingham, AL: BIsER, DODIE: NUR, , V I' Q Birmingham, AL 5 --5. :L-1-. A :EK?X5Iff?'f J. . , , '53 :lsr : X .55 V, - I , - 'i , BIXLER, DAVID: ME, Ruaaeiiviue, AL: BLACK, KAREN: Mu. T, N . gi: , Montgomery, AL: BLANKENSHIP, ci-IERYL: PV, Lester, AL: : or J . V L BoLEN EDWARD: PN, vaiagafa, GA: BOOKER, KAREN: CPE, EGVFMI A7 . V I -- .I A Glencoe, AL , . . :I I : I ' f - ' 1 A ri 1 ...' '-,' t I :I A -D X I'I ' t IAA f ' . 'I g 5' I I 'V 2 ,- BousKA, SERENA: PN, Huntsville, AL: BOWDEN, STEVE: CHE, V ' Q T -?f VV Huntsville, AL: BOYD, BETI-I: Rv, Huntsville. AL: BOYD, sHERI: '- I I i In . 1353 r'.- - GC, Peachtree City, GA: BRACKIN, LISA: EEC, Geneva, AL , S i! ' ' ' X. If - , ... I'II '- ., gs.. 'lima Ass: - ,I -I , ,Lg ,M - --.. 1. - , , . : - ,f- is 1 :: ' ..:A -- H. f -I :aaa ' '- -Ames A . , ,,,,: . . .. A L.r - A f . 1 lu: -: A f-It 45511: ' ' AI TW rr- Ia: f :- f R ::- iii: 7 , r,,, : ,g L A :A V ez, qi BRASWELL, GREG: PN, Hunravriia, AL: BRAY, ROBIN: Ns, 'B ' ' X V : 1 N 'J' I Leeds, AL: BRICKHOUSE, SIMMEY: AE, Repton, AL: BRITTON, A V A :A II JI- A :- MIcIIAEL: PN, Mghiie, AL: BRooKs, JIM: PN, Goldsboro, NC f 1 'II . ' , : .- -r ' ' ' . . --: , ' - , ' , , I 5 - ,V J. 'EA L BROWN, KELLY: PB, Selma, AL: BROWN, RICHARD L.: PM, - : IE: - , Af, it Orange Park, FL: BROWNE, SUSAN: VAT, Lagrange, GA: X I A 3 V Vs ! :V , 3 ' BRUMBELOE, MARK: GJM, Lanett, AL: BRYAN, LYNNE 'W . Q ' ff 4 :gi ,,,., KIMBERLY: ID, Inciaianric, FL L , , r-r- - :: Af Y :--- A . ' 5 ' r ,I 5 T I I ,Q E BRYANT, DEAN: CPE, Tallahassee, EL: BUCHANAN, JILL: PM. 1' ji . I if ' , 1 CV, Birmingham, AL: BUCHANAN, MARY BETH: ADS, Huntsville, Q I Q : , , AL: BucKELEw, LAMAR: AM, Hartselle. AL: BUETTNER, , I - V I BARBARA: FS, Cullman, AL ,V,V ,.:, V K f V V ,V W A VV 'R ' BUFFINGTON, JEFFREY L.: DH, Marietta, GA: BuRKs, MoNA: 3 Sf: if C CPE, Mobile, AL: BYRNE, JAMES: PN, Jacksonville, FL: V, V g I . I' If if ' cABRERA, SUSIE: NUR, orlando, FL: CAMP, MARK A.: RN, y-' ,I - 'J' ' :FI Gardendale, AL . x,:.::: Af ggi, .553-r: . --I A -i2 1 ..': r - . . l!H.'?I!!a-:ui :. ' K Freshmen CAMPBELL, LISA: PN, Gadsden, AL: CANADA, JIMMY D. II: AM, Pace, FL: CANSLER, SCARR: BSC, Okinawa, Japan: CARLSON, JOY: CS, Kingsport, TN: CARLTON, LOU ANN: MU, Grove Hill, AL: CARTER, JEFF: GC, Burke. VA: CASELLA, JOEY: AR, Buckhannon, WV: CASSETTY, CLINT: AR, Hendersonville, TN: CHAFFIN, CLAY: AC, Birmingham, AL: CHAMPION, ROBERT: AE, Woodstock, AL CHAPMAN, LISA: PRS, Birmingham, AL: CHATLIN, SCOTT: CHE. Silver Springs, MD: CHEAL, LAURA: GC, Signal Mt,, TN: CHESTNUT, CONNIE JO: FY, Nashville, TN: CHUNG, PAULA: CPE, Auburn, AL: CHUNN, DAVID: PB, Montgomery, AL: CLARK, CYNTHIA: GC, Eufaula, AL: CLARK, WILLIAM: PN, Roswell, GA: COFFMAN, REBECCA: EEC. Elkmont, AL: COFIELD, TAMI: FM. Boaz, AL COLE, ROBERT: AC, Mt. Brook, AL: COLLINS, DARRYL: EE, Mobile, AL: COLLINS, JOHN: CHE, Thomasville, AL: COLLINS, MAUREN: PPY. Lake Park, FL: COMER, RONNY: AC, Sylacauga, AL: COONER, KAREN: PL, Eutaula, AL: COOPER, CHARLOTTE: CPE, Semmes. AL: COPELAND, NANCY: FCD, Auburn, AL: COUTANT, DEREK: PN, Lilburn, GA: COX, ALAN: CHE, Birmingham, AL CRADDOCK, AMY: CS. Sylacauga, AL: CRANE, GENNA: FM, Florence, AL: CREEST, MICHELLE: EEC, Calnton, AL: CROCKETT, ROBERT: CE, Auburn, AL: CROUCH, DAVID: AE, Auburn, AL: CROWDER, LAURIE: PB, Atlantic Beach, AL: CUNNINGHAM, JULIE: NUR, Lexington, KY: CUSH, KEN: PN. Pratville, AL: CUSICK, KATHY: PM, Orlando, FL: DAFFIN, FRANK: PN, Marianna ,FL DANIELS, MELODY: ID, Birmingham, AL: DANTZLER, CAROLYN: GC, Homewood, AL: DAVIDSON, ALICIA: NS, Birmingham, AL: DAVIS, ANGELA: CS, Wing, AL: DAVIS, MIKE: AM, Marietta, GA: DAVIS, SCOTT: PB, Dunwoody, GA: DEASON, RUSSELL JR.: PM, Lexington, SC: DEASON, SHARON: GC, Birmingham, AL: DEBRAGGIO, DENNIS: PN, Mechanicsburg, PA: DEDELS, ALLEN: AR, Marietta, GA DEES, BRENDA: PPY, Albany, GA: DE LOACH, JANET: GC, Anniston, AL: DEMPSEY, LEIGH ALLSION: NUR, Phenix City, AL: DENNIS, PAULETTE: CPE, Wetumpka, AL: DENNIS, SCOTT: CPE, Huntsville, AL: DEWEY, PENNY: FM, Hattiesburg, MS: DEYOUNG, TODD: PN, Gull Shores, AL: DEYTON, JOHN: PN, College Park, GA: DICKSON, AMY: VED, Columbus, GA: DIGGS, KIM: WL, Seale. AL: DILBECK, KECIA: PY, Decatur, AL: DIXON, KIM: PN, Montgomery, AL: DOLAN, JEANETTE: SCR. Atlanta, GA: DOROUGH, DONNA KAY: ADS, Chelsea, AL: DOUGLAS, ORLANDO: FLT, Montgomery, AL: DUFFEY, KATHY: PM, Sycamore, IL: DUKES, LEIGH ANN: FLS. Newnan, GA: DUNCAN, STUART DUFF: PN, Germantown, TN: DUNCAN, SUSAN: PRS, Sylacauga, AL: DUNN, CHRIS: AFI, Lithonia, GA: DURANT, ANDY: AM, Fayetteville, GA: EASTERWOOD, THOMAS R.: PM, Blue Mt., AL: EBERHART, GWEN: PN, Fort Payne, AL: EDGAR, LEE: AY, Deatsville, AL: EDMONDS, JOHN: PV. Trinity, AL: EDWARDS, CHARLENE: NUR, Marietta, GA: ELLIOTT, LYNNE: FCD, Anniston, AL: ELLIS, MICHAEL: AR, Selma, AL: ELMORE, JULIA: GC, Gordo, AL: EMILING, NANCY: PN, Albany, GA EPPERSON, STEPHEN: ADS, Pell City, AL: ETHRIDGE, FRANCES: IE, Columbus, GA: EVANS, LOLITA C.: CHE, Montgomery, AL: EVANS, TRISH: RSE, Creve Coeur, MO: FAISON, ROBERT: PPY, Fayetteville, TN: FENTON, BRYAN: CPE, Jacksonville, AL: FERGUSON, ANGI: VAT, Birmingham, AL: FERNANDEZ, CONRAD: EE, Valley, AL: FERNANDEZ, JOAQUIN: PS, Miami, FL: FIGG, NANCY KAY: PB, Tallahassee, FL: FIGH, SUSAN: PB, Montgomery, AL: FISHER, ELIZABETH: AC, Andalusia, AL: FISHER, KAYLYN: CPE, Jackson, GA: FLEMING, SUZY: PRJ, Oakdale, LA: FLETCHER, KATHY: CPE, Adel, GA: FLOYD, DAVID: AR, Lathona, GA: FOLEY, JOHN MICHAEL: GC, lndialantic, FL: FOREHAND, LISA: TC, Alexander City, AL: FORRISTER, STEPHANIE: PN, Birmingham, AL: FOSTER, DAVID JR.: EE, Montgomery, AL FRANKLIN, PHIL: PN, Montgomery, AL: FRAZEE, CLARK W.: PB, Marietta, GA: FRIDAY, LYDIA: AC, Florence, AL: FULWOOD, ANNETTE: PN, Ft. Lauderdale, FL: GARDNER, DEB- ORAH: GC, Alexander City. AL: GARLAND, LISA: VAT, Birmingham, AL: GIATTINA, GRACE: PB, Birmingham, AL: GIBSON, LISA: PB, Tallahassee, FL: GILBERT, GREG: PN, Thomasville, AL: GLASS, ANGIE: CEE, Linden, AL GLASSCOCK, CHRIS: EE, Clanton, AL: GODFREY, SHARLA: GC, Oxford, AL: GOGGANS, KAREN: NF, Roswell. GA: GORDON, WANDA: AT, Phenix City, AL: GRANT, MICHAEL: PN, Birmingham, AL: GRAVES, JENNIFER E.: PG, Boynton, FL: GREENE, SALLIE: NUR, Jacksonville, FL: GROOME, MARSHA: GC, Kissimmee, FL: GUNTER, CHARLES: CPE, Birmingham, AL: GUNTER, JOHN J.: PN, Piedmont, AL Freshmen s . .., , flav ' . ffm., xii i? . if 0: , W E 'f 'Jijf ,V,Vlia P1 'M ' .W A . . . J f . ' V J, f. lf, ., t ,5 A g 'My . ,, .,,i, Z V., W ,3 :AV V :V V- V ,V ., VV v- I -,g VV ,gf rg: V ya .:..,,V - in e , l :ef .V , L. A - :V . -3 fl- V V . ...L ,,, - .' V ' l , ' :fff 120 for A 1 ' ' 4 V '- V 2 ', 1- V.. , V Zi - f::V '-.f ,: V VI 1: 'i .f ' f-' , :,, . 2, , '. . g Vg V ' f' l W ff' .t, ,- V fV' , f VV V . 'ff ii . 'Q..wf- 'f 'fiiif tiil 1ifz '? ' i!'P' 5' iw -Vt... :V .- 11:4 f , YV: , 1 f . , , wa-.V QV :V ' - 1 .Ve-Vf 5 M V- R' f 1 Q. I , i , 42,5 . ,, ,QQ , 33 Q 1 ,Ve.,,:V ' ,, A H . 5,1 'NOV VVVL ,L ..V 3. '. T .V I ' V ' EES' . , 41 - ii ' I LV VV , .' , ' - if 1 51 . V , E . 3 RQ? Mig., ,tg ,Q : 5, , 4 H' W NV. f L, . ' , Z ' ' .rf if ' , f-giififis T' ', 14' 7 J 3, , H 5 I ' . V I ' ' ', 1 ' '. M' V . L?,'qjjV:j Zfji Q, -' , J -. A Yr? t A : ' V ' . ' A V , ' V All A 5 mg . gf A 1, f, , . J M, , 'z My :VV . :wg A 2:4 , ' . Q . : 5. :QV ' 2' V. ' 6, A .I my ,,...M-VVWV ,., ,, ,,, H g,. V ' -:Vw . A, -- ..ffV-:.,,Vfe : Q' I, . A 1 . -' r- J. , ' ge, f . . . V f 1 i V r , gf,.:,f'j.' J . '- V V, V, 7 'f r , V , A l - , ,i:l'llil2:iil2f:i',v . . . QV V' f firl V .. ,I ,,. . , yy .,.:H' V I , V V ,V , 1 ,I ,E -z 7, , I :VV-V 1 , . fLV V. -' -V 1 ' P i 1- T 1 V- EV: V 1 Vey' .. ' , , 'Mfg :: ,V I. -4' V gf: : V , V V 1, . - ' . f , V? L. I ' V ------ - 1 V f'Z51:ifv2L.'K. XV' I ' 1 -: ' .V 2 . L . , : , WL .3 - L :YV -V W f-2 ' s V- V ., :V 'Q . pg ,as . . MV 52: V I ' I . 2 .1 ' :, ' ff' ' ' at VY:fV-Vf, .Va V ' f f :V i Y' ' ,L W f I i ' . -- is :' ' ' 3 'V ,W ,Q - v V, +: ' . 3 swf . V fx 4 . ,V !V V. ' . Vw -A V g, , , p ,.:'.. ' . '11-V 'V aif i 'si V ' i i : V' i. ' N 2 V Aff 1, -' ,g f PV' ., 1 ll ' .4-.4974 ' Vw ' HW , : lay.-. M ..,.. it 4 It E T W V ,, :gp an V: ll, ,bl . .M A . ,wg - U ag VE: 5. 5 xr, ,. ,- V ,J ' ' ff T ' Jr - Hi .N V , ' ,, ' 'L ' ' , A ' I V 7 ' 4 F ' V V' l 42 V ' I if ,V V , . - ', 5. ., V, VV Li, E : 'fa T' V ' V: -Vw V V V W, gsf-3 I ::':,,, A., 0 A .V V W' uit f'L'5!iiTfV :V . r V! 2 .M 'f 4.4 V V . -i... V V V w Z ' f' A 16 : Q ' 5 :Vg '-V V , y ' V .. at , V ,, , V V 5,f:,i1:::e,,fv 'T' If ' VLH -... ' ' ' I . nt . .. w L V - , , . QVAV VV 1 ff T V la I ' , 4 Q ' ' V. - 2' V' , . :V V 40 'V - 'Ve 1 H Vw' f' 2 . 1 1 5 V . .gow , V , 'V 5 my . -fV nr. -- , . 5 V' f' 'f ' , X V i :Vw 'V .. :mai g ., , V 3 X L ' W . .- V V Vf, ,, , .V,V we I ,J lil, ,H .F gy-dig' jf -vi 5 . iwV'fVVl.ll: .' vt - ,Q M f '11 f f ' 1 lux. M .ff V I 1 Z: 24 1,1 we , . . . , . ,, vga., , . Ia, , ,Q .A 4 . ' ' - .L ' V. - . . ,f . . . gh -4 g. Y qu , ,, ,.. ig, f - A fi, fffiiff A 5' 1 5' ' I YA' I ' I ' fe 1: I ,L.' :sm 'ai' All , . Q ,. , it ...Y , r A . V I K V H 1, ' f- 'fi - ' f W. ., .1 - Z . ,Kj J- , V :frf.:,1,,..t,v A K 2 , 'I' ', LEA-ff! ' . f 77558 ' Iii' iii' ,L I K 1. . -- I V. A K W r' feiff. 7' ' MW: 3- ', K' ' We . ' , ' N if.: -,.f,,' I T: K ' I P77 it fs Q, 3 - ga 3 i: . .-'.,..,.,,.,. ,. . 3 ' ,-' 1 ' 2: A - 1 ' T H , ,,,, I I 'Y F Lf , - K if , - 4, , fr., I . , ', 'f' ff .- f '-iff? ,J , V- ,nf f, . K f fmfi 2221... K r K' K , I . Q I - , .fi , . ' , - i ' ' ,', ' ..,, 1 ' gill ., I . f ' - ' , 4 ,I fe, ,1ff.,,: ey 4 I . W. , im -,sf eff - gr- ,s ,,, ,V ,W , , A, . M M, Q A '. , .,. 6,5 ,zf r . .. '- ff. fr .,., u: f' 'j , K ,, f r wf ' . - Q .., - fr In . X K , , l A ,i V ,,,5. fv , H., 5, ' ,V tj., , I, 11 tt, hd, g ' f . I - .K I 5 , :fi ' ' VVVWA K K 4 5 K . f A f' W ' ,f 3 4. 1 - , mf . - .2 fe 4 K I . -M sw' , ' nw -s wi L, ' - 1 :Kb ,-4 :4 L ' f : Q :Wir fm- aw A ' gh r' 'fri ' J-S ev 2. ' ,ifffif I' I. ' , .F f -J ' ' . , Uv. ' A. f K: . ' , ' ' , 'sf ? rf ' 1 ' ,ff-'SKK f W? , ' vo K f , K 1. . 1: ww : ff , f ,A f 'ff ' .. ,fi J-74. iw: v H fill' , ,, -1 1 3 ,,, ef -rw'-.fy - . ie - :pg -4, if , - ,. . 4 'lf' ,,,.' ,,,, ' 'Lf st , , , cf' . . - - ' , I ' ,. 'Y L . f, A . t :....... ...H at 5 'l l bfi? . I. , Q' . 4 al -, A ' t S f . -an . is ,WL 7: 5 2 I A I F., ' ,.,L 5 , I, . 1 ,, f Y.. , 1 Fe: , u i r ,,,,.i:' ,M W, 2 V, ,rr ' , I gr. , , I W W .W ' A Vi ' i K- rw - 3,-.. , In 34,25 H :q,., ,tjr5 f' I 'U ' 'wi I . Y , ' A . , ' I ' ' . ' yu' -' A I ' ., , mv I K ' riff, 4, , i l - W ' fi ffl. , f -'1' . il xi, r .Q . M , f - I ., WL L U, ,V M 'AV . , , ,,,, ew, may n l, , .H , A Q 0, . , I I3 -f -. Q, f 'K ' ,A ' .11 H ,.- ,. , . L, , , ., X ng . , ,,,.. A, ,,,, ,K XA 1 A 4 ' I . g-THD' ' 1 W : .I f V '- ' : V ' . I , . ' - 'i Zfw ., th V I IO , I . 1. . wt' 1 wi' I' ' P A Nt 1 I - ,gg u , A, V f , - . :Imm.,,':1 ri . K' ' 'Ziff ' ' ' xg , Vffteijlzl-'JJ ,' , g,.,f,f' f25q, , gi' : , :WYQ , :sw A , ' I ' . - .A , . , W .... : . A . . im: , ' 4' :. S' f -2 wif . F' i ' ' Vi V- . vw ' 1 1 4 , - . 1 L. : K1 K .1 I Q 1 +1 4. ' 0' I , F i 4 A i Y : 7 51: 34 . , ,,. . , L 5 , , ,, . . gf, ,,, : KZ W. ff ,- z,,,.t,., ,, ,. Xa J. : um , . A K' ,, ,g .. f I ' V ' ,L K V , 3 4' A X - , i 4. ' - ' ki I , ., A I . , ,f ' A r w . f - W , A : , fre' f , , -' K' Aff 'fv . Q . 4 ' 3-.V -1 ,-I Le- 3, f-- , ,,, I , ' W! xref. .mf I, -: , , ,, y . gym., I My .I . fig, ., L.. fm. . , .0 , .-f i fr, Lutz' I in ,bf fy 1' .. , -i i 4, 5, 4, 4, , . , . M.: , . I ,A 4-it ,. - f , , Jifif 'K K: F ::,,,:,' 1' 1 . ,. , ., , H f , V . V' J 5 ff 'Sf tv i iw. ' ff, K ' ' ft- V 5 A- , , .im 1,1 . . K ii gf! S5 S A N is iii 42? .Q Q WY ' .1 f-121' , , ' ,,...,, : , ,,,. , .rf , 'if 3 M , , ' :hw sie: - g-ag . ,, . - fy 'if : , 4 1 ' A Lg - V. . . K , , I ' ,- . 'iii ff FP W ' 55 - ff,fi. 1' ' i - QW, - E., ' vi fi, ig, ' ,A - f 1 . :gz- : 3 ' ' 3 1fIf:1f:I-wgwwfii -. ' - . iii 'ii':fiW, r:rr,:1f,ey5' ,Q - ' K' 'or' , . , 1 1:5 . If f f ,,w..1K3 I5 . , 1 ' ' . . ,Q L., fi, GUTTERIDGE, DANA: VAT, Birmingham, AL: HADAWAY, NEAL: CHE, Huntsville, AL: HAGLER, JULIE: AR, Winter Haven. FL: HALE, SHAWN: CS, Decatur, AL: HAMILTON, LANSING: VHE, Look Out Mountain, TN: HANKS, SUZANNE: NUR, Birmingham, AL: HARDENBERGH, MARTHA: PL, Centerville, AL: HARPER, DANIEL: PN, Pansey, AL: HARRIS, JANINE: NUR, Selma, AL: HARROLD, DAWN: PN, Birmingham, AL HASSEL, KATHLEEN: PB, Huntsville, AL: HAYES, DONNA: AFI, Mobile, AL, HEMPHILL, CANDACE: GC, Huntsville, AL: HOLLINGER, KRIS: PM, Jacksonville, FL: HOLLINGSWORTH, REBECCA: PN, Steele, AL: HOLMES, DANA: NS, Pinson, AL: HONTZAS, ARTHUR: PB, Birmingham, AL: HORNER, KATHLEEN: PB, Huntsville, AL: HENSON, MICHAEL: PN, Birmingham, AL: HERD, PHILLIP: FYE, Estill Springs, TN IIICKERSON, MARK: EE, Pensacola, FL: HILLS, JERRY: EE, Bowling Green, KY: HIX, BRYAN: ME, Rome, GA: HOLLAND, DAREN: AE, Alpine, AL: HOLLEY, MARTHA: PG, Huntsville, AL: HOLLEY, SUSAN K.: AFI, Pulaski, TN: HORNSBY, KATHRYN: PL, Troy, AL: HOUGHTON, DIANA: PB, Dunwoody, GA: HUGHES, DAVID M.: PN, Winter Park, FL: HUGHLEY, HALL: PN, Opelika, AL HURLEY, BEVERLY: PN, Birmingham, AL: HUTCHESON, SANDRA: AR, Lakeworth, FL: HUTCHINSON, ROSS: EE, Huntsville, AL: ISOM, STEVE: PPY, Arab, AL: IVERY, BARBETTE: AE, Montgomery, AL: JENKINS, MIKE: PN. Gadsden, AL: JENKINS, SCOTT: PN, Opelika, AL: JOHNSON, ALICE: IE, Birmingham, AL: JOHNSON, CLIFF III: PL, Albany, GA: JOHNSON, JIM: PN, Birmingham, AL JOHNSON, WAYNE: PB, Selma, AL: JOHNSTON, MARC: PN, Hobe Sound, FL: JONES, KEN: ME, Stevenson, AL: JONES, MICHAEL: PRS, Griflen, GA: JONES, PHILIP A.: PV, Abbeville, AL: JONES, ROBIN LEA: PL, Clanton, AL: JONES, STEPHEN: PN, Decatur, AL: JOYNER, LORIE: GBI, Stone Mountain, GA: JUNEN, COLETTE: EEC, Huntsville, AL: JUSTICE, JOHN B.: CS Decatur, AL KEAN, RICHARD: DH, Maxwell A.F. Base, AL: KEENE, MILLIE A.: PRS, Birmingham, AL: KENNEDY, AIMEE: CS, Mobile, AL: KENNEDY, JOEY: CS, Birmingham, AL: KENT, ALLAN: PB, Decatur, AL: KIMBROUGH, BRAD: PB, Thomasville, AL: KING, KARL: AE, Huntsville, AL: KIRBY, PAULA: GC, Decatur, AL: KNIGHT, DUSTY: VAT, Jemison, AL: KOTOUCH, GARY: PB, Jacksonville, AL LABATT, JIM: IE, Tallahassee, FL: LANDRETH, LORI: AC. Birmingham, AL: LANGSTON, SUZANNE: FM, Sopchoppy, FL: LAUDERDALE, JENNIFER: GC, Auburn, AL: LAWSON, DANNY: CS, Anniston, AL: LAWSON, SHANNON: PRS, Thomasville, GA: LEADER, STEVEN: PN, Montgomery, AL: LECHNER, JAMES: CS, Fairhope, AL: LEDFORD, JOHN: GC, Florence, AL: LEE, GREG: PN, Tony, AL LEIGH, SUSAN: PN, Birmingham, AL: LESESNE, WILLIAM E. III: AM, Brooks, GA: LEWANDOWSKI, DONNA: PO, Jacksonville FL: LINGO, DEBRA: PN, Remlap, AL: LITTLE, CHRIS: GC, Fairfield, AL: LITTLE, KIM: VOA, Clayton, AL: LITTLE, SCOTT: EE, Stone Mountain, GA: LOCKE, CHUCK: GC, Dothan, AL: LONG, DAVID: EE, Piedmont, AL: LONG VANESSA: PB. Birmingham, AL LOUGHRAN, SCOTT: AE, Concord, GA: LOVINGOOD, LEIGH ANN: PB, Decatur, AL: LOWE, KARA: FM, Lake Placid, FL: LOWERS, BEN: EE, Huntsville, AL: LUNA, JULIA LYNN: PN, Muscle Shoals, AL: LUTTRELL, LINDA: EH, Grilten, GA: LYNN, FREDDIE JR.: AR, Nostasulga, AL: MADDOX, JOHN W.: PB, Rome, GA: MAGNUSON, JULIE: RSS, Birmingham, AL: MAGOUIRK, TAWANNA: AC, Anniston, AL MAHAFFEY, MICHAEL D.: GC, Bessemer, AL: MALLINAK, TIMOTHY J.: CHE, Rainbow City, AL: MALONE, DENISE: AC, Lincoln, AL: MALONE, KEVIN: PN, Sugar Valley, GA: MALONEY, PATRICIA: MT, Tallassee, AL: MANSON, STUART: CHE, Knoxville, TN: MARINO, DOMINIC J.: PV, Plainview, NY: MARKHAM, DAVID: GC, Sumiton, AL: MARKLEY, DAVID: PN, Birmingham, AL: MARQUIS, ELLIE: VOA, Miami Springs, FL MARTRICH, KATRINA: FY, Montgomery, AL: MASH, BRYAN: CPE, Kennesaw, GA: MASSINGALE, ROSETTA: GC, Hurtsboro, AL: MATTHEWS, CHUCK: AE, Stuart, FL: MAY, RICK: EE, St. Petersburg, FL: MAY, WALLER: PV, Tuscaloosa, AL: MCCARROLL, STEVE: GL, Elba, AL: MCCOY, IRVIN: PN. Kansas City, KS: MCCRORIE, PHILLIP: PN, Pleasant Grove, AL: MCCUNE, CHRIS: PN, Homewood, AL MCDONALD, DAVID: EE, Killen, AL: MCDONALD, LAURA: ID, Winlield, AL: MCDUFFEE, PAT: PN, Montgomery, AL: MCFALL, MIKE: PN, Macon, GA: MCGILL, MARK: AR, Tuscumbia, AL: MCGLOW, MERIDITH: PRS, Lawrenceville, GA: MCGRAW, KELLY: GC, Mobile, AL: MCWATERS, GRACE: PB, Birmingham. AL: MEIER, SUSY: GC, Oak Ridge, TNC MERCHANT, JOHN: CE, Marietta, GA Freshmen MESSICK, DEE DEE: PN, Abbeville, AL: MICHAELS, JEAN: EH, Auburn, AL, MIDDLEBROOKS, TODD: PL, Davie, FL, MILLER, PV. MD, PN, GA, AL AMRY E.: PM, Bethesda, MD, MITCHELL, MANDY: Birmingham, AL, MITCHELL, VALERIE: CE, Severna Park, MIZELL, VAN H.: PS, Mobile, AL, MONAGHAN, TODD: Peach Tree City, GA, MONDA, DOUGLAS: PM, Lilburn, MONTGOMERY, MISSY: NUR, Birmingham. MOORE, ALAN: PN, Florence, AL, MOORE, CLINT: Columbus, GA, MOORE, FRANKIE: EE, Phil Campbell, AM, AL, MOORE, MICHAEL: PB Euiaula, AL, MOORMANN, DEBORAH: MDT, Jensen Beach, FL, MORRIS, LISA: MB, Loganville, GA, MORRIS, PAMELA: PG, Eva, AL, MOSHEIM, JOEY: OP, Montgomery, AL, MOTE, PATRICK: CE, Thorsby, AL, MOTLEY, CINDY: PL, Auburn, AL MULLINS, JOHN: PB, Dothan, AL, MURASKI, LORI: LA, Geneva, AL, MUSE, CAROL: PM, Scottsboro, AL, MUTH, KEN: PN, Worth, IL, NABORS, PAULA: BS, Talladega, AL, NAIL, BECKY: PG, Birmingham, AL, NARCISO, SONDRA: PB, Dunwoody, GA, NAY, JEFF: PN, Hazel Green, AL, NEEL, MELISSA: CSE, Birmingham, AL: NEELY, ELIZABETH: EH, Stone Mountain, GA NELSON, MARY ANN: AN, Chattanooga, TN, NEWMAN, KAY: SC, Cartersville, GA, NEWTON, WILLIAM C.: PN, Augusta, GA: NICHOLS, CHRIS: PN, Lagrange, GA, NIX, MAERA: VAT, Alexander City, AL, NIX, WINDY: IFE, Leajue City, TX, NIXON, KIM: GC, Birmingham, AL, NORTHROP, KIM: PN, Jasper, AL, NUNN, CINDY: CEC, Montgomery, AL, OBRIEN, JAMES: EE, Longwood, FL OLIVER, CAREY: EE, Arab, AL, OSBORNE, DOUG: PN, Marietta, GA, OWENS, DENISE: VBU, Decatur, AL, OZMENT, DRAKE: PL, Rome, GA, PADGETT, DAVID: GC, Union Springs, AL, PALMER, CATHY: CS, Lancester, OH, PARDUE, KEITH: PN, Calera, AL, PARK, RICHARD: EE, Deltona, FL, PARKER, DANA: PN, Montgomery, AL, PARKER, JOANN: PY, Auburn, AL PARMER, JEFF: AEC, Fiussellville, AL, PARR, DARA: PHS, Auburn, AL, PATTERSON, NICOLE: NUR, Athens, AL, PEARSON, PHYLLIS: PB, Gordo, AL, PEASE, FRANCES: CEE, Manchester, GA, PENDERSON, ALAN: PN, Montgomery, AL, PERRY, AIMEE: GC, Auburn, AL, PERRY, CHRISTY: ID, Anniston, AL, PERRY, JULIE: CE, Monticella, GA, PERRY, KEVIN: EE, Huntsville, AL PHILLIPS, SARA: GC, Silver Springs, FL, PICKETT, HUNTER: INM, Memphis, TN, PIEPER, PHIL: ID, Anniston, AL, PIERSON, JOEY: PN, Monroeville, AL, PINO, LEE: GC, Uniontown, AL, POIRIER, MIKE: PM, Birmingham, AL, PONDER, MELINDA: ID, Birmingham, AL, PONDER, SHERRI: CHE, Huntsville, AL, POWELL, SHERRI: CE, Laurel, FL, POWERS, GREGG: PN, Heth Springs, SC PRICE, HARLAN: AR, Clinton, MS, PRICE, SUSAN DARLENE: GC Birmingham, AL, PUCKETT, PAUL: AR, Montgomery, AL, OUINA, COURTNEY: PRS, Bay Minette, AL, RAGAN, SELENA: AC, Birmingham, AL, RAINY, KIM: FLT, Florence, AL, REARDON, SUSAN: GC, Decatur, AL, REED, RACHAEL: AC, Millry, AL, REED, TONY: EE, Lawrenceville, GA, REESE, SAMPLER, GRAY: AFI, Anniston, AL REICK, RENEE: PN, Homewood, AL, REID, SARA LESLIE: EH. Huntsville, AL: REISS, SANDRA: PG, Birmingham, AL, REYNOLDS, KAREN M.: PB, Lafayette, AL: RICHARD, JOHN K.: ME, Decatur, AL, RICHARDS, JOHN: PN, Mobile, AL, RICHMOND, LISA: FLT, Maryville, TN: RILEY, JOHN: CHE, West Palm Beach, FL, ROANE, CLAIRE: AE, Pensacola, FL, ROBERTS, TOM: PN, Wetumpka, AL ROBERTSON, LYNN: PB, Montgomery, AL, ROBERTSON, MELISSA: PPY, Shamblee, GA, ROBINSON, CARLA R.: GC, Eufaula, AL, ROBINSON, CHARLES: HY, New Orleans, LA, ROBINSON, KAREN: FM, Holly Pond, AL, ROBY, DEREC: PN, Anniston, AL, ROBY, SUZETTE: FM, Anniston, AL, ROEHL, JULIE: PN, Niceville, FL, ROHWER, PEGGY: EH, Oak Ridge, TN, ROLAND, JAMES: CHE, Birmingham, AL RONCHETTI, LISA: MDT, Calilon, NJ: ROPER, CHRIS: AR, Mairieta, GA, ROUSEY, SEAN: CS, Stone Mountain, GA, RUSH, DELINA: EE, Birmingham, AL, RUSSELL, CINDY: PY, Opelika, AL, RUSSELL, RICHARD: SH, Hartselle, AL, RUTLEDGE, PANTHEA: PB, Huntsville, AL, RYE, STEVE: PB, Helena, AL, RYLAND, FREDDIE LAMAR: ENH, Auburn, AL, SABA, DANIELLE: PM, Carmel, IN SALIBA, CHARLES: AE, Marietta, GA, SANDERSON, DIANE: GC, Huntsville, AL, SCHIESZ, DON: PN, Oklahoma City, OK, SCOFFIELD, RUSSELL: GJM, Meridianville, AL, SEWELL, TROY: BSC, Dothan, AL, SFAKIANOS, DINE: EE, Fairfield, AL, SHACKELFORD, KARTHY: EE, Birmingham, AL, SHELTON, SUZIE: ME, Decatur, GA, SHEPARD, KIRK: AFI, Huntsville, AL, SHIKLE, JAMES: PM, Birmingham, AL Freshmen :ss ' 4 S at A s A 2- 1 M .. A. i I T - '1 S. ' - L S Ei : vs ' :sg .:, I :IW Xi' ,Zig ,fly I if rwrri-QQqsL.i,f I - I , ' iasrgs I 'i W.- ..,... W, PM . - P ' i ii 2 ' 'N rs, ' sz is Pe. : so -fl: 1 I 5 ' R: ' ,- - ' if I R , :ze ' X W Q ,Ia ,K 1 ef' ffl u 7 ' ,KKLI . ,Sf Pl5:::Yif.5!3'll Ei: 5 L S555 T .1 :fi il 7:15 :IS . I ,,.. L u . A at f w f I, i Q f - px QQ QQ . ' Lg g 1 J a .Y :..,:.N M 1. is s ? YIM f , tam A, , W f S 'T' , , , , ' ' : ft .- I - F I . - .r ' 'tiff 22,5 A L I-Nz. Sfx v ' L x:.:i E: '. r '. ' 1 ii . MCL L 2:3 f ' ' A - . x 5555? 5 I , . 2 Q, iii iff ' - FN ' A Q ' 5: ' fe. vii ' .3 '. it v f X : ff: f. L ffsf,-W S -1' -3, A. F I - 1 Ei' 'X t , Q I: . f 3 -' : if riff 5 L ' 'I ' ' is-:.:,s - ,- X , -F A :2 -5 sf - :.s:Xf . 4 I : --'-- ?f:,,4 t f , :3 zz. . - . 2: f - if .. : M., .'-I 'rt ' A A as A f F as , N I 'IHS' 5535 , ' .. I 3 . Q ' ,. . . . , ,. , .. , , , . , . - -:see - ' fu - ' : , ' I. ' ss :- ag, 4 , - 1- - ,, ., , N' L. f ' ' I . f- W1 . . - I 4' 55 'Sv , use 5- 'L , y up . 'A -1 ,-it - A 'tr A ' is :xg C4 ' ri: . ' X W I I -f A fi .:.. :I ' Rf 1 -xi : , ' mi'ii5s.g .,,PLf33 . ' QW- -if ' if ., -'f ' I A- V :: M 3 A - Jw 1- 'i--f g . if ,- 1, k,y.,:.,,s:,.w,:n-f , A . , X,-a',.,.:3:,,,i3, Q i. 3, .X V' , szfisrxr K V . , ,,, I M , , ,L A . . , 4 , , , .. , , ,, , l , f rw ' . Y , ' :Ur ff' 'ZW' I 3 iw f ' , 1-1 hw-if , . , I , , - fs. ye 1, -as f ,. .. ,I ,- ' : W -3 I az, ' 'if . f lf it 'W rf if - I ' f rf , N ft lil' fifth 2-i f , ' X ,af 1 11' - W 5 ff ' I , ,, ,A 7 Un 14, ,fg,. , ,. : I ff : si f 'A I, .g lf, r t ' I I. My, I , , . n 1 up ,- ,, V , 2 ,u W. f 1. A 6 li 2 ' f Tr fi: Z . , It ' :gg Y -s 1-liz, ': W :f ' f E. ' i V ft ,,' fr ' 'M ' ,, 'v 'Q ' vm r , ff , .nf 1 ' - fs: ' f ' , t . . f ' i -' 1 1211? 5 - , 5, -'I f t I , 4 V t, I ,:, -- F..-Q f - f I 1: 2. 'av r il . l l ' 'WI . f' , 1 -,fl -Q- V 3 i . 1 w if if 1 , , ' f, 1 - , 1 A: V of ff 2 1 1 f F i , ' Lsfiiiv . t' X IQ ,fll-35' ,.i Q V- V 1, 'fff -f U I ' t v- 4 f 33545 ' . ' ,if A t ,..-- 2 X f 533 , fi .' L , H - A , was-I J . ' ' Q fi tr va. I A r , ' . W I , ' 2 ' ,f 1 I Ji ' I f 1 Hifi rw :-V g .2 L. me -W sf , i . . , Q, ,, I ,V 1 . . - , , , , . , ro , , ' . i i 4' , I, ,Q r , , 1 .Lp :gmt 'lm ' ' ' I r . :rig-,fig 1' ' 'K V . , Q-Q ,' X 5- ML. f I4 pl .,i,,Q,g7i.,, ,ff , .V ' 1. ,fE:5??,:2-?'f:,:',Vffi ' I' gy, , , V 7 .,, 4, ,,,, , , M 4 ., , , ,f e 4 1, iigllqzcv, - t g - ' ,J ,Q 9, Q, r ' M, , , 1 Wm icon, g fr , f Km, , W 1 H 'Q : ,. , v 2 I- al , I ' . ' , , 2 W , mf, ., l .,,, ,. M, ,,,,, .1 , ms? , ,f , .,,,, 3 , ,, , ,. , W, W. ,f s . ,W V fy , .. , , ? . .Q A I QF I... , 2 , 3 L Turn ,- 'ig . . ey: ? VI, ,Y-75,3 .Q X A X I l I ' .E A V V.: T? , V: , V' ,I , g, , A V ,DJ ' f f r f , , Ei I i :. I ti e:ew139f 21 .E- Q Q 2- ' 'f' '4 H: TI U ' ' - 'i ' ' 'QI L 1 I 714' I' :V L XII' YH, , w .vfII H' - ', ' 'Iv ' . w 3' I gj we . g gf In. . .5 as i d. , ,Y 2 .If :. f::-4:21 ' ' We . , iligwazz: ' mei, lfiiltrlllfii 1 '- 2 : F : J? 5215, ' 5. , ,,,,,.,', . . I -- f-II.:-II A I 1, ,,, ,, ,,,I,I. ,, , Ir .. ,,,,,,, , K K .,,,,,, ,I 5 V , fr 'rx-wad' W V af' i , ' 1 , an P f A fg f 4 4 r Q: ' ' gt . I if I, ef? f f 'iilm f'. .. ,,,: V' W ' W 4 , , , , ef ' . 4 .1 , ' ' 2: a . ' 92, ' , , Ii V ' P I ,1 ,ef , , ., if I ' I . ,I .W - - I 'Wh ,I gypffy 54-wie , I I k k Mil fr,,ffl.::: M vw , , - ...A A 95,9 IM C M a f T I! 2 X311 - , II. 1 ' 5 , M43 ,.,, I - f: . A . gl , ' -xt. : A N, ,' 4 I v ' ' 1 57535-7 ,,,, if ' :f,:ie, ' ,I .WI ,E -I 'ill T I, ' . . g:,gil:T:.3 g:,,.:,, l ' I 5'32if'? 4 lg A I: AM ' Y,- i 1 1 W' 471: T I! :iii I iupix 5 ilf,3x'1 . . I, , I f- ' I IJ. ,I . ' t t ' I : I' 922 I W . 9 , I- f ,ggi In . Ve , 1.55 , t VV, W V , ,k,, ., V :,, L, ,Q . ,. ,, , I- gg, , K.: ,, f 3 M V I s g L 'I - MTX- :Ti . ,l AL fx ' :V I i ,- , V 5 ,,, , 4 ,mu ,,,, ,, , .1 ,,, I , I,, ,,, , , ,-wf: v,,, ,, -W.. I- I .I .,,. , .,,,. .,., W, I . , .. I ' C' A Q ffm ' ,I ' ' '.' w I ' . ,- 'f 'V ' i I- 5 'Zi ' I '43 '- if I ', AW: 128451, f m: , . fr-If wr, VV fy ' ' : , 'mf if . , : A-- ' 4? V , V ,Il 'THQ 5-, IL M - V1 Y g gy, I ., . J ': iff.: - 1,5 iI ,JI - L ' l '3214:-34159 'Il ,m,, ,, .'xI If 53.11 5 ':'mwmWMIM.,..W. , Z1., Y'a YW. ,Yr fiwi' I :E322we5:::fIIr:I::,,Isfgf,, , ':: ' 2 I pg. ww 1 , Y ' I I ' ' '73 f g 1 ' .. 'ia ' ' ' - f 'I I- .F '- ' J r 5. I I I' 'fi ' I. 145: - r 2 .ye It' - ,I,,I ' ' E ' II - II' , .Isec - , -: X , ,V-T?:,I,,::. V . Q 4 x ,, ,A ,.....1IIr-:tru I I . I .I...., A--,I , H I , ,bf ' : V ' ,,I. .:.Z,g,,fI. J V Sam: V, ,V : d l .:, VI157yWIvfwWZg45 , I 2 . , I' i' 'Y 'i ' 5' E I Q , f Q' if M Ti F . ' ' 4-I : I I I. .U I 1 I I I - . It , . I - ,I I. I .4 ff: if I I 5 I 1 -, , I , P I f ' I' , W , U . NMI f 0 - ' ' aaa: I , .I ' A 4 f, .I A ., ,-, ., , A A, Q I , 'I 5 , f ' 1 i K - I 52 :Iv rg-I A - W Y., bf. 4 I I-iw WH, I: -f I . I, -mf: l I. g , :i dl . . , Ip , jg if Y , SA , , W , . x I ' 'VJ ' NI ' 'Q' I il ' ' ' ' iw! itll! ' ' '9 ,I Q ISI 5, 6 A fI wg' I f .- XI lf :gy ' , 5154, E T 3 M Aw.- , 'A 4, , In EH.. , 5, 1- '- ' ' ,- f Q f I . gr, - A i 'S' ' an was I' I me - . iv,-3' A A ,. I? i I, , M, V. ,, , :I gr w w! . ., l ' I . ' i 2 'A 4-,f If' 1' , ,I 4 I, I - i ' . , A I . , ' if -. I ' L gig If N ' A S Xe -' : V 4 ' i Y ,fh.I 4 1 M - I , 5 ' . I M A ', if 1 '72, . 7 I ' ' B Q jgf A -- ,Ia-7 Q Y :I N . l I, . ,d. 7.5 ,v 5 3 , , 11,5 N i.. I B K ' , I 'fI , C 1 If ,f'U , 925. 'S k f'f I 'l ,:I ,L .. ' ' 5 U ,. F - 2. . '1' T- WI A All '.:, tr V ev' 5 ,ay I hx -all , , V j t t .' , jr ' ' v f , - , , ' 5355! - ' ' it I' 1 if-,,, 1 , . ,aw ,I ,. , it 3m..!!. fn teas: iw ' Icn ' 3 4, ' f, . V 4 ' - 4 A . ' ' A A f . 4: 32 .' .7 'PF 5,1 , , I , , : Y .V I .X x ,V eq, j' . Y ff 4 , W 1 U2 .ig . , . SHIRLEY, BRYAN A.: ME, Winchester, TN: SHIRLEY, CHRIS: PN, Greenville, AL: SHIRLEY, CRAIG: CPE, Greenville, AL: SHOULDERS, SCOTT: EE, Clarksville, TN: SINCLAIR, DONALD M.: PN, Birmingham, AL: SINGLETARY, ANGELA: PB, Orlando, FL: SIZEMORE, KIM: PN, Flat Flock, Al.: SKINNER, RANDY: BSC, Jacksonville, FL: SKINNER, ROBERT: PB, Moreland, GA: SLAUGHTER, LINDA: GC, Auburn, AL SLAY, MICHELLE: MT, Birmingham, AL: SMITH, BARRY: GC. Birmingham, AL: SMITH, GEORGE: CHE, Mobile, AL: SMITH, KIMBERLY: EEC, Brewton, AL: SMITH, REGINA: CS, Huntsville, AL: SMITH, SUZANNE B.: GC, Phenix City, AL: SMITHERMAN, SHELLEY: PB, Auburn, AL: SNIDER, ALAN: EE, Anniston, AL: SNIDER, EARL D.: EE, Birmingham, AL: SNODDY, MONICA L.: NS, Athens, AL SORRELL, JOHN KEITH: CS, Lanett, AL: SPEAKS, STEVEN: PN, Montgomery, AL: SPEARS, CAROL: VAT, Birmingham, AL: SPEIGHTS, SALLY: GC, Montgomery, AL: SPENCE, TIM: EE, Roswell, GA: SPIDLE, AMY: PG, Anniston, AL: SPIVEY, JOE: CPE, Centre, AL: STALLWORTH, LISA: CPE, Auburn, AL: STANLEY, EDWIN: PN, Ft. Payne, AL: STEPHENS, RICHARD: CHE, Montgomery, AL STEVENS, PAMELA: FM, Atlanta, GA: STEWART, JULLIE: CPE, Toms River, NJ: STEWART, KELLY: NUR, Piedmont, AL: STRICKLAND, DAVID: ADS, Wetumpka, AL: STRINGER, SHARON: PB, Signal Mt., TN: STROUP, JULIE: GC, Nashville. TN: SUBLETT, BETH: AEC, Brownboro, AL: SUTTON, GARY: PB, Helena, AL: SWANSON, ANDY: DH, Nashville, TN: TAUTON, ELIZABETH: PB, Birmingham, AL TAWATER, PAM: SW, Chattanooga, TN: TAYLOR, NANCY: MC, Hartselle, AL: TAYLOR, SHARON: CJ, Evergreen, AL: TAYNTON, ANNA RUTH: VAT, Lake Park, FL: THOMAS, LAURA: CEE, Lalayette, AL: THOMAS, MILLIE: GC, Millbrook, AL: THOMAS, SCOTT: GC, Auburn, AL: THOMPSON, MARY DOUGLAS: FM, Montgomery, AL: THORNE, REBECCA: EEC. Jasper, AL: TIDWELL, LINDA: GC, Atlanta, GA TRAMMELL, MONICA: PM, Hartsville, AL: TRAVIS, LAURA: NS, Birmingham, AL: TROTMAN, RONNY: CPE, Montgomery, AL: TURNER, JAY: MED, Birmingham, AL: TURNER, MARGUERITE: PV, Pensacola, FL: UNDERWOOD, SHERI: LT, Newnan, GA: UNDERWOOD, TERRY L.: GC, Eastaboga, AL: USALAVAGE, SAMMY: BSC, Tucker, GA: VANHORN, VALERIE: ID, Brooksville, FL: VARAGONA, RENA: PB, Birmingham, AL VARNER, STEVEN: PN, Birmingham, AL: VAUGHN, JONATHAN: PN, Montgomery, AL: VERBITSKI, JOHN: PN, Montevallo, AL: VERNON, JUDY: PN, West Palm Beach, FL: VICKERY, SUSAN: GSW, Birmingham, AL: VONDRACEK, MARIANNE: ADS, Jacksonville, AL: VONFELDT, DEAN: AR, Troy, AL: VREDENBURG, WILLIAM: AM, Winston Salem, NC: WAGONER, ERIC: PN, Stone Mountain, GA: WAKEFIELD, SARA: PB, Pulaski, TN WALKER, BENJAMIN: EE, Maxwell, A,F. Base, AL: WALKER, JAN: PN, Jackson, AL: WALKER, KIMBERLY: PS, Clarksville, TN: WALKER, SUSANNE: CJ, Atlanta, GA: WALKER, SUSIE: EEC, Auburn, AL: WALLACE, KELLIE: FY, Miami, FL: WALLENFANG, CECILIA: PY, Huntsville, AL: WALLER, KATHE: NUR, Birmingham, AL: WARD, LEISA: GC, Geneva, AL: WARREN, HAROLD: PN, Homewood, AL WARREN, MICHAEL: MH, Fayetteville, NC: WATKINS, DENISE: AR, Norcross, GA: WATSON, CARI: CHE, Auburn, AL: WATSON, TOM: AB, Johnson City, TN: WEBB, GENIE: LT, Evergreen, AL: WEBB, JIMMY: PN, Atlanta, GA: WEBB, ROBERT A.: GC, Birmingham, AL: WEIGEL, SUSAN: MT, Palatka, FL: WEINSCHREIDER, DAVID: AFI, Birmingham, AL: WEITLAKE, RICHARD: PN, Montgomery, AL WELTZ, CHRIS: ME, Tampa, FL: WESLEY, FRANKLIN D.: TE, Sylacauga, AL: WESSON, JANET: AC, Tallassee, AL: WEST, RANDY: PS, Huntsville, AL: WESTHOVEN, AMY: HPR, Birmingham, AL: WESTMORELAND, ELIZABETH: AC, Florence, AL: WESTROPE, DREW: CS, Huntsville, AL: WHATLEY, SHERRI: ID, Evergreen, AL: WHITTINGTON, FLORE: HF. Eufaula AL: WICKWIRE, JULIE: GC, Huntsville, AL WIELLETT, MICHAEL: lNM, Memphis, TN: WILKERSON, KERRY: AE, Huntsville, AL: WILLIAMS, ANNE: PN, Verandina Beach, FL: WILLIAMS, JILL: CS, Satelite Beach, FL: WILLIAMS, JULI: PM, Knoxville, TN: WILLIAMS, PAIGE: PM, Demopolis, AL: WILLIAMSON, LESLIE: GC, Ft. Walton, Beach. FL: WISENER, RHONDA: CHE, Birmingham, AL: WOHLERT, LEIGH: PM, Mobile, AL: WOOD, ERIC: AE, Conyers, GA WOODARD, LYSA: EEC, Alexander City, AL: WOOLBRIGHT, DEBORAH: PN, Cocoa, FL: WOOTEN, LYNN: PB, Anniston, AL: WYATT, BECKY: PB, Birmingham, AL: YATES, RUSSELL: ME, Hermitage, TN: YEAGER, MICHELLE: FM, Lilburn, GA: YOUNG, BETSY: PB, Riverdale, GA: ZEIGLER, FRANK: HY, Anniston, AL: ZITO, MICHAEL: PL, Birmingham, AL Freshmen Greeks ,ff A V ' - ' -5 ' , . r. 1 ' A is . at ,- A A - L : . -1 - A W ' u.. ' i f -3 : Y -N ,::.f'3l' I ' i ,g QNQN 1 - f :f gf: . is . - J , A , xg A to 22 2' f':f -'Q -ff , 2 ,,:.,, - , ' ' r ' 'A , . x fs - Xa 1, ' N , L -6 V W A , s- -1 Sr ..1::' A . L Iv ' .1 t ' fc. ,i 1 ,Q , ,. . , KM A - ' , ,F - 5 ' ffl? E 4 3 fit. I I , .fr ' III' ' I :' 1 -, -L ' -3 . - ff '- :I r -t '- - 15 J 1 3,29 , . 5 . 1, I , 1-- , , A 1 I 5 ' , , an-SQ , 2: H .5,,:g1- ' 1 :::i:f-'- Q ,Aw , 1- -.q.. ,,gsgrf. : ' 'Q 'f hi f P if gi, if :- f ' ' ' A 1 Q N R , - .. A ' ' ' I 1 as ,. . .af . . L. L ggi ,A , , , . i . 1 X P A. , X . .. ,V N g is I . A A 5 , g , L, if - f' ' gg f ' ,Q , lg , Wg. 1 , . I .Y ' ' ' .t K4 , , . ii' ,- v i 'b -w A : X K ' 'if 2 : L A it - ag , , N - E 1 L t W A, ' Qisgrf , f , . f - xx f - A ' A . f '7 A, ,L .1 ' Q' A . . , f , AB, , is-in -ai, ' 1 Xe, , U, , V K K y . X 5 . Thi s , 'Eu .. ,. 'F A A Q 5 ii r 5 -, ram, - if , r A tl? . , ' ' L ' - A S' ff-ff, ' a i . A L .T B , t . .A . .. ... . L A . - . , 2 - .. - .riff fs:-5 , . L -fi' l - - r I - f ' if A 'WE A A R' ,L , if , , , .,., , in A A T - , . K, t .. . - - ? -A Aa, , an I 1 ,N - - . , aa. SUSAN BROWN ANDERSON, BETH: XX QPRS, Montgomery, AL: ARNOLD, JULIE: SACF, Daphne, AL: ATNIF, SHEILA: 3NS, Huntsville, AL: BAILEY, LAURA: 2GC, Huntsville, AL: BARBAREE, CINDY: 4lNM, Gull Breeze, FL: BARBER, DARLENE: 2NS, Montgomery, AL BARRV, DONNA: AENH, Tallahassee, FL: BELLUCHIE, LESLEE: 3ME, Montevallo, AL: BENTLEY, BITSY: ZSRSS, Hazel Green, AL: BERNSTEIN, KELLY: 3NUFl, Montgomery, AL: BEST, PAULA: ARSC, Brewton, AL: BOETTGER, KAREN: 3AC, Dothan, AL: BOLTON, KRIS: 2CS, Satellite Beach, Fl.: BRACKIN, LISA ANN: tECE, Geneva, AL BRADSHAW, KATI: 1PN, Dalton, GA: BRADY, RENEE: ZPB. Marion, AL: BRITTON, GAYLAN: 1ECE, Titus, AL: BROWN, CATHY: SCJY. Daphne, AL: BROWN, LYNN: AMK, Andalusia, AL: BROWNING, LYN: 3TN, Cordele, GA: BULLOCK, KELLY: 4lD!AFt, Montrose, AL: BULLOCK, STACEY: tECE, Montrose, AL CARRA, MARCELA: 3Cl-IE, Tampa, FL: CARTER, THERESA: 21E, Daphne, AL: CAVE, CATHY: 4AC, Vicksburg, MS: CHUMNEY, SELENA: SGPG, Apalachlcola, FL: COOK, LUCI: TFISS, Milledgeville, GA: CORLES5, DONNA: TGC, Auburn, ALI ELLIOTT, ANGELA: 1LT, Dothan, AL: FULLER, MARGARET: 41E, Montgomery, AL GAGE, KARIN: 2PFlS, Longwood, FL: GIBSON, ALICIA: lGC. Granger, IN: GODBOLD, LAURA: ZBSS, Birmingham, AL: GRANT, SUSAN: lCSM, Falrhope, ALI GRAY, LAURA: 4CPE, Fort Walton Beach, Fl.: GREENE, KAREN: APY, Saraland, AL: HAFERS, MICHELLE: 4TN, Dothan, ALL HAIRSTON, ELIZABETH: 4CS, Daphne, AL HAIRSTON, SUSAN: 2HFlA, Daphne, AL: HARDY, PAT: 3GEl-i, Beauregarcle, AL: HARGROVE, PAM: 4HA, Madison, AL: HARLEY, LORRAINE: ACDP, Bartow, FL: HARRELL, DONNA: SPIR, Ft, Myers, FL: HARRIS, JENNY: APY, Enterprise, AL: HARTLEY, PAM: 1GJM, Alexander City ,ALL HERREN, LAURA: lPPY, Arab, AL HERRING, LAURIE: AGHY, Dothan, AL: HILL, LEIGH: lGC. Montgomery, AL: HOLT, SHELLI: 4AC, Montgomery, AL: HORTON, PENNY: 1FCD, Huntsville, AL: HOUSEMAN, BETSY: 1FtSC, Orlando, FL: HOWARD, CINDY: 3AC, Huntsville, AL: HOWELL, ROBIN: ARSB, Marietta, GA: HUDDLE, NANCY: 3VOA, Atlanta, GA HUFFSTUTLER, LISA: 1GC, Leeds, AL: HUTCHINSON, LEIGH: 2lE, Dunedin, FL: HUTTO, SUSAN: 2PB, Marietta, GA: IRWIN, DORIS: 4CS, Huntsville, AL: JACKSON, ANDIE: SPB, Huntsville, AL: JACKSON, JANET: 1GC, Montgomery, AL: JONES, CATHY ZRSC. Mobile, AL: JOYNER, LORIE: 1GBl, Stone Mountain, GA KRACKE, KAREN: AVBU, Panama City, FL: KUCI, CAROLYN: 3OMN, Cherry Point, NC: KUSNER, FRANCESCA: llFE, Cullman, AL, LAKE, JENNIFER: lGC, Phenix City, AL: LANDERS, CARI: 1PB, Huntsville, AL: LANDWEHR, LISA: SCPE, Huntsville, AL: LAYFIELD, MELANIE: 1GC, Macon, GA: LEDBETTER, DONNA: 4lNM, Prattville, AL LOBNITZ, KATHIE: 2FCD, Orlando, FL: LOGAN, EMILY: 2CW, Huntsville, AL: LOGAN, KAREN: 1PRJ, Orlando, FL: MADDOX, CHRIS: ACDP, Sarasota, FL: MANSON, MARY: ACE, Knoxville, TN: MCALISTER, SHARI: AGPG, Alexander City, AL: MCELLIGOTT, DEBBIE: 3PB, Daphne, AL: MCGOWAN, CANDIS: AMK, Stockton, AL MCKINNON, EMI: SGPG, Roswell, GA: MCMAHAN, KELLIE: 1PEl, Decatur, GATMCOUEENTLUCY: 4CJ, Hayneville, AL: MOFFET, BAMBI: 1FiSS, Huntsville, ALI MONK, MARY: APY, Homewood, AL: MONTALTO, LAYNE: 1PL, Trussville, AL: MONTGOMERY, LEISA: 4CTC, Reynolds, GA: MOORE, PAM: 4RSS, Atlanta, GA MURPHY, KIM: 4PF?S, Nashville, TN: NEESE, DIANE: 1PHS, Spanish Fort, AL: NEWMAN, CATHY: 1PB, Dunwoody, GA: NORTHAM, SUZANNE: 2PN, Mobile, AL: PANNONE, MITZI: 2VAT, Montgomery, AL: PATTON, MARLENE: AOMN, Montgomery, AL: PAUL, BETH: 2FCD, Columbus, GA: PEASE, FRANCES: ZCEE, Manchester, GA Axrz 255 POPE, LAURA: 2PB, Atlanta, GA: PRIDGEN, LYNN: 3lE, Bay Minette, AL: REGAN, LISA: SVBI, Wetumpka, AL: REMKO, DANA: iHA, Montgomery, AL: REYNOLDS, KELLY: 3HA, Point Clear, AL: REYNOLDS, KIM: ACPE, Auburn, AL: REYNOLDS, PEGGY: 2PT, Auburn, AL: RIADON, YVETTE: 1PV, Hendersonville, TN: RICHARDS, KIM: 4GSC, Cocoa Beach, FL: ROBINSON, GINGER: 1GC, Wetumpka, AL ROBUCK, SUE: SPBS, Atlanta, GA: RUSSELL, DAWN: iPN, Hendersonville, TN: SATTERFIELD, AMELIA: 2GC, Lineville, AL: SCARBROUGH, JANICE: 3FLT, Maitland, FL: SCARBROUGH, JENNY: SFLT, Maitland, FL: SEWELL, GENEA: tPM, Montgomery, AL: SHAW, MELISSA: 5LPO, Huntsville, AL: SIDES, ANDREA: SECE, Helena, AL: SIMMONS, FELICIA: 40MN, Huntsville, AL: SMITH, CARRIE: IPB, Huntsville, AL SPENCER, LORI: 1PL, Sarasota, FL: STARK, TALITHA: lTE, Montgomery, AL: STEWART, STACY: 2PB, Dunwoody, GA: STOLL, BETH: 2F'B, Tampa, FL, STROTHER, SHERRI: lPPY, Opelika, AL: srnozien, SUZANNE: icsw, Birmingham, Ai.: TATOM, JAN: 1CPE, Montgomery, AL: VAN ARKEN, MELISSA: 1PN, Montgomery, AL: VAN FELT, JANIE: 2PB, Atmore, AL: VENABLE, ALLISON: 2Pt, Hendersonville, TN VENTO, NOREEN: IPY, Huntsville, AL: WALLACE, HOPE: SID, Dothan, ALJ WATSON, KAY: 2CME, Monroeville, AL: WEBB, LISA: 1GC, Birmingham, AL: WILBANKS, PAM: 1HA, Montgomery, AL: WILLIAMS, JULIE: 2HA, Spanish Fort, AL: WITTER, ROBYN: 2ME, Lansing, Ml: ADAMS, CHRISTINE S.: 4F?SB, Birmingham, AL ALFORD, MAGGIE: SPFIJ, Dothan, AL: BARNES, JULI ANN: ZNUR, Dunwoody, GA, BARNES, LISA M.: 2PB, Cullman, AL: BEALLE, BETTY A.: 4PlR, Atlanta, GA: BEASLEY, MELANIE KING:1PB, Nashville, TN: BELLSNYDER, BETH: SNUB, Birmingham, AL: BENTON, AMORY: 4FCD, Birmingham, AL: BETHUNE, ANN E.: 2AC, Birmingham, AL: BLALUCK, JIL COLLEEN: SHA, Lakeland, FL: BOLTE, PAULA:4lD, Brentwood. TN BOWEN, BECKY: SCEC, Stone Mtn., GA: BOYD, NANETTE LOUISE: 2FCD, Montgomery, AL: BOZEMAN, MIKI DARLENE: 3SC, Hayneville, AL: BRANTLEY, JODIE ELAINE: SCEC, Dalton, GA: BRICE, LINDA JO: 2AC, Birmingham, AL: BRYANT, ELIZABETH LEA: 1NUFt, Tallahassee, FL: BRYARS, AIMEE:1PV. Bay Minette, AL: BYRD, ANDIE: IGC, Dothan, AL: COOPER, DONNA GAY: 1GC, Huntsville, AL: COX, SUSAN TERRY: ZEPL, Bradenton, FL CUSICK, KATHY LOUISE: IPM, Orlando, FL: DANIEL, DAWN: 2FLT, Perry, GA: DECKER, ELIZABETH S.: 2Vl-IE, Shelby, NC: DEMKE, JANET LYNN: 3PB, Dothan, AL: DOVERSPIKE, BETH ANN: INUH, Huntsville, AL, DRAKE, KATY H.: iNS, Birmingham, AL: DUDLEY, DONNA CAROLYN: lGC, Opelika, AL: DUNCAN, NANCY C.: 4FCD, Orlando, FL: DUNSETH, SANDY LYNN: 2lD, Dothan, AL: ELLIS, ELLEN M.: 3MK, Fl. Deposit, AL ENSEY, R. ANN: ZPRJ, Birmingham, AL: ERVIN, DEBBIE LYNNE: 2CEE, Tallahassee, FL: FLOUNOY, CAROL D.: 4FCD, Birmingham, AL: FOWLER, CHARLOTTE ELAINE: 3FM. Montgomery, AL: GAY, KATHERINE CARSON: 4FM, Daphne, AL: GILBERT, VANESSA E.: ANUFI, Dothan, AL: GILCHRIST, CINDY K.: AFCD, Birmingham, AL, GODWIN, SUSAN ELIZABETH: 2FM, Decatur, AL: GORDON, TERESA LYNN: 4FLT, Birmingham, AL: GRAHAM, LINDA GAYE: tCEE, Jackson, TN GRAHAM, M. LEVIAN: 4CSF, Jackson, TN: GRANBERRY, JENNY: WGC, Montgomery, AL: GRANTHAM, STACY DENICE: 4PRS, Columbus, GA: GREEN, TRINA M.: 3PO, Woolsey, GA: GRESHAM, CAROLE LEIGH: 1OA, Decatur, AL: GRESHAM, MELISSA LYNN: SGSC, Decatur, AL: GRIFFIN, GINGER: APB, Birmingham, AL: GROVE, TRACY RENEE: lPB, Lakeland, FL: HAMRICK, TERRI LYNN: ARSS, Bainsville, AL: HARRISON, CECI SANSON: ARSM, Birmingham, AL HASKEW, LYNN: 3CEE, Birmingham, AL: HASSELL, TERRI LYNN: ZPBS, Hoover, Al.: HAWKINS HOLLY DEAN: SCSM, Troy, AL: HAYNES, LESLIE SUE: SAR, Hinsdale, lL: HENDERSON, ELISE: lPN, Alexander City, AL: HENDRIX, ALISON E.: 4MK, Muscle Shoals, AL: HENRY, JILL CHRISTINE: 4AC, Montgomery, AL: HOLLEY, SUSAN L: 1NUFl, Alexander City, AL: HOLMAN, HADEN: 1AR, Dothan, AL: HOLTZINGER, KIM: ARSB, lndialantic, FL HORTON, LAURA LOUISE: 2PF'Y, Decatur, AL: HOWARD, KATHRYN JEANETTE: 2FLT, Enterprise, AL: JACKSON, ALISON MARIE: SFM, Huntsville, AL: JOHNSON, SANDRA KATHRYN: ZCSS, Scottsboro. AL: JONES, CYNTHIA M.: 4MK, Griiiin, GA: JONES, JANE KIMBERLY: SFM, Columbus, GA: JORDAN, ANGELA SUZANNE: 1PN, Montgomery, AL: JORDAN, RENNIE: APIR, Montgomery, AL: KEATON, SUSAN LYNN: Z3NF, Columbus, GA KELLY, NANCY ELLEN: APB, Atlanta, GA: KENNEDY, ANN MARIE: ZFM, Orlando, FL: KILLIAN, MOLLY KATHRYN: WPB, Auburn, AL, KING, DEBBIE ANN: 3MT, Atlanta, GA: KIRKPATRICK, BETH: 3FM, Birmingham, AL: KLING, LYDIA: 2NUFl, Birmingham, AL: KREIS, EDIE ADAMS: 2CEE. Birmingham, AL, LAHMAN, LAURA ANN: 2PM, Lakeland, FL: LAMB, LAURA ANN: 4HA, Macon, GA: LAMB, SUSAN LESLIE: 1GC, Macon, GA 256 Axn -Aan ' WF' ' ..,,.W .., we 51- . L - XY :Qs it, if S3 t S 35 S: ,E ski sg ,Ari N . L., iss A is N Q L . Y WN I J 1 :fl 1155 r:.'f-:- 2' ' K an 'i 4? T ' I' QS. - we Q w -vit - A :ei-2 , Sf Y . f:'e,Feff ,.!5e .- 1.-A.: 1 ' - - we - X ' 311- , i-, xlfr ,, - - sg.. . if ,. - L , ,, . . : i -A - ,. 1 A si - ' -. - - SQ . J - - . , r Y - 1 A 3 Q. i as . L , , 1 ' I -' ' . . gag, T 9 h 4' 5 ' , ,E i- : 4 --': L r 2 A ' ,- 'FF S se. ieaezz i ff , r .- . A V3 waf i h T w,g,.f N A f L ttr,f: .L t :' - X i'ti'I I J Q I A A A ' . I A , .,.. .qi , by . ., s- 1 ' X xx A H ,Y I if . T' 4. s I i ..'k 4 Q Q .Q f in ,, . - I 5, Ss' f Q T' N 15' A Lust' te I - I est . , ,f, :ee as : the e,. g..- ,Q ' --f. . I .2 y I I , 1 'lay , L is :f f x I 5 . A i . A I A ssrs A I sississ A A A - A stsss t , , - g :I A Lf' , 1 ii- 4- ' A. - . A ' ' ,gy ,fr wi Vx I ie- X , if G5 I , K QR J , ,. . .. ,,,. sy V 'gt we k :fi - L . ' ' if f , -P f ' ' ., ,Q :aft sea: , Hifi Af few 3 : A 4 il' L , .Egg ..,. ,, ,.,. ,e,Egw ,, Q i'BB , : : is ft, y Q. fy' Q g va. 4 is ' : 2 - Lf' ,r..r fl I A Pg, r w.,l A 1 - 'ite A-Q ' A Q r . 1? B ' 75, - . if A . , , 4 A. . N 1-K 5, ifisi- , l I I l we L .A Q -4, Q L4 , I Q f if 1 ff Q I 7 4 w :- r I E l S I X Q ,,,x. . ,..x 2 .. -, X s - , ' ' :K Ak- :X .. 5. X: K , ., 1 , 4 K 1 :-fri: , ' ,m W aw -r Sa W . V - - 'iiiflr av .4 A--f f S 2 iffx Qi: A f 'N . ' ,s wam 1 g z '- Qc? i I' A g f ff x , I 11: I 'Z ' 5 s. 3 .ivy-:. - N: - J i.. . Y? Q .N -1- Q A ,f , fr Q Q ,Q , 4 .. . . ef 4 9 V- . .f,, ' 1 . Q .., 'Ii W , -' ff' 1g . ' V ff, 2 'f ' 7:4555 f 5 V,.. , i.. I fl' a ' an - . ,r . vi 'TUX 5 My '.,, ,R I : , .W . 4- W ,A fr jg' Wi. 3- .,. ,Z Q X , , ,Q V L A, , M' V .V 1 i f A V . ,, Sw: Y F' - ' ' A , : : K 7 , QW A 2 ' f , A ' -+ f' ' F f-ff 1 X 1, , H y , . , U 'Qi 'J ' r . '31 fuk . -. . ,- f - ., 2 +.- A - f lV'l'if5: l2 K f V ' ? if 7 HJ: 5' Z I 'i 'W 'If db F-. .5 r ii '. K t , L, , Q I ,, J N, , g,,k , I . , ,m,, ,V L ., . ,M N., ,. .Y ,. g , ,Q ,yi ' fs - fi- ? ai: , I ig' .3 f 411 4 , I 3. ,-3, in '- -1 ' 'ei' ' i f , . . , .- I ' xr I , rw 1. ga- s ., -' X A 1 r r , M, ' .f, ,f 'tg f ' V , ,, i I ,. :RWM ' ' 'f ' ' , E if 'M I I L A f ef: , . LANGFORD, SUSAN LYNN: ZPBS, Pike Fload, AL: LEDBETTER, TONI ANN: 2PG, Birmingham, AL: LEWIS, LORI ELIZABETH: SPUB, Greenville, AL: LOONEY, DONNA LYNN: IGC, Decatur, AL: LYNCH, FRANCES KAY: 3PY, Auburn, AL: MAST, JENNIFER KARI: ICEE, Atlanta, GA: MCDONALD, BETSY: 3ID, Montgomery, AL: MCGOUGH, DANA LYNN: 1GC, Fort Deposit, AL: MCLAUGHLIN, MINDY LEE: SCEE, Pelham. AL: MCRAE, MELANIE: 2AG, Monticello, FL MCUMBER, JULIE T.: IPPY, Montgomery, AL: MELO, SUZY MARIE: 4PRS, Tampa, FL: MITCHELL, JOANIE A.: 3FM, Columbus, GA: MONEY, TERRI LYNN: 4ECE, Atlanta, GA: MORGAN, LAURA LEE: 3PM, Auburn, AL: MOTTICE, LINDA KATHLEEN: SFI, Tallahassee, FL: NABORS, CINDY: SMH, Decatur, AL: NAISMITH, KATHERINE OUINN: SSCR, Savannah, GA: NEIL, BUNNY: 3PB, Fort Worth, Texas: NIX, DENISE A.: IFLT, Decatur, AL NORRIS, CELIA ELIZABETH: 3CEE, LaGrange, GA: NORTON, LAURA LEE: 4FLT, Roanoke, AL: OLSON, DIANNE MARIE: 1PN, Montgomery, AL: OWEN, LYNNE: 2AC, Dadeville, AL: OWENS, LETIA L.: AGJM, Birmingham, AL: OWENS, REBECCA ANN: IAR, Birmingham, AL: PARKER, DENISE ESTELLE: SCEE, Dalton, GA: PARRISH, LYDIA: 1NS, Montgomery, AL: PAYNE, JILL LYNN: 3PFlJ, Columbus, GA: PEARCE, VIRGINIA THOMAS: 2PIR, Birmingham, AL PERKINS, LINDSEY NORREL: IPL, Birmingham, AL: PIPPEN, SUSAN RENE: 2FE, Montgomery, AL: PREWITT, DEBBIE ANN: 2VAT, Decatur, AL: PROCOPIO, LISA MARIE: IGC, Dunwoody, GA: PROFST, AMY: 3PFlS, Atlanta, GA: REEP, SALLY ANN: 3NUR, Birmingham, AL: REID, TERESA GWEN: 4CEC, Moultrie, GA: RICHARDSON, LEIGI-I ANN: 2FM, Birmingham, AL: RICHARDSON, TRACY: AGSC, Birmingham, AL: RIGGS, BRENDA J.: 2PT, Stone Mountain, GA RINALDI, LAUREN CLAIRE: 2CEE, Tampa, FL: ROBERTS, KIM: INUFI, Birmingham, AL: ROGERS, JULIE E.: 3PY, Auburn, AL: ROGERS, NATALIE R.: IPB, Auburn, AL: RYAN, LYNN D.: SGSC, Atlanta, GA: SAUNDERS, TAMMY: ZNUR, Birmingham, AL: SAVOLDI, SUE L.: 2PB, Birmingham, AL: SHEFFIELD, JOAN DIXON: IGC, Dothan, AL: SIMS, SHERI E.: 2NUR. Decatur, AL: SIR, MARY BRYER: 2PB, Roswell, GA SMITH, JULIE ALISON: AFCD, Opelika, AL: SMITH, LANA: Al-IPR, Hamer, AL: SMITH, SARALYN GREENE: 1GC, Auburn, AL: SMITH, T. EDITH: ANUR, Opelika, AL: SOUTHARD, APRIL LYNN: 3VAT, Birmingham, AL: SPORT, LEIGH: 4NUB, Montgomery, AL: STAPLETON, WHITNEY ANNE: 2NUFl, Fairhope, AL: STEISS, SHERI E.: IAB, Tampa, FL: STRAIN, ANGELA MARIE: SGC, Richmond, VA: THOMAS, CYNTHIA ANNE: 2PT, Columbus, GA THORINGTON, LAURA ANN: 4MK, Tampa, FL: THORNTON, CYDNEY MACHELE: INUB, Auburn, AL: TUCKER, SUSAN C.: SPIR, Huntsville, AL: TYNER JAYNA BETH: INS, Birmingham, AL: UNDERWOOD, MARY BESS: ZNS, Decatur, AL: VANN, MARY GEORGIA: 4AC, Camilla, GA: WALLER, BARBARA JO: 1PN, Birmingham, AL: WALTON, MARGOT CLAIR: 2MK, Alex City, AL: WARREN, JULIE ANN: AFM, West Palm Beach, FL: WATSON, ABBY T.: IPB, Dothan, AL WHATLEY, JILL E.: 2AC, Barrington, IL: WHITTLE, ANGELA: 4IFE, Hayneville, AL: WILSON, BONNIE LUANN: 3TMT, Alexander City, AL: WINTERS, DEBORAH JEAN: IPB, Opelika, AL: WOODS, BETH: 2NUFl, Cohutta, GA: YATES, MARICILE: 2PRS, Woodland, AL: YOUNGS, MARTHA ANNE: AFI, Lakeland, FL: ZACKRISON, CHERYL ANN: SCHE, Mobile, AL ALLEN, LISA D.: ICS, LaFayette, AL: ALSPOUGH, LIZABETH ANNETTE: SCJL, Lithonia, GA: BAKER, FRAN: GPB, Eulaula, AL: BAKER, GINGER, L.: 2PM, Montgomery, AL: BARKER, ANITA LEE: SCEE, Birmingham, AL: BEAZLEY, ALISON S.: 2lD. Montgomery, AL: BENNER, SUSAN F.: SCEE, Birmingham, AL: BLACKMARR, BETH ANN: AAC, Dothan, AL: BODET, CECELIA A.: 1NF, Mobile, AL: BONNER, CLAIRE: 2CS, Roanoke, AL BRABSTON, LISA G.: 2PB, Mobile, AL: BRICE, KRISTEN HARBOUR: 3EEE, Decatur, AL: BRIDGES, LINDA: AAC, Birmingham, AL: BROWN, JENNY LANE: AFISS, Jasper, AL: BROWN, SANDY: 2CEE, Florence, AL: BURNHAM, BONNIE LYNN: 1Cl-IE, Dothan, AL: CARTER, KIM: 4HPR, Troy, AL: CHRISTOPER, LISA ANN: 4PIFt, Huntsville, AL: COBB, PATRICIA W.: ZPPY, Scottsboro, AL: COLLISTER, SHARON ELIZABETH: 2HA, Montgomery, AL COLOUITT, CAROL ANN: 3EC, Birmingham, AL: CONNER, MINDY J.: IPN, Auburn, AL: CONRY, ANN MARGARET: SAC, Birmingham. AL: COPELAND, LISA KAY: ARSS, Oneonta, AL: COX, DOTTEE: 3VAE, Birmingham, AL: CRANFORD, AMY HELEN: TGC, Birmingham, AL: CRAWFORD, KAREN E.: 3AC. Gallion, AL: CRAWFORD, KELLEY LYNN: 1PB, Gallion, AL: CRUTCHER, JULIE H.: IPBS, Athens, AL: DELANEY, CONSTANCE LYNN: 4AC, Orlando, FL DENNEY, LYNDA GAYE: 4MK, Gardendale, AL: DENNEY, PATTI ANN: IPN, Gardendale, AL: DILLARD, BETH: ZPRS. Winter Park, FL: DODSON, MARGARET LEE: IGC, Birmingham, AL: DORSEY, LOU THAMES: AFCD, Opelika, AL: DUPREE, DEBORAH S.: AMK, Atlanta, GA: FARR, E. SUSAN: lVBU Opelika, AL: FERENCE, CATHY: ZGSC, Gainesville, FL: FINLAY, KELLY LAURINE: AIF, Albertville, AL: FISK, SALLY ELIZABETH: 4MB, Decatur, AL Aan-Am 257 FORD, TOMA L.: 2HRA, Auburn, AL: FOSTER, LISA: APY, Greenville, AL: FOWLER, BETTY LYNNE: 3PB, Troy, AL: FRAZIER, TAMI L.: IFLT, West Point, GA: GARRETT, GINGER E.: 2CEE, Birmingham, AL: GARRISON, JANIE RUTH: IGC, Gadsden, AL: GAUNTT, STACEY: 2NF, Montgomery, AL: GEPPERT, JUDI L.: 2PB, Mobile, AL: GLASSCOCK, LISA BETH: 1PB, Birmingham, AL: GREGORY, ELIZABETH ROWELL: 3PM, Troy, Ai. HAAS, KYM K.: IGC, Vestavia Hills, AL: HALSALL, TRACEY LYNN: 2PM, Tucker, GA: HAMNER, JEANNE CAROL: 2VHE, Fayette, AL: HARRISON, MISSIE: IGC, Mobile, AL: HART, H. ELIZABETH: ACEC, Pulaski, TN: HAUSER, ELYSE MICHAEL: 2PB, Panama City, FL: HAUSER, LAURA MARIE: IBOMN. Panama City, FL: HAYS, CHRISTI P.: AAC, Pulaski, TN, HEARD, ANN H.: IPFIS, Columbus, GA: HEGGEMAN, ALYCE MARIE: 4VAT, Mobile, AL HEREFORD, LEANNE: 2CHE, Faunsdale, AL: HESTER, HEATHER: IPB, Selma, AL: HOFFMAN, H. PAIGE: 2FLT, Fitzpatrick, AL: HOLMES, LAURA ANN: 4EH, Dothan, AL: HOWDYSHELL, DEBBIE DENISE: 3lFE, LaFayette, AL: HUFF, ELIZABETH SUSAN: 2PB, Birmingham, AL: HUGHES, BETH ELAINE: IEH, Montevallo, AL: HUNT, JENNY LYNN: 3CEE, Rome, GA: HUNTER, ALLISON HART: 4GJM, Lexington, KY: HUTSON, DEBORAH: 3CPE, Huntsville, AL HUTT, LISA ELAINE: IAR, Tuscaloosa, AL: IRRGANG, MARY JANE: 4AC, Orlando, FL: ISBELL, LISA ANGELYN: 3FiSS, Gadsden, AL: JAFFE, PATTY LYNN: 3PM, Talladega, AL: JAMES, JAN: 3AC, Atlanta, GA: JOHNSON, CHERIE: 4AC, Anniston, AL: JONES, JENNY L.: IFLT, Birmingham, AL: JONES, TERESA HALL: IPN, Montgomery, AL: KAMINS, JODY: IGJM, Mobile, AL: KELCH, STEPHANIE S.: BVOA, Palm Beach Gardens, FL KELL, MELANIE A.: IPN, Pascagoula, MSL KIMSEY, CARLA J.: 3AC, Guntersville, AL: KOHLER, LISA MARIA: 3lD, Mobile, AL: LANIER, E. CARROLL: 2EEC, Lanett, AL: LANIER, ELIZABETH T.: AEEC, Lanett, AL: LANIER, TARA ANNE: ZCEE, Valley, AL: LAWRENCE, SUZANNE ELAINE: ANUR, Birmingham, AL: LEMBCKE, KERI E.: IGC, Mobile, AL: LINDSEY, MOLLY KATE: 2PL, Montgomery, AL: LTYLE, SUSAN M.: SPM. Gadsden, AL MANCIL, MERRIBETH: 2NUFl, Montgomery, AL, MANLEY, KIMBLE: IBSS, Decatur, AL: MANN, LEE ALMOR: SNUFI, Birmingham, AL: MCCLURE, ALICE OLIVIA: 2GJM, Mobile, AL: MCCORKLE, SUSIE H.: 3FLT, Montgomery, AL: MCCRAW, LAURIE: SCFE, Gainesville, FL: MCCRAW, MARY E.: ICEC, Gainesville, FL: MCINNISH, ELIZABETH VICTORIA: 3VHE, Huntsville, AL: MCKNIGHT, LEAH D.: IMU, Eufaula, AL: MERRIT, NANCY KAY: AAC, Lanett, AL MIMS, ANNE M.: 2PN, Prattville, ALL MIMS, KATHRYN ELLEN: IGC, Prattville, AL: MINSHEW, LAURA ANNETTE: 2FFiM, Anniston, AL: MOORE, TERRI ANN: 3NUFl, Dothan, AL: MOSLEY, ELLEN: SPRJ, Ozark, ALJ MURPHY, AMY ELIZABETH: 2MH, Hartselle, AL: MYERS, KAYE: FLS, Montgomery, AL: NICHOLS, JILL: AFL, Gadsden, AL: NOLEN, DANELLE ALLISON: IPN, Clanton, ALL 0'DELL, DOLLY E.: SCEE, Prattville, AL 0'DELL, IVY LYNN: IGC, Prattville, AL: OMUNDSON, LAURA LEE: ANUR, Grilfin, GA: PARKER, PATRICIA L.: 4ADS, Enterprise, AL: PATE, GAIL: 3NUFl, Barkville, AL: PEAVEY, HELEN F.: 2CS, Gadsden, AL: POOLE, MARY HELEN: APIFI, Forest Home, AL: PROWD, KAREN LEIGH: IPRS, Chattanooga. TN: PRUITT, AMY E.: 2GC Lake Park, FL: REDDING, JANE: APO, Montgomery, AL: REISER, MARTHA TILLETT: 4AC, Birmingham, AL RICH, ROBIN ELAINE: APY, Gadsden, Al.: RITTENOUR, JEAN ANN: 3PB, Hope Hull, AL: RYAN, GINGER L.: 2NF, Birmingham, AL: SALMON, RICA ELIZABETH: AMBI, Auburn, AL: SANDERSON, LISA KAREN: SMK, Opelika, AL: SANSOM, SHERYL LUNN: 2FM, Luverne, AL: SAUNDERS, SUSAN: IPN. Troy, AL: SAWYER, MARIE DENISE: ZCEE, Spanish Fort, AL: SCHILLECI, KELLI DEE: AMK, Stone Mountain, GA: SCHLITT, GRACE MARGARET: 2AFi, Jasper, AL SHANAHAN, ANNE K.: 2EE, N. Palm Beach, FL: SHANAHAN, MARY EILEEN: 4MK, Palm Beach, FL: SHRERE, NANCY ELIZABETH: 2PB, Alexander City, AL: SLINGLUFF, MARY HELEN: IGC, Dothan, AL: SMITH, LAURA A.: AFCD, Huntsville, AL: SMITH, LAURA ESTES: IGC, Tallahassee, FL: SPEER, SUSAN DENISE: 4FL, Atlanta, GA: STALLWORTH, MARCIA: 2HA, Pine Apple, AL: STEPHENS, STEVE ANNA: ZLEC, Huntsville, AL, STRICKLAND, CATHY L.: IPL, Auburn, AL TATUM, JAMIE MARIE: 4FL, Huntsville, AL: THAMES, MARY ELIZABETH: AAC, Montgomery, AL: THOMAS, KRISTI LYNNE: IGC, Gadsden, AL: TUCKER, CHARLOTTE ANN: IPN, TrOy. AL: UPTON, ELLEN RUTH: IPN, Gadsden, AL: VEAZEY, SANDY: 2NUF'l, Guntersville, AL: VERNON, MARYA ROBYN: AVAT, Evans, GA: VICE, BETH: IAC, Montgomery, AL: WAGNER, LAURIE ELIZABETH: 2CS, Mobile, AL: WALTON, ALLISON ANNE: IFISE, Birmingham, AL WALTON, KATHERINE E.: 4TH, Birmingham, AL: WEBB, DEBBIE: IPL, Birmingham, AL: WELCH, LAURIN E.: IPB, Birmingham, AL: WELCH, LEILA LATHAN: 3AC, Birmingham, AL: WELLS, VALARIE RUTH: ZPBS. Montgomery, AL: WHITE, KATHRYNE ANNE: IGC, Auburn, AL, WHITE, MISSY: 2PB, Auburn, AL: WILLIAMS, B. ELLEN: CSMK, West Point, GA: WILLIAMS, JERRE A.: 2AC, Americus, GA, WILLIAMS, MARGARET MARY: IGC, West Point, GA 258 Am I , , in A - Q. ' ,fl , 'TTI 1,:,,,,, . , , VJKQV 5 -5, ' . ' in 1 i , 'f'-::' fl 1- .V ' L2 ' ' I, ' r :xo M- f f- ff , ,f ,, 1,4 ' I ' I I . fl, 9 Zz, A V V- f -1 ,ap f' A f- :ff-A. fa 2 ll I N, . , V A ,,, . ,. 4 , . .XL lf' -M' ' if fl S .11 V Y' Q M 5, A , V, QV I sr y 5 ji, . ,,V rf-: 1 fi V' V V A w Z fi 21 . IQ V. ' t , , , - ,f V W , V , , VV ,,,,,, V9 . VV , ,VV , g ' - . ,.r ,r , . wg , V V ft :gf ,if f,i Lf Q .2 , ,V 4 'C ,. Vi .f . I , 1. ' , A .,, M 'V 2 , V N : :V 1 ' 1 If S -,,, V f 11 'Q A, f , , ,X V 'g' V, ' , ,,,V V V I N A 2 E .. V . i J V , V . f V f ,f 'S I ' :Paz ' 2 2' f - -A . r : i x , ,.' av ,, , Q Z it , f VV A ,V V,,VsAV ,,,v,,,, Hi 121 .NX Y- . .. fr, V ,QV V , -..ji , - 1 A f- 4 1. I f af' 'I 43931, WAV, ,J 2 V .. X , , , V. , Q - ' f f ' Q f I V I V A ,JZ 7? J. .I V ' W ' nw if - . ap, V 3 Z, f V, , I ,,,, 1 f , f Q- ' ' ., -' 2 ww ffggigx I2 I' l . 1-. J ' . J? ' . 1 ,, ,, V A ,,,,,V, V ,V V, 1, if I ,V if . , . V, V fee: ,at V - V ,V , s. ' V, ff' 'Q' -A fyw, ' ' f : V ,Va a. ' ' . : . ,rg V . V ,V A 'Q . V,: , :,',,j I . gl VV , ,fr -f , 'fa : ,- '- A L .4 if 4 ,,,, . A- .Y ir -- Y, , 1 0-A tt n1 'f'., fr 3 1- ' ' , fr .t Aw,-. .- Q '- ,,,,, ,...f:1: f' 1: V - , . , ,V fa ' M . 'rf '. f , ' ' 's , ' A f.-' ,., 1 r r, . H 1 ' i -I f .r H r f A fr f 105, e:.r'z', 'ffroziafwj ' ' V :' ' . I , 3 7 7 X 'W m z P i f -ff' f 21 , ,AM ff' Tiff-, ,I .gm t , J ,,- ,-., v 1 -gm: ,Q 1 I in ,safe Y . g Wk ,M . if if if QW f X i X ,I 'a z :,i?f X f mf L zfx 'f 1 '-W'g M , H ,X V' , f . 4 'Q 2 i- 7 Z1 'Z , If , ,1,,, K , ,N,, gh , , , W W I Q Q ., X A, ZX : L, ,g ,.,, , ,Y I ,, Y ,fr W: 5 it 2 ,qgeefs f'W yy 'Z 9 x ,,, if I ' A X 6. ig W f I , . I , :,, , , L ie . :nf 4 I 2, if J vb A x f X Q27 1 ,- W , f ,, y , A is 4 4 3 f f 'F 4 ii- ,, L 1? 25 52 l ', WILSON, LOU ANNE: Bl-lFiA, Opelika, AL: WINGO, NANCY P.: 4EH, Birmingham, AL: WINKLER, ANNE M.: 4FLT, Huntsville. AL: WOOTEN, JOY ANNETTE: tPN, Decatur, GA: ALEXANDER, CHRIS H.: lADS, Cullman, ALL BASS, THOMAS RAY: 2AN, Montgomery, AL: BOND, MARK CARSON: 2FY, Selma, AL: BROWN, JAMES M.: AADS, Atmore, AL BRYANT, DAVID: 2PV, O'Neal, NB: CALLAHAN, WILLIAM MARK: 4FY, Jackson, AL: CHAPMAN, JOHN WILLIAM: 2FY. Sarasota, FL: DUCKWORTH, MARTIN A.: 3ME, Uredenburgh, AL: DUNN, ROBERT H.: 3AEC, Dernopolis, AL: ELLIS, DAVID G.: 4lNM, Montgomery, AL: FRAYNE, DAN: SAEC, Uniontown, AL: FRAZIER, JEFFREY LYNN: 3AEC, Greensboro, ALL HEREFORD, TREY N.: 1AEC, Faunsdale, AL: HORTON, EDWARD TAYLOR: 2lND, Aliceville, AL HUFFMAN, RANDY DALE: 1ADS, Auburn, AL: IRWIN, LAMAR: 3AY, Foley, AL: JACKMAN, JACK WILLIAM: 4lNM, Montgomery, AL: JOHNSON, CALVIN: 2VM, Auburn, AL: JOHNSON, MITCHELL BYRD: AADS, Auburn, AL: JORDAN LEE MARSHAL: tPB, Demopolis, AL: LINTON, LANE: AFYE. Auburn, AL: LOWE, ROBERT MARK: 2FYE, Jackson, AL: MAGNUSSON, JOE CLYDE: 2AY, Andmore, TN: NAMEN, BILL J.: 3PM, Jacksonville, FL OLSZEWSKI, JOHN LAWRENCE: lPB, Dempolis, AL: O'MARY, ARNIE A.: SAEC, Auburn, ALL OVERTON, DANIEL G.: 2PN, Grove Hill, AL: PATTERSON, GORDON DAVIS: QADS, Auburn, AL: PERKINS, KEVIN WYNN: 4lNM, Linden, AL: PETERS, JEFF J.: 3MTL, Jacksonville, FL: PETERSON, JOHN W.: 2CE, Elberta, AL: PETERSON, LANCE PERRY: 3WL, Decatur, ALI PETRICK, CARL: 3WL, Joppa, MD: PRUITT, THOMAS PATRICK: ACHE. Lake Park, FL RASLO, MARK A.: 3ADS, Jemlson, AL: RICKS, STEPHEN WATTS: 3WL, Pensacola, FL: ROGERS, GOODRICH ADUSTON: 2AY, Eutaw, AL: SIMS, GREGORY R.: 4AY, Fayette, AL: SIMS, JEFFREY F.: SAEC, Fayette, Al.: WEBB, ALAN CHARLES: SAEC, Phenix City, AL: WESTMORELAND, JOHN BENTON JR.: 1EE, Bridgeport, AL: WHITEN, CHARLES M.: SCI-IE, Hellin, ALI WILLIAMS, JODY G.: ZFY, Selma, AL: WOODWARD, ROSS: AADS, Aliceville, AL STEINHILBER, SISSY: Sweetheart: DANILSON, DEAN: Adviser: ACTON, KAY: SPBS, Birmingham, AL: ADAMS, ELIZABETH: 3PFtS, Huntsville, AL: ADKINS, SHERRI: 1NS, Dadeville, AL: ALEXANDER, LAURIE: AFLT, Atlanta, GA: ATKINS, CAROLYN: 4INM, Birmingham, AL: AVERY, KAY: SAC, Birmingham, AL BARTON, DEBBIE: SHPFI, Eulaula, AL: BAYNES, PAY: IVOA, Tallassee, AL: BENDALL, VALERIE: 3HSM, Birmingham, AL: BLACKWELL, ALESIA: 1PN, Huntsville, AL, BLACKWELL, ANITA: 1CHE, Huntsville, AL: BLANKENSHIP, ALLISON: lGC, Birmingham, AL: BOERNER, CINDY: 1lFE, Huntsville, AL: BOERNER, SUSAN: 3CEC, Huntsville, AL: BOSWELL, JANE: AIE, Huntsville, AL: BOWMAN, KELLY: 1PM, Gadsden, AL BROOKS, JUDILYN: 3CTE, Demopolis, AL: BROOKS, LYNN: 2lFE, Tuscaloosa, AL: BROWN, SHEILA: SCOP, Huntsville, AL: BRYANT, NANCY: 2HY, Mobile, AL: BRYANT, SHANNON: 2MU, Millbrook, AL: BURT, PIDGE: 2PB, Eclectic, AL: ROZELLE, BURT: 4MH, Anniston, AL: BUSH, MELODY: tl-lPFl, Tallassee. AL: BYNUM, KAREN: 3NUFl, Birmingham, AL: CALLAHAN, LYNN: 3CEC, Tallahassee, FL CARLISLE, KIM: lMDT, Talladega, AL: CARLSON, TRACY: 2CS, Union Springs, AL: CASEY, CHERIE: AFLT, Mobile, AL: CAULEY, ELIZABETH: 3FM, Monroeville, AL: CHILDS, RHONDA: IGPO, Phenix City, AL: CORE, JENNY: SPBS, Huntsville, AL: COX, ANNE: 3AM, Huntsville, AL: CRAIG, SUE: 4GSC, Birmingham, AL: CREWS, DENA: SPRJ, Wauchula, FL: CUSTARD, LEA RAE: 4FCD, Montgomery, AL DANIEL, SUSAN: 2PB, Stone Mountain, GA: DICKEY, PAM: 2AC, Birmingham, AL: DOLLAR, CATHY: 1GC, Huntsville, AL: DOLLAR, CINDY: 3GC, Huntsville, AL: DUNCAN, HOPE: tFM, Florence, AL: ELROD, CRISTI: SCSM, Montgomery, AL: EVANS, JULIE: 3lE, Hartselle, AL: FAUST, SUZANNE: 1PN, Atlanta, GAL FLOYD, MICHELE: AAC, West Point, GA: FLYNN, JENNY: 1VAT, Auburn, AL FORD, MEG: 2PB, Atlanta, GA: FOSHEE, RENEE: APIR, Huntsville, AL: FOSTER, JANE: 2PB, Lalayette, AL, FRANCIS, WENDY: 2VAT, Vestavia Hills, AL: GENTLE, NANCY: 1PB, Atlanta, GA: GEURKINK, CHRISTY: SPRS, Huntsville, AL, GOODWIN, KAREN: 4AC, Huntsville, AL, GOODWIN, SUSAN: 2PFiJ, Huntsville, AL: GORMAN, KATE: APRS, Huntsville, AL, GRIMES, KVLEE: SPY, Eutaula, AL GUCKIAN, DONNA: SPRS, Clearwater, FL: HAISTEN, ROBIN: SCFC, Birmingham, AL: HALL, ANGIE: ZPB, Montgomery, AL: HALL, KIMBERLIE: 2PN, Birmingham, AL: HAWKINS, PAM: AFLT, Birmingham, AL: HAWKINS, PATTI: 1FM, Birmingham, AL HEETLAND, PAM: ZFCD, Plantation, FL: HORTON, FAM: SBSB, Birmingham, AL: HOWARD, TRACIE: 1lD, Marietta, GA, NUGGINS, CINDY: lPB, Huntsville, AL AI'.X-AI'I'-Ailll 259 HUNTER, LYN: BACF, Huntsville, AL: HUTCHINS, KAYE: lPCN, Huntsville, AL: JUDGE, BETTY: 1PB, Boca Raton, FL: KELLEY, DEDRA D.: SMK, Mobile. AL: KEY, MONIQUE: AAC, Jasper, AL: KIMBROUGH, JERRE: 1GC, Russellville, AL: KING, MELODY: 1CEE, Montgomery, AL: KINZER, KATHLEEN: 3lB, Auburn, AL: KIPPS, SUSAN: SNS, Talladega, AL: KITELEY, KATHY: 2PN, Auburn, AL KULAS, KIM: SPRS, Huntsville, AL: LANE, GINNY: 4HRA, Opelika, AL: LANGLEY, LAURA: 1PN, Birmingham, AL: LEATH, LORI: 2PRS, Vestavia, AL: LEWIS, MARGIE: lPN, Birmingham, AL: LINK, MELISSA: lCEC, Florence, AL: LIVELY, ROBIN: 1GC, Birmingham, AL: MARTIN, BARBARA: 2PB, Birmingham, AL: MATHEWS, CAROL: 4HRP, Athens, AL: MAYFIELD, CINDY: 2CPE, Birmingham, AL McCALL, ALLISON: 2CEC. Montgomery, AL: McMILLAN, MICHELLE: 1GC, Birmingham, AL: McWHORTER, BETH: 2GC, Anniston, AL: McWI-IORTER, DIANE: AVBU, Ft. Walton Beach, FL: MITCHELL, BARRIE: SMK, Huntsville, AL: MOOREHEAD, MARY KATHERINE: 1RSS, Montgomery, AL: MORACCO, KAREN: 2PB, Auburn, AL: MORGAN, JEANIE: 2GPG, Eulaula. AL: MOUNT, MELISSA: 1PB, Mathews, AL: NEAL, KANNA KAY: ARSR, Birmingham, AL NGSMITH, SUSAN: 1GC, Anniston, AL: NIPPERT, RENE: 2VOA, Gadsden, AL: NORSWORTHY, SHERYL: lFM, Georgiana, AL: OVERSTREET, DENISE: lPN, Decatur, AL: PACE, SHANNON: 1PB, Birmingham, AL: PALMER, LYNN ANN: 2GSC, Largo, FL: PAPPAS, KRIS: 2NUR, Montgomery, AL: PATRICK, LISA: 2PB, Huntsville, ALI PATTERSON, CINDY: 4Fl, Huntsville, AL: PEDERSON, DONNA: 4FCD, Huntsville, AL POWELL, LAURA: 4Fl, Birmingham, AL: RAINE, RAMONA: 2GC, Birmingham, AL: RUSS, DEAN: 4PR, Atlanta, GA: SCHRIMSHER, JANNA: 2lD, Huntsville, AL: SEKAS, MARIA: AOMN, Fairhope, AL: SELF, LAURA: 4GC, Oak Ridge, TN: SHOVLAIN, CAROLYN: 4CJ, Tallahassee, FL: SMITH, AMY: 4NUR, Birmingham, AL: SMITH, ANNE: 4CEC, Phenix City, AL: SMITH, LYNNIE: 1PL, Montgomery, AL SMITH, MEG: Birmingham, 3VOA, Huntsville, AL: SMITH, SONYA: SPUB, AL: SPURGEON, DOTY: 3HA, Huntsville, AL: STANLEY, GRETCHEN: SFCD, Birmingham, AL: STONE, SISSY: 2GMH, Huntsville, AL: SULLIVAN, HEATHER: 2l-ISA, Atlanta, GA: TAMBLYN, ANNE: 3VlA, Auburn, AL: TANKESLEY, JUDY: 3HA, Signal Mtn., TN: TANKESLEY, LYNN: INS, Signal Mtn., TN: TAYLOR, MELINDA: APRJ, Brentwood, TN TERLING, TONI: 1GC, Montgomery, AL: THOMAS, MILLIE: 1GC, Millbrook, AL: THOMPSON, LORI: ZPB, Huntsville, AL: TODD, LISA: 3AC, Birmingham, AL: TOLLEY, KIM: GPRS, Hinsdale, IL: TRIPLETT, JENNIFER: tVBU, Birmingham, AL: TURNIPSEED, DANA: SPPY, Montgomery, AL: TYREE, TINNON: ZPRJ, Florence, AL: USHER, SLOAN: 1GC, Atlanta, GA: WACHTER, MICHA: SFLT, Montrose, AL WASDEN, JANA: 1PB, Birmingham, AL: WIST, SUSIE: 2FM, Hamilton, AL: WHITE, PATRICIA: 4CEE, Birmingham, AL: WHYTE, PAM: 2PL, San Antonio, TX: WILLIAMS, SUSAN: SPB, Greensboro, AL: WILSON, KENNEITH: 1GC, Birmingham, AL: WILSON, ROXANNE: 2AR, Birmingham, AL: WINGARD, MARY ALYS: 1PPY, Birmingham, AL: WOODFIN, SHANNON: 4FtSR, Murfreesboro, TN: WYMAN, ADRIENNE: lVAT, Marietta, GA YARBROUGH, CINDY: 1GC, Haleyville, AL: YARBROUGH, JANET: 3MK, Haleyville, AL: YATES, KELLY: 2GC, Opelika, AL: YEAGER, ODETTE: AAC, Greensboro, Al.: ADAIR, H. STEVE: 3VM, Montgomery, AL: ALLEY, RODNEY WAYNE: 1VM, Adger, AL: AMOROSO, WILLIAM L.: 2VM, Chevy Chase, MD: BAIRD, L. DEAN: lVM. Bluff City, TN BARNES, Ronnie: 4vM, Abbeville, Ai.: BOND, Joi-IN MICHAEL: 2VM, Auburn, AL: BONDURANT, RANDALL JOSEPH: 2VM, Birmingham, AL: BRADFORD, DWIGHT THOMAS: 3VM, Toney, AL: BRADLEY, ANDREW EDWARD: 4VM, Huntsville, AL: BROOKS, JOSEPH ROY: 2VM, Tampa, FL: BROWN, DAVID W.: 4VM, Auburn, AL: BROWN, JAMES MICHAEL: 4VM, Scottsboro, AL: BRUNO, ANTHONY JOSEPH: 2vM. Birmingham, AL: BRYAN, JAMES NORWOOD: 1VM, Decatur, AL BRYANT, MARK ALLAN: 4VM, Auburn, AL: BUSSEY, BRET ALAN: 1VM, Guin, AL: CALLAHAN, PHILIP A.: 2VM, Hanceville, Al: CANANT, JIMMY: 4VM, Hueytown, AL: CAVANAUGH, JEFFERY DONALD: 4VM, Montgomery, AL: CHAMBERS, JAMES W.: 4VM, Scottsboro. AL: CHASTEEN, LARRY LAMAR: 3VM, Cropwell, AL: CHRISTENBERRY, BILL J.: 1VM, Montgomery, AL: CHRISTENBERRY, SAM: 2VM, Bay Minette, AL: CLEMENTS, CALVIN C.: 2VM, Opelika, AL COBB, JOE DOUGLAS: 3VM, Hanceville, AL: COHORN, VAN CARLTON: 3VM, Bowling Green, KY: CORNETT, JOHN HARDIE: 2VM, Cullman, AL: CROUP, WILLIAM STERLING, III: 2VM, Auburn, AL: DAVIS, GARY THOMAS: 4VM, Statesville, NC: DUKE, CHRIS N.: 4VM, Auburn, AL: DUNCAN, GARY CLIFFORD: 4VM, Ashland, KY: DUNN, WESLEY REESE: 4VM, Montgomery, AL: EDWARDS, SAM WAYNE: tVM, Lafollette, TN: FILES, WILLIAM SHANE: 2CM, Albertiville, AL 260 Aon-Av ,. f f ff , me ,mf f 4 J A 4 1 'WI :M 3 rig M f 6 , X f qi? , 5: My fav, , f eff , , ,. Q W 7 if 'J 0 Q X any 1 xt, tiff .LVL -i ,rfmfgef if ,Q 5 44 X 2 7 3. , :,, , gl , A J f , J . I 5' sf' ef X W , , 1 , :fi M r -if 'H ' is ,, i W f f 1 Jw g Q 4: iff 6 4 X f B, ta g W Z ? I ixnit' r iififlca 1 ., , V, Z t A v gig, V+ Q,-f fl K 35: , FWZ' is ' ' , ' A f hi m .lrr , fp r f , ', j ,- 'v H :gi , V ,A I fu z IL: 2. , V, I 4 ,gm i n ,L , if A 'f gf 4 ' ' I , Q ,, 7 ,V f LM -, X at I I :,,, r l f . . ,I I ei, , ya A - , , ,, i :rtr R . f , . , ' WL. . .n if V L I ff V , , A 1 , I rf I I I r r N 1- M ' -'j 2:2 - :-,, ,.:,fV, y f W5 W? are , : Lrss . 5 , TY , ,541 r ,r e Y i ' L 'i' ,. i .W mr V , ' W ,W fa ,,,:.:, ,,,, Qtr ,HS-,lil Wi : it S 4 M .V ,,', , Vg W' , A 3 i 55 if ir Z f. r , ,gl an, 1 lr fr , g. . i ,, 1 ir Q: .M I wi it ,Q T1 in ,, L ,f 11 E : if f in ' 21? NA .. i w b , .Z In , fbi K ., , ,-,. Lift' ' ' 1 If Q Q Af, A' ' L ck ,,,g Y ,g ki, A: M gmff 5, ', , gl,-wx. .rip . . , Tuff + L I , frrl' ' l A if A 42-V ,, 1 J' I ,J 9: 'R f Q 333 Nw 5 re A I T A . Q Q A . , I .T z .5 . ' 1 5 .ii I' if ' S Af' ' 11 'W ' 1 .1 r 'i g ,. 'H' Y ,A r' . I vi V7 -A ' I ,ff tx, t-ir '34 A be y :. ' -.:,, 4, ? X., ,, :- '4 , 5: , ' qikzr, I f x 1' A 'av W-r f , nf X , f 2 s 3 w , A mv:-851 3 .f gi? f . in . If I FISHER, SCOTT ALLEN: 4VM, Huntsville, AL: FRANEFIELD, STEPHEN A.: 2VM, Huntsville, AL: FULLER, DAVID T.: SVM, Hueytown, AL: FUNK, G. RICHARD: 3VM, Louisville, KY: GADDIS, ROBERT S. JR.: 4VM, Laurel, MS: GARDNER, JAMES A.: AVM, Auburn, AL: GAY, CYRIL GERALD: 2VM, Daytona Beach, FL: GLEAVES, DAVID LEE: 1VM, Chapmansboro, TN: GOLDEN, MICKEY JAMES: 4VM, Tallassee, AL: GRACE, JIM: 4VM, Fairdale, KY GRAVLEE, SCOTT: SVM, Florence, AL: GRIFFIN, K. SCOTT: 1VM, Valdosta, GA: GRIFFIN, SAMUEL GREEN: SVM, Auburn, AL: HANNON, PAUL JR.: 4VM, Auburn, AL: HARDYMAN, STEPHEN M.: 3VM, Moulton, AL: HARRELL, CARLTON DIX: 2VM, Chipley, FL: HARRIS, STEVE: 4VM, Wetumpka, AL: HART, CHARLES DONALD: 2VM, Birmingham, AL: HERTHA, DAVID WILLIAM: AVM, Huntsville, AL: HUGHES, TERRY ORIE: 2VM, Shreveport, LA JACKSON, SCOTT: AVM, Huntsville, AL: JACOBY, KEITH JOHN: 4VM, Auburn, AL: JENNINGS, JEROME KELSIE: 4VM, Auburn, AL: JOHNSON, CALVIN MATTHEWS: 1VM, Auburn, AL: JOHNSON, MICHAEL COOK: 2VM, Auburn, AL: JOHNSON, ROBERT C.: 1VM, Union Springs, AL: JONES, DANIEL F.: 3VM, Auburn, AL: JONES, LEN R.: SVM, Opelika, AL: KELLEY, GREG S.: 4VM, Birmingham, AL: KIDD, MARK: 4VM, Birmingham, AL KING, CHRISTOPHER J.: SVM, Hellin, AL: KNIGHT, TOMMY B.: 3VM, Birmingham, AL: LANGFORD, GARY: 3VM, Holly Hill, FL: LAZENBY, WILLIAM DONALD JR.: 4VM, Florence, AL: LEE, WILLIAM KEITH: SVM, Silas, AL: LINDERMAN, SAMMY DALE: SVM, Decatur, AL: MADDOX, RANDY: 2VM, Montgomery, AL: MANGUM, TOM: SVM, Charlotte, NC: MILLEDGE, ROBERT B.: 4VM, Birmingham, AL: MINCH, GARY W.: 1VM, Owenton, KY MORGAN, MICHAEL K.: 2VM, Clinton, MS: MOUNT, DANNY: AVM, Brantley, AL: MUELLER, GUS: 4VM, Birmingham, AL: MURPHREE, STEVEN T.: AVM, Auburn, AL: OLIVER, KURT D.: 2VM, Louisville, KY: PELPHREY, RICKY LEE: 1VM, Denver, KY: PERKINS, RANDY EDWIN: 1VM, Glasgow, KY: PETCHER, STEVEN P.: 4VM, Chatom, AL: PIERSON, WILLIAM BRADLEY: 3VM, Birmingham, AL: PINKSTON, DAVID C.: 1VM, Auburn, AL PITTMAN, LUCKY: 2VM, Opelika, AL: PURVIS, MIKE: 2VM, Opelika, AL: REHM, MICHAEL E.: ZVM, Auburn, AL: RILEY, ALLEN FISCHER: 2VM, Birmingham, AL: SCRUGGS, DANIEL WILLIAM: 3VM, Fayetteville, TN: SELLERS, GILBERT: 4VM, Flamer, AL: SKINNER, RUSSELL LEE: IVM, Mt. Sterling, KY: SMELLEY, STEVEN BRYAN: 3VM, Northport, AL: SMITH, PHILIP MICHAEL: 2VM, Birmingham, AL: SNODGRASS, STAN: SVM, Auburn, Al SPEIGHT, ROBERT M.: SVM, Montgomery, AL: STEWART, JAMES BARRY: 2VM, Hartselle, AL: ST. JOHN, JAMES WILLIAM: 3VM, Tuscaloosa, AL: SULLIVAN, DAVIS: AVM, Chatom, AL: TOWNSEND, BLAKE W.: 1VM, Auburn, AL: TUCKER, TIM: 4VM, Auburn, AL: WASHINGTON, WILLIAM HUGH: 2VM, Decatur, AL: WEAKELY, A. SCOTT: 2VM, Shelbyville, KY: WEBSTER, RAYMOND R.: 2VM, Huntsville, AL: WESSON, RANDY LEE: 4VM, Attalla, AL WILLIAMS, RONALD W.: 2VM, Albany, GA: WOOD, KEVIN B.: 1VM, Marlon, KY: WOOD, MARK D.: AVM, Andalusia, AL: WOOD, MICHAEL EDWARD: 3VM, Auburn, AL: WOZOW, BRUCE: 2VM, Ashford, AL: WRIGHT, DONALD ANTHONY: 2VM, Auburn, AL: YATES, RONALD ALVIN: 1VM, Auburn, AL: YOUNGER, RICHARD COLE: 4VM, Southern Pines, NC: ZEKOFF, ZEKIE: 4VM, Auburn, AL: OLLINGER, EVELYN LORETTA: Sweetheart, Mobile, AL ALLGOOD, BRYAN LEE: AINM, Dalton, GA: BATES, JOHN C.: IPN, Shalimar, FL: BEYNON, TIMOTHY D.: AEE, Dunwoody, GA: BLACK, BOBBY A.: 2AC, Conyers, GA: BOWMAN, BRYAN K.: 1PN, Trussville, AL: BROWN, MORGAN: 2CE, Ft. Meyers, FL: BURG, TODD: 4AC, St, Petersburg, FL: CANNON, MICHAEL: APIR, Cusseta, GA CASSADY, GEORGE: ACHE, St, Petersburg, FL: CHILDERS, THOMAS MCEVILLEY: SFI, Gainesville, FL: CLAY, STEPHEN WAYNE: SAM, Auburn, AL: COLBERT, ANDREW: 4ME, Birmingham, AL: COOK, J. KINSON: 2AC, Quincy, FL: COX, GENE T.: 2GGY, Camden, AL: DEAN, ROBERT ARRINGTON: 2PB, Opelika, AL: DELISE, PAUL: 4PL, Roswell, GA: DICKSON, JIM: 3PB, Birmingham, AL: ERQUITT, ALAN H.: APUB. LaGrange, GA EVERITT, RONNIE: AHPR, LaGrange, GA: FULLERTON, PETER V.: 2LPO, Miami, FL: GASQUE, JOHN M.: ZCHE, Birmingham. AL: GRAY, DOUGLAS GLEN: 3ME, Auburn, AL: GROVER, RANAY: SCPE, Auburn, AL: HALLENBERG, ANDY: 3lNM, Doraville, GA: HANSON, JOHN SCOTT: ZPB, Miami, FL: HILL, ROBERT G.: 4AM, LaGrange, GA: HOFFMAN, CHIP: AEE. Auburn, AL: HORTENSTINE, CHARLES EDWARD: SCI-IE, St, Augustine, FL HUNT, JAMES E.: 2AB, Holmdel, NJ: HUTTO, J. STERLING: 2CE!AFl, St. Simons ls., GA: JINKS, CHARLES CRAWFORD: 3BSC, Atlanta, GA: KELLY, STEPHEN M.: 4ME, LaGrange, GA: KENT, EDDIE: 3TN, Birmingham, AL: KERR, MARK WILLIAM: IAM, Fairfax, VA: KING, CLAYTON ALAN: SBA, Birmingham, AL: KIRKLEY, ROBERT MCKINLEY: 2PB, Auburn, ALL MARINAK, MATTHEW JOSEPH: SCS, N. Palm Bch, FL: MATTHEWS, MICHAEL R.: 5PVM, Birmingham, AL Av-Am 261 MATTHEWS, THOMAS R.: 2MBB, Birmingham, AL: MIKKLESON, STEPHEN LAWRENCE: AAEC, Winter Park, FL: MOORE, CLINTON CLARK: IAM, Columbus, GA: MOREMAN, NICHOLAS ALLYN: 4INM, Birmingham, AL: NAIL, FLOYD B.: IPL, Birmingham, AL: NICODEMUS, JAMES V.: 4AM, Dunwoody, GA: PARKER, KELLY LEWIS: 3PB, LaGrange, GA: SAVAGE, TOM KING: SAC, Auburn, AL: SCALES, MYRON BRINTON: IPN, Meridian, MS: SCOTT JAMES ARMITT: IPV, Parker, CO SHELTON, R. LON III: AOMN, Birmingham, AI.: SHEMWELL, RUSSELL: AEC, Opelika, Al: SPRINKLE, MITCH: 3CH, Marietta, GA: STAHL, RICHARD DOUGLAS: 2PN, Birmingham, AL: SUBERS, JAY A.: 2lND, Lamont, FL: SUDDERTH, DAVID SCOTT: IIE, Marietta, GA: TEATES, RANDY B.: 3lE, Huntsville, AL: TRUSSELL, WALTER THWAITE: SCE, Columbus, GA: WARING, BRIAN: 4CHE, Wilmington, DE: WASHBURN, JOE: 2PB, Glencoe, AL WHITAHURST, ANTHONY E.: IGC, Dothan, ALi WILLIAMS, MARK TURNER: 3PB, Clarksville, TN: WILLIAMS, TODD DUDLEY: IGC, Clarksville, TN: WILLIAMSON, MIKE: ATN, Atmore, AL: WILLIS, DAVID JOHN: 3Fl, Huntsville, ALL WOODALL, KEITH E.: 3GC, LaGrange, GA: WOODWARD, JOHN HAYES: ABSC, Ouincy, FL: YESSICK, MICHAEL E.: 2OMN, Northport, AL ADAMS, MARJORIE LEE: IPN, Marietta, GA: AITKEN, MARTHA SHARKEY: 4FLT, Huntsville, AL: ALLEN, MARTHA H.: IPB, Dunwoody, GA: ANDERSON, BETH: IGC, Pensacola, FL: ATKINS, JANE: 2FLT, Hamburg, AFI: BARNETT, BRENDA J.: 2FSW, Indianapolis, IN: BEAM, KATHY A.: ZCEE, Birmingham, AL: BERRY, KIMBERLEE C.: 4PG, Ft. Lauderdale, FL: BISHOP, KAREN ANNE: IPN, Huntsville, AL: BLANTON, LEVIN CHRISTINE: IPT, Alpharetta, GA BONNER, DEBRA: 4lE, Anniston, AL: BOWLES, MELANIE A.: 4FiSS, Weaver, AL: BOWMAN, ANITA LOUISE: 4WL, Montgomery, AL: BRANCH, CARRIE A.: SFI, Tallahassee, FL: BRODGON, TAM D.: 2AM, Tallahassee, FL: BRONSON, SHERI LYNN: ICEE, Orlando, Fl.: BRYAN, EVON C.: IPT, Stone Mtn., GA: BRYANT, AMY ELIZABETH: SGPG, Dothan, AL: BUTLER, D. SUSIE: 2PB, Tampa, FL: CAMPBELL, CATHY: 3GJM, Auburn, AL CARASTRO, SUSAN MARIE: IADS, Montgomery, AL: CARNEY, DEIRDRE IRENE: IGC, Tucker, GA: COCHRAN, ALICIA C.: 2CPE, Saraland, AL: COLE, NEILA J.: IFM, Huntsville, AL: CONDRON, JOSIE: 3AC, Orlando, FL: CRANE, TANYA LYNNE: 2PT, Stone Mtn., GA: CRAWFORD, JANIE NELL: 2FLT, Kingston, TN: CRAWFORD, NANCY C.: 4CS, Kingston, TN: DALTON, DAWN MARIE: 2PB, Tucker, GA: DESIMONE, PAULA MARIA: SPBSC, Hope Hull, AL DEUTSCH, KATHY M.: IMRB, Brooklyn, NY: DOWNING, NATALIE B.: 2FM, Anniston, AL: DUMONT, MARY KIM: STH, Mobile, AL: EBERHART, MARGARET ANNA: IAR, Stone Mtn., GA: EHRSTEIN, LINDSEY ANN: 4CH, Winter Park, FL: ELLIS, KELLY DIANE: IPPY, Columbiana, AL: ETHREDGE, EVELYN MARIA: SCEC, Jonesboro, GA: FISHER, MAUREEN: 2EE, Altamonte Springs, FL: FOREMAN, CAMILLA DENISE: 3MDT, Perry, GA: FOSTER, MARTY ANNE: ZGC, Orlando, FL GILLIS, JENNIFER H.: IPL, Boca Raton, FL: GLASS, DONNA ANN: APG, Ozark, AL: GLASS, KAY D.: 2PTN, Gulf Breeze, FL: GORTNEY, BONNIE ANN: IPL, Ashland, AL: GRUETTER, KELLY FRANCES: 2RSM, Powder Springs, GA: GUTHRIE, GAIL E.: ZNUFI, Maitland, FL: HAGAN, K. SLADE: 2FM, O'FaIIon, IL: HAGLER, KAREN SUE: 4AC, Huntsville, AL: HALEY, KAREN LYNN: APR, Stone Mtn., GA. HALL, GLORIA GAIL: 3VAT, Montgomery, AL HANKS, BARBARA G.: SCEC, Birmingham, AL: HEARN, TERRI ELIZABETH: APV, Winter Park, FL: HEATON, MARTY SHERRY: SNF, Huntsville, AL: HEISER, ELIZABETH MARIE: 3AC, Longwood, FL: HENDERSON, ELLEN ELIZABETH: 2PT, Birmingham, AL: HENDERSON, SHEILA DAWN: IPM, Opp. AL: HOOPES, KAREN DENISE: 3AE, Sarasota, FL: HUBBARD, PATRICIA J.: 4AC, Anniston, AL: HUNT, STACIE A.: IPB, Clearwater, FL: JOHNSON, LAURI ANN: IRSS, Ft. Myers, FL JOHNSON, MARY K.: 4EE, Mobile, AL: JOHNSON, RITA: 2CNA. Hialeah, FL: JONES, CANDY CHERYL: SIFE, Huntsville, AL: JONES, JENNIFER REED: 3MK, Tampa, FL: JONGEBLOED, MARIA ROSANNE: 2PM, Mobile, AL: KIRK, BARBARA SUZANN: IPB, Okeechobee, FL: KUMMEL, MARY ANN: 2GC, Montgomery, AL: LASZLO, MARIKA PATRICIA: 4VFL, Winter Park, FL: LAY, CATHY: SNLJB, Birmingham, AL: LOGGINS, KARLA LAREE: BCNM, Ftemlap, AL LOWE, NANCY J.: IPN, Fort Walton Bch., FL: LOWERY, DEANNA LYNNE: 2PV, St, Petersburg, FL: MANGUM, JEANIE MARIE: 2CHE, Huntsville, AL: MARSHALL, KATE: 2FLT, Homewood, AL: MCGEHEE, LEIGH ANN: SNUFI, Birmingham, AL: MCWHORTER, BRENDA ANN: 4PFiJ, Anniston, AL: MILANO, CHRIS IRENE: 2PR, Loganville, GA: MORELAND, SUSAN CAROL: SNUB, Birmingham, AL: NAPIER, MIRIAM LOUISE: 3MK, Atlanta, GA: NICK, NANCY ANITA: IPR, Montgomery. AL NUNN, JULIA N.: 2FM, Marietta, GA: OWENS, CATHLEEN ANDERSON: ZGBT, Opp, AL: PARMALEE, JULIETTE M.: 3FLT, Pompano Beach, FL: PATTERSON, LEE ANNE: IARS, Decatur, GA: PAYNE, KIMBERLY A.: IGC, Ft. Bragg, NC: PINEDA, JUDY RAMONA: IPPY, Marianna, FL: POWERS, ANGELA ANN: 2TH, St. Petersburg, FL: RASPBERRY, KAREN B.: IGSC, Cantonment, FL: REYNOLDS, VERONICA C.: 3CNA, Birmingham, AL: RIEPER, HOLLY: IPB, Fort Walton, Beach, FL 262 Am-AEA 3, ,cf - x V 'A 5. 5 5 .. . 4' Q ' I if AMI 533 it I 'I 3 1 ski :si -1fi.Xx , il v ' iw s ,I wat. tx , V , , A ff I':. K' s , L ? t It A L, K lst x,,f L . 1 r f -- i 'wx Y t -1' lv yr -.1 , A ta I ta i L, ,, ,Q , , Q, 'JP , N ,, ,,,,,,,,,,,. .J 3 tw we 1 f I , Ai t, A at -JV X , ' X Q f 5 N gg, L5 - A .. -4, .5 ,,,. i f x 'wr ... ' ' I 17, gal, L, .Ci , vi 'vi -1.9, M, vu. X34 ,Q Q of 5: it A A q 1' N' ' 1 A '1'- We 'bf1,f .t ., . 7 . fm ,,, . . rn A, M.,,,, ,,,,,,j,g ,i : J . K ' J l' Q, 5-5 Z we 6: xi 'V , ,,,. , -, ., A gm T. 1 U ' fy px ' , Q 3147, I, ' , if . , -L I , Um ,C 7.3 ROSS, BRENDA KATHERINE: ZAEC, Winter Garden, FL: SCARSBOROUGH, RITA I.: 4CDD, Eufaula, AL: SCHMOLL, KAREN MICHELLE: 3VAT, Hollywood, FL: SCONYERS, DEBBIE ELAINE: 4FI, Dothan, AL: SHARPE, AMY R.: SIE, Semmes, AL: SMITH, LORI LYNNE: 2VAT, Waynesboro, VA: SNYDER, MARY K.: IPN, Atlanta, GA: STEPHENS, STEPHANIE SIMONE: 1PV, Birmingham, AL: STROUP, NANCY DIANE: SEE, Ft. Watton Beach, FL: SUMNERS, LINDA KAY: 3EE, Huntsville, AL TRAYWICK, DEIDRA D.: 3CHE, Homewood, AL: VENZ, TRACI LYNN: INS, Pompano Beach, FL: WEST, LISA DIANE: SCEE. Seneca, SC: WIGHTMAN, JANE DAVIS: INF, Miami Shores, FL: WILLIAMS, KELLY ANN: ZSCR, Orlando, FL: WILSON, BECKY JANE: SPFIS, Melbourne, FL: WINK, SANDRA ANN: 2PB, Stone Mtn., GA: WOLTNER, BARBARA ANNE: AFLT, Woodbridge, VA: WOOD, LAURIE LANE: IGJM, Wetumpka, AL: YOUNG, LYNN M.: 4Fl, Gardendale, AL ACKERMAN, R.H. JR.: 3MK, Thomasville, GA: ARENDA, THOMAS JUDE: 2CJL, Ft. Walton Bch., FL: BANKS, TIM C.: 2CPE, Leeds, AL: BANNISTER, J. ALAN: BPB, Birmingham, AL: BARTMESS, KEITH K.: 4BAH, Cheerleading, AL: BOND, LANCE FRANK: IAR, Birmingham, AL: BONZO, WESLEY HAROLD: 1PY, Birmingham, AL: BRADFORD, WADE J.: 2PB, Gulf Shores, AL BRANDON, KENNETH MICHAEL: 3CE, Valley Head, AL: BURROWS, JAMES BRADFORD JR.: AME, Pensacola, FL: CANNON, JAMES CLIFTON: 4AC, Birmingham, AL: CHARNOCK, JEFFREY PAUL: SPFIS, Mobile, AL: CHISLER, KEITH W.: 2HA, Huntsville, AL: CICIO, ANTHONY LEE JR.: 2PL, Birmingham, AL: COBB, BRUCE ALLEN: 2PN, Birmingham, AL: COCHRAN, KEVIN H.: APD, Ashville, AL: COLE, JOHN L.: IPV, Huntsville, AL: CONSOLI, RICHARD DAVID: 2EE, St. Petersburg, FL CONSOLI, ROBERT DAVID: 2AE, St, Petersburg, FL: COTE, DONALD NORMAND: 2MB, Roswell, GA: CRAIG, TYLER LEWIS: 2AE, Kendall Park, NJ: CROLEY, RICHARD S.: IID. Gadsden, AL: CROMWELL, JOHN R.: 4lNM, Lexington, KY: DAVIS, RONALD ADDISON: 2CE, Huntsville, AL: DAVIS, WAYNE SHELTON: 3CJL, Birmingham, AL: DEERY, JAMES JEFF: IPB, Maitland, FL: DILLARD, ROGER DALE: SGC, Greenville, SC: DORRIS, DAVID D.: 3AR, Birmingham, AL DREW, SAM WILLIAM: SPB, Anderson, SC: DUFFEE, DAVID: AGPG, Birmingham, AL: EATON, JON FRANKLIN: 2Fl, Huntsville, AL: EICKELMAN, RONALD WAYNE: 2ME, Mobile, AL: ESKEW, GLENN T.: SGJM, Birmingham, AL: EVERS, CHARLES DEWIGHT: 3AC, Dadevllle, AL: EWING, ANTHONY GLENN: IAG. Alexandria, VA: FAISON, ROBERT BLACK: IPPY, Fayetteville, TN: FRANKLIN, ROBERT ALLISON: AAR, Chattanooga, TN: FRENCH, STEPHEN PAUL: SPB, Jackson, AL GILBERT, MARK A.: 5PY, Auburn, AL: GLEGHORN, CARL EDWARD: 1lD, Fayetteville, TN: GOODSON, JOHN M.: SMK, Hamilton, AL: GRAHAM, JOHN STEPHEN: 3MN, Mobile, AL: GRANT, ROBERT KELLY: ZGSC, Foley, AL: GREER, JOHN A.: 2EH, Atlanta, GA: GRIFFIN, DAMON GREGG: 4EE, Dutton, AL: GRIGGS, WILLIAM ALEX: 4AFi, Columbus, GA: GUIN, KENNETH JR.: 3LEH, Carbon Hill, AL: HARRIS, MARK MILLER: 4ME, Houston, TX HARVEY, STEWART ALEXANDER: AGJM, Birmingham, AL: HASTIE, RODERICK BUELL: APUM, Albany, GA: HAWTHORNE, JEFFREY ALAN: 4EE, Montgomery, AL: HEAD, DAN: 2FY, Columbiana, AL: HICKS, GLENN A.: BME, Greenville, SC: HICKS, JOHN ROBERT: IPN, Gadsden, AL: HOLMAN, ALLEN EDWARDS: 3HY, York, AL: HOSKINS, BRIAN E.: AIE, Tucker, GA: HOSMER, DAVID H.: 2ME, Alabaster, AL: HUBBARD, DAVID: 2AC, Greenville, SC HUGHES, EDGAR ALLEN JR.: 2PM, Irvington, AL: INDUNI, MICHAEL R.: 4CE, DeSMOineS, IA: JOVINGS, NICK ANTHONY: IPT, Vestavia Hills, AL: JUNEN, KENDALL J.: 2EE, Huntsville, AL: KELLER, CARL L.: 2PN, Birmingham, AL: KELLY, BRIAN H.: SPFIS, Montgomery, AL: KELLY, DONALD PETER: 2PN, Mobile, AL: KELLY, JAMES EDWARD JR.: 3PL, Montgomery. AL: LANGE, CARL F.: 3AR, Scotch Plains, NJ: LAZZARI, ERIC VICTOR: 2PB, Loxley, AL LEHMAN, CRAIG STUART: 1PL, Sylvania, AL: LINDER, DALE ALAN: 1MB, Montrose, AL: L'LORENS, HECTOR E. JR.: AAR, Pahokee, FL: LOVE, MARK K.: AAR, Chattanooga, TN: LYNCH, BOB E.: 2GC, Phenix City, AL: LYNCH, RAYMOND THOMAS: 3VAT, Phenix City, AL: MANIS, JOHNNIE LARKIN III: 2MB. Cocoa, FL: MANUSH, EDWARD STANLEY: 2EE, Sheffield, AL: MARCH, ROBERT EDWARD: 1EE, Mobile, AL: MATHEWS, ANDREW E.: 4PFiS, Tampa, FL MATTSON, GERALD A.: 2MC, Auburn, AL: MCCABE, MARK B.: IAEC, San Antonio, FL: MCCLANAHAN, RANDALL D.: 4AC, Auburn, AL: MCCROY, FLUCHER JIM: SME, Dothan, AL: MCKENZIE, DUNCAN DAVID: 2PN, Auburn, AL: MCWILLIAMS KEITH J.: 5PPY, Summerville, GA: MOODY, SCOTT C.: 3EE, Columbiana, AL: MUELLER, GUS: 4VM, Birmingham, AL: NELSON, JOE FRANK JR.: 2AM, Birmingham, AL: NEWMAN, FRED F.: 5ME, Homewood, AL OSWELL, WILLIAM T.: 4AR, Huntsville, AL: PARKER, T. GRAY: 3HA, Leeds, AL: PARKER, THOMAS: SGSC, Hendersonville, TN: PETTERS, BERNIE C.: 4lE, Dade City, FL: PICKENS, MARK A.: AFI, Andalusia, AL: PIERSON, WILLIAM BRADLEY: 6VM, Birmingham, AL: PITTENGER, BARRY MATTHEW: IPN, Naples, FL: RANDALL, JAMES NORMAN: 2PB, Dothan, AL: ROBINSON, STEPHEN K.: 5AFt, Tallahassee, FL: SCHROEDER, DAVID C.: AHSA, Pompano Beach, FL AEA-Ben 263 SHATTO, DOUGLAS SCOTT: SCE: Chesterlield, MO: SHOVELTON, THOMAS: AGJM, Huntsville, AL: SIGLE, ROBERT DALE: BEE, Columbians, AL: SILVERSTEIN, STEVEN ALLEN: 2lD, Nashville, TN: SMITH, GEOFFERY A.: 4EC, Miami, FL: SMITH, MICHEAL TRAVIS: 2EE, Gasden, AL: SONGER, ANDREW MICHAEL: 1PB, St. Charles, IL: STENALAND, JON ERIC: ZCPE, Louisville, AL: STARKE, KENT ALAN: 1Fl, Forest Park, GA: STEGALL, BRYAN HENSON: AGGL, York, AL STEWART, WILLIAM V.: 4PL, Winter Heven, FL: STRICKLAND, JOSEPH W.: APY, Birmingham, AL: STRICKLAND, PAUL SIMS: SPHS, Auburn AL: SULLIVAN, PAUL W.: BPB, Camp Hill, AL: SUTCIFFE, WILLIAM JR.: ZBSC, Chagrin Falls, OH: TALKINGTON, SCOTT RANDALL: 4EC, Auburn, AL: TATE, JON B.: 1CE, Naples, FL: THOMPSON, JOHN McDERMETT: 4GC, Mobile, AL: TORRES, PETER: 1PN, Mobile, AL: TSCHIRHART, DAVID JOHN: SPL, Orlando, FL TSCHIRHART, MICHAEL THOMAS: 1GC, Orlando, FL: VANN, JAMES THOMPSON: 2PN, Huntsville, AL: WAGGONER, GILBERT RUSSELL: 1ME, Morristown, TN: WALLEY, MARC A.: 3FY, Kingsport, TN: WATSON, MARC SAULS: 4EE, Payton, FL: WRIGHT, JAMES O.R. JR.: 4EE, Chattanooga, TN: GREEN, TRINA L.: SWEETHEAHT: STEWART, MARGRET: HOUSEMOTHEB: TAYLOR, EDWARD B: ADVISEH ABRUSCATO, KATHY: 2HA, Mobile, AL: ADAMS, ANGIE: 1ECE, Butler, AL: ADAMS, MELANIE: 4MU, Butler, AL: ALLIGOOD, DEBBIE: 1PBS, Thomasville, GA: ANGERMANN, MICHELLE: 1PN, Cullman, AL: AUSTIN, CLAIRE: 2GC, Union Springs, AL: AYERS, CINDY: 2PL, Montgomery, AL: BALDWIN, MICHELLE: 4FLT, Robertsdale, AL BANDY, MARY ANNE: 4AC, Orlando, FL: BARKER, DELL: APY, Warner Robins, GA: BLAKELY, MARTY: 1GC, Auburn, AL: BLANKENSHIP, VICKY: 1GC, Montgomery, AL: BOEHME, CYNDIE: 4TN, Montgomery, AL: BOINEAU, BETH: 2HA, Greenville. SC: BOLDING, BARBARA: 1GC, Birmingham, AL: BOLDING, BONNIE: 4CTE, Birmingham, AL: BREAZEALE, TERN: 1PN, Huntsville, AL: BROUNLEE, AMANDA: 3lE, Decatur, AL BURGOYNE, CONNIE: STN, Huntsville, LA: BYARD, JANICE: 1NS, Montgomery, AL: CARNCK, DEBBIE: 2VOA, Montgomery, AL: CARPENTER, MISSY: 1CEC, Dallas, TX: CASEY, BETSY: 3PBS, Boswell, GA: CHALFANT, KATHY: 3LSC, Nashville, TN: CHAMBLISS, LEISA: AMCH, Montgomery, AL: CHAPMAN, RUTH: 1PAH, Houston, TX: CHAPPELL, KEITH: 4CDP, Orlando, FL: CHWALIK, JULIA: 4FCD, Miami, FL CLEM, NARNETTE, 2PB, Stone Mountain, GA: CODD, CARA: 1PN, Wetumpka, AL: COLEMAN, MELLISSA: 1GC, Decatur, AL: CONNELL, BOO: 2lFE, Whitefish Bay, WI: CONWAY, PAM: 4PRS, Birmingham, AL: COTTER, KATHY: 1EEE, Enterprise, AL: CROWE, LAURA: 1PN, Homewood, AL: DANIELS, SUSAN: 4NUB, Mobile, AL: DENTON, JOY: 4CEC, Montgomery, AL: DENTON, JULIE: 4CEC, Montgomery, AL DEPROSPERO, KIM: 2FLT, Miami Lakes, FL: DRAWDY, CAROLYN: 2GC, Hendersonville, TN: DRIVER, SHELLEY: SPRS, Winter Park, FL: DRUMMOND, CINDY: 3CEC, Jasper, AL: EVANS, NANCY: APFIJ, Nashville, TN: FALKENHAG, INGRID: 1GPG, Mt, Pleasant, SC: FARMER, KIMBERLEY: 2FtSS, Mountain Brook, AL: FARROW, MARIANNE: 4PHS, Auburn, AL: FRANTZ, WENDV: 2PB, Greenville, SC: FREY, MARY: SOMN, Dunwoody, GA FUNKHOUSER, AMY: 1TN, Huntsville, AL: GIBSON, DONNA: AGC, Ft. Walton Beach, FL: HAISTEN, NANCY: SAC, Brundidge, AL: HALL, ANNE: 1GC, Mountain Brook, AL: HALL, CATHERINE: 4ID, Mobile, AL: HAND, MANDY: 2GSC, Winter Park, FL: HARGROVE, SHAWN: 3CEC, Roswell, GA: HARSH, MARY KATHERINE: 2PB, Huntsville, AL: HEAMAN, KIM: 4Fl, Huntsville, AL: HEMMETER, MARY LOUISE: SHSC, Knoxville, TN HENDRYX, AMY: BPRS, Dunwoody, GA: HERITAGE, JANNA: 4CEC, Murfreesboro, TN: HERMAN, LORI: 1PN, Franklin, TN: HICKS, KIMBERLY: 2VAT, Greenville, SC: HILTON, SANDY: AOMN, Birmingham, AL: HIND, SHANNON: ZHRA, Alabaster, AL: HIXON, BETH: SMK, Banks, AL: HIXON, KIM: AVOA, Banks, AL: HOLCOMB, GRETEL: 3AFt, Gadsden. AL: HOLCOMB, POLLY: 2PV, Gadsden. AL HORNUNG, CAROL ANN: 1GC, Montrose, AL: HURST, MARTA: SMK, Decatur, AL: HUTTO, SUSAN: 1GC, Homewood, AL: JEFFERS, CARLA: ZPRS, Birmingham, AL: JENKINS, BECKY: 2EE, Montgomery, AL: JOHNSON, SANDY: 1PB, Atmore, AL: JOHNSON, SUSAN: ACEE, Atmore, AL: JUDKINS, CATHERINE: ZPRS, Auburn, AL: JUDKINS, KIM: lF'CN, Auburn, AL: KANE, LUCY: 2FM, Tallahassee, FL KNOWLES, KIM: 3MK, Montevallo, AL: LACEY, SUZANNE: SCEE, Alabaster, AL: LANIER, LEZLEE: SLT, Montezuma, GA: LANKFORD, AMY: ZFCD, Birmingham, AL: LAW, CINDY: 1CTY, Auburn, AL: LEE, KATHRYN: SVAT, Mobile, AL: LEE, LAURA: 2PB, Flome, GA: LLOYD, KRISTEN: 1PB, Huntsville, AL: LONG, SUSAN: 3FLT, Roswell, GA: LUMMI8, AMY: 3NUR, Gadden, AL 264 IIHII-X51 W B. S: Q 9 9 8 9 I it W . F' we I7 ' T -fy 1, 45 J Y i t , 2, r f , .A 4 231' +V 1 2' r 4: ,,,,.' rw, 5: ' f ll if l i,. .lin t - ' , ' f 1,931 . r' fi, H f WEE: f KW -,t fa ff W, ff 2, 1 7 1 , , , :ina if , , ,,,,, f my fl' ' X fs: x xt :Ain .tt fl, rw gp. ,gf 4 4 Q 431 ? J f 5. ,asf i,-we I .ff if .J ig i. , 2,52 . 9, if 'HL K t:,: i fa 44. -1, 4, all ' ,,. A . A f' 2 f 3 QQ? f A , H ' 6 1 1 ' ,,1. ' 2' f may . r Y . iff, ' i' i' 1 , .: .- T? ' .r 'Q 'ff ,f , ' , , gg t V ff . 8 'ir I , ,,,, f f I 41 . i, , ii Hi ff , .Ml . ty :ff ' f l f 1 i jr R L in ,-JE 4. n x it f -1 g I .-5 ,,.. -A , A '? 145 I r A :LA f it l x 0 -KW i 4 .21 , , ' ' s l ' gif: , 'I' ':-I2 '35 ff S . g A ,f A' ,Q -0 nflki 6 ,V f , f , l .R MW! f ,. f W 'V , , : , it , fi, fr 4 M, 4' . ,,,, .. Z f -1 WSJ . f X if AM 5 s , Q N of - , 1 t, 'hs aa, KJ 7' im' ,ffm 1-Q? if as- f f f 4: 44 -A 1, 2475 , f 4 f X f .if ww ,, if . wind , A3 I A -is .. , ,Q :Ju , FX: s . Q X L- ss L we f ew Z in ,J eg, .. 1 f ,,- gf: il 4 W ff , ,i W 1 ,i fir- g, 4' .fr ? X 1 1 LQ y 42 wer 'sy 3 s XI X ,W xi s ses 1: I rf iw if if f gg, 2 4 ,f QW af ': ,T 1 X n : ct li? Q S , X Rs XX I L ,fm ,Ii l ig Y , 1-L-j f if af 'L- T I. 4 ' 4 ' ,c-1 f jr- . . . . r s Y we A -- - - s , x 1, I - I A ' M LL-- L,,- ' -- ' 1: kk.k H A Q 5: ' 1 -1 1 ss 'A -Y ' S. . Y , Ks YR ...-- , .... L - . kx.x -A i T ts s N if ' s X55 K ' ' ss X .yy X -2 Q9 L, it L t A A .. S We L IIATHEWS, EVE: 1PN, Andalusia, AL: MATTHEWS, EVELYN: 2PB, Huntsville, AL: MATTHEWS, REGIE: AMK, Montgomery, AL MATTOX, LEIGH: 3EH, Montgomery. AL: MCCALLIE, MARY CLAIRE: ZECE, Rome, GA: MCCANN, ANDREA: 2PB, Montgomery, AL: MCCLURKIN, JEANIE: SPUB, Cecil, AL: MCDANIEL, MELANIE: ACS, Miami, FL: MCNULTY, MARY: 2GC, Gadsden, AL: MILLER, DARI: 2PN, Anniston, AL MOORE, NANCY: 1PB, Montgomery, AL: MOORER, SHARON: ACHE, Gadsden, AL: MORGAN, ALICE: TCEE, Montgomery, AL: MORGAN, SUSAN: APRS, Mobile, AL: MOSELEY, JERE: ANF, Fort Valley, GA: MOSELEY, MONICA: TGED, Flamer, AL: MOSELEY, PAM: ACEE, Hope Hull, AL, NATHAN, LISA: 4lE, Huntsville, AL: OVERSTREET, KIM: AFI, Hendersonville, TN: OVERSTREET, PAIGE: ZRSS, Hendersonville, TN PADERA, CINDY: 2FLT, Winter Park, FL: PARTIN, DEBBIE: 2PL, St. Cloud, FL: PERRY, BETH: IPB, Huntsville, AL: PERRY, SUSAN: SCDP, Huntsville, AL, PHILLIPS, RACHAEL: 1PE, Montgomery, AL: PIGOTT, JENNIFER: 2lE, Decatur, AL: PIPPIN, TRACY: 3AFi, Montgomery, AL: PITMAN, PAM: ACEE, Dothan, AL: PLUMB, RENEE: 3MDT, Auburn, AL: PONDER, SANDY: 3FCD, Mobile, AL PREMEAUX, KIM: 2VAT, Nashville, TN: PRESSGROVE, CAROLYN: 1ECE, Birmingham, AL: PRUETT, KELLY: 2GC, Montgomery, AL: RACTIFFE, LAURA: 2NS, Nashville. TN: ROGERS, KATIE: 2GC, KX Tallahassee, FL: RUNNING, JILL: 1PM, Ft, Lauderdale, FL: RYAN, ELIZABETH: ACEE, Birmingham AL: SHAW, SALLY: 1PB, Tallahassee, FL: SIRMANS, KATHY: 2GC, Roswell, GA: SIRMANS, TRACY: 3HA, Floswell, GA SMALSHOF, MARTHA: 1GC, Columbus, GA: SMITH, DELL: 2PN, Nashville, TN: SMITH, JENNIFER: QPRJ, Nashville, TN: SMITH, JENNY: SMK, Decatur, GA: SORRELLS, MISSY: AFI, Opp, AL: STOVER, REBECCA: 2PM, Decatur, AL: STRAWN, MARGARET: 4lNM, Huntsville, AL: STROUP, JULIE: lGED, Nashville, TN: TAMBLYN, ANNE: 4HSC, Mobile, AL: TANNEHILL, MEG: AVAT, Scottsboro. AL THOMAS, FORTUNE: 1CEC, Anniston, AL: THOMPSON, TRICIA: 2PB, Decatur, AL: TRAMMELL, ROBIN: 1PB, Birmingham, AL: TUCCI, LISA: 2GC, Orlando, FL: VICK, PATRICIA: 2JM, Andalusia, AL: VONDRACEK, MARIANNE: 1PV, Jacksonville, AL: WAKEFIELD, MEG: AGSC, Atlanta, Ga: WALDEN, JANA: SPRS, Centre, AL: WEAVER, PENNY: 2MK, Gadsden, AL: WEBB, ANNA: ZJPB, Birmingham, AL ALLREDGE, JOE: ZBOMN. Albertville, AL: BARTON, MARK D.: 3PB, Marietta, GA: BEARDEN, CHUCK: ZPB, Albertville, AL: BLACKMON, BRAD: 1FY, Albertville, AL: CLARK, JEFF: ZSSE, Arab, AL: CLAY, STEVEN: ABSC, Boaz, AL: COPLIN, RALPH: 2AR, Ohatchee, AL: DUNN, KENNETH: 3AFl, Albertville, AL FRASIER, JEFF: AMT, Albertville. AL: GACKSTATTER, CHRISTIAN G.: 4ME, Oakland, NJ: GIBSON, SEAN: 3EE, N Palm Bch., FL: GULSBY, BRIAN: 3PEl, Montgomery, AL: HAM, BRAD: 3AMH, Albertville, AL: HENDERSON, BRADLEY: ZPB. Birmingham, AL: HOLCOMB, JAMES: AEC, Boaz, AL: HORTON, CHRIS: 1PN, Fernandina Bch, LF: KNOX, MAC: 2GL, Atlanta, GA: LEETH, BLAKE: ZCHE, Albertville, AL MCCLURKIN, LEE: 1PS, Atlanta, GA: MCDANIEL, DAVID: 3OMN, Albertville, AL: MITCHELL, DAVID: 3OMN, Albertville, AL: MITCHELL, SHANNON: BOMN, Albertville, AL: MOORE, GREG: 3PN, New Orleans, LA: NAY, JEFF: lPN, Hazel Green, AL: NEESE, ALEX: 1PN, Mobile, AL: PARKER, KERRY: 2TH, Leesburg, AL: PERRY, LARRY: 1CPE, Bessemer, AL: PIERCE, BRENT: 2GL, Vestavia Hills, AL POIRIER, ERNIE: SAE, Delran, NJ: RESTER, ALAN: 1PB, Mobile, AL: ROGERS, JOHN: BAE, Columbus, GA: SCALES, CARLYLE: 1AE, Atlanta, GA: SMITH, ERIC: 3VAT, Albertville, AL: SMITH, GORDON JR.: 2AFl, LaGrange, GA: STEADMAN, SCOTT: 3AM, Gull Breeze, FL: STOLL, WILLIAM: AFI, Tampa, FL: TEEM, LARRY: lPB, Atlanta, GA: THOMAS, CORY JAY: 2EE, Huntsville, AL THOMPSON, ROBERT: 2AFt, Vestavia, AL: THORNBURY, DEE: 4MCH, Albertville, AL: WATTS, BYRON: SPE, Boaz, AL: WILSON, ROBERT: SLE, San Ramon, CA: WRIGHT, SHAWN: 2VAT, Homewood, AL: YAO, SHAWN: 1PN, Albertville, AL: ACUFF, SANDY: 1PEl, Saraland. AL: ANDERSON, MADOLYN: 1GJM, Nashville, TN xsz-xo-AAA 265 ATKINS, PAIGE: 2FlD, Atlanta, GA: BAIRD, LORI: SAC, Panama City, FL: BARNES, ELIZABETH: IPL, Atlanta, GA: BARNES, GINA: ZRSM, Demopolis, AL: BOURASSA, JULIE: 4AC, Atlanta, GA: BRADY, CAROLINE: IPB, Mobile, AL: BRASFIELD, KELLEY: APRS, Gainesville, FL: BREAZEAL, GENA: IFLT, Atlanta, GA: BROCKMANN, BETH: 4FlSB, Austin, TX: BUCKANAN, BECKY: 2PB, Anniston, AL BURKHALTER, CINDY: IPB, Childersburg, AL: BURLAND, TISHA: I PRS. Mobile, AL: BYRD, DEBORAH: INS, Cotfeeville, AL: CALDWELL, JULIE: 2FLT, Austin, TX: CARNEY, PATRICIA: SFZSM, Jupiter, FL: CITAK, ANNE: ANUFI, Titusville, FL: CLARKE, KAREN: 3CE. Atlanta, GA: COGLE, KIM: 2GHY, Thomasville, AL: COLLINS, NANCY: 4NUFi, Birmingham, AL: COOPER, CAROL: 2LT, Tucker, GA COTHRAN, AMELIA: IFM, Greensboro, AL: COWAN, AMY: 3FLT, Nashville, TN: CRAIG, JANET: IGC, Tampa, FL: DAVIS, STACY: IGC, Brundldge, AL: DEMUTH, SHAUNN: 2PB, Seminole, FL: DENNIS, ROBIN: ZCSS, Mobile, AL3 DIAMOND, STEPHANIE: 3PlFt, Florence, AL: DUNKIN, SUSAN: AFM, Birmingham, AL: DYKHUIZEN, ROBIN: 3MN, Atlanta, GA: ELLIS, CAMILLE: IPB, Pensacola, FL ENDICOTT, KECIA: 4PY, Hartiord, AL: FAIN, GUERRY: AFISB, Atlanta, GA: FAIN, SHERI: 2MK, Albany, GA: FARRAR, KRISTEN: 3lE, St. Simons ls., GA: FERGUSON, DEBORAH: 2NS, Gadsden, AL: FIELDS, ELIZABETH: QGFLS, Nashville, TN: FORD, STEPHANIE: AGPG, Stone Mtn., GA: FOSHEE, JENNY: IPRJ, Huntsville, AL: FRANTZ, CAROL: 4EC, Gadsden, AL: FRANTZ, LAURIE: BCEC, Gadsden, AL FROST, LISA: 2NS, Clearwater. FL: GILLESPIE, SHARON: AEC, Auburn, AL: GINGLES, LESLIE: SPRS, Nashville, TN: GROVER, LYNN: IPB, Brentwood, TN: HALL, ROBIN: QCEE, College Park, GA: HASTIE, DAWN: ARSB, Albany, GA: HILL, JULIE: SCEC. Selma, AL: ISBELL, SUSAN: 4EC, Huntsville, AL: ISHOL, SUSAN: 2CPE, Panama City, FL: JACKSON, COLETTE: 2FLT. Mobile, A' JERKINS, BRUCIE: 2PB, Geneva, AL: KELLER, LAURA: SCEC. Montgomery, AL: KELLY MARTHA: IPN, Atmore, AL: KOHL, MIMI: IPN, Cullman, AL: LANCASTER, GINNY: 3MT, Albany, GA: LANDIS, JOAN: IPB, Mobile, AL: LANE, NANCY: IPB, Lumpkin, GA: LEE, EVELYN: SHYIPO, Orlando, FL: LEGALLAIS, BETSY: 2FM, Columbus, GA: LETTOW, ALLISON: 2NS, St. Cloud, FL LOCKRIDGE, LEIGH: SLEH, Atlanta, GA: LOCKWOOD, DOROTHY: 2CJD, Atlanta, GA: LUSK, REBECCA: 3Fl.T, Signal Mtn., TN: MALLORY, TERI: 2EE, Tampa, FL: MCKAY, HEDY: 2PB, Tampa, FL: MCRAE, LEANNE: 2PV, Montgomery, AL: MEAGHER, JENNIFER: IGC, Murfreesboro, TN: MENKE, MARLIES: IGC, St. Petersburg, FL: NABORS, KAYE: BPRS, Atlanta, GA: NEALL, JANE: 2CSS, Decatur, AL NEBERGALL, ANNE: 2NF, Birmingham, AL: NIGRO, LAURA: IPB, Lake City, FL: PAGE, ABBY: IGC, Lake City, FL: PATRICK, LAURIE: APD, Huntsville, AL: PATTERSON, ASHLEY: 1Gc, Mobile, AL: PENNINGTON, LUCY: 2PFis, Meridian, Msg PHELS, CANDY: 2CS, Albany, GA: PHILPS, SANDY SUE: IFE, Albany, GA: PRAYTOR, ELLEN: 2VAT, Mobile, AL: PRESLEY, KAREN: INS, Fort Worth, TX RABREN, KELLY: IMOT, Tampa, FL: RAY, KATHLEEN: 1PN. Americus, GA: REDFEARN, LEIGH: 3lFE, Dalton, GA: REGISTER, LISA: ICEC, Panama City, FL: RIVES, NANCY: 2PB, Montgomery, AL: ROBARDS, RENEE: BAC, F. Walton Bch., FL: RODIA, EVELYN: IGC, Gadsden, AL: ROGERS, ANDREA: IAS, Mobile, AL: ROGERS, CYNTHIA: IGS, Eutaw, AL: RUDD, REBECCA: INS, Pinson, AL RUSSEL, WHITNEY: 4OMN, Birmingham, AL: RUSSELL, MITZI: 2PFiS, Montgomery, AL: RUTLAND, TRACY: 2FM!FL, Opelika, AL: SABOT, SARLY: 2AE, Auburn, AL: SCHAPKER, GAIL: ICS, Longwood, FL: SI-IARPE, LORI: IFM, Enterprise, AL: SHILLING, KIMBERLY: 2RSB, Atlanta, GA: SMITH, ALLISON: 4MB, Jackson, MS: SMITH, ELLEN: IGC, Nashville, TN: SMITH, SHELLEY: 3CEE, Hattiesburg, MS SMITHWICK, BARBARA: 2CS, Lubbock, TX: SMOKER, KATHY: 3RSB, Geneva, AL: SNETSINGER, CORY: IFM. Mobile, AL: SPEARS, LIBBIE: IAEC, Orlando, FL: SPENCER, JULIE: 2FLT, Valdosta, GA: SPIER, STACY: 2GC, Ft. Walton Bch., FL: STOUT, CAROLYN: SPUB, Signal Mtn, TN: STREETER, MITZI: 2ADS, Ft. Lauderdale, FL: THOMPSON, MARY: 4CS, Ft. Payne, AL: TOOMEY, ANN: 3PG, Mobile, AL TURNER, CINDY: IFRM, Black, AL: WAKELY, SUSAN: ACHE, Clearwater, FL: WARTINGER, JENNY: IGC, Anniston, AL: WELLS, JULIE: 2PB, Montgomery, AL: WEST, LISA: IGC, Ft. Lauderdale, FL: WHITE, SHEREE: 2PB, Doraville, GA: WILLIAMS, LAURIE: IGC, Dadeville, AL: WILSON, ROLANDA: 4AC, Birmingham, AL: WOODFIN, AMELIA: 2CEE, Uniontown, AL: YEARGAN, MISSY: 3EED, Birmingham, AL 266mm fr .. : f tt M - :72ggf5r5w.1 1 ig . ,::::, 1- -1- , V i : :Q 22, A f W 1 f mi, - gif 5? fs , 4? X W 1 1 1 1: 1.1 I , , 'ti 'ficziwsy if A H: f 1 2 ,,f::gei5:. - ,.. . 'Q we gf. ,1 ,,,,.. V , th -5 ww U is by 1 5.7 f 11: l I 5: 'G 3 W .Q 'W z et, ' ' 1, Mi : ,- , 4 .JV W ,... - . fi -- asm, , r I Q 5 I 1 1 ?f ., , A gf 'M 1 , 11 3 I , 1 ,ff . . X A -st : - fi Q y 1 1 1 , .,., , - Y I ,.f,. r ' if-53 73 ,5 9571: 'I My , W f f 1 gg Q Nt x N iftaii 'HE Fe :fs V1 1 , 5 f X 1 tr ff 4 1 . ,,,,,. 4 th ' i . ,,,, J , V I f , 7 f, 5 ' If.. Q I 1 1 W v w 1 1 g Y, W 1 f 2 f If Z 4: V 9 'E 5 4 fa f i 1 i 1 t .1 if 'ie i Zeit-2 to W I i 1 X 2 411 Ain. an 1 tt :,: I ,:,,,, ,,,, ae :::: e wg, 3 A 3137 ' i if ff iz AH, V., ' 1 .... A .. . : I If 1 .L ' ' . f' , 7 7 : , , , f , ,V ,W : S: if 1: 22 ::' f if f ' - . 5 5 , f, I ' f 1 : ,V 1. I .- A it , I , , ' ' fic' n : I it rw, 1: .ew vi-45: , 1,-.ol V ,gulf , -Z Ni I Z y l - ., 11 Y?, K I Ae I ' 2, -Y -- -f 1: ' : - --'f W ' H : H 7 f WT .- A I af: I f V- 1 9 ' ff M .. f . at A I ii ,,,, I f ,iii ' ,Z 'fi ,I ' fi 'f i' w , ' A f 'f ' V , A , , ' -' - 53:41 ' Y w . bm, , ,,, N, . ,. y,W,11 . M V .V it 1 , ,,,.1 ::, . , i ::, :::. A 1. , . . . - ,, .1 1 , ' . - i rf :rt +, 3,5 W .in , ., H : . :V 70 5 2 .. -an 'Q' f' ' 3 ' 1' - ' 3, 1 I 4 : , , 1 , I we , . - 1 ff f .Q ' 1 - A if l V W! f f l . , ,.., ' , 1, ' H:- T . - 2 . - ,- f 1'-I f, ' x . of K-9 Efiv f '- , f 'f ' ,, . , 2: 55 ,1 49 f- -.a ry A -f Z A 5 , 5 ,Q ' . 13: ' ffl' S V tim kz V ii ' - V , ' fr: ,. fl' xi I I Eff if ' I ii :fi f ,I ,. 1 i , A lil: f 2 ,,, : . ,wwe M. ,, ,,:.-5:::. a..:,f- -. W :,.-i::'iI::1',.. .. , V ,, , J . ,. ' A ,. f , ' i , . . ' ' f' ' 1: ' 3' ' 7 . .. - ' f .f '11 1 f f . , - ' as I W I 'f ' .. - liol ' o T- I ' il' . , I V, ,,kV 4 , QI ' U . i ' i 'J -1 -' Q, , , T. . 'V .. , . - , . Q, , r . ,L,, r .1 flll: sf f: 2 wt H I K 7, f I. ff 4, if Q F I I . A We .,. - ' ,f 4 ' ,L 55, l . fr I f 'QTL , '- A - T ' A ., , si. ' . 4 Lf I .,4, N , 5 I f '. V . i M' A f V , 2 Y. . ' . A YOKLEY, KIMBERLY: tPB, Tampa. FL. ADAMS, PAMELA: SGC, Atlanta, GA: AKIN, ANN: ZPRS. Flome. GA, ALLISON, MARTHA: 2PB, Auburn, AL: ARTHUR, CAROLE: ZPB. Tallahassee, FL: BAILEY, TERESA: 2GC. Huntsville, AL: BAKER, SUSAN: SPM, Birmingham, AL, BLACK, ELIZABETH: ZGC. Montgomery, AL BODKIN, PEGGY: SVOA, Birmingham, AL: BONASERA, DIANE: SHPE, Raleigh. NC: BOROWSKI, LINDA: lGJM, Montgomery, AL: CALDWELL, KIM: 3MT, Summerville, GA: CAMPBELL, CATHY: 2NS, Birmingham, AL: CAMPBELL, FRANCES: 2NS. Birmingham, AL: CANNON, TERRI: QPB. Tampa, FL, CARMONA, LORRIE: 1PM, Miami, FL: CASH, MARTHA: 1PB. Mobile, AL, CAULEY, MARI: tPN, Tampa, FL CHILDREE, ANN: IPN, Mobile, AL: CORNELISON, ANN: ACSC. Huntsville, AL: DENNING, NANCY: 3lE, New Cannan. CT: DILLON, LEIGH ANN: 2lD. Florence, AL: EDGE, CINDY: 2PB, Cullman, AL, FEI-IN, LINDA: lAFl, Chattanogga, TN: FORD, RUNETTE: 4CEE, Rome, GA: GENGE, GLORIA: SIFE, l-tellin, AL: GILBREATH, KELLEY: 1PRJ. Trussville, AL: GILMORE, PAMELA: ZIE, Florence, AL GOWER, JANET: 2GC. Atlanta, GA: HAMILL, KIM: ZVAT, Slidell. LA: HARRELL, BECCA: AAC, Haynevllle, ALJ HARRELL, SUSAN: IGC, Haynesvtlle, AL: HARRIS, BETH: SHPB, Montgomery, AL: HARRIS, SHELLIE: 2PB, Auburn, AL: HENRY, LISA: 4PlFl, Lanette, AL: HINES, ANN: AEE, Miami, Fl.: HOLTON, PATRICIA: 2lD, Atlanta. GA: HORNING, LINDA: 1GC. Florissant, MD HURST, SUSAN: CSGJM, Decatur, AL: JOCKISCH, JAKY: SFSA. Greensboro, AL: JONES, AMY: SGMH, Donalsonvllle, GA: JONES, LUINDA: APV, Greenville, AL: JORDAN, SARAH E.: SPM, Auburn, AL: KIRK, CAROLYN: S-ECE, Montgomery, AL, KITCHENS, MALONE: tCS, St. Simons ls, FL, LABORDE. LACLARE: tGEH, Jacksonville, FL: MAY, CATHY: SFI. Daytona Bch.. FL: MCKEON, JANICE: SMK, Auburn. AL MCLEOD, MARY KATHRYN: 1VAT, Pensacola. FL: MCPHERSON, MARTHA: ZCSS. Lowndesboro, AL: MEDLOCK, VICKI: 4FCD, Montgomery, AL: MILSTEAD, WANDA: ZEE, Greenville, AL: MULROONY, EILEEN: SAC, Hlnson, TN: MURPHY, JEAN: lGC, Greenville, AI: POWE, BETH: SPB. Auburn, AL: POWELL, DEBBIE: ZFISD, Pell City, AL: PREY, PEGGY: 2GC, Auburn, AL: RADCLIFFE, DEBORAH: QRSR. Floosmore, AL RAISPIS, JUDY: SNS. Scottsboro, AL: RANDOLPH, JULIE: SCEC, Lowndesboro, AL: RANKIN, DIANA: AHSA, Eufaula, AL: ROBERTSON, SANDI: 2FLT, Phenix City, ALI ROWLAND, ANNE: 3AC, Miami, FL: SAPP, DEBBIE: SPV, Eutaula, AL, SCOTT, ADELE: 2GJM, Montgomery, AL: SIMPSON, NANCY: SCS. Hartselle. AL: SMITH, DOROTHY: 2GC. Auburn. AL: SNOW, CATHY: SMN, Auburn, AL STARR, KIM: tPl3, Macon, GA: THATCHER, TRISHA: 3EC, Auburn, AL: TIPERT, ANDREA: 2PN, Danvers, MA: TODD, SANDRA: ZPUB, Selma, AL: VAUGI-IT, LORI: SAC. Horton, AL: WARE, LORETTA: APRS, Oneonta, AL: WEST, CHERRY: SMK. Roswell, GA: WILLITS, PATTI: 2FCD, Huntsville, AL: WILSON, LYNN: 2FM, W. Palm Beach, FL ALT, WILLIAM GEORGE: 2PEl, Chattanooga, TN: ANDERSON, RICHARD M.: 4PIFl, Gainesville, FL: BENNERT, DAVID M.: 2ME, Marion, AL: BLACKWELL, BENSON CRAIG: 2PB, Gadsden, AL: BRELAND, JEFFREY G.: tPN, Rockwell, TX: BROOME, MAXWELL A.: 2lNM, Eufaula, AL: CALLIS, LOUIS JR.: 4PUB, Chattahoochee, FL: CLANCY, JOHN E.: SMKXFI. Carrollton. GA COBB, DONALD C.: 2GC, Slapout, AL: CRUITT, TIMOTHY: 2PN, Mobile, AL: DAILEY, SHERRILL I.: AFI, Birmingham, AL: DAYIS, JAMES ALLEN: 4LSW. N. Palm Bch., FL: DAVIS, MARK S.: IPL. N. Palm Bch., FL: ERICKSON, MARK RAYMOND: 2PB, Slidell, LA: FERGUSON, JAMES M.: SME, Sylacauga, AL: GALATIOTO, RICHARD ALAN: 3EE, Tampa, FL: GILLESPIE, GILL G.: 4ME, Ft. Walton Bch.. FL: GILMAN, ANDREW M.: Alumni Chairman HARTUNG, GREGORY H.: Graduate FtEsident: HESTER, WILLIAM GRAVES: STN, Hixson. TN: HYDE, RICHARD R.: 1PB, Peoria, lL: JONES, MICHAEL HENRY: 1PB, Phenix City, AL: KELLY, GERALD: 3BSC. Palm Bch. Gardens, FL: LEACH, KYLE C.: ACE, Decatur, GA: LUBY, PHILIP ANDREW: SCJL. Akron, OH: 0'NEILL, MARK ANDREW: APL, Kingsport, TN: ROWE, WILLIAM: 2BSC, Haleyville, AL: RUSH, RANDY: 1PS, Carrollton, GA SCALES, BRIAN KEITH: SOMN, Jacksonville. NC: SHEPHERD, BRAD: SME, N. Palm Bch., FL: SHIREY, GEORGE PAUL: 2HPFl. Haleyville, AL: SIEK, GORDON P.: 4AC. Clearwater, FL, SIMPKINS, ROBERT ROY: SAM, Stuart, FL: TARLETON, ROBERT LEE JR.: 2PN, Elmore, AL: TOMEY, CHARLES S.: SPB, Southfield, Ml: TRAYNOR, PAUL I: tPN, Guntersville, AL: VINSON, JONATHAN LEIGH: AKY, Columbus, GA: WENNOLT, RANDELL ARLIN: SPM, Birmingham, AL AAA-AI'-A241 267 WHIDDEN, KENNETH DAVIS: 3AM, Chepley, FL: WHITESELL, PETER J.: 2ME, Auburn, AL: ADAMS, BENJAMIN S. JR.: ZCE, Oak Flidge, TN: ATKINSON, MICHAEL PAUL: 2AC, Birmingham, AL: CARLTON, RICHARD ALAN: 1CHE, New Orleans, LA, CARON, EDWARD J.: QEE, Lakeland, FL: CARTER, P. RANDOLPH: 5lND, Littleton, CO: COCHRAN, LAWRENCE K.: 2FLF, Merritt Island, FL COOPER, BRADLEY: 1EN, Alexandria, VA: COUGHUH, TIM B.: 4AR, Rochester, NY: COULTER, JOHN D.: 2VAH, Riverview, AL: DICKERSON, THOAMS ALVIN: 4MK, Lake City, FL: DOYLE, ROBERT M. II: SLA, Dunwoody, GA: EUBANKS, WILLIAM BRADLEY: IPN, New Orleans, LA: FOLEY, THOMAS WALTER: 41NM, Dunwoody, GA: GAMBLE, ERNEST MARK: QCPE, Montgomery, AL: GOLDSBERRY, JIMMY EDWARD: 1PN, Panama City, FL: GRAPSKI, CHARLES JAMES: lPN, Long Beach, NY GREEN, J. PHILIP: 2NF, Gadsden, AL: HAYES, ROBERT K.: 3EE, Mobile, AL: HOFFMAN, MICHAEL JOHN: 2BA, Jacksonville, FL: HOOD, MARK B.: 3MTL, Birmingham, AL: HOOLEY, ALAN P.: AMTL, Auburn, AL: KEOWN, THOMAS ROBERT: IGC, Huntsville, AL: LEARY, DANIEL: SCHE, Mobile, AL: LEHAMN, DAVID CHARLES: 1PD, Peachtree City, GA: LINDSEY, KEIFF W.: 2BA, Tallahassee, FL: LUKOSCHEK, RAINER: 3CE, Auburn, AL MAGEE, MARSHALL WELLS: ACPE, Atlanta, GA: MATTLE, KARL RICHARD: 2EE, Millbrook, AL: MELTON, GAYLON: AAR, Birmingham, AL: MONTGOMERY, CRAIG S.: QAM, Huntsville, AL: PERRYMAN, WILLIAM KENDRICK: 1PN, Jacksonville, FL: PETERSON, JOSEPH THOMAS: 3TN, West Nyack, Ny: PIFFEL, DAVID BRUCE: 2PN, Woodbridge, VA: PROUTY, DWIGHT WILLIAM JR.: 1EE, Auburn, AL: SANNA, MARK L.: 4PM, Porkfield, CT: SCHMITH, JOHN E.: 2OH, Birmingham, AL SCLATER, JOHN RICHARD: 1TSC, Mobile, AL: SIMS, STEVE: 3PN, Tuscaloosa, AL: STANDIFER, ROSSER RAMSAY: ACHE, Hill AFB, VT: TABER, TONY: 4GC, Stn. Mountain, GA: THOMPSON, JEFFREY S.: 2ADS, lrving, TX: VINZ, BRADLEY LOUIS: SCPS, Huntsville, AL: WALKER, CHARLES GLENN: 3lNM, Auburn, AL: WATKINS, KENNETH PAUL: 2CPE, Jacksonville, FL: WEISS, PHILIP S.: 2PL, Bulialo Gr., lL: WESTENHAVER, JAMES HUGH: 2lNM, Auburn, AL WESTHOVEN, DOUGLAS: 2lDS, Birmingham, AL: WHITFIELD, FREDERICK STEWART: IPN, Tuscaloosa, AL: WILLIAMS, MICHAEL DAVID: AGC, Land O'Lakes, FL: WILSON, GREG L.: 2FY, Wilton, CT: WOOD, WILLIAM DAMRON: 4AC, Mobile, AL: YOUNG, GREGORY L.: 2PB, Huntsville, ALL MUELLER, LIZA: Housemother: ALSOBROOK, LEAH: IGC, Huntsville, AL ANDERSON, CHRISTINE: 2PB, Montgomery, AL: ANDREWS, GINNY: 4AC, Birmingham, AL: ANSLEY, BETH: 4FM, Stone Mt., GA: ARNOLD, ALLISON: 1NS, Nashville, TN: BALLARD, LISA: 2PB, Birmingham, AL: BANKS, ANGIE: 3PB, Birmingham, AL: BAUER, LISA: 4HBA, Dothan, AL: BRIDGES, JULIA: 3NVB, Birmingham, AL: BRIDGES, MARYBETH: 4GEH, Birmingham, AL: BUCHANAN, JUDY: 1VAT, Auburn, AL BUTLER, BETH: IGSC, Wetumpka, AL: BUXTON, KERI: 2PM, Auburn, AL: CADENHEAD, ALYS: 3NF, Prattville, AL: CAUTHEN, KARLA: 2PPY, Dothan, AL: CAVALERI, DEE ANN: 4OMN, Birmingham, AL: CAVALERI, LAURA: IPB, Birmingham, AL: DARSEY, WINNIE: IPN, Sunnyside, GA: DAVIS, ROSEMARY: 1NS, Norcross, GA: DAVIS, TAMARA E.: ABSS, Homewood, AL: DREHER, DONNA: 1PN, Birmingham, AL DUNCAN, ALICIA: 3NS, Decatur, GA: DUNN, KARON: 2PL, Scottsboro, AL: EARLY, KATHY: 2CJY, Birmingham, AL: EDWARDS, CANDY: SBSB, Auburn, AL: EGGLESTON, SUSAN: SNUFI, Birmingham, AL: ETHRIDGE, LEAH: AFCD, Dothan, AL: FARMER, KIM: 1PB, Birmingham, AL: FAUCETTE, SUSAN: SNUR, Birmingham, AL: FERLISI, CAROL: 2GC, Birmingham, AL: FONDREN, JANET: APB, Huntsville, AL FOX, MICHELLE: APB, Birmingham, AL: FRENCH, ELIZABETH: 2FCD, Roanoke, AL: GANEM, TRACY: 1PPN, Boynton Beach, FL: GENNARELLI, ANN: 1PB, Matiland, FL GIATTINA, LISA: 1GC, Birmingham, AL: GIBSON, FAITH: 4VAT, Birmingham, AL: GIST, TRACY: 1GC, Birmingham, AL: GIVHAN, JANET: 1PB, Birmingham, AL: GLASS, LISA: 1CEC, Birmingham, AL: GODFREY, MANDY: 3PB, Louisville, KY GOLDEN, ALECIA: 1GC, Birmingham, AL: GOODWIN, KIT: 2GC, Birmingham, AL: GREEN, HOLLY: 1PBS, Birmingham, Al: HAFFNER, JENNY: 3NS, Birmingham, AL: HAFFNER, JOANNA: 4AC, Birmingham, AL: HALL, MICHELLE: 2SCFi, Pell City, AL: HALL, GINGER: SCEE, Talladega, AL: HAMILTON, SUSAN, 1NF, Grove Hill, AL: HARRIS, KELLEY: 2PB, Birmingham, AL: HART, SUZANNE: 2PN, Dunwoody, GA HESTER, PAULA: 1FM, Montgomery, AL: HICKMAN, RONNA: 4FL, Birmingham, AL: HICKMAN, TAMMY: APBS, Phoenix, AZ: HOLLIDAY, LISA: 2FM, Montgomery, AL: NOSLEY, DORI: 4MBB, Montgomery, AL: HOUSER, DEBBIE: 1GC, Birmingham, AL: HOWARD, DONNA: 2HPA, Pensacola, FL: JACOBS, VICKI: 4CEC, Birmingham, AL: JEFFREYS, JEANNE: IPN, Gardendale, AL: JOHNSTON, ELISABETH: 2GC, Birmingham, AL 268 Aw-Am-Az I ,, ,WW L Q, Y' 4 Q' , I 'av' . Si ,,,: ,I ,ig W, , ,f,, I ' ,- 7 451 , f 1 ea 'Q' , f A ..: ny, . J ,Wk ,, fn, ' , My iw Q, f. ,P f M 4, '-. NJ :ff f, . ,, I, im, f f af. , .gy . .y ' f ' -f - f, wr, 1 V Q or V i ' 2 R I 48: XX, , J 1.2 x 3.7, V? . V as' iii Q 'if' 'ig' it an M, , X I za. ' G :fi f f V W ,,,, W, , A in . .,,, . , V , L, ,.,.. nm, ,, :WL w'f:'2::mf,,,g W',Qw ,.v W f ,,, -,,,,,, ,,, 7 7 :ri f f gy f f I -ff f f f 1. 1,5-1 ' ' ,,,. 1: 0 ,, Q 1 his 'fy ,ve ,, X 5 it 'r.i,, Q ,, , 'Z ' H . : , ' L:- W ' I , fro i , , fm , I2 tv. VV .3 I '47, 4, 4, , Q! I . -3 -fi ' i - .Z .W Q Klux, f I A X ,.a 'L 1 X cf Hff . .ffl WM W f w WW W 317 .4434 'Kiwi WW- M, ,,,7f- I . if 1 I f 6 'Q f f' ,, A A WW an 'mr :.f-:-: V 1 V .. W .,.. f 5 Ja 1 ' 24,3 M f f , V Lv, , ,. . , nf , , 1, I , f 1 X f 2 1, ff f X , '9 Y E, ,,,, Mfff , H f ,f , 'iz fi: -i 2 -5, , 1 gi if W M H ' 4 mf 1 2 e,, f-- 'Ze L --if Z f .w 1' - fr f , .. 'L' . F11 i 5, I , f W , , rrr W ff 2 ,. f , ' A if A ff ' W , A I ' 'I x Q if 5, ttf-fi : Cv g i ' 5- V , A in V, 611 , f' Me if '1 ff? . 1 f ii' M , A , :W i A , W 2 3 X I X 1 , I VV A ,, 5 , A ..:,f,e:, 3 , 4 ,,.. V 1 v , , VM , : My 1,5 --if A iw U 2 A , gf I V f f 'Q Wg A ' , ,,,, f M , r f f 'H if' ff , Xgf , ., r if f 5 . f J? fi f Zi W W: 9' f fr: 4 Q 15 W L W 5 i :M : f ff -' ,, ' A 1: f ! K ESV V 6 if M .W ' i X4 fy ,gg ,, M Z Mlm , A , ,. - R77 a X ff f f X X X gf ff ' H 7 gg g W M , ii af f J W f ,f 4 , , f ,f 5 4 4:1-:rf ,1 ,, 4149: Q, J f ,1 ' HW! f W I f f i f an 4+ f Q J fi ii' M I se rf- gg I f an ,Q 2? 5 K I ill if 449 L , A V J' 1 W S J ff , f ,lar 4: f '3 f , f f , , 49 , . ' r, fl' - M- v- V f 7, A , rf r W - .- , , - f K . . f , .swf 3, ,, E, 2124, 95:f.:.,, A f Zi? ,jf ,f i nf Q , Vi. ,,. . X, , . .1 v . , f92,,zi.'1' :,., , V ,W V- :MW ,wa r 5 , . :gl ,gf I ' -af? 'TQ-jf . I. f 1' ,X . ark 4 W f . ' 32, ? fn , 'W , , f 2 , ,W 2:4727 ,igfo V A W , .. W' ' MZ A ,. , A A ,Ev J f A i if K A . A PL . .- ,, ,i, Z - I g 2, :E , , . . W WH, ,.., . ' it A it , l it lrlllls H J A. ,:,,,, A , ., C: ,, W . ' ff 'M' H l A .,,., .. , L ' i ,,,, ' ,A ' - - ' . , A I ' : -A ' ' f 5,5 -' V .1 1 ' . L . V .. ' 'if V- F : 'S' f , if ' ' j : ' , , a V , V 1. U 1 f W f r - - ,9',,, if -, Q , .. ... 1 - 4 - y , ,1 3 : . I , - fa ar , la. :IV I W VI , , -if L ls ' 9 A W m'if L . , A i I f I .01 n-, ,, I . - I. Zi? gf7i:'?5i 4 t K I N I KW 1 ff N , l ,W , H 3 fi' f .2 ,, ff: f I r . . f. i A g , g s M , l I .iw rr, L, I 'A I I ,.,,,, ,, M I I 7 , ', , I .i.- I ii Q -an 'Wx 5443, r 23, ' -,, , Q., I K.: :fha i 4 : g , , , ,J g ,ggg g , ,,,, 1 , r r ,' A 'wb M1 . Li. f 2 wiv, .Nj M 1 'I . sl il YI . ,. 'L i V+ X , ,, W A fi. ,ww 3 '35, ff swf , ,,'f vI:: ' , W: ,,,.. ,,,.., ,, , . 22 1' f .. , if , gs 1- . 4 ox y vw' I fi' xi - 1 ',,- I f 'W .. JOSEPH, SHARON: 2CEC, Dunwoody, GA: KNIGHT, LISA: IPPY, Birmingham, AL: KUCERA, JAN: IPB, Del Bay Bch, FL: LAWSON, BARI: 2GC, Birmingham, AL: LESCHER, MOIRA: 1GPG, Ft. Lauderdale, FL: LLOYD, LISA: SCEC, Anniston, AL: LOVE, SHAREL: 2VAT, Anniston, AL: LYNCH, DOREEN: 2PB, Montgomery, AL: MARIANI, MADELINE: 1GC, Tltusvllle, FL: MARLOWE, KIMALA: 3FM, Dothan, AL MAY, LAURA: tGC, Roswell, GA: MCKINSTRY, KATHY: ACEC, Mobile, AL: MIDDLETON, MELISSA: 2GC, Greenville, AL: MOORE, DONNA: 1PV, Decatur, AL: MOORE, SUELLEN: 1PPY. Whatley, AL: MURPHY, CAM: 4Fl, Tallassee, AL: NASH, SUZANNE: SNS, Birmingham, AL: NESBITT, DEBRA: APB, Montgomery, AL: OAKLEY, LINDA: 2PN, Birmingham, AL: PERDUE, CHERYL: 1GC, Montgomery, AL PURDOM, JENNIFER: 3PB, Decatur, GA: RAINEY, KIMBERLEE 1GC, Florence. AL: REED, KIMBERLY: 1OP, Ft. Walton Bch., FL ROBERTS, MARGARET: AFI, Gadsden, AL: ROWE, RENE: 3BBU, Birmingham, AL: SAAL, KATHLEEN: APFIS, Ft. Lauderdale, FL: SAAL, MARY BETH: 2FM, Ft. Lauderdale, FL: SCHEER, DEBBIE: 1FM, Arab, AL: SCOTT, JILL: 2FLT, Tucker, GA: SHERER, CAROL: 3lFE, Jasper, AL SHERMAN, ANNE: 2PB, Roswell, GA: SIMMONS, JENNY: 2NS, Birmingham, AL: SIMMONS, JULIA: 1GC, Birmingham, AL: SIMS, HOLLY: 1PL, Scottsboro, AL: SMITH, KIMBERLY: 2GNY. Nashville. TN: SMITH, VALERIE: 41NM, Nashville, TN: SNUGGS, EMILY: ZCEE, Birmingham, AL: SPINK, ALISON: ZPB, Decatur. AL: SPRUILL, LISA: 3GC, Franklin, TN: STONE, SUSAN: 4PFIS, Union Springs, AL STRAITON, CAROLYN: 1GC, Orlando, FL: STROUD, ANNE: 3CEE, Selma, AL: SUBER, BETSY: 3CEC, Montgomery, AL: SUMMERLIN, SCOUT: ZGSC. Dadevllle, AL: THOMPSON, VAL: SGC, Birmingham, AL: TYLER, CAROL: ZHPR, Atlanta, GA: WATKINS, ALLISON: 3PB, Birmingham, AL: WATZ, AMY: 3Fl, Huntsville, AL: WHITE, ANGELA: 2PB, Birmingham, AL: WHITED, JILL: 2CEE, Oneonta, AL WILEY, LISA: tPB, Danville, AL: WILLINGHAM, KATHY: SHA, Ft. Payne, AL: WILSON, LEANNE: 1TM, Alexander City, AL: WINFORD, LORI: 2VOA, Helena, AL: WINGO, MARYBETH: 3FLT, Homewood, AL: WULFF, TRACY: 2FLT, Fairburn, GA: YEAGER, JOY: 4GMH, Opelika, AL: ZIRKELBACH, LISA: ZONS, Birmingham, AL ABERNATHY, MEL: AGEC, Dalton, GA: BAILEY, OWEN: SHA. Mobile, AL: BARTON, JEFFREY ALAN: 3AR, Birmingham, AL: BATES, BARRY: 4MDT, Birmingham, AL: BATES, THOMAS PAUL: 1PN, Grand Bay, AL: BAUM, STEPHEN DAUBERT: 3MK, Jacksonville, FL: BLACKMON, KENNETH EDWIN: 4CE, Pensacola, FL: BOOTHE, ROBERT SCOTT: 1EE, Huntsville, AL: BOSWELL, STEVE M.: AAN, Birmingham, AL: BRADBERRY, TIMOTHY ERNEST: 4CE, Birmingham, AL BRANTON, LYLE WADE: 2ME, Fayetteville, GA: BRITTON, ROBERT RUSSELL: 1PN, Birmingham, AL: BROLUND, JOHN SAMUEL: 4ME, Mobile, AL: BURTON, DAVIS O'NEAL: 2AR, Tuscaloosa, AL: BYERS, DAVID EDWARD: 2PB, Huntsville, AL: BYERS, MARCUS E.: AOMN, Huntsville, AL: CARROLL, CURTIS: 2ME, Ringgold, GA: CLAYTON, JUSTIN SCOTT: SEE, Gadsden, AL: COBB, STEPHEN A.: 4AN, Anniston, AL: CONRY, ROBERT MARTIN: 4CHE, Vestavia Hills, AL COUCH, DON R.: 2CPE, Gadsden, AL: CREASMAN, CARL E. JR.: IHY, Athens, TN: CURREN, JON FOSTER: ICS, Bess, AL: DARNELL, MICHAEL DOYLE: 1ME, Grand Bay, AL: DAVIS, BRUCE F.: 2GC, Winder, GA: DEAL, JOHN E.: 3AN, Nashville, TNC DECELLE, CHARLES WALTON: SME, Montgomery, AL: DOYLE, JONATHAN JACKSON: AHY, Auburn, AL: DOYLE, TERRY J.: 2VAT, Blountsville, AL: DRIGGERS, ROY MORRIS: 3MC, Dothan, AL FOX, GREGORY ALLEN: 2EE, Mobile, AL: GARRIS, DONALD J.: 1PB, Mobile, AL: GENTRY, DANIEL WINSTON: SADS. Aliceville, AL: GERRISH, HAROLD P.: 3AE, Miami, FL: GORDON, TERRY CONNER: 2AE,Guntersville, AL: GRINER, GARY M.: 1EE, Huntsville, AL: HALL, TIM: AEE, Hamilton, AL: HAMILTON, HAROLD E.: 3PB, Fiogersville, AL: HILL, MIKE: SGMH, Auburn. AL: HOERLEIN, RICHARD F.: 3PB, Auburn, AL HORTON, JAY: AADS, Guntersville, AL: HOSKINS, WALTER GRAHAM: 3PB, Dothan, AL: HUYNH, TAM HONG: 3ME, Houston, TX: JACKSON, KENNETH ALAN: 4ME, Grltlin, GA: JAMESON, ROBERT J.: 1ME, Atlanta, GA: KELLY, JAMES A.: 3AC, Monlevallo, AL: KENNEDY, PHILIP M.: SAR, Stanford, CT: KING, STEVEN D.: SMCH, Blountsville, AL: KIRKLAND, KENNETH DOYLES: 4FI, Panama City, FL: KORNEGAY, GEORGE BARRY: 4ME, Montevallo, AL LEWIS, ALVIN TYSON: 41NM, Birmingham, AL: LEWIS, CHARLES PHILLIP: SEE, Birmingham, AL: LEWIS, THOMAS PEARSON: 1PN, Birmingham, AL: LIPSCOMB, JOHN RUSH: 2PB, Auburn, AL: MARKLEY, DAVID W.: 1PN, Birmingham, Al: MEAGHER, JOHN FRANCIS: 1PN, Auburn, AL: MILLER, CRAIG: AMCH, Montgomery, AL: MILLER, HENRY ALVIN: SCE, Auburn, AL: MILLER, MARCUS ALTON: 3CE, Auburn, AL: MIMS, WILLIAM SHELTON: 4MB, Prattville, AL Az-FH 269 MOLAND, DARRYL LYNN: SVAT, Gadsden, AL: MOORE, JONATHON: AVA, Wilmette, IL: MORGAN, STEVE HOYET: SPN. Auburn, AL: NELL, CARLTON E.: 3VAT, Satsuma, AL. NICHOLSON, DAVID WARREN: GADS, Marianna, FL: PAYNE, ROBERT MOORE: 2MLJ, Lillian, AL, PEARSON, JAMES C.: 3AE, Huntsville, AL: PIERCE, JERRY: AAEC, Auburn, AL: POUNDS, JAMES C. JR.: 3AM, Birmingham, AL, SAVAS, KEITH G.: 3lD, Huntsville, AL SHAMBLIN, GREGORY HUGH: 3lNM, Oneonta, AL: SISK, MICHA 'L DAVID: 2PL, Birmingham, AL, SLAY, STEPHEN ERIC: 2x C, Mobile, AL: SMITH, GLENN ANTHONY: 1FYE, Auburn, AL SPEAKMAN, MICHAEL SHARP: SPUB, Auburn, AL: STI 'NBERG, RICHARD KELLY: 3ME, Huntsville, AL: STEWART, DAVID S.: AAC, Tampa, FL: STONE, CHARLES GREGORY: ZCNM, Baxley, GA: STONE, MONROE ANTHONY: AMTL, Lanett. AL: STRINGFELLOW, LYNN RANDALL: AINM, Grand Bay, AL STUERMER, RAYMOND J.: tAM, Dunwoody, GA, SUBLETT, BARRY HOWARD: AGJM, Brownsboro, AL: TOMLINSON, STEPHAN ROY: 3FYE, Cherokee, AL: TURNOUIST, TODD ERIC: 1PN, Auburn, AL: TYUS, R. KEITH: 2PN. Selma, AL: WAGNER, TOBEY ANDREW 2ME, snetinlile, GA: wssusv, ROBERT EDWARD, JR.: 4CE, Birmingham, AL: WHITLEY, BRIAN H.: 4EE, Midfield, AL, WILLIAMS, WES: 2PV, Seale. AL, WOOD, BENJAMIN RUSSELL: 3PH, SElma, AL CONRY, ANN MARGARET: Sweetheart, ESTES, CLARA HELEN: Housemother, ARMISTEAD, ELIZABETH: SGPG, Poquoson, VA: BOOK, SUZY: QCPE, West Palm Beach, FL: BORTZ, LISA: SHSA, Chagrin Falls, OH: BRINDLEY, ELIZABETH: APUB, Miami, FL: CANNON, KIM: 4LT, Lakeland, FL, CLARK, SHERYL: QCPE, Panama City, FL COWAN, CINDY: AAC, Huntsville, AL: CRAIN, CAROLINE: AINM, Atlanta, GA: CROOK, CHERYL: 4lNM, Senoia, GA, DEATON, JAN: 3VOA, Dunwoody, GA: DERONCEY, KRISTI: 4lFE, Hueytown, AL: FAULKNER, PAIGE: 3AC, Meridian, MS: GAINES, LYNN: 2CJ, Montgomery, AL: GORE, KAREN: 4PIFl, Leeds, AL: HEAD, BRENDA: 4HSA, Sharpsburg, AL, HIBBARD, BRANDY: GFLS, Ponte Vedra, FL HORTEN, KIM: 2lB, Peachtree City, GA: HUGHES, TRACEY: 4FM, Birmingham, AL: INGWERSEN, BETTY: AMK, Atlanta, GA: MOON, ANN: 4CFE, Gadsden, AL, MOORE, CECILIA: SVOA. Ensley, AL: MORRIS, LORRAINE: 2IE, Athens, AL, MOSLEY, ROXANNE: AAC, Bessemer, AL, MURPHY, KARYN: 3FSA, Mobile, AL: PETTIE, KATHRYN: 2GC, Dunwoody, GA: POWELL, BEVERLY: ANUH, Gadsden, AL REVELL, ANN: BNUR, Dunwoody, GA: RICHARDS, REBECCA: 2VAT, Pinson, AL: RIVES, I'-IOBVN: tNS, Homewood, AL, ROWER, DEBBIE: BNUB, Atlantis, FL: SMITHERMAN, ROBIN: 3HSM, Bessemer, AL: VARMA, DEEPA: SCHE, Dunwoody, GA: WILSON, CYNTHIA: 4MK, Sanlfiamone, CA: WINTER, ELIZABETH: 2PM, Huntsville, AL ADAMS, ROBERT JOSEPH: 2PL, Danville, VA: ALEXANDER, E. PRIOLEAU: 2EH, Charleston, SC: ALLEN, DONALD HUGH: ABSC, Lafayette, AL: ANTHONY, WILLIAM BRENTLEY: AAC, Andalusia, AL: BAIT, THOMAS DWAYNE: 3LA, Huntsville, AL, BAYLESS, HOWARD DASHER: ZBSC, Lakeland, FL: BEADLES, WILL PARKER: 1NM, Moultrie, GA: BEASLEY, JERE L.: 4AC, Montgomery, AL BENTON, THOMAS: 2GC, Foley, AL: BETTY, BENJAMIN RUCKER: 31NM, Madison, TN: BEVERLY, PAUL THOMAS: 2AEC, Dayton, AL: BLOODWORTH, LUCIAN FERRIS: tBSC. Birmingham, AL: BOWDEN, TOMMY: AGC, Montoevrlle, AL: BRADLEY, JAMES THOMAS: 'lFY, Bay Mlnette, AL: BRIDGES, SAM BOLLING: 2PB, Boaz, AL, BROWN, GEOFFREY S.: AEH, Highland Falls, N.Y.: BROWN, MARVIN: 3MBl, Latayette, AL: BROWN, TERRANCE MICHAEL: tPM, Hartselle, AL BUCHNER, GEORGE BRYANT: 1PN, Montgomery, AL: BURKE, JOHN JAMES: 2PN, Charlotte, N C: CAMPBELL, BERT MCNAIR: 4GC. Brewton, AL, CHEATHAM, WARD CHRISTOPHER: 2PB, Birmingham, AL, COLEMAN, CLIFF C.: ZBSC, Lakeland, FL: COLLEY, KENNETH ROBERT: 3TMT, LaGrange, GA: CONNOR, TIMOTHY DAVID: 4BSC, Coral Springs, FL: COWART, WILLIAM: 1PN, Lakeland, FL, CUNNINGHAM, MILES MCCORD: SCHE, Birmingham, AL: DARNALL, LYLE: 2Fl, Birmingham, AL DEVENEY, DAVID FRAZIER: ZPB, Lookout Mountain, TN: GORRIE, JIM: SBSC, Birmingham, AL: GAW, CHARLES MICHAEL: 1PL, Brentwood, TN: FRYEHAUF, ROY LAWRENCE: ZAR, Perry, GA: FLYNN, PAT: 4lNM, Decatur, AL: FLACH, PHILLIP THEODORE: 1GC, Clearwater, FL: FITE, WILLIAM JACKSON: tPBS, Decatur, AL: FAULKNER, DAVID WAYNE: 4Fl, Rome, GA: DOERR, JAMES LOCKWOOD: 1PM, LaGrange, GA: DISI-IMAN, ANDREW G.: 4FY, Decatur, AL GUEST, BEN CHEVES: 1EE, Huntsville, AI.: GUEST, LIGE D.: 4tNM, Huntsville, AL: HAAS, DONALD E. JR.: ACHE, Ft. Payne, AL: HARGROVE, JOHN W.: 4PL, Madison, AL: HENRY, PATRICK T.: 2PB, Birmingham, AL: HILL, ANDREW: AIND. Brentwood, TN: HOLLADAY, FRED WILLS III: tPN, Hayneville, AL: HUFF, PHILLIP KNOX: 4ME, Decatur, AL: HUNTER, WAYNE L.: 4EC, Birmingham, AL: HURST, JAMES PRESTON: 1MB, Decatur, AL 270 FH-me-KA . W, ,. , ,,,, ,,,,,,M ,, K.. an few' , , we V. in I I ' , I' I , my K.. , li, Q ,gf 'T ,giigpf 2 fgj Q4 ' 4 .',. f , I f, ' it 'K i,,,' ' N I A ti? L Q B A It , , Q- 1-A i, W ' Q? , L7 Q f I fm, L73 Q: A , f , A or . n it - M. ,l 'A 4, if Ii ' 1 I m, 'Ii : 'f eww H A ,al f ,f y? .L 'M l .' fr 433' Z ii .lm . - A 'f fa I - . an 3 . ,, S , il' , 5 , A -if fssr, . ' . Q , rtlll it W, f , , XL: ,Q I 1' E Qui ' ,Wu X I ,. P I A V ,fLj,f,.. .,..L-f9 2 ' , V 1 . 1 .. H. . - ,,, I I ' A f- . Q , vi, my y 5 5 4.57 ,V -0 V, ' ,W ff? r , I, + ,, A ' . , ' ' T 5 . H '- f Z i X 1 I 4 ,,,, J., - :ef N ' -we .4 ff fa. :IZ f ,-, :f ef 4 , , , V, , ,, , , , , 1 , W 5 ' L f , f f , .,.., , f r , . , I . Z E A ' ' ' xy I 1 : rrr f f A--1 f , ' ff-.12 1 , ' mf' WM fi .f -' 'PT .rf:-.1 f e: if f 1 V A .. 6 T ' li I ' Q. ,,,,. 2 - f ' : I f A , , , 1 i if ,MQ 2 ., ' ' ,,li'?fii L... :LL W Z I 4 L25 ,,,,,,,,,., , ,, ., ,.., ,, 1 9 ,, T Q . f x .. V 2,64 H-, , , , -gr, QV Q , V I I N , 5 : M., 4, f A t ' . , 1. . 2 I A t ' at ,K f x, 1, 1 -, . I I' 2 I I 2 2' N I I T me llrl A S. an fr 1 -'fu ' ,,. ,L .T A' ,Zip X325 gint' ' 3 5.5 ' , ,Z ' Q, I - ,,, ,, ,Lf -., 1, Q W, ,,,, ,, L, , ,,, 5 1 , X L L , ,, L, A K I k tl I I li : N ,V A , 5 l , I N, ,aw K f7l 3 rl r 1a3A3 K I if M' 1 , ali H ii f ,, ,A ' Q4 E' My ' XE' 2 ,hA,,,E, fmt? 'Y si 'z W f ,J 4 X . y',, I aw, Ali? , Z' 1 if , , 4- 'fig' A W l f wg' , , .. M ,L ,, It -fm i fZ ? 04 if - W4-Q.: ,fda w r. I an nj' A 1 1 f ti - 4 56 t V- !,:,0..,, I EI Q t ,f . iv, , JAMES, TIM: 2GC, Montgomery, AL: JONES, LYNN LOREN: ICE, Moultrie, GA: JORDAN, JAMES WILLIAM: AINM, Ft Payne, AL: JORDON, GLENN MAXWELL: 2MK, Decatur, AL, KAY, JON SCOTT: 2AC, Nashville, TNQ KRUSE, STEPHEN A.: 4AC, New Orleans, LA, LARSEN, TIM JAMES: AFY, Decatur, AL: LEE, STEVEN BRUCE: AADS, Franklin, TN: LITTRELL, JOHN WADE: 3PB, Decatur, ALL LUNA, DREW J.: 2PB, Spring Hill, TN MARTIN, ALBERT DRAKE: SAC, Monroeville, AL: MARTIN, E. RONALD JR.: 4INM, Montgomery, AL, MASINGILL, ERIC BLAKE: IPLA, Daphne, AL: MASINGILL, JIM W.: IIBSC, Daphne, AL: MATHIS, MICHAEL WILLIAM: 2PB, Rome, GA, MCALISTER, PETER CLYDE: 4CE, Nashville, TN, MCCULLOUGH, H. ALLEN: SMK, Atlanta, GA, MCGAUGHEY, SAM: 4Cl-I, Macon, GA, MCKINNEY, KEVIN RYAN: 2PB, Mobile, AL: MCLEMORE, LEE JEFFREY: IPPY, Moulton, AL MITCHELL, EMMETT IV: ZCPE, Tallahassee, FL, MIZE, CARTER LANIER: BPB, Columbus, GA: MIZE, DAVID: AME, Columbus, GA: MORRIS, DANIEL M.: 3lM, Atlanta. GA: NAY, ROBERT MARC: 2PV, Petersburg, VA, NEAL, DOUGLAS EDWIN: IPM, Mobile, AL: NORRIS, CHET: 4AY, Sardis, AL: NORTON, J. STEVE: 2Fl, Nashville, TN: PARSONS, EARL III: 2AC, Pensacola, FL: PRESLEY, R. LEE: 4AM, College Park, GA PRICE, ROBERT CRAIG: IPPY, Selma, AL: PRICE, WALTER JASPER III: IPL, Huntsville, AL: RAMBO, TODD WHITE: AADS, Midland, GA: RATCLIFFE, JEFFERSON G.: 4AC, Selma, AL: REESE, THOMAS MARRIOTT: 2GC, Auburn, AL: RODGERS, MARSHALL REID JR.: SBSC, Birmingham, AL: SANDERSON, G SCOTT: SMK, Moulton, AL: SARTAIN, ALLEN: 4PUB, Decatur, AL: SENTER, MARK S.: ZPAC, New Orleans, LA: SMITH, MARK ROBERT: 2AM, Columbus, GA STEVENS, GREGORY FRANKLIN: IME, Wetumpka, AL: STEVENS, TOM ELI: 2PN, Birmingham, AL: STEWART, JONAS H.: 4INM, Selma, AL: TAYLOR, JOE RAINE: 2Fl, Roswell, GA: TAYLOR, LONY: 2AM. Rome, GA: TAYLOR, ROBBIE W.: ZCE. Yatesville, GA: THOMPSON, ART L.: ABSC. Decatur, AL: TORBERT, JAMES J.: IPB, Latayette, AL, UNDEREIOOD, JOHN F.: IAR, Decatur, AL: VOIGT, WILLIAM C.: IPN, Birmingham, AL WACHTER, CHASON HOWARD: IGC, Montrose, ALI WALLACE, HAROLD CLARK: IIBSC, Decatur, AL: WATTS, RONNIE GENE: 3VDE, LaGrange, GA, WHATELY, WARREN: SFI, Opelika, AL: WHEELER, D. KEEHLIN: 3PL, Brunswick, GAi WHITE, JOHN BENJAMIN: 3lNM, Macon, GA: WHITTELSEY, c.s. IV: 3PL, Opelika, AL: WILLIAMS, RICHARD RUSSELL: SPUB, Monroeville, AL: WILLIAMSON, DAVID MICHAEL: IPN, Birmingham, AL: WALTON, REBECCA ANN: Sweetheart LONG, AMELIA: Housernother: ADAMS, TRACY: IVAT, Columbus, GA: ALLEN, LESLEY: 30MN, Anniston, AL: ANDERSON, MARY MARTIN: 2AFl, Clarksclale, MS: BAILEY, LAURA: 2OH, Birmingham, AL: BAKER, RENE: SLT, Pensacola, FL: BALDWIN, LISA: AFCD, Miami, FL: BEARD, LESLIE: IGC, Atlanta, GA BENSON, BE BE: IPB, Russellville, AL: BONNEY, EVA: 3lD, Birmingham, AL: BOWERS, BETH: 4CE, Nashville, TN: BRENNAN, CINDY: 4MK, Montgomery, AL: BRIDGES, LENDA: 4PFIS, Albany, GA: BRINSON, JOANN: QRSS, Pensacola, FLC BURLESON, KELLEY: 2NS, Anniston, AL: CALLAWAY, SUSAN: 4FLT, Rome, GA: CARGILE, KATHY: SCEC, Millbrook, AL: CARNES, ANNIE: 3PlFl, Wedowee, AL CAYSON, DEBORAH: SCEE, Blountstown, FL: COMOTTI, JOANN: 2VAT, Simsbury, CT: CONYERS, KATHERINE: 2PB. Vestavia Hills, AL: COOK, CASEY: 3OMN, Birmingham, AL: COX, SUSIE: 1RSS: Stone Mt., GA: CRAVEY, DONNA: INUR, Montgomery, AL: CUNNINGHAM, CATHY: ANUR, Columbus. GA: DAVES, ANN: AADS, Mobile, AL: DEAN, AMY: 2lFE, Cullman, AL: DEESE, LUWANA: 2FM, Phenix City, AL DOMINY, DEBBIE: 4CEE, Dublin, GA: DOWDLE, JEANNE: 2PB, Huntsville, AL: EDWARDS, SANDRA: 3PB, Atlanta, GA: ELLIS, JULIE: IGC, Montgomery, AL: ENGEL, SUSAN: AMK, Summerdale, AL: ERICKSON, KATHLEEN: 2AFI, Nashville, TN, ESSLINGER, SUSAN: ACPE, Atlanta, GA: EVANS, JOANNE: 4HA, Birmingham, AL: FINDLEN, BARBARA: 2PV, Biddelord. ME: FITZMORRIS, LUCIA: 3PFiS, Monterey, CA FRAYNE, DEBORAH: IGC, Uniontown, AL: GARDNER, CAROL: 4MK, Atlanta, GA: GAUT, KRISTI: SFSA, Chamblee, GA: GIBBONS, LEE: 2MU, Montgomery, AL: GILBERT, JANET: 1FM. Bay Minette, AL: GILLASPY, GLENDA: 2CHE, Gadsden, AL: HABIB, LISA: 2GSC, Charleston, SC: HART, SUSAN: tPB, Montgomery, AL: HARVEY, KENDALL: IGSC, Prattville, AL: HAYES, PAGE: AHRA, Bay Minette, AL HAYS, JANIE: 2PPY, Auburn, AL: HILSTON, MARSHA: ZCPE, Arcadia, FL: HOGAN, KIM: 2FM, Johnson City, TN: HOLCOMB, LISA: 4NUR, Atlanta, GA: HOLIFIELD, LAURA: QFM, Mobile, AL: HOLMES, SANDY: IPN, Homewood, AL: HUGHES, LEA: IIB, Enterprise, AL: JACKSON, MARTHA: IPB, Birmingham, AL: JOHNSTON, BARRETT: 2FLT, Phenix City, AL: JONES, JESSICA: IGC, Hatchechubbee, AL KA-KA9 271 JONES, KATHY: IFM, SCOIISDOIO, AL: JORDAN, JOANNA: 2PTN, Union Springs, AL: KEIL, CAROLYN: 3MK, Pascagoula. MS: KENDRICK, BONNIE: lCS, Montgomery, AL: KIRKLAND, ELAINE: 1PRS, Nashville, TN, KITCHENS, CARLA: 3EE. Gadsden, AL: KITCHENS, GAGE: lPN, Gadsden, AL: KNESTRICK, KATHY: 3BSS, Nashville, TN, KNIGHT, MARY ANN: 4PB, Albany, GA: KOTLEWSKI, LISA: BPUB, Ft, Walton Bch, FL KRUMHOLTZ, KAREN: SPB, Boca Baton, FL: MARSHALL, CATHY: 1PB, Gadsden, AL: MARTIN, JANICE: 2CEE, Atlanta, GA: MAYFIELD, SANDY: AINM, Montgomery, AL: MCADAMS, SUSAN: SFM, Nashville, TN: MCCRAY, MALINDA: 4GSC. Greensboro, AL: MCCREARY, RENEE: BNUR, Atlanta, GA: MCIVOR, JENNY: 1lFE, Atlantic Bch, FL: MEADS, JUDY: 1GC, Pell City, AL: MONTGOMERY, TAMARA: SEC, Madison, AL MONTGOMERY, TRACY: 3FLT, College Park, GA: MORGAN, KATHRYN: 30H, Ourncy, FL: MULLIN, DOROTHY: 2CS. Huntsville, AL: MURPHY, JAN: SBSS, Mobile, AL: MURRAY, DINA: 3HPR, Birmingham, AL: NEAL, SANDRA: 2GBl, Richmond, VA: OLDHAM, KIM: ZPPY, Augusta, GA: ORZECH, LOUISE: IGC, Atlanta, GA: ORZECH, YVONNE: 3PB, Atlanta, GAL PAXTON, MINDY: 2CPE, Marietta, GA PERRY, MARGY: WGC, Nashville, TN, PERRY, ROBVN: 2PN, Spartanburg, SC: PETTIT, SUSAN: AVAT, Nashville, TN: PITTS, SARA: 1PL, Phenix, City, AL: PORTER, DE NAY: 2l-IPO, Vestavia Hills, AL: RHODES, RACHAEL: lPB, Huntsville, AL: RICHARDS, DARLENE: ZRSS, Birmingham, AL: ROSS, CINDY: 4PY, Albertville, AL: ROSS, TERRI: AFCD, Miami, FL, SCOGGINS, FREIDA: AGSC, Leroy, AL ST. RAYMOND, MICHELLE: APIR, New Orleans, LA. STEADMAN, TAMMIE: 1GC, Pascagoula, MS: STOUT, SUSAN: IGC, Plantation, Fl.: STRANE, VALERIE: 2GC, Montgomery, AL: SWIFT, ELIZABETH: 2GC, Gadsden, AL: TASHIK, ANDREA: 4HA, Shalimar, FL: TEATE, SHARON: 4CHE, Birmingham, AL: THOMPSON, LOU ANNE: SFI, Huntsville, AL: THOMPSON, SALLY: 4OMN, Nashville, TN: UPCHURCH, BETH: ZPV, Huntsville, AL WAGNER, DEANNA: 1PB, Fort Lauderdale, FL: WARD, LEISA: 1GC, Geneva, AL: WARREN, TAY: APIR, Corinth, MS: WATSON, DEEDY: 1PN, Paxton, FL: WEIR, LOUISE: 2PB, Delray Bch, FL: WESTBROOK, WENDY: 1GC, Charleston AFB, SC. WILLOUGHBY, LAURA: SNUR, Northville. Ml: WOLF, JANETTE: 2GEH, Birmingham, AL: WRIGHT, LAURA: 2GC, Auburn, AL ALFORD, LANDON LEIGH: 3CEC, Birmingham, AL: ARIAIL, GAYLA MARIE: IGC, Amerlcus, GA: ARNOLD, FRANCES E.: 2lD, Allanla, GA: BADHAM, MITYLENE MCDAVID: SMC. Birmingham, AL: BEALE, SISTA: ACEC, Montgomery, AL: BEASLEY, JULIE A.: 3NF, Montgomery, AL: BERRY, SUSANNE A.: ZBCPE, Birmingham, AL: BIRCHFIELD, DIXIE ANN: AHSC. New Market, AL BLOESS, JANET M,: SPR, Mobile, AL, BOWMAN, JEANENE HILL: IGC, Scottsboro, AL, BOYER, MARY R.: 3PG. Auburn. AL: BREWER, KIMBERLY JANE: TNS, Daphne, ALL BROWN, BETHANY NELL: IPB, Montgomery, AL: BRUNS, ELIZABETH CHRISTINE: SRSM, Dunwoody, GA: BURLESON, NANCY ANN: ISCPE, VBIFICO, FL: CARL, LELLA TRUEHEART: IPB, Opellke, AL: CASHIN, KELLY M.: AGPG, Atlanta, GA, CHAMPION, MARGARET L: ZVBU, Tyler, AL CHANCEY, ALLISON: TPB, Enterprise, AL: CHANCEY, V. CAROLINE: 2PB, Union Springs, AL: CHAPMAN, CATHY A.: ZCEE, Prospect, KY: CHATWOOD, REBECCA D.: IGSC. Fairhope, Al: COLEMAN, ALICE KAREN: ZNUR, Auburn, AL: CORTE, JULIE: ZCPE, Daphne, AL, COURTNEY, GENIE J.: 4HY, Moblle, AL: CRANE, KATHERINE LEE: 3HFlA, Decatur, AL: DIFFLY, LEAH: 2EED, SElr'na, AL: DRIGGERS, LAURIE ANN: ZEED, Selma, AL DUGGAN, FRAN C.: ZFZSB, Birmingham, AL: DYESS, LORI ANN: lFM, Montgomery, AL: EDWARDS, AINSLEY ROWE: AOMN, Huntsville, AL: EDWARDS, LEE ANNE: 4SC, Selma, AL: EDWARDS, SUSAN KATHLEENHPHS, Juno Isles, FL, EIDSON, JENNIFER: 4AC, Dothan, AL: FELL, ANNE GYLMER: 2GC, Birmingham, AL: FIGG, NANCY KAY: 1PB, Tallahassee, FL: FIKES, JULIA LEIGH: 2PB, Athens, AL: FLACH, SUSAN ELIZABETH: 4PlFl, Clearwater, FL FOWLER, LAURA ANN: 2FM, Montgomery, AL: GADDIS, AMY ELIZABETH: AVBU, Laurel, MS: GAY, LYNN: APIFI, Auburn, Al., GILMORE, AMY H.: 3CEC, Gadsden, AL: GILMORE, LAURA: IHSS, Gadsden, AL: GOODNER, H. ANN: 1GC, Birmingham, AL: GOODWYN, FOY GILMORE: SMC, Montgomery, AL: GRANT, ROSEMARY: 2AC, Dotahn, AL: HAMBRICK, JOY LYNN: ACEE, Scottsboro, AL: HAMILTON, MARY ALLEN: 2SMH, Decatur, AL HARBARGER, JULIE H.: ALA, Huntsville, AL, HARDY, HOPE: 1PB, Alberta, AL: HARDY, SUZANNE NELLENE: IGC, Selma, AL: HARRISON, ALICE-ANN: 3AC, Selma, AL: HASEV, SUSAN SCOTT: tGC, Decatur, AL: HENDEE, ALISON WALL: AFI, Decatur, AL: HINTON, DEE: ZCEE, Eutaula, AL: HICKS, BARBARA CAROL: ZCEC, Selma, AL: HICKS, BARBARA BAncnoF'r: IGC, Birmingham, AL: HENDERSON, SHIRLEY K.: 3CDD, Pensacola, FL 272 Me-,t.x if 4 .iff Bn- ? A , f ll ,ff Cf! J . .,., 5 iw if .f K, as ilftrrf L 9 -.:, Y Y X! qw . , I2'4?Q1, A wr fs ' if I X j an - V J ' af 5' 2 VK lx ,Q 1 '93 - WW H' if AW . ..,, f ,f lf 't -.2 I fx I , A. 'M wit X fi , V... .W ,ar 6' fb 4 fl. Z' 2, I r1 qi A r vb, X ., Hr: :,, 5' 1' ' W kg! Y ' Q E X ' r . sl ' . ,,,, .vvrfvw ,,gg , vi l, : A- WS X l f W Mawr: . W W rf J , W fi, W ,f s L E bf l. i, 'X if 'il , Ax Q , A It I a. , I f 4 : , X ,, , 4, ,Q w In I 5 Z af E Nad ig I ff ii 1' ' A eq, 2: , A 1 f '51 l 4 W ,, , nw... . . , ,. ,..,. 4. KN x N ,y ffl.-, Mc, M 1.14: f 1 1 x 9 ff : . Nl. f ffrt W A . 2 f I l I 1 f ', 'Ir 5 f x i , ,fa I , Y 1 x 'Q V fi R X E H. QV va JI. I ,qu I f 4 'X N., K .X S N X i ez? ' . tx i . X K RJ x . Z., I , x to O xi ,.-'I V JXWX XJ , , KSPP KZPP X. Gamm gi k ,, Q jAV . , 0 1 if , Q s Q r R ' If I ' if I HUDSON, NANCY L.: BCEE, Montgomery, AL, HULL, KELLY: AHY, Panama City, FL, HUMPHRIES, FRANCES GREGORY: IFCD, Montgomery, AL, HUMPHRIES, SALLY W.: 3EE, Montgomery, AL, HUTCHESON, MARTHA CELESTE: SCEC. Montgomery, AL, JENKINS, JULIE: 2PM, Anniston, AL, JOHNSON, JENNIFER E.: SPIR, Fiome, GA, JONES, SUSAN LYNN: ARSS, Selma, AL, KAY, CAROLE ANNE: IPRS, Nashville, TN: KINSEY, JANET MARIE: 2PB, Birmingham, AL KITTLE, MARGARET LEIGH: 2CPE, Meridian, MS, KNOWLES, ELIZABETH FAIRLIE: IGC, Montgomery, AL, LANCE, NANCY J.: 4MK, Auburn, AL, LAWRENCE, ELIZABETH FOWLER: APY, Anniston, AL, LAWSON, KATHIE HOWARD: AVAT, Birmingham. AL, LEBERTE, LISA: 2HA, Huntsville, AL, LESTER, LEIGH ANN: IGC, Mobile, AL, LOARD, JOY: 4lFE, Montgomery, AL, MANOR, MARY ASHLEY: ISC, Marianna, FL, MCCORMACK, AMY LOUISE: 2PB, Ft. Walton, FL MCCUTCHIN, JUDITH LEE: ICHE, Montgomery, AL, MCGREGOR, DEBBIE ANN: SFI, Montgomery, AL, MCKINNEY, KELLY PATRICIA: SFISB, Mobile, AL, MCKINNEY, KERRY MARIE: 4VAT, Mobile, AL, MCLAUGHLIN, KIMBERLY JOYCE: 2NUR, Selma, AL, MCLAUGHLIN, LIANNE: 2PB, Auburn, AL, MCLAURINE, MARY NELL: SCPE, Huntsville, AL, MCLAURINE, MELISSA LYNN: IPN, Huntsville, AL, MIKELL, SUZETTE RENEE: IOT, Huntsville. AL, MILDRUM, BETH: SFI, Clayton, AL MILLER, KAREN LYNNE: SPIR, Huntsville, AL, MILLS, HELEN CAROLYN: IMB, Birmingham, AL, MOBLEY, ALISON LEIGH: 3FM, Laramie, WY, MORRIS, EUGENIA CLAY: 2HPE, Selma, AL, MOSTELLAR, CARRIE MOORE: ICPE, Mobile, AL, MYERS, ELLEN ARTZ: IPN, Knoxville, TN, NELMS, SARA ANN: 2HA, Mobile, AL, NEWSOME, CAROL ANN: SPBJ, Mobile, AL: NICHOL, JANE M.: 4AEC, Selma, AL, NOBLE, SUSAN FENNELL: IPB, Montgomery, AL OCONNELL, LISA R.: SPFIS, Tallahassee, FL, OLLINGER, BECKY A.: 3PB, Point Clear, Al, ORCUTT, ELIZABETH M.: 3PG, Birmingham, AL, OWEN, ASHLEY B.: ICEC, Dothan, AL, PACE, JULIE ALISON: IPB, Pike Bd, AL, PARKER, KATHERINE HAMM: SAB, Birmingham, AL, PASCHAL, PHOEBE JOY: 4HPPl, Opelika, AL, PASSAILAIGUE, MARI J.: SNP, Columbus, GA, PATTERSON, KELLIE MARIE: 2PBS, Panama City, FL, PRYOR, ELIZABETH ANN: 2lFE, Huntsville, AL PUGH, MARIE: SHPR, Dadeville, AL, QUINLIVAN, LAURA TEMPLE: 4Fl, Atlanta, GA, RAMAGE, PAMELA JANE: 4CEE, Athens, TN, RANDALL, JULIE L.: 4Fl, Huntsville, AL, RICHIE, LILA F.: 3CEE, Demopolis, AL, ROACH, SARAH K.: ICFE, Huntsville, AL, ROBERTS, LEE LEE: 4PO, Columbus, GA, ROBERTS, LISA HILL: SNS, Atlanta, GA, ROBERTSON, SUSAN HEATHER: SRSS, Montgomery, AL, RUTLAND, LAURA VIRGINIA: ACEC, Fitzpatrick, AL SANDERS, ROBIN GRACE: IFISS, Montgomery, AL, SCHREIBER, CYNTHIA RENE: 2CS, Foley, AL, SCRUGGS, SUSIE: APG, Birmingham, AL, SEILOT, LAURA ELISE: 2FtSB, Mobile, AL, SHIELDS, C. CAREY: ZGC, Gainesville, FL, SIMPSON, ELIZABETH PHILLIPS: 3LA, Birmingham, AL, SMITH, ANN WALLIS: SBSC, Hilton Head ls., SC, SMITH, LYNN: IGC, Auburn, AL, SMITH, MARGARET YEATES: IGC, Birmingham, AL, SPEAR, MELISSA: BFISS, Montgomery, AL STANFORD, CISSIE: 2PN, Montgomery, AL, STEWART, MARY KATE: SFM, Pike Rd., AL, STEWART, MELISSA BETH: SFI, Huntsville, AL, STOCKHAM, MIDGE ROUNTREE: 2lNM, Birmingham, AL, STUDSTILL, SHERRY LYNN: IGSC, Americus, GA, SUGG, ANNA LAURA: SHY, Dothan, AL, THOMPSON, SUSANNA SLADE: ICEC, Selma, AL: TRANUM, KATHERINE COOPER: 2GSC, Birmingham, AL, VANN, MARY MELISSA: 4NUR, Union Springs, AL, VARNER, MOLLY CORNELIA: SCE, Auburn, AL WAID, CATHY: 2HA, Dothan, AL, WALTON, BRENDA CAROL: 3GJM, Columbus, GA, WATERS, NONIE: AMC, Jacksonville, FL, WEIDENBACH, BETSY: IGC, Eufaula, AL, WEIDENBACH, SUSIE: 3AC, Eutaula, AL, WHITE, KIRSTEN A.: IGJM, Tucker, GA, WILKINSON, DOLL LOGAN: SPRS, Selma, AL, WILLIAMS MARTHA KATNRYN: ACEE, DeLand, FL, WILLIAMS, MARTHA VIRGINIA: ICEE, Montgomery, AL, WILLIAMS, MARY FLEMING: CSPIFI, Atlanta, GA WILLIAMS, PAMELA A.: 2PB, Auburn, AL, WILLIAMS, TYLER A.: 2CEC, Pike Rd., AL, WILSON, LORI ANN: AFI, Birmingham, AL, WINES, MARY ELIZABETH: IPB, Winston-Salem, NC, WOODS, DENISE T.: IEE, Birmingham, AL, WORD, EMILY P.: AFISS, Scottsboro, AL, ALLEN, LEE: IPB, Thomasville, AL, ARD, LIZ: 4CTD, Toledo, OH AVERY, KYLE: 2CJY, Columbus, GA, BAXTER, JOSETTE: 2CEC, Atlanta, GA, BENTON, MARY: IGPG, Opp, AL, BIRELEY, GABRIELLE: IPN, Vero Beach, FI, BISHOP, BETH: AMBI, Marietta, GA, BJURSTROM, JANA:2PT, Dunwoody, GA, BORDEN, CHARLOTTE: GAC, Montgomery, AL, BORDEN, MELANIE: SAC, Montgomery, AL, BOSS, NANCY: 2PB, Huntsville, AL, BOX, LEE: IPB, Birmingham, AL BRADSHAW, GINGER: IPN, Dalton, GA, BRASWELL, CHARLOTTE: 2PPy, Ashville, AL, BROCKWAY, TINA: IPAB, Vestavia Hills, AL, BROHAWN, LAURA: 2ME, Lake Park, FL, BROWN, SUSAN: IPN, Nalhvlllo, TN, BUTLER, KELLEY: EICPE, Prattville, AL, CAFFEY, KATHY: INS, Ozark, AL, CAIN, JUDDI: IPPY, Opp. AL, CAMPBELL, LAREN: IGPG, Fort Lauderdale, FL, CAMPBELL, LYNN: APRS, Fort Lauderdale, FL KA-KKI' 273 CHANDLER, CLAIRE: 4PFiS, Atlanta, GA, CANNON, LANE: 2PM, Tallassee, AL, CAUTHEN, NANCY: 3VOA, Anniston, AL, CLINE, WENDY: 2lND, Enterprise, AL, COUSINS, CONNIE: 1GMH, Marietta, GA, CRIM, AMY: ZPN, Rome, GA, CUMBEE, LISA: 4PY, Montgomery, AL, CUMMINS, MARY BETH: AADS, Frankfort, KY, DAWSON, KATHIE: 1GC, Huntsville, AL, DELTATHOUWER, LYNN: 4GL, Birmingham, AL DONALDSON, LYNN: 1PB, Opp, AL, DUNN, MARGARET: tPN, ' Montgomery, AL, ELDER, MARY BEA: SFM, Madison, TN, ESKEW, CATHY: 4AC, Huntsville, AL, EWING, SHARON: 3PL, Venice, FL, FINCH, ANN: 2GC, Hueytown, AL, FRENCH, JAN: 4RSR, Anniston, AL, FRENCH, LISA: 2FCD, Baton Flouge, LA, GODWIN, JENNIFER: 2PB, Ormond Beach, FL, GUNNELS, JAN: SCEC, Opp, AL HALE, SUSAN: 2CEE, Grissom AFB, IN, HAMILTON, JULIE: 1PPY, Vestavia Hills, AL, HAMILTON, LISA: 4lE, Birmingham, AL, HANSEN, ROBIN: IPCN, Vestavia Hills, AL, HANSEN WENDY: ACHE, Vestavia Hills, AL, HEDGES, SHELLY: 1ADS, Mandeville, LA, HENDRICK, ALICIA: 1GPO, Phenix City, AL, HERRMANN, NANCYANN: 2CS, Fort Lauderdale, FL, HOBDY, JAN: SMK, Nashville, TN, HOLMES, CARTER: 2GPG, Birmingham, AL HOOBLER, LAYNE: tGC, Atlanta, GA, HOOD, JANE: 2GC, Monroeville, AL, HOULDITCH, KATHIE: 1GC, Montgomery, AL: HOWELL, LYNN: 4AC, Hartselle, AL, HOWELL, REGINA: ACEE, Hartselle, AL, HOWLE, DIANE: lPB, Anniston, AL: JIMMERSON, JOANNA: 3PB, Fairburn, GA, JOHNSON, CATHY: 2CEC, Huntsville, AL, JOHNSON, HOLLIE: 2PB, Montgomery, AL, JONES, CHERYL: 4PY, Dunedin, FL JONES, STANLEY: 3VAT, Auburn, AL, KELLEY, LAURA: 2FiSS. Atlanta, GA, KENNEDY, GRETCHEN: ZPB, Monroeville, AL: KENNEDY, TRICIA: 1PL, Monroeville, AL, KERN, LAURA: 4 PRS, Montgomery, AL, LAND, GEORGIA ANN: 2FiSM, Allentown, GA, LEE, ELIZABETH: lPN, Huntsville, AL, LIGHT, LEIGH: SGJM, Brentwood, TN, LUNSETTER, JULIE: AAM, Ft. Belvoir, VA, MADDOX, HELEN: 1GC, Atlanta, GA MADDOX, JOHNNA: 2PB, Rome, GA, MALCOLM, SANDY: 2HA, Nashville, TN, MARTIN, ANGELA: 2GC, Auburn AL, MASTIN, LOIS: 4PPY, Mobile, AL: MAY, KARLA: IPL, Birmingham, AL, MCELRATH, ELLEN: 4lE, Macon, GA, MCKINNEY, CHRISTY: 1GC, Atlanta, GA: MILBERGER, LISA: IGSC, Huntsville, AL, MINOR, DEE: SCEC, Smiths, AL: MINOR, JILL: INS, Smiths, AL MUSE, LAURA: ANUR, Atlanta, GA, MUSE, MARY GAIL: 2FM, Atlanta, GA, NEWSOME, MICHELE: 4MK, Tampa, FL, NORLANDER, KAY: IPD, Vestavia Hills, AL, NORRIS, KIM: 1PN, Birmingham, AL, NORTHINGTON, DANA: 2PB, Marietta, GA, NUNNELLEY, CINDY: 4VOA, Anniston, AL, OBRIEN, MARY: 1PFiS, Atlanta, GA, OLSON, BARBIE: ilD, Vestavia Hills, AL, ONEILL, BETH: 2GC, Birmingham, AL OSWALT, KATHRYN: 2GC, Phenix City, AL, PAVLOFF, ELLEN: 3PB, Atlanta, GA, PAYNE, ROBIN: SRSS, Auburn, AL, PHILLIPS, MENDY: SNS, Fioanoke, AL, PLAYER, LAURA: SMK, Dunwoody, GA, PLOTT, CAROLYNN: SPY, Montgomery, AL, POOLE, AMY: SCEE, Tampa, FL, RAWSON, ELISE: 4lD, Atlanta, GA, REEDER, JULIE: 3FLT, Miami, FL, ROHS, CLAIRE: ACSE. Atlanta, GA ROOF, JULIE: 2PB, Phenix City, AL, RUCKER, JULIE: 2CEE, Atlanta, GA, RUDD, HEIDI: 1AFiS, Ozark, AL: RUNYON, MARY NEILL: SNUR, Clarksville, TN, SCOTT, JAN: SPRJ, Oak Fiidge. TN, SIDES, LOUIE: 2PN, Montgomery, AL: SPEIGHTS, SALLY: IGC, Montgomery, AL, SPIDLE AMY: 1GPG, Anniston, AL, STANFORD, SUSAN: 2PCN, Vienna, VA, STEPHENS, GERRI LIN: IPM, Atlanta, GA STROMIRE, BETH: 4FLT, Cocoa Bch, FL: SUBER, CHRISTI: IPB, Dothan, AL, SWENSON, KRISTEN: IPL, Boswell, GA, TALBOT, MARY: SFLT Hampton, VA, THOMAS, JUDY: 2ME, Nashville, TN, TIDMORE, MARIANNE: AMK, Montgomery, AL, TINNEY, DARLENE: QPFIS, Tuscaloosa, AL, TOTH, TERRY: 3GJM, Ouantico, VA, TRAWBRIDGE, LESLIE: 3Fl, Stuart, FL, TRUITT, MELINDA: 2CEE, Hillsboro Beach, FL TURNER, NANCY: IPB, Columbus, GA, UZZELL, MELINDA: 4CPE, Birmingham, AL, VAN LEER, LAURA: 3FLT, Lanett, AL, YERPILLOT, CLAIRE: SPBS, Marietta, GA1 WAITES, JANET: 4OMN, Enterprise, AL, WALKER, NANCY: ZGC, Shorter, ALI WALLER, RENEE: 4FM, Florence, AL, WEHRAM, LAURA: 4FLT, Memphis, TN, WHITESIDES, KATHY: 1PVM, Somerville, AL, WILLIAMSON, JUDY: ALSW, Birmingham, AL AKINS, STEVE: 4AEC, Nashville, GA, ARD, JAMES C. III: 4AC, Toledo, OH, ARNOLD, KELLY L.: SPFISXSC, Albany, GAL AUSTIN, DAVID CHESTER: 3lNM, Smyrna, GA, AVRETT, JAY W.: SME, Dalton, GA, BARNETT, DAVID J.: AMK, Atlanta, GA, BARRY, FRANK RUSSELL: ZMK, Alexander City, AL, BAUKNECHT, SPOT A.: 2AM, Jacksonville, FL 274 Km'-K: ra - ,W . , W-. : J if ,J 2 , ,V .J 'S i l I .VK HE? A i Q 'ifsm r 1 V ! f 1 f ! 4 vs , X ft V, 1 ' Q- T' I-I-, L gin- - I rs 3 ,rf . , 2: ' ' , if ' 9 if . nw, W ., V , 4 Q A V : ' f Z V,,rsz::.:5,, , ,V ,.w,.,- I I ' -5 1 ff- i ' '- V W, ,,,,, ly I i f l Ir 1. 1 , 1 , f if i L a 1 V., a, Q ,, W X W 0 ., 5 ,NU ti' . .- Q .f m ,. .1 3: f ',,, 4- ? , , ,, .. J f, A W ,L ' I . ' t 4,0 , 'iii A A am 'ai 1 3? -A-, , ' + ff: 1 'A , ' 9 ' SE? 2 f ', :SQ ' Y, L . 1 xc? 1 ' f:,Vzf- A A .aa , , , f -, gf. :MQ - . .ft 7 ' ? Q A if 2 E: Aa, ZW i l 3' , 2 Q V , 2 I s q .f It if ' i r' ' ,744 ' q ' , V , . 15- I :V I 1: t, ,Q 4, zfifi, 55 A. 4 , A 11, ' Q Q, , , yr V :il fr ig .ff I W ,, 'rft , ,I , Inj, . . ,iff-4 3,51 - r ,Q tg, 1, t ix , , A . , ,V uf - ,, A -, ,ir ,Q :gy , . - W 1 .V 4,41 M 1, ,El , I ,rf ,V , ' , VM ,. Y ,XV N, sv 'c 'f fe YA , 3 .V V ' ' 'i 4 1. Q.: Q MA , rw A V' 7' ,,,fQ,, ,- W e 'I' V ei 'f , Q: f' .' 2 V I .2 ,M I , J R , 2 b .,, , 2, s . . . ' I H H . V ' is ' ' V- V ' it f i if M5 'I , , To A i r 'K , V , ' '- L W V , . J 2 '55 Q V , V f t V ' ,zz ,,, tw J . Y ,, -,V . V V. V: ' , , . .J ,, I A V f , c 1' , : V, 'Q Z v' , - tr J Q .-: i b -- ,, ,f ,g :ff , if -- e V , ,i .sf ' ' V, QV , f j '. V 9 I -f ,. 14' A 'ite' , 3 , 'A , f V V V, ' V jg - ,.,z E' If x . i f I , , ' 3 .ff V - A 'rw 1 , A . l - ' ii U -as f- -'Q , A V 5 ,V :T 1, ,2 ,Vo , ,f 5 L. V - ' fi , 1 ' E 'Of , 1, rift: l X AQ J.. gf . A ' gift V7 f : W' ' .. U , 1 Q '-A tip' -,f Q I , E t-a- go, , A X7 W V , V E., , It ,ir V ii I . l t xx i ,, f at ' . , A ' A I ,J , if 4 , V .3 F, X : A ' ' 2532 . -4 ,JL -f- -Q-' ,f bf, .,,. . 3 ,J f, -4, 2? fa- , 'ew 4 . i , QE' f f fiffwfi .-,. .. by 4 FE. i :fi iyvvftiz ittgwf-1 :lf I :dirt :tt Q'-'Q I 'H I , 1, AM ft wi eV,,. I K ' . 'f' ' -2 1: . INV.: F i .WA ti-, Qi A A We 1' P+ V- . : 4 . , :Mfr . i P W , I 5 ff,f 1 yy, --,f ,, fue. -fff- f ,,,, , g Q ., i ' f A wa A e. T :S fat? ? '7i I jf: A . is :ii bw . . 7-A f . f if ii 1 rv E I I A D . 13 . A kk,V ,Z X , . f t G ' id , : 39 A f ' fL Ji Jn ltll 3 ' , , f 4 i M .ii ,za Q A T A . -2: 'QQ G 1 I I l AI T: ,s , , ,Ll ,, 'KJL tk, Z , n 53,1 f.. . f lv I ff if f. I A 1 ww-' era.. . . z: , M? .. L if i L4 'E ,Q 5 g til . I l t .Xi 5 x 6' X , i,i BEAVOR, DERREK F.: 1GC, Stone Mountain, GA: BLANKENSHIP, JAY MACK: ZARS, Columbus, GA: BREWSTER, JAMES ANDREW: 3AC, Atlanta, GA: BURGESS, MARK WILLIAM: 1PD, Atlanta, GA: BURNETTE, GREG H: 4lMN, Dawsonvllle, GA: CAIN, BILLY ROBERT: 2PB, Hartselle. AL: COOK, JEFFERY SIDNEY: 2PB, Fairburn, GA: COOKE, WILLIAM BRADLEY: TAB, Columbus, GA: CORINGTON, KEITH: SME, Newville, AL: COUPLAND, ROBERT CASTON: SPB, Birmingham, AL COX, KEVIN L.: 2PB, Marietta, GA: DEARMEN, LEE: AEE, Helena, AL: DENSON, MICHAEL BRIAN: 1GC, Decatur, GAC DENSON, WILLIAM BRUCE: SMRK, Decatur, GA: DODD, JOHN FRANCIS: 2GJM, Mission Hills, KS: DODD, ROBERT HOWE: 2FC, Tallahassee, FL: DOUGHERTY, GREG NEIL: ACJL, Columbus, GA: DUMAS, JOHN EDMOND: 3BSC, Jonesboro. GA: ECKARD, MIKE ANTHONY: GPB, Atlanta, GA: ERICSON, LIEF RICHARD: SOMN, Auburn, AL FINCHER, DARYL WAYNE: SME, Arlington, GA: GARRARD, RON HOLT: 3BSC, Atlanta, GA: GEORGIADES, MARK RICHARD: 3PB, Sarasota, FL: GIBSON, THOMAS LITTLE: 3AM, Atlanta, GA: HALL GREGORY MARK: 1AFi, Columbus, GA: HALL, KEVAN HUNTER: 3lNM, Atlanta, GA: HAMIL, GARY W.: 3Fl, Shenandoah, GA: HARRISON, MICHAEL T.: SMK, Atlanta, GA: HAWKE, MARK LUNSFORD, AAEC, Leary, GA: HENKLMAR, DAVID BRIAN: 1PG, Jacksonville, FL HERRON, DAVID: 1PN, Atlanta, GA: HILL, ASHLEY PROVINE: APRS, Nashville, TN: HIOTT, JACKIE WAYNE II: AFI, Jacksonville, FL: HOLIUS, JOHN J.: SPO, Brentwood, TN: HORNER, STEVE ANDREW: 1PB, Pontevedra, Fl.: HOWARD, J. MIKE: ZPB, Ft. Walton Beach. FL: JACKSON, JAMES PAUL JR.: 4AM, Dunwoody, GA: JENKINS, JAMES KENDALL: ACPE, Richmond, VA: JESSUP, RODENT A.: AINM, Doraville, GA: JOHNSON, MUMBIE JON FRANKLIN: AINM, Chamblee, GA KESTERTON, DAVID ROBERT: AMK, Atlanta, GA: LGFEVRE, CHRISTOPHER: 3lE, Atlanta, GA: LINTON, MARK E.: ZPCN. Media, PA: MANZO, CHRISTOPHER A.: SAM, Newnan, GA: MARTIN, TONY THOMAS: IPM, Birmingham, AL: MATHEWS, SCOTT CHARLES: IGS, Tequesta, FL: McCALLUM, CHRISTOPHER JAY: 2PD, Birmingham, AL: MCCALLUM, PHILLIP W.: 3PO, Vestavla, AL: MCDONALD, MARK CHRISTOPHER: 3AM: Auburn, AL: MEADOWS, BRANT ROY: 1AM, Marietta, GA MEADOWS, STEPHEN MICHAEL: SCPE, Marietta, GA: MONCRIEF, ED C.: SBSC, Dalton, GA: MORRISON, WILLIAM MICHAEL: BCPE, Dealta, AL: MULLINS, JOHN L. III: IGC, Dothan, AL: NEWTON, KYLER: 3GC, Atlanta, GA: PACE, JIM: 3GSC, Albany, GA: PARKER, ALAN JEFFREY: 1PN, Ozark, AL: PENDLETON, CHARLES RAYMOND: 2PL, Roswell, GA: PITTS, TIM O.: TPB, Abbeville, AL: POLLARD, DAVID A.: SAM, Tarpon Springs, FL PORTEIZ, JOEL STUART: IPB, Auburn, ALI PRICE, MICHAEL WAYNE: AEE, Dothan, AL: PUGH, WESLEY: 4lNM, Hartselle, AL: RANIN, BRUCE REAGAN: 2BSC, Dothan, AL: REESE, WILLIAM H.: 3FLT, Panama City, FL: REMINGTON, WILLIAM CRAIG: 1GC, Nashville, TN: ROBERT, MICHAEL CHARMOLT: 4Tl, Atlanta, GA: RUSH, CHARLES DAVID: 3AC, Peachtree, GA. RUSSELL, BIRD L.: 4lNM, Prospect, KY: SANDERS RUSSELL: SMK, Stone Mountain, GA SAPPENFILD, JOHN P.: 1PCN, Brentwood, TN: SHIELDS, MIKE: AFI, Atlanta, GA: SHORT, RILEY PHILLIP: SGSW, Coral Gables, FL: SMITH, CHIP: 3Fl, Brentwood, TN: STONER, ALLEN RICHARD: SHYIPO, Hartselle, AL: STOVALL, WEASEL E: 4MK, Huntsville, AL: TALLEY, WILLIAM GILES III: 2PB, Leeburg, FL: TEEPLES, JOHN: 2PN, Atlanta, GA, TERRELL, JAY D.: 3lNM, Stone Mountain, GA, TIEDT, ANDY: ACED, Dunwoody, GA TODD, JOHN L.: 4MBl, DesMoines, IA: TRIPPER, ALLEN ROBERT: 4GPO. Marietta, GA: TYNER, JEFF L.: 3AFt, Trussville, AL: UPSHAW, JOHN C.: 1PS, Baton Rouge, LA: VANVOORHEES, STEVEN COERT: 2EC, Athens, GA: VIKERY, CHARLES ANTHONY JR.: 4AE, Norton AFB, CA: VOLINO, GARY DAVID: 3CS, Dunwoody, GA: WALKER, GLEN H.: 3lNM, Smyrna, GA: WEBB, JAMES M. APRSIGJM, Atlanta, GA: WIEHMAN, MIKE R.: ABSC, Tampa, FL WILLS, PHIL RANDOLL: SEE, Abbeville, AL: WILSON, RICHARD GLENN: ABSC, Chamblee, GA, WOOTEN, STEVE CLAY: AAM, Decatur, GA: PICKERING, ELIZABETH: HOUSEMOTHEB: BURKHALTER, JACKSON R.: ADVISOR: ALDRIDGE, ANDREW C.: 2AC, Huntsville, AL: ANDERSON, ROBERT LEE: ICS, Warne, NC: ARMSTRONG, JAMES: 4MK. CoralGables, FL BALISTRERI, JAMES M.: SCE, Lighthouse Point, FL, BALLEW, DAVID WILLIAM: 2PB, Atlanta, GA: BARNETT, CLIFTON G.: 2VM, Daytona Beach, FL: BILLINGSLEY, REGGIE: SAH, Birmingham, AL: BLACK, RICHARD EARLE JR.: 2lNM. Huntsville, AL: BOND, CHARLES LUNSFORD: SINM, Bedford, VA: BOSHELL, THOMAS E.: 2CHE, Birmingham, AL: BOTTCHER, BEN J.: IGC, Oneonta, AL: BRABAW, JEFF ALLEN: 2PB, Cocoa Beach, FL, BRANNON, JOHN J.: BOMN. Donaldsonville, GA BROOKS, MICHAEL DAVID: APIH, Auburn, AL: BROWN, CLAY E.: APBS, Tucker, GA: BRYAN, ROBERT: GPN, Tampa, FL: BRYANT, JOHN EDGAR: QTC, Dalton, GA, BYRNE, PATRICK JR. 4lNM, Pensacola, FL: CAHALAN, MICHAEL FRANCIS: ZME, Huntsville, AL: CAMPBELL, KIM L.: 3Fl, Jasper, AL, CANFIELD, GREGG: 4lE, Albertville, AL: CANNON, JAMES LAWRENCE: SBS, Scottsboro, AL, CHALFONT, FRANK FULTON: 3FI, Nashville, TN KEAAXA 275 CHANDLER, JAMES MARION: SEE, Huntsville, AL, CHRISTOPHER, JEFF T.: SPB, Athens, AL, CLEM, W. FRANK: STH, Athens, AL, COGGINS, BILL: 2lE, Huntsville, AL, CRANE, BEN C.: SEE, Florence, AL: DOBBS, MICHAEL DOUGLAS: AAFI. Mobile, AL, DOHERTY, BARON: AMC, Mobile, AL, DRYDEN, GREGORY LYNN: AFI, I-leflin, AL, DRYDEN, MARK HOWARD: 2PV, I-leflin, AL, DWYER, TIMOTHY JOHN: SCE, Birmingham, AL EDWARDS, GREG ROBERT: SPB, Huntsville, AL, ELLIOTT, SCOTT S.: 2PB, Atlanta, GA, FRADENBURG, GLEN ALAN: AMK, Auburn, AL, GAUTHIER, WILLIAM G.: IPM, Baton Rouge, LA, GETZ, STEPHEN B.: AFI, Auburn, AL, GILLIS, AUBREY THOMAS: 2FLT, Alabaster, AL, GODFREY, GARY R.: 2IE, N. Palm Beach, FL, GREENFIELD, JOSEPH L.: APY, Winter Haven, FL, GUEST, WALTER HAROLD III: SAE, Huntsville, AL, HALL, JOHNNY W.: SPN, Montgomery, AL HALL, ROBERT RANDALL: 2CE, Millbrook, AL: HALLMARK, JAMES ERIC: 1PN, Birmingham, AL, HAMILTON, STEVE M.: SCHE, Birmingham, AL, HENDERSON, JIMMY H.: SBSC, Ft. Walton Beach, FL, HENLEY, JEFF: AFI, Tampa, FL, HEPBURN, TIMOTHY M.: IAR, Atlanta, GA: HETTINGER, MICHAEL ALAN: 3BSC, Tampa, FL: HILL, BRANT: SCE, Montgomery, AL, HOGAN, JOHN: AEE, Green Bay WI: HURFORD, STEVEN W.: SCHE, Huntsville, AL IVEY, JAMES R.: SINM, Birmingham, AL, JANSING, CARL SCOTT: 1PN, Brentwood, TN, KASSIS, GEORGE C.: SMK, Joliet, IL, KEIM, DANIEL C.: AFI, Marietta, GA: KERCHER, JAMES DOUGLAS: SPY, Gadsden, AL, KETCHUM, KENDRICK D.: SMK, LaIes, Azores, KNESTRICK, WILLIAM EDWIN: IBSC, Nashville, TN, KNISKERN, THOMAS R.: SBSC, Lighthouse Pt., FL: LANE, THOMAS BRIAN: SME, Opelika, AL, LEDBETTER, CHARLES L. JR.: ZGPO, Auburn, AL LYSINGER, RICHARD SCOTT: SIND, Birmingham, AL: MALLORY, MARK E.: 2lNM, Huntsville, AI., MARINO, EDWARD JR.: AAC, Birmingham, AL: MARTZ, JAMES GARRETT: SEE, Huntsville, AL, MATHEWS, WILLIAM G.: 2lE, Athens, GA, MATHIEWS, RAY JR.: SINM, Montgomery, AL, McCRORY, RODDY: IBSC, Tucker, GA, MCDONALD, STAN: AAEC, Huntsville, AL: McGee, MATTHEW BRYAN: AAM, Tampa, FL, MCLAIN, TIM ERIC: 3HA, Phenix City, AL MEADOWS, JOHN: AINM, Lakeland, FL, MOORE, DAVID: SMK, Oneonta, AL, MOORE, MATTHEW RASCO: SMK, Oneonta, AL, MORGAN, RUSS LANIER: IGC, Atlanta, GA, NAUMCHEFF, DAVID MICHAEL: SSC, Huntsville, AL, NQSMITH, CHARLES REDDING: AFI, Oneonta, AL: OLIVER, PAUL: 2PB, Atlanta, GA, PARRISH, MICHAEL LEE: AIE, Montgomery, AL, PAYNE, RUSTY: ACE, Pensacola, FL, PEPPER, RICHARD EARL: ZJE, Stone Mt., GA PILVER, MICHAEL CALVIN JR.: APIFI, St. Petersburg, FL: PLUMMER, ROBERT A.: SAC, Grove Hill, AL, PRICE, WILLIAM HERALD: 1GC, Orange Park, FL, RILEY, JOHN EDWARD: ICHE, West Palm Beach, FL, ROBERTS, JEFFREY C.: APY. Ft. Payne, AL, ROBERTS, PAUL MARVIN: ALEH, Atlanta, GA, ROBUCK, BENJAMIN EDWIN: SCE, Bainbridge, GA, ROGERS, THOMAS ALBERT: SIE, Biloxi, MS, RUDOLPH, C. LEE: AMK, St. Petersburg, FL, SCOTT, KENNETH MARK: SMK. Jacksonville, FL SHERRELL, CHANDLER C.: 2PL, Dunwoody, GA, SHOULTS, MICHAEL ALAN: 2PB, Destin, FL, SINYARD, DONALD L.: IPN, Birmingham, AL, SMITH, KEITH: AIE, Athens, AL, SNIDER, CHUCK: ABSC, Montgomery, AL, SOMMER, MARK FRANCIS: SFI, Montgomery, AL, STAUTS, ROBERT H.: AINM, Birmingham, AL, STEPHENS, THOMAS GLENN: SAC, Tallapoosa, GAL STOCKDALE, JOHN R.: 2GC, Panama City, FL, STURDIVANT, JAMES ROBERT: SPO, Birmingham, AL THOMAS, DAVID A.: 2PL, Huntsville, Al., TITUS, ANTHONY GLEN: AAEC, Birmingham, AL, TRAVIS, DON A.: 2AC, Atlanta, GA, ULRICH, G. KURT: AMK, St. Petersburg, FL, ULRICH, ROBERT TRENT: IGC, St. Petersburg, FL, VINES, ROBERT POWELL: 3MK, Birmingham, ALL WALD, MAURY: AGSC. Birmingham, AL, WARREN, GREGG SCOTT: SIE, Lafayette, AL, WHITLOCK, JEFFREY DONALD: 4lNM, Lanett, AL, WHITT, THOMAS HUSTON: 2EE, Huntsville, AL WILLIAMS, THOMAS JR.: IPN, Huntsville, AL, WILSON, DANIEL M.: SEC, Huntsville, AL, WINGO, JEFF D.: APIR, Birmingham, AL, WOOD, JOHN D.: 1PN, Racine, WI, YAGER, DOUGLAS L.: SAE, Vandenberg, CA, YANTIS, ANDREW CAIN JR.: SCE, Atlanta, GA, YOST, PATRICK: 3PF?J, Greenville, SC, KICKLIGHTER, JOSEPH A.: Adviser ADAMS, JAMES G.: 3VM, Auburn, AL, ADAMS, LARRY G.: SVM, Lexington, KY, ALLRED, CAROL LYNN: SVM, Hamptonvllle, NC: ALTON, SUZANNE: IVM, Louisville, KY, AVANT, JUANITA: 2VM, Dothan. AL, AYER, ANN A.: SVM, Auburn, AL, BAGLEY, MICHAEL: AVM, Clayton, NC, BAIN, FAIRFIELD: AVM, Wakefield. VA, BAIRD, NICKIE: SVM, Gaston NC, BAKER, BOB: AVM, Louisville, KY BALL, JAN McPHERSON: 2VM, Auburn, AL, BATTEN, JANET GAIL: 2VM, Auburn, AL, BECK, MARK RICHARD: 2VM. Amsterdam. NY: BEGGS, CLYDE JEFFERSON: AVM, Carrollton, KY, BELLAMY, LISA KAY: 2VM, Owensboro, KY, BIDDLE, DQWAYNE: IVM, Fort Payne, AL, BISHOP, GREG LEO: IVM, Louisville, KY: BRITTON, SUZANNE M.: 3VM, Akron, AL, BROOKS, MICHAEL: SVM, Cynthlana, KY, BROTHERS, SHAWN MARIE: IVM, Auburn, AL 276 AXA-mx Mer I , I rf' 9 V, 1 A 11, 3 I 5 . V: A IE' .I my, if I A I- wif gt wig ' Q I N f , I ' I ' +1 I, , :gif ,Alia -MBR, F, V , Z I ili . f A ' . w Wwmw f fi ie- 1. ,ry uf, 5. f MQW, wi ? Mi?4Q'f wa sts, f f' tl 2 I I ,,A .,,,,, , A, .,,, :I f ig , M I x ' Qt , f 5, , gwg x ' Hg 41 .f 1 i . M , .,,., I . ,, 1, -af , I A V N ' M gk ' I 3 f' if v t A f., i t F l ,gifigz M71 . ' fi: me Q Ar-, asf, M: lil ,,e 2 fi BAL. i fm 4. ,..i the I ' ' , ,.., A V, 20' ease tiii O Q? I , g ,,, P 'ig A , f T3 Q45 'vw Q' x- A es Ei Q A 2 .-of L ,sf- as ,. ,V ,Of -6 Zn: T'7! A il? 3 4 Gi If ' nvvzl 4, 5 J i J' , I P- A n ,,, , ,, .g:k1,1 . Q a A it A V , J it .L y Y ' V , , , -ew Q V.: . ..qv , , I , , f r g y ,,,,,:,,W , ,,,,,,,.,.,,, , , :lr , f 1 'gf Z if Q' Y ,, ggi K 1 A Ji, , 5 ,, , I J I , i vi, uf' I A A YWM3, I t H 'vu i SX A 1 , ,gf y A 15:2 A ':': , I i4 BURBA, DANIEL JOSEPH: 1VM, Grayson, KY: BURKETT, BRUCE GENE: 3VM, Faubush, KY: BUTCHER, JERE W.: 3VM, Lexington, KY: CALLAHAN, MICHAEL F.: 3VM, Villa Hills, KY: CALVER, MICHAEL CARL: 2VM, Lexington, KY: CARPENTER, JIMMY S.: GVM, Mooresville, NC: CARTNER, SAMUEL CORBIN: 4VM, Newland, NC: CHAMBERS, BAUER LISA: AVM, Birmingham, AL: CLAUNCH, DAVID REED: 1VM, Versailles, KY: CLEMONS, CONNIE LEE: 1VM, Hueytown, AL COBLE, RAY HOLT: 4VM, Greensboro, NC: COFFREY, DARRELL LYNN: 1VM, Columbia, KY: COGBURN, CINDY D.: 2VM, Ranch Candler, NC: COLEMAN, GARY DWAYNE: 2VM, Auburn, AL: COLLINS, MYRA DAWN 2VM, Wrigley, KY: COLSON, KAREN JEAN: 4VM, Northport, AL: CONNER, JOHN: 2VM, Scottsville, KY: CONRAD, LOUISE STITES: 2VM, Auburn, AL: COOLEY, WILLIAM H.: 3VM, Wagnam, NC: COOPER, WILLIAM RICHARD: 3VM, Charlotte, NC CORUM, DENISE M.: 1VM, Louisville, KY: COTTON, CHARLOTTE A.: 4VM, Russellville, AL: CULP, CATHY ANN: 3VM, Mobile, AL: DANIEL, GREGORY B.: 4VM, Corbin, KY: DAVIS, DONNA KATHRVN: 2VM, Louisville, KY: DAWKINS, WILLIAM: SVM, Winston-Salem, NC: DOUGHERTY, JOHN PATRICK: 1VM, Hopkinsville, KY: DUNGAN, HARDY: AVM, Paris. KY: DUPRE, LAURIE ROBIN: 3VM, Jeffersontown, KY: EDGE, TERESA E.: 4VM, Owensboro, KY ELLIS, HORACE LEMAYNE: 1VM, Danville, KY: FISHER, JOEL: 4VM, Canton, NC: FORRESTER, SHARON DRU: 2VM, Ashford, AL: FOSTER, STEPHEN E.: 2VM, Concord, NC: FOUNTAIN, VICKI LORINE: 3VM, Skipperville, AL: FRENCH, MARK ALAN: 2VM, Mt. Washington, KY: GAROFOLO, PAUL ANTHONY: 1VM, Ft. Mitchell, KY: GEHRINGER, JANE MARIE: 2VM, Ashland, KY: GILLUM, RONNIE WILSON: 3VM, Burke, KY: GLASSCOCK, MELANIE ANN: SVM, Cullman, AL GRAHAM, DOYLENE: SVM, Greensburg, KY: GRAHAM, LYNN: 4VM, Bowling Green, KY: HAINES, WALTER GRANT: AVM, Auburn, AL: HALL, REBECCA E.: AVM, Union Springs, AL: HARTSELL, ROGERS: AVM, Concord, NC: HATAWAY, BELINDA D.: 2VM, Montgomery, AL: HAYES, MARK: AVM, Burlington, NC: HAYES, ROBIN: 4VM, Greensboro, NC: HAYNES, STEVEN CLINTON: 4VM, Auburn, AL: HECK, DANNA: 4VM, Cullman, AL HERNANDEZ, JENNIE YOUNG: SVM, Hampstead. NC: HEFINANDEZ, MICHAEL: 3VM, Horse Shoe, NC: HOLMES, MICHAEL: 1VM, Auburn, AL: HORKY, KITTY G.: AVM, Montgomery, AL: HORNER, ANDREW: 3VM, Asheboro, NC: HOWARD, BILLY WAYNE: 4VM, Sandy Hook, KY: HOWELL, KECIA: SVM, Andalusia, AL: HYAMS, DEBORAH H.: WM, Auburn, AL: JACKSON, LEIGH J.: 1VM, Auburn, AL: JOHNSON, LOUIS DEAN: 4VM, Nicholasville, KY JONAS, LISA ANN: AVM, Fayetteville. NC: JORDAN, MITCHELL CARTER: 4VM, Auburn, AL: KAPOOR, KARL N.: SVM, Auburn, AL: KING, DENIS GERARD: 2VM, Guston, KY: KLINE, CARYL: 2VM, Louisville, KY: KNIGHT, LINDA A.: 1VM, Wetumpka, AL: LAGODNA, MARTIN MICHAEL: 1VM, Winchester, KY: LAMB, WILLIAM DOUGLAS: 2VM, Huntsville, AL: LANE, JAMES CARTER: SVM, Harrodsburg, KY: LANNING, LYNDA LEE: SVM, Charlotte, NC LAUDERDALE, DONNA G.: 4VM, Elkmont, AL: LEACH, EDDIE N.: SVM, Hartford, KY: LONG, JOSEPH A.: 3VM, Elizabethtown, KY2 LYNN, FOX BAMBI: 2VM, Paducah, KY: MARTIN, JOHN DAVID: 2VM, Louisville, KY: MATTHEWS, CINDY LEIGH: SVM, Lexington, KY: MATTHEWS, MICHAEL R.: 1VM, Birmingham, AL: MILLER, ANGELA MARIE: 2VM, Elsmere, KY: MONTGOMERY, CAROLINE MORTON: 4VM, Atlanta, GA: MORLEY, JUDY M.: 1VM, Sanders, KY MORROW, GINGER: 4VM, Asheville, NC: MOSS, ALAN: 4VM, Hudson, NC: MULLER, SUSAN: 4VM, Huntsville, AL: O'BRYAN, MICHAEL: 4VM, Payneville, KY: ROGERS, STAN: GVM, Princeton, KY: O'GRADY, MARY C.: WM, Louisville, KY: PINKSTON, KELLY: 3VM, Glasgow, KY: RICHERSON, JOAN TAYLOR: 1VM, Burna, KY: RICKETTS, LISA HODGKIN: ZVM, Lexington, KY: ROBERTS, LAURIE EUGENIA: 2VM, Mobile, AL nocens, MONICA L.: zvm, Cullman, AL: Rom, Tom RICHARD: 3vM, Louisville KY: sAvLon, JEFFREY WAYNE: 2vM, Ml, Vernon, kv: sctllllllor, KENNETH P.: avlvl, nnodella. KY: scnmlnen, JOEL L.: Avlvl, Lexington, KY: snot-wen, LISA BRITTON: 2vM, Chatham, vA: SMITH, MIKE Jn.: avwl, Sylva, NC: SMITH, SALLY: 4vM, Talladega, AL: SMITH, SARALYN ELIIABETH: 2vM, Opelika, AL: SMITH, 'rem AUSTELL: 3vM, snelby, NC SNOW, REGINA GAIL: 2VM, Mt. Airy, NC: STATON, PAULA: 4VM, Auburn, AL: STEWART, MICHAEL WILLIAM: 3VM, Lexington, KY: STONE, TINA: 4VM, Covington, KY: SWALLOWS, ALICIA ANN: 4PPY, Dothan, AL: SWIGERT, REVELLY JEAN: 1VM, Shelbyville, KY: TARTER, MARK DESMON: 1VM, Nancy, KY: TEMPLE, ROBIN: AVM, Elizabeth City, NC: TENORIO, TOM: 3VM, Georgetown, KY: THOMPSON, LELAND: 2VM, Montgomery, AL TORSCH, ANDREW ROBERT: 3VM, Anchorage, KY: TRETTIEN, AMY LYNN: 2VM, Montgomery. AL: TURNER, DAVID A.: 1VM, Hopkinsville, KY: VAUGHN, REBECCA LYNNE: 1VM, Auburn, AL: VICK, KELLY ANN: 2VM, Birmingham, AL: WAGNER, DEBORAH JEAN: 4VM, Wilmington, NC: WAINWRIGHT, MARGARET ANN: 1VM, Louisville, KY: WEEKS, PAUL DOUGLAS: 3VM, Scotland Neck, NC: WEISS, JOHN A.: 2VM. Auburn, AL: WEST, MARGARET: AVM, Fayetteville, NC rm: 277 WHIKNER, DONALD WEST: 4VM, Greensboro, NC: WHITLOW, DAN MARION: AVM, Scottsville, KY: WICKER, BILL PERRY: 3VM, Sanford, NC: WILLIS, ELIZABETH LEA: 2VM, Auburn, AL: WILLS, STEVEN J.: 4VM, Auburn, AL: WOODWARD, JOE: 4VM, Mocksville, NC: WILSON, LOLLY S.: AVM, Auburn, AL: WOLICKI, ANN JESSICA: 4VM, Auburn, AL: YOCUM, JOSEPH GRANT: 4VM, Auburn, AL: YOWELL ANN MITCHELL: 2VM, Hustonville, KY McCLARY, DR. DAVID: Adviser: PECHMAN, DR. ROBERT: Adviser: WOLFE, DR. DWIGHT: Adviser: ALLMAN, WILLIAM K.: 4AM, Atlanta, GA: BASSETT, DWIGHT M.: 4FI, Mobile, AL: BELL, HUNTER S. III: 4OMN, Atlanta, GA: BENTON, JOHN MILES: 2GC, Birmingham, AL: BERRY, WALTER EDWARD: 1PB, Birmingham, AL BERTUCCI, PETER S.: IGC, Mobile, AL: BETBEZE, J. BENDER: SBSC, Mobile, AL: BICKSLER, HARRY J.: 2PL, Mobile, AL: BROWN, JACK V.: 4MN, Birmingham, AL: BRUHN, MITCH: 2BSC, Birmingham, AL: CAMPBELL, CLARK MOORE: 1PN, Signal Mtn., TN: CATO, W. WARREN: 2PB, Central, SC: COLEMAN, JOHN ROBERT: 1PL, Atlanta, GA: CONWELL, FRANK C.: SPV, Mobile, AL: COOPER, LLOYD BOWERS: 4lND, Birmingham, AL COPELAND, RILEY SCOTT: 2PB, Mobile, AL: CORTE, TRAE: 1APl, Montrose, AL: COX, DAVID MICHAEL: 2PB, Decatur, AL: COX, STEVEN: SME, Decatur, AL: CREEL, RICTOR H.: 2PB, Mobile, AL: CROWE, CHRISTOPHER P.: ZPB, Chattanooga, TN: CULP, C.G.: 2PB, Birmingham, AL: DIORIO, GARY: 4ME, Decatur, AL: DRENNEN, ROBERT H.: SARXBSC, Birmingham, AL: DRUHAN, DAVID ROSS: 2PM, Mobile, AL DYAS, CHRISTOPHER H.: APMXCH, Mobile, AL: DYAS, ERIC J.: 2PL, Mobile, AL: FRERRELL, M. SCOTT: lPB, Birmingham, AL: FREDERICK, REX J.: 3Fl, Mobile, AL: FUSTON, ROGER KING: 3lE, Signal Mtn,, TN: GIRDLER, RICHARD R. JR.: 4Fl, Birmingham, AL: GLASCOCK, AUGUSTUS MACNAIR: 2MN, Lookout Mtn., TN: GLASCOCK, CHRIS MOORE: SCHE, Lookout Mtn., TN: GODWIN, CLAY H.: 3PM, Mobile, AL: GORK, DANNY R.: 1PN, Chattanooga, TN : GUYTON, PHILIP DEWUSE: 1PN, Houston, TX: HARTMAN, JAMES WILBUR III: SAC, Mobile. AL: HEDBERG, ROBERT J.: 4MK, Mobile, AL: HENRY, PATRICK ALLEN: 2GC, Birmingham, AL: HINES, SCOTT CASSELL: 2PB, Birmingham, AL: HUDSON, STEVEN TAYLOR: 4BSC, Chattanooga, TN: HUGHES, MICHAEL ROBERTS: 4MN, Birmingham, AL: JOHNSON, CHARLES G. JR.: 3BSC, Mobile, AL: JOHNSON, MICHAEL B.: 4PB, Birmingham, AL: KANE, FRANK JOSEPH: 2FLF, Flome, GA KENNEDY, ERIC: APUB, Foley, AL: KIMBROUGH, KALVIN B.: 2AR, Foley, AL: LANDSTREET, THOMAS FAIRFAX: ZPRJ, Nashville, TN: LARUSSA, JOHN GREGORY: 2PB, Birmingham, AL: LEDFORD, RICHARD DANIEL: 3PD, Montgomery, AL: LIPSCOMB, JAMES S.: SHA, Auburn, AL: LITTRELL, MARK PEYTON: 2PB, Decatur, AL: MASTIN, ROBERT: M.: 3AC, Chattanooga, TN: MCALEER, JOSEPH GUY: IBSC, Mobile, AL: MCCULLOUGH, CHARLES M. JR.: 3ME, Atlanta, GA MCELHANY, DAVID EDWARD: AME, Mobile, AL: MCGUFFEY, BEN: 2lE, Rome, GA: MCKAY, JOHN HOWELL: 4Fl, Tampa, FL: MCLEOD, ANDIN CAPPS: lPM, Mobile, AL: MEADOR, JOSEPH W.: STN, Mobile, AL: MILLS, JOHN MCNAMARA: 2PB, Mobile, AL: MILSTEAD, DAVID G.: 3ME, Mobile, AL: MULLIN, DAVID ALAN: 2CHE, Chattanooga, TN: NELSON, CRAIG: 2PL, Chattanooga, TN: PACE, JOHN W.: 3AEC, Mobile, AL POWELL, COLEMAN: IBAC, Signal Mtn, TN: POYNOR, WILMER 'S.: 2HY, Shoal Creek, AL: REHM, KERRY M.: SAC, Mobile, AL: REGAN, CUMMINS W.: SPB, Mobile, AL: RIMMER, DANIEL THOMAS: 4INM, Birmingham, ALJ ROGERS, MICHAEL CHAPMAN: 1PN, Mobile, AL: SAYLER, JACK M. JR.: SBSC, Savannah, GA: SCHWALL, CRAIG LAURENCE: 2PL, Atlanta, GA: SHOULDERS, JIMMY: AEE, Mobile, AL: SHUGERMAN, HARRY: 2GC, Birmingham, AL SIMMONS, PAUL W.: SAC, Birmingham, AL: SKELTON, ALLYN ROSS: 2ME, Mobile, AL: SMITH, CHRIS A.: 2PB, Mobile, AL: SMITH, RUDYARD H.: SBSC, Mobile, AL: SOWELL, CHARLES LOUIS: SLA, Chattanooga, TN: STROECKER, KENNETH ANTHONY: 2PN, Mobile, Al.: SULLIVAN, PATRICK: ZBGC, Mobile, AL: SULTIS, CHRIS MORRIS: ZPB, Birmingham, AL: SUMMERSELL, TRIP: 1PB, Mobile, AL: TOOMEY, PATRICK DOBBIN: 2AC, Mobile, AL TROTTER, THOMAS FRANCIS: 3PM, Lookout Mtn., GA: WADLEY, KEVIN ROBERT: ZPUB, Tallahassee, FL: WALKER, JIMBO W.: IBSC, Birmingham, AL: WALKER, WILLIAM ALLEN: ZGC, Birmingham, AL: WALSH, MARTY JAMES: 2GC, Mobile, AL: WILLIAMS, CAREY PHILLIPS: IAC, Birmingham, AL: WOOD, ALLAN: AFI, Troy, AL: WRIGHT, JAMES MCDANIEL: SAC, Atlanta, GA ADAMS, J. OUINCY III: 5MT, Talladega, AL, ADAMS, JEFFERY ALAN: BPIR, Montgomery, AL: ADAMS, THOMAS S.: 3Fl, Talladega, AL: ALSUP, MICHAEL J.: 4CS, Fairhope, AL: ANDERS, RONALD LYNN: IPB, Auburn, AL: ANDERSON, BRYAN W.: SBS, Destin, FL: ANDERSON, MURRAY B.: IPE, Opp, AL: ANKENBRANDT, DAVID JACOB: 2PV, Huntsville, AL: BARBER, PAUL L.: 3AC, Opelika, AL: BARKER, CHRISTOPHER ALAN: lCE, Birmingham, AL 278 mx-me-om 1 we I I' if , A 1, V V A ' r :-t 3 , ,. I iiiif . .V Y 'i ...,. .. : I . vu Kwgf , TJ mfg ' if ' 1 Q I III : I , ,L , :::::::l'::i: I ,i M: V. X , 9 fi K. i?Q . A .4 -Ja R., , 'I 3 if , . fr: ifffiki f :,, if I -T! K 'II , X , it I 15 .I X Y X 1 1. .rg ma , -i , Ig 2 Q. H s J : - ' 4: 35 ::,,,5 . ' . ,., , yt , , , ,, . , f . ea ,, I ,E ' Q. , if ,gm AVA., Yu 1:1 ,,,, , , ,l :Q I f, X it i I be 'V i A XT 5.35 I V5-z -I I 5, gy y A ,, , , ,W , , , , ,, ,,f? , i ' 4 , J' , , ,, , L 3? .-1 ., 4 -1 3 ' A F y iq . 4 1, Q: X 5 L. I ,ts 4 , y , , ., , y ,, , , i ,W I , If 134k I , I A' I 4 ift A I V i f My. f . I . .- , , 4 'jj L - L , M ,. :V It X , f V k fa ,, 'fs Qi: k ' , gf V I? If f I . f , : b we A , i '- , 1 Q f 7- I Q f Q , , fi if X W , , , , , , 1:9 ,WJ :K . :ffl f iw wif? I r ' A I ! ' I I I ' A , , rg , :Q Q 4, ,- it A A I -A ' , .,4, ,A,, . Q ia X , s fl J' 'f X ,,,, . , :ig I v 3: 'Wil I ' g Q fr ' - Ie, . I Veg? I I f, g BARTHOLOMEW, CHARLES THOMAS: 3CE, Gritlin, GAB BEVERLY, DOUGLAS HUGH: 2AC, Ozark, AL: BLACK, JAY: 3CS, Dadeville, AL: BREEDLOVE, DAVID WARREN: AAB, Opp, AL: BROWN, JOEH M.: 4Fl, Daphne, AL: BULLOCK, GUY W.: IIE, Dunwoody, GA: CAMPBELL, H. DUNCAN: 4ME, Montgomery, AL: CARL, CHARLES T.: 4BSC, Opelika, AL: CARR, BART: 4PL, Birmingham, AL: CHAMPION, ALLEN B.: 4PS, Aibertiville, AL W CHILDRESS, GEOR AE WILSON: IPM, Floanoke, AL: CHRISTONBERRY, ILLIAM: AVSA, Montgomery, AL: COCHRAN, THOMAS H.: SBS, Sylacauga, AL: COLLIER, JEFF: 4OMN, Jacksonville, FL: COOKE, MITCHELL F.: SBS, Opp, AL: COWART, PHILLIP O.: AAG, Gallion, AL: DAVIS, MAURY JOSEPH: 3Fl, Dadeville, AL: DEER, RICHARD ALAN: 2AC, Monroeville, AL: EDWARDS, JOHN: 3MBl, Pensacola, FL: ENGLISH, HOHN ALAN: ZPN, Birmingham, AL FARRIS, BUBBA: SFI, Dothan, AL: FARRIS, C. KIMBO: 4Fl. Dothan, AL: FAUGHT, DAVID WILLIAM: 4Fl, Birmingham, AL: FORESTER, GOOBER S.: 5lNM, Auburn, AL: GARRARD, KENNETH W.: SAM, Birmingham, AL: GIPSON, DAVID: SPM, Albertville, AL: GLASSCOCK, JOHN OWEN: 3AC, Florence, AL: GLASSCOCK, STEVEN RYAN: 4AC, Birmingham, AL: GODWIN, BILL: 4BSC, Montgomery, AL: GODWIN, JOHN STEPHENS: 4LA, Decatur, AL GODWIN, ROB ANDREW: SCS, Auburn, AL: GOOCHER, SCOTT ORIN: SIE, Montgomery, AL: GRAVES, WILLIAM D.: 3ME, Alexander City, AL: GRAY MURRAY DANIEL III: SAR, Columbus, GA: GRESHAM, WALTER L.: 2PR, Birmingham, AL: GRISSETT, RODGERS: SPN, Talladega, AL: GUNTER BARRY JAMES: 2PB, Birmingham, AL: HAJEK, PHILLIP DAVID: 4MC, Auburn, AL: HANCOCK, JAMES HUGHES, JR.: 2PB, Birmingham, AL: HARRIS, KENNETH LEON: IPM, Ozark, AL HAWKINS, JEFFREY DAVID: 3BSC, Montgomery, AL: JENDERSON, J. GREG: 4AC, Opp, AL: HILLMAN, FANG CARLTON: 5ADS, Winter Park, FL: HOWARD, ALAN L.: 3MK, Briertield. AL: HUFF, JEFF JOHN: 4CE, Birmingham, AL: HUGHES, J. GARY: 4OMN, Birmingham, AL: JORDAN, JAMES FRANKLIN: 4VBl, Montgomery, AL: JOSEPH, CHARLES K: 4BSC, Montgomery, AL: LAMB, ALBERT: VSA, Americus, GA: LEE, STEWART: ACE, Birmingham, AL LUMMIS, GREG K.: IPN, Auburn, AL: MALLORY, ROBERT THOMAS, JR.: 4MCH, Sylacauga, AL: MANN, ROBERT, FELTON JR.: IPB, Birmingham, AL: MASSEY, CLAY JACKSON: 4ME, Birmingham, AL: MAULDIN, MACKE BUCHANAN: 4Fl, Leighton, AL: McANNALLY, ROBERT SIDNEY: 2PO, Decatur, AL: McBRIDE, JOHN BRYAN: 5, Muntord, AL: MCGLAMERY, GEORGE LEE: IPN, Florence, AL: McGLAMERY, GERALD GARRIS: SCE, Florence, AL: MCKISSICK, E. CRAIG: SPT, Montgomery, AL MILLER, RUSSELL G.: AADS, Elmore, AL: MITCHELL, WILLIAM TAYLOR: IGC, Little Rock. AP: MORRIS, SCOTT GREGORY: AMCH, Birmingham, AL: MOULTRIE, PHILLIP D.: 4Fl, Albertiville, AL: NAUGHTON, ALBERT STEPHEN, JR.: 2PM, Birmingham, AL: NESBITT, W. SCOTT: SCS, Gadsden, AL: NORWOOD, ROBERT, STACY: 2AEC, Fayetteville, TN: NUNN, JIMMY: 4PB, Montgomery, AL: O'NEILL, TIMOTHY JAMES: IPB, Marietta, GA: OSTENSON, STEPHEN RICHARD: 3AC, Montgomery, AL PATTERSON, KIRK ALAN: 2GBl, Dothan, AL: PREWITT, MALCOLM LEROY III: SAC, Decatur, AL: OUARLES, J. COBB: 4BSC, Dalton, GA: ROGERS, GE-OFF M.: 4PISS, China Grace, NC.: RUMBARGER, TOBY: 3lNM, Birmingham, AL: SANSOM, ROBERT BRUCE: IPD, Montgomery. AL: SAUNDERS, THOMAS J.: 3Cl-IE, Auburn, AL: ACHUSTER, CHRIS ALAN: 3lNM, Columbus, GA: SCOTT, AUBREY: 4MCl-I, Montgomery, AL: SCOTT, WILLIAM G.: 3CE, Birmingham, AL SHEPHERD, JOSEPH NEVILLE: 4PM, Opelika, AL: SHERROD, DAVID A.: 2BS, Birmingham, AL: SIBLEY, JEFF L.: 3Ol-l, Mt. Hope, AL: SIMMONS, W. ALLAN: 3INM, Auburn, AL: SIMS, BILL A.: IPM, Decatur, AL: SMITH, CLYDE MICHAEL JR.: IPN, Vestavia, AL: SMITH, DOUG W.: 4EE, Tallahassee, FL: SMITH, V.: 2AFl, Griffin, GA: SORSBY, DAYTON PHILLIS: SMK, Birmingham, AL: SOUTH, EDDY LAMAR: AMK, Opelika, AL SPEAR, BRIAN STANLEY: 2AC, Montgomery. AL: SPORT, HAYWOOD JR.: 2PB, Montgomery, AL: STEIN, JOHN STANLEY: IPB, Birmingham, AL: STONE, ALVIN JR.: IPB, Pine Apple, AL: SWINSON, MICHAEL K.: SME, Auburn, AL: TAYLOR, GREGG WILLIAM: 2ME, Dothan, AL: THOMLEY, MARTIN LEE: SPM, Birmingham, AL: THOMPSON, J. VINCE: 3PFl, Chatom, AL: THORNTON, BARRY STEPHEN: 3PM, Auburn, AL: TODD, KENNETH L. III: 2PM, Dothan, AL TWESME, DAVID A.: SMCH, Sylacauga, ALL WALLER, STANLEY ALAN: 2PN, Dothan, AL: WATTS, ALAN SHELBY: 2ME, Birmingham, AL: WAUDBY, ROBERT H.: 4GL, Birmingham, AL: WENZLER, RONNIE: 4PFiS, Germantown, TN, WERTHEIM, JEFFREY HARMOND: SMK, Miami, FL: WHEELER, LEWIS CLAY: IPN, Birmingham, AL: WHITTEN, DAVID M.: SME, Decatur, AL: WILSON, JEFFERY RAY: SIE, Montgomery, AL: WILSON, MARK E.: SMB, Jasper, AL WOLLER, RONALD RAY: AME, Decatur, AL: WYNN, WILLIAM JEFFERSON: IPM, Huntsville, AL: TAYLOR, MELINDA ELISABETH: Sweetheart, Brentwood, TN: WOOLF, JANE: HOUSEMOTHEFZ: ARMSTRONG, MARK RICHARD: AEE, Dothan. AL: BARBER, ANTHONY: 3AFl, Auburn, AL: BAUGHAN, JOE WILLIAM: 2AFi, Birmingham, AL: BOLEN, KEITH: BAM, Cantonment, FL QFA--:Kip 279 CENTO, PETER FRANCIS: AME, Warner Robins, GA: CHENEY, CLIFFORD ROYCE: 2AN, Cantonment, FL: CLARK, GURVICE ASHLEY: SAC, Phenix City, AL: DOBBINGS, DAVID DONALD: 4MN, Auburn, AL: DOWNING, MICHAEL LARY: 3BA, Bloomfield, MI: EVANS, JOHN L.: SEE, Russellville, AL: HILLMANN, EDWARD AUGUST: 2CHE, Atlanta Highlands, NJ: I-IODGES, KEVIN DEAN: AEE, Birmingham, AL: JOHNSON, RICKEY LYNN: 1AE, Hayelock, NC: LAND, DIXON ALAN: 4AC, Cantonment, FL LEE, JEFFREY ALAN: 1PN, Pell City, AL: LEE, THOMAS DALE: 1CJ, Pell City, AL: MAKOFSKE, ROBERT: 4EE, Canaveral, FL: PERRY, ROBERT EARL: ITMT, Pell City, AL: ROBERTSON, MICHAEL WAYNE: 3HY, East Point, GA: STORIE, GARY WILLIAM: 4GHY, Birmingham, AL: THOMPSON, ROBERT WAYLON: 2PL, Russellville, AL: UNGER, TIMOTHY GLEN: AAC, Wyckoff, NJ: WHITE, THOMAS G.: 2AC, Bas King Ridge, NJ: WILLIAMS, MICHAEL ALLEN: 1AFl, Mobile, AL NAGLE, TROY: Adviser: WARMAN, JAMES: Adviser: ALEXANDER, JOHNNY J.: 2PBSC, Georgiana, AL: BLACKWOOD, KEN: SPB, Faulkville, AL: BRANTLEY, TOMMY L.: 1PN, Montgomery, AL: CHITWOOD, SKIP: 4MBl, Fort Payne. AL: CLARK, K. TYRONE: 4PFtS, Fort Payne, AL: DORMAN, BARRY M.: 3TN, Opelika, AL GRAHAN, FRANKLIN RYAN: AVAG, Cullman, AL: HARMON, VERNON E.: 3AC, Wetumpka, AL: HODGSON, CHARLES G.: 3BSC, Montgomery, AL: JOINER, PHILLIP WAYNE: 2EE, Birmingham, AL: LESLIE, WILLIAM MARD: AOMN, Decatur, GA: LUTHER, WILLIAM A.: SGC, Opelika, AL: MASK, CHARLES BARRETT: APUB, Alexander City, AL: MCCONNELL, JAMES C.: 2GC, Wetumpka, AL: MICHAELS, KENNETH R.: 3ME, Montgomery, AL: NEELY, TOMMY ED: 2GC, Hayden, AL NIKCEVICH, JAMES M.: 4FLT, Homewood, IL: NIX, RUSSELL BLISS: 2AEC, Montevallo, AL: NOEL, WILLIAM W. III: 1PN, Seaford, DE: OBERT, WILLIAM GERALD: AEE, Ashlord, AL: PARKER, WENDALL R.: ABSC, Evergreen, AL: POWELL, WILLIAM CHRISTOPHER: 2HPE, Titus, AL: ROBINSON, MICHAEL WAYNE: 2PUB, Alexander City, AL: ROGERS, DAVID SCOTT: ZPBSC, Wetumpka, AL: ROWE, JOE EDWARD: 4ADS. Wetumpka, AL: SASSER, JEFFERY: 2GC, Alexander City, AL SIDES, DAVID L.: 4PL, Wetumpka, AL: SLAUGHTER, BRIAN: 4BSC, Wetumpka, AL: SLAUGHTER, STEVE: SPB, Wetumpka, AL: STRICKLAND, DAVID: 1GC, Wetumpka, AL: STRICKLAND, JOHN: APBSC, Wteumpka, AL: STRICKLAND, ROBERT: SPBSC. Wetumpka, AL: STUBBS, JAMES M.: 2VAG, Titus, AL: STUDDARD, BOBBY SCOTT: 2PB, Montevallo, AL: TERRELL, MURRAY D.: 4ADS, Titus, AL: TIDWELL, THOMAS EDWIN: 4OMN, Montgomery, AL TRAYLOR, WILLIAM D. JR.: 2PB, Equality, AL: VRZAL, JAMES H.: AMK, Decatur, GA: VRZAL, MATTHEW D.: 2FY, Decatur, GA: WILHITE, DANIEL: AAEC, Falkville, AL: ABNEY, CANDY: SCEE, Birmingham, AL: ACOBA, EDWINA: 2PB, Panama City, FL: ADAMS, BEVERLY J.: AGSC, Bradenton, FL: ALDRED, TRACEY: BGSC, Nashville, TN ALLISON, DELIA: SPB, Macon, GA: ALTOMONTE, KARYN: 2NUFt, Valley Forge, PA: ANDERSON, BETH: SEEC, Atlanta, GA: ARANT, MARY CLAIRE: 1GSC, Atlanta, GA: BAILEY, GWEN: 3PB, Atlanta, GA: BATES, MICHEL: 2GC, Dalton, GA: BATLEY, DAWN: 4Fl, Montgomery, AL: BEERS, DEBBIE: 1PB, Birmingham, AL: BEERS, LAURA: 2FM, Birmingham, AL: BISHOP, GIGI: 2PB, Rome, GA BOREL, DEENA: IPB, Mobile, AL: BOSTROM, JANE: 2VAT. Fairhope, AL: BRASWELL, DONNA: 2PB, Chamblee, GA: BRISCUSO, BOBBIE: AFLT, Potomac, MD: BROOKS, CLAUDIA: 2PFtS, Marietta, GA: BUCK, BETH: 2NS, Birmingham, AL: BURGESS, KIM: 3PFlS, Marietta, GA: CALLAHAN, PATTI: INS, Coral Springs, FL: CARNATHAN, THERESE: 1GPG, Mobile, AL: CHAMBERS, MIMI: SGEH, Atlanta, GA CHILDERS, ANGEL: 3CJO, Birmingham, AL: CHILDERS, CINDY: 4CSC, Birmingham, AL: CLIFFORD, ELIZABETH: IFM, Tallahassee, FL: COCHEU, THEA: 2VAT, Tampa, FL: COOK, JULIE: 2CHE, Roswell, GA: COOK, ROBBIE: 1PB, Homewood, AL: CREMIN, TARA: 1PM, Huntsville, AL: CROWE, SUSIE: AHHE, Mobile, AL: D'AMICO, FRAN: 1PPY, Birmingham, AL: DAVID, CAROL: 2PB, Birmingham, AL DENTON, MARY: 1GC, Washington, DC: DICKSON, DONNA: ZNF, Huntsville, AL: DIXON, CATHY: SSCR, Marietta, GA, DOBSON, LEE: 2VHE, Acworth, GA: DOTSON, ANGELA: 1GC, Marietta, GA: DYER, DEE DEE: 2PB, Winston - Salem, NC: EDWARDS, CAROLYN: 1PFlS, Marietta, GA: ERVIN, JENNIFER: 3ME, Mobile, AL: ETHERIDGE, SUSAN: IFM, Sweetwater, AL: FLYNN, MARY BETH: ll-UB, Decatur, AL FOSTER, LISA: 4FM, Tampa, FL: FOUNTAIN, LACEY: 2PB, Doraville, GA: FULLER, JULIE: SCEE, Newnan, GA: GARRETT, KELLY: 2PFlJ, Carrollton, GA: GOODREAU, MELANIE: SGC, Panama City, FL: GORDON, SUSAN: AFCD, Newnan, GA: GRELIER, MARIE: 1GC, Birmingham, AL: GRESHAM, DEBBIE: SCEC, LaGrange, GA: HALL, JULENE: 2VOA, Atlanta, GA: HALL, TEREZA: tPT, Fairhope, AL 280 fbxw-QKT-oil: if 1 It , r I' l A S , :,,. I ' k - , , - fi A: , 'V ,, ff r rr I ' f - 'I - . f ,,yy , ..,,, y y V y Qi? X I! 'V A I in ' A' I Q I I' . r ,, L A r ' 'f If ' V -r , . ' , F' Q V Y ., me A or , :ak It ' ,V Q ng, JSI. H K 2-1, It -..1 VW X V :gym 1. '- 1 f': 2- 1 KY .,,. i .ie -ff-- -- V A ,,,, y , y . ,,,, , 5' y 2 Q 5 4 1: ,K :-': - I 5. , K X x ' ii wasp? 8 i -f -.-,- 3 X -rsx we-1 A Q 1 ---f1 s ass ,f'- - -,.---1,:,.. .sw ,. S l I A S iiilii ' ' 35: 1 Q ,C C s::f': . s o , I ' it ,V A , f ,L - - , V. g .I ,, tg i . A . 'iw ' ,i 2 5 ' 'J ' i . 'i ,,:,. ,. if : , my we 60 lg ,W , 7 f 1 .. J A 354 ' . 5 H+ W 11 tt , . , , r , K iyf.-psf, I . ' iff. 4 V M2 35 , 1 9' f A gg .1 fl' ' ' sf' A f ff 1 I 'W az W , ,LK ' 45: A 1 'mi I I We 'Y' ev, , - ' 1' 'fm PEW? fri' 'utztfwi 4 1 I ff' mfr' . Q.: -f. ,raw wr- ,, W ff' ',.. i , A- V . g I , '- it l , . We ffm ff , zrrfff A-ff ,J , , -4 A f ,3fa,.,,.,,,, . l.,, M, rf, , f , Hg a Ar n f f .- I -1' 5 Q ' 1 in ' M 'ian' Q2 C'f' . fis f 'ja' A - g 4, , . . '1 1.1 . . My ,-- ,1 , fy ,,,r,, r ,Qi ' I: ' P ii 'wtf W ' .li A ' 1 l l gf. , ,... ..,:,,,, , , r .vi nn, f A' . Q I I 52 ,- 7 T f ' J' y i . ' I f f -is 5, v 3 Z' We 4. fvfzrift ,: , W 2 f 9' , . ,, ?,,,-3' ,- . -W f gs,-1-J , .Q I v qv ., I 1 i , v. ., Af ,, , i l X I 'V i :W fa W x 1 A 2 iv ,A mam A ,J S J B, , 2 f f 1:1 3 i I ff , ' ' I 'E ,I f f 4 it Q J , X V , '3 F 'i - fvrik- , B ' ,Q Q 'fy - Q fs o A J' 4 5 f I . nrt M fs if? A 1 A wr , Ar 1 .M 1, Q , pdf' 'Nr 4 f 3 , 1 M I Z K' f ali' fQ f 'K 1 9? 4 1 14, f x f f 3 + I gr y, , J , V A f ,, ' -1,2521 , : 4 2'- f ' V . SQWEJZYJS A . I W? fa :ff J? 'W 'if A J? gi, 4 . JMX: 'U Wa' if 4 A r 4 A fm ,A if: ,am -i . .- ,f .M U ,gh 'W' 5 AW i ' 9 A I. ' fl 1 : 4 1 ,, V W . f, fr , 4 ff r A ff f 335, V, ,.., , HARGETT, LISA: 2OT, Decatur, AL: HAUG, ELISE: SPM, Dunwoody. GA: HAVRISIK, DONNA: 1PN, Clopton, AL: HEARNE, LEE ANN: 2PB, Nashville, TN: HENDERSON, VICKI: ARSM, Birmingham, AL: HERREN JUDY: 2PB, Birmingham, AL: HICKMAN, LEIGH ANN: IPH, Birmingham, AL: HILL, BECKY: 2F'B, Decatur, AL: HOWELL, TRACI: 1GC, Huntsville, AL: HUFFCUTT, NATALIE: ZCEE, Camp Leleune, NC JENKINS, ASHLEY: 4 PRJ, Birmingham, AL: JERNIGAN, JOANNA: lPPY, Murlreesboro, TN, JOHNSON, JANET: 3lB, Decatur, AL, JOHNSTON, JODIE: 3FM, Brundidge, AL: JORDAN, PAM: ZGC, Savannah, GA: KAISER, JENNY: 3Hi-iE, Carrollton. GA, KAISER, JILL: SPRS, Carrollton, GA: KANE, ELIZABETH: IVAT, Rome, GA: KELLY, CATHY: ZCSE, Bepton, AL: KENT, MELINDA: 2PB, Helen, GA KING, NECIE: 4GSC, Huntsville, AL: LAWHEAD, JILL: 4CDP, Mobile, AL: LEHNER, KATHY: ZPB Tampa, FL: LIVELY, DIANNE: 3PRJ, Huntsville, AL: LOWERY, BETH: 3ID, Raleigh, NC: LOYD, EMILY: SMK, LaGrange, GA: MAFFETT, HOLLY: AFCD, Atlanta, GA: MALLORY, BESSIE: 1VAT, Macon, GA: MAYSON, CAROLYN: IVAT, Mobile, AL: MCCLURG, ALLISON: 2PB, Cartersville, GA MCELVAINE, SUSAN: SHSA, Mobile, AL, MEADE, JANE: IPB, Florence, AL: MOORE, MELODEE: ACDP, Miami, FL: MOORE, SANDI: 1PN, Mobile, AL: MORROW, LOFII: SPRS, Carrollton, GA: MUNGER, MARGARET: IGC, Birmingham, AL: MURCHISON, DANNA: 2OT, Birmingham, AL. MURRAH, AMY: ll-DB, Carrollton, GA: NEWCOMER, SUSAN: ACFE, Birmingham, ALL NEWEY, GAYLAN: ZECE, Atlanta, GA NICHOLS, CAROL: SFLS, Columbus, GA, NIPPER, LEIGH ANN: 2PB, LaGrange, GA: O'NEAL, RENEE: 2FLT, Birmingham, AL: OWEN, DARBY: lGC, St, Petersburg, FL: OWENS, ANN: 3PB, Huntsville, AL: PALMER, ANGELA: IPL, Jacksonville. FL: PATTERSON, KATY: lGC, Atlanta, GA: PAYNE, KIM: ICEE, Marietta, GA: PERSINGER, MEG: AVAT, Lookout Mountain, TN: PIPES, JANI: AFLT, Birmingham, AL PIPES, JERI: 4MK, Birmingham, AL: PLUMMER, FRAN: ZGC. Grove Hill, AL: PRICE, TINA: 2PB, Dothan, AL: PRUET, KAKI: 2NUFl, Birmingham, AL: PURCELL, ROBIN: 2PB, Decatur, GA, RATCHFORD, MARGARET: IGC, Huntsville, ALL READER, MARIA: ZAC, Dadeville, AL: REDFIELD, JULIE: 2GFL, Miami, FL: RIGBY, SHERRI: 2PB, Mobile, AL: ROBINSON, CAROL: lGSW. Birmingham, AL ROBINSON, CAROL: lGC, Birmingham, AL: SAIA, CLAUDETTE: ZHPE, Auburn, AL: SAILORS, DEBRA: IPBS, Atlanta, GA: SALMON, TRACI: SGSC, Birmingham, AL: SALTER, LORI: IPB, Birmingham, AL, SCONYERS, MELINDA: QPRS, Dothan, AL: SEATON, LENI: AFCD, Bellair Beach, FL, SIMMONS, LAURIE: AFM, Greenville, SC: SIMPSON, KELLY: 1GSC, Hugson, OH: SLAUGHTER, BRENDA: ANUR, Birmingham, AL SMITH, ANN: ANUR, Cherry Point, NC: SMITH, JAN: tGC, Cherry Point, NC: SMITH, MARILYN: 'lVAT, Macon, GA: SNOW, CAROLINE: 2LI-IY, Oak Ridge, TN, SPINA, PROVY: 4CEC. Brimingham, AL: STAGG, KIM: 1PN, Birmingham, AL: STEVENS, LYNN: 2AC, Birmingham, AL: STUTTS, LORI: 3Fl. Dothan, AL: TATE, HELEN: 2PB, Atlanta, GA: TAYLOR, JUDY: 2FlSM, Signal Mountain, TN THORN, CINDY: 2PB, Birmingham, AL: TREXLER, SUZANNE: SPL, Atlanta, GA: TROTTER, CASS: 4+-lA, LaGrange, GA: TURNER, SANDY: WPB, Birmingham, AL: VREATT, LINDA: SGC, Gadsden, AL: WALDROP, LISA: lFM, Auburn, AL: WALKER, JANET, 3HA, Birmingham, AL: WALKER, PAM: 1PCN, Huntsville, AL: WALSH, CARYN: 2PB, Matairie, LA, WILKS, JANE: 1NS, Carrolton, GA WILLIAMS: CATHY: ACEC, Perry, FL: WILSON, CINDI: IIE, Smyrna, GA: WRIGHT, PATSY: AFM, Montgomery, AL: WYNN, NANCY: IPRS, Orlanda, FL: YAROSZ, JONI: lGPG, Miami, FL: ADAMS, LANCHE: 2PB, Birmingham, AL: ALLEN, KAREN: 1PB, Huntsville, AL: ANTONY, LORI: SME, Montgomery, AL ATKINSON, KATHERINE: SGPO, Fort Walton Beach, FL: BAILEY, DONNA: 4FiSS, Pensacola, FL: BARNETT, CINDY: APIFI, Birmingham, AL: BEARD, WHITNEY: 3FiSS, Macon, GA: BECK, MISSY: 2PV, Mobile, AL: BENTLEY, KIM: 3NS. Sylacauga, AL: BEOUVICH, BETSY: AVAT, Pensacola, FL: BEOVICH, MOLLY: SADS, Pensacola, FL: BLACKWELL, NATHALIE: 2PB, Linden, AL: BLANKENSHIP, RIKI: 3AC, Montgomery, AL BOWEN, HEATHER: 2FCD, Atlanta. GA: BRADFORD, CARLA: 2PM, Fulton, AL: BRAXTON, AMY: ZPB, Auburn, AL: BREWER, BECKY: SFCD, Fort Walton Beach, FL: BROWN, KATHY: 2PFtS, Dunwoody, GA: BURRY, LOU ANN: SHPR, Leesburg, FL: BURT, CINDY: 1PN, St. Louis, MO: CALLAHAN, CAROL: lGPG, Jackson, AL: CAPE, KAREN: BGC, Mobile, AL: CHARLTON, ANN: 4AC, Birmingham, AL QM-HB4: 281 CHRISTIAN, LISA: 3FCD, Huntsville, AL: CICIO, VALERIE: 3PB. Birmingham, AL: CLARK, MELISSA: IPB, Dunwoody. GA: CLEVELAND, RUTHIE: tGC, Mobile, AL: COBB, BEBE: ABSR, Mobile, AL: CONNER, LAURA: 4NUPt, Montgomery. AL, COPPER, SUSAN: IPB, Naperville, FL: CRAFT, JOANN: IAB. Citronelle, AL: CRANE, CAROL: 2PN, Birmingham, AL: DAVIES, MARTHA: 3FI, Siganl Mtn, TN DAVIS, MARIANNE: 4GEH, Naples, FL: DILLARD, DIANA: 3AC, Mobile, AL: DUKE, BETH: 3MB. Libertyville, IL: EICHELBERGER, LEE: 2AC, Huntsville, AL: FAIRFIELD, MICHELLE: IGC, Atlanta, GA: FITCH, NAN: SGPG, Huntsvulle. AL: FONDE, BETSY: 3MN, Mobile, AL: FOWLER, MARIA: SCEE, Gadsden, AL: GRANT, SUSAN: 2PN, Louisville, AL: GRATTON, MARY JANE: BPB, Merritt Island, FL GRIMM, KELLEY: 3PB, Chattanooga, TN: GUIN, KELLI: IFI, Huntsville, AL: HAMILTON, SALLY: 2MC, Birmingham, AL: HARRELL, LISA: AFCD, Jasper, AL: HARRISON, JENNIFER: IPUB, Tallahassee, FL: HAYDEN, CATHY: 3NF. Mobile, AL: HERRING, KIM: 2lD, Decatur, AL: HERRMANN, SUSAN: AIFE, Centralia, IL: HIGGINS, SHANNON: iAM. Germantown, TN: HILL, ANNE: SEC, Montgomery, AL HILL, LISA: SCEC, Anniston, AL, HOLLAND, LAURA: AID, Mobile, AL: HOOTS, TRACY: 3VAT, Montgomery, AL: ISBELL, DEANNE: BEE, Signal Mtn.. TN: KAISER, TAMMY: 2PFiS, Foley, AL: KERDYK, KIM: 2LA, Coral Gables, FL: KERN, KIRSTEN: IPB, Fairhope, AL: KOMINEK, KAYE: ARA. Mobile, AL: LANGSTON, LORI: ACEE, Mobile. AL: LASTER, MARY LEE: 2F'B, Atlanta, GA LONG, MELANIE: AVBU, Birmingham, IAL: MALLORY, AMRY: IGC. Atlanta, GA: McCRACKEN, NANCY: IPB, Montgomery. AL: McCURLEY, D.D. 2PB, Hartselle, AL: McELHANNON, BETH: 4FM. Atlanta, GA: MOONEYHAN, ELIZABETH, IPN, Montgomery, AL: MULL, PHYLLIS: 2PB, Mobile, AL: MULLINS, PAT: IFSA, Opelika. AL: MURRAY, ALICIA: 2PB, Thomasville, AL: MURRAY, JANET: 4l-IPB, Mobile, AL NEWMAN, PAIGE: SCEC, Montgomery, AL: NOWELL, NAN: 3MU, Greenville, AL: PAGE, MARY LYNN: 2CTC, LaGrange, GA: PARKER, BETH: IGC, Hunsvllle, AL: PERKINS, JILL: ICEE. Mobile. AL: PHILLIPS, RENEE: 3HFlA, Bristol, VA: PHILPOT, CLAIRE: 1lD, Mobile, AL: PICCOLO, TRACY: ZPB, Montgomery, AL: PINSON, LISA: 2LT. Satellite Beach, FL: PORTWOOD, ALICIA: IGC, Atlanta, GA POWELL, LISA: ANUR, Guntersville, AL: PRIDMORE, MARTHA: SBSH, Oneonta. AL: PRINS, MINDY: ILT. Leesburg, FL: RADFORD, GINGER: iGPG, Moulton, AL: RHODES, VICKI: SRSS, Pensacola. FL: ROACH, ANGIE: 2PB. Knoxville, TN, ROBB, LISA: 2LT, Merritt, Island, FL: ROBERSON, ELLEN: 3PR, Moulton, AL: ROBERTS, BARBIE: ZPB, LaGrange, GA: ROBINSON, AMY: 2NS, Montgomery. AL ROBINSON, KIM: 3FM, Merritt Island, FL: ROBISON, TRACY: SEEE, Thomasville, AL: RYAN, LYNN: SFCD, Atlanta, GA: SANDBERG, JANICE: IGC, Winter Park, FL: SANDLIN, CONNIE: IADS, Cullman, AL: SASSER, SUSAN: 4AC, Decatur, AL: SAWYER, STEPHANIE: tlD, Birmingham, AL: SCHIESZ, MARTHA: 3MN, Mobile, AL: SHELTON, AMY: INS, Moulton, AL: SILLS, RENEE: 2FB, Linden, AL SIMS, DONNA: 2VBU, Ashland, AL: SKONEKI, CAROLE: SNUR, Montgomery, AL: SMITH, TYLER: 4Gl-lY, Mobile, AL: STANDARD, CINDY: 3GF'G, Macon, GA: STROUPE, KATHRYN: BGPG, New Orleans, LA: TERMINI, LAURA: IPB, Dunwoody, GA: THOMPSON, LISA: 2F'B, Birmingham, AL: WAGNER, CINDY: AFCS, Mobile, AL: WALKER, CARIE: 2NS, Jonesboro, GA: WEAVER, CATHY: 2PFlS, Mobile, AL WHISMANT, LINDA: SAE, Decatur, AL: WHITTLE, BONNIE: 2lD, Greenville, AL: WILKERSON, LYNNETTE: SGEH, Opelika, AL: WILKEY, ANNE: ACEC, Miami, FL: WILLIAMS, TERI: 2VAT, Macon, GA: WITMER, DEBBIE: 2lB, Marietta, GA: WOODBERY, HARRIET: SAC, Bainbridge, GA: WOODDALL, JENNY: 3PlFl, Macon, GA: WOOLLEY, DAWN: 2PY, Graceville, FL: WOOLWINE, TAMI: ZGSC, Winter Haven, FL WORD, LAURA: 2NS, Fairhope, AL: WRIGHT, CAROLE: IVAT, Mobile, AL: WRIGHT, MARGARET: 2ID, Mobile, AL: VARLING, DENISE: 2NS, Pensacola, FL: AKERS, JEFFREY JULIUS: 2GC, Columbus, GA: ALDRED, MIKE ALAN: 2MFiB, Auburn, AL: AWBREY, JAMES J. II: SCH. Auburn, AL: AWBREY, JON FRANK: IPB. Dunwoody, GA AZAR, KEN W.: 2VAT. Montgomery, AL: BAKER, JOHN BRARILY: IGC, Mobile, AL: BEARY, DOUGLAS LOUIS: SIE, Chagrin Falls, OH: BENNETT, DALE WINSTON: SAEC, Auburn, AL: BONE, JIM LEROY: 2GC, Columbus, GA: BOWIE, CHRISTOPHER ANDREW: AADS, Covington. GA: BRANNON, SAMUEL VANN: 2CJL, Roswell, GA: BROOKSHERE, BRENT B.: SPM, Dacron, GA: BROWN, WILLIAM H.: 3MK, Opelika, AL: BRYANT, DARRYL W.: 3FI, Daphne, AL 282 TIBGP-IIKA -we ,Qin si: if ,QI i A i ff' ? 'Fffz Qi J .i , If I fl -mga! f x I ' 9 ,X ,, M, .-1 fx 7 gi' A If , ar W' Q ,ht 9 I 0' M SS? , it ,- if .. I :, S.: I ,,,,,.t if ' 9 ist:-ef - - swttet.-i gt? I v 'tie X :ez fa: mes ' . . H if .. fe E - Q x Sex? I :L TN, X A S t , ' ' ir i'i , .- , A. f f' 'fix :F - il- .rf F ' ,fif - - I -' ., L. -A S, , . 1 . 'Q . n s l- 1 i .. ' 'S I i - 3 x t . If l 'I i I I F 1 - . ii ' . -r i A ' I' N V , Y, if 'i'f'L'iW5i'ff: , we? A ga EN . K' :ij Y A iw, A 'y qtgzfss f f, 2 i l 4 'I , g h N .,., t. . , ,..,.,,, , .F ., ,,.,,,. , , .,,, , , :N 2 Q Q :Q , A rir: ,, 'A we , , y..,. , ,.,, or L . 2 i fi Q e rg ' A SF' if L f 'f ., ,. ,,s E sig, -A was . N x RX I X XG? X' -K: Y :Ng-' , ' ' i' A A . ..,, . ,gg1i,, ,:,, . .,,,,, s :Q ,f.., , .1 SWL, S K, X E L :Q A , 1, S ' f - M-1'Q2?5',a' , XY' . . 9 I W t if , ', - if-., , , 3 , ff , , Q, ,.f , :la 1 1 ru. 'J ,M A I , ik RQ N S Xe , . N X' V G t , t XP X N .Qc S e S Egg A -A . :E 'Xi A '13 y H I 'xi ' x I S 12211212115 .2 I-f 'Eff s 1 - 195 his .e -et A ., , N v - Sr- AN: , N, Q -t. . , - X , ..,t,.. ,L .,,,, Q 'lbw tm' . .4 I if 2155, v L if A be . . -weqggta r fi? 5 f V, ,fbtf 1 mf 1 X '44 , z o? ,, ' ' tk 'I a ' , X t f 'XJ f I 1 ! L, ':,, P 37' 453 ,,tt ,.., . Q4 , f? I x I I F it A ' ,Q F , - . ff A :' - A 1' 1 I ,V 1,1 ,- ' f ' , ' ,tif 'WI L :fi f cr' - i 25, 25 I f As' - , L- , if ' . ' Qefkatzf I 53, ,J ,rf 1 !2!.i A' , . - ZEN: ailfgjw ' ,T f I Q 'ip . ,' ' ,sy .,:,t. V. ie: .1 -r ,Z ff 4 f, , ' -Q mt, ,1,g,f I, , A , .I 'W ,f 1 ' nr, ' I I ,af-.w. ' ' i tx' A ae I '18 A IC' ' AA: 1: F wi , . A ' S 3 wi :ir an., we -Lg' ' , f . 'Ri' . 1' x., ,Q X' 1 f ' I . i I f ,J iw A we F 1 it :sit 2 'T g-Y? i I . ' I gi Y ,-- , , .A : 5' K is 1 E ,WY Q4 ' f re. 41-f xp. f 24 i J - 2 3, , . f , I 5 E X r JSI: r ,IQ 'Q -.S , -dx x , ,Q-., v , i ,,., M2 X ,as- f J ,, Q K? A I' . ' I ZI4:'7' ff' , III -ZW ', ,...! L : t r -f ,, , I yi ,-,,, . sa., wi. , ,g 7 K ' Xen :. fl.. x ir -:-1. 0' t lil KN ., ,L A W l g V Al ,,, 5 1 ya i A W L 1 ff 1 l A H V . L,,,,A:. 'I ,, 12 :QR 5 A v , Q ,J X : A : A g ' gf Q: .w ' , if r aw, L 'W - ir lj. K X. :gif fd.. A A . igwth . ,., A ' 1 ' . iC,, : If gdffigif.. ,Jia ' aj, QA 'T-sf 0 ,, ,, V . , , 'Y . w ff Q Q : . I, - , , ' ar f 4 1 fff' P :Q-WW 1 3 ' ' t M: Q.: Q A 9, aw. Q, A mv e ,. 1 ' 5 E w I ' I f Q i e 'Q Q f ff k,, WK , f f I 3 Q I4 A T1 : ' f Q f M A 1 Tl .,, L 4 .: M an -2 2 t fm s A 1 sk N 'n A 6 U ' . I E. 4 1 . - 1 ,1-y f . my 5, , , ,, i y V Vu y A 6 M ' 1 5 'L I ef gf, ,:, 'Z Jia, t A Q, ,, ' 1 f 0 A , ,Wi , w, . - m gk ,M , 9 ea , - 9 , ., LW. r gf -A , f , if Q 1, H , H , . I fi: x :ah L A . 1 2' , li ,'Te,, ff 1 L, by ., sf, fr' t ' X A , :r , af , , I . . ,,k,h n 4, Q X25 3 X X My ry Z Q W 175 ' Y , L . BURKS, TONY DONALD: 2AC, Town Creek, AL: CARROLL, BLAKE MICHAEL: 1AEC, Auburn, AL: CARROLL, DAVID B.: AAC, Tampa, FL: CARROLL, JOHN LEWIS: 1GC, Montgomery, AL, CARTER, SAMMIE R.: 3MK, Frisco City, AL: CASEY, BRIAN THOMAS: SAC, Hudson, OH: CASTLEBERRY, RICHARD F.: 2PFlS, Birmingham, AL: CHANEY, ROBERT W.: 2MK, Auburn, AL: COCKE, BRADFORD S.: ZCPE, Alabaster, AL: CONWAY, CHARLES DAVID: 2EE, Atlanta, GA COOK, LEE M.: 3MK, Montgomery, AL, COX, RICHARD EDWIN, JR.: 2PD, Phenix City, AL: CRESSWELL, JOHN ROBERT: AGC. Camden, AL: CUSHMAN, JAMES BRADLEY: 3AE, Jacksonville, AL: DEAL, JAMES LEE: APL, Montgomery, AL: DEMBOWSKI, PHILIP MICHAEL: 1GHY, Miami, FL: DIETZE, DAVID GREENSLIT: 2CS, Point Clear, AL: DOLLIHITE, DAVID W.: 4CHE, Mexia, AL, DURR, PAUL GOLDWAITE: 3FI, Montgomery, AL: EDWARDS, CHARLES HUGH, III: 1PM, Auburn, AL ENSLEN, ALAN FREDERICK: IFLT, Montgomery, AL: FARMER, TODD W.: 3VAT, Birmingham, AL: FLURRY, DAVID DUNN: 2GC, Auburn, AL: FLYNN, JEFFREY SCOTT: 2GC. Sharpsburg. AL: FOLMAR, JAMES DOWDELL: lADS, Auburn, AL: GARD, EDWIN S.: ABSC, Daytona Bch., FL: GILLIKIN, THOMAS C.: 2PB, Florence, AL: GRAHAM, WILLIAM A.: AME, Jacksonville, FL: GRANT, LANCE VAUGHN: lPB, Dunwoody, GA: GRAPP, ROBERT LLOYD: 1GC, Lanett, AL GUCKIAN, THOMAS W.: lGC. Clearwater, FL: HAMMOND, DAVID CRIS: 4lNM, Newnen, GA: HARRIS, DAVID: 2GC. Decatur, AL: HARRIS, FLOYD MCDOWELL: AAC, Camden, AL: HEAD, DAVID OWEN: 1GC, Sharpsburg, GA: HERMES, PETE SPENCER: 2ME, Decatur, AL: HERSHEY, CHRISTOPHER JORDAN: 2PB, Vestavta Hills, AL: HERSHEY, JEFFREY B.: AHA. Birmingham, AL: HESTER, JAMES FRANKLIN IV: tPN, West Point, GA: HIRSH, JAMES EMORY: BHPR, Auburn, AL HOWELL, ARCHER L. III: SAY, Newbern, AL, HRABACK, ROBERT JOSEPH: SAM, Berwyn, IL: HUDSON, DAN HOWARD: AMCH, Birmingham, AL: HUNTER, ALLEN THAW: IADS. Auburn, AL: HURSTON, HOWELL VINCENT: 3AC, Boswell, GA: JAMISON, WESLEY VERNON: 4Pl-l, ST, Petersburg, FL: JENKINS, MICHAEL ROBERT: 4GGL, Charlotte, NC: JORDON, KEVIN W.: SPN, Columbus, GA: KEFFER, KEVIN C.: lHA. Birmingham, AL: KEMP, C. MARK: ZBSC, Dunwoody, GA KETCHUM, CHRIS: AAC, Atlanta, GA: KNECHT, DAVID JEFFREY: GBSC, Hinsdale, lL: KOVACH, TODD ALAN: 2PM, Dunedin, FL: KRASH, BRYAN R.: 1GC. Newnan, GA: LEWIS, CHRIS D.: 4TN, Birmingham, AL: LORINO, DAVID THOMAS: SMK, Baton Rouge, LA: LUNSFORD, GREGORY S.: APUB, Phenix Cnty, AL: MATHEWS, JIM ENOCH: 2GC, Phoenix City, AL: MAYFIELD, JACK L.: 4CE, Savannah, GA: MCELWEE, GARY C.: SEC. Gadsden, AL MCKEE, DOUGLAS L.: 4lNM, Orange Park, FL: MIDDLETON, KIM: 2CE, Dunwoody, GA: MORRIS, KENNETH B.: ZPB. Dunwoody, GA: MURPHY, JOHN W.: 4AR, Birmingham, AL: PARRISH, J.D.: 4AEC, Scotsboro, AL: PENRY, CHARLES D.: ZAEC, Daphne, AL: PHILLIPS, TRIP: 1PN, Montgomery, AL: PITTMAN, SAMUEL JEFFREY: 2AE, Roswell. GA: RAGAN, RICHARD THOMAS: 1PN, Senoia, GA: ROBERTSON, RONALD STEVEN: ACJL, Gadsden, AL ROBINSON, DAVID BRIAN: 2PB, Woodbury, MN: ROSE, PAUL RODERICK: 2GC, Birmingham, AL, ROWLETT, JOHN W.: SBS, Hopkinsville, KY: SANDERSON, KEITH B.: 2CPE, Rainsville, AL: SANFORD, ROBERT W. JR.: 2BSC, Birmingham, AL: SCARBROUGH, JEFFREY: 4AEC, Elba, AL: SCOTT, ROBERT H.: 2PB, Atlanta, GA: SELF, GILBERT PORTERFIELD: 2PUB. Florence, AL: SIBLEY, JAMES: 4CS, Egypt, AL: SLADE, STEVE R.: 4CJL, Auburn, AL SMITH, ROBERT CHARLES: SINM, LaGrange, GA: SORENSON, CHRISTOPHER LEE: 2PB, Seminole, FL: STALLWORTH, FRANCIS DENNIS: SAEC, Beatrice, AL: STANTON, JAMES MICHAEL: SMK, Monroeville, AL: STEELE, HARVEL H.: 4AEC, Beatrice, AL: SUDDETH, JOHN MIXON: 2Fl, Fairhope, AL: TATUM, JEFF: 2AC, Frisco City, AL: TAYLOR, VERNON BELL: 1PB, Andalusia, AL: THOMPSON, JAMES JR.: 4AC, Opelika. AL: TOMBRELLO, PAUL GERARD: 2lNM, Birmingham, AL TYNDALL, MATT A. JR.: SBSC, Birmingham, AL: VANRYSSELBERGE, GREGORY JOHN: ZPB, Flowery Branch, GA: VANRYSSELBERGE, JEFFREY P.: 2PB, Flowery Branch, GA: VAUGHAN, WILLIAM YOUNG III: SME, Daphne, AL: VICE, JERRY DONALD: 2PV, Gadsden, AL: WADE, WILLIAM C. III: AAM, Humble, TX: WATTS, PAUL VICKERS: IPL, Tallahassee, AL: WEDGWORTH, MORGAN DAVIS: 2ME, Nachez, MSL WHITE, DAVID BENNETT: 1ME, Atlanta, GA: WHITTEMORE, ROBERT HUDLEY: 2GC, Atlanta, GA WILKEY, STEVE U.: 2PB, Tallahassee, FL: WILLIAMS, WILLIAM WARNER: BPL, Opelika, AL: WINSTON, LLOYD H.: 4CJL, Merritt Island, FL: WINTER, JOHN LEWIS: 4HFlA, Monroeville, AL: WOLFE, GARY DAVID JR.: 3PB, Auburn, AL: WOODS, SAMUEL B.: 2GC, Dothan, Al.: FLETCHER, BETH: Housemother: HAM, WILLIAM: Adviser ALEWSEVITCH, STEVE ERNEST: 2EE, Longwood, FL: BAILEY, RICHARD: 2HA, Birmingham, AL: BARNES, CHARLES G.: ZCPE, Eutaula, AL: BARTON, CHARLES B.: 1PM, Bay Minette, AL: BARTON, JOHN CHRISTOPHER: 2PB, Jasper, AL: BENSON, ALEC: 2FY, Rome, GA: BLACKMON, JOHN EDWARD: 4Pl.lB, Bessemer, AL: BLACKWELL, G. STUART: AFI, Atlanta, GA: BLAUM, TIMOTHY: ZGC, Montgomery, AL: BRIDGES, TIMOTHY: 2GC, Eufaula, AL nm-nxo 283 BUSH, JIM CLIFTON: lPUB, Louisville, AL: CALLOWAY, THOMAS B.: ACHE, Atlanta, GA: CAMPBELL, WILLIAM R.: 2EE, Eufaula, AL: CHANDLER, STEVEN EUGENE: SAT, Huntsville, AL: CHILDERS, JOHN MICHAEL: WCHE, Ozark, AL: COHEN, GREGG T.: 2PV, Tamarac, FL: COLLUM, BENJAMIN: 2GBl, Andalusia, AL: DICKERSON, STUART W.: 2CPE, Arab, AL: DOLLAR, DAVID L.: SIE, Atlanta, GA, FARMER, GLENN EARLE: 2PO, Auburn, AL FENDLEY, ROBERT PERKINS: 3AMl-l, Bay Minette, AL: FITZGERALD, TIM G.: 3MK, Dunwoody, GA: FLAGG, MICHAEL S.: 2FS, Montgomery, AL: FORD, BRUCE JR.: ATN, Savannah, GA: GOSSER, CHARLES STEPHEN, 2AE, Tifton, GA: GRANT, JIM BENJAMIN: APUB, Louisville, AL: GREGORY, JOSEPH LEWIS: 4EE, Tampa, FL: HALL, ROBERT G.: lCPE, Columbia, SC: HARBER, WILLIAM M.: SBSC, Auburn, AL: HARPER, LAWRENCE RAY: 3AC, Auburn, AL HEALY, EDWARD ROX: SPN, Birmingham, AL: HILL, THOMAS A.: AEC, Warrior, AL: HUDSON, PHILIP WALTER: lPB, Jasper, AL: JONES, FRED ALLEN: 2MTL, Jacksonville, AL: JONES, HAROLD HOWELL: SGL, Bay Minette, AL: KAHL, PATRICK THOR: AEE, El Paso, TX: KELLY, ROBERT K.: ABSC, Atmore, AL: KIMSEY, JONATHON BRUCE: 2ME, Guntersville, Al.: KNIGHT, KENNETH WAYNE: 1PN, Elba, AL: LAWSON, RONALD WAYNE: APUB, Andalusia, AL LEATH, JAMES TUMBLIN JR.: 2PD, lrondale, AL: LEONARD, MICHAEL: 3PN, Montgomery, AL: LEVERETT, TED K.: SBSC, Augusta, GA: LONDON, MATTHEW CLAYBORNE, AMK, Macon, GA: LOUGHRAN, CHRISTOPHER C.: ZPUB, Dalton, GA: MACGELL, RICHARD D.: AAC, Savannah, GA: MAXWELL, JOHN TOWILL: ATN, Savannah, GA: MOORE, MARK STEPHEN: 2PV, Eulaula, AL: OWEN, ROBERT B.: 3Fl, Bay Minette, AL: PETERSON, JAMES PHILIP: 2AE, Elberta, AL RENNINGER, MICHAEL RICHARD: 1PB, St. Petersburg, FL: RICHARDS, ALLAN LAWRENCE, lPB, Albany, GA: ROGERS, DAVID M.: IPN, Winston-Salem, NC: ROTH, TODD ALEXANDER: AAM, Simsbury, CT: SAMFORD, LOUIS BRISTOW: 1PN, Miami, FL: SEGERS, MICHAEL WILTON: 1CE. Ariton, AL: SHORT, J. MICHAEL: 3CE, Jasper, AL: SINGER, L. BENTON: ZPN, Eufaula, AL: SLEEMAN, J. FREDERICK: ZPB, Birmingham, AL: SOWINSKI, NICHOLAS: 2GC, Riverdale, GA STIMPSON, KEITH EDWARD: ZPB, Mobile, AL: STOKES, MILES ANDREW: AAE, Carnp Lejeune, NC: STONE, LLOYD, L. III: AMK, Odenville, AL: TAYLOR, TIM DAYTON: IPN, Eulaula. ALI THORNE, LARRY EDWARD: ZPD, Jasper, AL: THYE, SCOTT R.: ABSC, Silver Springs, MD.: WHITAKER, TODD D.: ZNUFI, Jasper, AL: WHITE, WILLIAM R. JR.: 2AC, Eulaula, AL. WINKLES, ISAAC C.: lAR, Huntsville, AL: WOODHAM, GERALD C.: IPN, Eulaula, AL MURPHY, CAM A.: Sweetheart, Tallassee, AL: TINES, FANNIE L.: I-lousemother: WILLIAMS, JOE: Adviser: ADAMS, HENRY THOAMS: 1PCN, Cartersville, GA: ALFORD, DAVID W.: 1PM, Dothan, AL: ALLISON, JOHN C.: AHPE, Montgomery, AL: ARMSTRONG, MICHAEL BRETT: SCE, Headland, AL: BARBER, DYKES: 2PB, Brimingham, AL BARRENTINE, STEVE WAYNE: 2PN, Mobile, AL: BARRON, WILLIAM KENT: IPL, Newnan, GA: BERTHOR, BRUCE E.: AAC, Birmingham, AL: BISHOP, JOHN CLAYTON: 2PN, Helena, AL: BRADY, CRAIG C.: 1PB, Selma, AL: BROWN, DAVID MCCAIN: 2PD, Eufaula, AL: BURFORD, JAMES LAMAR: 2PB, Montgomery, AL: CARADINE, DAVID ESWARD: SMK, Birmtngham, AL: CARTER, ROBERT H.: 2GC, Birmingham, AL: CHUNN, VANCE McLEOD: AHA, Mobile, AL CONNER, JOHN F.: 1FV, Eutaula, AL: COOK, BENJAMIN A.: 1G.lM, Macon, GA: COUNTS, WILLIAM EVERETT: 3BSC, Mobile, AL: DAUPHIN, KEITH HARRIS: 3BSC, Montgomery, AL: DREY, ALBERT OWEN: 1GC, Mobile, AL: DUNCAN, WESLEY: AMK, Hawkinsville, GA: DURDEN, MICHAEL E.: 2PB, Dothan, AL: DYE, PAT FAIN: SPO, Auburn, AL: DYSON, GERALD C.: 2ME, Birmingham, AL: FISER, WILLIAM DAVID: ABSC, Clarksdale, MS FLARBEE, WAYNE WEIDINGER: 2PB, Atlanta, GA: FLOWERS, GEORGE DAVIS: AAC, Dothan, AL: GARRISON, JAMES CARTER III: 2PN, Tucker, GA: GRANT, JAMES W.: ABSC, Dothan, AL: GRAVES, PRESTON NOLEN: 2PB, Alexander City, AL: GROSS, W. BAILEY: ZBSC, Columbus, GA: GUEST, MICHAEL CURTIS: 3PM, Huntsville, AL: HAGAR, GREG B.: 2PB, Inverness, FL: HARRIS, BRIAN B.: 2GC, Hoover, AL: HERRICK, DAVID PHILLIP: APM, Montgomery, AL HIGBY, FREDERICK MARK: lPN, Panama City, FL: HIXON, JOHN EDWARD JR.: 1PM, Montgomery, AL: HOLT, JOHN SCARBOROUGH JR.: 2TR, Columbus, GA: HOUBE, ALLEN GEORGE JR.: ABCH, Watertown, CT: HUTCHESON, MARK FREDERICK: IPB, Montgomery, AL: HYDRICK, STEPHEN DURST: IGC, Columbus, GA: JONES, GEORGE M.: ASSC, Montgomery, AL: KENNEDY, JAMES W.: ACH, Alexander City, AL: KESSINGER, BENJAMIN LEE:. 1PL, Lexington, KY: KITTRELL, JON P.: 1AR, Fairhope, AL LANE, GREG B.: ATN, Dothan, AL: LAYE, JAMES SCOTT: IPCN, Columbia, AL: LAYFIELD, MARTELLE III: 2PB, Columbus, GA: LINGO, RICHARD J. JR.: SPUB, Eufaula, AL: LYONS, M.J. III: AFLT, Birmingham, AL: MATTOX, TUCKER JR.: 1PM, Montgomery, AL: McENERNEY, THOMAS MARK: 2PN, Montgomery, AL: McGOWIN, SAM B.: SBSC, Wetumpka. AL: McKIBBEN, ANDREW JACK: 2EE, Dothan, AL: MEADOWS, GILBERT TODD: 2PN, St. Clair, AL 284 IIKQ-EAE .fx ff . vm.: T 7. 1 S sl R I , , , ,,,, W' 5 lil Et A if-L I it - ,, , ,, , N Q im, vw a f I X X 1 ' T57 nl rnmltl gl 'ilrl il i,gy ,y I ii g, Q. 2 ,5 A f 4 ifil it I :Inn M f.-. A 4, ' V EE , ,lii A I , I ,. ' fvfuq ..,. A lil I I SESAM: A xt II 14:3 'if ZW? fr' Ml' t 1 s 'SFS .4 V nz? fa X an , . L Y A 'bc 12. A -.f fy , tw 9. gf :L i M 1M t . . K, 'I , G 'M ,I Qki K I X7 A r B X, , J ,P J J d I Y I f' A ' zu V , 1 W yd Q I is ,ii 1 I , gl fi Q: 1 A M41 'N f S E K i Fylvrflz iz H . , - wi R n 1 I . E J 5 g I A ff I . E Q: : ' M l, Atl A t I' ' R I al i K i L y X t Q , ,V was fi i A 'L , ' , V lan r Lili! L L X ,, fy if 4 1 r .1 if 2 , ,er .N 7 V Q, I 1 , . l t' ' I li MEFFERT, WILLIAM D.: 3BSC, Birmingham, AL: MIMS, BYRON DWAYNE: 2PN, Tucker, GA: MOFFETT, ROBERT BRENT: 2AEC, Montgomery, AL: MOORE, JON A.: AMCH, Selma, AL: MORRIS, HENRY H.: QBSC, Birmingham, AL: MORRIS, WALTER F.: 3BSC. Birmingham, AL: NALL, WALLY: 4FL, Birmingham, AL: NICHODS, DAVID S.: 3lNM. Columbus, GA: NICHOL, C.L. RIDLEY II: 3FL, Atlanta, GA: PADGETT, JOSEPH D.: ZPB, Union Springs, AL PARKER, LARRY M.: 2PM, Dothan, AL: PATRICK, JOHN BENJAMIN: 1PN, Montgomery, AL: PRICE, JOHN CARL: AOPE, Jackson, Ml: PRIDE, ROBERT ELSWORTH: 1PN, Florence, AL: PUCKETT, STEVE L.: 3INM, Montgomery, AL: RAMAGE, RUSSELL S.: AVAT, Athens, TN: RAND, CHRIS S.: 1PB, Roswell, GA: REEVES, BEN C.: 3Fl, Eutaula, AL: REGISTER, JONATHAN H.: 2PM, Birmingham, AL: RIVENBARK, DAVID LEE: 2PPY, Columbia, AL ROBERTS, J. GRAHAM: BAC, New Orleans, LA: ROBERTS, J. KIRK: 2PB, Montgomery, AL: ROBERTS, JOHN HARDY: TPB, New Orleans, LA: RUTLAND, JOE R.: 2PL, Fitzpatrick, AL: SAMMONS, WILLIAM W.: SMB, Huntsville, AL: SAVOLDI, J.G.: 2PFtS, Birmingham, AL: SCHOEN, CHRIS B.: 4AFl, Atlanta, GA: SCHORR, DOUGLAS S.: Auburn, AL: SCRUGGS, RANDY ALAN: 1PB, Atlanta, GA: SCRUGGS, RUSSELL SCOTT: AFI, Atlanta. GA SEWELL, CHARLES ROBERT: WCPE, Clayton, AL: SHOEMAKER, CRAIG MAX: SPB, Stone Mountain, GA: SMITH, L. LEHMANN: SBSC, Opelika, AL: STEWART, FRANK M. III: 2BSC, Pike Ftoad, AL: STEWART, JOSEPH, GORDON JR.: 4CSL, Montgomery, AL: TATUM, JAMES ANDREW: ADCH, St. Petersburg, FL: TROTMAN, ROBERT TYLER: SPN, Montgomery, AL: TRUEB, STEVEN S.: GAR, Birmingham, AL: TUCKER, ROBERT GLENN: AME, Troy, AL: VICKERS, JAMES KENNETH: 2PB. Scottsboro, AL VILLAR, SCOTT DOUGLAS: 4lNM, Montgomery, AL: WALRAVEN, CHIP: 2ME. Montgomery, AL: WARREN, JOHN EDWARD: 2PN, Birmingham, AL: WEEKLEY, J. WADE: SPM, Midland, GA: WILES, DAVID ALAN: 2PM, Kingsport, TN: WILSON, LARRY T.: SFI, Birmingham, AL: WINGARD, LEE: LSBSC, Montgomery, AL: WISE, ROY IRWIN: 1PB, Newnan, GA: WISE, THOMAS HENDERSON: STE, Newnan, GA: WOODDALL, LEE: lGC, Macon, GA WOODRUFF, MILTON M.: 4EC, Columbus, GA: RAMAGE, PAM Sweetheart, Athens, GA: MAYO, MARION P.: Housemother: AKINS, MARK ATTAWAY: 2ME, Statesboro, GA: ALBRIGHT, THOMAS H.: 3AC, Huntsville. AL: ALLEN, CHARLES JEFFREY: 3AC, Huntsville, AL: ANDERSON, KERRY JOHN: SPL, Tampa, FL: ANDERSON, ROBERT H.: 2PB. Nashville, TN ATKINS, EARL ALLEN: 3EE, Huntsville, AL: ATKINS, WILLIAM MILES: 2PL, Tampa, FL: BACON, ROBERT STEWART: ABSC, Jacksonville, FL: BARRETT, THOMAS JOSEPH: 4AC, Griffin, GA: BEATY, CLINT: ZPB, Orlando, FL: BENDALL, STEVE LEE: 1lD, Birmingham, AL: BOHNER, JACK COLLINS: 4lE, Dunwoody, GA: BONDS, JIM NEAL: 3AM, Griffin, GA, BRELAND, GREGORY J.: SAE, Mobile, AL: BURNS, CLIFFORD E. JR.: 5Fl, Tallahassee, FL CASTRO, RAFAEL: SAC, Montgomery, AL: CATES, STEVEN GLENN: 2PN, Nashville, TN, CHARRON, JOHN L.: 1BSC, Brentwood, TN: CHASE, RANDALL C.: 2ME, Brentwood, TN: CHEATHAM, LARRY STEVE: AINM, Franklin, TN: CHESHIRE, OTIS BOWYER: 1PB, Nashville, TN: CLASSE, JOHN H. JR.: ACE, Orlando, FL: CLEARY, KEVIN: 2CI-IE, Huntsville, AL: COLEMAN, C. THOMAS: 4AM, Roseville, CA: COLVIN, CHARLES EDWIN: 2ME, Huntsville, AL COSTANZA, VINCE R.: 3EE, Huntsville, AL: CROWLEY, ALAN: AAR, Atlanta. GA: DALE, ROBERT YOUNG: 4EH, Nashville, TN: DAVIS, JAY T.: 1PG, Birmingham, AL: DESKIN, MICHAEL J.: 1PN, Juno, FL: DESKIN, PATRICK M.: 3Fl, Juno, FL: DORRIETY, WILLIAM G.: GCHE, Atmore, AL: EAST, SCOTTY THOMAS: 1PB, Vestavia Hills, AL: EDWARDS, JAMES DONELSON: SBSC, Nashville, TN: ESPY, CHRIS JAMES: tAE, Prattville, AL FEYKA, JOE A.: 3lE, Dunwoody, GA: FLIPPEN, SHAW: 1PBSC, Florence, AL: FOSTER, JAMES G.: AMEC, Orlando, FL: GANGLOFF, CRAIG A.: AAC, Cocoa, FL, GASKILL, JOSEPH III: 2PB, Birmingham, AL: GRAHAM, RICHARD MILLS: 2CPE, Nashville, TN: GREGG, WILLIAM JOSEPH: SOMN, Nashville, TN: GRIFFIS, KEVIN AUSTIN: 2AC, Huntsville, AL: GRONOUIST, P. ERIC: SOMN, Madison, AL: HAMBURG, H. BART: 4AY, Panama City, FL HARLIN, MATTHEW J.: AAE, San Antonio, TX: HARLIN, TIMOTHY JAMES: 2lB, San Antonio, TX: HARNDEN, CHARLES W.: 2AE, Fort Lauderdale, FL: HARRISON, CLIFFORD III: AME, Nashville, TN: HARRISON, JOHN F.: GAC, Nashville, TN: HEARD, C. SIDNEY: 4lNM, Athens, GA: HOFER, ROBERT ANDREAS III: 1FLT, Pensacola, FL: HOLTON, DOUG L.: SGSC, Birmingham, AL: HORNE, THOMAS: SGC, Prattville, AL: HOWARD, DAVID WILLIAM IV: 3IE, Clarksviile, TN HUHN, DOUGLAS ANTON: SAC, Orlando, FL: JOHNSON, DAVID BRUCE: 3AC. Nashville, TN: JONES, JOHN PHILIP: 2PB, Roswell, GA: KIASSEN, ROBERT WILLIAM: 4AM, Fort Lauderdale, FL: KINMAN, JIM WALTER JR.: SBA, Macon, GA: KIZER, JAMES P.: AMRB, Atmore, AL: LACKEY, PAUL S.: AEE, Muscle Shoals, AL: LACKEY, PETER DOUGLAS: TPCN, Muscle Shoals, AL: LEE, ANTHONY JOEL: 3AC, Franklin, TN: LETTON, KURT DEVERE: AAC, St. Cloud, FL mn-Ex 285 LINEBERGER, ROBERT EDWIN WARREN: 2AC. Brentwood. TN: LOFLIN, ROBERT C.: AGSC. Nasnvtlle. TN: MARESCO, MIKE E.: ZCJL. Burke. VA: MEAD, CHARLES MICHAEL: 3MCl-l, Arab, AL. MERIWETHER, LEE WILKERSON: WE. Montgomery, AL: MIKELL, DAVID RANDALL: 2PL. Tnornaston, GA, MORGAN, PRESTON A.: AME. Nasnvllle, TN. MORONEY, CURTIS LEE: 2GC. Natchez. MS: MYRICK, DAVID FREDERICK: 2AE, Fairnope. AL: NESBITT, SCOTT: QPB, Montgomery. AL NEWELL, ROBERT DAVIS: ZPO. Sprtngtteld. VA, O'BRYANT, GREGORY GRANT: 3EE. Huntsvtlle. AL: OMAN, JOHN ALLEN: SBSC. Brentwood. TN: PAYNE, ROBERT L.: ZPB. Thomasvrlle. GA: PEEPLES, BARRY AUGUSTUS: ZPRS. Waynesboro, VA. PILATO, VINCENT ANTHONY: IME. Blrrnlngnam. AL: POTEET, JAMES: AEE, Nasnvtlle. TN: POWELL, GEORGE JR.: 2ME, Nashville. TN. RAABE, JEFFREY M.: SINM, Montgomery. AL. RAWLINGS, JEFF MILLER: lPM. Thomasvrlle. GA RAYNOR, JEFF D.: IPB. Jackson, GA. REYNOLDS, BILLY KNIGHT JR.: 2GC. Batnbridge. GA, SAEGER, TIMOTHY WILLIAM: 2PN. Vestavta. AL: SANDERS, CHRISTOPHER R.: 3AE. Dunwoody, GA, SECKMAN, BENJAMIN: QPB. Nasnvrlle. TN: SMITH, CHARLES MORETON: lPB, Hattresburg. MS: SMITH, GORDON P. JR.: 3BA, Ocala, FL: SMITH, JEFFREY: AAC, Signal Mountarn, TN: SMITH, L. RANDAL: 3EE, Ocala FL: STAP, MARTIN JOHN: ZME. Huntsvtlle. AL STEVENS, JAMES MICHAEL: BAE. Decatur. AL. STINE, JEFFREY CORVIN: APO, Wlnter Park, FL. SWEARINGEN, BLAKE EMERSON: ZCHE. Huntsvtlle, AL, SWEARINGEN, KEITH NATHAN: SEE, Huntsvllle, AL. TANNER, CHRISTOPHER MAURICE: 2PB. Thomasville, GA, TENCH, DAVID WILSON: 4AF?. Auburn. AL: THOMAS, JEFF: 2GC. Huntsvtlle. AL. THORNTON, HAYWOOD RUFFIN III: ZHY. St. Cloud. FL. UNDERWOOD, ERIC DAVID: AME, Strawberry Platns. TN. IJTZ, MICHAEL LINDSAY: 4AM. Sprtnglleld. VA VAN FELT, GEORGE THOMAS: CKADS, Atrnore. AL. WALLACE, LEE: BME. Dunwoody. GA: WEATHERLY, JIM LYMAN: 3Fl. Atlanta. GA: WESPISER, DAVID C.: 4AC. Oxford. OH, WHITESIDE, PHILLIP JONATHAN: 2AC, Daphen, AL, WHITT, BILLY G. JR.: 4lNM. Huntsville, AL: WILLIAMS, KEN M.: ZPB. Montgomery, AL: WILLIAMS, KENT: SAEC, Orlando. FL. WILSON, JACK: 2F M. Winter Park, FL: WOLFE, DOUGLAS KARL: 2AE. Stone Mountatn. GA WOLFE, JON G.: 3AE. Stone Mountarn, GA, WOOD, DOUGLAS JEFFREY: 2CE, Louisville. KY. WYLIE, STEVEN BARRETT: HND. Franklln. TN: YEATMAN, HARRY WILKES: ABSC. Blrrntngharn, AL. ZEVALLOS, CESAR AUGUSTO: ZBSC, Grtlltn. GA: JONES, MARY B.: Housernotnerg ABEL, DAVID CROSBY: 4ONM, Gadsden, AL: ALFORD, THOMAS BRACK: 2lE. Gadsden. AL ALLEN, GEROGE F.: 2PN. Florence. SC, ALLEN, JOHNNY GLEN: BPB. Auburn, AL: ALLEN, WILLIAM EDWARD: ABSC, Montgomery. AL: ANDERSON, GREG P.: ABSC. Troy. AL: BABCOCK, BILL GORDY: IPM. Montgomery. AL. BAKER, MICHAEL E.: 4PE, Errmlngharn, AL: BATES, CHIP L.: lPN. Atlanta. GA. BICE, JOHN KEVIN: lPB. Gadsden. AL: BLAKELY, BARRY WAYNE: 4VOE. Mobtle. AL, BOAN, ALAN D.: 2ME, Greenvrlle. AL BOULER, JAMES MORRIS JR.: 3I-IPR, Monroeytlle. AL. BOWDEN, BEN III: SADS. Eutaula. AL: BOZEMAN, C. TERRY: ABSC. Montgomery. AL: BOZEMAN, JAMES ALAN: 1PB. Montgomery, AL: BROWNE, ROBERT LEE JR.: IGJM, Mernpnts, TN: BRYANT, JOHN TIMOTHY: AAY. O'NerlI. NE: BURTON, JAMES SCOTT: SPE. Lrthonta, GA, CALDWELL, CHARLES ALTON JR.: 3FI. Huntsvtlle. AL: CHAMBERS, MARK ALLEN: IPN. Montgomery, AL: CHAPPELL, THOMAS S.: ISINM, l-luntsvtlle. AL CHESHIRE, R. TODD: ZPB, Tuscaloosa. AL. COBB, RAY S.: 4lNM. Gadsden. AL. COLEY, JON P.: 2PB. Gadsden. AL: COLLINS, PHILIP R.: 3AC, Gadsden, ALL CONERLY, M.H. SAYMOUR: 3Fl. Carrollton. GA: COOPER, MICHAEL ROSS: lMTL, Gadsden, AL, COX, KENNETH W.: ZPB, Troy, AL, DAVIDSON, WILLIAM PICKETT: 3MlL, Montgomery. AL: DAVIS, GARY W.: SAC. Huntsville, AL1 DE LLACER, AMARO MIGUEL: 2PB. Ltnden. AL DILLARD, LARRY S. JR.: 2ME. Btrrntngnarn, AL: DOWLING, WILLIAM WATFORD: ZBSC, Gadsden. AL. DRAKE, HENRY A.: 2AC, Birmingham, AL: DUGGER, LANE C.: AFP. Sun Valley. lO. DUKE, JAMES WALTER: AMR. Atlanta, GA: DUNN, WILL B.: IPB. Wetumpka. AL: EDWARDS, MARK T.: 4AE. Brrrnrngnam, AL: FERRELL, MATHEW BRUCE: 4PM. Blrmlngnarn, AL. FLOOD, LLOYD BEFITRAND: 3Fl, Merrdian, MS: FLOWERS, BRYAN E.: 5TN. Atrnore, AL GAUTIER, ROBERT LEE: 2PlFI. Mlarnr. FL: GIBSON, JAMES CECIL JR.: IFYE. Montgomery. AL: GLANTON, TOM M.: ZGC. Carrollton. GA: HAMILTON, JOHN ERIC: 2PB. Annlston. AL, HAND, JOHN ANTHON III: IPB. Errmrngharn, AL. HARKLEROAD, DONALD: AAEC. Atlanta, GA. HEACOCK, WILLIAM: CBPB, Sylacauga. AL: HESTON, GREG L.: tPB. Atlanta. GA: HILL, J. sco'r'r: SPM. Gadsden. AL: HILL, STEVEN THOMAS: IPN. Atlanta. GA HOPKINS, WILLIAM B. JR.: 4I-IPFI, Greenyllle, AL: JACKSON, ROBERT MARK: SPB, Trace, AL: JAICKS, STAN REA: 3AM. St. Petersburg, FL: JOHNSON, CARLTON MURRAY JR.: BHY. Atrnore, AL: KAIN, JOHN RODGEFIS: 4ME. Blrrrtingnarn. AL: KEENUM, ROD WADE: IMB. Annrston, AL, KEETER, BRIAN CHANCEY: IMC, Heber Springs. AFI: KELLY, ANDERSON HENLEY: ABSC. Huntsville, AL: KENDRICK, JAMES RUSSELL: 5AFI. Ft. Walton. FL: LAWRENCE, MICHAEL FREDERICK: AMK, Anmston. AL 286 EX-EN 4 4. f ,,. ...W . ,-,, 'i w ,V mw- Q , ' Sl I :JP I , A A g '3 r A : All All A I' A f ,,..,.,,, , I ,,.,, A 45 - f I .,.. 4 j, gf: at t Q 2 Ill A lil KS! , N ' F I dsl tl ' , ,,,, ' ..,, f ,,,.,, .,.,,. , , A rj .Q ,Tl at , 4 L A M lt I' 1d . it 'Z 4 323 il t ..f Te ' 3 lu , ,. . A I I- , I IJIL I I If k K IM l shall: ' 2 As! Atl I Jn., -an W . .. 49- ' , .Q ,. , .. ,I .f-45' -ff. -.I 9. ,M W- M- ::-- -L , : Bt t I 2. s lm gm! M 3 T- ,ef Yay A ,g ,L ff. 5' AQ I sl All tl .1 Z: is fe, T3 ,Q L A :Q ' lil: I l S . . ,i K: ii ii ' Raft. 'I las iii I e O Q L x lf 3- 1- , , 1 f' - A . A J A A A ag leaf L I A A Sl M A : A IM L L i . l : A , -A , ,, P: , pg, ,, Ayij B, ' lrat ' :ff -E1 ' as ' : A 1 fl I A Tai? VE L L L L 1 1 lltl :tim , A ia 11 : F -1 J: l l, il .l M It Q LEARY, CARL JOSEPH III: SME, Huntsville, AL: LEATHERS, AL STEELMAN: AIE, Dickson, TN: MAY, STEVEN CHARLES: tPB, Auburn, AL: MCDONALD, ROBERT ALLEN: 2PV, Selma, AL: MICKLE, J. COOPER: SINM, Huntsville, AL: MILLER, JOSEPH AUSTIN: ACE, Montgomery, AL: MOORE, MITCHELL GLENN: ZPB, Gadsden, AL: MORGAN, DAVID THOMAS: AINM, Clinton, MS: MUMMERT, JAMES CLARK: WVAT, Decatur, AL: OLIVER, THOMAS L.: tCl-lE, Jackson, TN PAGE, ARNALL SANDERS: IHA, Macon, GA: PAGE, JOHNNY ANTHONY: SHA, Macon, GA: PIKE, CHRISTOPHER SCOTT: 2GBl, Carbon Hill, AL: POWELL, CHIP: QPB, Birmingham, AL: REID, GLENN ALAN: ZCE, Montgomery, AL: RETIEF, DIGGIE J.: 3GL, Birmingham, AL: ROBB, ROBERT MICHAEL: ATN, Merritt ls., FL: RUNYAN, F. DAVID: ZPPY, Homewood, AL: RUSSELL, MARK: 2PO, Huntsville, AL, RUSSELL, ROBERT: APUB, Dahlonega, GA SAHLMAN, STEVEN BRUCE: 2PB, Columbia, SC: SALTER, MARK DANIELS: 2PN, Homewood, AL: SCOTT, THOMAS KEITH: QAH, Tuscaloosa, AL: SIMM, ROBERT BRITTAIN: AOMN, Winter Park, FL: SIMPSON, DARRELL O.: SBSC, Montgomery, AL, SIMS, J. BENTLEY: 2GC, Sylacauga, AL: SKONCKI, SCOTT J.: 1GC, Montgomery, AL: SMITH, GARY DEAN: SHA, Tucker, GA: SMITH, GREGORY LEONARD: AINM, Grayson, GA: SMITH, TERRY BRYANT: 3PlFl, Rochester, IN SMITH, TODD M: 2PB, Rochester, IN: SPEER, JAMES ANDREW: ATE, Ozark, AL: STICK, ELLIS R.: AADS, New Orleans, LA: SULLIVAN, MICHAEL W.: ZPB, Birmingham, AL: SWEARINGER, JOHN MANLY: 3AEC, Montgomery, AL: TAYLOR, ROBERT GEOFF: 1PN, Eulaula, AL: THOMASON, ROBERT JAY: lGC, Carrollton, GA: THOMPSON, PHILIP ALLEN: ACJL, Huntsville, AL: THOMPSON, STEVE CURTIS III: 2AM, Gainervtlle, GA: THORNTON, STEVEN CURTIS: 2AE, Auburn, AL TOOLE, N. DOW: AEE, Augusta. SC: TOOTHAKER, HARRY H.: APR, Montgomery, AL: TURNER, DAVID D.: 3lNM, Birmingham, AL: TWINER, MICHAEL STEVEN: 3CE, Atlanta, GA, VAN BERER, ROBERT L.: IPE, Huntsville, AL: WAGNON, DAVID LOUIS: 2PN, Birmingham, AL, WAKEFIELD, WILLIAM MARTIN: 3FL, Anniston, AL: WALKER, GEORGE WALTON: TPB, Gadsden, AL: WATT, WILLIAM JR.: SPB, Montgomery, AL: WEAVER, JOHN OUENTIN: QPB, College Park. GA: WEAVER, SAMUEL W.: WPB, Gadsden, AL: WHITAKER, WARREN GENE: SPB, Huntsville, AL: WILLIFORD, ROBERT M.: ABSC, Birmingham, AL: WOODWORTH, JOHN KENNEDY JR.: ATN, Lookout Mtn, TN: WOOLARD, ARTHUR PAUL: ZBSC, Montgomery, AL: WYATT, DAVID MARK: 4AY, Sylacauga, AL. ALVERSON, WILLIAM B. JR.: ALHY, Dothan, AL: ALLEN, RICHARD MICHAEL: 3BA, Lake Worth, FL ARVIN, SCOTT ROBERT: tPN, Vestavia, AL: BARR, STEVEN DONALD: SINM, Doravilie, GA, BAZZELL, THOMAS R. JR.: 2lNM, Montgomery, AL: BLOUNT, STEVE S.: IGC, Dothan, AL: BLOUNT, WILLIAM M.: f3PB, Dothan, AL: BROWN, LANCE RIGBY: ZINM, Clopton, AL: BURKHOLDER, PAUL HILL III: IPH Mobile, AL: BYRD, TOMMY: 2PC, Colteeville, AL: BYRNE, ALBERT E.: AINM, Montgomery, AL: CAMPOLONG, JAMES MARK: 2PB, Seminole, FL CARGO, SAM OWINGS: AAC, Birmingham, AL: CARTER, SCOTT: 2PB, Auburn, AL: CATER, KENNETH WAYNE: SEE. Birmingham, ALI CHRISTIAN, PHIL D,: tPL, Alpharetta, GA: CLEMENT, PHILIP THOMAS: 2CJL, Mobile, Al.: COULTER, CLIFF GEORGE: AMK, Huntsville, AL: DAVIS, PHILIP C.: 2PB, Auburn, AL, DRIVER, THOMAS E.: ACE, Montgomery, AL: DUTCHER, MARTIN T.: 2AC, Birmingham, AL: ELLIOTT, CHARLES M.: 2PM, Montgomery, AL FICKLING, LESLIE THOMAS III: SCHE, Elberta, AL: FLOOD, MATTHEW W.: AHPEIBI, Vestavia Hills, AL: FOSHEE, MARK A.: 3AE, Hope Hull, AL: FOSHEE, ROBIN JEROME: lGC. Hope Hull, AL: FRASER, DOUGLAS D.: AMK, Dunwoody, GA: FREEMON, ROBERT W.: AINM, Scottsboro, AL: FRICKE, MARK: APB, Orlando, FL: FULLER, CHARLES CARY: 2PT. Montgomery, AL: GARNER, JAMES K.: AINM, Marietta, GA: GILLESPIE, DAVID ALLEN: AAH, Vestavia Hills, AL GILMORE, JAMES PARMELE JR.: AAM, Atlanta, GA: GRAFF, NEIL ALAN: 3PRS, Montgomery, Al: GREATHOUSE, J.D. ALLEN: AIE, Phenix City, AL: HAACK, ROBERT OTTO JR.: AEE. Montgomery, AL: HALL, TIM: AACF, Montgomery, AL: HARE, BRIAN PATRICK: 1PN, Birmingham, AL: HARPER, BRENT ACAN: SIE, Prescott, AL: HAYGOOD, GRANT H.: AAC, Auburn, AL: HECHT, MICHAEL F.: 2AC, Homewood, AL, HELMS, MICHAEL S.: 2PM, Dothan, AL HESTER, BARRY HAL: AOMN, Moulton, AL: HOGUE, GERALD ALAN: 4OMN, Birmingham, AL: HOWLEY, MICHAEL G.: ZPB, Dunwoody, GA: HUNEIDI, KARIM: AVSA, Huntsville, AL: JACKSON, CHARLES DANIEL: APY, Monticello, FL: JOHNSON, GARY O.: IPN, Mobile, AL: JONES, JESSE SHERWOOD: SAH, Dalton, GA: KARABINOS, CHRISTOPHER JAMES: AIE, Huntsville, AL: KAYLER, DONALD C, III: AAM, Dunwoody, GA: KELLEY, JOSEPH LEE: 4PO, Ashland, AL KENNINGTON, BRADLEY KAROW: 1CHE, Dothan, AL: KENNINGTON, DONALD R.: 1OMN, Dothan, AL: KOCHER, ROBERT PRESTON: 3ME, Tampa, FL: LATHEM, MICKEY L.: 2PM, Birmingham, AL: LEE, NEILL: SBSC, Savannah, GA: LEIGH, TIM: AME, Savannah, GA: LEWIS, RALPH DON JR.: 2BSC, Dothan, AL: LIVENGOOD, CHARLES TODD: BMK. Dunwoody, GA: LOVELESS, MARK EDWARD: 3PM, Atlanta. GA: MARTIN, CHRISTOPHER CLAY: IEPY, Tuscaloosa, AL EN-EOE 287 MCCARTHY, KEVIN JAMES: lAH, Birmingham, AL, MCDUFFIE, MICHAEL S.: AAC, Slocomb, AL, MCNEEL, JOSEPH WILKINSON, III: SPY, Century, FL, MEADOWS, ROBERT BROOKS: 3TN, Ashford, AL, MEDFORD, JOEL DAVID: 4FLT, Dothan, AL, MILLER, E. HUGH: 4ME, Altamonte Springs, FL: MILLER, HANK: SIE, Jackson, TN: MILLER, RANDALL C.: 3AFl, Knoxville, TN: MILLER, WADE JOYNER: 3TN, Ashiord, AL, MIMS, ALAN L.: AAC, Birmingham, AL MOORE, JAMES RUSSELL, JR.: 2ME, Atlanta, GA, MORRIS, WILLIAM ANDERSON: AFM, Montgomery, AL, MULLINS, JEFF J.: BINM, Trussville, AL: MUNROE, CALVIN WREN: SAFI, Talladega, AL, MURPHY, JAMES ROBERT, JR.: AAR, Cuthrert, GA: NIX, BOBBY: APO, Auburn, AL: NORRIS, RICHARD: ATH. Birmingham, AL: 0'CONNOR, MICHAEL DREW: lAE, Jensen Beach, FL: 0'MARY, MARK: 4Fl, Dothan, AL, OWEN, JAMES P.: APRS, Montgomery, AL PAGE, WILLIAM SCOTT: ZSSC, Montgomery, AL: PARAMORE, JEFF D.: lPN,,Dzark, AL, PARAMORE, PHILLIP E.: 4G.lM. Anton, AL: PARE, RICHARD ELLIOT: IPV, Jensen Beach, FL, PASCUTTI, JOHN MICHAEL: 3lNM, Atlanta, GA: PATTERSON, CHARLES M.: 4CE, Decatur, GA, POOLE, MARSHALL LANE: AAC, Decatur, GA, RALPH, JAMES MICHAEL: BTN, Lake Placid, FL: SAGE, BRIAN M.: 4IE, Atlanta, GA, SAIA, JOE C.: IAC, Birmingham, AL SALANITRI, RICHARD FRANK: CICS, St, Petersburg, FL, SAWYER, WILLIAM GLENN, JR.: 2GC, Coral Gables. FL, SCHMIDT, GREG E.: BMK, Ft Lauderdale, FL, SEABORN, ROBERT M.: 4Fl, Montgomery, AL: SEIBERT, LESLIE EUGENE: 4INM, Roswell, GA, SELLERS, MARTY THOMAS: BADS, Ashland, AL, SFORZINI, ANDREW LEWIS: SAMH, Auburn, AL, SIMMONS, MICHAEL JAY: IPM, Pontevedia, FL: SIMMONS, ROB: 3lNM, Auburn, AL, SMALLWOOD, THOMAS LEO: AFI, Titton, GA SMITH, MIKE F.: 2AC, Auburn, AL: SMITHERMAN, RUSSELL TODD: ZPB, Montgomery, AL, SOMMERS, TODD ALLEN: AME, Tilton, GA: SPAIN, JACK D.: SME, Montgomery, AL, SPANN, PHILIP NORMAN: 3AR, Dothan, AL, SPINA, PAUL J.: 2AC. Birmingham, AL: STAWRETT, J. SCOTT: lME, Birmingham, AL. STEPHENS, KENNETH JACKSON: AINM, Atlanta, GA, STONE, WILLIAM BRYAN, II: SEE, Gadsen, AL: STROTHER, R. WAYNE: 4lNM, Montgomery, AL STRUTHERS, CRAIG R.: 4AY, Montgomery, AL: THOMASON, BARRY R.: SOMN, Birmingham, AL: TOLAR, KENNETH LEE: 2CHE, Marietta, GA, UHLIR, JON DAVIS, ZPB, Dunwoody, GA: UPP, CHRISTOPHER WINTERS: 4CPE, Daytona Beach, FL: UPSHAW, DAVID OWEN: SLEC, Birmingham, AL, UPSHAW, WILLIAM CRAN: SAEC, Birmingham, AL, WAKEFIELD, JOSEPH WINSTON: 4lNM, Atlanta, GA, WARREN, JOHN MARK: SOMN, Selma, AL, WATFORD, TIM H.: SAFUBSC. Dothan, AL WELLS, KAMERON L.: 2PM, Birmingham, AL, WEST, JAMES DAVID: 2PM, Montgomery, AL, WETHIGHR, ROBERT BRADLEY: 2MK, Winter Park, FL, WILBANKS, DAVID CHARLES: 3TN, Montgomery, AL: WILKINSON, CARLOS WINSTON: 3AH, Panama City, FL, WILLIAMS, PAUL: 4EE. Panama Canal Zone, WOODHAM, KENNETH M., JR.: SGL, Midland City, AL, WOODS, KEITH: AINM, Orlando, FL, WRIGHT, DAN ALLEN: AFI, Dothan, AL: WYATT, KENNETH TIM: SAM. Trussville, AL ZIMLICH, PAUL RABEN: lPN, Mobile, AL, BLANKERHSIP, ELIZABETH S.: Housemother: ABBATE, SALVATORE C.: 4ADS, Attalla, AL: ADAMS, DOUGLAS ALAN: ICHE, Lexington, KY, ALAN, SCOTT: ZPB, Plantation, FL: AMOS, RICHARD WILLIAM: AIE, Huntsville, AL: ASHLEY, KEITH H.: SCE, Jay, FL: BACHAN, CRAIG A.: 4lNM, Ft Lauderdale, FL BOSS, BRIAN PHILIP: AFI, Huntsville, AL: BRIDGES, SAMUEL MARK: 2AM, Montgomery, AL: BRITT, ERIC ARMAND: 3EE. Griflin, GA: BURNETTE, PETER S.: AME, Mendham, NJ: CAMPISI, RICHARD M.: AIARS, Hampton, VA, CARROLL, DAVID PATRICK: SCHE, Birmingham, AL, CHERRY, MARK DWAYNE: 2Cl-IE, Smiths, AL: COLEMAN, MARK S.: 3ME, Hartselle, AL: CONWAY, JOHN FRANCIS: 2ME, Stone Mountain. GA: COOK, STANLEY F.: 4AY, Moulton, AL COVEY, DAVID JOHN: SAE, Ft. Walton Beach, FL: CRAVEN, WARREN R.: 4BSC. Ft Lauderdale, FL, CROSS, KENNETH HUGH: 2AE, Tucker, GA: DANIEL, JAMES WALTER, JR.: ACPE, Huntsville, ALL ELLISON, CHARLES HENRY: 3lNM, Perry, FL: ESTRADA, JOHN P.: lME, Fayetteville, GA: FERRY, HUGH E.: ZARS, Trussville, AL: FOX, ERIC EUGENE: 2AM, Savannah, GA: FOYT, JAMES MATHEW: 2PB, Coral Gables, FL: FREEMAN, DAVID PAUL: IEE, Huntsville, AL GENTILE, THOMAS JOHN: 2PB, Glen Burnie, MD: GLASGOW, ARTHUR J.: BAEC, Hartselle, AL: GOLDIN, STEPHEN JAMES: 4MK, Atlanta, GA: GRAVLEE, GAINES P.: 4lNM, Huntsville, AL: GRIFFITH, GARY BRANDON: 2AE, Tucker, GA: GUSH, LEONARD, KEVIN: 2PB, Dothan, AL: GUTHRIE, WALLY E.: 2ME, Maitland, FL: HALEY, DAVID C.: tPN, Stone Mountain, GA: HAMNER, JOHN ROBERT: SMK, Fayette, AL: HANCOCK, JAMES KIRK: 2PO, Dunwoody, GA: HARMON, BART GREGORY: SLEH, Selma, AL: HILL, ANDREW: 4AC, Hazelhurst, MS: HINELY, TIMOTHY D.: iCHE, Prattville, AL: HOWELL, ROBERT CLAY: 3CE, Childersburg, AL: HUFF, TIMOTHY HENSLEE: IGPO, Peachtree City, GA: JENNINGS, WILLIAM MARK: 2EE, Melbourne Beach, FL: JOHNSTON, DAVID ALAN: AMN, Homewood, AL: KANTOR, MARK ANDREW: IPB, Huntsville, AL: KING, GEORGE DEWEY: ZPB, Dunwoody, GA: KOCH, ERIC R.: SIEIINM, Huntsville, AL 288 EIDE-XII of , ,wi V, - '13 :wwe :V I,I: ,F W I: , 9 f IW K ' ff? : fe J . - tg, we f f , yy I y . I A 3 A I 5 I. p 3 , M li I lah K, A i dsl Sl if If I I ' :G - is Ms K Ml g y ,,,, 1 3 ll , , ,,,,,,, , t AI it r 1,1 L . , l . G55 GE D L ' I if Lil I-4 A I lm A A I , I X I , Vrll Q I0 I , I 4 MIMMIAS A li' llll I. f ,, ,l ,A ,,ff N.: X Q vl . s V. ,,. . ' 'X - ,g :,.,,, ,,,,,,,, ,,,,,,, , l ,,, ,.,, , , as I ,fl B' Illll , , ' A ' L x I ' , ,,,,,, ,,,, ,,, yyl, , ,y lil L ,,,. .,,,,,.,.,. ,,, l ,,,,,,, ,y N 7 A l ,., ,..,,, l I 2 W V. IVVVI , ..,' I I I . If 2 I I Ie, 'fl I 'H ,,,,,,, , ,,,, ,, , , ,,,,,, , ,,, or ,,,,,,,,, ,,,, , hrlet I 1 -- , g O I - NIM I L? ,. .11-fi , fr H , ' - if . I Q 'V I ' I s ' 1 . T T 1 I 'fn S f i A e , A gf f ,W , i , :yW,.W.,g,yM,g,,,,,, , i y . , A , L? 5 ,? W ia- -x q- , f , V We 2 N f rt if il L.. ,lit iaiiteiit IMI Bifida 79.19 Z4 :vt efdf W W... j.,QQ iQEY, 3 yu, Q Lx fx .ali l ..W, ,W . ,,, , W,,,.7,l, ,.ll , . , ' gg 1 - . K L ' A 4' V b2'I ' , I ,zfl ,V .0 4? . V if ' Y ' A A, it Y 1 A ' I :if :il YT' ve A ' 0' My . . i i. , K? , in A l gf, If XAAA I I I a . C? . A f, 5 'PSS 'ggi 53: L , S, . -K :L W fy, t. II 154 lg M ' S - A' 5 L ,i . ,,, R ' if L S. . :ii t gyggg t . t. A ,ga Q . - . Q I i E Q , psf R n 735 ' .vig ' 4 'i qi nf J :fi - 2 'I LFE? ' V - is I , 1' -. . 2' re. I ' ' ' l it gig ig Q . :,,i . 5 y . . ,, Xi,: A S I., ff' Q I , g ' ' K I fm- I I I I A my 6 A Q5 3 .2 W my i Ja, , L gf 1 A L Ji. I F! . F I ' IR' I Ia f fl 4, I ...AI ' L 'i' ' 9 ' 9 r H l li f lflhyl :32 55. rl I ' 'iy - ' It 'V 7 ' 2:4 , fr --, ' .aw M 'ii' I ASAE IWX' LIB! ,' l V Q .,,.v, . i 5... , , 'L , 'f' , an I ' I W S, . I ' ff? Y .S .fi A ' F ' F ,A lv ,bf I I 4 W In ,. 6 , .inf ig f'- Q QI. bil 'Eli X' If i .- l' Q. gf J f I , f , gg I A 'I Q A . 4: - 5. x i x Z' ffirizt A .. r . i . f . 4 ' -4 ' gn I iii 'L ' - 49- I .jf 65? 'I x f f ,AQ '5 'f ' l 1 3 g :g,2i A ff. f LB . LANZA, JEFFREY MICHAEL: 3VAT, Huntsville, AL, LEWIS, MICHAEL K.: BCPE, Huntsville, AL, LOCKRIDGE, FRANK B.: 2PM, Birmingham, AL, LUKENS, JOHN G.: ABSC, Ft. Thomas, kv, LUTOMDKI, DONALD F.: 4oMN, Birmingham, AL, LYNN, DAVID ALLAN: 3FY, Decatur, GA, MAL, MARK HENDRIK: 2ME Auburn, AL, MCBRIDE, CHRIS: SMFIB, Plantation, FL, MCKNIGHT, STEWART D.: AFI, Alexandria, VA, MEASEL, ALBERT A.: 2EE, Barbank Dr., AL MILLER, GARY: 2PB, Tucker, GA, MILLS, THOMAS ARTHUR: 3PB, Tucker, GA, MOORE, JOHN OLIVER: AGL, Birmingham, AL, NAHORS, JAMES KEITH: iME, Peachtree City, GA, NICHOLS, JAMES A.: SADS, Marion, AL, PARAMORE, JAMES MICHAEL: 2PB, Melbourne, FL, PELK, JIM DAVID: SMN, Hartselle, AL, PERRY, DAVID THOMAS: AAC, Birmingham, AL, PETERS, MARK TODD: 1GL, Lexington, KV, PICKETT, HUNTER LYNN: 1INM, Memphis, TN PIPER, DAVID J.: 3 OMN, Atlanta, GA, REEVES, MICHAEL DURAND: AHF, Hartsell, AL, RICHEY, MICHAEL RAY: AAEC, Birmingham, AL, RODRIGUEZ, BROOKE: SCPE, Memphis, TN, ROGERS, KENNETH EUGENE: SEE, Phenix City, AL, SHAFFER, DAVID ALAN: 2CHE, Azie, TX, SIMS, JOHN D.: 2PB, Hartselle, AL, SMITH, DANIEL EDWARD III: SME, Birmingham, AL, SORENSEN, ERIC H.: 2PB, Melbourne Beach, FL, STEWART, JAMES HOWARD III: ALPD, Anniston, AL STEWART, KEVIN DONALD: 2EC, lndialantic, FL, STUMB, JEFFREY T.: 2G.JM, Birmingham, AL, THOMAS, DONALD VAUGHN: 2Pe, Stone Mountain, GA, TIGHE, FRANK JOSEPH: 3HY, Anniston, AL, TURIS, TIMOTHY M.: ABSC, Huntsville, AL' TURNER, WARREN RUSSELL: ZPVAADS, Huntsville, AL, VONSCHUTZ, WILLIAM T.: AEE, Huntsville, AL, WADE, JOSEPH FREDRICK: 2CH, Moulton, AL, WARD, JON: 3DH, irliterprise, AL, WASDEN, PHILIP JACKSON: AFI, Birmingham, WILSON, WADE: 1PN, Birmingham, AL, ZALESKI, MICHAEL JOHN: lPN, Nashville, TN, BELL, NELL M.: Housemother, GOODWIN, GEORGE: Adviser, ABERCROMBIE, JAMES E.: 1EE, Hixson, TN, BACHELOR, JAMES MICHAEL: 3EE, Prattville, AL, BEE, G. MICHAEL: ACJL, Tampa, FL, BERNDSEN, JON DUNCAN: ABSC, Gulf Breeze, FL BROWN, GLEN W.: 2ME, Newnen, GA, BRUCE, HERBERT R.: 2BCH, Jacksonville, FL, CAIN, ROBERT A.: 2AE, Coral Springs, FL, CIVIL, GREGORY ALLEN: ZCPE, Dunwoody, GA, CLEMENT, KEVIN BRYAN: 2EE, San Antonio, TX, CLEMENT, MICHAEL C.: 1ME, Prattville, AL, CODY, MICHAEL THOMAS: 1PB, Orange, CT, COFFMAN, JOHN R.: AEE, Vaalrico, FL, COLT, JON CHARLES: tPB, Dunwoody, GA, COLVILLE, WILLIAM ROBERT: AAY, Jacksonville, FL COX, BRUCE B.: 2PB, Greenwich, CT, DALY, JOSEPH FRANCIS III: 1AR, Macungie, PA, DAYTON, MARK W.: 2PN, Ozark, AL, DEVAULT, WILLIAM KEITH: AMTL, Clarksdale, MS, ELMORE, SCOTT DAVID: AAM, Fairfield, CN, FESTER, JEFFREY T.: ADHY, Ellenwood, GA, FIELDS, PAUL: 3AE, West Palm Beach, FL, FIKE, GREGORY W.: tCPE, Montgomery, AL, FLETCHER, MARK HOWARD: 3CH, Gadsden, AL: FOX, STEVEN DAVID: ACPE, Stone Mtn., GA HALL, JOE M. III: SGC, Birmingham, AL, HANLON, HERBERT EDWARD: AME, Lake Park, FL, HARBIN, KENNETH EDWARD: AME, Palm Bay, FL, HEFFREN, MARTIN THOMAS: SAC, Burke. VA, HUTCHINGS, CHARLES J.: 4lNM, Miami, FL, JOHNSTON, JAMES MATHEW: 2CE, Jasper, TN, KEIDEL, JOHN W.: 2ME. North Bend, OH, KEITH, JIM: 3EE, Birmingham, AL, KELLER, KARL MICHAEL: ABSC, Manlius, NY, KESSLER, GRANT DAVID: 1CS, Foley. AL LAING, MICHAEL A.: ALEC, Titusville, FL, LOCKHART, RUSSELL CLIFTON: ASC, Prattville, AL, LONG, RAMOND M. III: APIFI, ST. Petersburg, FL, MACARTHUR, SCOTT E.: AAC, lndiapolis, IN, MACHAVIER, WILLIAM TED: 2AMH. Decatur, GA MARTIN, MICHAEL KEVIN: 3CJL, Montgomery, AL, MAY, MICHAEL D.: SEE, Davenport, AL, MCLEOD, MICHAEL PACE: 2AE, Stuart, FL, MILLS, RANDY: AAN, Ft. Walton Bch., FL, MINSHULL, ROBERT GEORGE, JR.: ACPE, Gull Breeze, FL MOOLDY, EVAN J.: 2AM, Miami, FL, MORRIS, ROYCE FOHN: 3VAT, Forest PK, GA, MOYERS, JAMES EDWIN: L, Monroeville PA: NESBITT, JAMES T.: 3GL, Auburn, AL, NEVILL, JOE GLEN: 2AM, Humble, TX, NIGGELER, CHRISTOPHER LUKE: 4cPE, Jamison, AL, NOLEN, Tmlomv R.: ace, Gadsden, AL, O'CONNOR, THOMAS W.: ACPE, Nashville, TN, PACELEY, PETER J.: ACPE, Huntsville, AL, PETTIS, PHILLIP PIERCE: 3CPE, Dunwoody, GA PURTILL, GREGORY SCOTT: 2LPO, Ft. Lauderdale, Fl., KAWL8, FRANCIS COLLIER III: 1PN, Huntsville, FL, RICHARD KENT JAMES: 2AC, Gasden, AL, RICHARD, LANCE: ZPB, Gasden, AL, ROMAN, DAVID: ATN, Tempe, AZ: ROMAN, SCOTT CHARLES: 1CPE, Kings Park, NVQ SCUSSEL, RANDALL CLARK: 2PB, Huburn, AL, SEARCY, DONALD REUBEN: 3EE, Nashville, TN, SEDACCA, ROBERT ALLAN: AAM, Ft. Lauderdale, FL, SEUSSEL, RICK C.: 2PE, Auburn, AL SMITH, STEPHEN GREGORY: 3PB, Birmingham, AL, STORY, JAMES E.: ICPE, Dunwoody, GA, STREET, MICHAEL T.: 2, Tampa, FL, TINSLEY, MARK: APV, Pell City, Al, VERNER, DAVID: AAR, Florence. AL, WELDE, ERIC C.: AEE, Warner Robins, GA, WICTOR, TIMOTHY: 4AC, Cape Coral, FL, WILLS, KENNETH JOHN: 2AE, Dunwoody, GA, CONNER, DONALD M.: Trustee :ii-'mi-1 289 BROWN, MICHAEL DAVID: 2PO, Atlanta, GA, CANTRELL, RON STEVENSON: 2MN, Dalton, GA: CARN, JONATHAN DAVID: 1AFl, Ozark, AL, CHRISTOPHER, LARRY SCOTT: AANM, Greensboro, NC, CONNER, REE T.: AAC, Tuscumbia, AL: CONNER, T. CHRISTOPHER: 2PO, Tuscumbia, AL, COOK, SCOTT ALAN: 1PB, Ozark, AL, COUSSONS, MICHAEL WILLIAM: 2GC, Florence, AL COWAN, DAVID LLOYD: AAM, Birmingham, AL, DENNY, JAY: AAM, Alexandria, VA: EARNEST, CHARLES BRADLEY: SCSE. Maitland, FL, FAIR, ALAN GLENN: 3INM, Niceville, FL, FLOURNOY, JOHN: 1GC, Niceville, FL, FOWLER, JAMES H.: SMRB, Decatur, AL: GETHERS, DAVID ANDREW: ABSC, Mobile, AL: HIGGINS, ERIC ALLAN: AMED, Madison, AL: KAISER, GEORGE PETER: 2PN, Elberta, AL, LOCKHART, TIMOTHY JOHN: BEH, Hartsell, AL LUCAS, KEITH T.: 2GC, Jackson, AL, MADIGAN, KEVIN M.: 2CPE, Clearwater, FL, MARBLE, KEVIN TIM: AMBI, Tallassee, AL, METCALF, DONALD WARREN: 1PN, Snellville, GA, MIDDLEBROOK, JIMMY EDWARD: ICHE, Flichmond, VA, MILLER, ROBERT WILLIAM: AAM, Pt. Pleasant, NJ, MUELLER, ROBERT WILLIAM: SEE, Pensacola, FL, MURRAY, MARVIN M.: 2AE, Montgomery, AL: PEARSON, WILLIAM ANDREW: 2EE, Maitland, FL, PEDERSON, PERRY A. JR.: AEE, Longwood, FL PICKERT, JOHN: 2PB, Pensacola, FL: REDMON, SCOTT PATRICK: 2CPE, Sunwoody, GA, RESTREFO, GABRIEL EDWARD: 3CE, Palm Gardens, Fl: ROBERTSON, KEVIN ALLEN: 2lND, Snellville, GA, SANDERS, CLARK DRAYTON: 2CH, Dalton, GA, SCHAAL, GARY M.: 1GAN, EGLIN AFB, FL, SCHALL, ROBERT JOHN: 2CJL, Eglin AFB, FL, TIERNEY, JAMES FRANCIS III: SGC, McLean, VA: WALLACE, ALAN WILLIAM: 2CPE, Atlanta, GA WHITE, LUCAS MARSHALL: 2PB, Montgomery, AL, WILLIAMS, NORMAN GLYNN JR.: 2AE, Selma, AL: TIECNEY, KATHRYN ANN: Sweetheart: BARGNER, MARY: Housemother: AUSTIN, STEWART L.: 2NN, Dadeville, AL, BARRETT, JERALD L.: AIM, Tarrant, AL, BLAKEWOOD, BENJAMIN JENKINS: 3PO, Victoria, TX: BLALOCK, JOHN DOUGLAS: ACS, Auburn, AL BOWEN, DAVID J.: 3ACF, Floanoke, AL: BOWEN, GREGORY P.: ZBSC, Falkville, AL, BROTHERS, DAVID SCOTT: SCE, Altoona, AL, BROWN, MICHAEL CHARLES: AAR, Satellite Beach, FL: CHARRON, JAMES A. JR.: AFI, Chattanooga, TN, COMPTON, D. REED: APIR, Milton, FL, DIETZAN, JOHN WILLIAM JR.: AFI, Chattanooga, TN, DUNNER, MAURILE: 2lB, Mobile, AL, ECHENIOUE, MARCIAL L.: 2CPE, Fort Lauderdale, FL: FRANK, CRAIG MARTIN: AINM, Port Charlotte, FL FREEMAN, CHARLES: 1PN, New Orleans, LA, GUTEIERREE, CARLOS MARIO: 1lE, Miami, FL, HEAD, MICHAEL C.: AINM, Melbourne, FL: HUGHES, WILLIAM EVANS JR.: AIE, Attalla, AL: JORDON, STEVE: 2PV, Mobile, AL, LIEBLONG, KURT GEORGE: 2EE, Clearwater, FL, MARTIN, NEIL F.: 3AE, Severna Park, MD: MCCORMICK, JOHN ALAN: 3EE, Palm Bay, FL, MCCOY, STEVE RANDALL: 2AM, Seminole, FL: MCWILLIAMS, JEROME KEITH: 2GL, Milton, FL MILLER, CARL G.: ACJL, Ft. Lauderdale, FL: MORGAN, JOHN S.: SCHE, Gadsden, AL, MOTZ, AUBREY IV: SPC, Peachtree City, GA: NELSON, KEVIN: AMK, Nashville, TN: PAGE, JAMES TRARIS: IPN, Auburn, AL, PEAK, JOHN H.: 2PSY, Auburn, AL: PRITCHETT, JERRY ASHLEY: 3ACF, Gadsden, AL, REYNOLDS, RUSSELL HOWARD: 2EE, Coral Springs, FL, ROUNSAVILLE, FRED BLAKE: ABSC, Mobile, AL, ROWAN, WAYNE THOMAS: 3BSC, Birmingham, AL SARRATT, ROBERT L. ABSC, Nashville, TN: SAWYER, R. KENNETH: ABSC, Huntsville, AL, SHEPPARD, ROBERT R.: ACHE, Houston, TX, SLAPPEY, TODD CLIFTON: 1AC, Phenix City, AL, SMITH, GENE A.: ZGHY, Albertville, AL: SOTO, ERIC ROBERTO: IPAR, Panama City, FL: TEHAN, GEORGE WILLIAM: ABA, Springfield, OH, WAITS, ANDREW: AME, Winder, GA, WALL, ROBERT CLAIR: AME, Winder, GA, WARREN, ALLEN JACKSON: tPB, Montgomery, AL WEYANT, ERIC DOUGLAS: 3lNM, Opelika, AL, WHATLEY, STANLEY PHILIP: AAR, Gadsden, AL: WILSON, BUDDY: AGL. Birmingham, AL: YOST, SCOTT ALAN: ACE, Huntsville, AL, ZWALD, JAMES: AHSA, Atlanta, GA: SULLIVAN, MOM: Housernother, ADAN, ANGELA: AGPG, Atlanta, GA: ALEXANDER, LINDA: SCEC, Birmingham, AL ALLEN, AMY: ZCEE, Plantation, FL, ALLEN, KIM: 3FCD, Selma, AL, ALLEN, MARY STONE: ACHE, Boswell, GA, ANDERSON, CHARLENE: lPV, Smyrna, GA: BAKER, JOSLYN: ZCSSC, Montgomery, AL: BANSTON, KIMBERLY: 1AM, Billeau Beach, FL: BARC2, SHARI: 2PB, Ft. Lauderdale, FL: BARNETT, GAYLE: 3PY, Marion, AL, BARNETT, CAMILLE: 2PY, Marion, AL: BAYLEY, KAREN: 1lD, Atlanta, GA BEAUPRE, GINGER: 2FM, Ooravllle, GA, BENTLEY, EMILY: 1AR, Oneonta, AL, BLACK, BELINDA: AOMN, Atlanta, GA, BOYD, CARRIE: 2PFl, Birmingham, AL, BRADLEY, SNOW: BGAN, Atlanta, GA, BRAKEFIELD, GINA: AHPR, Huntsville, AL, BRAKEFIELD, TINA: AFCO, Huntsville, AL, BROWN, LINDA: IEE, Cocoa Beach, FL, BUTLER, SARA: 3MT, Atlanta, GA, CECIL, CAREN: 1CEC, Montgomery, AL 290 ex-ea-zu ,-fl X ,, ,js .A 1 I -V V :Zz Z 91, ' F lg E .J 'dz All v 'r ,Tis . , ' W 5 V if W 6 K V T , eg! 2 .ff l g ti' 2, Y ,. 2 I V ia A A V fwfr il ,fe uf: f 1: ,A ' wt MT' 9' l My I ' iili 41, f 2 I ,fy-l ,,,,'k ,sian f f' f l 'O' t f 1 if AW, 1' ii 1 A .V fa x N I 2 I A K . , fy an ,S B -a Y - l ' 1 , L' :, V' K N: ,5 A , 6 I ' .rl -A M , My i Al 'Ae' l, gal: xl . :r ' iigi if Al All :I V J f 9 g l 3 I ?s.ZL. .,,, 1 1' I V: -V ' R. ,E . ' ., , :L f Rf Sf ' -- S ,J : - X1 - , gig., ' A A ,.. - f ' - 'L A : - g 4 A 'Y 9 N 5 Xu A .v F. :L F5 A 'F :xr New :A AE: I Af A K 9 'W sr f 15 . 5 R 3 X A BSS X J. fi- ,K ,. ,f , ,, isa., Q X A , 'Fl '55 5 ,, S , f , r : f 2 F. gd,':.:.:1 -., Ei if or 4 , f ,.f'5,.,, fl :rf Z 7 M W' A ' H CHOCALLO, EILEEN: 2CHE, Stone Mtn., GA: CHUANG, SALLIE: 2MCH, Florence, AL: CLARK, TERI: 2PB, Birmingham, AL: COBLE, CRISTY: 2FM, Lewisburg, TN: COCHRAN, BEVERLY: SAC, Rainsville, AL: COLSON, BRENDA: IHPR, Dunwoody, GA: CONNER, LAURA: 2NF, Plantation Acres, FL: COOK, JENNIFER: IPB, Pike Fload, AL: COPELAND, BEVERLY: 1PN, Birmingham, AL: CROASMUN, JOLENE: 3GMH, Birmingham, AL CULWELL, LISA: 4PY, Birmingham, AL: DAMIAN, SUE: 1CHE. Huntsville, AL: DAY, LINDA LYNN: ACSC, Gaithersburg, MO: DICKS, AMANDA: 1OH, Gulf Shores, AL: DODGE, VANESSA: SPB, Atlanta, GA: DREESBACH, TRACY: IBA, Naples, Italy? DYE, KATHY: 4PlFi, Birmingham, AL: FERRARO, ANITA: 1PM, Montgomery, AL: FORTNER, CHERYL: iPB, Huntsville. AL: FRAMPTON, SUSAN: 1MDT, Huntsville, AL GIVENS, STEPHANIE: IFM, Marietta, GA: GOLDSMITH, PAIGE: 2EEE, Atlanta, GA: GOULD, LAURA: 5PY, Panama City, FL: GRAFF, PAT: 4AC, Lakeland, FL: GRAFF, WENDY: IPB, Montgomery, AL: GRAYDON, LORI: 2PB, Alexander City, AL: GREEN, MELINDA: 1PT, Montgomery, AL: GRISHAM, LAURIE: 2GC, Huntsville, AL: HARRIS, TAMMY: 2NS, Sardis, AL: HARRIS, TREVA: SNUR, Huntsville, AL HARRISON, ELLYN: 2GC, Marianna, FL: HENDERSON, KATHERINE: 3LT, Marietta, GA: HENGHOLD, BETH: 2PN, Beavercreek, OH: HOCHREITER, MARY: 2lND, Miami, FL: HOLT, JANA: SHRA, Florence, AL: HOPKINS, LYNNE: 2GJM, Huntsville, AL: HOWSE, DEBBIE: 4CEE, Gardendale, AL: HUBER, MARY: AF, Birmingham, AL: HUGHES, BARBARA: 4CSC, Atlanta, GA: HUNT, KELLY: SARXID, Holmdel, NJ HURFORD, NANCY: 1CHE, Huntsville, AL: JANCATERINO, TERRI: 4GPG, Montgomery, AL: JOHNSON, HEIDI: ZPB, Bolling AFB, DC: KAVOOKJIAN, JAN: 4AM, Albany, GA: KELLEY, CHERYL ANN: 2ECE, Huntsville, AL: KELLY, JANET: 4FCS, Hingham, MA: KISH, CHRIS: INUR, Sattord, AL: KISH, CONNIE: 2PC, Saliord, AL: KRANERT, KAROLINE: 4FM, Huntsville, AL: KUCKER, BARBARA: INS, Gallatin. TX LARISON, NANCY: AFM, Largo, FL: LEHMAN, CHRISTIE: 2CEE, Sylvania, AL: LEMASTER, MONIQUE LISA: 3FLT, Birmingham, AL: LOEWENTHAL, KRISTA: SMB, Marietta, GA: MARTIN, DEBORAH: 2FLT, Stone Mtn., GA: MASON, MARY: 1NF, Auburn, AL: MATTHEWS, CLAIRE: 3MK, Miami, FL: MCCOOL, BARBARA: 4CHE, Huntsville, AL: MCGARITY, MARIANNE: 1BA, Birmingham, AL: MCGUIRE, MOLLY: 2BA. Lansing, Ml MICHAELS, ANNE: 1PN, Birmingham, AL: MILLER, LISA: AGPG, Pittsburgh, PA: MILLER, MISSY: ZRSS, Pell City, AL: MILLS, KAREN: APPY, Panama City, FL: MILLS, PATRICIA: 4AC, Ocala, FL: MOORE, CARLA: 3FM, Crab, AL: MUELLER, DONNA: 1FM, Mobile, AL: NEWBERRY, KIM: SFISS, Alexander City, AL: NEWTON, KIM: 1FM, Clarkston, GA: NUNN, PAIGE: SAC, Huntsville, AL O'NEIL, LAURIE: 1GC, Birmingham, AL: PALMER, J0 ELLEN: 1CS, Leroy, AL: PARSONS, KIM: 3FM, Oxford, AL: PENNIMAN, KAREN: AMT, Dover, NH: PERRY, BOBBI: SIE, Cocoa Beach, FL: PHILLIPPI, GINNY: 4FLT, Birmingham, AL: PHILLIPS, JAN: IPT. Alexander City, AL: PHILLIPS, KATHY: 3LMH, Ft. McClellan, AL: POOLE, PATTI: IBS, Ft. Pierce, FL: REESE, ELIZABETH: 3FCD, Montgomery, AL REGISTER, KIM: 4PFIS, Montgomery, AL: RILEY, SHIRLEY: SVHE, Huntsville, AL: ROBERSON, JILL: 3CJY, Dunwoody, GA: ROBERTS, STACEY: ZCPE, Hartselle, AL: SAITTA, MOLLY: 2PB, Doraville, GA: SANSING, LAURIE: ZCEE, Decatur, AL: SAYERS, SHERRY: 1CS, Birmingham, AL: SCI-IMITZ, DEBBIE: SFCD, Dunwoody, GA: SCHWARTZ, PHYLLIS: SMK, Stone Mtn., GA: SMITH, ANGIE: 4MK, Alexander City, AL STAFFORD, LISA: ALPB, Montgomery, AL: STEPHENS, SHERRI: 2lFE, Louisville, AL: STORY, DEBBIE: SPFIS, Alexander City, AL, THOMAS, CHRISTA: IGC, Birmingham, AL: THOMAS, DIANE: 4LTI, Dallas, TX: TRAYNER, JILL: 3FlSFi, Tampa, FL: YANCLEAYE, TERRIE: 2NS, Selma, AL: VARNEY, LAURIE: 2PN, Cocoa Beach, FL: YAUGHAN, JENNIFER: WBA, Nashville, TN: WARD, LISA: ZVDE, Eufaula, AL WEBB, LIANE: IAF, Birmingham, AL: WIGELSWORTH, LISA: 4FLT, Ocala, FL: WILDER, PAMELA: SACF, Oxford, ALI WILLIAMS, KIM: 3CS. DeArrnanville, AL: WILLIAMS, LUCRETIA: AGPG, DeArrTtanville, AL: WILLIAMS, SHEILA: IPPY Birmingham, AL: WILLIAMSON, LAURA: 4CJL, Birmingham, ALL WILLICE, KATHERINE: SVAT, Huntsville, AL1 WILSON, FRANCES: SPB, Montgomery, AL: WRIGHT, LAURIE: 2FLT, Dunwoody, GA ZTA S Q.. U, ,Q . ggmig A-Q--.. .y I KVIV ' W Izy- SSW y ffffem W ,My Qi' Q lf' -V .fx -99450 -:Wm x - - fM wk iff, -1 , . , awww, 1- ,,,, ,X 1.,: k A V - . ff? Q w 'S 'W' U if V . . Q ' f ' Q at 'h 'hh' f 'x .f L- Q , 3, 6,5 7. , V. .f V-.,,Ms.m, . ' L 0 f 5' ' ,Q .- S w 1 gi A N , , -bags'-4. 1 W ' 5? i fy Tx : orority girls, fraternity men, big brothers, little sisters - how many families can a person belong to? Approximately 23 percent of Auburn students belong to at least two: first, their real Mom and Dad and second, a group of brothers and sisters who wear the same foreign letters. Some call them Greeks, some don't call them, but it would take an unobservant person not to realize the impact the Greek organizations have at Auburn. With 30 fraternities claiming more than 1,900 Auburn men and more than 2,000 girls as members of the 18 sororities, the Greeks are a visual part of Auburn and participate widely in campus and city activities. Band parties, fundraisers, socials, parades and Greek Week add to campus life, and the revenue that Greeks bring to local businesses is significant to their income. For instance, Greek spending comprises 25 percent of the State Store's income and 30 percent of the beer distributor's earnings. Forty percent of Lang's Sportswear customers are Greeks, and they command 75 percent of Sani-Freeze's operations. No matter how you feel about sororities and fraternities, they do contribute a lot to Auburn's community and it looks like they are here to stay. - by Charlotte Borden Arm CRAIG SHIRLEY The Greek Alphabet Alpha ner.. Gamma Delta al-fah bay-mix gum-uh del-Ialx Epsilon Zm Eu Theta ennvlon :ag-lah ay-lair thayvtali lou Kappa Lambda Mu WL-.0.mh mp-gli Lmib-dnli mem i Ill N Ii 0 H , Nu xi omifmn Pi new :EYE anim-c-cron pit' W Rho Sigma Tau llpsilun me sig muli raw cop-ti-lun cl, X qi Q RUSSELL ci-ioFiELi Pri: gil ffl, uiitylih Wrech Tech Burn The Bulldog SPIRIT FLOAT SPIRIT FLOAT . I. Sorority 1, Tau Kappa Epsilon I. Sorority 1. Kappa Delta 1. Delta Zeta 2, Sigma Pi 1. Chi Omega 2. Alpha Xi Delta 2. Phi Mu 3. Chi Phi 2. Kappa Delta 3. Pi Beta Phi 3. Alpha Gam 3. Kappa Kappa Gamma ll. Fraternity ll. Fraternity 1. FIJI 1. Chi Phi 2. Chi Phi 2. Sig Ep 3. Sigma Chi 3. FIJI 294 Greeks SUSAN BROWN M N Greek Week Winners 1982 Sigma Chi Derby 1982 FFZATERNITY SORORITY 1. Zeta Tau Alpha 2. Delta Delta Delta 1. Pi Kappa Alpha Q3 way tie for firsti 3. Chi Omega 2. Sigma Pl Alpha Omicron Pi 3. Sigma Phi Epsilon Chl Omega Derby Darling: Katherine Parker Kappa Delta JOHN REED Greek Facts KA was founded by Flobert E. Lee and they celebrate his birthday each winter with Convivium Alpha Gams consistently rank top in sorority scholarship . . . FIJI calls the governor of Hawaii every spring during their Happy Birthday, Hawaii party . . . Kappa Delta was the first sorority founded at Auburn in 1922 .. . Jimmy Buffet was a Sigma Pi at Auburn .. . Toni Tennile was a Tri Delt on the plains . . . Delta Sigs have the oldest house on campus, built in 1928 During WWII girls lived in fraternity houses . . . Betas have their own live-in ghost at their house on College Street .. . Alpha Xl prints the Men of Auburn calendar each year . . . Snug Jordan was a Theta Chi at Auburn .. . Miss Lillian Carter was a KA housemother at Auburn , . . In 1982 Teke chapter was voted the Most Improved Teke chapter in the nation Pike calendar girls were voted the best Pike calender girls in the nation ... Alpha Chi is moving up the hill to Dorm J in the fall SAE's are the oldes. fraternity on campus: Fob James was an SAE here . . . Gamma Pi's won first place in the GLOM Greek Life photo contest ,. . Chi Phi is the newest fraternity on campus, refounded in spring 1982 A third of all Greek women across the nation have been Chi Omegas . . . Delta Chi has the newest fraternity house on what may soon be the newest fraternity row . . . ADPi won first place in Step Sing for sororities in 1983 . , , Pi Kaps took first place in the fraternity Greek Life photo contest with their 'composite' shot . . . Ken Mattingley was a Delta Tau Delta at Auburn . . , Farm House has the highest GPA among fraternities .. . OTS and Alpha Psi, being the two vet fraternities, compete strongly against each other . .. The first Aubie, Barry Mask is a Phi Tau ,. . Pi Phi and Kappa were both founded at Monmouth College and have a joint party every spring called Monmouth Duo . . . Lambda Chi enjoys sorority competition at their Watermelon bust in the spring . . . Sigma Chis look forward to waking up at 2:30 a.m. to a house full of sorority girls during Derby Week . . . Zetas are remembered for their 'Zeta Goodbye' during fall rush DZ, FlJl, Beta and Alpha Gam hosted the largest fundraiser of the year Kick off the Fall in 1982 Panhellenic 295 means all-Greek. Greeks ffifiigef 5 t5 i WWW Qfftg , Wgi agtgtig Ipha Chis are making memories . . . surviving through a week of ice-water teas, Broadway, Loveboat and Old South parties with a result of 47 beautiful new pledges . . . pairing up with the Sigma Chis to raise money for cystic fibrosis at our annual Oktoberfest . . . dressing up in crazy costumes for a trick-or-treat Halloween party with the Headstart kids . . . dialing for dollars at the Auburn Generations Fund phonathon and the excitement of receiving a 33,000 pledge . . . having a Spring Fling party for Project Uplift . . , watching talented Alpha Chis perform with University Singers, Tiger Pause, Concert Choir, Dance Theatre and Auburn Entertainers . . . getting involved at the Plainsman and Glomerata having Too Much Fun at Pandamonium pledge party . . . supporting our sisters in Tigerettes, Tiger Splashers, Hockey Honeys, fraternity Little Sisters, ODK, UPC, SGA and class honoraries . . . winning first place for our Homecoming float - Tigers Give Rutgers Knightmares! . . . singing at candlelights for engaged, pinned and lavaliered sisters . . . remembering our Golden Lyre Ball at the Peachtree Plaza, Christmas party, champagne socials, lake parties and Riverboat Rendevous in Montgomery . . . Alpha Chis are making memories to last a lifetime! - Alpha Chi Omega ALPHA HI OME I Kim Murphy Cindy Barbaree Kelly Berstien Pam Hargrove Kelly Bullock Donna Ledbetter Mary Monk Julie Williams Gayla Britton Karen Boettger Shelli Holt Karen Green Susan Hutto Lucy McQueen Elizabeth Hairston Margaret Fuller Pam Moore Laurie Herring Donna Barry Andrea Sides Julie Arnold Lisa Regan Mitzi Pannone Jennifer Lake Lynn Pridgen Beth Anderson Ginger Robinson Janet Jackson Bitsy Bentley Paula Best Beth Stoll Susan Hairston Laura Pope Cindy Howard Angela Elliott Yvette Reidon Dawn Russell Carolyn Kucci Candis McGowen Janice Scarborough Chris Maddox Lori Spencer Shari McAlister Pat Hardy Cathy Brown Cathy Jones Karen Logan Betsy Housman Leigh Hutchinson Darlene Barber Lucy Cook Pam Wilbanks Jan Tatom Laurie Joyner Kate Bradshaw Selena Chumney Sheila Atnip Noreen Vento Laurie Herren 60. Stacy Stewart 61. Carrie Smith 62, Nancy Huddle 63. Sherry Strother 64. Kelly McMahan 65. Layne Montalto 66. Lisa Brackin 67. Lisa Huttstutler 68. Penny Horton 69. Ame Satterlield 70. Marcela Carra 71. Gina Sewell 72. Pam Hartley 73. Melonie Layfield Not Pictured: Laura Bailey Kris Belten Stacey Bullock Donna Corless Alicia Gibson Susan Grant Fran Kushner Cari Landers Diane Neese Cathy Newman Theresa Poyner Dana Rernko Jenny Scarbrough Talitha Stark Suzanne Strozier Melissa Van Arken Lisa Webb Kay Watson Melissa Shaw Leslee Belluchie Lynn Brown Laura Gray Pam Hargrove Lorraine Harley Donna Ledbetter Mary Manson Kim Reynolds Susan Walker Leigh Hill Leisa Montgomery Doris Irwin Lyn Browning Michele Haters Donna Harrell Jenny Harris Robin Howell Libby Mason Mimi McKinnon Marlene Patton Kelly Reynolds Sue Roebuck Felicia Simmons Karen Kracke Allison Martin Lisa Landwehr Theresa Carter Cathy Cave Karen Gage Laura Godbold Andie Jackson Suzanne Northam Beth Paul Peggy Reynolds Janie Van Pelt Allison Venable Hope Wallace Robyn Witter Renee Brady Camille Hembree Kathie Lobnitz Debbie McElligott Kim Richards Dee McCown Frances Pease Alpha Chi Omega I 'iff hat's ADPi? Oh, that's my sorority . . Let's road trip to the Tangerine Bowl! . . . eat those Wendy's burgers . . . dittos across the room . . . Tuesday night dinner club . . . jammin' on Dorm E lawn on Squeal Day . . . we beat Bama?!! Oh, how sweet! 23-22, Yeh!! candlelight tonight, oh, I know whose it is .. . Step Sing, this is it, girls! . . . picnic at Chewacla, yum Hartz Chicken . . . eat much? . . . Saloon Express . . . who needs a date to the Georgia game? May I help ch'you? . , . Kim, can you cut my hair? . . . living for each other land the weekend! . . . love 'ya too, bye! whose turn to clean Mimi's litter box? lShh, don't tell Ms. Leader! .. . can you get my phone? . . . oh, excuse me, you're having Bible study! . . . who's making popcorn?? how 'bout them Braves, Lynn P.? Haley Center Concourse, meet 'ya at the trashcan . . . a shoulder to cry on is always there . . . can I borrow your green sweater? . . . when will I every study?? . . . QUIET HOURS! ... we'll just all go to the game togetehr - girls are fun ... can we share your Homecoming mum? . . . here's some juice and a smile for your cold .. . another blind date??? .. . Country Chaos, Square Dancin' Pi's ... wanna' use my Chet's Club? ... see you at the Ouad, 11:00, ADPI table ADP! football, get tough! aerobics in the chapter room, you need to be there . . . Fantastic Fail Dance . .. picture man, over here! whose turn is it to clean up the kitchen? . . . has anybody seen my French book, it was right here a few weeks agol? . . . who says we left our families and came to school, l've got a great one right here , . . love your buns, C.J. , . . is that mandatory? . . . is anybody going to Terrible Terrell? . . . what would I do without you, my friend? . . . you mean I have to graduate??? What's ADPi? Oh, that's my sorority . . 298 Alpha Delta Pl ir by Betty Bealle, president PH ELT . Levian Graham . Melanie Beasley . Edith Smith . Carole Gresham . Julie Rogers . Edie Kries . Lynn Haskew . Lynn Ryan . Tammy Saunders . April Siuthard . Susan Godwin . Vanessa Gilbert . Cynthia Thomas . Sue Savolsi . Sally Reep 16. Laura Morgan 17. Teresa Gordon 18. Laura Norton 19. Margot Walton 20. Debbie Prewitt 21. Ann Kennedy 22. Lydia Parrish 23. Cindy Nabors 24. Holly Hawkins 25. Jill Henry 26,Nancy Kelly 27. Rennie Jordan 28. Virgina Pierce 29. Maggie Alford 30. Debbie Ervin N. N -K K B Melanie McRae Lauren Rinaldi Katy Drake Sheri Sims Laura Horton Alison Hendrix Lydia Kling Melissa Gresha Nanette Boyd Andie Bryd Abbey Watson Celia Norris Terri Hassel Beth Woods Donna Dudley gf X .Q-ff 5, Beth Bellsnyder '. Susan Pipen :ot Pictured: ndy McLaughlin ligh Sport ine Ensey li Banes nory Benton Cla Green en Ellis acy Grantham lnny Neil tdy Gilchrist die Brantly ,ula Boite Kathy Cusick Chrissy Adams Ann Bethune Jil Blalock Debbie King Lori Lewis Aimee Bryars Lea Bryant Juli Barnes Casey Gay Jenny Granberry Beth Doverspike Elizabeth Decker Donna Cooper Tracy Grove Elise Henderson XL xv . -5 Susan Holley Kathryn Howard Kathy Johnson Molly Killia Lydia Parrish Lindsey Perkins Lisa Procapio Natalie Rogers Janet Ryan Saralyn Smith Sheri Steiss Cydney Thonton Barbara Jo Staller Marieile Yates Joanie Mitchell Terri Mony Linda Utottice Angela White Missy Atkins Teresa Reid Leigh Richans Amy Propst Bonnie Wilson Suzy Mile Allison Jackson Julie Warren Laura Thorinton Toni Ledbetter Jill Whatley Bess Underwood Mary Sir Kaye Lynch Suasn Tucker Lana Smith Debbie King Angie Strain Laura Lannau Laura Lamb Nancy Duncan Leslie Haynes Cynthia Jones Kimberly Jones Susan Keaton Ceci Harrison Kim Hortzinger Susan Langael Donna Dooney Jenifer Mast V -S, X N XS, ,wg .,.- ' A Q4 Dana MoGough Denise Nix Dianne Olson Lynna Owen Becky Owen Marg Vann Susan Cox Julia Smith Terri Hamrick ..,-A-'J' L.. 3' Jr. ,ff my , Alpha Delta Pl 299 X l y , . ll I I lil ii erving as president of Alpha Kappa Alpha has been a tremendous learning experience tor me. It was by no means easy, at times, things seemed impossible. But I knew that my Sorors were behind me, and that they had entrusted me with a great deal ot responsibility. This and my love for AKA gave me the extra motivation that I needed to attend my second or third meeting in one night, run here or there, and after all that, go home and study. I wouIdn't trade this experience for anything SORORS, THANKS FOR EVERYTHING by Deanna Nelson, president 300 Alpha Kappa Alpha 1. Deanna Nelson 2. Cynthia Holloway 3. T. Angela Smith 4. Celeste Williams 5. Angela Elridge 6, Willola Ashley 7. Jacqueline J. Hill Not Pictured: Marilyn Beatty Lucille Williams f,X7QfN idx ,A in :fx fx CTX' Q, 'VZ 1.11 Qtfylt 1 1 , , ix 2' Wi. X 1 f Q K 1 1 xwt S E .X 9 'tx f if ' ' if A 1 i 1 ' E f V Q . ' K . . fi, XY , , f . . ,L 1 X' - V X i X I 'V i J! AX. if Y X i N 1' i ' i l XLX ff' lx f . y fi K JR, 1 1 V, 'fi 1 l 1 ' i 1 . i 1 i If x 1 1, jx X l V, X i i i 1 y 1 ii ,f .I 1 y E-Y 1. Doug Smith 2. Roger Gibson 3. Chris Lent 4. Mary Ann Dixon 5. Susan Holbrook 6. Cindy Wilson 7. Karyn Murphy 8. Ann Moon 9. Kevin Gant 10, Eric Gibson 11. Kathy Fry 12. John Woolnough 13. Eric Lowe 14. David McCollum 15. Randy Spolter 16. John Morse 17. Rick Glassell 18. Mark Montee 19. Skip Cadwell Not Pictured: Kristi Deroncey Mary Lynn Dumont Berry Olson ii smaller fraternity, Alpha Epsilon Pi advocates that being small 'makes the group close-.' The fraternity received its charter at Auburn in 1969 and believes that its relative youth enhances its brotherhood. Although it is small Alpha Epsilon Pi stresses quality and high standards consistently rating in the top 10 scholastically. The main social event is Bamboo Bash which is held annually in the spring, Little Sister Rush adds to the excitement of winter quarter, and a host of other events round out the social calendar. i'Within the fraternity, Alpha Epsilon Pi seeks to develop well- rounded individuals with a broad outlook on life. - by Chris Lent, Alpha Epsilon Pi president RUSSELL SCOFIELD AEPi 301 ii xpecting rain? Who cares! No matter what happened each day with the weather, the sisters of Alpha Gamma Delta stick together. The fun, friendship and fellowship we share all act like an umbrella - protecting us from any rainy day. days and rough times, the spirit of the sisters comes shining through. That spirit is equal to the beauty one finds in the rainbow. Each sister representes her own color, one different from all the others, and when we all come together we truly contrast and complement each other. I feel the respect each sister has for all the other members, no matter how different they may be, is what pulls us together and keeps our spirit shining. The Alpha Gams do have a variety of colors within their members. We have some bright ones who keep the group scholastic average high, some cool ones who find it hard to accept a loss in intramuralsg we have some bold ones who find that socials and the nightlife are not enough and we have the blue and orange sisters who are involved in everything Auburn has to offer on campus. We also have some softer colors who do everything behind the scenes to keep the chapter's enthusiasm up and all the business work in order. I would have to say that Alpha Gamma Delta has one of every color in her rainbow, each mixed in a special way and adding her own spark to the chapter. ln the past year, I have seen this group of girls achieve so much here on campus as well as out in the community. I feel it a great honor that I got to serve them as president. The Alpha Gam spirit has brightened my life and the lives of many others. Through our rainbow we live to see people smile, laugh and be VIHPDY- - by Alyce Heggeman, president Alpha Gamma Delta W 6 A Tis 8 A .win Q ft m m gxf gl -gn, .m ,fqmsfvzasmzsfiflzwgzfsersffrigmfxrwewsegg-Lawmsqatsyggzzwzwtsww,gw:1.: gm ZQMEQQIWAg1,f:iZ2Zc?f2glf'SQgwifisifi me asa: 151152292593ztiazlvazqtiii Jim21:.ifEaw,gE.3e.gzi5sz: Swv fazwsevas zwfifwew :Bagitz22i:.2w.:.s2Zgz,i'igy mzitaziis :ff P25911 .Q wi? M ggi, pwgsfsi ws, I 5 W sg as ms awp A A Lf 1 :egg-1 .Hgqfw W: 2 gawk Y 2 H :M 1 0 U 1- av wg ,W mrszeiyx eg Q be f G 3. 2 wzwh-gswswts me iw1,Nftz.,.., ..ff,1wt:.sw M 4'.ww1gw-,wN'1:., ...-UMsggiww7fQgww:wz2J21sz1i54 .zaiszzf Xiu Alyce l-leggeman Gail Pate Steve-Anna Stevens Sandy Veazy Debbie Howdyshell Tara Lanier Allison Hunter Kelli Shilleci Jamie Tatum Lisa Copeland Anita Barker Sharon Collister Kim Carter Stacey Gauntt Anne Winkler Missie Harrison Janie Garrison Melo Kell Marcia Stallworth Patti Parker Leah McKnight Cathy Strickland Susan Farr Christie Hayes Ellen Mosley Kathryne White Lou Dorsey Sally Fisk Connie Delaney Laura Smith Margaret Dodson Mary Jane lrrgang . Susie McCorkle Kay Myers Marya Vernon Pattie Cobb Flica Salmon Linda Denny Lynn Fowler Sheryl Sansom Patti Denny Leanne Hereford Susan Saunders Kathryn Mims Alison Beazley Dolly O'Dell Susan Lytle Ann Margaret Conry Ellen Upton Adonna Spear Ginger Baker Stephanie Kelch Ann Heard Lisa Carter Jody Kamins Judi Geppert Keri Lembcke Cathy Ferrance Helen Peavey Leila Welch Beth Huff Beth Mclnnish Jeanne Hamnef 65. Lisa Christopher Anne Tucker 66. Beth Dillard Laurie McGraw Suzanne Lawrence Martha Flelser Nancy Wingo Kimble Manley Sandy Brown Nancy Shreve Ginger Byan Alice McClure Grace Schlitt Lisa Brabston Laurin Welch Danelle Nolan Ivy O'Dell Kristi Thomas Tami Frazier Margaret Williams Laurie Wagner Laurie Minshew Karen Prawd Jerre Anne Williams Lisa Hutt Ginger Garrett Kym Haas Molly Lindsey Anne Shanahan , Mary Shanahan . Kelly Finlay . Marie Sawyer Laura Holmes . Beth Thames Beth Ann Blackmarr Helen Poole 100. Jane Bedding 101. 102. Carol Colquitt 103. 104. Amy Murphy 105. Anne Mims 106. Mindy Conner Lisa Gregory Elyse Hauser Laura Hauser Elizabeth Lanier Nancy Merritt Beth Vice Mellle McCraw Lisa Foster Katen Crawford Lisa Kohler Carroll Lanier Jan James Toma Ford Dottie Cox Ellen Williams Katherine Walton Allison Walton Angelyn Isbell Fran Baker Cherie Johnson Debbie Hutson Carla Kimsey Bonnie Burnham Merribeth Mancil Susan Conner Kelly Crawford Beth Hughes Julie Crutcher Alpha Gamma Delta Gayle Barnette , Gina Barnes Jeff Brazier Jeff Peters . Trey Hereford Sonya Staufenberg , David Ellis . Jimmy Brown John Chapman Jeff Sims Mark Callahan Benny Westmoreland Alpha Gamma Bho frm' bl 14 Jack Jackman Leigh Wright Marty Duckworth Lisa Wilson Chris Alexander Randy Huffman Gordon Patterson Sissy Steinhilber Jody Williams Mark Bond Pat Pruitt Tom Bass Andy O'Mary Robbie Dunn Lisa Baldwin Lamar lrwin John Weatherly Joe Magnusson Judilyn Brooks Carl Petrick John Oslewski i r 34. Lee Jordan 35. Bill Namen 36. Clark Kent 37. Greg Sims 38. Kevin Perkins 39. Lance Peterson 40. John Peterson 41. Mark Rasco 42. Nancy Anthony 43. Mark Lowe 44. Leslie Thames 45. Alan Webb NOT PICTURED: Taylor Horton Danny Overton Mitch Johnson Dus Rogers Steve Ricks Charlie Whiten Calvin Johnson Lane Linton ef r C iitwqtqy Qt r wa? at 3' . up ii lpha Gamma Rho is the national agricultural fraternity in its sixty-fourth year as a chapter here at Auburn. AGR is a social- professional organization and is designed to benefit Auburn students in the school of agriculture and related curricula. Alpha Gamma Rho, as a social-professional fraternity, provides the opportunity to become acquainted with students and alumni faculty in agriculturally oriented fields. This professional aspect is a unique quality of Alpha Gamma Rho that distinguishes it from other fraternities. Alpha Gamma Rho is also a social fraternity with a year- round social calendar. Yearly social events include: fall band parties, winter formal, Dirt Farmers' Brawl, A-Day Luau party, and house beach party. Socials with sororities also fill each quarter. AGR is also active in a well rounded intramural sports program. This program ranges from football to last year's middleweight A-Club boxing champion. Alpha Gamma Rho also won the annual all campus rodeo the last two years. The brothers of Alpha Gamma Rho are involved in the community. AGR and the Fraternal Order of Police sponsor underprivledged families to Thanksgiving, Christmas, and Easter dinners. AGR is also active with the state convention of Future Farmers of America, sponsoring the state Star Farmer Award. Alpha Gamma Rho has many tangible and intangible benefits, gained through personal association with brothers and alumni, that will accompany the brothers of Alpha Gamma Rho throughout life. - by David Ellis, Alpha Gamma Rho president Alpha Gamma Rho fff Q 9 W 6122262 tif FW I if tr Sftifggf its iff 2 Wir Alai! 433235 ome on along and listen to the AOPis on Broadway. As president of Alpha Omicron Pi, I have been provided the opportunity to work with a very special and unique group of girls, and consequently, I have seen the great impact that the Greek system has on Auburn's campus. Our members feel that it is a vital aspect of college life to be involved and to serve in various organizations. A few of the organizations in which AOPis actively participate are: Mortar Board, Tigerettes, War Eagle Girls, SGA and Campus Crusade for Christ. But somehow more important than the benefits derived from participation in campus activities are the rewards gained from being active within the sorority. There's a song we use during rush that says, When I think of home, I think of a place where there's love overflowing. I can honestly say that l've found a home in AOPi as each day provides a new opportunity to grow closer to my sisters. What would I do without sisters on those midnight runs to Kroger, those Friday afternoon crank-ups or those Sunday evening hen parties? You know you're home when you walk into Margarite P. Toomer Hall, hit second floor and turn either left or right, because there you'II find an open door. I look to my sisters admirably for the many ways they represent AOPi. There is a source of pride derived from working toward common goals. Whether it be through cleaning up after one of our fund-raisers or being one of the seven AOPis in this year's Miss Glomerata pageant. AOPi is a stage of many individual performers, yet we all share in the spotlight as we grow among various ideals, personalities and dreams, toward one common goal - sisterhood. As I exit the stage, I leave knowing that I have indeed been blessed for having had the opportunity to be a part of this talented group. So to my sisters I leave, wishing each of them a lifetime full of the sunshine and roses they've given me. - by Sue Craig, president Alpha Oi-nicron Pi iglfiflssve ms?-iiewrws J. REED Xwibfiftiflfv 2?1f's'31Li:wff 9 'QWVTM 292 SS' f-M f,i'3E3?f'Z'f 2335 4Z?5?3fHm5x'5 M3550ZQZ.fNs'141'w'7'Zi5'Qif 'fa359i' W3 vt? ia'Q'u35f 3 Q.: Diane McWhorter Kay Acton Tracy Carlson Susan Daniel Karen Goodwin Karen Moracco Kay Avery Ramona Raine Patricia White Kenneith Wilson Kim Tolley Donna Guckian Tracie Howard Cindy Huggins Pam Whyte Pam Horton Janet Yarbrough Debbie Barton Nancy Bryant Robin l-laisten Jeanie Morgan Betty Judge Melissa Mount Rene Nippest Sherri Adkins Lynnie Smith Susan Nesmith Mishi Wachter Lynn Callahan Dean Russ Pam Baynes Melody Bush Michelle McMillian Millie Thomas Renee Foshee Carol Mathews Lisa Patrick Shannon Pace Elizabeth Adams Lea Rae Custard Cathy Dollar Cindy Dollar Jane Boswell Roxanne Wilson Pidge Burt Jana Wasden Susan Williams Shelia Brown Susan Boerner Kristi Elrod Sheryl Norsworthy Susie West Julie Evans Robin Lively Amy Smith Susan Goodwin Judy Tankesley Duty Spurgeon Melinda Taylor Kaye Hutchins Barrie Mitchell Christy Geurkink Jenny Core Sue Craig Odette Yeager Sloan Usher Heather Sullivan 69. Toni Terling Kelly Bowman Elizabeth Cavley Rozelle Burt Kristin Glasgow Adrienne Wyman Valerie Bendall Suzanne Faust Laura Powell 1 03. Anne Tamblyn it V. px ,s, Q 11' ,. ,, Carolyn Atkins Danna Kay Neal Marla Sekas Nancy Gentile Patti Hawkins Margie Lewis Lisa Todd Cindy Yarbrough Melody King Denise Overstreet Wendy Francis Aleisa Blackwell Angie Hall Mary Catherine Moorhead Lynn Brooks Barbara Williams Cindy Patterson Pam Dickey Donna Pederson Allison McCall Anita Blackwell Laura Langley Sissy Stone Lori Thompson Cindy Boerner sno rt tr i 2. Not Pictured: Allison Blankenship, Kim Carlisle, Rhonda Childs, Hope Duncan, Jenni Flynn, Melissa Link, Cindy Mayfield, Mary Alys Wingard, Leary Bidez, Cherie Carter, Kate Gorman, Donna Hefferly, Ginny Cane, Suzy Mattmuller, Sandy Metts, Rachel Riggs, Laura Self, Carolyn Shovlain, Gretchen Stanley, Anne Smith, Sheila Brown, Karen Bynum, Anne Cox, Dena Crews, Lisa Darabaris, Lyn Hunter, Dedra Kelley, Monique Key, Susan Kipps, Kim Kulas, Lori Leath, Meg Smith, Sonya Smith, Laurie Alexander, Jane Foster, Kimberlie Hall, Kathy Kiteley, Kathleen Kinzer, LynnAnn Palmer, Kris Pappas, Janna Schrimsher, Jennifer Triplett, Kelly Yates. K' Q' . .... . ' .954 ? X it we it . .s.wt WAS K Q mf s M ' E Wig ,NN 4 ,. ' 'diss ms is ,gg W gms iff 1 4 'GEBEEQTW fifigaiisie 9 2:5: V 'Z 5 its Q 5 gi, al Sis f f q.: 5:2 Ffh.. , -, gpg.. . i 15 V -2.55 5 as W. . Q 25 's2f 5 3 'Y ,. : g. if i s ess .... : wg , at is W gigs ff kim E ,Q 1 5 f: 23223523 Wg? 2 ff ,5EZ1??f3AfV st gt tgggg i f iii it Q fg? iii ' ri X53 its 5 , ,,..., i, 2 i n i ts? we 5 Eg iii rg , ,. V S V EQ ist . J are js we Q i it 1555523 z Q Sa? ,,, at 1 3 Ht 5,3 it E Q 2 if if .. in WL R v I ' i s-' t--e i. : . Alpha Omicron Pi his W -at 307 Van Cohran Paul Hannon Gary Duncan Scott Fisher Dr. David Moll Dr. John Smith Dr. Joe Newton Dr. John Cottier Dr. H.C. Morgan Dr. David Harrington Cole Younger Steve Murphree Chip Lazenby Bert Gaddis Zekle Zekoff Bruce Wozow Sam Griffin Steve Adair Chris King Randy Wesson Tom Mangum Richard Funk Ray Webster Dan Jones Stan Snodgrass Len Jones Jim Grace Dwight Bradford Rusty Skinner Bill Christenberry Norwood Bryan Sam Edwards Dix Harrell Scott Weakley Rodney Alley Bobby Johnson Ronald Yates Dean lElmerJ Baird David Gleaves Terry Hughes Randy Perkins Kurt Oliver Randy Maddox . Calvin Clements . Lucky Pittman David Pinkston Cyril Gay Allen Riley , Mike Rehm . Phil Callahan . Calvin Johnson . Philip Smith . Steve Fronefield Not Pictured: Andy Bradley David Brown James Brown Mark Bryant Jeff Cavanaugh Jim Chambers Gary Davis Chris Duke Wesley Dunn Jim Gardner Mickey Golden David Hertha Scott Jackson Keith Jacoby Kelsie Jennings Greg Kelley Robert Milledge Gus Mueller Steve Petcher Davis Sullivan Tim Tucker Jeff Waits Mark Wood Ronnie Joe Barnes Larry Chasteen Joe Cobb David Fuller Scott Gravlee Steve Hardyman Alpha Psi Steve Harris Mark Kidd Tommy Knight Steve Landreth Gary Langford Keith Lee Smamy Linderman Danny Mount Billy Pierson Jamie St. John Dan Scruggs Steve Smelley Bobby Speight Milre Wood Billy Amoroso John Bond Randall Bondurant Roy Brooks Anthony Bruno Sam Christenberry John Cornett Bill Croup Mike Dishman Shane Files Charles Hart Mike Johnson Mike Morgan Mike Purvis Barry Stewart Hugh Washington Ronnie Williams Tony Wright Bret Bussey Scott Griffin Patrick Peay Rick Plephrey Steve Silberman Blake Townsend Kevin Wood iisiilsscif ffefi ii, w giwi ithiiiift if 6 iiiemm ti : Gi he Theta chapter of Alpha Psi fraternity was founded at Auburn in 1912. Since then we have grown to be the largest and most powerful chapter in the nation. Alpha Psi represents the strength and unity of the veterinary profession in the past, the present and the future. Each brother's contribution to the betterment of the fraternity builds an individual foundation on which to develop his professional career. In recognition of this fact, the members participate actively in intramural sports, socials, winter formal and Spring Bound-up. Bound-up, our biggest event of the year, takes months of careful planning and provides a day of fun and excitement for both men and women of Greek and independent groups. It is through these social activities that we establish bridges between the veterinary school and the main campus. The brothers of Alpha Psi comprise a functioning embodiment of ideas, dreams and actions with a common goal of sharpening our knowledge and skills in veterinary medicine to better serve the profession and society as we grow. - by Van Cohran, Alpha Psi president Alpha Psi 309 rfb ,g 18 .5 20 . 2 ii i fill-i ill' EIB eware the Viking! As the ship neared completion, the Vikings began to chill the quart bottle of Bud for christening purposes. The bikini-clad beauty was chosen to break the bottle over the bow. She swung with effortless ease toward the razor-keen bow. As the bottle fell to the ground and shattered, we quickly grabbed our hammers and began to reconstruct the bow. With three decks fthe Lido, the Promenade, and the Alohal there was more than enough room on board to take a lounge chair, crank back with your date andlor bottle, and let Doug Clark and the Hot Nuts do the rest of the work. The party was great for everyone. lt satisfied every end ot the spectrum, from those who just wanted to relax and mellow out to people like Mickey who climb the wall and then moon everybody. The actual party had begun several days earlier with several stages of psyching ourselves up to a fever pitch. This also included several stages of hangover. The final hangover of Sunday morning after the band party will render anyone speechless. But hey! We look at it this way. Viking Party comes once a year, just like Christmas. You don't spare any expense or energy in making Christmas a memorable event each year, now do you? - by Steve Kelly, Alpha Tau Omega president. Hayes Woodward Kelly Parker Brian Waring Randy Grover Matt Marinak Nick Moreman Tom Matthews Steve Clay Walter McCain Tom Savage Paul Delise Mark Williams Charlie Jinks Eddie Kent Ken Kirley N. Wiley Thomas Jay Subers Jim Nicodemus Tim Beynon David Whitman John Jackson Bobby Hill Bill Embree Steve Mikkleson Kinson Cook Joe Washburn Greg Hallmark Andy Colbert Bobby Dean Stan Melton . Greg Collins Keith Woodall Mike Yessick John Gasque David Willis . Clay King . Mark Cutshaw . Russell Shemwell . Ted Hortenstein 40. Lebo 41. Alan Erquitt 42. Lee Allgood 43. Walter Trussell 44. Andy Hallenburg Not Pictured: Todd Burg Mike Matthews Steve Kelly Ronnie Everit Lon Shelton Chip Hoffman Peter Fullerton Richard Stahl Tom Childers Morgan Brown John Hanson Randy Teates Doug Gray Bobby Black Sterling Hutto Gene Cox Mark Kerr Clint Moore Floyd Nail Tony Reed Brent Scales Jay Scott Scott Sudderth Lee Walters Todd Williams John Bates Brian Bownan Vince Coutounamos Mike Harrington Bob Leo Jett Oswald Daron Shorthouse . sr sr w , Mm Not Pictured: Sharkey Aitken, Melanie Bowles, Carrie Branch, Josie Condron, Mary Lynn Dumont, Marty Foster, Donna Glass, Kay Glass, Jane Graham, Margie Grimes, Kelly Gruetter, Gail Guthrie, Karen Hagler, Karen Haley, Barbara Hanks, Terri Hearn, Beth Heisler, Linda Hinson Tricia Hubbard Jan Huber Rita Johnson Maria Jon ebloed ' f ' Y 9 , Jay Mann, Chris Milano, Shawn O'Brien, Angela Powers, Holly Rieper, Stephanie Roop, Leah Saunders, Nancy Stroup, Linda Sumners, Kim Townsend, Dede Traywick, Debbie Wesson, Lee Adams, Allison Allen Beth Anderson, Brenda Barnett, Kathy Beam, Laura Bennett, Dee Carney, Alicia Cochran, Kathy Deutsch, Kelly Ellis, Barbara Kirk, Nancy Lowe, Kim Payne, Stephanie Stephens, Cora Block, Katie DeSciose. Paula DeSimone Susan Carastro Tara Weinmann Stacie Hunt Marty Heaton Shawn O'Brien Amy Sharpe Kay Glass Jennifer Randolph Marika Laszlo Kate Marshall Miriam Napier Karen Bishop Laura Brewer Sherri Bronson Jane Wightman Dawn Henderson Kelly Williams Sandy Wink Traci Venz Lee Anne Patterson Tanya Crane Maggie Eberhart Susan Abel Julie Parmelee Slade Hagan Jeanie Mangum Susan Moreland Debbie Sconyers Anita Bowman Allison Bryant Lori Smith Cissy Allen Cathy Campbell Janie Crawford Judy Pineda Cam Foreman Evon Bryan Amy Bryant Lynn Young Bonnie Gortney Lauri Johnson Lindsey Ehrstein Dawn Dalton Brenda Ross Jennifer Jones Mary Ann Kummel Nancy Crawford Neila Cole Mary Snyder Nancy Nick Susie Butler Alison Walker Lisa West Levin Blanton Maureen Fisher Mary Jo New Kim Berry Barbara Woltner Jennifer Gillis Kim Nixon Karen Rasberry Sherri Bronson Rita Scarborough Ellen Henderson Candy Jones Tam Brogdon Mary Johnson Leigh Ann McGehee Becky Wilson Maria Ethredge Gloria Hall Karen Hoopes Kim Ware Cathy Lay Deanna Lowery Karla Loggins Jane Atkins Julia Nunn Karen Schmoll Lauri Wood Kaye Clark Cathleen Owens Brenda McWhorter Natalie Downing Veronica Reynolds 1 312 Alpha xi Deira ALPHA Xl 1 x .An ll WW? AW? iifgtm 1:1 U 71 73 74 I T . Ll iz' x 5 7. .J . 9 z -V 62 .- nr: f' , 44 :tsl Q A f 'W 2 r 6 9 15 11 is ,C ' ii ecording how I feel about the past year in Alpha Xi Delta would be somewhat like writing the Gettysburg Address on a chewing-gum wrapper, it is impossible to express all of my memories in the space available. Instead, l will indulge in sharing a part of my memories - some of which you will recognize, but some of which are familiar only to us. Being an Alpha Xi Delta means: Winning the first-place sorority spirit trophy for the third year in a row . . . watching All My Children and eating lunch in the chapter room . . . getting lost during the scavenger hunt fThanks, Momi . . . riding the elevator to the top of Peachtree Plaza at formal . . . the Blues Brothers and first place in Sigma Chi Derby Chorus Line . . . celebrating a long-awaited initiation . . . winning Panhellenic Most Improved Scholarship . . . painting 150 tiger paws on faces at the Georgia game . . . getting a dozen roses from the Big Brothers . . . listening to Coach preach about the importance of intramurals . . . eating seven hamburgers in 10 minutes? Cl'd do anything for my sororityl . . . placing second in Burn the Bulldogs . . . Alligator woman, the Ultimate and Jane and Diane faka Solid Gold! . . . guessing whose candlelight it is . . . crying at senior ceremony . . . trying not to cry at Pref . . . being Your Own Best Self. I will remember the laughs, the traumas, the tears, but most of all the joy of watching 130 individuals working together to achieve a common goal - whether it be winning a trophy, raising money for philanthropy or just keeping the chapter room clean - and realizing their own potential in the process. - by Brenda McWhorter, president B. SCHNEIDER Alpha xi Delta 313 Ijfnjxlii Lui! likil rl .. ... Mm wiv? 7? fif V Jlxllxj tlddfummbw rv X Yilixx f ' fgfrs. sg TTL ij W ltr fi HR - 37 Y ti it Y .ti W . 1 .. 1 f8lfif52iJeQ1aiQiM its 5 W! ' 71 N Y. iff? K, fx? if 21 lg 2 r i A 1 V 1,' ki, ,lx N GE j 1 S 919 11 I2 13 14 J KKAA 'L' X ,ff 1 X 'X ,x W 17 ' i 'Mr i,'-lsjftf A ia 4 sk e J L 0 N!! PRR x N i Rf R ,jfwinxjxpi xi Q Betas ii eta Theta Pi, the oldest general fraternity on the Auburn campus, was founded August 8, 1839, at Miami University, Ohio. Nationally, the fraternity is known for its leadership in several facets of fraternity lifep it was the first fraternity with a national magazine, the first to have a chapter house, the first to colonize on more than 33 campuses and the first fraternity with an open constitution. Locally, the Delta Zeta chapter of Beta Theta Pi is also known as a leader among fraternities at Auburn, excelling in sports, scholarship, community service and, above all, University service. The Betas of Auburn have long been known for their academic excellence, and 1982 was no exception. They finished second among all fraternities scholastically on campus. ln addition, two brothers in the Auburn chapter were recognized at the Beta Theta Pi General Convention with scholastic scholarships. ln sports last year, the Betas fielded teams in most all the intramural competitions, making the playoffs in basketball, tennis and horseshoes. Currently, the Betas are third overall in sports competition this year. Another area the brothers of Beta Theta Pi pride themselves in is that of community service. The Betas sponsor the Miss War Eagle Pageant, a preliminary to the Miss Alabama Pageant, to give the girls of Auburn a shot at the coveted title of Miss America. ln addition, the Betas have worked with Project Uplitt. ln 1982, the Auburn Betas were presented with two awards indicative of their vast participation in all facets of university life. At the national convention, the chapter was presented with an award naming it one of the top two Beta Theta Pi chapters in the nation. Here on campus, the Betas received the Alpha Omicron Pi award for the fraternity most involved in campus events. Although the Betas rank high in all of the aforementioned areas, they still have time to socialize. One of the highlights at Auburn each year is the annual two-day Beta Beach Bash, an A-Day weekend event that is always a success. - by Bill Stewart, Beta Theta Pi president Jim Kelly David Duffee Allen Hughes Jesse Manis Carl Keller Donnie Kelly Bill Stewart Jon Eaton David Schroeder Carl Gleghorn John Thompson Allen Holman Brian Kelly Mark McCabe John Greer Charles Evers Alex Griggs Bernie Petters Craig Lehman Ron Davis Anthony Cicio Rick Consoli Andy Matthews Pete Torres Keith Chisler Jim Vann Robert Sigle Rob Consoli Ron Eicklernan Robert Grant Glen Eskew Keith McWilliams Richard Cannon Gray Parker Mark Harris Kevin Cochran Joe Strickland Doug Shatto Paul Sullivan Jerry Mattson David McKenzie Robert March Sam Drew Eric Stanaland Don Cote David Tschirhart Bob Ackerman Lance Bond David Hubbard Jeff Deery Carl Lange Steve Silverstein Mark Pickens Dale Linder Scott Talkington Steve French Steve Graham Dake Dorris Norman Randall Greg Griffith 66. Eric Lazzari 67, Mike Tschirhart 68. Dave Bean 69. John Cromwell 70. Kurt Kurtsteiner 71. Jeff Hawthorne 72. Mike Goodson 73. Jim Cannon 74. Alan Bannister 75. Tim Banks Not Pictured: Jeff Charnock Bryen Stegall Bill Oswell Geoff Smith Tommy Shovelton Ken Guin Marc Watson Eric Eitzen B.J. Sutcliffe Ken Junen Dan Head Frank Nelson Mike Smith Stan Manush Flay Lynch Bob Lynch Scott Moody Jim McCrory Glenn Hicks David Hosmer Wade Bradford Robert March Tyler Craig Mike lnduni Jim Burrows TONY EWlnQ Mike Brandon Alec Harvey John HiCkS Kent Starke Keith Bartmess Bob FfiiS0n Jon Tate Bob Franklin John Cole Don Cote Betas 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. 21. 22. 23. 24. 25. 26. 27. 28. 29. 30. Shannon Hinds Debbie Partin Evelyn Mathews Sandy Ponder Kathy Chalfand Wendy Fratz Penny Weaver Kathy Abruscato Ann Hall Barbara Bolding Susan Long Lisa Nathan Barbi Wise Ingrid Falkehag Monica Moseley Shawn Hargrove Regie Matthews Carla Jeffers Cathy Judkins Julie Denton Mary Anne Brandy Cyndie Boehme Mary Louise Hemmeter Cindy Padara Lisa Tucci Cindy Drummon Kim Heaman Janice Byard Carol Woosley Mary Claire McCallie Jill Running Racheal Phillips Beth Willoughby Jennifer Smith Beth Boineau Kathie Rodgers Kristin Lloyd Claire Austin Mary Katherine Harsh Mary McNulty Fortune Thomas Melissa Coleman Laura Crowe Jennifer Pigott Cindy Ayers Andrea McCain Suzanne Lacey Vicky Balankenship Eve Mathews Pam Mosley Patricia Vick Unidentified Unidentified Jere Mosley Laura Werster Amy Hendryx Jenny Smith Joy Denton Meg Wakefield Michelle Baldwin Janna Heritage Jana Walden Polly Holcomb Mariann Farrow Cara Cobb Robyn Trammell Carolyn Pressgrow Judy Chwalik Amanda Brownlee Beth Perry Kim Deprospero Mariann Vondrachek Margaret Strawn Mandy Hand Nanette Clen Sally Shaw Susan Perry Nancy Halsten Sandy Johnson Marty Blakey Ruth Chapman Connie Burgroyne Kim Farmer Leigh Wiggins Susan Morgan Betsy Wheat Ann Wilson Amy Funkhouser Renee Plumb Nancy More 91 92 93 94 95. 96. 97. 98. 99. 100. 101. 102. 103. 104. 105. 106. 107. 108. 109 110 111 112 113 114. 115. 116. 117. 118. Alice Morgan Lori Herman Julie Stroup Pam Pitman Amy Lummis Tracy Sirmans Tricia Thompson Pam Conway Laura Ractliffe Paige Overstreet Carolyn Drawdy Kelly Pruett Mary Frey Betsy Casey Debbie Carrick Becky Jenkins Missy Sorrells Susan Johnson Anna Webb Jeanie McClurkin Julie Wolfe Bess White Cindy Law Kim Overstreet Donna Gibson Melonie McDaniel Kim Knolls Dell Barker Not Pictured: Leisa Chambless Wendy Ryan, Marta Hurst, Dell Smith, Melanie Adams, Meg Tannehill, Paige Freeman, Lezlie Lanier, Beth Hixon, Laura Lee, Susan Daniels, Catherine Hall, Leigh Mattox, Rebecca Stover, Dari Miller. Chi Omega lr-'U i ft WIWM' Wit Mwitaafti Gm v H b ig. ,, mf 1 it iii g :W BFITZ ii e have decided to use the Chi Omega Choo-choo GS the DHCKQYOUIWG for our group picture because it is from one of our favorite skits during rush. l love the choo-choo skit because it says that wherever you go you'll always find Chi-O's. In the skit we sing a song that says we've got the cuties and the beauties and the brains you'll agree . .. Our pledges are definitely cuties. As l watched our pledges come screaming around the corner of Haley Center during the Wreck Tech parade, l must say l've never felt more proud of a group of girls showing their Auburn spirit. And our beauties . . . l'm excited to say that Cyndie Boehme and Barbie Wise were both in the top 5 for Miss Homecoming. Not only that, we have the brains, too! Leisa Chambless was recently tapped into Phi Kappa Phi. She is in the top five percent of her senior class. l'm proud to say we have a well-balanced group of girls each with their own unique qualities which combine to make Chi Omegas the individual, yet unified group that they are. by Ffegie Matthews, President Chi Omega viii fri lil 318 chi Phi GG onstruction began this year on several new structures on the Auburn campus. Groundbreaking ceremonies were held for a new engineering building. On the other side of campus, past student leaders saw their dreams fulfilled as the foundation was laid for a new student activities building. With construction on schedule, we are truly in a time of progress. What many students did not see was the foundation being laid for a new organization, one that had no physical structure but was built on strong principles and beliefs. Personal expression formed Chi Phi here at Auburn, an expression that will last when buildings have tumbled down to be replaced by others. Chi Phi is a building process in itself. Leadership, integrity, pride and self-respect are developed in each individual. In such a young group, each member is able to add to the tradtion of spirit and competition that is developing. Our spirit and tradition go beyond outward expression but are concentrated in each of us. Progress may be rated in many ways. The addition of a house, a strong showing in spirit, an effective rush and an expansion into campus activities are all signs of a healthy growth. We are striving to improve the foundation that was laid this year: a foundation that many succeeding Auburn generations may build upon. - by Cory Thomas, Chi Phi president Larry Perry Steve Clay Carlyle Scales Shawn Wright David Mitchell Mac Knox Blake Leeth David McDaniel Brad Henderson Jeff Nay Lee McClurkin Brad Ham Larry Teem Scott Steadman John Rogers Rob Wilson Joe Alldredge Cory Thomas Chris Gackstatter Jeff Frasier Jim Holcomb Not Pictured: Mark Barton Chuck Bearden Brad Blackmon Jeff Clark Buster Coplin Ken Dunn Sean Gibson Brian Gulsby Chris Horton Shan Mitchell Greg Moore Alex Neese Kerry Parker Brent Pierce Ernie Poirier Alan Fiester Eric Smith Bill Stoll Robert Thompson Jim Tinkler Byron Watts Shawn Yao Skip Smith :gi , Y 25 5 vii? 55 K 5 ss? ngglf Q52 il if ig SM 15 5 E E Egg ig? if g is MEX! l 2 SS X z sg by Y, ia gig 'SQ ,,. M - K sig , , 52 I SEQ ug- ,, X fi? Sw: ESE .gig E ff f E E, E 532 'e x if 5 L . im fi If s 1 no a Phi 319 5 x 4 John Henly Kevin Maher Barry Gainer Brad Jackson Jeff King Jim Hargrove Fiaymond Fowler Bill Allen Mike LaChance Peter Irby Lee Fly Brad Roberts Steve Pratt Bill Thigpen Don Joe Mikell Paul Butler Jay Turner Doug Wheatley Wheeler Chapman Drew Westrope Chris Strzelecki 22. Tom McCasky 23. Mark Maxwell 24. Tim Kovacic 25. Alan Pickett 26. Steve Settle 27. Mrs. Margaret Anderson 28. Chris Coughlin 29. Mark Nelson 30. Bill Bolen 31. Tom Fuller 32. Dennis Woodling 33. Fiichard Fuller Cooper Pierce Neil Bosmajian Greg Miracle Greg McCain Lance Farrar Y 34. ' 59 ' K 35. Stacy Witherow Not Pictured: ...am at ir Wilt itll ii elta Chi fraternity was founded nationally as a legal fraternity in 1890 with the pursuit of justice as its central theme. Delta Chi has since become a social fraternity and has added the goals of academic, athletic and social achievement. Overlooking the new intramural athletic fields, the Delta Chi house is the newest on campus and the first house on a proposed fraternity row. Delta Chi traditionally dominates its intramural sports league. The Delta Chis are always competitive in any given sport and have earned the small fraternity all-sports title eight of the past 10 years. They have been defending this title for the past four years. The Delta Chi's biggest social events are the winter formal in Mobile, the spring house party in Daytona Beach and the annual A-Day Indian party where everyone dons war paint and has a heap-big good time. Through brotherhood and cooperation, the Delta Chis maintain a special bond that remains long after graduation as was exhibited in a visit from their astronaut alumnus of the class of '54, Henry Hartsfield. - by Steve Settle, Delta Chi president llllll 1? ,Q L i iLtliilLliiil,,l1fW, A Touch of Class Marlies Menke Kelly Flabren Julie Spencer Deborah Fergeson Lori Sharpe Laurie Frantz Ellen Smith Leanne McRae Julie Wells Cindy Turner Kim Shilling Susan Duncan Betsy Legallis Lisa Frost Abby Page Cory Snetsinger Gena Brazeal Kecia Endicott Guerry Fain Laura Keller Sharon Gillespie ,ll uburn's Tri Deltas are 28 years strong We filled our calendar with socials and services all year long. Beginning fall quarter with a spectacular rush, lt was filled with socials, parades and our annual Orange Crush. We honored our pledges in Atlanta you see, And Showboat with the Pi Kappa Phi's helped our philanthropy. Our fun continued through winter as well, As all of our sisters would gladly tell. Winter formal was the highlight of the season, Tri Delta's have fun and we don't need a reason. Springtime came with a trip to the beach, As sunnin' and tunnin' was pleasing to each. With our annual faculty and A-Day receptions, We honored teachers and parents without any exceptions. But this isn't where our happenings ended, Our spring Birthday Bash was unquestionably splendid. Through all of Tri Delta's activities of the year, Sisterhood and friendship was always kept dear. All of our events bring our sisters together, Because once you're a Tri Delta - you're three times better! - Delta Delta Delta by Julie Pourassa, president Ginny Lancaster Becca Lusk Sue Wakely Carolyn Stout Tisha Burland Kathy Smoker Libbie Spears Sheri Fain Gail Schapker Ellen Praytor Leslie Gingles Caroline Brady Kathy Ray Terri Mallory Rebecca Rudd Candy Phelps Allison Smith Mary Thompson Sandy Phelps Julie Caldwell Robin Hall Robin Dykhluzen Lucy Pennington Lynn Grover Stacy Davis Sally Sabot Kelley Brasfield Kaye Nabors Julie Bourassa Susan Isbell Amy Cowan Mimi Kohl Page Adkins Nancy Lane Renee Robards Karen Presley Laurie Patrick Becky Buchanan Leigh Redfern Kristen Ferrar Heay McKay Sandy Acuff Robin Dennis Amelia Cothran Ashley Patterson Brucie Jerkins Cindy Burkhalter Stacy Spier Kim Yokely Sheri White Jennifer Meagher Laurie Williams Ann Nebergall Ann Toomey Barbara Smithwick Dawn Hastie Stephanie Ford Joan Landis Madolyn Anderson Lori Baird Mitzi Streeter Lisa Register Nancy Rives Martha Kelly Anne Citak Cindy Rodgers Karen Clarke Jane Neall Allison Lettow Mitzi Russell Susan lshol Camille Ellis Stephanie Diamond Dorothy Lockwood Carol Frantz Jenny Wartlnger Shellye Smith Shaunn Demuth Linda Hogue Laura Nigro Evelyn Lee Elizabeth Fields Jenny Foshee Tracy Rutland Not Pictured: Stephanie Anderson Elizabeth Barnes Gina Barnes Beth Brockman Lesa Burger Trish Carney Kim Cogle Nancy Collins Janet Craig Catherine Cardwell Leigh Lockridge Evelyn Rodeo Andie Rogers Cheri Spittler Lisa West Amy Woodfin Missy Yeargan -nr fa 1 .Jin ' ., M ' 'St s ' il 5 t at M 5' rf gtfgifisgiwi iifglli. Ltiffwfzrt Delta Delta Delta Not Pictured: Lynn Wilson, Wanda Milstead, Luinda Jones, Andrea Tipert, Lori Carmona, Alisa Allison, Kim Hamill, Sandi Robertson, Cathy Snow, Peggy Prey, Dorothy Smith, Linda Langston, Kelli Gilbreath, Theresa Barnett, Karen Kaufman, Trisha Thatcher, Michelle Pritchett, Mary Cauley, Eileen Mulrooney, Jaky Jockisch, LaCIare LaBorde, Cindy Edge, Kim Starr, Ann Childree, Beth Harris, Diane Bonasera, Julie Randolph, 5 Debbie Powell Susan Hurst Terri Cannon Frances Campbell Pam Adams Vicki Medlock Malone Kitchens Debbie Sapp Susan Harrell Cathy Campbell Patti Holton Lisa Henry Elizabeth Black Nancy Simpson Patti Willits Cathy May Rebecca Harrell Amy Jones Shellie Harris Cherry West Pam Gilmore Judy Flaispis Susan Baker Adele Scott Kim Caldwell Linda Horning Loretta Ware Ann Cornelison Gloria Genge Lori Vaught Janet Gower Linda Borowski Runette Ford Martha McPherson Anne Rowland Carolyn Kirk Carole Arthur Nancy Denning Sarah Jordan Martha Cash Linda Fehn Sandra Todd Ann Akin Diana Rankin Teresa Bailey Anne Hines ,am ,wan OO O .- if iw w ii gfwt W . as FiltSl CLASS Y I- I I I ' v . Kyiv? ,dTaKing fo 'UNE Arr Q 1 s ,rs x elta Gamma sorority - individuals with different talents, but at the same time striving for the same goals. The girls who wear the anchor form a special group that is involved in a variety of campus activities. These activities range from SGA, Capers, Mortar Board and the Order of Omega to Auburn Entertainers and little sister organizations at various fraternities. The Delta Grams proved that hard work received recognition. After receiving the American Red Cross trophy for a sixth-year win, the sisters went on to place fourth overall in Sigma Chi Derby. Anchor Splash proved to be a successful event with the Delta Gams raising more than 31,000 to go to their philanthropy, sight conservation and aid to the blind. Despite the charitable events, they do find time to relax. Spring luau took the sisters to Montgomery for a ride on the Robert E. Lee. Pledge formal saw sisters and pledges along with their dates dressed in mafia-style clothes and dancing the night away. Of course, winter formal was no exception. The sisters celebrated the beginning of . winter quarter with various social events such as hayrides, l marshmallow roast and just plain good times. So regardless of what the Delta Gammas participate in, their anchors are always flying high. - by Cherry West, president Delta Gam L-1-I-,.. 13 1 0 14 5 'f 3,-6.,,'hv,9J it it L QV' S3 r L Q, 326 cena sig ii elta Sigma Phi fraternity has been on the Auburn campus, in varying stages iof sobriety and undressi, since the turn of the century. ln this long tenure the accomplishments of the Delta Sigs have been listed in the annals of Auburn University ias well as the local law enforcement agenciesi along side such memorable names as Johnny The Rat Scarselli and Pinky Three Lips O'Donnel. While many of Auburn's fraternities have a background rich in history and tradition, none is quite as rich tor thicki as Kappa Chapter's. The Chapter House itself, a local landmark for more than six or seven weeks, is an identical architectural duplicate of the Walter Nebish Home for Unwed Mothers in Glasgow, Scotland. The grounds which surround the estate are comprised of the same rich earth which, when mixed with the proper amounts of spilled beer and grain alcohol, forms the finest wrestling mire in the entire Southeastern Conference tif only Coach Dye would give the girls the scholarships backi. These are just a few of the many things which the brothers of Delta Sigma Phi, active and alumni, take great pride in. The other stuff we can't mention in print i5th Amendment covers thati and probably won't have to worry about when we get the young girls in the picture back to their parents before 8:30 p.m. by Mark O'Nei!!, Delta Sigma Phi Andy Gilman YoYo Daily Lynn Mosley Donna Loden Lynn Rowe Caroline Kirk Cal Cobb Jeff Breland Fiobbie Tarleton Mark O'Neill George Shirley Bob Haley Jon Vinson Rick Anderson Greg Hartung Kim Bruski Susan Buchner Chuck Tomey Mark Erickson Molly French Chantel Daily Hanna Malloy Gill Gillespie Theodore Cleaver Paul Traynor Fiick Hyde Mary Ann Moses Cliff Lallis Billy Hester Kenny Whidden Bill Alt Jad Davis 35. Gerry Kelly 36. Jim Ferguson 37. Brian Scales 38. Paul Savickas 39. Brian Bellsterling 40. Mark Davis 41, Brad Shepherd 42. John Clancy Not Pictured: Kyle Leach Richard Galatioto Max Broome Randy Wenndt Mike Jones Delta Sig Q ii he Omicron Kappa chapter of Alpha Phi Alpha Fraternity Inc., was established at Auburn University on May 29, 1982. Seven young men with many of the same ideals wanted to establish a charter in which the precepts of scholarship, manly deeds, and love for all mankind were exemplified by its members. Characteristics such as these may be viewed in some of our prominent brothers such as Dr. Martin Luther King, Jr., Andrew Young, Bill Cosby, Duke Ellington, Jackie Robinson and Thurgood Marshall. Solidarity and service to our community are inherent goals for tomorrow. - by Ferdinand Williams, Alpha Phi Alpha president 1. Ferdinand Williams 2. Rod Johnson 3. Flobert Smith 4. Michael Bell 5. Anthony Smoke 6. Fredrick Huntley 7. Phillip Lyman Not Pictured: Edmond Thomas 328 Alpha Phi Alpha ii ince its establishment in January 1974, Kappa Upsilon chapter of Delta Sigma Theta sorority, Inc. has played an active role in Delta Sigma The-ta's program ot community service. Each quarter, several projects are planned. Some ot these projects include visiting the patients at the nursing home, visiting Porter Apartments fa complex tor retired citizenst, monthly donations to the Pensions and Securities food closet, fund-raising activities for the Muscular Dystrophy Foundation and the East Alabama Sickle Cell Association as well as tutoring of elementary school children 7 Li This election year, added emphasis was placed on voting. Delta participated in DeIta's Operation Big Vote by registering voters on the concourse during October. Later in the month, the chapter president assisted the Board of Registrars with the SGA-sponsored voter registration drive. Other program thursts for the year are test- taking skills and career awareness workshops. Delta Sigma Theta takes pride in emphasizing its concerns with social welfare academic excellence and cultural enrichment and de-emphasizing the social side of sorority lite. - 1. Glinda Ware 2. Shirley Hudson 3. Patricia Reese 4. Viveca Ward 5. Candace Moorer R Winifrnrt I ittlefield M. WEEKS Delta Sigma Theta 'T e it if ii ello, Auburn, and War Eagle! The brothers of Delta Tau Delta would like to take this opportunity to say that we are as proud as ever to be an active part of this college campus. The fraternity hopes that our spirit and academic and social participation have had a positive influence. Being a fraternity that holds a special closeness among its members, we enjoy supporting Auburn athletics together in large numbers. Our socials with sororities, formals and house parties are never dull and are always unpredictable. As for performance in the classroom, well, .. . They say a picture is worth a thousand words. lJust kidding, Mom and Dadlj Delta Tau Delta is known for good work and good fun, and we are committed to maintaining that reputation. - by Bob Doyle, Delta Tau Delta president Delts DEL1' Ross Standifer Jeff Thompson Mike Atkinson Rick Carlton Bob Doyle Ken Watkins Larry Cochran Mike Hoffman Danny Leary Chuck Walker John Coulter Keift Lindsey Fred Whitfield Greg Young Alan Hooley Ben Adams Ed Schmith Greg Wilson David Lehman Doug Westhoven Tom Foley John Sclater Tony Taber David Pifel Rainer Luckoschek Mike Williams Bob Hayes Mark Hood Liza Mueller Craig Montgomery Will Perryman Not Pictured: Tim Coughlin Tom Dickerson Brad Eubanks Mark Gamble Jimmy Goldsberry Bill Wood Mark Sauna Brad Vinz Jim Westenhauer Tommy Keown Jed Prouty Delis 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. 21. 22. 23. 24. 25. Tracy Gist Lisa Bauer Marybeth Wingo Janet Fondren Cam Murphy Karon Dunn Donna Howard Lisa Ballard Lisa Knight Judy Buchanan Tracy Ganem Kim Farmer Scout Summerlin Anne Stroud Alicia Duncan Kathy Willingham Susan Faucette Jenny Haffner Joanna Hattner Carolyn Straiton Julia Simmons Madelyn Mariani Susan Eggleston Jill Whited Lori Winford Jan Kucera Leigh Burkey Angie Banks Allison Spink Elizabeth Johnston Leah Alsobrook Donna Dreher Donna Moore Laura Caveleri Melissa Middleton Carol Ferlisi Elizabeth French Jenny Jeftneys Holly Sims Lisa Wiley Tammy Hickman Ginger Hall Michelle Fox Ann Genneralli Kelly Harris Sharon Joseph Jenny Simmons Vicki Jacobs Marybeth Saal Dori Hosley Kathy Saal Margaret Roberts Mandy Godfrey Paula Hester Michelle Hall Angela White Beth Butler Faith Gibson Lisa Holliday Lisa Zircklebach Missy Harris Tracy Woltt Kathy McKinstry Carol Tyler Suellen Moore Allison Watkins Suzanne Nash Debra Nesbitt Susan Stone Ronna Hickman Alys Cadenhead Lisa Lloyd Candy Edwards Karla Cauthen Keri Buxton Cathy Early Amy Watz Emily Snuggs Betsy Suber Jlll Scott Kit Goodwin Anne Sherman Suzanne Hart Susan Hamilton Beth Ansley Sharon Wainwright Rene Rowe Ginny Andrews Jayme Holloway Kim Smith Marybeth Bridges Jennifer Purdom Teresea Leary Lisa Spruill Julia Bridges Val Thompson Bari Lawson Tamara Davis Not Pictured: Allison Arnold, Winnie Darsey, Rosemary Davis, Mary Lee Friend, Lisa Gialtina, Janet Giuhan, Lisa Glass, Alecia Golden, Holley Green, Debbie Houser, Moira Lescher, Laura May, Linda Oakley, Cheryl Perdue, Kim Rainey, Kim Reed, Debbie Scheck, Robin Harden, Jean Carroll, Tammy Hickman, Deanne Caveleri, Kimala Marlow, Melissa Middleton, Jennifer Purdom, Rene Rowe, Joy Yeager, Christine Anderson, Keri Buxton, Pam Fitch, Anne Armstrong, Doreen Lynch, Paige Steelman, Gayle Wilkerson, Debbie Taber. Delta Zeta ii Q ggae . 5 9104 2 II B M54 Wikia is ' lil g i i jagffi? . . . 5 III! III -Ill I ll ' ii hat is a sister? A sister is someone who always listens when I talk, but more than that she always hears me and understands. What wonderful memories of being with my sisters this year. The times of fun and frolic, sad moments, happy times, exciting moments, late-night studying . . . Looking back, I remember how precious each sister looked with her gorgeous suntan when we returned tor school. Each girI's eagerness and willingness to work showed our special unity as we prepared for rush. And what a special moment as those beautiful pledges ran up the hill to our chapter!! We welcomed each girl with open arms and loving hearts. We started off the year with a bang by organizing a swimming party, an ice-cream party, a pizza party, a Halloween party and a Christmas party with our Big Brothers, sooials and our special pledge formal in Montgomery to honor our pledges. I was so proud of our pledges who captured the hearts of the judges and won first place for spirit in the Wreck Tech Parade! I was so excited when they winnied third place in the Burn the Bulldogs Parade with their Winnie the Pooh float. l'm so proud of each one of them! I am able to share my hopes, my dreams and my life with you as my sister as we continue on our way. As each quarter draws to a close and we begin planning for the next one, I know the next will be better than the last as we work together as sisters of Delta Zeta. - by Joanna Haffnen president l A ZETA Q- gm L -i in s , ' it li. 7 ii p at the crack of dawn to milk the cows, to slop the hogs and to work the fields. This is not the typical day of a FarmHouse brother. Although our roots are in agriculture, and we have several brothers in agriculture, the brothers of the Auburn chapter of FarmHouse come from diverse backgrounds. We have brothers in curriculums ranging from art to Zoology. Although we have been at Auburn for only 12 years, we have made achievements that few can equal. We have won the Ralph Brown Draughon Community Service Award for six years, the A011 Service Award for five years and the IFC Scholarship Award for five years. FarmHouse brothers have always been active on campus. Our brothers have held positions from SGA president to varsity athlete. The real spirit of FarmHouse rests in its brotherhood. With brothers like Bunny, Big Sham, Pod, Lip, Agee, Wang, Bear, Sharpe and, of course, Frick 8t Frack, the FarmHouse spirit is kept alive. - by Jay Horton, FarmHouse president 334 Farmhouse .1 Marc Byers Robby Payne Steve Cobb Wes Williams Walter Hoskins Ken Jackson Jon Curren Keith Tyus Scott Boothe Woen Bailey Don Couch Dan Gentry Steve Boswell Jay Horton Warren Nicholson Barry Sublett John Brolund Craig Miller Terry Gordon Phil Lewis Tim Hall Robert Jameson Bob Wesley Alton Miller Jim Pearson Bich Hoerlein Dick Steinberg Todd Turnquist Tim Bradberry Jeff Barton Dave Mercier Alvin Miller Phil Kennedy Ed Byers RJ. Stuermer Harold Hamilton Keith Savas Mike Speakman 39. Jim Pounds 40, Lyle Branton 41. Glenn Smith 42. Mom Estes 43. Steve Slay 44. Jim Kelly 45. Barry Bates 46. Greg Fox 47. Barry Kornegay 48. Gregg Shamblin Not Pictured: Mel Abernathy Stephen Baum Kenny Blackman Emmett Blankenship Neal Burton Marty Conry Jonathon Doyle Morris Driggers Charles Decelle Scooter Gerrish Mike Hill Tam Huynh Steve King Kenny Kirkland Alvin Lewis John Lipscomb William Mims Jon Moore Steve Morgan Corky Nell Thomas Norden David Stewart Anthony Stone Randy Stringfellow Stephan Tomlinson Brian Whitley Bob Britton Scott Clayton Carl Creasman Bruce Davis Johnny Deal Terry Doyle Don Garris Gary Griner Tom Lewis David Markley Mark McClellan John Meagher Darryl Moland Mike Sisk Greg Stone Toby Wagner 'V , rw-1 , Wa. f . M., ...ma ' We we ' . ,nf ,W H W. , .f ,, i , .,,, ,, if K Farm House Andy Dishman Mary Beth Flynn Cindy Nabors Angela Whittle Susan Flach Becky Walton Janet Johnson Susan Conner Lisa O'Connell Christi Bruns Ann Smith Tim Larsen Doll Wilkinson Bev Beverly Don Allen Preston Hurst John Underwood Lee McLemore Drew Luna Suzanne Lacy Tom Batt Mike Mathis Lyle Darnell Sherry Rigby Bess Underwood Leah Ditfly Karen Miller Kathy Chapman Mary Williams Liz Arnold Anne Smith Laurie Driggers Doug Neal Ben Guest Cliff Coleman Foy Goodwyn Llge Guest Chris Atkins Walter Price David Devaney John Stewart Albert Martin Michael Gaw Burt Campbell Lony Taylor Mark Smith Lee Dobson Allen McCuIIoush Howard Baylift Laura Beers Tricia Thompson John Kay Stephanie Kelch Jim Massengil Ralph Huff Laura Lamb Jeff Raising Rob Adams Rick Williams Ron Martin Reginald Matthews Jeff Bron Kevim McKinney Carver Mize Steve Norton Peter McAllister John Hargrove Benjie Gorrie Luke Bloodworth Edward Haskell Bill Anthony Sam Bridges Allen Bowler Not Pictured: Jim Jordan Sam McGaughey Chet Norris Pat Flynn Allen Sartain Steven Lee Todd Rambo Art Thompson Jay Burke Jeff Brown David Faulkner Nelson Sexton Wayne Hunter Robbie Taylor Scott Sanderson John White Rucker Betty James McCook Prioleau Alexander Jim Gorrie Danny Morris Thomas Reese Marc Nay Earl Parsons Keelln Wheeler Ken Colley Marshall Rodgers Van Farrell Miles Cunningham Warren Whatley Jack Fite Tim Connor Sheldon Whittelsey Joe Taylor Stephen Kruse Gene Haas Jett Christiansen Marvin Brown Gil Graham Tom Bradley David Williamson Bryant Buchueu Jeff Torbert Wade Littrell Ward Cheatham Mark Senter Greg Stevens William Cowart Mike Brown Fred Holladay Craig Price Pete Flach Jimmy Doerr Winn Hayes Tom E. Stevens Chason Wachter Richard Young Lynn Jones Will Beadles Glenn Jordan F 'g Z X -Y it 42 snr ,X , LL- 4 mt en t!!! it -rr 47 jf? tif it it iii? if Emi ? his W5 'f' Q 'R L r' Y Win ' p ri fbi ii ometimes known as the fine Southern gentlemen and sometimes known as the Old South hell-raisers, the brothers of the Kappa Alpha Order have been an integral part of Auburn for many years. Each year in January, we celebrate the birthday of Ftobert E. Lee, our spiritual founder, at our Convivium Banquet. Our upcoming Convivium will mark our 100th anniversary at Auburn University. KA is probably most noted for our Old South party each spring quarter. This week-long event is Auburn's largest party, filled with sorority girls, socials, band parties and culminating in our famous parade to Toomer's Corner Friday. With the brothers on horseback, our dates on a flatbed truck and our pledges pulling our cannon, the annual Old South parade is quite a part of tradition at Auburn. Other than Old South and Convivium, KA has many social functions through the quarter, including our Highlander Fling party where we all dress in Scottish kilts and our Fliverboat rush party in the summer. KAs at Auburn are known for having fun, but we are proud of our contributions to our school and community as well. Each year we sponsor a foster child, hold Christmas and Easter events for the underprivileged and have many brothers involved in University activities. We believe Kappa Alpha will continue to be a worthwhile institution at Auburn. - John Hargrove, Kappa Alpha president nu gb ' - - 1 V fw iflrijift ll A B ,,i.-g.Iiijii , - 1. Roy Croft 2. Tony Perry, 3. Caroline Crain, 4. .John Stine, 5. Cheryl Crook, 6. Rebecca Richards, 7. Ann White, 8. Liz Armistead, 9. Sheryl Clark, 10. Robyn Smitherman, 11. Kim Horton, 12. Brenda Head, 13. Betty Ingwerson, 14. Cindy Wilson 15. Karen Gore, 16. Roxanne Mosley, 17. Beverly Powell, 18. Jan Deaton, 19. Cecelia Moore, 20. Tracey Hughes, 21. Lorrie Morris, 22. Lisa Bortz, 23. Debbie Rower, 24. Ann Revell, 25. Russell Shaver, 26. Jeanne Weaver. Not Pictured: Suzie Book, Kim Cannon, Cindy Covar, Kristi DeRonoey, Paige Faulkner, Lynn Gaines, Ann Moon, Kathryn Pettiss, Robyn Rives, Kay Spradling, Deepa Varma, Renita Waters, Elizabeth Winter, Karyn Murphy, Beth Brindley. ii uburn University has offered me many opportunities, but the greatest one has been my sorority. I did not want to come to school, but my parents told me to try at least one quarter. If I was not enjoying it after my first quarter, we would discuss my not coming back then. Well, like many freshmen, I fell in love with Auburn and that discussion never came up. From the very beginning, I had a group of friends in Gamma Phi Beta who were always there. I remember all of the road trips to Atlanta we made, but the one that sticks out the most in my mind was when 12 of us piled into Tracey Hughes' van bound for Atlanta. We did not change just one lane at a time going through Atlanta, oh no, we changed three lanes at a time. That was an experience I was thankful to live through. There have been other fun times like house party where everyone had to have a pineapple and formal. Winter formal was the first big event to take place after I was elected president. I have had a blast during my four years at Auburn and in Gamma Phi Beta, but there comes a time for good-byes. Thanks for the memories, and never fear, we shall return one day. - by Ann Moon, pfegfdenf Gamma Phi Beta . Wie. su. 'uma' ly ' rl ..,. , ,ws Q rv' - 1 -' 1 f 5- gg .bm , W,:.,,,. HX, K H . 9 .R es -1 ,..1 . 'Tr' A- - ' me A I if f ,W f. W' 'Q , 1... .,. -ts Gamma Phi Beta . eng '94 B. Schneder l S heta Delta Chapter of Kappa Alpha Psi Fraternity was founded at Auburn in 1974. Since that time, its members have been actively involved with community and service projects and various fund-raising activities. The dedicated brothers who make up this social organization have participated in annual blood drives and cultural activities. Kappa Alpha Psi encourage high scholastic and ethical standards as well as a strong friendship within the bond of brotherhood. Kappa Alpha Psi will always strive to its 1 fulfill ire motto which is achievement - ff C Vincent Edwards Roderick Hawkins C.C. Collier Billy Parker Lawrence Whatley Jerome Dees Arthur Billingsley Ricky Caldwell Renaldo Nichols Christopher Woods Ernest Holland 'ill' u llil , l H l SI Q N-H ! L T lf by A. Billingsley, Kappa Alpha Psi president Not pictured: Arthur Britt Tony Burden Kenrick Guild John Hill Abraham Johnson Christopher Martin Willie Tucker l 3 l i l KATHY SCRUGGS Kappa Alpha Psi No! Pictured: Tracy Adams, Lesley Allen, Leslie Beard, Laura Bonney, Lenda Bridges, Susan Callaway, Deborah Cayson, Casey Cook, Debbie Dominy, Susan Esslinger, Joanne Evans, Barbara Anne Findler, Lucia Fitzmorris, Deborah Frayne, Lea Hughes, Kathy Jones, Bonnie Kendrick, Lisa Kotlewski, Karen Krumholtz, Jan Murphy, Dina Murray, Louise Orzech, Robyn Perry, Rachal Rhodes, Freida Scoggins, Michelle St. Raymond, Elizabeth Swilt, Andrea A. Tashik, Deanna Wagner, Tay Warren, Deedy Watson, Laura Willoughby, I P'-ra Wright. Beth Upchurch Cathy Marshall Renee McCreary Leisa Ward deNay Porter Susan Stout Jessica Jones Marsha Hilston Christy Gaunt Christy Armour Cathy Cargile Donna Cravey Tammy Montgomery Carol Gardner Luwana Deese Joanne Comattl Kathleen Erlkson Carla Kitchens Cathy Cunningham Lisa Holcomb Tracy Montgomery Darlene Richards Kelley Burleson Amy Dean Jannie Hayes Jeanne Dowdle Gage Kitchens Elaine Kirkland Susan Pettit Cindy Ross Margy Perry Paige Hayes Beth Bowers Janice Martin Katherine Conyers Laura Holitield Caroline Kell Tammie Steadman Mary Martin Anderson Louise Weir Kim Oldham Terri Ross Juli Ellis Malinda McCray Lisa Habib rrett Johnston Cindy Brennon Annie Carnes Yvonne Orzach Glenda Gillespy Catherine Morgan Valerie Strain Susie Cox Susan Hart Lee Gibbons Joanna Jordan Joanna Brinson Eva Bonney Sally Thompson Mindy Paxton Kathy Knestrick Lou Thompson Sandra Edwards Dorothy Mullins Susan McAdams Sandy Mayfield Jannette Wolfe Wissesmws. 340 Kappa Alpha Theta failin g 1 ' Wfigftieigim isjQi ii hese girls are the sisters of Kappa Alpha Theta! You probably won't recognize most of us because we don't usually walk around campus dressed as gangsters. if you want to be able to spot us on campus, here are some clues.' Darlene will have Briiiian's picture wherever she goes. Debbie will be chewing bubble-gum and eating a salad. Barrett has a cut lip from her blind date. Malinda will be looking for her stolen car. Dina always plays tennis . . . how rare!! Laura will be drooling over John. Christy Lisa and Michelle are dressed in pink and green, and an alligator is usually nearby. Freida and Tay will be twirling their batons! Sally eats health foods . .. bigger than life! Elizabeth, Louise, Barbara and Glenda listen to the GoGo's album and are dressed to match. Lee won't be without her Barbara Streisand songbook. Kathryn has plants growing out of her ears. Lucia won't be without her broken vacuum cleaner. Sandra will have a dozen roses waiting for her every morning - especially during rush! Lenda wears rows and rows of add-a-beads Terri drives a black batmobile. Susan rides with the top down in her M.G. Marsha wears spiked heels trying to be taller than 4-feet-11. Carla won't be seen without Kevin by her side. Renee will be wearing a Nike warm-up suit. Barbara has her nose in an L.L. Bean catalog. Laura has her phone attached to her ear and sits in the hall talking. Lesley will have a calculator and checkbook in front of her. Mary Martin, Eva and Kathleen will be awake 24 hours at Dudley, Cathy will be jogging at the Coliseum and chatting about Charles. Jan has a top hat on. Susan has her Tigerette uniform on and is always going to an SGA meeting. Kim is busy with Rick and her goldfish. Beth will be studying or at Scott's when she has free time from the pledges! Luwanna is working on a project when she's not gone or on the phone. Kathy and Sandra are baby-sitting Willie and Billie when they aren't playing pranks on their suitemate! Carol is eating eggs and apples and trying to figure out who is waving to her when she doesn't have her glasses on. Lastly, our awesome pledges will be walking around campus with their Theta t-shirts on, but you'll probably find them studying so they can make their grades!! 'Good luck trying to find us! See you around .. - by Sandy Ma ytield, president Kappa Alpha Theta QQ Q o QQ Q30 cl ' 'U' o QQ Q Q Us 9 Q 1 Q SRWQQWIWQQ - iwhsttttti fvtt' Wltt tsft'-.W PA ID LTA ' I I I rudging up the hill on another rainy Monday, I am worn out with thoughts what I must do by Friday. Finally, I reach those beautiful glass doors of Dorm B which open the way to my home here on the Plains. With the opening of those doors comes a bright ray of sunshine and there - suddenly - is a reason to smile and to laugh .,. As always the lobby is buzzing with excitement as the normal lunch group hurries to find a seat in front of the television for another episode of All My Children. The friendly greetings and cute remarks help me put my rough morning behind and start me laughing. Eventually, I head for second floor with a new bounce in my step. Suddenly, I hear a loud burst of laughter and recognize that some poor sister is about to be the brunt of another one of Kelly's, J's, Sista's and AIison's pranks. At the other end of the hall I see Martha and Susan diligently pulling out the paint brushes and butcher paper for another spirit campaign. All right, Kappa Delta football practice in five minutes comes ringing through the dorm as Bloess, Newsome and Brenda rally the team together for the playoffs. Katie and Beth yell that pledge meeting is about to begin while Kelly Cashin pins up a reminder to sign the activities book. As I stop in the hall to get a drink of water I hear Goose reciting phone numbers, Leah, Laurie and Liz giggling, Kim and Alice Ann inviting everyone down to our place for a soda and Jones' and Emily's beautiful voices singing. Put your right foot on the floor! Then I see Joy and Bad Gad running out to another meeting, Sally Humphries' heading to study and Pam Ramage running for her ringing phone. I wonder sometimes how 165 girls can go in so many directions and still find their home in Kappa Delta. But as I walk to my room on this typical Monday afternoon, I realize that it's the silly pranks, the sorority football games and our many individual personalities that bind us here at Auburn, but most importantly, forever as Kappa DeIta's. by LeeLee Roberts, president 342 Kappa Delta Barbara Hicks Lori Wilson Allison Chancey Maggi Smith Martha Hutcheson Cissy Stanford Beth Pryor Lee Lee Roberts Susan Noble Dee Hinton Lianne McClaughlin Lori Ann Dyess Laurie Driggers Rebecca Chatwood Brenda Walton Deb Lucas Foy Goodwyn Kim Brower Janet Kinsey Caroline Chancey Lynn Smith Laura Gilmore Margaret Champion Susan Robertson Ginger Williams Mary Fleming Williams Lee Anne Edwards Susan Flach Leah Diffly Janie Howie Fran Duggan Julie Fikes Jennifer Johnson Fran Humphries Ainsley Edwards Lisa Roberts Anne Goodner Amy Gaddis Kari Coleman Bethany Brown Laura Seibt Allison Mobley Sally Humphries Ellen Myers Doll Wilkinson Susanne Berry Kelli Patterson Lisa Leberte Hope Hardy Sudy Thompson Amy McCormack Julie Jenkins Lauren Fowler Joy Loard Cathy Chapman Marty Kathy Williams Alice Ann Harrison Lee Crane Ashley Manor Ashley Owen Beth Wines Beth Mildrum Kelly Cashin Suzanne Hardy Nancy Figg Midge Stockholm Nancy Lange Carolyn Mills Mary Allen Hamilton Tyler Williams Kathy Lawson Laura Rutland Kaci Tranum Kim McLaughlin Sheri Studstill Carrie Shields Katie Stewart Sara Nelms Rosemary Grant Christi Bruns Julie Kaufman Nancy Hudson Mary Nell McLaurin Kirsten White Elizabeth Knolwes Allison Hendee Melissa Spear Cathy Waid Susie Weidenbach Julie Corte Becky Ollinger Denise Woods Gayla Arial Jeanne Bowman 95. Kelly McKinney 96. Cindy Schreiber 97. Melissa Stewart 98. Gylmer 99. Lynn Gay 100. Pam Rammage 101. Julie Harbarger 102 103 104 105 106 107 . Joy Hambrick . Susan Jones . Emily Ward . Shirley Henderson . Melissa Spear . Julie Randall 108. Pam Williams 109. Jennifer Johnson 110. Lisa O'Connell 111. Susie Scruggs 112. Barbara Hicks 113. HJ Passailaigue 114. Kelly Hull 115 116 117 . Kerry McKinney . Karen Miller . Debbie McGregor J. JOHNS. J. REED, BFITZ Kappa Delta Not Pictured: Kyle Avery, Jana Bjurstrom, Noney Cauthen, Cathy Cosby, Anita Digesu, Sharon Ewing, Ann Finch, Wendy Hansen, Joanna Jimmerson, Stanley Jones, Debbie Livings, Ellen McEIrath, Laura Muse, Cindy Nunnelley, Ellen Paulofl, Robin Payne, Jan Scott, Carol Sims, Benee Waller, Tina Brockway, Tricia Kennedy, Karla May, Kay Norlander, Gerri-Lyn Stephens, Christi Subei, Nancy Turner, Kathy Whitesides, Beth O'Neill Julie Boop Melinda Truitt Amy Poole Beth Stromire Jan French Laura Kern Gretchen Kennedy Nancy Boss Flegina Howell Lois Mastin Mary Beth Cummins Lisa Bechtel Lisa French Melinda Uzell Lynn Delathouer Darlene Tinney Lisa Cumbee Layne Hoobler Hollie Johnson Mary Bea Elder Diane Howle Margaret Dunn Jennifer Godwin Claire Rohs Laura VanLeer Jane Hood Lynn Campbell Robin Hansen Laren Campbell Kathie Dawson Heidi Budd Susan Brown Laurie Player Carter Holmes Lynn Donaldson Juddi Coin . Judy Williamson . Wendy Cline Mary Benton Nancy Walker Louie Sides Mary Gail Muse Sally Speights Julie Hamilton Claire Verpillot Amy Spidle Elise Flawson Helen Maddox Christi McKinney Melanie Borden Shelley Hedges Connie Cousins Laura Wehrum . Cathy Johnson . Lisa Mllberger . Lane Connon . Ginger Bradshaw Julie Fleeder Mary O'Brien Kim Norris Lee Box Jan Gunnels Beth Lee Kelly Butler Leigh Light Laura Brohawn Amy Crim . Judy Thomas Kathie Houlditch Julie Rucker Gabrielle Bireley Kathryn Oswalt Georgia Anne Land Charlotte Braswell Nancy Herrmann Michelle Newsome Laura Kelley Leslie Trowbridge Sandy Malcolm Lee Allen 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100, 101. 102. 103. 104. 105. 106. 107. 108. Kristen Swenson Charlotte Borden Terry Toth Dana Northington Josette Baxter Merrie Slettendohl Mendy Phillips Marianne Tidmore Susan Hale Lynn Howell Julie Lunsetter Beth Bishop Jill Minor Janet Waites Claire Candler Alecia Hendrick Susan Stanford Dee Minor Kathy Calfey Cathy Eskew Liz Ard Mary Neil Hunyan Carolyn Plott Lisa Hamilton Cheryl Jones Jan Hobdy Johnna Maddox il! new v 'M ZZ! 3 te 344 Kappa Kappa Gamma A - A f ' 4 1 77 , 64 56 ' 10 73 80 1 A f 43 79 6 D A 48 17 Q 42 44 45 A r 1 A 1 2 24 4 6 1 l l i A A A ,Q ,Q if A -A as A A A A 65 A 59 71 7 76 7 A B1 82 ,L e l f sa 1 . 1 5 45 550 D QW' 1920 A ,Z 3 A9 99 GAA NASE, 0 12 i t A ioom Er 6 L 99 4 60 4 4 A 6 62 Q W5 6 537 38 40 M 10 Q ij 13 14 15 is if 1 . - ' o miles 'O ii appa Kappa Gamma is a group of fun and caring girls. lt's having someone to go on the Cambridge Diet with - and then go to Sani-tlush the very next day. lt is deciding on Thursday night that a trip to New Orleans on Friday for Mardi Gras sure would be fun - and then really going. lt is sitting up until all hours philosophizing about life and boys, men, I mean. lt's having someone to call tor help when you've fallen off your bike, of all the embarrassing things, and knocked out all of your front teeth! t'UnderIying the enthusiasm and fun which the Kappas always seem to have is a genuine love and concern of each girl for the other. And what could be better? - by Laura Wehrum, president Kappa Kappa Gamma it 346 Kappa Sig l ff 2 - ii or more than 80 years, the Beta Eta chapter of Kappa Sigma has excelled in all areas of campus lite. The men at 104 Hemlock Drive are always finding new challenges to meet and new goals to set. From the first Auburn football game of the year to the American Graftitti party spring quarter, Kappa Sigs have fun all year long. YZARC, House Party, and South Sea Island are some ot the highlights. Sports are another important part of the year, because Kappa Sigmas are always in the race for the All-Sports Trophy. Just like all Auburn students, Kappa Sigs are concerned with academics. Kappa Sigmas consistently rank high in the overall academic standings. Whether lt's sports, academics, or social lite, Kappa Sigs always excel in their undertakings. They are involved in every aspect of the student lite besides the basic three mentioned. Their interests include everything from music, weight lifting and aviation to hunting, skiing, and government. Kappa Sigmas - they do it all, and they do it well. - Ashley Hifi Kappa Sigma president KAPPA I A Brad Heatland Raymond Holcomb David Hellerly Mike Price Catherine Hartramph Elizabeth Pickering Phillip McCallum Russell Sanders . John Sapentield Pam Holderby Pam Martin Mike Harrison Sharron Joseph Paul Jackson Jimbo Pace Steve Meadows Carolyn Edwards David Austen Keith Covington Mrs. Nicodemus 2 vim Q , ,.,.. , , ax .sy i S -fr 5 WP gp -- -- 4 I J vp, V KET K: 5 Kr? .5 K Q An: ,X 'EQ - iFf if vi Q i e2 ,ei ' T, 5 QHQ Q . .5 it A ' l-fi 5555253 if 3 it it is 5 2 fig 5, 2 . - vsiftaitijg Qitliiiafil . gg? Q ,ffl 3 5 '5g,.:: ..-. : .EE V W, it 1-Q -E: we V? T will g g ,g i i, 4, il 3,4 time 22 4292 it g ifts ip 532253 gt fs E id bg '52 wget fr 5 it M :t ilt g , fit Sli? it 23155 14 ' .EE Q Fi it sift . sg, . . 5 Z 2 Q t x l Q iw 2 gi Q 4, . , 255. if tggilii E , 'ii E ty? , A I , tgirl 5 l it , l ' is Sw E lit :'I ga s Q Ez Q ti ,ft-tim e . iftfiii :Lg l gsm? ? 2 .. .. ii i? J il , Si ta? I ll. K 5 5233 23- T tl f ait felis it is I 735 y is . E ! IE Egg ilu it 2 i L Eid, 2, A i 5 f l David Ballew Jimmy Henderson Steve Getz Jeff Roberts Richard Lysinger Drew Yantis Mark Mallory Johnny Hall Alex Pruett Tim Dwyer Dave Thomas Mark Dryden Kendrick Ketcham George Kassis Jimmy Ivey Jim Balistreri Tom Kniskern Ben Botcher John Bryant Greg Dryden Clay Brown Tom Lane Tim Hepburn Tommy Boshell Steve Hamilton Skip Sherrell Brant Hill Chuck Ledbetter Jay Chandler Mark Sommers Kurt Ulrich Jeff Wingo Don Travis John Stockdale Paul Olver David Salter Jeff McCulley Scott Elliot Matt Moore Steve l-lurford Charlie Nesmith Tom Rogers 43. Greg Warren 44. Chuck Snyder 45. Robert Plummer Not Pictured: Andy Aldridge Bob Anderson Jim Armstrong Cliff Barnett Mark Barnwell Reggie Billinglsey Ricky Black Charles Bond Jeff Brabaw Pat Byrne Mike Cahalan Kim Campbell Greg Canfield Jim Cannon Frank Challont t Au cc Jeff Christopher Frank Clem Bill Coggins Ben Crane Mike Dobbs Baron Doherty Greg Edwards Brad Flippo Glenn Fradenburg Billy Gauthier Tommy Gillis Gary Godfrey Joey Greenfield Hal Guest Randy Hall Eric Hallmark Charles Hart Jeff Henley John Hogan Scott Jansing Mike Hetlinger Jim Kercher Bryan Keim Dan Keim Bill Knestrlck Scott Lowery Garrett Martz Bill Mathews Ray Mathews Roddy McRory Stan McDonald Matt McGee Tim McLain John Meadows Russ Morgan David Naumcheff Mike Parrish Rusty Payne Rick Pepper Mike Pilver Bill Price 348 Lambda cm Paul Roberts Ben Robuck Lee Rudolph John Riley Mark Scott Mike Shoults Don Sinyard Keith Smith Bobby Staub Tommy Stephens Jim Sturdivant Tony Titus Trent Ulrich Bob Vines Maury Wald Jeff Whitlock Daniel Wilson John Wood Doug Yager Pat Yost ..- I WV: S i lL, tiftwii il it it if .llblil lil l Gi ambda Chi Alpha at Auburn was founded in 1915. Since then, Lambda Chi has grown to be one of Auburn's largest fraternities. The chapter strives to excel in several areas, including community and campus involvement. During Halloween and Christmas, Lambda Chi has parties for the Project Uplift children. The fraternity also visits the Opelika Nursing Home weekly to play bingo with the residents and hosts the Auburn Special Olympics for retarded children. ln addition, the chapter is active on campus. For Lambda Chi Alpha, Step Sing has become a favorite event. Last year the fraternity placed second in the event and received the originality award as well. The fraternity's leadership involvement also reaches a wide variety of interests. These interests include SGA, Plainsmen, cheerleading and many honor societies. Lambda Chis are also socially active with their annual sorority pledge tea, Watermelon Bust, Winter Formal, House Party, Little Sister program, Luau and an annual fundraiser which contributed 81,200 to the Big Oak Ranch, a residence for homeless children. In addition, the group is active in athletics, having won 10 all-sports trophies in 12 years. Along with playing an active role within community and campus affairs, Lambda Chi Alpha takes pride in its close circle of brotherhood. For all of these efforts, fraternity has received the Grand High Alpha Award for national excellence for a chapter. - by Matt Moore, Lambda Chi Alpha president 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 Clyde Beggs Mark French Bill Cooper Karl Kapoor Dan Whitlow Charlotte Cotton Mark Beck Debbie Wagner Joe Long Ann Ayer Mitch Jordan Lisa Jonas Lolly Wilson Doug Weeks Sam Cartoner Kenny Schmidt Regina Snow Mike Culver Dru Forrester Lisa Shorter Steve Foster Bruce Burkette Melanie Glasscock Vicki Fountain Joe Woodward Mike Callahan Bill Wicker Suzanne Britton Dennis King 30. Will Coloey 31. Bill Dawkins 32. Angela Miller 33. Lisa Bellamy 34. Andy Torsch 35. Steve Haynes 36. Jere Butcher 37. Lynne McMaine 38. Jim Lane 39. Tom Berge 40. Doug Elledge 41, Pat Dorroh 42. Hardy Dungan 43. Gary Coleman 44. Louis Johnson 45. Eddie Leach 46. Jim Carpenter Not Pictured: Steve Allgood Mike Bagley Fairfield Bain Al Baker Bob Baker Jan Ball Lisa Chambers Ray Coble Karen Colson Sigeizmw 22555 eff 1 it ?2L,wJi2S ji? 123'251t?'ti'i'tEE 'GZ N-wi! Lfzftsiwiz iseggtgggi V51 si Mmm 'WE time 4:55559 eM2+LQ3?fi'3 ww 'HREF X sg' iiiieg iewgf' miss fit? MW ERE? 7 t' gg? at 4:2122 if . VA :assists reset fattsgstt xv sew ' S56 Zlzikifhs 3229539559 fttwtilstz MYQWEN Adm . , .Aff it yy,,. . 7 W . 311 L, Q V7 yy .JWIAM .44 4 454,51 4 f , 'ia Greg Daniel Teresa Edge Joel Fisher Lynn Graham Walter Haines Becky Hall Roger Hartsell Mark Hayes Robin Hayes Dana Heck Kitty Horky Billy Howard Al Hudson Donna Lauderdale Andrew Lawless Ray McDonald Caroline Montgomery Alan Moss Susan Muller Mike O'Bryan Joel Schrader Sarah Smith Paula Staton Tina Stone Robin Temple Margaret West Donald Whitener Steve Wills Joe Yocum Wendy Zellmer Jim Adams Larry Adams Lynn Allred Nickie Baird Mike Brooks Cathy Culp Laurie Dupre Ronnie Gillum Doylene Graham Mike Hernandez Andy Horner Kecia Howell Cindy Matthews Kevin Monce Ginger Morrow Kelly Pinkston Beth Reddy Stan Rogers Tom Roth Gene Smith Mike Smith Teri Austell Smith Mike Stewart Tom Tenorio Jennie Young Bob Moser Lynda Lanning Juanita Avant Jan Batten Cindy Cogburn Myra Collins John Conner Louise Conrad Donna Davis Belinda Hataway Caryl Kline Bambi Lynn Fox John Martin Laurie Roberts Monica Rodgers Saralyn Smith Danita McElroy Ken Neal Leland Thompson Amy Trettien Kelly Vick John Weiss Betsy Willis Ann Yowell Bill Lamb Jeff Saylor John Coulter Mark Whitley Denise Coram Margaret Wainwright Mary O'Grady Suzanne Alton Paul Garofolo Darrell Coffey David Turner Jean Swigert Pat Dougherty Jane Gehringer Leigh Jackson Mike LaGodna Joan Richerdson Dan Burba Reed Claunch Mark Tarter Greg Bishop Rebecca Vaughn Connie Clemons Linda Knight Mike Holmes Shawn Brothers Mike Matthews DeWayne Biddle Lisa Ricketts LeMayne Ellis Debbie Hyams Judy Sabelhaus-Morley Todd Bickett Frank Hooper David Wilkinson - 4 M mf bvwwwaiiift Omega Tau Sigma -F -- - V WM 'T'ww 'ie ,,.,. .... j WL .- :-:.: 1 gl T 40 5'35W8,gg oocaarcil i B LU EGRAS5 i t liifl ii mega Tau Sigma is an international professional veterinary fraternity that combines the functions of both social and professional fraternities. Our purpose is to encourage and foster the development of well-rounded, ethical veterinarians. OTS is always proud of its scholastic achievemtns and continues to maintain the highest yearly GPA of all fraternities on campus, this year surpassing 47 other groups for the honor. As well as staying active all year with a calendar full of social activities, OTS is very committed to community serviceg this year's Dogpatch Bluegrass Festival was once again held to benefit regional charities. This year we also won the Vesper Community Service award, designating Zeta Chapter as the most outstanding OTS chapter internationally for work done and contributions made outside the fraternity. We're also proud to participate in the intramural sports program, and OTS made it to the finals in volleyball, basketball and horseshoes. All in all l'm proud of the chapter's multitude of achievements and improvements this past year and have come to know OTS as a 'service-minded, scholastically-oriented, professional fraternity that likes to party a lot too. ' - by Mike Callahan, Omega Tau Sigma president Omega Ta S gma 352 Phi Den 'i M955 ii W' ll fraternities boast about their particular aspect of being the best. Some of them make claims about intramurals, academics or campus involvement. The Phis do not neglect these, but we allow a great social calendar that cannot be matched on the University's campus. Through imaginative social themes, the 69th annual Bowery Ball, Roman Party and great little sister participation, the Phis continue to be a great brotherhood in 1983. We are also proud of other achievements we have made over the year. We made it into the playoffs in intramural football. On the community service scene, we participated in two all-campus fundraisers and sponsored a Halloween party and a Easter egg hunt for the Head Start Youth Program. The Phis look for continued success in the future. - by Steve Hudson, Phi Delta Theta president Jimmy Hartman Marty Walsh Paul Simmons Gus Glascock Tommy Trotter Mitch Bruhn Charles Sowell Pat Toomey Chris Glascock Cary Williams Jimbo Walker John Carussa Doug Nesbith Craig Nelson Chris Crowe Trae Corte Neil Armstrong Howard Smith Danny Gork Ben McGufffey David Mullins Mac Wright Cole Powell Andy McLeod Pat Henry Peter Bertucci Ken Strecker Ricky Creel Sonny Culp Mark Littrel Roger Fuston Chris Smith Jack Brown Grason Chew Mike Johnson Dan Rimmer Miles Benton Fliley Copeland Kevin Wadley Jack Sayler 41. Rick Credrick 42. David Milstead 43. Ross Druhan 44. Billy Walker 45. Ross Skelton Not Pictured: Kim Allman Dwight Bassett Jimbo Bicksler Hunter Bell Ill Bender Betbeze Warren Cato Lloyd Cooper Steve Cox Frank Conwell Robert Drennen Eric Dyas Chris Dyas Gary Diorio Richard Girdler Clay Godwin Scott Hines Michael Hughes Robert Hedberg Steve Hudson Charlie Johnson Kal Kimbrough Eric Kennedy James Lipscomb Tom Landstreet Richard Ledford David McElhaney Robert Mastin Jack Mills John McKay Bo McColiough Wilmer Poynor Jay Pace Kerry Rehm Cummins Regan Harry Shugerman Paul Speyer Craig Schwall Jimmy Shoulders Chris Saltis Steve Thompson Allan Wood Phi Den 353 Paul Barber Peanut Prewitt Scotty Morris Murray Gray John Glasscock Moe Moultrie David Burgess Jeff Werthiem David Whitten Sid McAnnally David Gipson Bob Mallory Duncan Campbell Bart Carr Bon Anders Mark Forester Jeff Sibley Dennis Scott 21. Alan Deere 22. Stacy Norwood 23. John Godwin 24. Geoff Rogers 25. Joe Brown 26. Gerry McGlamery 27. Scott Nesbitt 28. Chris Schuster 29. Alan Howard 30. Jane Wolfe 31. Tim O'Neil 32. David Hillman 33. Billy Mitchell 34. George McGlamery 35. Stephen Naughton Not Pictured: Johnn Adams Charles Bartholomew Jay Black David Breedlove Charles Carl Allen Champion Bill Christenberry Tommy Cochran Jeff Collier Phillip Cowart Maury Davis John Edwards Bubba Farris Kim Farris David Faught Bill Godwin Rob Godwin Steven Glasscock Dawson Graves Barry Gunter Phillip Hajek Jim Hancock Jeff Hawkins Michael Horne Jeff Huff Gary Hughes Jimmy Jordan Charlie Joseph Stewart Lee Clay Massey John McBride Craig McKissick Russell Miller Jimmy Nunn Steve Ostenson Cobby Quarles Toby Flumbarger Y Ken Galfafd Tommy Adams Lee Gresham Mike Schor Doug Beverly Bryan Anderson Bod Grissett Greg Scott n or ll., .VJV 354 Fiji Joe Sheperd David Sherrod Alan Simmons V. Smith Dayton Sorsby Eddy South Mal Sport Mike Swinson Martin Thomley Barry Thornton Trip Todd David Twesme Shelby Watts Flob Waudby Ronnie Wenzler Jeff Wilson Mark Wilson Ronald Woller Murray Anderson David Ankenbrandt Chris Barker George Childress Mitchell Cooke Alan English R, Morris Glasgow Kenny Harris Pound Lamb Greg Lummis Bob Mann Kirk Patterson Bruce Sansom Tom Saunders Bill Sims Mike Smith John Stein Gordon Stone Vince Thompson Stan Waller Clay Wheeler Bill Wynn W. ,.A5 W REED if Wt ii he group you see is not your usual social fraternityg in fact, we don't even approve of that term. We are a group based on brotherhood. This is not an organization whose only tasks are to insure existence by pledging rushees, to have parties or to wear jerseys with Greek letters. We feel our fraternity is a unique institution composed of men who disregard mediocrity and strive for excellence. Men who have achieved many personal goals to be proud of are found in our group, but the one thing which holds us together is that we are all most proud to be FIJI by Joe Brown, Phi Gamma Delta president GMM DE Fiji 355 S U ,N 21 I N -hx,-A Wit Phi Tau ii hi Kappa Tau is a group of men here at Auburn who have different interests and ambitions. We have found that a more meaningful college experience results from sharing our interests and talents with each other. The close friendship which has emerged will extend over a lifetime. lt can be as much as you want it to be. This statement summarizes the success of Phi Tau at Auburn. Our accomplishments include our strong athletic program of football, basketball and softballg 100 percent participation in the blood driveg first place in the small fraternity division for our homecoming floatg and active participation in all campus activities. A special event each year is our annual South Seas Fantasy which continues to be a campus-wide success. At Phi Tau, our accomplishments will continue with good men in the future. Phi Kappa Tau means a strong tradition in fellowship. Fellowship is an intangible part of our brotherhood. Perhaps fellowship can best be defined simply as living friendship. To the men at 317 S. College St., it is why we are a fraternity. There are many organizations in a college open to students who are looking for more than just a textbook education. In a time when there is a demand for people with well-rounded backgrounds, Phi Kappa Tau offers you a chance in 1983-84 to develop in many areas that will help you later in life. - by Jimmy Stubbs, Phi Kappa Tau president Jim Vrzal Scott Rogers Matt Vrzal Jimmy Stubbs Ken Michaels Jim Nikcevich Tommy Neely Rusty Nix Scott Studdard Barry Dorman Tyrone Clarke John Strickland Grayson Hodgson Bill Olbert Mark Leslie Clay McConnell Billy Noel Murray Terrell Jeff Sasser 20. Michael Robinson 21. David Strickland Not Pictured: Skip Chitwood Phillip Joiner Barry Maske Wendell Parker Frank Pugh Brian Slaughter Steve Slaughter Robert Strickland Tommy Tidwell Frank Graham Vernon Harmon John Radney Billy Traylor Phi Tau 357 Phi Kappa Psi mil if iii t HM 1 n the past year, Phi Psi has made great strides toward achieving the high standards set by others. Among them we must include, for instance, that paternity suits were down 70 percent because of an improved pledge education program. As usual, Phi Psis continued to keep a low profile on campus, despite our usual excellence in scholarship. The number of local retail establishments refusing checks from brothers has risen dramaticallyg however, on a more promising note, the local bars continue to receive our patronage with disguised enthusiasm. Our chapter maintained its excellent reputation among fellow Phi Psi chapters at the national convention held last August in Atlanta, Ga. As a service project, we visited several of our alumni in the V.A. hospital at Tuskegee. Refusing to rest on our laurels, Phi Psi looks toward greater accomplishments in the future. - by John Evans, Phi Kappa Psi president. NTS, Chip Clark Robert Perry Tim Unger Tom White Dave Dobbings Mike Robertson Waylon Thompson Tony Barber Kieth Bolen Robert Makofske Pete Cento Mike Williams Ed Hillmann Mike Downing 15. Rick Johnson 16. Doug Hertha 17. Bill Baughan 18. Gary Storie 19. Cliff Cheney 20. John Evans NOT PICTURED Mark Armstrong Richard Ash Kevin Hodges AI Land Chip Lee Tommy Lee ,. .. ,W ,.... ,..,.,. -- .,........ Q SBI Sffitf ...I wg K 5 .5 -1, fs .Z mifihiwd, awmww wwaffm .wmzmz 11212522 :timers- JOHN REED W Rift fi eff? fi Wifi 3 v it had lima-Q. ii eminiscing back over a wonderful but frightening year, I cannot believe it has actually passed so quickly. I can remember all the eagerness and enthusiasm that I felt when I became president. I never realized how much I was going to gain in one year from that office. When I leave Auburn I will take with me, packed up in my suitcase, memories of so many activities. Although most of these will soon fade away I cannot imagine ever losing those memories of Phi Mu. I will sit and laugh about all of those crazy parades and the funny things we did as a group. I will remember the fantastic feeling of Squeal Day after we knew our hard week of rush had finally paid off, the funny skits at our Christmas and senior parties and the many fun trips to Marvyn's. I could never forget the laughing as we drove to the sunny beaches of Florida for the traditional house party. I will smile when I think of the excitement we had as we planned our pledge formal on a riverboat only to have it dampered by a freezing rain. These are only a few memories of Phi Mu. I am sure each girl could recall always having that special friend close by and the wonderful times they shared together. The unity between Phi Mus is so very special. Phi Mu is an ideal, a spirit. It has expression only in the fellowship of its bond begun when life is young and is not to be broken in old age. Love for Phi Mu is not for a house, for brick or stone or a material possession. It is for handclasps, for tears, for song, memories and most of all, friendships. It was truly a time I will always remember. - by Wcki Henderson, president Phi Mu Patti Callahan Lynn Stevens Mary Claire Arant Mary Beth Flynn Carol Robinson Susie Crowe Jenny Kaiser Ann Smith Jan Smith Vicki Henderson Dianne Lively Lee Dobson Karyn Walsh Robbie Cox Misty Donahue Karen Altomonte B.J. Adams Dee Dee Dyer it Angel Childers Jane Wilks Cathy Lehner Susan Newcomer Susan McKelvaine Provs Spina Tara Cremin Dana Murchinson Judy Herron Lori Salter Sandy Turner Tina Price Donna Braswell Kelly Simpson Debia Sailor Melinda Sconyers Caroline Snow Janet Johnson Emily Lloyd Becky Hill Gwen Bailey Lisa l-largetl Pam Jordon Tereza Hall Cindy Thorn Jane Baustrom Linda Vreatt Maria Fleader Mary Denton Beth Anderson Jennifer Ervin Claudia Brooks Meg Persinger Necie King Cathy Williams Kelly Garrett Kim Payne Gaylan Newey Lori Morrow Dawn Batley Kim Burgess Laurie Simmons Traci Salmon Candy Abney Fran Plummer Leni Seaton Bobbie Briscuso Janet Walker Lacey Fountain Fran D'Aico Therase Carnathan Leigh Anne Hickman Sheri Fligby Donna Havrisik Patty Walker Lee Ann Hearne Angela Palmer Carolyn Edwards Ann Owens Amy Murrah Jane Meade Elizabeth Kane Joanna Jernigan Jill Kaiser Leigh Ann Nipper Suzanne Trexler Susan Etheridge Kaki Pruitt 55333512313 is 1 gl we 4 Q 2 1 -5 S3522 5 gg W 7 Q rw-faq Q A 3:5535 j . L evzggii 21 55233 L- 2 gf 35 E352 2 S 2 2 2 5 23252225 Phi Mu 361 Cindy Wagner Phyllis Mull Missy Beck Beth McElhannon Margaret Wright Lisa Robb Kim Robinson Kathy Brown Marianne Davis Ellen Roberson Carie Walker Laura Conner Janet Murray Kaye Kominek Dawn Wooley Donna Sims Barbie Roberts Tammy Kaiser Mary Lynn Page Carol Callahan Susan Grant Beth Duke Karen Allen Debbie Witmar Jill Perkins Jenny Harrison Janice Sandberg Mary Jane Gratton Connie Sandlin Cindy Standard Kathy Stroupr Carole Skoneki Joann Craft Tracy Piccolo Missy Clark Laura Word Stephanie Sawyer Claire Philpot Katherine Atkinson Cindy Burt Carole Wright Carol Crane 362 Pi Beta Phi Louann Burry Susan Cooper Valerie Cicio Laura Termini Renee Sills Tracy Hoots Diana Dillard Tammy Woolwine MaryLee Laster Kim Kerdyke Carla Bradford Cathy Weaver Becky Brewer Heather Browen Lynn Ryan Lee Eichelberger Amy Robinson Karen Cape Bebe Cobb Paige Newman Lori Langston Lisa Thompson Angie Roach Beth Ford Blanche Adams Susan Sasser Linda Whisant Sally Hamilton Martha Davies Jenny Woodall Martha Schieze Betsy Fonde Lori Antony Lisa Pinson Amy Braxton Biki Blakenship Deanne Isbell Tyler Smith Ann Charlton W dwitiifttt W in Q 2 ??:a Taq? Y .3 .9 Vs- fa? S .f Mm I' i Phi sisters dream of close friendships that sisterhood can bring. Dreams that are filled with . . . P is for Pledge Formal and our Lake Party too. I is for involvement in all the things we do. P is for poise for which we don't have to seek. We had Top Five Miss Fall Rush and two of Top Ten Miss Greek Week. H is for Hat Hunt when our pledges are new, where we get a big sis and a big hat too! I is for intelligence that shines in all that we do: ODK, Mortar Board, Order S of Omega and Who's Who. is for Squeal Day when the good times begin. I is for Initiation when we finally earn our pin. S T E R H O O D is for skating parties, Sigma Chi Derby and Step Sing. is for Tacky Tourist Party with the Kappas each spring. is for enthusiasm that all our girls possessg we have Capers, Tiger Splashers, Hockey Honeys and Tigerettes. is for raising money at our Woodstock Fundraiser this fallg the American Cancer Society received the proceeds from all! is for Fort Walton House Party where fun memories were made. is for overjoyed when we placed second in Burn the Bulldog Parade! is for our organizationsg Mariners, Kadettes and SGA. is for dreams of being a Pi Phi today. - BET PHI Pi Beta Phi 363 364 Pike l,.,. , - VI T W is ililjl ii i Kappa Alpha fraternity stands proud as one of Auburn's oldest and most prominent Greek organizations. its members emphasize the combined importance of academics, athletics and sociability. Pi Kappa Alpha is consistently regarded as one of the outstanding fraternities on Auburn's campus. The brothers take pride in their successes and achievements both as a group and as individuals. Together they worked toward raising money to support charities including the Alabama Boys' and Girls' Ranches and the Alabama Special Olympics. The major social functions include the Fire Social, Bohemian Brawl, Wild West and Luau. Pi Kappa Alpha believes its sense of brotherhood, along with its leading achievements, places it at the forefront of Auburn fraternity life. - by Steve Slade, Pi Kappa Alpha president The members of Pi Kappa Alpha declined to print their names since their faces were not in the picture. ggi el f 5.5-1-:. -.. -fi. . ' 3 - Y ... . . ' X , T-H. n- - I . f V - - - -H .f'. J l'-S ' w-'rib . W , 1- ? fF', DP- Aw- .. - -. .as 1' f.,..-. if A 'm .:,'Zi T..?'M2 '. ' ff l - ' - . Y 'f wwf vw - . K 3' - - PM 1- ' k ' '- '. 'X - ii , 72' K ' - 'TY ' S f .. 4 ,f - : -M-L '.4,..-:'. g f H- - ' . Q -W A ff -- , ,xg - '14 f , vm .:vrfq,,'fv..- '-' Eff Q- : :ar . x of ,.., y-WSPSQQ . .- --f .. -WN.-wx --: - V -fgxf' M - v-. ' 35 2 ' -3114545-saw. - .fm ., B- sf - ' -+ N WI wg-..-Swv . W-.f-'wg 3. 1 . , 1. V ' -'- 5 M- , f . . . fm, f W--1.9. 'D , f f? wi-Jw , Af , -w h -Q. -A -3-xy.-5,-M Q - my GL. - . ff -1 , 4 f - ,w . - Fw-'i'S9Lf - 1 '. 'K 'Q . - L --.2- wg- M-W:..mLQff!W,if, .: -z a ' nf . , ' V ' ' Y- X-BTQY nf .--- x RMQ H I .- X . . :,.mw, - f-5-'Af' !'5f A f+f- v 'K ' by ' 'R' ' ,,,g.g..-E.-f,iu.- , .m nzw . .,. ..4,. 3- eww.. . AW. . , M ., , .X , , 1 .I - A ' ' J fn ' -Wffxm - 3 ' - 9 1 ,f A A 'f :SESS ' , fm--Q , 1. 'x ff- . - 1 . Y V- f - v -251' , N Q . ' X - - ' - Q ' A 4 ' ff-ff m W a ' Q 1 fp 75? ' Lf f ., - v '? 'A ,23Q 5 1 . .4-.,'a-M ri-gr' ,. . W-3: , --13... W.. m3y.,fQp:af..:Xf.,w, k - D- L. W ' g ..f . m N , V3 1 A f . 5 - M . , . K' ' ' K ,j . J' '. .sz -, -- 5 - ' ' ,A , 1-1-ip! , 1. A . ..,,.,t.. , ., .QQ ff: . V. ...,,.,cg, L. . a , 1 N... A I K ,X : , x cu Q .' . - I ' - - ' ,pm gf q' - w - 'Q 1- Awm tm-1 f- me., , K , K , , v , ,Q , A A ,, .XL .,. .-,..,w.,vv f -x , lg . 5, - .15 V .Eff -12 srymi- ffj. L' . .M '- friifx. A .15 . ' - 0 1, - f , -5 L .ff , . 3 . W h Nxt iff-f ' ' . fi, 5-,i K .it fir: .f nl, 5 H gif-, : ' .1 - -- X M ll Q 7? 3?-2? . Q r' 1 J, fxfliii? I 'L . I ,w f gm .m-:gf +1 Q -Y K, , . rn, V AM I. f - ra 4 .g ' , .1 4 H f kg.- v A i' - 1 -' llfi 1' ' . 79 1 A S ' K, r , .gwf I g' 1 42.1 i, H b- 'Q' lfffi f, , ' 1. ii-'.5wfsu..s... -- -1 -x:-.M--. A' 'Fifi -A . . -7-H---...z -gg,7':- f v- Q- -A , . j 3 K' A , WW W-Q VW- ' fiiififf-1- 915 -5.-.k5i..,?i,.v Q.: M K 1. Lggfp . ., ..-,' ' . , .,, ' 'f 1 5 w ..-,.,.. T, W ,wi .-.,.,.,l-, . ,, 4. -,,.g.0 - ,V - 4 wif ., -if Q- v ' 'V -' 'W li' V K .pix 3 3 -w .,-.55 -3 . dn I. f nf- -Q Ag .., - -.,-M. .. -A X -' --G, 'fx -.Mgf A N. riwh, f 41 x r.xw5.v M 3' x -1. , , . . 325 is' gf 'ikflv' ' .iw ff ' 1 L 5 ,f In Q ffv .., 366 Pl Kap 1. Betty Welch, cook. Not pictured: Top Row: Mike Short, Ronald Lawson, Stuart Blackwell, Steve Chandler, Scott Thye, Mike Stokes, Bond Calloway, Jay Gregory, Pat Kahl, Bobby Kelly, Johnny Blackman, Trey Stone Row 2: John Maxwell, Todd Roth, Matt London, Perk Fendley, Jim Grant, Mark Harber, Stuart Dickerson, Ed Healy, Tim Bridges, Douglas MacGilI, Bruce Ford Row 3: Robert Owen, Roy Harper, David Dollar, Ted Reverett, Tim Fitzgerald, Hal Jones, Ben Collum, Alec Benson Row 4: Mark Moore, Chris Loughron, Glenn Farmer, Gregg Cohen, Bill Campbell, Mike Flagg, John Kimsey, Steve Bosser Row 5: Fred Jones, Rufus White, Benton Linger, Tim Blaum, Cam Murphy, Joe Williams, Fannie Tines, Dick Bally, Keith Stimpson, Greg Barnes, Fred Sleeman l lRow 6: lChris Barton, Jim Peterson, Steve Aleksevitch, Bobby Hall, Jim Leath, David Flogers, Tim Taylor, Jerry Woodham, Larry Thorne, Nick Sowenski, Mike Henninger, Ton Hill Row 7: Jim Bush, Phillip Hudson, Bristow Somforcl, Todd Whitaker, Ken Knight, Chuck Barton, Allan Richards, Mike Childers, Bubba Winkler, Mike Leonard, Mike Segers Not Pictured: Jeff Mitchel Allan Welch Drew Graw David Carrol Drew Sullivan . eeae T T A XEE,AA,.. QE, V'A, ,ttit mrxt ,ix xg .r., ,t,, g 2 s s t. . T r A ' ieif s . J , X? l A ,i., A t A'lA'ZA QXQXQXQXQXW frif rirr PX QXQYOXQX i , . .,.. , ,.,,, , is . ,11-i, t ,,,. ., .Y.,. ith H 2 A . itat Q. Q91 ttit Wi! ' i Q ' llkbx, ' ll iii' :' i +1 'T ri Y- 'J' Z. it ii aft A' ,t,.,,,. twg,.,a5g. tf52'va2 fiai1iigzL? is tw ,wats eriewwz PANKEY milf? Dm ii lpha Iota chapter of Pi Kappa Phi, founded in 1926, was once again named Master Chapter by its national convention. Along with this honor, the year was highlighted by the annual Jungle Party on A-Day, first place in the blood drive and another good year tor scholarship. With the help of Delta Delta Delta sorority, the chapter's fundraiser, Showboat, was tremendously successful. The money donated to the Pi Kappa Phi national charity, Play Units for the Severely Handicapped CPUSHL was more than enough to earn the President's Award for the chapter. Pi Kappa Phi combines scholarship, service and social activities to develop well-rounded men. Pi Kappa Phi, a personal fraternity, promotes unity through brotherhood and individuality. by Ed Healey, Pi Kappa Phi president PI KAPPA PHI Pi Kap 367 N i GG he brothers of Sigma Alpha Epsilon have enjoyed an eventful year. Fall quarter brought the annual Wreck Tech and Burn the Bulldogs parades and eight home football games topped off with eight band parties. lt was a busy quarter not soon to be forgotten. With winter quarter came our annual formal, this year taking us to the French Quarter of New Orleans. Winter also means four more band parties and our annual charity fundraiser. The quarter would not be complete without our yearly Wino Party, which is always looked forward to as the Auburn winter starts to dampen your spirits. The return of spring is marked by the heaviest social calendar of the year. We have our annual house party where we shed our winter clothes and head for the beach. Along with numerous socials and band parties, spring is highlighted by our annual Bankers' Ball, a week-long party that lives in everyone's mind as the premier social event of the year. The brothers of SAE enjoy taking time to help others. We have our annual Halloween, Christmas, Valentine's and Easter parties for the underprivileged children of Auburn. On campus you will find SAEs involved in virtually every facet of University activity. The fraternity is proud of its participation in the SGA, The Plainsman, Spades and varsity sports. We are also well represented in the various honoraries at Auburn. We as brothers of SAE recognize the importance of our position as leaders on this campus. - by Chuck Allison, Sigma Alpha Epsilon president 368 SAE Wayne Elarbee John Stein Greg Lane Bart Lewis Chuck Allison Spoofy Fieeves George Flowers Clay Bishop Jim Savoldi Bailey Gross David Wilds Billy Sammons . John Conner . T. Monster Queeby Carter David Fiser Buzzard Berthon . Graham Roberts Buss Bamage Lee Kessinger Bibby Woodruff K ,,. . 3- - ,x r fy , GK. I 1 . 1 .AA , ,- .v X W W kpbltrg-'51 an A TW Q Q, 7 ki , It W . at 1 .khyy J .. , Q-ff kg Q A352 TR' A ref-if 4 fl .1 5 ga , , L H f 'f Q W gQf Z, ., S, Ya W' w M ., ,R az . Y Vx f. X' - LAI mafia iii ss :gg EI-if i nf Ti- , Y? 1523 5 i if N f QQ 1 ix ,' A A sf Q Q, 4 in 2 ,QE E .W w .ggi gb, 5 W-fl - , 11,3- P 531 .A .. -,.- - A , 1'-2 M f, K , xi 1, ' ' 2 LL 1 3 ' gif N' ' +'!: Q 53 1 .,..x. g V Q, xx 3 , ffxfgfay . V. if Iliff, g, A Q if V ,w r W - K. ,gr 'S Q? A 3 ' ' .i'f7 g.1i - 11133, E3 A 'W Bob Dale Peek Smith David Tench Jim Weatherly Jeff Raabe Ken Williams Clint Beaty Jim Edwards Jack Bohner Jon Wolfe Doug Wolfe Bart Hamburg Doug Huhn David Myrick Doug Wood Ben Seckman Mark Akins Jim Foster Jay Davis Peter Lackey Curtis Barton Lee Wallace , Jett Stine . Rafael Castro . John Oman . Scotty East . Steve Bendall . Randy Chase . Eric Gronquist . Rob Payne . Randy Smith . Jim Kinman . Haywood Thornton . John Harrison . Jack Wilson . Scooter Lee . Jim Bonds . Scott Nesbitt . Jeff Thomas . Richard Alker . Jeff Gaskill . Doug Holton Tim Saeger David Johnson 45. David Howard Not Pictured: Bob Bacon Richard Graham Chuck Harnden Phil Jones Curtis Moroney Billy Reynolds Martin Stapp Chris Tanner Bo Cheshire John Charron Chuck Colvin Alan Daniel Mike Deskin Chris Espy Kevin Griffis Rob Holer Jim Kizer Mike Maresco Lee Meriwether David Mikell Robby Newall Greg O'Bryant Vince Pilato Steve Ponsell Jett Rawlings Jeff Raynor Charlie Smith Blake Swearingin Keith Swearingin Tommy Van Pelt Phillip Whiteside Steve Wylie Greg Alex Randy Hanscom Al Kelekei Tommy Albright Jett Allen Bob Anderson Earl Atkins Miles Atkins Tommy Barrett 370 sigma cm Greg Breland Bo Burns Steve Cates Steve Cheatham John Classe Kevin Cleary Vince Costariza Tom Coleman Alan Crowely Greg Dorriety Pat Deskin Joe Feyka Shaw Flippen Craig Gangloff Billy Gregg Matt Harlin Tim Harlin Jay Harrison Tom Horne Bob Klassen Paul Lackey Kurt Lettow Flob Linburger Rob Loflin Mike Mead Preston Morgan John Pappy Barry Peepies Jim Poteet Eddie Powell Bruce Reynolds Chris Sanders Jim Stevens Eric Underwood Mike Utz David Wespiser Billy Whitt Kent Williams Harry Yeatman Caesar Zevallos Mike Darwin Sidney Heard Steve Hendrickson Bill Herbert 33,5 E11 use-Pg nf-hard v Q -H we ii he Gamma Sigma chapter of Sigma Chi has once again completed a year of active campus and social involvement and has retained its high academic standards. Brothers hold positions in the SGA, IFC and UPC. Sigs are also members of ODK, Beta Alpha Psi and Tau Beta Pi honoraries to name a few. Brothers on the Plainsman and Glomerata staffs round out the Sigs' campus participation. As a social fraternity, Sigma Chi traditionally has some of the best parties on campus. With fall quarter football weekends, Sweetheart Ball and formal in the winter, spring quarter luau and house party, the Sigs have a very busy social calendar. However, there is still time for at least two fundraisers each year and the annual Sigma Chi Derby each spring in which all Auburn sororities compete for top honors in a week of unusual but exciting events. i'Despite the diverse backgrounds and personalities of the brothers of Sigma Chi, belief in a common goal has molded these men into a unified, interacting group. With a tradition of active alumni support and the continued efforts of the brothers and pledges, Sigma Chi will remain one of Auburn's strongest fraternities. - by John Classe, Sigma Chi president Sigma Chi 4 5 7 l :alll ll W wi Rb Ei igma Pi at Auburn University can be described in two words, growth and pride. This special combination of qualities was acknowledged this past summer as Alpha Delta chapter was presented with the Grand Council Award recognizing Sigma Pi at Auburn as one of the top three chapters in the nation. Fall quarter approached and with its arrival came eight home football games and a new housemother. Bush provided a talented pledge class. Friday afternoons at Waldo's were never without its Sigma Pi section. Parents Weekend, Halloween Party, Homecoming, socials, .. . the memories go on. Fall quarter came to a close with the Christmas Banquet and a chance to say good-bye to those hectic football - band party weekends . . . at least until next year. Tangerine Bowl here we come. lt seemed even before the Christmas tree could be taken down, we were all back in Auburn working and playing hard along with the AOPi's to prepare for our annual fundraiser, 'A Night in New Orleans.' Whoever started the misconception that winter quarter was uneventful was certainly not a Sigma Pi. Just to mention a few, Little Sister Flush, snow skiing and candlelight dinners in Gatlinburg tWinter Formall, Founders Day Banquet, Valentine's Day party, the list goes on. Sigma Pi climbs into the top ten fraternity grade point averages. Brother Andy Hill is installed as the new Inter-fraternity Council President. is the winter over yet'?! Spring, warm weather, shorts and beach weekends. Perhaps the biggest event of the year, Luau, occurs in Spring quarter. The fraternity house is transformed into a tropical paradise complete with island pool, covered bridge, waterfall and volcano, House party promises to be the best of sun and fun filled weekends in Fort Walton Beach. The brothers of Sigma Pi strive to find the perfect combination of scholastic and social development. Sigma Pis are active on campus with brothers involved in Auburn University Varsity Athletics, SGA, UPC, the Plainsmen, IFC and various national leadership and scholastic honorariesf' - by Peter Burnett, Sigma Pi president Sigma Pi David Piper Steve Goldin Tim Turis Eric Fox Bart Harmon Chuck Ellison Mark Bridges Sal Abbate Brook Flodriguez David Shaffer Danny Smith Tom Gentile Eric Britt David Lynn Scott Allen Stan Cook Mike Lewis Jim Peck Tim Hinely Andy Measel James Anderson Otto Von Alum Mike Fleeves Bill Schultz John Hamner Phil Wasden Jimmy Daniel Richard Amos Kevin Gush Jimmy Stuart Tommy Mills Gaines Gravlee Vaughn Thomas Mark Mole Bill Jennings Jack Conway Mike Flichey Peter Burnett Jeff Lanza Warren Turner Art Nichols Andy Hill John Lukens Art Gasgow David McKnight Jim Paramore N. K -sr ,, im ' lr ,. , 'Y gf W 3 r T A V.. 9 . W W. Az., ,- 9 3 r.q,Q f yt , , f fifty f iv flnziv 47. Jett Stumb 48. Mark Campus 49. Eric Koch Not Pictured: Doug Addams Keith Ashley Ed Atchison Craig Bachan Brian Boss Mark Coleman David Covey Warren Craven Kenny Cross David Freeman Gary Griffith Kirk Hancock Robbie Howell Tim Huff David Johnston Mark Kantur Chip King Frank Lockridge Chris McBride Chip Moore Bubba Nabors Tom Peck David Perry Mark Peters John Sims Eric Sorenson Kevin Stewart Frank Tighe Freddie Wade Randy Wallace Wade Wilson Mark Cherry Hunter Pickett Keith Rogers Jim Foyt Sigma Pi 373 N xi ii it X Q YA gil Ljllfi X 1' 1 ,W fi M ,.,L.,C is .- is F. X . is .. 56 V 15 ,Dui QW EPM fggj fuss 3, W tMVfY,,, N x N2 gn ,gm ty , X x 5 ni ' 'S wit S' sl QR to l ,jawn ii' iii 1 , 4, , 1 J XL y x 1 G1 1 A Wm fx X x NUM, 15 H l i t HN A1 M, H as , X is 31 I ,Z Ji ws Q f If 1. l i 1 x i X N , 1 it ff it f 1 1 B ' 1 'R x T fx 9' to 112' is fx if M VH t nl U 1 2 L H A L ,if A i i N 6 X 1 , f 1 ,f 9 i in V i ,J f i 1 xx , J 5 i fx V Xl i i 'N 1 ,X y X P X X i f X 4 x ,Vt Jdfxx x X l fx jk K Ti A f X Sigma Nu ii his 'sharp' group is the Sigma Nu Fraternity of Auburn University. lt includes such names as Codger, Bablin, Bull, YeeHaw, Gato, Spaceman, Ol'Boy, Gun Dawg, Hood, Thrill, Mo, Weave, Goose, Chap, Spike, Hark, Moose, Phildo, Wong, ET, C.C., Scruffy, Funbo, Dog, Cobra, Steak, Swag, and some others I'd rather not mention here. The same guys worked for the Auburn Generations Fund, underprivileged children, the Girls Ranch, the Elk's Club, All-Campus Fund and had several brothers in the SGA including the vice-president, Russell Kendrick, We have brothers in many fields ranging from agriculture to engineering to pre-med. Many people seem to think that 'frat guys' are drunken, preppy slobs who take six or seven years to get their business degrees. We feel that the people who believe this gross stereotype are ignorant, shortsighted and have never experienced what a genuine fraternity is. Sigma Nu Fraternity is home at Auburn for us and the brothers are friends which will remain so for a lifetime. We also have our fun. Our social calendar includes such events as Country Club, Luau, Christmas Auction, South of the Border Party, Winter Formal, Halloween Party, Fondle Florida, Jerk Georgia and socials with such themes as Mash, Punk Rock, Animal, Fantasy, Goodwill, 50's Rock'n Roll, Woodstock and Suppressed Desires. Some people recover from these parties immediatelyg some feel the effects for days but all have a good time. We are a diverse group but our feelings about Sigma Nu are the same - the best! - William B. Hopkins, Jr., Sigma Nu president. 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. it Mark Edwards Glen Allen Paul Woolard Mike Lawrence Gary Davis Chip Dillard David Turner Gary Davis Diggie Retief Bill Davidson Kile Milling Jon Coley Steve Weaver Al Leathers Bob Willifred Barry Blakely Charles Caldwell Scott White Phil Collins Carl Leary Tom Oliver Wally Walkr Bobby Gautier Geoff Taylor Bob Van Beber Glenn Reid Henry Drake Jimmy Gibson Mark Chambers Sam Weaver Bill Babcock Alan Bozeman Terry Bozeman Ray Cobb Carey Chandler Bubba Bill Wakefied Scott Burton Chip Thompson Mark Jackson 2 JOHN Darrell Simpson Todd Cheshire Bill Hadcock Russell Kendrick Mark Wyatt Bobby Simms Tim Bryant Mark Salter David Abel David Runyan David Wagnon Phil Thompson Mitch Moore Ellis Stitch Will Hopkins Chip Powell Arnal Page Scott White Tom Glanton Robert McDonald Robert Brown Jimbo Bouler Jimmy Mummert Chip Bates George Allen Anthony Hand Kevin Bice Billy Dowling Miguel DeLacer John Doe Brian Keeter Greg Heston Lane Dugger Brack Alford John Woodworth Warren Whitaker Cooper Mickle Don Harkleroad Steve May Stan Jaioks Chris Pike NOT PICTURED Ed Allen Greg Anderson Mike Baker Alan Boan Tom Chappell Mitt Connerly Kenny Cox Jim Duke Bruce Ferrell Lloyd Flood Bryan Flowers Eric Hamilton Scott Hill Carl Johnson John Kain Andy Kelly Andy McCorkle Buzz Miller David Morgan Johnny Page Robb Robb Mark Russell Robby Russell Steve Sahlman Bentley Sims Gary Smith Terry Smith Todd Smith Greg Smith James Speer Michael Sullivan Manly Swearingen Steve Thornton Dow Toole Mike Twiner Keith Waldrip William Watt John Weaver Kyle Collins Mike Cooper Will Dunn Steve Hill Rob Reid Keith Scott Scott Skoneki Jay Thomason Sigma Nu Sig Ep Flip Spann Zoomer Bill Blount David West Paul Burkholder Greg Schimdt Paul Sping Chris Upp Gary Johnson Joe Sala Dan Wright Steve Bar Wade Miller Gerald Hogue Chris Karabinos Lance Brown Emery Raulerson Robert Murphy Bill Alverson Steve Blount Barry Thomason Rob Simmons Russ Kennington Phil Paramore Robert Seaborn Don Lynn Hank Miller Phil Owen Joe McNeel Rick Salanitri Ken Tolar Charles Fuller Russel Moore Mike Elliott David Medford Marty Sellers Neill Lee Bobby Haack Hugh Miller Ken Wyatt Brooke Meadows Ken Cater Todd Smitherman Jim Ralph Doug Fraser 46. Carlos Wilkinson 47. Bob Kocher 48. Gil Gilmore 49. John Pascutti 50. Matt Flood 51. Tom Clement 52. Danny Jackson 53. Mike McDuttie 54. Albert Byrne 55. Les Seibert 56. Todd Sommers 57. Scott Page 58. Todd Livergood 59. Mike Howley 60. Hal Hester 61. Cran Upshaw 62. Joe Kelley 63. Neal Graft NOT PICTURED: Rick Allen Scott Arvin Brad Kennington Scott Helms Butch Lewis Martin Dutcher Tommy Byrd Jim Campolong Sam Cargo Scott Carter Mickey Lathem Sherwood Jones Tim Leigh John Miller Alan Mims Andy Morris Cal Munroe Bobby Nix Mark O'Mary Chip Patterson Brian Sage Chip Smallwood Scott Stewart John Uhlin Phillip Davis Tom Driver Tommy Fickling Mark Foshee Robin Foshee Bob Freeman Mark Fricke Kirk Garner David Gillespie Brent Harper Grant Haygood Karim Huneidi Don Kayler Mark Loveless Kevin Woods Scott Montgomery Jett Mullins Richard Norris Marshall Poole Andy Sforzini Ken Stephens Wayne Strother Craig Struthers Dave Upshaw Cran Upshaw Jody Wakefield Mark Warren Tim Watford Kam Wells Brian Hare Kevin McKarthy Kent Woodham Paul Zimlich 'iii 'gal sswlalsszt. . 8' Q 5 xitwwil' M S wir, 6 irwtllil Gi ounded at Auburn on November 7, 1907, Alabama Alpha chapter of Sigma Phi Epsilon is one of the largest chapters on the campus Qeven though half of the brothers did not show up for the group picturel. Sig Ep proudly displays the All Sports Trophy that they won last year. Sig Eps are also involved as cheerleaders, senators, UPC chairmen, and Plainsmen. Nationally, Alabama Alpha has won three Buchanan Cups recognizing outstanding chapters. The year was highlighted with Saloon Express with Alpha Delta Pi sorority, and winter formal in Boone, North Carolina. We ended the year with A-Day celebration, house party, and Waikki Week. - by Bill Blount, Sigma Phi Epsilon president. Sig Ep 378 iffezswzesw Q www . vt, i 'Erie F 4532323 ,mi J . , Ji aww, sw gfiy tg ygzaatiwrggi is as 1 4: 4 giiwifftfsg W2 we 5gS.2+4g.imV9 fe Steve Smith Kevin Kollman Jim Johnston Mike Martin Kurt Botjer Joe Daly Fuller Mitchim Dave Verner Don Searey Mike Bee Lance Richard Scott Roman Keith DeVault Jim Bachler Mike Street Evan Mooldyk Greg Purtill Rob Colville Steve McDonna Bill Dykes Joe Foley Mark Fletcher Tim Nolen Herb Hanlon Scott Elmore Scott MacArthur Joe Hall Mike Clement Chris Niggler Bob Coffman Herbert Bruce Kevin Nixon Rick Johnson Bobby Sedacca Ed Heitner Paul Dean Bobby Creel Mark Tinsley Chuck Hutchings Robert Minshull Tom O'Conner Greg Fike Jim Storey Bo Cain Rick Esposito John Colt Ken Wills Mike Hariord K. Richard E.T. Nevill Mike Laing John Kiedel Jim Thomlinson Kevin Clement Mike McLeod Pete Pacely Steve FOX John Rickley RSV l-O09 Mike May ,ms -iighf . - Teke 61. Paul Fields 62. David Kessler 63. Glenn Brown 64. Jim Davis 65. Royce Morris 66. AI Davis 67. Dave Roman Not Pictured: Jim Nesbitt Karl Keller John Berndsen Jeff Festor Martin Heffren Phillip Pettis Richard Shrove Bruce Cox Buddy Rawls Mwiiklill ii t was a very good year. From Speakeasy to the Miss Auburn Tan Contest to a strong finish in sports to again winning the Wreck-Tech float competition, the brothers of Tau Kappa Epsilon excelled in what ever challenge came their way. In recognition of these accomplishments, TKE International, with a larger number of chapters that any other fraternity in the country, bestowed upon the Auburn Tekes the award of 'Most improved Chapter.' The three principles of love, charity, and esteem have bound the members ot this international fraternity into a strong brotherhood, a bond that has produced leaders since before the turn of the century. Frater Ronald Reagan has often attributed much of his success to the virtues he learned as a brother in Tau Kappa Epsilon. TKE stands for men. lt will continue to promote its ideals and to produce leaders. Next year will be a very good year. - by Kevin Koilman, Tau Kappa Epsilon president Teke Q f aqiiiisfai iii? ' lii iiii ii N. N I G Q' urphy's Law: If anything can go wrong, it will. This cliche often proves true when more than 100 girls get together. Several incidents stand out in my mind, and here are just a few: During pledge formal in Montgomery, before boarding the riverboat, there were about 28 people who were about to miss the boat because their food was late. l was one ot those 28, and as president, I was elected to swallow my food whole while trying to catch the boat in order to request that the captain wait for the other 26 people. Another incident occurred just before rush began when the electricity went otf in the early morning hours. By some miracle, I woke up and realized what had happened and set a non-electric alarm clock. Then there was the worry that other sisters might miss a big day because of awakening late. Next come the smaller problems. For instance, running late for chapter meeting and the phone is ringing off the hookg playing an intramural sport and the last person has not shown up, a popular soap opera being interrupted by a nationwide special report. Some of these incidents are less dramatic than others, but in the end they worked out for the best. Maybe it's these experiences that have helped to bring us closer together. Whether we have laughed or cried, we will remember them always. - by Laura Williamson, president Zeta Tau Alpha T X ff -r igz. Q-P A ...U 'T' 'ff' 2 ' -fd '1'-sf' 3 r WSW? ,QaQ'fa W2 5iw,,g g gig '-'-' :a .:' -:fa.:. 6- .:.3-g-g-g:g-g- .f: . - ::...a :- ---- Q W a sw wfwfw w a ,-vf?2-1 y3Zg'i3-R??'fEi3W?2'sli 5iY'M 'iff ' 361213 ,Sith E53 '35 rt K 3527313 :-::2.i: E:::IC:3 '? '5 Wifawggg ? g' -5 5. ' . Laura Williamson Anne Michaels Monique LeMaster Laurie O'Neil Wendy Graff Phyllis Schwartz Barbie McCool Kim Newberry Lisa Culwell Sue Damian Beverly Cochran Christie Lehman Kris Loewenthal Molly McGuire Debbie Schmitz Lynne Hopkins Ellen Harrison Ginger Beaupre Barbara Kucker Krista Thomas Sherry Sayers Pam Wilder Jan Phillips Gayle Barnett Lisa Miller Terri Jancaterino Angela Adan Shari Baroz Belinda Black 30, Tammy Harris Shirley Riley Karen Penniman Laurie Sansing Janet Kelly Beth Henghold Mary Stone Allen Lisa Wigelsworth Trisha Mills Lisa Stafford Liz Reese Melinda Green Karen Mills Debbie Howse Nancy Hurtord Camille Barnett Jill Roberson Laurie Varney Laura Connor Gina Brakefield Kathy Phillips Tina Brakefield Kim Allen Sara Butler Kelly Hunt Kathy Willice Stephanie Givens Kim Parsons Terrie VanCleave Not Pictured: Linda Alexander, Amy Allen, Joslyn Baker, Carrie Boyd, Snow Bradley, Amy Chavers, Brenda Colson, Teri Clark, Jolene Croasmun, Linda Day, Vanessa Dodge, Kathy Dye, Paige Goldsmith, Laura Gould, Pat Graff, Lori Graydon, Laurie Grisham, Natalee Hanner, Treva Harris, Katherine Henderson, Mary Hochreiter, Jana Holt, Mary Huber, Barbara Hughes, Heidi Johnson, Jan Kavookjian, Connie Kish, Karoline Kranert, Nancy Larison, Leesa Lovelady, Deborah Martin, Claire Matthews, Carla Moore, Paige Nunn, Bobbi Perry, Ginny Philllppi, Kathy Prewitt, Kim Register, Molly Saitta, Angie Smith, Sherri Stephens, Debbie Story, Diane Thomas, Jill Trayner, Jennifer Vaughn, Frances Wilson, Eischelle Allen, Charlene Anderson, Kim Bankston, Ruth Bayley, Emily Bentley, Linda Brown, Caren Cecil, Eileen Chocallo, Sallie Chuang, Cris Coble, Jennifer Cook, Beverly Copeland, Amanda Dicks, Tracy Dreesbach, Anita Ferraro, Cheryl Fortner, Susan Frampton, Chris Kish, Mary Mason, Marianne MoGarity, Missy Miller, Donna Mueller, Kim Newton, Jo Ellen Palmer, Patti Poole, Stacey Roberts, Lisa Ward, Lianne Webb, Sheila Williams. xg' I, -sg , Sq' S-5' . .sf fs ,Xp ya K g S ' 'STM g ., x W 0 X 1.3 , ,ti , go, fr X l fel! 'S Q Q V531 is. S ff , it -4 X M gmkffkis. it ff? ?WJ1H'1?' 5 ei Yugi' ww Q SAM S 2:11 Wires M W 252256 5555 Avi A 21557 M434 We . www f viii Dwarf' f-Wag 3 ze-ai QTL 71.8 ,M,a,,,,, wtgfizazff zmggzjffy-fi A at-Mi fd aw ,exwrf-,avi zmfttti mfs wasix, in ,ago We 2 1 ss? szagiizslsarssg 3221 aw A Q is-wt 3255221 Nfl, Zi be ww ws. Quai? M A'-AQ.. M, ,. , . in K .,,::s-wg, ,,,, ,l,, Mi l ,XL ,t ,. . N , 1.,.-,r -....4.......,.,,.. A . ,. 1 V, 2: bf! M si We V . W 1 K wvzzfwf S. s D T ' S .sst , Q.. K. -Q . -R t s1::i2 in - .- Q . ...,, u S . N , . . , .. . ,W -ffm I M 'T ,. f .Z.....a2r2r'. A - . -f I S ,'-- r ' sill W ,V M M. , , . ,J t ,. c . K' k'LL 'L wmwst tt iff ,, as f W W -4 W S , r, gat V r sa 'ixfmff wales S' amish ggi? ,. ' il? :-:2:::.E: .2525g-g,:j:.s22:25-5-.-5:2.:.'::i::: , .:5.-2: s tx .Musk ,Nik 3.513 wg 521:-szgiii 1a'2Mi2 wJfii2 25:5 'f Bw' Q, ff 'i'f'm,s ' ?', ,, 'Y M, ' , ,, ,, - ' f.:a: t.fs2r,iiizt:1sfs,s-, seem1s?Wwiy,es,zie2zagain:swzsfa:?:srim6?va?2ziSi3aZfas ?Qigmaaiggmsffm Zeta Tau Alpha Q Wi 'lil ' 1 ii ich in tradition, Chi chapter of Theta Chi Fraternity looks with foresight to the future and strives for excellence in the present. Superiority in scholarship, brotherhood and athletics are prevelant goals among our members. Scholastically, we are a consistent top 10 leader among social fraternities. Athletically, we lay claim to the 1982 League B Flunner-up All Sports Trophy. We received top billing in softball by winning the 1982 Fraternity Softball Championship. Socially, we teamed up with the Pi Beta Phi's to present one of the greatest all-campus fund raisers in Auburn history. We pay tribute to all brothers, but especially to Shug Jordan Chi chapter '32, who was recently inducted into the National Football Hall of Fame. With this proud heritage Theta Chi will continue to be a leader among fraternities. - by Jay Denney Theta Chi president 382 Theta cha Andy Pearson Kevin Robertson Brad Earnest Perry Pederson Kevin Marble Kevin Madigan Marvin Murray Bobby Schaal Gary Schaal Eric Higgins Bob Miller Jim Tierney Bee Conner Mike Brown Luke White Scott Redmon Jay Denney Gabe Fiestrepo Keith Lucas 20. Alan Wallace 21. John Pickert 22. Ron Cantrell 23. James Fowler 24. David Cowan 25. Clark Sanders 26. Jimmy Middlebrook 27. Don Metcalf NOT PICTURED Sam Fair Pete Kaiser Kevin Robertson Bob Miller Chris Conner Larry Christopher Mike Coussens Jeff Smith Jim Anderson Dave Gethers Bob Mueller Them cm 383 i W A ' gf-N 37. Herbert Wilson 38. Carlos Guiterrez 39. David Brothers 40. Sargeant Fair University Security Not Pictured: Thomas Fitzgibbon John Blalock Jim Zwaid George Tehan Reed Compton Russ Fleynolds Jake McWilliams Allen Warren Charles Freeman Steve Jordan it Aki w ill ii e normally aren't this vindictive at Theta Xi, but . . . When on a typical night like thlsg when we are all inside the house trying to do some serious studying and we hear of someone breaking rules right and left . . . For example, here where this campus security man obviously parked his vehicle on the wrong side of our basketball court, while under the influence, without proper decal, and in the middle of the night, we really must protest. Now our long-suffering president is compelled to issue the officer a citation that can only be appealed at the Theta Xi's next joint social with Tau Kappa Epsilon. For some reason, we really don't think that the officer should hold his breath. This is only one incident of the fun and crazy times we have here at the Theta Xi house. - Stan Whatley, Theta Xi president Theta Xi 386 :Fc .B N CRAIG SHIRLEY THE IFC OFFICERS, 1982 and 1983 ARE: TOP - BILL BLOUNT, DAVID DOLLIHITE, JIM KELLY, BOTTOM - TOM BATT, ANDY HILL, BEN ROEBUCK: NOT PICTUREDI BARRY MASK. ii n 1982, the Auburn lnterfraternity Council was recognized as one of the top 10 lFCs in the nation. This year the IFC was one of the most effective organizations on campus and accomplished this through good organization and strong leadership. The IFC initiated the Shug Jordan-Dean Cater Memorial Leukemia Fund, which receives the proceeds from Greek Week. The fall '82 fraternity rush saw an increase of 14 percent over the tall of 1981, despite a decrease of two percent in male enrollment. IFC expenses were also reduced by almost 20 percent, thus avoiding an increase in dues for 1982 - by Barry Mask, IFC president Front row, L-R: Marshall Ezell, Andy Pearson, Will Hopkins, John Hargrove Back Row, L-R: Ferdinand Williams, Matt Moore, Ed Healy, Ken Whidden, Jay Horton, Barry Thomasson, Ashley Hill, Stan Whatley, Bob Doyle, Mr. Grant Davis fAdviserJ, Jimmy Stubbs, Kevin Kollman, Bill Stewart, Steve Kelley, John Classe, Steve Settle, Joe Brown, Cory Thomas, Steve Hudson, Steve Slade, Peter Burnett :Fc 387 From L. to R, Amy Lummis tV.P.J Joy Loard tPres.t Allison Watkins fSec.l Ftolanda Wilson lTreas. not picturedl Ei fter having worked with Panhellenic as vice president and then as president, I have many special fand some embarrassingt memories that deserve sharing rather than sharing information on the basic facts about Panhellenic. Before I begin, let me say that being Panhellenic president breeds not only certain leadership qualities that I hope I have gained, but also an abundant supply of humility. Thank goodness I can chalk up some of the dumb things I'II reflect on for humility's sake rather than letting them have a permanent negative impact on my life - l'd be in big trouble if I let that happen. For instance, don't think I wasn't humbled and mortitied while bragging about Panhellenic achievements in front of 1,500 girls at Greek Convocation I exclaimed . . . land so as Auburn University has prospered and growed so has our president all day during rush, it was necessary to revise that role a little at night. Playing SWAT in the dorm halls with the vice president while the rushees were in rush counselor meetings seemed to be the perfect remedy. A special thanks to the rush counselors during Fall Rush 1982 who put their resources and talents together to entertain the rushees during the computer breakdown. I never realized we had such versatile rush counselors. These reflections represent only a tiny corner of my memory bank from the past two years with Panhellenic. There were many more special moments and quite a few more embarrassing ones. All of them, however, involve people who have become just as special in my life as the memories. - Panhellenic system.J At least I got a laugh out of them. by Joy Loard, president RUSH - What a week! After playing Panhellenic 5 ... ' if .T 'L , .g:g,, T K, SCRUGGS 388PanhcIIonic PANHELLENIC: Ust Flow L. to RJ Cindy Wagner, Sandy Mayfield, Paula Best, Fiegie Matthews, Joanna Haffner, Cathy Snow, Amy Gaddis, l2nd Bow L. to Rl Amy Lummis, Ann Moon, Cindy Standard, Betty Bealle, Amy Propst, Lee Lee Roberts, Joy Denton, Julie Bourassa, Jani Pipes, 13rd Flow L. to Rl Alyce Heggeman, Suzanne Lawrence, Laura Williamson, Sue Craig, Debbie Sconyers. Missy Harris, Laura Willoughby, Willola Ashley, Cherry West, Flolanda Wilson, Joy Loard. NOT PICTUBED: Alison Watkins, Patricia Besse, Brenda McWhorter, Vickie Henderson, Pam Moore, Jan Deaton. Craig Shirley PANHELLENIC lsitting L to BJ Carol Callahan, Juli Barnes, Natalie Rogers, Judy Buchanan, Cathy Strickland, Beth lstanding L ro BJ Margy Perry, Tammy Steadman, Karen Basberry, Loren Cambell, Ann Goodner, Gabrielle , Debbie Witman, Melinda Sconyers, Lori Salter, Martha Kelly, Emily Logan, Susan Grant, Brucie Jerkins. Pa hellenlc Honoraries Alpha Epsilon Delta ii lpha Epsilon Delta is a national honor society for pre-health students. The purpose of AED is threefold: lil to encourage and recognize scholastic excellence among students, l2l to provide activities for intellectual and professional advancement, and stimulation of its members, and 139 to provide a program of service to the campus including educational activities of benefit to non-members as well as members. -- by Dixon King Held Trips chairman Members: Flow 1: Doug Denison, Greg Hawkins, Connie Shih, Debbie Lockhart, Carole Skoneki, Kay Ellen Woods, Craig Miller, Waii l-lashimi Kim Veal. Row 2: Shari Thornton, Beth O'NeilL Susan Walker, Pam Costes, Susan Hughes, Tricia Appleton, Jeranne Muse, Jamer F Shikle, Bill Lester, Glenn Woods, Jon Waroj Leann J. Lessl, Kim Dean. Row 3: Don Cote, Laura l-lagooci Kim Franklin, Lane Cannon, Beth Bishop, Ben Walken Carl M. Adolsh, Renee Burdett, Richard Brown. Row 4: Niki Oquist, Dennis Woodling, Jeff Boilenbucher, Cary N. Sikox, Kenneth Prickett, Dixon King, Busty Hedgens, Frank Stevens, Richard Simpson, Gary Friesen, Bill Reynolds, Martin ihomley. 390 Alpha Epsilon Delta Officers, fright to leftj: Flow 1: Mrs. Lavonna McDaniel adviser, Leann J. Lessl, recording secretary' Benee Burdeit, presidentg Kay Ellen Woods, vice-president: Laurie Patrick, corresponding secretary, Susan Walker on- campus coordinator. Row 2: Dixon King, field trips chairman: Craig Miller, historian: Busty Hudgens. Band-AED chairman, Frank Stevens, advisen Mike Fox, Scalpel reportery Wes Smith, Martin Thomley, committee chairman. i Beta Alpha Psi ii eta Alpha Psi's purpose is to promote professionalism in accounting majors and to provide opportunities for selt- development and association among its members and practicing accountants. lt sponsors field trips to large accounting firms and industries, business meetings led by practicing accountants and an accounting colloquium which includes a barbecue and a golf tournament. A 3.00 GPA is required both in accounting and overall. - by Stephen Kruse, president Row 1: Paige Steelman, Sandra Lowe, administrative vice-president: Jennifer Edson, corresponding secretary' Paula Lamp, recording secretaryg Nancy Merritt, vice-president of pledges: Elisa Popejoy, Mary Jane lrrgang, vice- president of pledges: Kim Murray, Cindy Chittam, Martha Reiser, Terri Dooley. Row 2: Steven Glasscock, treasuren Sam Cargo, Scott Macarthur, Shelton Haynie, Tim Unger, Stephen Kruse, president' Francis Fernandez, James John, Bill Fielder, Tommy Tynes. Row 3: Dr. Gary Waters, Frank Dolbow Tommy lnzina, Connie Burgess, Teresa Vandegrift, Tricia Hubbard, Mary Vann, Cathy Eskem Kathy Williams, Christie Hayes, Lisa Gibbons, Kathy Burnette, Jane Gray, Paige Faulkner, Jan James. Row 4: Wayne BarUeld, Richard Gottstine, David Hagerla, Mark Hess, David Slessman, Brad Pendergrass, Susan Sasser, Robin McKinney, Beth Ann Blackman, Deborah Alien. Not pictured: Julie Arnold, Cathy Cave. aiu. HART Beta Alpha Psi 391 Honoraries Alpha Pi Mu n li lpha Pi Mu is the industrial it engineering honorary. During the year, its members work in conjunction, with AllE on .several projects including holding ia joint A annual banquet. To be eligible for . membership, a student must be ranked in , the upper one-fifth of the junior class, or in the upper one-third ofthe senior class and . l have at least a 3,0 GPA, Alpha Pi Mu tries A . to promote good engineering ideals and W W practice while acknowledging those .students who display academic excellence. - 5 A i 'by Lisa Hamilton, president Row 1: Tim Homan,ALaura Ward Maki McGuire, Deborah Bursa, Eng. council rep.: Dr: Tony S Smith, faculty advisen' Lisa Hamilton, president' Hose Chu, vice-president: Teresa Proohaska, Z secretary' Ginger Atwell treasurer,jLynn Pridgen, Jayvweatherforol 77m Cook, Row 2: James Pope, Melanie Herring, Ellen McElrath, Charles Gainen ,Jimmy Bass, Steve Smith, Chip Williams, Miriam McGhee, Amanda Brownlee, David G. Grlder, Row Wayne Merritt, Thomas Harris, Hank Millen Jeff Wilson, Stan Wise. i' i Z 392 Alpha Pi Mulltipha zera BFITZ Alp 612 Zeta E6 , lpha Zeta, founded at Ohio State University in11897, is the national honor fraternity for agriculture and was formed as a service fraternity for those students in agriculture. .TheAlabama chapter of Alpha Zeta was chartered at Auburn in 1941. The purpose ofthe chapter at Auburn ,is to be of service to the School of, Agriculture, forestry and biological sciences, the students and faculty ot.Auburn and the , , people of Lee County. The main projects of Alpha Zeta are to providethe students and the public with , gardenplots and to assist, with Ag Day in g the spring. - A g by Beth Sniden president Row I: Albert Culbreath, Elisa Sereciqni' chronioler, Pam Sumrali' Scribe, Mike Hensnawf' Heather Dawes. How Il: Beth Snider, Dana , W Robinson, Jane Nichoi Mary Alvis, Kathryn A V Morgan. Row ilk Perry Vance, Valery Lanham, 5 Kelley Black, Nm Williams, Lora Henry. Row IW Chris McBride, Sidney Bradford Paul Patterson, Alan Bugg. Row V: KennyiMoss, Sage Ralston, Doug Adams, Roger Nichols. Row VI: Albert l Culbreath, Thomas Moore, Art Glasgow. Row VII: . Glenn Wehtje, Roger Moore. .V xi Alpha tamaaa Delta honor society, recognizes high schoiastic achievement. The purpose is to promote scholastic achievement among Students in their firstwyear of college, and to assist them in developing meaningful goals toratheir L L tuturef Members haveattained a 3,5 GPA duringtrtheir first quarter or first year at Aubum.T'gg- L L e L L L g bygPidge Burt, president ' Alpha Lambda Defra ipha Lambda Detta, a freshman a L 1 Row 1: Wrginia Hayes, gfacuify adviserg Sylvia ' A yere, treasurer: Lynne Greco: Christine , t Hauswirth, Row 2: Ginger Baker, secretaryg Pidge Burr, president Danna Farmer, vice-presidentg' Sandy Brownf Lisa Ayersf Renee OfNeal,' Emily ' Leischuck, liaisonadviser. L L Alpha Lambda Delta 393 Honoraries . Eta Kappa Nu Gi J ta Kappa Nu is an electrical engineering honorary which acts as a J service organization. Each year thisggroup participates in campus activities including S Engineering Week, E-Day and community service for The Red Cross and East Alabama Shelter for Battered Women. As engineers, we feel it is our duty .and responsibility to better ourselves and our surroundings. The group ends each year E with a fun-filled picnics for both students and faculty. ,-- .,p r g gi by Wctor DeBrunnen president Flow 1: Wctor DeBrunnen president Gene Eokman, ,vice-president. Row 2: Bruce Harvey E corresponding secretary' Roger Whitson, f Q' w engineering council frepfesentativeg .Rhoda Green, reoordingseoretaryp Alex Luttrell bridge t correspondent: Lrgon WllliamspRow 3: Rodney r Stewart, James H. Alton IL Linda. Sumners, Scott Olson, GHve.Daniels, Scott Clayton, Jerry.Harz5 Row 4: David Sandberg, Scott Mabee, Daniel - Posey Steve Chubb, Kevin Hodges. Leigh y Reynolds, Steve. Pesto. Row 5: Pnilm Metzger: Sieve Hunten John MoCune, Nancy Neeloi Wok! Sandberg, Robert Mathlson, Clifton Gilmore. Row 6: Wadeworlev Tom .Whaley James Packen Jack Hgh, Than Jaw Yu, Anne Hines Bruce' ' Bowers. Row 7: Professor if Nelson, Advison 'Nm Johnson. 4 Eta Mu Sigma iii society for aviation management students and was founded at Auburn in 1978. in the past year, Eta Mu Sigma has established chapters at two otheriuniversities with the eventual goal of becoming a national honorary. Scholastic excellence is the major requirement for membership: juniors must achieve a 3.3 GPA and seniors must maintain a 3.0. Each quarter we initiate new members, andewe have a banquet to honor our graduating seniors. - ta Mu Sigma ist the only honor by Julie Lunsetten president Row 1: Jay Dennev secrelaryftreasurerg Julie Lunsetter, presidentf Greg Rachel vice president Prof A.W Callan, adviser. Row 2: Brian Petrovioh, Dale Benedict, John Stein. Row 3: Bob Bowers, Greg Johnson. Not Pictured: Ron Sarto, Mark Enzon Don Kayler, David Russell. 394 Eta Kappa Nu!Eta Mu Sigma 'UM -If rw, Q53 K' sly . N rl' DELAINAIPANKEY K -1 FAOM ii t A y arnma Lamda Omicron Mu was formed six years ago with the intent of giving at least some recognition to the poor souls who devote all their spare time to creating the official publication ot the . organization '-- the GLOMERATA. The honorary strives to achieve excellence in recreating a year of Auburn history while maintaining some degree ot sanity. Class attendance and a GPA are optional. Chapter meetings are held Tuesdays at 6 p.m. with mandatory attendance. Activities include Deadline Socials and Winter Formal at the lucrative Limelight in Atlanta. - A by Lisa West . y g Student Life - Events Bow 1: Mom, Beauty's Beauty Hairy, Raggedy Ann, Lustfs Love, 'Calendar Gini Glenn Glom, Where's who? Row 2: Starlet Bunny Muffins, I just showed up for the picture, Nggen Ellie, Lust Efiie Kit Darling Darylv E 71, Buzz. Row 3: Ernest Angsley Jr., ' Lady DL Bunny Fu Fu. . Spadette, Athletic Supporten Suzy, Marion Andretti Ebony Editon Row 4: Photo, Jim BuntBun, Sue's Replacement. Not Pictured: Lynn Ann Palmeh Ben Fitzpatrick, Bob Gamble. Pershing Fiiiilesy g he National Society ot Pershing Rifles was founded in 1894 and is atri-service T and civilian honorary. Pershing Rifles act as the University's official color guard and drill e e team. They represent Auburn in parades and drill competitions throughout the southeastern states. - by Victor Mclnnis, commanding officer Row 1: L. Mclnnis, commander: E Labram, executive ofncer. Row 2: S. Kinman, P. Shublrri 71 Hughes. Row 3: D. Anderson, J. Lee, 71 Varn. Row 4: .L Shaven J. Cansler. Row 5: L. Burwell E Somih, Major A. Moore. rmrsrfpefshing arises 395 Shorts, Raggedy Andy, Slash, DLPGADTCEGOD, Honoraries Chi Epsilon ii i hi Epsilon, the civil engineering honorary, recognizes academic achievement in civil engineering and provides service to the community. Chi Epsilon also recognizes achievements made in the civil engineering field by alumni and community engineers through the initiation of chapter honor members. Any civil engineering student who is in the upper one-sixth of the junior class or the upper one-third of the senior class is eligible tor membership. - by Michael Irwin, president, Row 1: Michael McLean, Farhad All Farhanrl Fiaymond Moore, faculty adviser: Oktay Guven, Michael Irwin, president John Bough, John Nichols, Lloyd Pitts, vice president. Row 2: Michael Stonen treasurerg William Blakney, Wally Jordan, A1 Gurlaskie, Nmothy Bradberry, E- council representative, Fiocky lung, Steve McAnalhf. Row 3: John Veillette, Barry Eady Frank McFadden, Robert Arnold Tom Dawson, Maria Sanders, Alan Carter. Row 4: J. Melville, E Harney, Will Flatt, C. Bell S. Paseur, B. Mowery. Row 5: John Carney ill, Bob Fant, Preston McGill Scott Kramer, Ronald Crocken Bob Vecellio, Tom Culpeppelg Frazier Parker. ' Delia Ornicron 396 Chi EpsilonfDelta Omicron' ii elta Omicron is a professional fraternity for women in music. its purpose is to encourage character, leadership and scholarship and to foster fellowship through music. Membership is open to music majors or minors with at least a 3.0 GPA. Delta Omioron's adviser is Nancy Vinson. Officers are: Laura Andrews, presidentg Jan Ziglar, ist vice president: Karla Loggins, 2nd vice presidentg Leigh Anne Chambliss, secretaryg Jennifer Hudson, treasurer: Leigh Ann Cutchins, director of music activities: and Lisa Spencer, chaplain. - by Laura Andrews, president Row 1: Karla Loggins, Laura Andrews, Susan D. Jones, Leigh Ann Cutchins. Row 2: Paula Pitts, Lisa D. Spencer, Robert Lauden D. O. beaug Melanie Townsend Tammy Jackson. Row 3: Melanie Adams, Teresa Yates, Robin McClurg, Lorie Jan Zglar, Susan llwlkinson. JOHN REED rvx I r'l 1 ounuuuo Phi Kappa Phi Phi Kappa Phi recognizes superior scholarship in all academic disciplines. Senior students and graduate students J in the upper tive percent of their class are eligible. ! is is ?- , ,aging .5 F I President, Joseph H. Yeager Vice President, Robert B. Rogow Secretary, A C. Cooper King A Treasurer, Dewey W. English Public Relations Officer, Grace P. Jones Marshall, Carolyn Lipscomb J immediate Past President, A Donald Y. Perkins Phi Kappa Phi initiates Donna Lynn Addison Neva Jane Aiken Carol Ann Akin Farhad Alifarhani Kathy LaRae Atkins Mike Allen Atkins Steven K. Atkins Lora Leita Bach Diane Elise Bagley Fairfield Tucker Bain Laurie Jo Baisch Pattie H. Barber Katherine Miriam Baringer Mark David Barnett Eric N. Barnhart Jean Cerise Beckett Rachel A. Berrey Marianna L. Bertucci Abhoyjit S. Bhown Sandra R. Bignell Jennifer M. Bishop John Charles Bishop Gregory G. Blanks h Patrick D. Boland John R. Booth, Ill David C. Bridges Kenneth Mack Bryan Elizabeth N. Burton Janet Eileen Bush, Cathryn Summerour Campbell J Sharon L. Carleton Ginger Lee Cates l Steven Leslie Caufield Leisa Chambless A Ann Charlton Sin Hock Cheah Julia S. Cheape i Betty Jean Commander William R. Corbett Walter Liston Corcoran, Jr. Ann E. Cornelison Cindy Lu Cornett Rachel Ann Cornwell Albert K. Culbreath . Kimberly Kyle Curley Gregory Bruce Daniel Susan Denise Dark James David Deerman . Deborah Anne Dick Dale.F. Dickens Leigh Ann Dilgard i Laura Ann DiMillo Lisa Jan Dingler J Gregory G. Drewhorn Claude H. Dungan, Jr. Teresa Esther Edge Mary Evelyn .Ellis A Vernelle Elmore Stephen E. Parish A Scott Allen Farrow A Robin Feldman Betty J. Fendleyi Nannie Ferguson . Norman George FitzrCoy Andrea B. Fleek Michele Floyd A Nannettee Marie Foglia Nancy Lynne Redding Fordham s Richard Lee Franklin h Harry Thomas Freeman Deborah Gail Garner C Edward G. Gibbons, Jr. Christie M. Glover Kimberley L. Goodson Patricia J. Graft . . Pamela G. Gray Emily Griffith T P Johanna Lee. Griffith ' A Garry K. Grooms J. Russ Gurley ' Margaret Hughes Hamm Gregory Joseph Harber Linda Clyde Harris Rebecca Kathleen Hassett' Robert I. Hawkins Tracy Hayes Dana Alice Heck P Cynthia Gail Henderson Mary Catherine Hernandez Ronna K. Hickman Anita K. I-light .l Edward P. Hill, IV Karen S. Hill A Katherine Goode Horky A Brian K. James , Calvin Matthews Johnson Paul Wilfred. Johnson P Lisa Ann Jonas li Marilut Jones Janet L. Jordan T J Lorenzo Marcos Juarez, Tasos Karathanasis Mansour Ali Khan A P Susan Rowland Kellerman Roas D.AKersh B Amy Williamson King Clayton A. King Robert D. King Z Charles Edward Kinzer 1 Mary Ellen Ball Kfinner Linda Alice Knight Kerry A. Knott 5 Michael P. Lakeman l Amy L. Lambert C Paula Jo.Lamp B W ' Lisa Mitchell Lassiter , Johnny Lee Latham ,Susan Lynn Lavin Frank E. Ledbetter,flIl Beth A. Lee Teresa Ann Leslie J Lisa Cates Loggins A Lee Mahavier . Barbara LynntMains Amy Lynn Marler A i ' Kimberly Kaye Mattern Sidney F. Mays Virginia G...McCarver A Randall Davis 'McCIanahan , Michael M. McCown . Kimberly A. McCoy ' P Virginia L. McGee. i i l Sandra Ann McKnight Robin Anne2McLendon Michael Padraig McLoughlin Raymond Anthony McManus, Lisa McQueen ' Wesley Patricia Merrell Claire B. Milton J, l Robert Haywood Moon Susan E. .Muller l i 'Joe D. Mynatt Sarah J. Myrick Kelly R. Nelson A Michael E. Nixon. Perry L. Oakes A Patrice S. O'Gwynn Julie Carol Olliff Christina Louise Dltinger Denise D.A0usley J Dawn Marie Page A. Alexandria Lin Palmer , Danny M. Parker Karen Elizabeth Patterson K James Andrew Perry, . . Sally E.1Pharr P P P P Pepper Denise Phillips Beverlye Nixon Pollard Kevin Stewart Price Robert Allen Price K P Patricia Leah Bassett,Quinley Russell ll. Riley W Carol Lynneilftoberts A J C Jeffery Dal Robinson Anne Carolyn Rocky y n 1 James Herbert Rogers Wyclitfe V. Ciountree, lll A Elirabeth Sahlie Cynthia Sanders P Ellen Pauline.Sanders is a Joel L. Schrader, , Amy Michele Shelley A James Rudolph Shelton Nicke K. Sivils , , i l Alicia L. Smith Patti Rhodes Snell ' Bradleyv. Spearing l Jodie Hele Starkel Linda A. Stevens A P Michael D. Stroup- Paul C. Stumb, Nancy Janeestumpft A Davis Lee Sullivan Carole A. Sweeney Carolyn Ann Tatum Tracey E., Taylor P Ann K. Thomas, 7 A Loveli Thomas L Frances Washington Thrower Henry Allen Torbert, Ill A f Jan' Mariel Turner Jerry L. Underwood' James Edwinsyvinson Susan Marion Von Brock l - Lori Mariewaddail C A Kathy Brwn Walker Timothy Todd .Ward W , Paula Watkins' J J Sara K. ,Weatherford 1 i Julie Leon Wetch Wentworth . 1 Stuart Martin Wentworth Cynthia.D.iWiginton 2 it ' is Jerry G. Williamson Q i Harold Andrew Wilson, Jr. Lisa Kay.Wright 2 ' J Mangg-Ling lNu,Yeh 1 Zwetko 2. Zekoff y if Phi Kappa Phi ,397 Lambda Sigma , ambda Sigma Society is a national honor society for sophomore college students. Lambda Sigma is an organization dedicated to the purposes ot fostering leadership, scholarship and fellowship among the sophomore class, ot promoting leadership among the freshmen, and ot serving the interests of the University in every way. - Honoraries Jon Uhlin president Lambda Sigma Society Row 1: Beth Woods, Patricia Vick, Rebecca Stover, Elizabeth Adams, Lynn Ann Palmer, Mary Ellen Huges. Row 2: Mary Allen Hamilton, Debbie Prewitt, Anne Bethone, Molly Lindsey, Claire Austin. Row 3: Sharon Collister, Robyn Perry Lisa Copeland, Elizabeth Decken Jerre Anne Williams. Row 4: Anne Mims, Tanya Crane, Deborah Martin, Tammy Saunders, Bess White. Row 5: David Taunton, John Uhlir, Mac Knox, Ted Warren, Mike Hill, Row 6: Omar Newman, Eddie Powell Marc Nay. Not Pictured: Mickey Lathem, Larry Parken Sonja Baucom, Barry Gardner. Beth Woods, secretary' John Uhllr, president,- Mary Allen Hamilton, treasurer, Rebecca Stover, vice-president. 398 Lambda sigma A: BFITZ Lambda Tau H ambda Tau is an honorary for outstanding students in medical technology who have completed one year and maintained a 2.5 overall average. The purposes of the club are to stimulate higher academic achievement and to help develop a professional character for this highly specialized vocation. -- Jeranne Muse, president Lambda Tau Row 1: Frank Thornasg Carol Cooper, secretaryg Howard Scott, vice-president' Jeranne Muse, president: Belinda Bishop, treasurerg Linda Green, historiang Renee Plumb. Row 2: Laura Pipping g Wanda Matthews: Carol Stewart: Jean Fells: Cam Foreman: Lezlee Lanier: Kara Overholtzer. Row 3: Lynne Koski' Bruce Briar Ken Crawforol' Kathy Kirbyg Peggy Preyg Valerie Hanks: Lynne Kennedyp Donna Hueltf Kelly'Patterson,' Allan Valaer. Omega Chi Epsilon ' mega Chi Epsilon is the national chemical engineering honor society which recognizes iuniors and seniors who have displayed academic excellence in chemical engineering. A 3.0 overall grade point average for seniors and a 3.25 for juniors is required for membership. The organization participates in Engineering Week by helping to prepare a display and by guiding tours through the laboratory facilities. It also provides information on graduate study in chemical engineering for interested students. - L Sharon Teate, secretary Omega Chi Epsilon Row 1: Sharon Teate, secretary' Susan Haakf ' Tim Nolan. Row 2: Tim Maloney' Barry Pike,- Fiichard Brown. Row 3: Tom Woody James Hood. Row 4: Julia Cook: Kim Yost: Wah Cheong: Jay Postlewaite. Row 5: Susan Gattls, treasuren' Gloria Garcia: John Ashley: Dr. Leo Hirlh. Row 6: Jim Turnen president: Brad Corson, Row 7: Joe Watkinsg Afsheen Khatami' Joe Parker: Tony Catanzaro. No! Pictured: Mary-Stone Alleng Wallace J. Bigler: Kelly Ellis: .Mary Fowler: Gerald McGlamery,' Brian McGuire: Scott Missildine: Patrick Pruittg Pam Rossp Don Littrel: Beverly Tannen Marty Conry' Sandrailf-toberts, vice- presidentf Stephen Mackeyy Gloria Garciag Danny Thompsong Jim Svachag Ben Harrison: Edward Hill Lambda TaulOrrega Chi Epsilon 3 9 Honoraries 400 Mortar Board , i ' ' L i Li LL , ,, A A L L ' L L L JOHN REED L i I Mortar oard Row 1: VKin1 Curley, Nancy Wfngo, Mary-Stone ,Qi , W , L ' i L Allen, Laura Wehrum, LeeLLee Fr'ooarls,,Julia . Umar Bogfd is 3 Senior hongrary Smith, Meg Wakefield Claire Hobs, Karen Lovoy Dell Barker, Rowi 2: Eddy South, Brenda Borgh, Odette Yeager, Jeri Pipes, Monique L 1 VanLandingham, Jani Pines, John Hargrove, 'Suzanne Lawrence, Bet.fy,Bealle,,Connie Delaney! f Fionna,Hib'kman, Ann Charlton, Vanessa Gilbert Nora Araujo, Lynn Campbell Row 3: Jeff L L Thomas, Clayton Edgar, Bill Alverson, Marty Conry David Vwlaon, Paul Roberts, William Moore. , W , that selects members at the end of their junior yearion the basis ot scholarship, leadership, and service. The organizations aim is to develop these prlnolples while striving for the betterment of the University and the community. L L L 'The spirit among the members is to provide a unique opportunity for a meaningful exchange ot ideas both . individually and as a group., Included in Mortar l3oard's activities are selling Homecoming mums, selecting two favorite teachers e quarter, endowing three scholarships, holding ia leadership L L Conference for freshmen andzrattling ott an autographed team ball duringttootball L , season. L- . L , L L L by Pau1Roberfs, president L i Q Mortar Board A L Omicron Delta Kappa I I micron Delta Kappa is a leadership fraternity which works for the betterment of Auburn by recognizing and rewarding' individuals of outstanding character. Character, which is manifested through conspicuous attainments in scholarship and high standards ot efficiency in collegiate activities, is honored through numerous awards or memberhsip in ODK. Traditional projects at Auburn are the ODK-Wilbur Hutsell Cake Race, the Miss Homecoming selection, presentation of the ODK-James Foy Sportsmanship Trophy to he winner of the Auburn-Alabama football ame and selection of Squires Honorary. These traditions and the accomplishments f past members provide a rich heritage for DK and for Auburn. - by John R Moore, president Raw 1: Laura Morgan, Laura Wehrum, Lisa Brockway Ronna Hickman, Mary Anne Dixon, Nancy Wingo, Jani Pipes, Susan Davis Jones, Lynda Denney, Amy Propet, LeeLee Roberts, Suzanne Lawrence, Row 2: Lynn Brown, Regina Bradford Linda Bridges, Martha Raiser, Mary Jane lrrgang, Lauri McGraw Anne Charlton, Jeri Pipes, Dell Barken Ann Hines, Russell Kendrick. Row 3: Grant Davis, adviser: Theron Cartor, Marty Conry, Mike Dobbs, Linda Hamilton, Connie Delaney, Vanessa Gilbert, Mary Monk, Lisa Hamilton, Tim Maloney. Row 4: Stan McDonald Rusty Smith, Jeff Thomas, Eddie South, John Hargrove, Greg Henderson, Clay Brown, Kim Overstreet, Monique Vanlandingham, Brenda Borgh, John Moore, president: Jim Gorrie, Row 5: Hector Liorrens, Scott Morris, Steven Baum, David Wilson, David Herrick, Don Cote, Paul Roberts, Greg Schmidt. Honorarles Omicron Nu act fi micron Nu is ia nationai ,honor society for outstanding students in home Q economics. Students who are in the upper it 10 percent oi the junior class or the upper 20 peroent of thegsenior class and have at ieastfa i3.0 GPA? are eligibleffhere are two initiations each year in addition to an annual freshman tea. - i ' by Danita Johnson, president Row 1: Hodgeebon Jolly .oaqrra Johnson, Susan Lowthen Kelbf Hnley. How 2: Betty Neel, Beige Talley, Carol Robbins Camp, Carol Pawloweki, - Beth Miller . Order Omega t he Order of Omegafis a national, ,Greek honorary designedto recognizeithose ,Greeks who have made outstanding O s .contributions to their respective chapter or to the Greekiife withingthe University. The Order is notdesigned toiirecognizegieaders who happen to be Greek, but to recognize Greek leaders. In the selection process, emphasiafisplaced upon the individuai's outstanding contributions to his chapter or to Greek life at Auburn. j g Omega's must be juniors or seniors who i exhibit ieadership, hard work or some viable force within their chapter, the IFC or Panheilenic. Greekweek 1983.wiIi be a joint project of the QFC, Panhelienio and members of the Order of Omega. - W i g yy by Jeff Sibley, president Shown in the Omega are: John Hargrove, Jl1l'LaWhead, Deanna Nelson, Ann Moon, Freida Sooggins, Agree Heggeman, Laura Vwlliamson, John Green Cynthia Wagner, BillfAlverson, Ann Hines, Jay Horton, treasurer Amy'Gaddis, vice president Jeff Sibley, president: Brian Sage, Amy Lummis, Gram' Davis, advisor Barry Mask, Lisa Hamilton, John Classe, Suzy Melo, Randy Spolten Brenda McWhorter, Emily Leischuok, advison' Wheeler Chapman, Evenrn Henry Mark Woooi Fernande Williams, Rolanda Wilson, Joy Loarq Paula Best, Allison Watkins, .Julie Bourassa, JoAnne Haffnen Rebecca Harrell and Russell Kendrick. Omicron NufOrder Of Omega L L ww mfm Honoraries Pi Mu Epsilon G6 J A i Mu Epsilon, the mathematics 1 honorary, was foundedat Auburn in 1954 A and requires a 3.0 GPA overall and in A 4 mathematics. Pi Mu Epsilonfworks toward .P furthering scholarship in mathematics at Auburn. Some of the programs that Pi Mu Epsilon sponsors are the spring quarter J i A Calculus Contest, a guideito Augurn's, math department and voluntary tutoring of MH 140-163 students. -- , y by Pat McLoughlin, Qpresident Row 1: Betty Flyberg, Sondra Mcwhorten Julie Ross. Lee Mahavien 2nd vice presidentg Jack Hgh, Eddie Jackson. Row 2: Dr. Steve Brown, Russell Propes, Theron Garten Steve Hunten Matthew L. Snook, treasurerfsecretary: David Evans, vice president: M, Padrais McLoughlin, presidentg Joseph W Chung Yu, Keith Moring. A i Pi Tau Sigma ii . 1 ,i Tau Sigma is the national mechanical engineering honorary fraternity and was formed in 1915 are The University ot illinois. The fraternity was established to form a closer bond ot fellowship between men and women in the mechanical . engineering profession andrto promote scholastic leadership as well. The Auburn Chi chapteriwas installed in 1940 with a desire to. promote scholarship, professionalism and a strong educational V program in mechanical engineering. With these. ideals, the chapter continues to serve the department ingmany areas. Pi Tau Sigma is active in the areas of tutoring, E- Day activities, scholastic awards, ASME and .social activities. f- 1 by Rod Summers, president , Row 1: Rod Sumners, president' Melanie Magee, James Mabe, Mguel Reznicek, Don McFarlan. Row 2: Opal Fenn, secretaryg Brad Cope, Lewis Wyatt Jr., Jim Creel Robert Towner. Row 3: Tom Hubberr. Row 4: Caro! Hardy, Joe Floss, Gary DiOrio, Lee Wallace, Gary Hall.VRow 5: Steven Morgan, Greg Monday Paul Norton, Scott Hayes. Row 8: Tim Flowers, Greg Nafi Robert Kochen Mark Harris, Scott Moody. Row 7: Mike Hamm, Fred Allen, Patrick Glynn, Duane Smith, Jedford Phillips. t y 1 404 Pi Mu Epsiionfpi Tau Sigma Phi Lambda Sigma ii hi Lambda Sigma is a pharmacy T honorary society. its purpose is to promote and recognize leadership and service in the field of pharmacy. The members of this organization mustrhave a 2.0 overall GPA and have completed three quarters in the School of Pharmacy. The national headquarters are at the Alpha chapter here at Auburn. Each tall, a homecoming reception is held at which the alumni are honored. The highlight of the year was when members attended the national convention in New Orleans. -- by Phillip Presley president Charles Darling, advlsen' Steve Harris, Pam Boyot Ruth Stanley, Phillip Presley, Connie Roebuck, Keith McWilliams, Linda Stievers, Jimmy Crump, Mary Martin, Christy Thomas. Phi Mu Alpha ii he primary purpose ot Phi Mu Alpha sinfonian is the promotion of music and matters pertinent to music. in order to realize this desired goal, they must depend on three powers: music powers, man powers and money powers. The membership implies the chapter belief that one possesses the qualities desirable in a sinfonian. A 2.0 GPA is required for membership in this honorary as well as determination and fortitude. The organization annually sponsors the American Cornposefs Festival. Row 1: Laura Andrews, Kyle Caldwell Aletha Mann. How 2: Phil Littrell, Alan Pate, Norma Fallen Steve Fleming, James Clayson. Row 3: Jeff Funderburk, Morris.Drlggers, Dwain S4 Tolbert, ' David D. Mann, Brian Elroci Phi Lambda ssgmalphi Mu Alpha 405 Honoraries Phi Psi K V 134 5 I A ,V I Y Jhi Psi is an organization createdito i promote excellenceandr fellowship among , textile students and the textile industry. 'Thisin year, Phi Psi held three meetings with its t alumni group and an open house for high school students. Phi Psi also hostsfthe gs meetingsigfor the Alahamajextile Operating Executives inthe fall and spring, Several l l fnembers attended the l national convention A at Clemson University. The highlight of each year is the honorary initiation of outstanding industrytexecutivesf' - t i g by? Greg Tarberg president QRqwy1: Phillip Tomlinson, Mike Stewart, Tiin Claybrook, Mley Morris, Calvin Smith, Mike i Hobbs. Raw 2: Hal Gibson, Mary Morris, 'A l Elizabeth Helton,iBonnie Wilson,iRegina Joinen Julie Turnen Carol Batchelor, Danna Farmer, ' f Joannadordah, Morris.Collins, Dinesh, Gupta. , Row 3:gJeff Alverson, Jeff Graham, Troy l Gresharn, Greg Tarven' John' Booth, Mack, Oliven Scott I-gale, Ricky, Cottle. . L '- ' Alpha xi , is gg i Alpha Xl is the national honorary it i traternityitor,tloricutture, landscape and ornamental horticulture. Students in these p t majors with as 2.8VGPA,and junioror senior i ,standing lareeiigible. The fraternity has l several activltiesfwhieh include, helping to W l tehost thetagriculture alumni for Roundup i f Day, organizing fall and spring induction y fbasquets, sponsoring intercollegiate flower- judgingand flower-design teams tooth going thisfyeaftoi Colorado State, Fort Collins, Cololphonorlng outstanding alumni and f horticulturists and hosting Agricultureylilay. is r The members raise money for their activities by raising and selling landscape plants each year. r,- sl , g g by Elisa .1 Serecmnl president ,t , Kathryn Morgan, Beth Sniden Paul Fl. Gowart, Heather Dawesjhistoriang- Elisa Serecgni president: Barry South, vice president: Deanna i , McCollum, tseoretaryp, Jeff1Slbley, Kenneth C. 4 -i Sanderson. K 406 Pnrpsilm Alpha xi ' l JCNNIFCH JUHND CRAIG SHIRLEY Pi ggi i . . . . ' ' i Lambda Theta is an honor and v -W professional association in education which , recognizes students otsuperior scholastic r achievement and high potential for professional leadership. Pi 'Laml:idaiTneta' L honors each initiate forhis orlher i Q L . cornmitmentto excellenceand expects f each member to participate actively inthe association throughout his career, Gamma Theta chapter of Pi Lambda Theta received g the gawardlfor the Best New Organization fon Campus. Mernbersare selected bytheiri L ' grade point average. -- f or i e i i ' i Q .W 5 by Beth lrWlloughby, president Raw11: Dn Thames Worden, adviserg Beth - . llwlloughby fpresident' Celeste Tuckerf Kristen Brice, publicity chairman: Mary Claire Robinson, treasures Shan Gamer, secretary' Dixie Eilrchneld, Laura' Rutland Lori Langston, MarthaLPrlolmore,, 2 Dianeflaileyg Ronald Muncy' Row 2: Lynne . Patrick, Mary Whitman, Evebrn Tuck, Deidre' i Speini vice president: Jan Goldmang Laurie Frantz, rIGrn Bridgesg Millie Elheredge, Micl1aellBradforoE . 'Da'vldfBass. 'Bow Ik Becky Ennis, Laurie y ,McKinney Denise Parkerfdoy Dentonftlulie V' Denton, Lenore Coopen Lana L4 Richey Myra M. Johnson, Beth Lessleyg Pam Maltbie. f r . 5 Pi Delta at an it W L . i Delta Phi is tne'nationallFrench i honor society organizedto recognize L students who excel in the study of French, i to promote interest in the French language r and to encourage fellowship amongyits 7 . mernbs-rsfThis year's activities included a Christmas party' with the otnertoreign language honoresocieties, Frencnand L Quebecois film festivals and a multi-L f disciplinary conference entitieciy Foreign it Languages and international Trade for a Better Alabama featuring illinois 4 W r L rCongressmaniPaul Simon as keynote y y speaker. -- i i ' L by Martha S. Aitken, president Raw 1: Cheryl Stringfellom Nancy Walken Demltrius Danley Linda Camp, CareyiTaylon Martha Aitken. Row 2: Robert Moore, Leslies Trowbridge, Jodi Nesmith, Cynthia Waver Barbara Woltnen Dawn- Naglen Tina Crocoo. f Pi'Lambda ThetalPi Delta Phi HOHOYBYIES nm chi ii M ho Chi, the national honor society tor pharmacy students, includes the top twenty percent of each class. A 3.00GPAiis required upon completion of three quarters of professional curriculum. Rho Chi l promotes the advancement of pharmaceutical sciences through the encouragement and recognition of sound scholarship. The organization has an annual awards banquet in the spring as well as an annual convention. - by Ruth Stanley, president Row 1: Linda Stevens, Jeannine Baskin, Sharon Knighton, Jim Thomison. Row Z Lisa Lassiter, .Connie Roebuck, Greg Berryhill Dr. C.K Born, Ruth Stanley 77m Boosen Susan Jones. Sigma Gamma Tau 6 6 igma Gamma Tau is the national honor 'society tor aerospace engineering. The society recognizes students and professionals who have, through scholarship, integrity and outstanding achievement, been a credit to their profession. The Auburn chapter sponsors scientific, professional and social activities each year. - by Andy Vlulliams, president Row 1: Ken Winfree, secretary' Robert E Taylor Jn, treasuren' Henry Freeman, E-councils representative' Barbara Howell, Maslafa Hashemikia. Rowi2: Dale Shelli Clay Pass, vice- presidentg ,Mark Edwards, Neil Martin, Jon Wolfe, Michael Tinker Row 3: Mike Kendrick, Mark Millen VWlli3m Swearengen, Andy Williams, president: Mark Driver, Dr. MA. Cutchins, faculty adviser: Dr FW Martin. Row 4: Brian Thompson, Flon Coggeshall Sam Fleming, Chris Hall Bruce K McLellan, J Michael Abernathy. 408 nm cnirslgma Gamma Tau ,... ,-N2 N4 f 14'-fl? wlff Wifi sigma oerra Pi cc - igma Delta Pi is a nationai honorary designed to recognize outstanding students of Spanish and to give them the opportunity to associate with others who share their D5 love of Spanish. The group sponsored Severallectures and presented Spanish film productions throughout the year while . striving to further the foreign language cause hefeat Auburn. - D by Rebecca Gulledge, president Row 1: Mrs. Escarpanten Clay Branum, secrelaryp Rebecca Gulledge, president: Jeff Faust, Marsha Asher, vice-president' Carl Johnson. How 2: Dr. Escarpanter, adviserg Monica Musick, Carol Nichols, Marla Vwlson, treasuren' Brandy Hibbarcl Dr, Glaze, advisen' .Janet Jackson, ,Judith Brier. 7 SigmaiiLambda Chi i Ei . . , igrria :Lambda Chi is a nationat honorary fraternity for building science g g students. Members must have completed two yearsgbotistudylwith an overall G.P.A. of 3.0eand demonstrateieadership in building science. This year it held orientation sooials for new members and sponsored the annual department offbuilding science recognition dinner at Montgomery. - g . byFClaytoniEdgars, pres. Row 1: Keith Hornsby vice-president: Glennu . ldmfan, Kerry Wilchen Stuart Millenilllrlike Propsi. BowA2rfStephenfStablen .Steve Gill Jeff White .secretary-treasurer? Drew S. While, Doug g Davidson, Clayton Edgar: president, Row 3: . gi'1.- 1 Lehmann Smith, Dang Norman, l?obert.aSharpe, Kevin Wicks. RUWF4: Michael Reardon, Steve Mann. r D- signal. Delta Pirsrgma Lambdeiflhi 409 Honoraries A fJon Kay' A 4 A M Patricia Vick Mickey Latham A, Student Government Associationfjr s Plainsman Assistant News Auburn University A iiihebecoa Stover A .N A 1-Editor Cheerleader ' Eddiei'PowelI Student Government Lee Gresham Lambda Sigma iViceSPresid,ent . . SGA Ott Campus Senator Association V 9 S A Annisrlliethune A mary Alleh Hamilton Mike Hecht College Republicans Vice-President 4eLA i 4Ar Lambdg Sigma Treasurer UPC Frlms Director A Squires i Squires A 4 quires is a iocai' honor society which recognizes outstandingisophomores. its 10 members arefselectediin the spring of their freshman yearn by the fmembersirof Omioron Delta Kappa on the basis of leadership in the areas ofgschoiarship, student govemme-nt,fathieticsgfstudents publications and other campus activities. To be chosen asia Squireisithe highest honor an Auburn sopnomoreijmayiaxiain. Thisgyear's i . coordinators for Squires were Mary Aiien Hamilton and Patricia Vick with DrQ Drew Fiagan aseifadviserfjl +- A , by Patricia Vick, co-coordinator Tm Sage' 42 Spades if A. o i . 4+ paces originated in 1915 when Left ro Flight: so Auburn men realized a need forian , A e f Rees William Waite, Edward Lamar South, Eobertg organization bringing together the most Maffffl C0004 William Qordongsodwin, Johns pfomil-,em and influential Students of the , William Hargroveglames' Russell Kendrick, James class and of the University? The .nameg ' Edward Kelly Jr, Clay Eugene Brown, Stanton j Spades was chosen because these students have served as instruments leading to the further development of Auburn A University. Wearing the spade symbolizes thehonor, character and tradition of A ll Auburn. i- i Preamble from 1915 Charter Howell Mcponalq Johrz,Gefy Hughes, Spedes Honoraries 412 rams Talons ii he Talons was established iast year as an honorary to encouragemschoiarship, leadership, citizenship and service among Auburn students and to recognize juniors who have exceiied in these areas. The group offers juniors an opportunity to share ideas and work toward common goals. The Talons pian to sponsor service projects both for the University and the community. - by Laurie McGraw member Members: Row 1: Susan Lytle, Jennifer Johnson, Lynn Pridgen, Karen Boettgen Susan Cox, Laura, Morgan, Dena Crews, Anne Rowland Ann Margaret Comy secretary. Row 2g Mary Louise Hemmeter, treasurerg Ellen Roberson, Caroi Skonekrl Terri Moore, Julie Woli Holly Harrison, Cindy Nabors, Sarah Mackey, Laurie McGraw Kathe Rogers, Lori Vaughn Flenee Carlanoi vice- presideni, Row 3: ,Andy Sforzini, president' Jeff Sibley Greg Schmidt, Neill Lee, Don Cote, 'Stephen Baum, Ken Guin, David Herrick, Jim Gorrie, Clay Brown, advisen Not Pictured: Barbara Boyett Lisa Brockway 'Debbie Byrd. ' Officers: Row 1: Connie Delaney student advison Mary Louise Hemmerer, treasurer? Renee Garland, vice president, Row 2: Clay Brown, student advisorg Andy Sforzini president Joseph Kicklrghten faculty advisor. Nor Pictured' Ann Margaret Conry, secretary- Dr. Pat Barnes, faculty advison Steerage ii s . . teerage is the Naval honorary at Auburn. Chartered in 1949. Steerage' l represents more than 30 years of proud Naval tradition. Consisting of Navy 'E midshipmeri and active-duty personnel, this honorary promotes the ,highest standards andlidealsfor which the U.S. Navy is l respected worldwide. Steerage helps ' prepare each of its members for a commission as an officer anda gentleman? W i by l2avicl.A, l1Wlson,,,vioe,president Row 1: Randy Payne, president: ,Scott Russell ,John Qietzeri, Lindy Kirkland Lt. Laubenthal adviser. Row 2: Joseph Coughlin, Karen Hoopes, r ,Eltin Currarrgglli Stephen Schiitman,tDavid Vwison, esquire. Noi' Picturech James Speer: Kevin Stanley. f .H S- Tau Dieltate, au,,Slgma Delta isfa national honor society for students in the departments of . architecture, landscape architecturej i industrial design and art. Members must N V havecompleted eight. quarterskot study and Emaintained a 'B' average and a record of superior scholastic achievement, -4- W A by Jay Thomson, president Row 1: Ericflsunoion, Daniel Kirchofi Jay W Thomson, Eric Swett. Row Z Walton onancey' Devin Moore5fBarry'iWorley4 Laura Lauderdale, . Joseph Aboujaoudei How 3:hMike Chapman, 'f John MoElveeog Gina Bake-15 Wm Andersong Gay Hoppenglohn McCormac. RowA4: Taylor. W. , Hostetteg Frank Crittenden, Darryl Mcoonarac Mark Sisk.' H K Steerage!Tau Sigrna Della Honoraries , ,. W -. .ammo M Nwsggt rs-, ,,,m,,,,, 'f:W'w:wwf'w'w,g,A,f WMM M swmf w,ya.gyf ef -we:-:ee . - --www -'-' 'v,mMx.-MMgg,3g,,e-Nmmatwmwa ,:v.s-awmwwfqybg-gfmmawva-we ANNA WY' A M s K 'wwefxmm M ' 12 gw wifi W mm M-My M-wa s A Wamego-We fees W ifam mfm f.:W w WW -- A f Q' .,.,.,. .... sf f.. KM W f gfffwwtwyf Hamm WW M W M www Howe-M wwf-Mfew55 'iLWl5aaaa 'Q Eg SQ, WW V X 2 t' ' fb if . ,ef -wyn-I t, ,,, V M33 ,g 4 t ,, ,Q Im my W sf W r-:L E-t 1 Wifi' fa 15,25 f W A wa t h s X Q t f R H ft E on at W at Q e f amtww Nga., Q 4 , . 5 mg a , W,e3.f1gg Q ..,,.... W . 525 ., ..- I -5 52515-,g1T '. 's ,gist its ff' . b as is at ' NS We . '.: -ari a 51SH'f s.1: ZrZ ': Z'.EsE Ef1 Q4 5 wa Q, on - L EM . V ff. Y QA Z.. as .,.. A A Ragga ,.wses,igM 3 .-... .... - - s gg 1 3 ..., .A ,..., E ., ,, ,.,,. , M, My ?,y.1a,.,,:,Q,gs.s I ct. ta ,.,.,.,. , ., .... ...... . .. ...,. , , gt, . mm was . at ,. 3 4 , , Q gt, 2 N. gx we s a? sf sjfjtggrgy g,.,z,,.,gM,,3:t29,,,,,q,,,iggt,y M, ,gg 30 Nab 3 ,,t,fyg,,x y W 3 gavwtggq tg, ,,,, g a, Wiz We w as , JN S , gk 0 wb ,T 3, 5555 twig? fig gym Wm Q .f , A .6 .-f. .-.-f : 5-: . - : Wlgssxggit . A ii,gg5py75M3y?3gV 2w,,,?g,, ,w :,.-,-3 ,5-:,:, E E- .,,.. :?fr1g. .,.... .,., ? ., , ,,..,.., .,.. ,h. ..,. ,.,.,, . ,.,. ., ,Rig ,sf fi t. A ,gent Q 453' ,X Vg, .4 N f :...:: .. 0 i at as t at a s sa ---- 2 2 X 2Z.rsti:,:':g1 .,.,. , H, ,, -9-Er'-sit .2Er-5:2-5E:.i:.:',::f'f:-g:Ei-:5' .25 2 N -P i 1 ' 1 'f?!2:5fEI' 5'-if.-:i'. J - ' ' 5fI i k 7 -ff : ' -- 'Q , .,,g,g.,.v : -.:::.::...,.3, .,.: ,sas :S W5 ,wwgti ,, ..,.. Ei ,gy ...,. Www? ., ..ll..,. ....+xk,,, tw? ie? Q 4 V5 W K was ,F X2 MEM ZS W Ng P' , .- .1 ---- - . ss.1. H. so N :vs tt.,,t ,.. -.2 f Nt, .. . ,.,., at 2555 35.2-2-.-'-2-2'I-' 4. gn, do N W' W ' fi 'Motif awww-ft5f'f Qizssf 5 ' :t.-'-' get gg .:-.2 .'a.,:,:g-,Lg - V .:-:-':a:.:Y2:s-g:gf.,g. ,- fffz Q EE' ,-,-,-- -g- :'- ::::jg:E'f?g1::-3: - -a: :E-1-: 3 g 3515- - -j- lg: 4. at ew ,.,. WT A W A 5 . g Fx 'S , .1 k it A 2 w et 1 W W it M XA f .4 f at X tl wtf f. at t L me Q G Q . ' t f 4, .2 X' S NVQ? i f 1 2 Xa '-ill 1 wx -W gg 'G K S at 'W '5 A' Wei M vw f 355, W Q of av as we at + V 533 we we f tt . ..... fi . e t K . ... f . . .... . as s. We ,twfkf ,, A ,,,,, . .- .. t 4 fs , ' N --q s, , 5' 956 ---. ..,.j-Q:-,:, : : g-,: 5: 5355-.:.K ::.:f.:,-fr .j.f5g:55:.-., -: .5..:'.g at . f:'., 3 - - :r--:I-' g. g:,. :,j - 5-51.22 ' ww :fig-j5g jf:3 .5-5.-.. , .:.::' .V., ,- , ,.,,,., ,.. , X. 5 - 5. . .... A f r s t , tgg ..., .:t- eg ii? lk, 4 it t W A N if be Q 1 vi ','PA' L J f it gal EJ so ,g f ...t F is M 5 J Q f rf , 1 I Q 22.1 .. . T '39 k ..... 4 wg M . .f . at. ,.. sg ,,,, We ,. gt?-.. , -' t Le- . ,,M., a if 'fa Q : - H 'sza-1:1 If - .:'r::r.. -: z--1 , s 'rar -:-::--.2.2:2 .-.-:5::::-.-: .-.- 1:-2:-I-'r Q gi s g . Wt ft :rg 355 55 1 -f' .f.f ,f sr :. flivi zii fz . - I 2- -.:.-. rr : - if aaa - A 'H Na gtk mm? at 5 s 5 vi Wee' SEQ T 5' tt vw 'f ,aff 23 1-We 2 Q T f M Z' 35, .-ffm H - U wiv ' 'wry new 5 M Emgiw? WW .f N 0 A ggi, Nm ww I x t. Q W: agua J X-PM K ff X 54, 2:35 ,fm 'Mft 'S SQ' wi iid A V- If 4 4 58 .W 1 5 ,f f as G H 4 v P' ff y , , V, q4x , y , , ,,,,, . ,, ,g , ,, , :a , , :,:,, ., b,. . .:.,., , , .. y , .,,, , ,,, 5 . y :,, , ,, , ,.,, , , ,, , y . ,,, , , ., , , , g ,M g . -r Wa stes at if at fe Q. fs at t ff it t or see W if to i.. ...... 4 X' ,, .... H A T V' as aaa? mv ?' v. MP2 .gif X 'M 3 The Army ROTC program at Auburn continues to flourish as it has for the past 60 years. With enrollment in all courses for the school year 1982-83 at 700 students, the military science department has had its best year ever in terms of providing informative, exciting instruction to all students at Auburn. While more than 100 students are taking advantage of the opportunity to pursue a commission as a second lieutenant in the Army upon their graduation from Auburn, five times that many are taking a look at the program through elective courses that get them out of the classroom and provide hands-on, interesting instruction in mountaineering, rifle and pistol marksmanship and the role and importance of the college-educated officer. Many of today's officers were once Auburn freshmen who took an ROTC course and found out that the Army would help defray the cost of their education and provide them with meaningful, challenging positions of responsibility after graduationsf' - by Major Moore Photos: Top: Chuck Knause, Eddie South, Sal Rodas, Eric Fox, Chuck Owen and Roger Moore. Center: Auburn cadets on a break during Leadership Lab. Bottom: Cadet Lynn Burwell points to an obstacle that Rebecca Crawford has to negotiate during off-campus training at Fort Benning. Clubs ,W ,: E. :5t: I-sri: if-a..5g:5fgg,f,,g2::aa:5:Eg:g gi 1.5--E-r:-,:E,,g. ,.,.,g5,3g5,-5-- .g,g1,:+ 5, ::.: ,,J tiwgia, ,affair Q Q Mjhwrwtm, .. Q 11 F if ,mam , p, si j tkgfwi fmt? wife, xF'5'r2.1E3i2Mf'ftt'YfW32'i 3l '?.g5.f':2twt 1321. M fem.. few, 1 A Q gf. ' S we 9 M. .. ,I 5 We 'E QW an Q3 mf fr MXN 2 2 tm? tr W ties were tw it Q W trretirfeiiwitt 'P' yi ,Sis S ga 3 ie? Mit at W Qrtw 5535235 Qlirg tt S ,,,,, tt' Qtr gw 2 Q. .. we W are 9 All H it 6. tt ,M in K A I -:I222i 's.5E':-2-5:I-1.2!-EAEEFEI' 22:1-H--:- :I2' 2 '51 'tw -ITP af w1gi5igQ35g2S'z,ml?S'1EP 'kqwJW'ftttwr.a ss3fvw: v?Q: r f W VMI 'WN' ire It t?3'iZ 'ti Tm nfrfgwwaiw rf H522.Sita2:33261fsxiiifwimwffkitzefwgf Wwisia PM M. G -:g5::',...-wr:,: -: -ia,-,:.,5.--,.i,g,.--.:1e:.a. :-:::-'f-,-:--.,.-.:.a .... 5 ,:,-:: .,.:.:. :Y -Ni? 3, ,,e.g,W ,fm Q mf Q gee' ,awgwcgwsfvfa - QQafl5?Sp.?zi,3Q H5228 M ' N -wr sewer: H Ms. X ft 'ww if fwfyrssyy s.QQ'MwsMs, A ?wfrwa2f?i? H, WMWQ wi Q M .4 tr H: Q A 3 :..-1.f:.- - s:e ytas,e,gi: mtgfcettgtu is rats effiwt M at ww: ff' r .:' it S tfiitgsgw in - a f 1 , 3mtf,5i?5 .6 M 5 Q? My: wp 3 if ..., f Erirriii' A fx g k E' A, 2 if in SEQ Evijw cl?? Q if its m?iSY.525iW ..,. AWN 1 t A Rs M: - 225255 . '5 E:s:5.5: A ' fztttifrffstf - ' 'G W' --.- 4 , .:'I'.'I ' New t 'S Q F5 4 .L my 9 V' fee H vi , . Afro American ,rig rg The Afro American Association is an organization that responsibility, administers activities to improve social and cultural life and promotes students' rights. The group fosters awareness ot the campus as well as in local, state, national and international communities. The organization promotes full cooperation between its members and other campus groups. - by Veronica Carpenten president Row 1: Mary Fl. McGowan, chaplain: Candace Moorer, executive secretary, Glinda Ware, recording secretary, T. Angela Smith, vice president: Veronica Carpenter, president. Row 2: Patricia Reese, Tina Sanders, Tracy Martin, treasurer: James Carpenter, parliamentarian, Roy Manning, advisor: Janice Davis, Lolita Evans, Sandra Johnson. Agricultural Communicators of Tomorrow helps to stimulate an interest in all fields of agricultural communication. Events for the year include selling plants and attending a national convention in Biloxi, Miss. The members also plan to enter a national critique contest in categories such as advertising, photography, features, news stories and radio spots. - by John Stevenson, president Ann Steinhilber, secretaryitreasurerg Letia Owens, vice president, RE. Stevenson, adviser, Ann Murphy, John Stevenson, president. Not Pictured: Dr. Jerry Brown, adviser. Clubs Society i promotes academic student's position on the , . ,N t . . . . ,Q at its its -Ni ,sg 555555359SteffawiwgftatBsefbziggeiziizmfgggffiagiisikstsfiit my ,152 ,, .W ws .fer Y W ft as ,ggi Q zstsrsettegsstgwrgk 4 sig M W Q ag.. 1 j:.::E.-:5':3 4 v s . - N , mwwm r we . f ,A M ,. wt . Q y New f... H 2 Jw- is t ,am W:.,.,.wf A Mears .fr ,, W ,ff mm Q- fr WE, Q FNS it A 1 -4 ' ' r ts gg 5- r . :ry s sirafwtfmk Q Gifsiiffq ti,riT'mTig 55 yi x'jgGg5a25E gimme ig ft? Sir tt My ffm :g mgiriitssitwgiitirriwgwe rszggsfsgzggggrrggggzwsgggaaa ftfwiafi , s -1 mfr NSY-at'33ss,5MeM:m,:r.wkwmw-gee....., ,wwssttggcm Wm ww sm wlswsm ,g,,r,. em M 0 my rw, sf W 5, Wwfvmsr: rsirwt, , S ffm si 2 5 5355? ,iittigsi Qgwggi Ssfaaisaiewxars srSSEWtWC'5ffZ5iZ5L?'901 W.fssfrszzafwilmfwwtesws'sswwgiw,.,, srimsismcs uzqrriggwrgrgw gswawwe me it W fafthfiigwrg iss wx tml :ww MSstfzwfrfitsiiwiifwrfgffsssirzgpfgggJzf,:'2s:tz5q,S. gn alfa sign ,wa Q? 5 ti' ?g1,.?i??E?fFi3ii,.E? .Q if ss. Q. .aifis rif.? ,.sr?t: M. Am., , , . , , A Q, f mkaif l wsgggegfr szi w s iiz t tsi s m f zxiib ssif fifxzi ..:::-:-:-:':- , .g . aww' A.C.T. RICK HOLL J' MIKE WEEKS .aj M -frn :sif2:s5a :Il 2.'I .,.........,,,. . . 'A V , ' M M 'J 4, ' M K '::: ::-,' .,...' .0155 : . . , . ,,. --i if mf PM .fc fe S: H . . . i iw, H N mm ,. W. .ww sg altmml W im ,ii i D .- ,... , Ih' ' L l Wefgum ' moi : MM sV W MM:-FM ' ': 'msn M., mu ., ., .f,: ummm M . M Mmm Mi jmm Y W my 'ma-NTWWH Nfl, .wif Y 7 :gi :::::: fi gg V, -M Www MW 1 W .- .,.,.,. Www W' ' New W W ' .,:.,:: :,-,:- ...., M ' M ---T .,.,,..,-., f .-v-..'-,.,u- : . A on T sj f me TT - -Q -Q , Q,2. .2,.. ,,,, ., ZZZ , er' - 1 Q .sr N: F - 5? fm ' uA, A rm, . V 'Elf 5: R W w Aqllbl G: bllal ..,:. W Wi-W Eg W V' -mm -. T W- .,.. .1.,..V.. ,.x. -- .:Vv.. H ' , M , ' A T 1 I . ff' ' W- .. -:,-1:',:,. ...,..- . ..,,,, ., ,,., W. ' I Ii. ....,.. Ziff ztii ,:.V --v:------- Ll Zzi ' 1 ' if 'Z' ' ' .,..... i n ..,. . aw- it ,, -:2:- , ':'Z'V:b ,zz T. ,.,..e Agrict. iure Council The Agriculture Council consists of two representatives from each of 16 agriculture- related clubs at Auburn. The student president, vice-president and senator for the School of Agriculture serve as officers of Ag Council. The council strives to promote unity and interest in agriculture affairs. Projects include the annual Fall Roundup, Ag Alumni Day, an Ag Hill Beautification Project and Ag, Home Ec, Vet Med Day which prompts 2,500 high school students to visit our campus. Advisers are Bill Alverson, dean's office, and Dr. Bill Hardy, Ag Economics. by Jeff Sibley, president Row 1: Jeff Sibley, president: Eddie Carlson, vice-president: Ann Steinhilber, ag hostess: Nancy Ozment, ag hostess: Russell Miller, ag senator: Dr. Bill Hardy, adviser: Mr. Bill Alverson, junior adviser. Row 2: Paul R. Cowart: Tom Bass: Bob Hill: Shane Ford: Eric Searcy. Row 3: Dave Logan, president of Marine Biological Society: Daniel Hargrove: Sage Flalston: Brian Gamble: Barry South: Elisa Serecigni. Row 4: Tom Mathews: Bill Sutton: Luanne Payne: Malcomb Pegues: Stacy Norwood. Row 5: Stephen Cobb: Marie Keri: Tony Watkins: Emmett Heard. Row 6: Mary Beth Hayes: Natalie McMillan: Laura Park: Kris Turnbull: Terry Carroll: Dwain S. Tolbert: Donna Goodchild. JOHN neeo clubs 417 A. tzmjwwti f. ,.... ,.,,.i: 'l-L:-M41 ezszsjmrrvmfs may-155115 m e i it M . ,X W femw' ,,.,i - '- 4 : 5 ,wx rf-:We m ise .:-r:-:- Mmaag tmiamw: wg lfwgemw .... - , W X M. .A wmrmwc ---- A . W?'Q'3YMm1 irww vsweefwvm W ww Mwzzs iw-ef V sw N - . we. tm ge? .:..:.:.:.: .:-l:-:-:Q-:... .... . .... . fe' ymvstw- . ...:s' -:z-t-: 732' M5 -M X i 5: 2I,.. :tizzai ' UQ . :'.::::.:- 1 as i :::s- -'-'-' I - -: ---- ---- , , . ft , amgggww . if mggwm, ws, me-vw:.,N5':N K - .,.. , t l mv ' f i Q 3 : E It , , 1 1 t iii - 1 ' Me :W entree -'-'r ff V - s ,gf .-asa-:vw ---- Z -1-:-.,.:.:.:,,, ., WM.as54+2-W fHL A e sw -.'. w it? 'Q 55-5?': f5-W f E M..A.. MMM M, , .:g'5:g:,,g-was ---- -g,:g-::g:- ga,-:g g-5:-1. . ,,,,, ,I::g.f:gg ,.:.,,:,J' , .,.,., , ':::::E: ---- :- '-'- 5 -- -. .,..:s:555gggf5-5--i. -:,,., 5:-ss: :egg -V - -:-5 W ..... : ...... - DOUG BRIFEON Agriculture Economics The Agricultural Economics Club is Row 1: Sally Smith, Mary Cox, Lynn Green, Kim formally called the Alabama Student Section YPHGS, L9Sli9 Thames, Alan Webb. Flow 2: ci ii-ie American Agricultuial Economic Luanne Payne, Ellen Elmore, Libbie Spears, Steve Association. The purpose of this organization is to stimulate scholastic and professional interest within the agricultural economics discipline. Membership is open to all students interested in economics, marketing or the enhancement of agriculture. Activities for the year included meetings with leaders in agriculture, field trips and related events. - by Steve Raby, president 418 ciuns Raby. Row 3: Jimmy Wendland, Edie Hester, Jane Nichol, Brenda Ross, Robbie Dunn. Row 4: Don Baker, Jeff Moore, Susan Perry, Scott Parten, Larry Hubbard. Row 5: Gregory Copeland, Mike Hill, Charles Rutledge, Gordon Fennel, Kenny A. Moss, Row 6: Paul Patterson, Mark Slay, Cecil Robbins, Dale Bennett. Row 7: Art Glasgow, Charlie Lokey, John Cook, Buster Padgett, Dr. Greg Hanson, adviserg Richard Holloway. Row 8: Arnold Woodham, Chuck Penry, Joel Farrow, Jeff Bull, Jeff Scarbrough. James Pratt, Sage Ralston. 0 'si B , '?'fg?525W5QA2W-if-sisezgmsazg'fsfggv sgwssgg: mg gf::e:?,.m'fi:fg it 5 , gave my 4 fir Witty: .ss 4 if ,gvw 5 f 1,3 , M ewfzsfss rf Jr 2 'iif5?fi?!srwN'f.::?:: if W .. Ss+,,irY35'g??5,vsgg5m?.fs 3i?s5i4?5-g'a33ei?S5g3t2fY?fiv55555555 fr le f S I A fb'-'52 4F3IVGf WFS? .-Q:'wSJhw.v.: Mein? fi ,,yv,g,,,, t,,, W :mg My my 3 weigh, 2235293 s:sfS:e2WaQs2i25' i :tg zrzmsy g U gssqgsgge ff7?f'3PiW5 Wrtww wt W we ,wtfgfwww W H H W fi , ., . , , , , .. 73959 ' ws . 555 '83 F553 fr N ew -I 4 2:: r 'Y ' WW Q , , , . , we is 2 ig? i A fr . , if ---- f I e s get T2 I ,. t ilt, J , 5 aft If J, .,1, . ., 5 , is Q sr, .gf . . .. , ffi,,,,,,,f, M, ,W , iw .,.,. if, ,,,,, gg? S, , ,nu j fr as in rig W if P t E, my tt eg ir he Q K, its ew g it R , get Meecsi, 2 wi wt... gt .- , Nw: t . fee, Q , . 4 A., t. .. , .. , ,.,w,.M Av twsifgys ew :misses ers:-wc:z.w3'5'zm:a N aam: www f H. I , V913 we N , -va if sis :wits ,se A-.. f ,,::N:gysaw? zwgegpge: aiigiilr ,ggiwf 'Z .fsgiit wssrgf? ,,wiXQs1-Qstiisszlfjgegfwlfsm ' jig? rw t' 0 it www :I rwin 'wef t 223:22 115,61 a re li Q se Wifi: f t Q 55:2 it fat fimgig Sgt , sififflia s fi if K 4 3 .ZW Zh, N., ik ,, M. , ,, Mpc, M at Q. , ge 95:5 .... M ,mp Q, ee ts 4,68 , .., St, stu Q itiiffzwr,ez:swlawfxiwsfgssaegflYsvfiilssiafzyyys- fgsyig .-..- Arfgilyt-es, W .,w, waz,S2gfw, . sfltfis wsrwsf view, ,wttfsfwfmiw . s,,ss.:,,w sf , . -R A .Q tv m- l s, ,1 tftwttf r 52 , :fs tw W., ew' : lr ff my WM, ' they Q Wssgggt 1: 2,3 Hg? git git 55 fn? tg iii, Q e :Q gg ,gig 4 ss, Vs gif 55? 'it ts 25535 3 t, H.. .Q,5a,, ,ct,,,,,,..,,. ,, ,W .t,,,,, :,.,'t ,,,,.,,,,. -.:. ,,,,,,,, .c,,,,,,t, :.,.,,, as, .-,. , W ...- , ,.,e,c. aw , 1, W fave ?afi5YEf3?EfIS5l?k?wg? wiwrsfssfsslziifrf was gl,,t,, pit Q 5? .I gigs? 1 gag yew if 'eggs :wry ici: New ,, we ,,5,,t-st s r Q etgxg, R J my 4 533 f A Egfr: :Q te? fuses? f fe. , f fs, W ii ?ig?Q3s iii f is af ef? ri fi A W 'fam Q - W If 5, 5:5 5,5 gifgfgtegg asset t ,. r we g we 1t'f1:m,,,?:,,q,s.,wf,f, MV, f its 55513 tgwvvzg it 23sy,,,,.? ... fsM,z,W.,,43jw. Lzf7?:rf?S'gw game wits fuse '-sssgmg .Qt mg .lv H .g my ,WM W wgwsfng ws ,vM2A,wfiw:,,sw M' me wg,,w5,g all Q ls .., f f.,.,ga-ft,g.v yfix, w.,,f,,Qf gcgsfil. 45,2 , gi, Q , fm, if 33359 ,. Mwgsfi as , , :'- -'::1:'::E,5 2f.:'.::::2f':::..:j-:- Z wtfwgis gggfgihjfietgfis Zfrwigfggff twegfikrfmifg 2 2 KIM-K , 1 Nw Nfetqls fgtvg Q? i 'Mgew?iStgi?5'fi if W yi? ?5,?i'fSQK gags ,Q mi ,writ 6 Skifltss EXW? ,X I ggi? E SM it 2 ggi ff N, he S X A mf' psi if Q if Q as Q i Q W my ,vt-ff G, if sw w .ss 3 it we it Af 0 f time 'QQ ,M 1,4 Z gt fi l ps? if! 7 9 Q sfggf ggi 5 W 5 ' W in A83 s3?IQtg'f fg vdjmgtrg Si 'wiifgm is yggfiissggafmgefgyjffi 351,33 33, ZGQQIE' qsggigzgff W riff, is EW? Sagem yur gf S Ii ggffigfggi M wif rig pa Q, we , 5 is ess: age-,,, Ness, W , ,saw 5 ,, 33 nfxfh z met ss , wr fl. gs M ,W www gw:azQt,,..gelwff es: - es nr ge tg Wtwfw ,, Q 6. , M 2 ri itiryga :tr 1 tzstgg, 'K t Q :Wiz , be , ifzsfffwrttf ' 4 ,iss :r a-' , MWA 38 -. .. A iw is N ,t tim? it ff, Sgxii-lgf w'M,wi,.5 at if 4 is 'Q' it 3' 'ff 'P v'?v:h'gf'1' W is 'I' i af' HQ wg' RH F Q itiagix f 'wi E32 wb? I yy ti? ,QW QI 43263 Vw '25 wig-Wi si EW tiki! 2 3 iw iQ?i film? 4? N SEQ FSA ei? tp H Q tv Jr 5329! .IW .,.A,. . :ez Q ight .2 My its ,ff Q J , iw? if? ,Q 'i lkmtw it Shri fidgets, says rv 2 t Jw Q ist, 2, ,W N Q ,F wwf w.f...,, V. - is W, me ew at M we ,ww swf :,,ffse.,f,,fv tt,-time vt . Q , ., ,, -, -X , M - 5:12 39205 50f1:1siwf':w Q55 'igtisfwf 'if-fmagf - 2535 2' A 5.59-f 0 59251 , ,,, DE ri -minima mzxgxm ii gb ex S ffzfiszwtif mi ' 2t,Wi:f'im H555 Mmw,r 6 nt' tr Z ,W W 0 3 ,-ff... fe 5 :- siege. .tier :msg M gales: Sf, ':'::- ef '-wi., Q , - ts - 5 .- 1 fir is t 3, if We S' W lt 8 tz,. . . , . sg 45 ii .J ,t,.t.....1i. f.,Q. ,3'fQs .J . is -'E 'IE: I AIAA The American institute of Aeronautics and Astronautics, AIAA, is an organization whose primary interest is the advancement of the aerospace profession. Some of the functions of the Auburn student branch of the AIAA are to offer members a chance to hear speakers from industry, to show aerospace-related films on a regular basis and to give interested students a chance to present technical papers at regional and national conferences. - by Brian Thompson, president Row 1: Eric Wietstruk, Brian Thompson, president, Dorothea Cates, Henry Freeman, Dianna Kerr, Barbara Howell, Ken Winfree. Row 2: Jamie Burnum, Stephen Hall, Clay Pass, Robert Taylor Jr., Sam Fleming, Mike Kendrick, Matthew Harlin. Row 3: Dale Shell, William Swearengen, Phillip Parker, Andy Williams, Mark Driver, Michael Tinker, Mark Miller, Jon Wolfe. Row 4: Dr. M,A. Cutchins, Fton Coggeshall, William Dlllo, Chris Hall, Bruce McLellan, T. Michael Abernathy. Alpha Eta Rho Alpha Eta Rho is an organization for those students interested in aviation management. The group promotes aviation in the community, as well as advancing the members' knowledge of aviation. - by Molly Brown, president Row 1: Alan MCG-ee, vice president, Carolyn Atkins, Molly Brown, president, Kim King, pledge trainerp Sally Sabot, Holly Roe, John McCalla, treasurer: Teri Godwin. Row 2: Todd Storey, Floss Schaffstall, Jay Denney, Julie Lunsetter, Steve Williams. Row 3: Hugh Muller, Bruce Ochandarena, Jim Gilmore, Ken Wyatt, Scott Barlan, Joe Nevill, Row 4: Fiichard A. Forster, Mike Regan, Jerry Dye, Tom Scolarici, Ned Linch, eu sciiueioea Clubs 419 .. -Q I Q me ..., . ,.,., ., ..,1.,.:..,: META 5 ::,,:,,7E.5:,5.,:, :i:.:,,,,?5.E:.,,.: MM em - , - N ig -:-'--,--:-:,-:-'-:i Ig, gE1g5:5:g1 5 f:gf: ,:.,:,,..,.,:, 5551: mg E kwwfmsg WP mmm --mm M ,M 2 .,..1, ,., EL . E? .,,:,,A,,A,,A.A, ,.,,.,,i.1., A,..:,.W ..... , , ..,,z:: 251251:2:2:::,:-:--:-,-V.-Q:.. . -'-2271 7 ' 2: EE, ,,.:.:f,s:g1p:f..1:2':2 --1 Y - F3552 ., 1H'f'-' :2:-1:1:'-:2':-f- HL... -' :4'1 .:.1,..,..:,:.. Q ,Q23 ' - ..:, .. -1: I ': w : :' : , if '1 ::fg12.fw:f' New ' ,-V -.,.,- 1 .,.,..:, 1 2 W ': 2 ' ,Q M isis, jmr,-4,-wim:g,.:QhMm !--- an :.i -PL1V:---V--- .,:,' ,.:,E .1:..,..E ZA1 'igi 2 ,AA, ' 'ffE iigii 2 :'.Qs 5f2:f2A25 e: r : , Z: 5:.,E 1 E ifgl .Q1ii1A1f12V:V.. ..,V:11:i:-.-1i5,2:.1Qf :LE 2,: '55 5 E'2 ':: '1' :' -: :.:f:A:1. Q Zji 5 g EZEE 'E'E' I ': ?f F :EQ252',EE1 Eg2EE,i.::. E H f':: f21A22'f2f2 2f'A1E'1f' :L2'2f2 1 .izzg :2 Zgli ,ZZI i,: fgigi Q ZQQI ff2- ,.,. f ,.-: :-'ff Qsifg :ffl Q'::i --:-1 1 -1-1212sf2Qfi2:2QQ 12 2-f'A1 1-'- -A-A 'A'22f'i 'h'2'1 2 2 1'f 2 f22i.2 Eisli 'A215112flf'EE':i 'lzlzffaiii 2 ff, E ., Ei -1 'WM B :EL Cobb, Arnie Cobb. Row 2: Terry Johnson, ' A bb-- F' Ti A F of E W .,...,,. A G -M, ...sf-M b ' 'M M , .,... T - , as-M .ar WWW--nj .:.. - fum., -'-- f:,fef'M2e'fm :::,y9-2i2'4f'S .. 'filimafwmmw 'M -A V- f obq- 'f----WWW : : ': 5 ':ZC::,:.'. :Lp .... :':H' i '1f w,,wT1 :, -:,: 2:.::E555i2:?5 .g- A .i ..., mxMx 'fv:F'W'M ..5, Witgfii ' '1 2 ...: zi, , fbl' 2 l .,.,.T,. L,, , .,A.., ms lim M . ,V.b 4 -or o ' T fffig ..v. .... . . f m Alpha Phi Omega National Service summer camp, has provided campus tours Fraternity has been continually serving the and has for 32 years operated a non-profit Auburn campus for the past 55 years. student book exchange. Alpha Phi Omega Founded on the principles of the Boy is also responsible for the care of Auburn's Scouts of America Oath and Law, the mascot, War Eagle V. The members ot chapter provides service to the nation, Delta Chapter of Alpha Phi Omega include community and to the campus. Delta sweetheart Debbie Dupree, brothers, I V 1 - - iv Al ar Chapter has assisted with the Red Cross pledges and little sisters. - p Q Blood Drive, has established the Dr. William E. Goslin Campership which sends scouts to by Alex Maynard, historian Row 1: Albert Mercer, Judi Geppert, Keri v . X' Lembke, Debbie Dupree, Susan Hale, Alex Watson, Joanna Jimmerson, B.J, Sutcliffe, David Maynard, Darlene Tinney, Carolyn Weise, Donald Scott, Laura Cole, Steve Sellers, Bill Boyett, Bill Lester, Adam Epstein, Cindy Wilson, Laura Lauderdale, Brian Franklin, Linda Maples, Becky Walley, Eric Smith, John McCune, Nathan Wallis, Robby Gulledge, Greg Whitfield, Alan Perfect, Jim McAlarney, Jim Maples, Kenny Jones. Row 3: Charlie McCall, Cathy Jackson, David Weise, Ken Broyles, Reggie Hall, Bob Ingram, Bliss Bailey, Mike Ziemba, Scott McKay, JOHN REED Williams, Not Pictured: Bill Sutton, Charlie Jacks, Mark Kolasinski, Paul Johnson, Gary Shelton, Omar Newman, Jon Overholtzer, Tim Pettibone, Huck Huddleston, Glenn Mizell, Jim Welch, Lynda Dobson, Darlene Wagner, Alison Beazley, Robert Bove, Huan Nguyen, Harlan Price, Pat Bryson, Tricia Bynum. Sandra Hardy, Judy Thomas, Tavie Schad, Marc 422 Clubs Jimmy Graves, Norman l-licks, Bob Lock, Wes ' - .... ' - - '------- W' f gyms-sssm rfrmfg W M e w ,... . ,-ew Wm :M-we awww .... ' WMEHSQM-W .... K S i 'W f i --.:,,. W g -.M ----- i e s --r-: -1 -:ti-, - fy. :'r.- 4 t,: 7 1' t -- i t ---- ' ---- fgiqggw - 5:53, P -:ia 5 i 5 : l g 11 ii - i , E f NT' ' Wgfml .,.. it KFMMM. tr if ' MSW QW mgwg at me ,::g Q5 .E',:r:E ., 1.,g1 :. 32? ,s it 'iii ,,-,- ' e was rf rf if i fiifg' I if 5 i t if 5 ff? 't h.,M,, .. . W itwwwmtu KMA ' 'I .,.,. 1 ' Xi if , 5 f g E , gg-Sgr: t in lt, s i? -:- r 3' it 5 :Qtr i -it l M. .... r umm. - f li ..,. me ' i rg . 1 vmwww sera.: ft: fggfgfaw .f :gr -ef!-25 A ,,,, .. E:-:mi-',.:q:' rg - -42: ------ , --' i 2 if-W: sr ' W--Wa, ., X... M a t M1275 fffffllfi li , VW. :iz A.Ws4.,ms .Wm W .i ffjjwjsg i f '---- --' . v.... American lhstitute Ot Architects The Student Chapter of the American Institute of Architects' first purpose is to act as student liaison to the professional practitioners. This is done through correspondence with the professional organization, attendance by students to the professional conferences and attendance by professionals to student conferences. Through these exchanges, the students hope to get a better feel of what they are about to thrust into upon graduation. Functions within the school include social activities, educational programs and community awareness. The AIA organizes in-house lectures utilizing both faculty and professionals. The chapter is also involved in activities to increase the awareness of Auburn to architectural and planning issues. Socially, the chapter's claim to fame is the annual Beaux Arts Ball, a campus-wide party to cap off Fine Arts Week in the spring. - by Robert Montgomery, president CRAIG YSWTIY Row 1: Bill Hines, Jeff Hudson, Nancy Armington, Bob Montgomery, Jim Albea, Otis Gatlin, Jeff Smith, Pigwell Holen Ill. Row 2: Bill Woodsmall, Mark Sisk, Donald Brown, Anne Jones, Philip McGrath, Tim Spafford, Patricia Dahn, Donald Bay. Row 3: Michael McVay, Cooper Pierce, Greg Parsons, Cathy Sullivan, David Tsreedlove, Lewis Godwin, John McCormac, Gay Hopper, David Bolott, Audrey Rogers, Bose Scott Long, Kevin Oualls. Row 4: Laurie Crowder, Jeff Weaver, Susan Mock. Row 5: Keith Starnes, Charles Gwathmey, Kevin Kayler, Jeff Winkle, F.L, Wright, A. Palladio, Jim Hunt, John Portman, Clubs ' ' -': Shel 1 'W -I-ma, ' w WfHMk :ffwe?aw1Wia :, WW+AMfM MvHff: Memewm-k-fmt :Wg V ' s2'W 'f'g 55ff ,?s'gaQffff5?5'iY5?'i2Ettt???5tttr:'?ePrff' t if T 'W V .-., f X mf Wi W 5 mt? if Ig If Qeigiiagreefwiffeitfseiz - are 2' t 2:r-.E Z:L::.il..5E. zwf2':fffm:..mS2t Wa is '- 1 - T -.-. a my ESE tiggitiwgigrgeggkwii Eiitz 53335 ei? v 2: 3 2Ii ' b,xW ' g3gi2?W79Z?!mZES2t5pi't5A.,s3S'5f-f'Q?3 K lie H -I-.:-fe:-::1 -2 ---- : :::i'5:..:-air:-:I r--- :::: ::?-2: ----- . E:2:- :.'E.::::-:. - W f1.fsWt2':g?7fef1?fZE5i:i wsrwfrii kxilgngiegfiwwm, - .2. : ek:::::::: ---- ::. :-: ------- SQLNSZSE ,wig W ge'?gyJUaf'??w?tiiW5s?55 - .: :I::'.f: x'N 125- ff Q tiiitsiiifiwsfeaszezrfwgweittWiistxtzdrffrfwgttf ':::s'2f? .::-:-:s 52'Ef2f.f2--iff? ff2:f2'ff f: 2rS f2'- :::-:ffm t fi if , .,,,L,..,v,.,. ,:,:,: .,::.:.,,.,., , .:,. ,,,,,,,,,, I .., , . ,,,,, ,,,,,,, . W: .... . ,,,. ,:,,,, ,x,, , . . ,.,,,.,.,, ,,, V M .,.,.,. . ,,,,,,,,,,,,,,,,,,.,,.,.,.,.,- .,..,. . ....,,. .,.. U Q .M V Q . , ,,.. , . .. We gi .-.-.- . ...-. V . : U . :Q ,ft - , r M mirfwyww-Ws.:1.' EEETEAW? QfSSwS'QQ5ig:,i:,2 fifiiigifvgrtig-2Sb wb :smea r is tz s fst wgefgefit. tj? f , Si9i:i:'wfi,'1m2-SLE? ' W :2:f:-Rt ',g:'52 36.3.1fi5:2If2: fl':' 1- ' :Www : -1 s- 5-5525 E2-!'2EI'5 N. M at f 'tl M iff' Hi S Tie ti H iwwf it 2212... 'aI:I:'.I: :':F'1i:2 - .2 ':.,: pi , Q-. 'eg its gated f ?9-Et'ixW'Mt2ofWif5555f?l55StfftG54 1--: :: : : :-: : ' tsattfgft Y ff?ig5kggi'Q5?'5X25s gSsMga4QE5Y5f? Qs mi Ssftgffgggm 'lggigigggtin tfSfft5t'f4.gsQQi1a?assi:rHvw 1 A-423:25 f' ou t 22 Sw me we Magid? Se EQX: tafwttfgiiffgigitiokfgf .,., Qgstggiisivggikw -Zigeifsiykgsifess W sswtaegzeiggts 2: ,Q 'fr SM figfiikf 'fgfiwifwf-f'?Q1fEtit ivgtfttftg sua -15252522 Vw Ei:2fStWeggw:2:Qgwixfw -': E:'-HE tssiest 5 get it wiggiiqiffwi :WZ ' mfg- Sfmt if:-2:-fa'5i'Ef?2: E'.-rib: ,:'.f: - 2: 2:' : '::xf 5i'i2-ti' -2 ::' ii: ' if 39 4 Sgtaigg? Eiiiwgmfi-3? 55WI5XS'2'22?5:sqw3Zfaif3?L?t1 P t'P H 3 5-if ' 'M' ft t' Xgigwgggwwmgm ' X gc t A EfEw2'NZX'3fM gwggfig We Wmmxig ,: - :-E5 . . fiilif:-: ' agwgig ' ::: : 1-:- -' -' eg g--: 35329 Qksmvw '355'55E iag,g lefpgifflw fi gsfavgjwffkfiidi :: ::E::..::--I: 5253 gtxfgistgg Q5 Sfeggfr ggi W5 'yS16f?if'.P Wie KW WWTW'-? S' m sr'-.ffr.'.zfr -: : :h -rf 9 mr? 1:-.:s on Mitsi f tts ft 2gig:,4gQ::29f3: seef2wgs5E:vs,yfE: eAS1ff:::ez:Eggt.,,, :' exegesis eggs ::,..:szQ,fE:wQwf Biigggttrpg K tm gg gtemfig? I 15.1 .,... . .-.-. , -- - :V-ff :.g:::.5t-:f fm--1 -t s. :EW 355- 'f f rfffff-:: : fist ::':::::- s-r -. .-.- .. PEE:- EE : wgrmrwn rmtaaiir Wiw ws fffm w QSM ': - gs-' I-2:22-s::: :: . .'.. .:-- 2:2:.-:EIQ2 :2-5:-e?:--is-5? i2'-2122-is .'2z-- if:-.2 2:: S' f 35-W if - : Z sa- .2 2?2-I-2 2:'2:':2 2 :: .... s l if 935935332 'iff 50 5962 ' '38'g ' ':Q ' : QQ -2.f2-'- 2.'I E2 .Ts Q f This organization is the chemical- engineering rnajor's connection to the American Institute of Chemical Engineers. The bi-monthly meetings feature guest speakers who provide current information about the chemical professional. In addition, several field trips were planned for members to see area plants. Besides being an organization with a professional aspect, members have club socials which give students a chance to make friends with fellow Chem-E maiorsf' - A.l.C.H.E. by Steve Mackey, president Clubs Row 1: Frances Scranton Ill, Doug Brinson, Rodney James, Betty Byberg, Charlene Moy, Brent Murray. Row 2: Mike McCormack, Roger Johnson, Susan l-laak, Lisa Adams, Linda Baker, Claire Hamner. Row 3: Keith Jones, Doug Aureo, Glenda Dean, Mark Gamel, Thomas Austin. Row 4: Alan Freeman, Pat Douglass, Lynn Elliott, Jeanie Mangum, Mark Whiteman. Row 5: Steve Mackey, Carlisle Herron, James Svacha, Chris Keaton, David Hendrixson, Sandra Bogers, Allen Gibbs. iiliii is E I I H W Vf.' ww-1 l l liillilil li I .-M..-..,... 'f ':.e.,,....1 if nn-mmmfuwmnquq nn.,- v-won ---N-v--1---nu'-ugtg...... --'v---v-an-q-g Q...-. .......,....-uuus'q-q- ...........-.uunnuqq you ---0-vnu-u-unuunqunuu ---uunnnn-nuunu can-1 su. 1 JOHN REED fs fr , Egg 'r ears tai my if V ,.,., - ...., is .-.. if ..,, . h Mig : ,I - -- 13:2 2:15 - .5f I2.r2 tI f ' . - -if '-.sf vsetiggscziggtgtzftiiiiiysaisfgiifiwW2 as P55551 fSQfmfr52v5QQtze Witt ,sts it W . ,:::.1-: ig ,gg-sssg,g ,: wew,ggfm5e35 we Aiszwvwwgii s, 5 my s 'sif we M sg w.xi:zfgiM,gg:,yisWQs 5523 gWg ,:,gwz,:a: 1- 5-mf. gg: ::..:-. .: : '-1.2:-:sf- - . i- '2f .. iii' :tsfezsx3 f:Q f5'??iWN imgtevgfgtgt si. Mfgiiif? -Sf:e,fz:2'W, .i'r?tff5'5Qfw5s'?w:QS Se g:- me -I V2 '-'ffi-sf s i - 23 5: 1- - 52525 -2 5? sr?552 5i :'-f f? 5.5fr asf' 4 i E :w s - i ff?-5 ' 5g i fif ii GSW stm ffgiwlf fi-2-2 ' fi-I MQ ---- zzeS??Qitievs psf ftsggzttftyi as aries sim ff.. use figseig zyssewiv 'iwswza t ??3ig:a we if im .- 5-2-.- -. .q.j:'g:g W - - .,,:. gf-at , :fi eg was asf? x'mv?wsgt?Wf:Zf55S45,,ws N3 itggeiwxfwiwtfs 30 sfwSf1g5gQ5 ii,5t,g-:-:- ,gggawwz :mm gygsqeegggxr omg? tQ2?':3g 91.5.35 gms Q: ,miwtgsgegw get t :...55,.,M it We -wg2,QW is ,nis san fit s f 't g 5i?5vt?fJi'tt f:f?f5 iszasigisfiff Ewggsfirzwf 3,1353 sits systs ? gvi?2ses, yggm, S559 zgwmsimeegg,e4sggQ5fsz5F:r:fffyisgmgwyyiww -es, sgggjwt J, :vsegist ,,,,., ---- J., , L TDVEEAIHA PANKEY V MSiAlME is a professional organization of metallurgists, metallurgical engineers and materials engineers. The student chapter of AIME at Auburn is involved in the ongoing research of material processes through participation in undergraduate research paper competition. On campus, the group is involved in many activities which include participating in E-Day and annual cookouts at the home of the faculty adviser on homecoming. The organization is also involved in current research with the most up-to-date equipment. - by Keith DeVauit, secretary Row 1: Pete Jemiang Glen Westrich, vice- presidentg David England, president, Lee Zock, treasurerg Keith DeVault, secretary. Row 2: Russ Chavers, Bill Lewey, Anthony Stone, Darrell Deweese, Dr. Bryan A. Chin. Row 3: Jim Cunningham, Mike Coussons, Jett Peters, American Society Of Agriculture Engineers JOHN REED ASAE is the professional society for agricultural and forest engineers. The Auburn student branch meets every other Monday at 7 p.m. in the Ag Engineering conference room. Activities include sponsoring a fall cookout, a spring picnic and the Ag Engineering spring awards banquet to recognize outstanding students and faculty members. - by Mary Anne Dixon, president Row 1: Dr. John Turner, Scott Carr, treasurer, Hal Wood, Alan Robbins, Danny Robinson, Charles Daniels, Bill Foshee, parliamentariang Tim Martin. Row 2: Mr. Jim Donald, Dr. Paul Turnquist, Dr. David Hill, John Deere, l.N. Harvester, Jett McDuggald, Chuck Vessels, Mike Chapman, Arlen Adams, Andy Smith, Tim Williams, Judy Hamman, secretaryg Mary Anne Dixon, presidentg Ward Pyron, Norman Stiegler, Phillip Edwards, Doug Evans, Peter Bilt, Alan Bugg, Tom Bass, Ag Council representativeg Lane Linton. Row 3: Wayne Fowler, vice-president, Greg Worley, Clay Peeke. Clubs 425 Tir iii?EL'-f5f!Ei1ffEf.5?f:L2?E555:55 E . . ,af: W ? :Q mf Sm 1' rs ZWAWWM' M wg 1 '-'-'i mmm Amiga H it 3 0 g 'V SMWQ was WWW WWW W5 Q - V fSm'2Sf 2,a. ,.,,,,,, .. ...... M W4 it ,Q MW X Hr Q 2 Q if Sf 1 ,ff , 7, 5 ::- --Q.-: : :.1 ------ - it sg if gg may is 4 Q :gs 5 fa 2 3 f 1 X x gs, an S9 Wm U, aww Wimx Q p k visf rf: V? Y rg e is 5 if A i??m gg Q WY? W We ay mg, 1' S4 Q iyyt gf rgex- 5EEi5X :.1:--235:-1:--2.2:-:Z::.: 2e::,:f.r:'y,:f.s -::z 3 Q. .. Q . Q 9. . V 5 'Gs 3 5 Y2W35w Q55 E5 1? WEE' 5' V it K gtg 3 535- 29 ft 'f,:+.:.--:-.sr -.--- 2- Qs 5 gg? Q Q W F W K' ks he ff' r f 'Rf f ft ..... ,... .... ,..... .. ..... , ..,, . ,.,.,. I A 5 X gi 5733 egg? Wag qw g ' my it :gk is Q9 gg swag Q3 n geget ...stiff my is.. t .r:: dir...-:Q fl NM, 5 : Ni. 1' K Kg? 25 Q if x 4 gk si? -Q -N' 535 A 23 it Qi tw Q3 ,2jr,..5,g, f H My k g ., ggtirgsfa TQ ., S 0, .. , 1,4 s 1? Sf? j :tc 1 W 3 9 s M.. .... , - fake I, .... .... ,. get ,, 535802984 55 25 sg: Y g fi 1225? - -'-' mf. 1-af -I-:ff .... ':-:E.:E:.E:::: ::-a- SW MMV SL vw' ig if '9 3 Y -Wg: 9' f , K V33 x iii? 2,5 25 2 gg st? 5 ix idk? gtg r r W Ev 5 ggi ,sr gms? A gg? 2? ti M er News 3 wr M it it tj ri kts M r W5 i W Egg frm 3, We ' Ft tf 2 trite sis t rv he 43 ttf .f 254215 ft? tv WWA w.fxi :425f M 1 rms is s 4 IA M tgtws wk-Eg' iw ,J 2 ASCEMWW The Auburn University Student Chapter of the American Society of Civil Engineers provides a forum through its bi-monthly technicaliprofessional programs to improve channels of communication between its members and members of the practicing civil engineering profession. The mixture of technical and professional topics is designed to acquaint civil engineering undergraduates with the economic, political, professional and legal problems associated with the profession and its practice. by Lloyd Pitts, president Row 1: Phil Littrell, Chuck Nygaard, Bobby Wesley, Joey Miller, Lloyd Pitts, Dennis Smith, Michael Barilone, John Nichols, Michael McLean, Tim Bardberry. Row 2: Jeff Walters, Scott Yost, Monty Hudson, Maria Sanders, Peggy Williams. Row 3: John Classe, Rusty Carbine, Chris Bell, Mike Stoner, Wellington Stevens Ill, Russell Green, Tom Dawson Jr., Ken Blackmon. Row 4: Habibollah Nassiri, Keith Matteson, Marvin Farmer, Rowland Lamb, Karen Clarke, David Reaves. Row 5: Mark Kolasinski, Lamar McKissack Jr., Bob Humphrey, Allan Sanchez, Rocky King. Row 6: Kirby McCrary, Harry Vice, Kyle Leach, Jeff Benefield, Robert Smith, Ronnie V Smith. ASPA The Auburn Student Chapter of the American Society for Personnel Administration is part of a national organization of more than 300 professional and students chapters. Membership consists of 15,000 persons with an interest in the personnel administration field. The purpose of the student chapter is to promote interest in and knowledge about the increasingly complex problems involving human relations in the workplace. These goals are achieved through semi-monthly meetings with qualified professionals in personnel or industrial relations fields and by subscriptions to professional publications. - by Tim Martin, president Cindy Barnett, Kathy Basile, Brad Burden, vice president of membership: Kelly Cashin, Lisa Christopher, secretary-treasurer: Susan Flach, Lynne Yowler, Lynn Gay, Dr, William F. Giles, faculty advisor: Margie Grimes, Cheryl Harve, Lisa Henry, Jennifer Johnson, Russell Lowrey, Michelle Martin, Tim Martin, president: Karen Miller, Walter Northcutt, vice president of membership, Ann Owens, Michelle St. Raymond. 426 Clubs ag, X it ggi iss f Q 33355 2 gs gm M ., fr Q. UN -J ,sy i f L mmweg ftgtt tssssssssgt. ,S its J gg, f ee if rig, resis t ' -'i-- f f or S tts ist r Mfr S Q Q L isis? se c see as ww if ss sr: is ss i . M, f G T 5 -- :tar . ...... aww , : -- .. J ,vs f - ., mww iv M .- m....,t. :W swfftfwgi 6 my A W Wm - - - -4 , -' . , . -'f NWf?. ,r .ew?M:lt me ,,.. . V N- azz: if r . . - : mfiaeatt wfgggiessaesgg - st A- 1 .... -,...,mz:w:-V-ww ' kwa-Nsatrgjxg-X - - r- 1,4 AM, A- Ax? .J uv' -V gg V, ra-. sa Q -K...-ai, 1 'r A ' ?..B.x,-N' g. X K rn-A Q., L 7,4 :K - --. 1, ,ri t , ., V' . ,,, X ' 1 .t . ' Este 5 -1. , ri ...tr , K r,1g,.y':.3.Hs,' W N. A ,- , F 1 r . M 45 Q The student chapter of the American Society of Landscape Architects, a relatively new organization at Auburn, is dedicated to passing on to its members a sense of commitment and responsibility to the land which they will need as tuture landscape architects. The contributions of present-day landscape architects are studied and brought into focus during an annual fall trip. ASLA's involvement in Fine Arts Week is Row 1: Leon Vignes, Dwayne Johnson, Judy Dickinson Beatty, Bon Huffman, Lillian Graves, Susan McMurry, Professor John F. Robinson, program chairman, Howell Beach. Row 2: Greg Nelson, Julie Harbarger, Tim Warzecha, Cindy Smith, secretaryg Chris Pugh, Laura Lauderdale. Row 3: Bill Youngblood, David Baker, Don Moats, Gay Grayson, Sandra Heaxt, Sam Barnett, presidentg Elizabeth Simpson, Wayne Lamar. Row 4: Tim Coughlin, Tina Parker, Horace Walpole, John Godwin, Marcus Jones, ASLA .pkg . A M. MCCRAY culminated in the construction of a lush Professor Michael LOYDGF- water garden in Dudley Hall's courtyard. by Sam Barnett, president clubs 427 :5i: I 9'5I-fl:-ii! ' 25'-iff- . 'i '- I : '-'-'- - 55:-21:-:.-5-ali---H 5:i--r'l- E.:. ' ' fI:I'I:I'I fII.I.IEI,. s GW -W3 N2if4'?: M5Rwi?b.ffv.'5vswS0WS1 me 'sw M Q 4 ,swwoisp 'ffl , as iz sw N. ml sf 'Z Wi? 342 , N 'W ' f'Lf i e 'Wi'c N'fcX 3fb M' 1J'aN'- sw 1 ' .IE5.f5 5-- .554-:ii-. 53 ' 'I2:53512f5?'5.i1Ei2555E'f5.Z me we Zgst '2 fiwfwa eig ------- f:.g.g- : Ws rfis if A Aw? wg gtiwwssgu grrffztlgigt-ig-,9gHEH3,figi4f-at s ff? g ,r ggttrszgg wf wnssgtwgt W tw : g: .g-,Z- -:g .g:-5 gust , Mvgjssgjtziztigigtaiifggtgt QQsgis iFgsgiigQ's,igQg3gf? 5,23g,i::1:gsg?grZvMg4+1555-M59Zs5isirTgdA.535Ava?zfZfatwf1.2'g22fS2M2322 fsggiivgggigiggsg as .- M Q X A2 M S is Eggisdfigmyfwiswdyzsktiwfgg sQbggaVZgMeG M g 1039 fggiwg Q Wg' gufftfvi 23 33153 9 Eggs? fm? sm Es F W ek we we my 'f f f :.'sf--22: t 'D QWWESW-GWV sewers may A fe H1 ifwmwsfw if rt 0 T uw vw ' 'ti fiizmcfsfv-2 rfsiwesfw Wm S- ff N's.'si's-, . sg' M . . 'iw ii :,.,:.:.: X .,., w Q Y 6,511 wr ,Ns izgmsw gigs si 1, 1 sm? Q3 Jim 'HQ W mi W 4.132 2,3 , 'SQSFSIQM W i Saw f 'Meg Q35 ffgfgww fgwm -,,gvxg1 w,,,s- H.,q,,mXA,,gg,,,, Ezjzwfssi, ' .- is ...., 1 g Q :fs st1,iW:f::fw:sff:. .,.::f:t,..- ww ruszswa wzsssazis.'sstwmszsfsg ,tw me 4 siwfa' Q W sgvtszs 1 vga wi' - easiest ssfeag1games:wvteiwrwsmtgsegm sixggigs 5 , fzfiwgszwzittssl efsnwswwe if:DressesQzsigzmsxsgwsw5:fMffz:2:2e.:1s:' sez' sis: Wtmszttte Q A WG? 'f f:.s:S': ':f:-::::-if . -:::a3:,:::5:,:ii--1,f':::.::,. 9 . -: :. :, rr. .. : - if: ' W t ' 33 ge 51 wfsgwggigssf A532 gargwgstrza csfass 5Wgszrsamizsgfzswfsuiaissfsuss .:.swgv,W ft.: Amt, wi A if i M ' ,f ti .. B.. if ggmegi,-fwsggs gg as ,E 5 . ite my Maw 4 swiss! e Qzgirmisvlsas 6. We 0-Q93 HS2'i2't fSf1's 'f 53 i.::1gE sissy' , it A S224 333.gif gg 2 si my Qlfgw ss: was ,. :ser fs if T : :a :EQ :- it i' . K E i1fvifi?.:fE5EEQ:E152t 235252 fag? t12'2iW2tw,5?5tf'W2i5ki tafgwfszigsaggiis? E tj... ,Gai it E221 'iii F:-512. ' Q ' mesggtlx W I emggsfgswsvgvg 855 gi? E mi is 1 55 Eggfgisvgfijiggi may avg me www J he Q: Y :fag E AWWA gitSeM3ES E M152 ragga Qtiitgvimmgga gg M yy 5. my 5 s snag 2, Q Q '. if . . 2 g 555:25 J ET W 'ik fi 3' E N? ggi ff Q WS 2 354 if X Ss is sims sas is ig 3 gx AQHA 3 .Q 5 Iillllfii . ,-1, gm Q .: .... T Q.: - as tw., me it mxifiiejg. .. gsgsgs0'5,SEz:f 352231 Qggwwq tg, ,gifs M as Q. JE w 23 , ,M were sr, g,wg,,..,gxg ,,,E..,,3 . 1 2552? ' ' at . fy Q ,gs A W 8:28 ww 3 k H W ,. up ggdgsg UN if Q Amt! . Q XV., V, , ,Wmg ,www Q54 .QQ Q if ,Z A, gpg :see Q gags ti Q s 5 ax. be s gy gs is s t .. Aww.. st Q .. V ix Q 1 ,. : ..-. ,A A 6 fi kyigfigttg 3i2Q EQ24 3 Q3 gigs! ,E N ,bg gg? 'psig 'igviisxiif kgfis s ef M Kit. 33' SQ hggzgtigiggkdifg Eifigpeffgtfi .gm 5 it 2 .4 , R m sirsfzfsimsms.stsS5:fey:a:.t:,ftSwift:iigitwfebzxfi-tilitzfztgzszeisurf 5:Efsss:i:,.,.iEgt9 rt?fS MW :Hvififxf?-Fifvt difrstswseis iYS :iQf5pf2,,e it as N 3, is r .t i if .3 it time f , ti Q ..:z,.. :E E .:'.,.-g,..-:-. ,ew m gg ,gg wfgz.eww5gig-5 as fzmstfgw Ng. Q sr Q 10 H .vs f fsiz. Pfggg, Wm Q, wp M P wwwwwwqf .ww fam-swwsmsgwlfwiw-sw, ssssssifsit ww vs: Q, sg .xv seg 8 M 35 gv , :-:,- ',,,'?-S'i'g7:s25i,Z' :::.- 5 ,t, t w .,. :.v:, -j,:, '-,v 5-'::'-'g '.'2.:1.'fjEj::'- e aw Q' . 'gigw h gii i3f,L?i3'5ff??2:.' s3'5W SHN wks wiki'-1 sfiiikwgf w2,,vwi www at Wifi E33 X T, iiityfiitfht ?zK2t ?ZQiWsV'iKS:'s'W+ii35rfi ??ir13tWQKE?Sif2Ss5f we .Wi 'tv H5541 Q3 -1 fi:-:::5 LN :5::: ' ..:55:'E5i:.:. :....5:.:':5f'-: Q :,:.: -:: 5::::::5:.:-: .-.Fist-r:.j 5: E 55 5iQ'E fj 532 22 15 255 2 23 : 2 il e s 4 ga g ig. .- 1: at - ff .: -s s-:f s -s . 4, A.S.lVl.E. The American Society of Mechanical Engineers is a professional organization which meets weekly and is open to all mechanical engineering students. ASME serves as an information center for the mechanical engineers by offering plant trips, fellowship and guest speakers from industry. Activities include picnics, steak dinners, interdepartmental athletics and regional ASME participation. Members also serve as tour guides during Engineering Week and participate in other E-Week festivities. - by Lynn Mayberry, corresponding secretary Row 1: Lynn Mayberry, corresponding secretary, Leslee Belluchee, chairmang Opal Fenn, membership chairman. Row 2: Lori Antony, Susan Ounanian, social chairman, David Newton Row 3: Bret Peterson, publications editor: Karen Spanyer, treasurer. Row 4: Terrell Yon, Preston Morgan, Matt Whitfield, vice chairman: Roy Blackshear. Row 5: David Dotson, Carol Hardy, Eric Underwood, Joe Ross, Barry Kornegay, public relationsg Peter Liewelryn, John Hancock, recording secretary, Greg Monday, Derrick Littlewood. Row 6: George D, Georgion. John Church, Chuck Hammock, Jim Payne, Row 7: Stephen Shaw, Tom Marshall, Jeff Plenstouich. Clubs KATHY SCRUGGS Q . If Q 'xfliiff if 533 9525 wr'-Mwwwwsisszwtwwaiswr We ast:,.ffs3fs::,wefwxmaswwfws-::g,,,QwaMtf 'MQW tt, es we :MW tt ,yt ,W ,,W,,,,t,, ,.,.s.,,t tr we M , . . fir ..f2,1,., N5 ,,weQ:,YH..'Q?gQ2WZiQ PZi'7W E,ff' A fiiawiitziigf-W MSM 552-Jwvagsitiwsi lffsizmtfw wi'i432tS'Sf tswsfwgifs R' if 'it Wzttfist-55't'S',5r-ff i ixsfsktaezhizsifsss '2f6,ssm'k:t:s2l.,M W we law? E Q M lm .wwf W lwiia 0i..,,z,fEt.,EWt E my FA st? WSE Awwt gitwggimw 3 52533 sg E55 gg te I . . W M UW., 1 Q :ft :fm J, tt t , t.. , . UP, , .st , at M it We EU , Q-ts-1-3 , is 2 f it 'ti Bt t A t M X: gt as tit is f E 5KiN?5ZiA'iWi A ts W,:,rtj'rgtf:5:::j-255: is tbgft'-frgvtjfzsatttssfiif guest: , M,flf TW 5sfWj,t,.:sifgL5wft efsWz:,t:ref:,f,gXg::g:3f-:ggivzsitfftfgfsigtgtsma. msjtgfsimtggbsjifw tsigttgisgvigti ggtgtt q.sgz?fa,::,:w R Q ,, .MV saw Ways., ,slag ,lv rg: 1 , , . .,.., .. . . , . , xgw!Q3lsue,,M.,, HW 3Q,.,s,:3gs0Miamx..am .lsm...,,M, A we Q, Mp? f P5 6 M me rw www E,+.sRg3'5,?zgw1ewt.,Q5gg,Y4 s,s,,Q,zg:5nvg5E,3jgv W -Hgetmwsw,5333543gflxiwgggggesggggehmstis gs ss? :wig Ssggfstsk H? News 51? wqwv N H , fam. . ,. we-it :passe :gg ,g1a1gr:,,e1srsj, v as ,ggstsmiw ww vassal-.mrs,est.p:.:.,L aszwrtssfmsgzzsysaw me gg gym: egg? gqzfzzzefgzfah ysj QZWW., gg 5 E Vi t we f -M as an sv ,,,YtM,s,...,.,,.1.,.Y.,,f:::,1,,gls.:sM-,ef-:C zsfwms Q Q 2 3 W , tmslwftg ctw X l as sz Maj-152' a:?w,sW? ,M m if . Qt p Q., t 44,92 ft, New ew if U it ffgwtwn 1 t'tqg55'?tf5??5 time W 533' ' W X 5 Q53 25? ,Q igtfi5?gfg,r QQLQM . JQ w if? f tt Qigwiiitf this WS-stsfw was f i eff: 5 gf 5 ti ff Wana '- tsfiti., stage 2 was 2 its t ig as Q-Lge rg? K QQ A ,A sl,1l.,f iS' N53 5f3555w.ZSS5WQTZQQQ' 5295533 3732? ,,ff'?FEEfT:v5??5f2i'52?M 4 55?w7js3l?S223312ff'M fwyi 4?fxKZW'?7A'wWwiiwvkfZ 3PaS'e1iiEL'5?5x3:Xt' gow WMU? ff' PY cgi? swiss tmsww f f2:5fNi',HGtA:fiwew wzmwst-m1swf'.y ff ff 4 WW :P was ifewi-W tr ., Me W Hwmstm-et, Mt aaa is - t ,, t Wm .t,,W.1 em WviavefmtsgftsiiertgrwsggPimftfsititvztetsgiti' Zta 5 fem mist it W JN we tgztst-azz, ., , , rg wggffs ff A5 , ,f W twagbs. sa ,vw ewes W-is ,ss we, ,, H at sf -fg:-:- sfgimti'iZLZfSfii'533f5VYf?Qi22l3?1,jZ5i it gy sig? ' 15: t if 5251, vwgggxg MQ 122521 W WwQ,e,j f if M Q IQ sv :- ESE. 3 nf ts ftt:,5,,fti5f W ,W st.:.sa.,zNfd1xt aim -,2iizqgwMy.mw' W. ..., . ww: ftstywqasesa www :wet 5r zg-,:g- - , - tififiwflt .. -ff 't 2. ,5..,. , , W, , ,. . M, , , .. , . ., , 5, ,,, ,S gg , , ,, gg Q, ns 0' Wg. Szffgffef at ,-1 Iztzw . ,, .4 ,, as ., Yi? aggwwm W we 5: as mia! SL sf ,vtwwaffffi'iziziawgngt we .gifts iw M 'V as I M fyfg an W, tgsgggv 4 E M We Q X, swygy fgirteggsistiszaisssiisfi. m5:?m 191 as0ess'-15itNzztesfeggtlbxwggiresfsgsgzzss'63.5.15 we sszegifeewwiwmg wwf f59?:5b5Mi?2f50'tSs2i?S?' miata ggi? stag iggwgewrfgsiift Etgasw tt iwrwvwMwwwmfzw-VAyfmtitfs.Wien.11azzzg:t:5f'fgFEs K5wwtf ivmsssfte 3593 Q ffyfgiggvfr vigwwfiw-wie-fwffatateszzetgwgf,i,s,enf:fff:e-fmWWS:efsmgisifggzszww,igwv-lim stasis ,ssifttgszrssega pw QQ wk ,st . -: stseiesfts mga-tws,:t.we152getawszitagLfZ2:t,:1?a:4gresfassrsrmwfzsfsweris ww xsewiitrgwsgsssjtsst ssgtsswwt SQSSFMVSSKKi,w2tsiftJZigsQ,m3s'sr:sfsw:v,ssf:fs:ie:?,re1w,mafszsrwZzasswzgsztgizmgf arwggsggtsgsgssszztstgfss .,gaysggkzeigsstststszsfaszgmes tt' 2 figrfftrfgghifmf,-fifkwfviiiwfeirreieizi tsimssfffima' 'tftttgeggiitktifffgtifffQt2222tar:fs:5.::2::W'Q rfmrtfttfiifawltteififfs fmizeewwza-mx: weitgmligwziftsyjrwzczsstsawasssfgiietitsssslttswst.attests:seggifitafwiiw-126vs:,,Qsszvzszzmefe.swfikiiaggmt Pig, ,Q -I-2. 34355522 i' z26:::Pffw2gwv1ww rstawsrsw 223552zsfisitfiztiwkzssfttasr:tieff:wwwWill?lwwsfrtWtzztzmlwgbfefww ey ww? time '5'Q2,5x3,xt2Siff35sQ23'2?s',Syggwioel-fggvywsawvM2m.,2lZZf2',f 'f P7tiQZ57332:s1,Q1rfitglivi211vw-wQ:Sfs?i2Lgflqifwbfysfnrfgw-fgsijwgf Qi,,fi,.M5SZ,,t WE? its Ni ithSatatsfwsestsrssiisiszfr Wiigryismw was M-Qffww,wW:5ff:s szffs.,t2z5c:,1rwwWgmMas-1 as View ,sat Pfsgi' -,sv 4 stave? .gswifhw isxeihli tstwzff,-Q www::wwwwFffs,wf:W:':g5s:tf few- awww MW lzsfrftaeswtr rv it geek? .Q 4331, was S QE Sky wmerismw,mmt,.,.,,g:t:2s new wa 6, gwwggwff time W t as ,Segal W at mnegwrt.W,,,t,,.ta'p.f..gtets2',,fst,,fg:tvsegzwf'AMW12f5a..,..M,,...ggmwesfsimlfx New MMSW wasszxighestg, gw we Q ws, stats ,...,,,..,.,ea ,. gtg Q are awmwzgswstasw.ta.,,,,,,,,,5,gL,W: gtg,ffgfiwqeaeiww Qs im Hgggsgjgmgtg gtggssgtsii ws msg? ,, sa4s,.itm: .g:.sa4:it,223z,EM:fmyfiUwgfaslayesh-iswssivitfza sttlstazz-Srww wfwgv MMS Awtitssfea sstizkfxtiisgsif owe 'Liam mm! e ggs W ttifsesw' gfgif wzte sw rfitzzftmstewitafftt' tat imma i?Wi5?g'?yZ2F 5::s:Wf:gfsf+q,iggwMf 1fir?2:'2l22f: ::2swts'wM:5t?f5?Mw ',,tE'Se?2tWWg'3'5St: tsismstkszzizzz'QW11225-4ig3s.1tt??5EPa1s:ffa:v CRAIG SHIRLEY Angel Flight Angel Flight is a service organization that promotes the AFROTC and the Arnold Air Society. For the past two years the group has been awarded the Purdue Cup for the most outstanding flight in the nation. Various projects include a March-of-Dimes Walkathon, study board sale, Tiger Trot, Camp ASCCA clean-up and many others which enable the group to raise more than 312,000 each year for charity. - by Jeri Pipes, president Row 1: Valerie Smith, Sally Crawford, operations officer, Cyndie Boehme, historian, Alison Mobley, administration, Jeri Pipes, commander, Laurie McCraw, uniforms and little major, Linda Bridges, Comptroller, Lela Welch, rush chairmanfpledge trainer, Jani Pipes, public affairs. Row 2: Susan Cox, Sally Smith, Laura Adkins, Karen Penniman, Julie Denton, Sharon Collister, Marie Lee, Melanie McDaniel, Carol Daird, Kimble Manley, Melinda Mitchell, Carolyn Jones. Row 3: Capt. Moreman, adviser, Mrs. Moreman, Lori Morrow, Beth Stoll, Kim Murphy, Candy Edwards, Cindy Thorn, Kaki Pruet, Laura Player, Mary Jane lrrgang, Jamie Tatum, Susan Boerner, Ann Bethune, Ann Ensey, Becky Ollinger. Row 4: Stacy Campbell, Suzanne Lawrence, Elaine Fowler, Anne Shanahan, Claudi 8 Brooks, Donna Guckian, Holly Harrison, Beth Hill. Row 1: William Moore, operating, Mark Scheffer, chaplain, Eddie Bush, commander, Thelma Schall, deputy commander, Susie Trowbridge, historian, Michael Hill, projects, Darsi Kruiger, comptroller, Anthony Burns, administration, Laurie McCraw, little major, Jim O'Brien, Air Force liaison. Row 2: Steve Aleksevitch, Marty Hupp, Todd Baker, Keith DeVault, Allen Andrews, Richard Harper, Dwight Bassett, Matthew Harlin, Michelle McCain, Greg Rachel. Row 3 Robert Miller Al Price, Dave CRAIG' SHlRLEYi Jones, Mike Speakman, Miles Stokes, Butch Grant, Scott Sherrill, Capt. Moreman, adviser. Row 4: William Hurst, Keith Moring, Dean Bekker, Samuel H. Wall Jr., Chris Millander, David Urich, Morgan Anderson, Scott Barron, Bob Pate, Bob Richard, Bruce Watson. Not Pictured: James Batti The Arnold Air Society is a nationwide professional service organization of Air Force ROTC. The John Boots Stratford Squadron has been voted the best in the nation for seven of the last nine years. The Arnold Air Society's mission is to promote the Air Force, Air Force ROTC and the University. Along with Angel Flight, the squadron carries out projects such as the annual Walkathon, Tiger Trot, blood drives and many others. - by Eddie Bush Clubs swiiizw . W, ,, , we we? Q? WEtMt2EtiittEi'tTiffW5E?i :mrsw'::s2:ft::sw221:2-'emitzatssrssszsxsmwstwsfwww W we new A-M ei News QW at as 4 tw, Sewers Mitt .at mtg? M ,Wa X A ss? ty W.,mtQ,f.z1sW,craigtmtgmgiggg:,s5f,:tt::fQs:!igiigigiilgggigggigjiegggggigggiigggggiigi g 5 - Wfwtwfmsa,1t.waw2i,se:1.f.t f tw X gt 3352 WZ, WESZZZESR? 2125953232 f.f3S3Sj 3 3'?:322?2,f'?,5'J'ff52'i'f2i9Z5iif?.1ii2'LZ'22'?lQ3 ,,?'4 4iEi37 s'.- ??2f 'm2Z?Q3'ff?Z 't9 , EST' QW 'fi H lil? skvggye we up tn' my wa gigww-Q We .. 'z-.' at-,Mwst-lwzvmau sizes was f sry? Sw VE? wife? seams wilwiwtwa Wwtmfssfwwwiize''i'w ?'f'f,'wwfwz't wg gfggsuff , - gi, Q W K sw 5 me to ww :ze f 2 W mt p-ft ,Q Ky Q3 13,5 . fs-3 T REM Q::ffg,5'vgfl?ef :w..sma2'1ssi:m't3i2JiH 3Hi2'?W:gtataw t,1ff2 - 4 .. M5, 4 35, 2 ,. . 4 1755. . ,, ., .5 W ., ,. . H mm. . , f k t ggi ggtfigf tsgzfigfmtff tz,f:gc:f5?wse Mm Wwi 23575535135 msbisagiyyv tanks! EP?t 2tt EM Hi Etettigp ,tm ,.,w,gggs1,:e1f5mggm0l:t5.asm,t,.wf3.t,,s,.7,,f,,Mg.,,..,,.,,,M tzzsmriekiitszfszttspgasgwsgwwiw.WWm'za,.W.,,,.mmwma...w..M,mt. ,s.s,,.s,::s::itmt,gaf.:,:tz2wM:zu Wgwgt szmgmgf-gmwwgtv W rw-iff:tmmzftiwezsitzshsgrtzfaxwsiwsiv ltwmsivtssvrittizwimtc few, it mg,Oggmgggggwwgmbgsmm ,Ramm,:W,mZM.w :g5gmgmgW,,,m,,W,, i1t,,,,y,,:,fQ,,,F,,.,t,S..4.,,s,a. .mmmmms.tgffgggspm-1,q,,,33,mmym Regs., wstxzs.Wvgt:4mgkW,,WW asm5MawUSaw,,1tge,,M,1gtM,t,Swtzt.sQ2sa:.: wwgmmmWg.m3Q.iamz ,. atfggg,r s, :saQ: m3f:t5Je,w,,sz3aJ.zsM,wswMstsss,t:1:5'eimfferfmztzeviiaawwm-SzeasmA-swzswafxzfeztszmpswsfMmevwsffchfiffwtgsresmitgzfam, 9332595 wsitsfawifgsssfmzabezt:Masewe-'eww we-tvwewwfl wwe: Witt: wfs1:ggs:tgi:1f,5Z :sei-git?-iw fsftittnefsffW5:12222f:ffss:i:15a?fQia:gets?w:etiE':Efis.f,i:f3t5f:'t3 Sims, fzlifaitrsit 5? at We My MH, twtslitt , 6:2 :SBD F Stzriim':s2i,'t.e'l?w2t 4sEQ2N't?fi ft Y:m::,:tSQwg2,,s21 W'1wm'iH 'i'W3 Wiitftfel WSL. ' t g em ,fu sri5g.,5'f'gigw Lrg, :fy -V 1 2321iffgtiggwgfz-yggvggegg'fggsgggg5j:wgw-gftgsfg5232325252,aSwjkg,stfww?ftw5g5y?SZSfQ?tZfMb? .Jistiki W 23? 'tswiitz',Wtiswfsifs?SQZ52fi352sifs,fi3?w?f3f ?i'35i35fXU?St'fTv5?Sq5 fx' . Q Q- :Q sts 3 2-21382gsgtgagrggggggggwggi, G Mgt W fs W K eggs.::vgwggzswgggiWQ,ggQ?ik25g5255fWgi5vQSggiw 21553 '15ateggtigvgtvwmxigewamfef5gfgfwifgssxtfezstfszwfswsg tkizgzgwsgqssggv Qg'?ggv?igEg3g,ggg?Qggg:tE?35Qs3,te tssa2iW5Q2gZ g2atmS5i5 ,33:lYSf-ii3?EmgM35'3l5'?ftP Wig! 2 - ' sf , ' wwtggiftt' 0 tt: Y-ftlirw' S5253 is rfrgzgzwszszggigz is my law: it mem mggiw M tw Q.ELt.g P fiwvtifrwftttgzitifhfsttfs Wtetfff P i C7 35: ' ' ' I C ,M A ,sf Participation in sports at the intramural level, recognition tor outstanding achievements in academics, extra-curricular activities and military instruction and a spirit ot comaraderie help round out the college years and make the student better equipped to take his place in today's society. Auburn Army ROTC students have established remarkable records tor achievement over the past year which include selection tor advanced graduate study at Army expense in the form of fellowshipsg winning the Governor's award as the outstanding Army ROTC student in the state tor three consecutive yearsg selection to ODK, Spades and Phi Kappa Phig and participation in SGA activities. This year's enrollment of scholarship students hit an all-time high when 62 Auburn students began the year with the Army helping them through college by paying for all tees, tuition and books. Some brought the award with them from high school as 4-year winners, but most received their scholarships by applying as students at Auburn. - by Major Moore Photos: Top: Cadets gather for the quarterly physical readiness test, Center: The basketball team won its division in the independent league. Bottom: David Tucker, Roy Shepherd, Kevin Nelson, Kevin Gant and Eric Fox receive awards for excellence at the 1982 Advanced Camp. 430 Clubs A v 4 A W M as W a 5? t FW T .::..A. ts ew Mrmelg A M ..., T 'W N' M WWW mm' V ! ..,.. M WV '.., ,........... - --WWW r Ks L T z 5 f . ..A... ...... M W ,EJ MM-.. M 'V ' MMV W luuurlxu ' V Vlzzl V ,'-- M .,,L 5 V . MW- W ' H F 3 E SX! M IDIA it m f. 1 -'---- Vi' 5 W mrmm is I 'mms S wag l lf W M77 ' ilzu M M W1 --V.Q:.. ff' E it E' E2 ig ' ' .,.... - ' w we l . .,........ W . , .,4.:,. ti ll W . .fm ,,,, 34 VLVA by Su C .,,,. s , f f X? 'fff' xg tx -. . 'ffl' X 'X tha n .K ' nw- if' 1 W. ,VVP P- 7 Army RCTC Some of our classrooms are not classrooms is an often quoted comment in the Auburn Army ROTC department. This year, students participated in a variety of out-of-doors activities designed to test their confidence and provide skills not otherwise attainable. All Auburn students continued to enjoy the activities of the wilderness skills and mountaineering classes both on and off campus. The highlight of the class was the field trip to Cheaha State Park and the opportunity to practice on the cliffs and mountains what was learned at Auburn. Since the classes are open to all Auburn students, the fun of rappeling and crossing a rope bridge was available to those students who had not yet decided to join the Advanced Program. Regularly enrolled students in the Advanced Course had the opportunity to rappel out of helicopters at the Army's Air Assault Course at Fort Campbell, KY, or take that big step out of an aircraft in flight at the Army's Airborne Course at Fort Benning, GA. All in all, 1982-83 was a good year for the students and cadets in Army RCTC. - by Major Moore Photos: Top and Center: Auburn students ponder, then attempt the cliff rappel at Mount Cheaha. Bottom: Cadet Salvador Rodas glides down from the 250-foot free tower in parachute training at Fort Benning. 431 2- .,., ', Mf g wgggtr ,,,,, j - .1,3 :- as ztggggti ,ff as Sw:,sg,V :1irea g:r,5Sfw ,, Sifwfg ----- it-M .f rr r 'f ,g V ,gg,.r1 'm,sw .-... 3,-5:3:5-5.., ,,-,:,::, ifMtggfggswgggf5rssM535g5:,zw3fQfmrfaxgwf1wfggis4 gt k gif ' Sv --.-: s .wg ?2sr.,f5,,g vgMs?gf. r mm fs w :rziggf5: :-::.::.:.g-- - smwisssss wgizw rs'.' : -' - Q t ges sts -.-. . :--5:52-N2 fi? 2' giivisitstwaiiiiissxisffim-tiedQirswim?tigviiigfffsfiwiizfsksisQMS K ?.3S'w 'iaf3W?' gikkszswsrwt V532 -- ..:: :: w e mi?-A 2555 twxiiokzzeitt -'-'- , qssee setg Si w iizigs tsaggfsjsmegsgrmstiiifwwsiwwwzw Wmf-favfwssiffewsksss as -- : sgwtfzz ssvtzase g ------ M '- tmgiftits ----5 is if .... - 555522 s v : 1 ' ' ies ? sf'f :ff:t- ' gg 'tsittsffif ggittgiszsizszsfisrffwifswlswzifetfiffz-xzsilaseM52 Wgsisrzisewsfwwss sg 2 fg'X'2g2WQS2if?' ,iiafs g5 ' E2 2iZ:.' ,g.g. i,::g::-35:5-.E -55-.:.E .... 4 .g-:,.,-g sa gg Sig gyisitggg mfv 4252 ts siygja gg M54 fgggwislwmggg fzfifgrfsi1:fw5.v2:g5:m2233221-eiLszgweggfigigrsvxwziaimigiiiskggw -- 2- 2. .:g:':' - , :g--gsv: :rl .:. . .:-I-I- w r .: E5::ggg-:- ,-:5 g-:: :a:5sg.:-.5-:- :, : 3 'nf 53 429 gg gszyeggissgt .swsgimyrweigggsiisss 3 85.15551 misgsgggisg s izsgmggyw Qggrglgggffgksqrsgg:Sf3,sggfgsg3ge?s::gtw S5q2:gg,:tg1 M wE2Q3g'5ggm E:'f2-2 :- 1313 5: . ,A - it gf? 5, .. Q Sggsxawwligos' as . ACE! The Auburn Student Branch of the Association tor Childhood Education International is an organization comprised of education majors who are continually concerned with helping all children from infancy through early adolescence. Some of the organization's projects included working with the Auburn Arts Association by participating in Saturday morning workshops for children and volunteering time at the local hospital. - by Linda Barcz, hospitality chairman Row 1: Lisa Reeves, Ginger Williams, Annette Hughes, Rebecca Coffman, Denise Parker, Mandi Meacham, Suzanne Prince, Kathy Williams, Mike Bedsole, Joy l-lambrick, Dena Akin, Cindy Flickinger, Jerry Lee Easterwood, Laura Rutland. Row 2: Tracey Hilliard, Linda Chandler, Wendy Ryan, Joy Denton, Kristen Brice, Celia Norris, Valerie Lane, LynnMarie Cook, Linda Barcz, Pam Ramage, Julie Denton, Nancy O'Kelley, Lynne Patrick, Nancy Hudson. M. TROY HELMS Auburn Club The members of A-Club particpate in many community activities. Whether they are visiting children in the hospital or playing a charity basketball game, their goal is to promote community leadership through cooperation, effort and Christian fellowship. Annual activities include the fund-raising boxing tournament and the Miss A-Day Tea. Membership consists of outstanding athletes and managers. - by Todd Rubley, president Row 1: Rob Shuler, David Jordan, Bob l-lix, Randy Campbell, Tracy Turner, Todd Rubley, Chris Rowe, Richard Hughey. Row 2: Ron Middleton, Tim Jessie, Carver Reeves, Jay Jacobs, Jeff Lott, Randy Stokes. Row 3: Andy Bauer, Bill Allen, Steve Smith, Steve Ballard, Chip i Creel, Jett Jackson, David King, Demetrius Cotrey, Dan Phillips, Jeff Parks, Steve Wallace, J t Jerry Randall, Jim Bone. Row 4: Michael Beam, A A t,-- , L g A. , John Black, James Wallace, Doug Smith, Dowe f Aughtman. . CRAIG SHIRLEY 432 clubs SP?l'33 g93'55?fl3X'5335T?3ti'SS'33g5if3535?f '?i5L55I:?V'35iX5i3e215f?Z'Z35fS? tiW?'S?i?935' WW Z WYSI SEF TF ' 55. .:: 5i'-5'3-E':::' 5ft3?:f.: .5' i.:fQ r 'ffl-1 ft ts W, ,QL it f40SQ'fSsgg5??E:irr5Sa3fi5Q5, Wiirifigisggfgwa M5335Mig.-????iw?s5if5f521, 1f??2s:w sfsstits Nlgwgff-Q55 W W :fl sim 2 W B, w s ,gm X ' M Sf Qwrfazsf-as ..fQ?2:fevfrf:fss:'t:wSisfetwfrtffr saggyssgsgssrmsm3:,.s?22QQfse:ggbafreezers,,.f.rfA'wszeWwwssgfwa..:gwis..:Mas sgstrfasgigrstessggsstyi sa .9 ggassrss rgsgtggif ., 2v.m ,lgwbx txwg gr tr r w ri l yg,5r5aga3v,e.,gg55,s...rifeysi ,ggafa.?sSsts:i2?sr?z?eaiggf,,,sawf,mearg,gf,e5..::g?s:...:g.f:gf:af::szwszftrsllasers.:fggsqsgggspsgsggggftsfssvsstwsisriggszsssmqsssssw ,rams ssz:s:.rgaa,srf:fktfS' 5.-r v -sav e? w g -. W f iqsiswaiitigssetistttfegfifggrrskwerefifstraw-rrgraiwgsrss.ff':fe25a:w.rggssi.:wQf5frf.,w2s:wffssssswtiiigffrfrftww ssfsit task-its Tsei:rgwifftfaiittzrwa-iizafxbr rfffazsftiiafa rw .Q 5 f - rf . rs - A if fer fwfr-la. s't'wMw'f.,'ff -M5 :M fs rf Meffwfa . 'W' wwf we A so atfiftkilsiimiiifs?35EwmsS1i:2?W: Wm.at m.fs:'W5kfs::wd'w0x:.t.v 'QXQE sWyamaEt'tQw' g gf -s:-:,:ha:-.-: :- if. -' : :- - ref Xia a sazpag sswgwsss Fw,traitssssztgarriitwytsstmwwstst savrzzzfsremanew.s::.efa:ssg,3ss.i.erMat:swsi.::.t.-,...,,.,,ag, ., ,- 353, ...wa X 4. - . x sz E rf pagef:awwme12352:smttrritggggfgfvafEfsffsmgitwsefitisistrhwfigswiiswewififzeis Qviagiw-M2331'itkaitiitgsssaifs rw ffesgsggifiaiwww gsggsask gwfa si s-.::' .: 'tm H? 'refs tt ,S tsmg, s5S,.:f,, s::.tfs..,ggas,eggsft f , gfvsrgr gsm 2 'tfisimwm 'Q ry xrrsfm-.m:fSf'S'f2t?13iQ'?SN5Ygigq2xf3tfrmmQg5S-KVI siitifxffrr32?l.?Ff::Emi3tZEaT'ifr9tg:ii3 'z2J'?t5WWs2'tgs:1:Rm3?iZ3?tTZf 53:5 'w.ErQVi,Ssf5?553s'E3wZW?,:s,.mi,g,3S'0 ' tif:rgwii:-'1Ps3?:s':Jfggawmit gms F wwag ec s - ,-:':- get XS HQ 5 was .Msgs igssgesfst 5swte,aa:E',gffs.,rs.f t Maw:iffaz:f:tfass..wwe:-1paws.s..sM....:fMa..:,gtga...r:gs?s sw., sSr3g55ss.ss,55sgsttsr.Q, sa.f:.,zw1fi.isiggxaasswi rf . -1 as M t,2ws,3 f is 5, Q tstssggfsg fg2w,WSQfa,3fg::vff5gaXsLtgifeatefwfwh arise5fzssgsvfsigygitggfrsfgrwggfryggggsgaa-1552 gggg, Qc,smssegfrgbfivfsigNrisiissrwmasafaiv g-:::.:g: T-wa 52 ef My Y .5 V. Q , M was ,, 2, y13,,,,s,,,.,WM,,..,,?: u.,r.1,fm..s,,,g pies H tt? Q.,-,wif J Jw. t, 53,55 , wawwxt, M V, ar 3, 9 R. ,,v.1TM, ,Q arsbsttrf yea, .sv Mfg., N says ,, s,m.s,. sg? M Qs ,qs e snag arms, aaaagjgatg. Q as , is tr seweragerf:?wti,.Qffsvfa.,1Q.f:.Wseff2a.:: rf--,ease wlezefwibvsafrrrswaiigrt fgraszsrsstiisrzxysm.:.fi.ess:z:irQ'2's.fsazssflazilitzfissa ff:t'2if.f5f2:wwstsegwffqwaehgfirtffttttrsgaffwifgrrggmsss G2 ssmstrrfs .stssa sfaw eww W was 2::sa.rgg.as::aeg:VtZ:ssskM, Meiersagzgzwesssgiewifwasfrfteaarergat ssffftrgsrztrigitgssslits 2:25.52 w.gsws ,,:rfs ' a3,e ws,, si r wsW14iasQsg::g:.ewSmart: rw-miteswgsvkwsMsasrsfriiififszssvazaffxwfzfrfe gas was viwseaasaa,a.,,,aasmgfra,a:ff.:esg2asig'3x.t.? sg.. J .4 My ,pvtwmggxasws Qgggmxsigeysagwii 2 .J.,a,,5,:fb2.s,..,ffsw s.. xwwi.,.z.':2w1,f.1v'wV-Matws was-:fewwzeM 1Mwf'sggt5He r sf.-133 'twigs as S mstwigs-sitis5ssxti?2::1fwisfa:f,pfJim swf-4 fzfwy.i, rwrsi stfswa- .- , me Mfg 2 Q t5'3,vstst:rg,aQa5grfv??s.5s,. we 2:..75W.ff51ir,. svagsrwwestfstgstifzssewg srsgisgggsegksssewarssxeswiaszswffs was . , igyagtgzsstta it X .tml-tr9z1sgswet1:t2,g:rfff'i?fr2ims:,:,sessgfmr sa1sz:::rasas:: ggfaarrzfwrygmssggfggwagggswgrfssgwszssamssassss 'sa,,.aisg,ms2ma . Q Qaszfegggwtezssaa M-s,e,rggt'fasMt fs - ara-Q:-f .1 -.2 sw iss saga-C'tf ia fr 5 -wsssggfegswggsswestszftas i.4,wa...s,1sw as-tram-ig:rfw.w.s eszwwa -W?,giw,sm,,:5w. rsrmwarffzsgew :smsassgtszemssa:raf2kfss..,,gagQ1a,fsws-wwwailwszswhs . .ag at 5.s,??g'Ssa,,v5..,,gm se. at -ff : gg - m s ,,,,,s'::s Q., 1, Ms asfgssassfKsss:as.sr8rsf.feSeam.:sfa5??w.:2.a.:waa.sf was wqfsz wwra.-:sweater :eg ress fsssrsrrtwfig avg? visa: sew .assi rg we .ant Y fr St T sa mass: we Wa at rssworfa :fer ef sizes rfmazzrfzfwzwgrsfsfffrfsrga 2 sw :spa a 'fs rf as , 5 .. as 'sa A asrs. . .-.:.:. -. fr f 4 H a s a ra si sisgggasrg f sf z si f rsl saf srlsrz itft . is-??ZiZ.lFs'? S 1 -5- .fr 5 SsS3? q.?s tS5s: -. 5?5i3?:R i'3af:?4i a3:::s:,s mi sses ,v iii 53,2 Mme i.. -18.8 x s.. -fix... I: if if ff., 1 v DELAINA PANKEY BOB GAMBLE Auburn Entertainers The Auburn Entertainers is a University affiliated dance group. The group performs at pep rallies, women's basketball games, intramural championships and baseball games. The Entertainers are chosen after a week-long clinic during spring quarter and work to promote Auburn spirit during the entire school year. - by Carol Gardner, captain Row 1: Carol Gardner, Sue Ann Fite. Row 2: Marsha Howard, Jenny Simmons. Row 3: Jill Williams, Holly Sims. Row 4: Sandy Lee, Glenda Gillaspy, Martha Brewster, Mitzi Pannone. Row 5: Robyn Perry, Dina Phillips, Kristen Swenson, Brenda Colson. Row 6: Martha Holley, Vicky Limbaugh, Margie Gentle, Paige Faulkner. Row 7: Angela White, Darlene Tinney, Not Pictured: Kris Bolton. Agronomy Club The Agronomy Club promotes an understanding of the field of agronomy. The club has fall and spring picnics, a winter banquet and a spring turfgrass sale. The group also participates in Ag Alumni Day in the fall and Ag Day in the spring. - by Malcomb Pegues, president Row 1: Brian Gamble, Ag Council representativeg Janet Smith, vice presidentg Tim Bryant, treasurer, Kim VonSickle, secretary, Malcomb Pegues, president. Row 2: Jeff Butler, Heidi Clay, Cindy Strickland. Row 3: Fioger Moore, Mark Wyatt, Phillip Coburn, Melanie Wood, Mike Henshaw. Row 4: Larry Warden, Chet Norris, Daryl Wyatt, Mike Pepper. Row 5: Mike Henderson, Dr. Joe Hood, Dr. Jacob Dane, Rob Colville, Dr. Cooper King, adviser. Not Pictured: Hex Chandler, Ag Council representative. Clubs ,.,,- V.,--..-.-. ..... . ,,.,. 2 .,., 33 .,., 5 ,..m,, .. . .,.., xg M ., .W gr 2 ... MMM, gf . V,,V ,tE,,,,Ymm.? .,.... . VNM. ,VV .. ,.,m,,,, . . U.N. :F N, ,5.t..,m,,,, Xg?,QWw,,,,,?2,,, , , . .. . . ,.,.,., , Y ---- . .... '-'-' S -' 'Wi-- 2 .Izi:i':' www N all-Nm ' 's w 33i ?i' s Sir:-.2 V, OJ? Mr'-:rw si 4:-: ' .:: ::::-: ist rv - N a' sis, .JH A s A425 A : Fit '12:'-2 's':i:.-.:E'::.. 2 W? 1 V ft t i i i .:::: .. , sri- W,w,iitafsftm?242gw 1-15533 01 - Wrzwgqg' 1-. 'Lv 35 as ff was 2:2--g-fi , fa,w 'r ,, w e-iwineegs isvm asw fgish-:':fii-2 1: -.- ---- - 2'Z2. 22.E':: Weir:-ki :-':2:1-':- -:5a-:f:I:- r ':e?:-:ss-:f-: 2-.-.I.E:E:t:I':' :gi-.: w3f M525 3 hfwre 51575545 steric: tt as .ag 1 ':'?I:I:E'5s 'S 4 W 'X' ki ,W Stix ' - 2. 1 .V www , Qwes t S it Q W,,,effaM'2wif Levitt agar fa ,eg .... .,.,. f s y Q x ' ' -qi.. A .. . :- .. ,x, . . gf lm Megan Q ag, .. 3,, .:.-.- :.:.- si - :if- . . ir ew H X11 E 4' be if 'S 3 M rt 't E? 7 h ia tr 6 Saresw S W 2 Q ' .:r:.::g.::.:-... .'--.f::.:,, ----- 5:-::.::::-:: -555: 11 AQ ftg ilttizfftfzss 3,3iEta1e,sf?s,wQf ,,rA?12S:g2f'es:zwf'eSm. Ffa? V , ww ., W rs, as 3 if Vg? -- ,gif 5' W A sgWsa s eg2gggf?5?vwgWW:s, A5,,iz igggt it 'Q' rmtgggggggg 'Q sawgftsjgag-g+N g gf' M gt QQZMQ H55 'git a ?t iggggfif ' baring gg, , 2 S ' -: F':ji5is:5: :fit-I'i2sgi42'E:':g:, - i-2'2..!..22t2'2'..I I .2-2:--2-2'-2-' ::.,-,:-,zg-.5--2 222 -,,I2:5-f-:ws-.22:2 Iii:-'a' .gf-fa'f2':2'E ' E.-'EQ-,: :g'g-Ms rixaa:-:gg :::f':' ': g::::. :- :EIII a w ss 5, ,.,.,5mg4..v X,.a gff,g-ig, 5 M,es,,e,gsg3 MW, , Wwgg, sv ge ,EW s ,rf 1 Q. wg his ,age 9 54fl.:,,,,,,,e,,,,,,,7Lf-mam, gg ,t,,, -,-5-5-3 . 5 Ji., iz.--,,..,. ,M -. ..., .,,., Q , 5:- i: . -W:-:::,?:. --::.-g:,,::g:gg-:-:g,: :::::i 3 H ,.,.-:gzg Q ww Q x5sss,wg,g:,,,,,,,,,55Wvms,1,yigfy5Q5ga,s,.,,,,mi3 Q1 www, M35 ,mg We 3, 4533. H .,-:: .. gf,-3m,a.i,, N ggsshwgsa gwggjgqh gym: ,MW ayzwg, .. sa. R i 3 :tr-1i52'?'3'g?ss aegis .:.:..::..::-H- 15:-gs :-:--.s.:,f-:g:4- sf ,. A -M ,ff ,, gg, 4, ,ir 'S' rv ff s we-4 02 at as fs W. :sw wap, eiwrswssess-kgs :mas .,,,,g,1 4 we ww: .qu wr. ,Q . t 334.2 fe swap, .:.':, . 31 ' +55-E 2: Ng ' .j:' .Q-,gg:, A?5 r g,W , iiGi?g Sig ight mf :ii ' S ff 55825533 'ir xg' I5 iZf2'2f sgE'3?g?5k',g'g g5i'vA .- ....... - . .. sa! .... .: .... K, ,gi it ,btw W . if .firfmiegrz ia W M get New V , . tie, , , ,, We L ,SQ -.5..,..5..-... -------.- :..:.,. st- ., - -.-. ..-... i .. 24 ii s ------. gam fwuagtmtts eww, of Vwttvsvsvwwsawviftf s Q 'tw :Q 2 ew 2 5 Q ---- S. as :tw ,eg ef lifes: 1:-W ww sims my -f we Mkftt: ,, ,i is i Q if at if gs, is sa its v, ,t an as pc? A9 -9 M gg 3 s g .sg ,Sega ,ij tfz .?gaT,gsgsxgQ35?gsgagg355Zwi,k Q, 435354 5, K my ,Aga wivgi wifi Am 1 tts Ste? we 32 WH QW gg 2? t t 'Y 'ri JC R is tg ut Q isetgsgt ,gr Q may A ff YKFSW N55 in si egg wgf2,?Q?235'5 as Ku' 'Spirits we KW IM?-5 W' s. 4 3 4 S Q? ff get 2225 8,550 :Egg mgt agosies at v 5 1143326 ,fag gm S .tibia ggg i ,,,,,fw, 'teak 5 if 15 A, Edmxgwg xgigsgg wh we Qgwgx gags? E gsm in sg 9 A , Q 2 sb ttf f sa if eg 'Z it is Ast: g gif! M2 is 4 , egg 4 an X243 54 9 'S Z Zig? Q53 ? E 5512 91 gilqig P? gg is iwawfa s M s' 500,25 g X52 wings 5,55 Ja if 44 Wu, uw 4 , ,, 2 4 fm sf it ,sa gs M5 Qaggpxi gvgmt 9 Q swieeftgt- ,fn Mwst P E533 ,,,, ew M W E as? P we -4 23 v Q td A 4 55 .az 1: .1 if sedans tv M .8 EZ? W we 6 'Ass me wi it B at X wa.: S- in Q.. V? 3 4, Sgg w 3 i ., R K qi M 35, as Riew ski WWA saw? 2 Q New 2 QR 25,5 .9 5, 5 Q sig? 5 Egmg gg 3 egg? mwah ,A M W ,Rig MQ g at 'iI1Z3I.:IEg'Ig.j.. -fs2.:.':.'.g:5:5 .' :..i .2. . -:. --,Q -If-ii ----: .... s:'i:i':s -E-252523 fwS 5:-a:5- H fr Wtfsfiisw' 2 fists?rgrfisimiijpggwgmsnsa frgwgx My semis is E M- :iz ivgmsiit Ugg may 25351, g,6?wi5wmb3G5f',,,,q2saAe,a?5?.3.g3g,,,1-1 was af s as W if' ..... P i 0, My it we as W ' H M52 fi Hr it va It ir 5 t. r Q wtxetw er ret t Q ' rx- I: -32551 5 -.-. - -:- -. :-.Ii'.'5.' ' .:.:.'T:-:9Z: Q Q 5- -'-:- , 15- - ut-. fy. '.f :-:-: '-: ,. . t A - ,,,, :. . .g.: - '-'-5 -: '.j Q Q: -: .g.:. ., :. .Q :-:f-.:: . I H I, -I Q 4 sv WW DM W Ii, m e snap' ' 'G' Wiz :W wmv P? ' 9 3,99 I Ps -2- - - AM, t Q MV .. - Q-3 lj-3 A Q K 2 D90 fl' we prawny V A I bi: 6-2' ,gp 'WL-b - f. :I Q, .,3,:,-gg::::F-:g- :5:-,:-'g1.,- - :2g-gf- 1 is ,:- am- ,:,::-:5-was :. Q :: :.asj.:g'.g..::,, :, ' .g:.:.sf-g- sgpwiw H1455 ,eqv1, 225 was iiiirtgvggs ffh vzsig we sneak ,ew is X .QSM :,-..:.:-:g:g.. 0 2355 i 35421 , QS gg 54 .. ,. - .gf-5,':::a:ig:-sz E5f?1i!I5iIfZ : ?':' ::-if :tf : aEr.i5:sZa.5 ii: Ef2 2'2:::'::2s:i- 5:- :-: :2 :! E::::.5-xi- . ' A' gg i r r! Zi'.i.r2 5 Zi i f- si rmi i '3?wf?i Iv Z5 - -5-LE: faaitsei ir .....e . .. .. re: , is ri . ,.., at by awww 2 M Mi yivisggg, fig at bi N ' tg Q it Q 52, awe si Sagas Y if e amen? Q 4 Q E332 RQ? it we w t 'ir was def m x gewqitbsg awk. 5 3 2321 3 3 if 3 2 '55 5 ,.,. . ....... 5... ..... .... .... . .,A.:,,,,..,, ........ .. ..,. . ..... , ,, ,.,, .,,.,,, . . .,., ,,A., .,,, .,., ,,,,.,.,. 51: Rehab Club is the local chapter of Alabama Rehabilitation Association. Members are involved with the handicapped in rehabilitation processes. The club's purpose is to advance the role and function of rehabilitation counseling. - by Jaye Ann Bagan, president Row 1: Ed DeBardeleben, Evla Mae Edwards, Deborah Radcliff, Selena Gaston, Michael Jones, Dana Kay Neal, Jaye Ann Ragan, Yukasi Cugowski, Chris Butler, Jeff Petersen, Donna May. Row 2: LynnAnn Palmer, Sondra VanCleve, Ginny Stone, Lois Ann Cauther, Randall McDaniel, Phyllis Lee, Belinda Smallwood, Tweety Bradberry, Bob Couch, Marilyn Long, Gary Corday. JENNIFER JOHNS Russian Club 3 T The Russian Club, though associated with the foreign language department, has as its goal a more complete understanding ot the Soviet people that can be acquired simply through the study of their language. By examining the various cultural, social and political aspects ot the Soviet Union, we are attempting to peer through decades of popular misconceptions in order to see these people as they really are. To accomplish this, our organization is addressed regularly by authorities on these various aspects ot the Soviet Union. In addition, trips to state and area sites of Russian immigration and culture give us a practical insight into their way of life. Finally, our organization acts as a forum for discussion that reaches tar beyond the lectures and trips into our active party calendar. Put simply, we are a group of i students with common interests in learning about the Russian people, their language and society, and we have a hell of a good time in the process. - by Steve Alexander, president Row 1: Benjamin Tipton, Carole Rogers, Larica Smith, Carolyn Reed, Sherry Tipton, Janis Antonek, instructorg Ronnie Smith, John Lee, John Williams, Arthur Busby. Row 2: Royce Northcutt, Sam Busy, Stephen Robbins, Mark Sodergren, Ricky Caldwell, Steve Alexander, Steve Ellis, Larry Young, Mike Urban, Gary Stone. JOHN REED 434 Clubs . -.,,.,.-,:..-.A . W QQAX W MWNS W ,E .WWW .. .V up gg 5 aw gg x wx H A '---- - A ---- A- --.- .-.-a . -,- ..., : sg ,Q G , '- l , .. f ---- E mviv wi? 5,1-ijfg tfff fmii w we stittiw., ,.,, ,..:. it V we .il .vw t fr MW at .J .,.,. may My ,.,, . .,.,, , ..........V, ie ,,,, . t .... , ...., ..,. y3 ?gg,,,ggXf3,g? egg gig: :r : 1: ' as --'- Q fY1i,glMtgftEtQ.,.s24,,gg5R,ggefffQvswis 5, .- si - -.-.- K 2:- -gg: :- iw :, : 'su . : .. v P .1 .t rw gf . .,. ,, t f - --3.5 -.:g.:5: , - ,.,,: - .gg5: .:,.,i ..--...-.i:,, ,.,. A, we il.. 252 355 ---- , i Y I ' .5 ,Sgt : sm gg 5 5 ,. 1 -if 2 -. DELAINA PANKEY Social Work Club The Auburn Association of Student Social Workers promotes social work as a profession and interaction among students, teachers and the profession. Throughout the year, members participate in several service projects and social events. Included in the service projects are work with Alabama Sheriffs' Boys and Girls Ranch and the Department of Pensions and Security and several other volunteer efforts. - by Judy Williamson, president Row 1: Molly Dickonson, Terri Jancaterino, Cynthia Hammond. Row 2: Lynne Bovingdon, Judy Williamson, David Massey, Stephanie Anderson, Julie Newman, Alan Miller. Row 3: Patricia Gross, Karen Kempter, Kim Register, LyVonne Braddy, Melanie Terry. University Finance Club majors. The club has two or three Day every spring quarter with topics covering banking, brokerage firms, mergers and job opportunities. - McKay, treasurer: Madeline Cadet, social Charles Evers, Sarah Murrah, l,M. Broke, Margaret Nelson, Brian Williams, Alisa Chris Gattis, Stanley Gilliand, Bo Burns, Andrea Juno, Leslie Trowbridge, Carri Marcinko, Dawn Batley. Row 5: Dr. John , Janxes, Marcus Clark. l 2 The Finance Club offers its members the chance to discuss current topics and job opportunities with representatives from different areas of finance. These representatives provide useful information to all business majors, not only finance speakers each quarter and hosts Finance by John Reed, vice-president Row 1: Mark Pickens, presidentg John Reed, vice-president, Valeri Cicio, secretaryg John chairman: Lori Wilson, social chairman. Row 2: Tamra Huddleston, Nancy Street, Rebecca Greco, Kim Heaman, Missy Sorrels, Janet Meeks, Donna Smith, William West. Row 3: Harmon, Terri McCormack, Julie McCann. Row 4: T. Bill, Cindy Owens, Julie Greggs, Allison l-lendee, Lane Dugger, Linda Joly, T Jahera, adviserg Dr, Terry Rose, adviser, Brian JENNIFER JOHNS Clubs 435 , if 1 1 .. am wwe ta wma wfaas.3,g.f,,s :,rffsifs-as Qitffwsiw 'z5::5::::rfgse-::,1:.f W2 s25f5x91?q5S5g33a?Q?Qeg3Mg53gS:5E,35bsfafsfsirgtiiis ?Qf'sWW:2-fnfffq-Safeotiwashfffsfrif335,531--s1f?S:Hs',s:meatsfifsffsz,3f,:IfMuff'f:53i53?5fa5xggi??sf,fws:fsswsw ,fssfrfsfsfnzofffg iraq -Kim, fun:iwifireifffxriiiliffffvifrkfff2fwyt5fe,rs2'wWaGsf2zesfffgritsfrrefii fa fssiwf aft? wwf Qi23:sfif'?fi2a2f wlafitffwtgf 'GiwfanQi:4rfs:w'm.f1ffe.aaf.:fswaf:?fA21:af'f:ff'1ffSy2:2:fter:f:mYfffeffbilrrfiifffsrafmfiwW1:if:ff4w:,.,f:-reefs,:,:,f ilfiwf faw,rf1::sst:gf tffwfsif-ffswswH?ff3i?M?2:efTe,wMf4'fefS:4.fw?:ffsvgirfs a ng?g wt ' 51ffsgsM.zg5s:sq.zgPgji:55:-::f,fskw,,r::,v:,f'i.?g,f:1.tfi.2,,Lfs :gg.Qffws:fKf,::,g..,sg:psi5955:gg:,:,,.Mgzat:rt:s:gssgfmgigwitzizsshggfgaffrgsesrUesmffw--',15ge,f, taayrf, ,wggsf offs , LraskffiframefwifzaafifaffM:gff.'Lw'swSf,y:rfws,425'v:s5:2s5:a:g2:ga.:::'fit'2'Wiwfx:9t:wf w,'ff'5.:, bmi 55,5 a3i,sH,fwq,E-ft-Q3 p e,,g,fg:,W-.5 as ga ,peg Usfwggffrgagat1gg:,.f,,mwqf. D-vsggnga.-,,5y.g,:f?Q9,,,7,f3 gfsgnsy f 5:,p.g,gg. y-.,1x,,ggi ps. ,,g?Q5f:fS:?..,gf fy.:s,g5Qg5g345,g:,ge:,w5:fiMggiwgfasf,,,y.':fi,w.fg,ys:g.,fy, .wana if W sgistgnaixffgfai,-1wfffmgfsagwgazgdgfggffiffffi zgflfficase-Qwsigsfwtwgf.fQ6,.,gw.ings ,a,,Mw.i,ss,m: iff: .ts twfegstgsieaigrsg :swag :,,a:,,.,,te-ri,W.gag:,.a,fs,,s.,,gx xt A , ,29.5.,f':s.,,Q-,5f,,,g.g,.a,,1,s.s,,-.,:vt1:w,,tMQ3gt,X,.,wi,s,,,: .1 1, new ffyirmsfamfkwwsswsebs-, Hiawatha ksfrawbw'-rivhfiitevs svswsfltwgswwswt M saws? wagyigf Hwmwsfm2f1wsv.,?w'ww::wrf.-Hiwff.is: wwf ,Qwfwireewf.:f.'-ifaw ffffw:f3Vf's:,h5:11if,1f6fisf:,f,wf.Sffsabw9v msfrfimfirffwrfrffzwsm 'a? :142'n 5f 5?i-' WSW- -'rwf f Ffaaf' JZ ff:-w:at.'f:i1fff2n?i.w533Q swam wasQw5',s24qsgfafygka,,.mwgg. ,+.,451w,s2gwg,gwfw.,5.,f?g gym: .Msg s 'fwiw,aSg,g.s,p2 gasses fstfsgigtfw tH,gw:,:ys51V,lew.:gi,,,x. swam ix wirfwf 9 img w,5ai:f.'- :sm 2.1-mga, W 'riff-fgwwmagtmwwaazirffaffffwvu kia: gzvftasvfsvsiei wie-124, :H Wim,-5:'53fh ' cwa?t mmf' H---ww.3 vw:-inns, :wthfe-,awfs,.gww::ff'sWff:r:-5 as 'www an-22 wasmsw Zwtswe.-mga wriswss-2v:w Siifwftgtiaszgrwifgisaffumrisisx gawisgxfxfg-i,sQ:'t. r. rw. .f ,wwf rbixmxf ww Jeff wa fwfr:-waferrf.:w,F:S2sMf,5sws-U :s2h5:v5s9'v?,fsw4'epSw-a?N1w:U:zsm.rw1,ws-'...www was ' .wr M or me eg-t wibtfgtggfw wlfffza saws by waffxfw,irfrilafrsstwtpmgzssswfsts? M .UMW 26 Symtfifssmwf-:w5w':QfV::s'xw-, fs wwf- - we 4, nfl. U.:siie.wf::,fa-i,w:,,: swf.fsfgfwrrffwstxatbseslvs 23, swwe-Hmmwwmkewkaffsf. aims-w. .w,gs,gaf,qgm:s::,,,-,:f2m,g,,:w ,045 ssgtgtg, gk, 0, W5 A , , aww, , ,MW ,,,,,, k,..,!,,b,,g N, .ahiem i?::ff.,.,,,5?,,g.5r.,s m.,,X.x. we 1, . gage, ,, .N .M.,i,,as .Hy ., 7. ., V, , .:., , , W, , ., 6.,, ,.x,s,,..,:, ami, st .,s,we'.,,3,wm:vs yfiaegw ,mgw iww,ma,-Q. M, Q-: nga, 4. V A-I X, Mfg fm? ftaeiwawsfiffxf agree-2 fr as-l'W::r,g'f1fr'f.rf fwf f-cfm rf:swewfm,,,:ffwzsasiw:M.f:2.?51'2sewsrgazfffsgfssffifmfewwas-iwifrsxfsfkswfame .fwrrv rirstsftfs. ss:2ff:msiw:Q,ssf:M.mesQ..svre. zwsseaisggat fsffggggiis, rw 5:32535 Mg was if wg wgs,f+12-rm?if,-vWe,w,.zi5fe4smfsfiwff,saga-sye,ww.-f55233535:?fi?ha:f:5m:w',1f:.wa:,:wef551,,.:s,,ef,f,wsfvsml::.q55.,f.,,-frgfm, ffffwww fffifffff::e:,visas:seam:Wfzwasfrarhffwgam isliayfg as,g,gx-,rs3Qt12,5.3,f,sf fgtfa Q35 gt ., at i - M -w.-aw,agM.r.gw::i.-9..w.:f ,Xv:?w,-wcfv.r,qi.m::.,i .wwfv5,r.'r?r:h.w rfafwnsaswf. wsu-ss sg-yzszfgszfwsmsmv1w'msffff?w9av'.swfif ft wwf -V netsw, Mazen: ff'ambien.,sskf:.::sgww5ze.wph Swami: at swam sa- we 1 wr 1 an amen asf H ' U it . , r A V wswzsgtw mf.:-wsa,ii,, ww. f,.fMw hgetw, fm: 1-4 fvgwrlyf Q ,f,:M,fw,w, wrswftwrig-s Newegg, Mmm mgffszgiff, wgwr. Q-qw. Q. fs,5f:,,-.-MM, ,ft,i,f.rf., .ga ,gf wraps: 5 ek' Wg ,wi whiasflipff fs,mg.e5s-,fx as , ti ,sig 9 1.2 mg. Q gfsfwgzafsw wie. gtg,t,f,gf.,,..,i-.,,yi.2g., - aw g :es :w,.k,.-5s,.sgi., w?:v:6,f,i.,5 rsvp: ,,Sw:,fg:2s:g,:.3 wfw., rygzgwp wag.,1.:s:s:af, 5a,:w.:4':eQ,if,.W-,,f.,,a, ,w.:,M.' ,,'i.i-were ' ,, Gsm..-v M. 3 ' -we :gi was Ss- Q2 a .V fwtswfffisfz-11 wtiswqStgw:m,w:M:,a'fggSsfs?s9f:sHr1f:'iSw.: 4,':g,2l:.:tSs:yarwiffQNs.f4,Lt:f.gfs1 .3 ifrsfzgiiglfgwissiis.graysf3,2f,212:f.im:fi:,fQ:,5.x,f::2,iqregress:Q :fewe- Ewwfiftfr-:ff3'efSfzf ,ws ff 1 fr - ,F Q. ara we ,N ' .:fagi.g,fQi.5,f1:iyK mg.:'sg:3ft3,,g,pI,,.:,w,.:f35fi ff f'1's2ggr:ff9:4.:mf tg w,a,,, ' gwptw, I :gf f :jsut M5154 rises? 12: Fwiav: mari, ',:Z'l53' K QV iw- i '-Z'f::2,:ff1'ig3'ri.:lSsfwiirff .5 :ig . 5 :?f,f -if sw wawufitfrisssqt rimU'fi v:2qfr:ifff:frfiieil rf rc, My ,Q new an v ww A.S.A.A. The Auburn Student Accounting Association promotes accounting as a profession and strives for interaction among students and the profession. They have three or four speakers discuss accounting topics each quarter. In November, the club sponsored the 12th Annual Accounting Day. Meetings are held every other Monday night. - by Francisco Fernandez, president 436 Clubs Q, Row 1: Francis Fernandez, Laura Quinlivan, Valerie Bufford, John Sakmar, Row 2: Pattie Holton, Linda Damm, Paula Lamp, Flobin McKinney, Tommy inzina, Jonja Jordan. Row 3: I ,,,, L, ,W Beth Peek, Mark Walton, Teresa Cox, Lisa Ayers, Dawn Jernigan, Phil Parks, Row 4: Alicia Murray, Diana Dillard, Fllki Blankenship, Carole Arthur, Janet Pinson, Sylvia Ayers, Lynn Howell, .f A Q, 4 wi! , ,. ,,-- my . A . ., , ,, . ,,,, ...JL lllyy - ,, MIKE wEEks Stephanie Stillwell. Row 5: Bart Carlisle, Chuck Ayers, Shelton Haynie, Mike Holloway, Joe Bowman. Row 6: John Boller, Luellen Bishop, Linda Brice, Kathy Burnett, Sam Cargo, Alan Mims, Bob Sanford. Row 7: Earl Everette, Steve Nelson, Jerry Brazeal, Jeff DeKonty, Kevin Fletcher, Joy Griffin, Kelly McMillan, Shane Pitts. i l l ew. iw2gf5:5'l?1g,2,g3,3g,, ismgtfv - f ., , , , , , ,, times wsfg,va Q, M 'V I M: : if asm etfggw sf be ef-PM 2, wif fi ,.if':It.j.sS,fwt f' if fi' we A tr , es, -W M :,. fftwe12f,' 4-J 3Hfai1f3Qgws. ig -X as-mv A' , it : if ' Mt A2t'fQw:?5' 6.1m-Ffiaiwv ,ff.'mmV.:fwf:: ew- as we :fi -'f as H it K . W Nt ,Swag ,W yxwsk fZ.:ff'4w' sa it T My W is ss? - wet? ap sg Q Q T' i , Ms N . . .. M it ai X Wf,4wffw's,fw-iw '-t' , ' N, i as Hitfefielfffyqfri V V -iv!-'Qf3'.rafaiff'tr Y ram 'w:f.fv 7.1 , 3,,..3,,aw,,s -V ,615 lam fa ,pf ,again '-is ,g itfegzggeggsae, ameri, iqfwyapggaasgsgya :geo X in fa M wg SMS, k A, ,Jigsaw ,ss , pgslfag my as mhyf, 55,5 shag as, 1, Wagga,-i.gs:f :y,,s,w:f9.M.aQ,.. f W 5965355 gfgilytisjjfkwfi.:if?25v5f':WiiigftS'5figf?,ig?Xig5?J53Zf?:53'tg1tg5tM ,poser :wr 151qQa35'Mt .f . 5kiKfi:f'5i l'f?.?N5 we 9 Tfflfgtffwg' wh rf aawfwwwaxwfwwc Hsmefswtafwfirf :X use aiw'zfa.ww2 KQrEs?f'WZsJQfltU , ,,,,.,ys,M:,,.,?s,,t,,M,,,i,,s,.i,W5i.mmg.a,,:.:. i me is ,f , N, I : t were , 5 Q , , i 4252: -S saggy 5 at Qagtfmti Wikia ss Kit 7 i sf s if 2 iw ,fi at 4 w awe M M Q t as 5: , se , . ,I Qs, 5 ,, ,f,h!,2,Q.gw. :saw rf: ,3,f,5:g,q,w,,s12pw,112,-gffaag mifrrffffafs sgimwsffffgf W5 Q N M ' ' H ' K iw infix : we er ' vwfaf wiifwfHrfrfmisiitffwzi fs r 9, i ffgstisfsae tt it fsfe.M iff we , is i wg ii 5 My we -ic 9 5 we Myg, scggffsvai we ,gy N 4,5 , .I Wsgwsgrawff ww B X at if sis? f f , ef, .fwtifth at ,M,Q,sQ?fs?.'f? eflffiigzssfs, Q27 Y. 1 My fa 5 eefaisg spgisvskyg fs,,sxlN,.,sivx3,s 59.545 qwkwgawggagg G, Vina, y f , Usygcgg 1, A , s , t . ,aww-si W Q24 'ge' if ' ' -:gtk . I 5 X, .wygggf K ft, :.,y,f,.1s:, , .tw .am qghaiw may faysgsxfm Q, -we . I: iq s :wf H - V , . f Seas f 'Y' Ti flilikff. I Ei' i at a,.,,f t V m,y:1'f.:e.efw,w: s . f rt i 57515 it V :M 'T arffkfrzsia 5 ' A ft? V P. is :ffwifQ's?3??,a ' Sgt' ,,,v5:js,gQf egg? We eyfiiiigys Z 4Qs?Q.s:?afFf: sf:aQw.fwfwviwgws QW AMW. is Q, ,M in ,wh msew ss, as it a , sm' M A 'U 2 s3Qy.fm ,31g,,f,g,:'f:Qyfg5234lftmfryesfyf3n5,siS,3:2:Asff 3 if -' ig. if Feff. I 'Q V W. si? '- 3 Z aw WZ rf 1' 1, W'WstErff. .fa 9331 1? fEfW5'we' ?st., tsiaf if 11555 5, .2 it 2? acifwff .af i M15 F ,, N f A piieigiltjtiiisi W ff : 't ffm H: sa: s if 9 sa if 1 9 f 4 f, 1 ,f,v,,My,i,3, az, . ,fy W: 5, A 9 I N WM, ,gn ,P ,. as ,wi ,Qs 15 'f 'f Ee gm fek,,qyjv?g,1NiQsxi'fS 32,353 tif Y f ff :EXE g ffigifgfftaiw ily W '?'l'Q?b2?f?gfMZ? ?5X5 t wffrtg N , . .. rmfsmffiwif as at t i iitlrrxzj, XWag?2:iU5ej2i3?'z:Z2ZQ?bZt?iti'g,2lgQgJMaZ,fsf:1-1lilrisglflgffiazii P ti ,a A., .i , ,. i .cv ,J Q as s,sf,f:,f ,gm A fwsifxrf--Piffifraf2?5t'mLw fimfittlnfsqwifffitxfiirt-M Lis: Y Q gfv Mt 6 tt Wei sf s at 2 A., if N tits t . Q K 0 ,-Nti. 5659 0 as we 2 if ' iifiliflt gjigff fm pr , 5 ,V ,. J, , 235. .,,,5fs?? 'i ,sieg e i ws- :Me .- i-1 Ii iii ' ani' is Ii-I - H -H - -li la ii ag -Iiimigiililiiiggilni in H i 'I ii i iii i in . .. i f W A.U. Hillel Auburn University Hillel was organized to promote Jewish fellowship among the students and faculty. Hillel celebrates religious holidays such as Rosh Hashanah, Yom Kippur, Hanukah, Purim and Passover. Members gather for social events, including picnics, weekend retreats and parties. Hillel also sponsors special events for the entire campus. Services for Jewish students and faculty are held at the University Chapel. by Marge Hirth, adviser Row 1: Claudio Stiebel, Debra Weinberg, Seth Schulaner, Elizabeth Winter, Dean Ritter, Mrs. Marge Hirth, adviser: Michael Littlestone, Nancy Ostrov. Row 2: Dr. Leo Hirth, adviser: Fiandy Spolter, Ed Murtagh, Bill Bloom, Ralph Bozenek, Les Capouya. RUSSEL SCOFIELD Poultry Club The Poultry Science Club is comprised of students who have an interest in the field of poultry science. The club performs several service projects such as maintaining a house of laying at the Alabama Sheriff's Girls' Ranch. The club also attends the Alabama Poultry and Egg Association Convention and the Southeastern Poultry Science Convention. - by Charles Peacock, vice president Row 1: Fiandy Streckland, Lynn Calhoun, Randall Ennis. Row 2: Beau LaRue, Wade Robey, Jeff Butler, Stan Keimer. Row 3: George Stanley, Sidney Bradford, Shane Ford, Greg Bailey. Row 4: Mitchell Pate, Dr. Joe Henden, adviser: Charlie Peacock, David Sullivan. Clubs M4-.-... , 'M' P- if: W , My --.-- W V -J'-ff-W Wwfflffu-1Ki 'fM '-H'wwwM-ygzX:f':M'M.Nw i . ....... W ,WWW --Wzmrff' -'xg-fmw H 'W uw . ,.... k'7 'f ..,.:f ,: 'W' ,Q ,f --M M M1 WMMW .::.:.:.,:.1-g,.,,M.- Www ,gM. W 5 ww wwf 'Q' ' WN LW 'mlfw 'W' N ... ,,,...A. Wm M --W: HW ' ww-www ,f V 'siiasmw -- -: www ,WWW M ---' -M MW W fin. : .. 1 A ' WH- cl., W' Www'-f' Asa2:-1':1L'W-- N HV , ---'- W---W: :.,f'W N .,.,. ,...... ....., A awww li H .. WWW WA -1 f MN..M.M:g11..a,.fN-Wfgmw-WMM-'NM , V - J ..,. ,, -,-- f gwmwwwmw M .,..,..... MMM .. ...... ,... V WW -M W V m.., W N ' M M, ,g ,www ---- W Mm, ,N M- V, nw V VT MM- N --------- - -W---' Www., .... :IW- ------Vf ww Km Y 'fm ,i...,,,M W u miLn,+, w,,..MWM M, .... W W... WWW W ' ...M .,,, ' 'AMW' ........ W ,l .MN ww 11:1-f-MQ4:amMN : -' 'f wz: A , W - wfjMmg::m,,. M,M,,M-:W .,.,. ,,,,, ,ww NJ ..... M11 mm f M N 5. -M 'fri .-A,.,.. -' W A MQW Www N M-:M ---- MM - ,Q W ------- uf- f , MW W w ww W- Mmm- -' Wm M5 if-W ---- , ff ..... 'ffmm-W, M, .. -wfw x ww Mmm-A,,g,1:-Sim. :f::2:g,,.::Q' . - - N iw ,ff ,M..uW N f H --MM h fm ,' 5, , M,.,,,,-LZ111'.':.'. '?'wa fm1gg5,,,J3LQmm -Q-fW,,g, mM.,:MM. V VN W NNW -N using-555 gy- ,WM-vhzgglwfl-W ,QQWW-3-fww -WMMW M 2-N-Ziff W - ---- :glirwf-ggmww -'-- NNmZgjmWm'h W -,-- , 'fimmRm,Wzz1wm .111 H M M -MW M N ,,,,,,,,,,, LW: -,----- .... . Wffrx 'T 1 '-'-- MW: . 'mm -'-- Nam-r MMmf:., M ,. ,M Awww ! H ' w-N' .,., Wmmmw V. ,mn w,Mgf'gwwWWfM ,.,. , -- f 4 H W 3 x . 4 3 i Q S 1 i G 4 5 2 5' ,ax nv. X 5.4, V x x Ji- in fvmfwf QW W .A Mn? 'Vin F M A, YR' is an lp, 'S' ills Aft' pg an -X , 'ff 'U as ,I Y X 'QA1 '3xe' u+ym.4sy,1, . I VYN ,xy ,K Q K.. i Q'-L. Afgkjwsai g5fg15iQ5g,Q 'K x fx l y tm Wvkvws' 52 as Wins Tig? iii 'zfmwizzl Silas, ' 'igifibm' as MW -,ws rw - iv -2 Str zgiffzwf it Q C tvs .. wa, . sat 352:52 DQ-figfggtfa , tfzeiifwlgfffg r Ma, W H MQMQZEQ-mriygggggiyigxgsgwgxg ,ggh Mscgzggw. gg fi egg gg? ge: Q i,.,,ii25.w - if - - -1 M- if W M , - ---- s q ..... wegaksss W .E 525921 lssaiftwz F i wa' W MS. A RSM sm? is V I ' 53' W j:1ggi5i2gqxgQ,'s K s .- tesgssasfse am 5? 5 95 ya, as it W me gk EX fit' N? 53 5 Q by 5355 sw an A X75 Mitt? yy-ffif 5 E .g M aw he wa: 2553 ga'ExaW.,tsggite25a,gtttaigi , ,la Q ,gag .2 A air tZti,si'.b S12t'itJP' ezzzwf Anti: Sleisrisfegwititzsazse .QS is ag ai, wtmatxw awww, Nm. we .,m,,,,w.,Wf , H was ssst0ifg2NW,,gQ A is :Azeri M we asfggtzs rf 'ai 'reassess ft 1 ,r M, A 1: NIQQU i 5 N- gait A555556-i mesgsg isfggg, NEfg?fQ1.w iiS,f-5555 Q iiigigssfsgg frg k',, H 2 Q itgsxd vmia 555 J? W is H 52: is 5 'iz sfsgwwfirizgwgwszrxf ,315 wmwisggaim:siwaffwzgigesimgfgpsf::S3g'ff52f:::g,, ZQilZf2,1fi,Sfgx? 5 3 Jig 2 ,sh ls, M ,gf sr i-Hs-f fm eg mea' :ZH 5'i:2 W5f1 K P5511 W E'??eY 50 'iftlffit r TT V233 J E V L 3 X fmygiai, , ge232.T:,.t ,fi i ., t . ,W ,,,,,M.g,,,,g,w,m H5533 yg Mixgggiyt 5Q1lZ?5sgN Sis? mi 353555: Uiiltmiws 4 'WS Q55 V ifizasgmggi sz, Tw TN iW:::-- ' 1'4S9J'W ei '?Xf35',fiT2wg ywAS?t reassess iiiiwfxienii Wszfw etziszfvwsssassifimf :staff f 2 -rn. fmt. -: vfsww .mei mwzff New i vga ,A ffmf:,3s1.,ie'?Waww0i gm: Q: 5' .V A Q 5 Yff fx, Q N to Q t Q? ffyfiifi gf fl sis, .uf it 1 1525- -- ffzgi, Zfmfii 'T iff A? ,tags ,vga it Z :iff tiff! 5212 weft Sh , it 'f wi t 2 9 fi a 1 f 9' ,w P v L: Q .Q ie M i R 'X Q A w va 2 X H 52, 1 3 5 fi .wwjfs mg 3 ,igwa gm QQ . .Mk5r1,,,ggt ,sg it Qs M. ,veils gs j,QNg5agg7v?:veQga,?5f,,31 S fifgv ,, 'i.,,,, , 3 V, , W, . , is WMT.aW,.,ggwMt,?5wlM,-fgigwgfggmgfggfm ta gisagiigtxli S tj lF3iWsk Qt 'A 5' We H555 t tw5,'?t3zg'f'Zi'i:,4it'tfig:4?,fff::r:fi'?t'r'i4515 1Zrrgf.i,'rg,5i4fgxijQf 0Qga2f'e:?iPit:2Zf? , ., i3?t3fE5?E55' Q ,smS3,gs.iaiSg?'g .:.::'. - - g Z A 2 s-,lrigzs Sm J f:g,cqiew.5: 'QHFNZIQQMXw'.eN-Nw,2655'Mtf-f 55553 itasiliawmimmM AMW SQQEYI3 wwm swrtitiafgis-Meg1gfieesSi5,sg?'M typ, ,Q-,iimgpg Unis gtwastwgxlg wa msg msgwwfeggiifesva.,J5,g, 'Hwtmrt 4 w-vs-gt ' : iq is-X - tfwwlfetsewer,-w3'ff2w2'l-5Ns-we etwzfvk Y Qsegemmtxtiraofs tilmtatww fsrww,-4ggEg?Wf'w -fftwsm ibn . ffm was ffwwa :Zgsfgw9,2s1wrwa:wi.,, ,,Mm.Zag85vawrsgsi,,gggsgtm,,l.wijiwwa 253, t?pa,,-tysfa-Lew, sa 5 .v 4 v Q W. as as U ,g was r ia awp swat A 1 . Q., , . ms, 4 .Q as ,,Mw5as,, W -.saw , isim, tv eval, , ww, , wo,,,,9, yum. wise WU, -salma, - eg-1asM,,,,,, ,W ww ww., M, ,J-vw L,,.UfMW,,,2, 1 M, K 6-s,,,1,,,, . . . . ,. gas . it 4, 'Q , , 5 at , M igqasfzgwww H, U W, sm wages as,,..,,2gxm,w.,, ewfwm, A ffm . ,fem eine., my-2, 'imma,t,4PwaWirixHffev.w??,w,-s2frH:.si-tmasseexfwea-0 ww. is ssmwi, -MMM., were ,,.,,wiwW,g me-Wtwi, em as gg mt X if 'R A tr 1 viii? Q' .. i . as ff.-, was-W Q es gm, W2 wa? .S , A v ,fb xi . sammy' . ' it , fwfr W V-was Y wwwww..w,'egMfs.v4.l,eHwww ,,g,,f12Qgswgacttwwwwaaztiitfnoq.. ,tyzfwfsngts twat,-s :aw , Cami rr-wwfrzxf, Q, fi A MW. f er. Sfwmg , . is ,fy ,Q X .- 9- after as wagewf s ttfwtipw swam i-z-fw.s4,w,: ww-Qlfw New www ,ww ,,:.,ri few g,2'Hwwf.i,. W Rsswytttluwis www aw: Pwsiwwf 4 wwvw i,fsMf-Hg.,'H-cfm..irwwaffsg,'fwMa.W W6 ay-fe' M gp if M ea X A N M Q 1 Kgs , wmzgg,,m.,,st:5ewmg,-wa.,.www WweimWzz.f eMM.:3sQ:MIWavesofk,et:m1i3fiiws:f31smm3t2'fQvf-femyzkmmamafff5t,..w:'-wwsmzfpwfev- atv ziismifmstw 7w,gv-wwstsfbgbi awaits gag 'W Jian' WF L A-' -' ' 4 Q H Q f,gfvf'i't gmW:?Cww.12newGaiam-QZWM2S5525-'frsggsiiiriagwssviifggfrsimisffwaillflittmSfiffgdfweiiz-Swwwf:WML?gym?Aa'-Z3iZ2w':h12i25izawi--siiigw'sisiltftiimffeisizlzggvem5Si95i2fsw5.'Sif5:3?:sfiftfiisigamsii .ws EPQHSQ .sg P A .12 3. - if at tr W, at ,,, 4 any gMat.i,g3g.swm aw WYKZS-M55 mzgtgsgvf aiim,f,wm:..g,,,,Maww.,ZNAWtiX u,.Q,,,f-N,.1.a,,fwQw,,:ag:i,m,: .Q,gwQ1,smggggwm:isles-rzkws gqggwgwgg.aeag.Wv.-m,,gMg5 gsm .:f:gptw sifafs-ffawtfw ' ti X es. 0. ' F10 aftf3MyaiZa'35i?3s?5ggw. at Jigga Q 't'mQ3stH1irsfS'iimYaQiqsm2g?:52gfswifltffqfi-55 kiffssfv gfzfwffzffiggwi,fiimm Mwggv -5-zaigizgigfwfwsstwgisegiwswfgsiw-mS5e:?.fwfksgfyffwwf,may emit: lzgqagigiiiswgtgggg K. Q W? , H X ' r r-we 1 ' AU Public Relations Club Public Relations Club is open to all public relations and mass communications majors. A student chapter of the Public Relations Council of Alabama, AUPRC is designed to educate students in the public relations field through actual experience. The club currently consists of 50 members and is actively involved with public relations on campus and in the community. - by Jeff Christopher President 1st Lenda Bridges - Vice President, Melanie Austin - Secretary, Jeff Christopher - President, Susan Morgan - Membership Chairman, 2nd Jennifer Craig, Malinda McCray, Candis McGowan, Kelley Glover, Deborah Rickles, Ellen Mosley, 3rd Leslie Gingles, Ann lnman, Craig Featherstone - Secretary-elect, Marianne Farrow, Becky Thies, Nancy Kelly, Shawn Sims, 4th Nancy Blancato, Debbie Story, Martha Swindall, Debbie Bell, Betsy Casey, Leslie Lingle, Iris Dabrowski, 5th Jennifer Ray, Sharron Atchley, Lisa Hammack, Mandy l-land, Kay Acton, Kathy Prewitt, 6th Standing, Ginger Moss, Mawk Arnold, Harriet Glasgow, Johnny Merrill, Richard Castleberry, Kim Kulas, Virginia Pearce, Bobby Nix - Treasurer Builder's Guild Builder's Guild is a student organization for those interested in the promotion of the construction industry. The group holds an annual homecoming barbeque for alumni. Speakers on pertinent construction topics are featured at the meetings. Members take part in cookouts, Fine Arts Week and Career Day. Row 1 Carol Read, Larry Borders, John Lukens, Secretary, Jeff White, V. Pres., Clayton Edgar, Johnny McGuffey. Row 2 David W. Plott, Julie Langford, Mike Purcell, Bob l-ledrck, Wayne Williford, Richard Drennen, Chris Pounds, Keith l-lornsby. Row 3 William Bray, Pat Williams, George Smith, George Varner, William Moore, John Wilke, Stephen K. Barber, lan Tenpenny. Row 4 Mike Propst, Kynn Harris, Jeff Brooks, Andy Blackburn, Tom Peterson, Michael Reardon, Robert Williford, Brian Wilson. Row 5 Jeffrey D. Gattis, Steve West, Drew White, Greg l-lunter, Stuart Miller, Paul Woolard, Darrell, Simpson, Eric Hunter. Row 6 Earl Smith, Mark Barnes, Allen Guillory, Joe McDade, Steve Hudson, Jim Wilson, Jr., R.W. Aderholdt, Doug Davidson. Row 7 Kevin Wilks, Rex Adams, Tim Turis, J. Bender Betbeze Ill, Sharon Caton, Mike Davenport, Mark Taylor, Sally Kimbrough. 440 Clubs John Reed John Reed V 'W 9 33555155333 WW I QWY5' 5'f?3'543v'545z'WMr L--431321 A it 35335, WQ.'?fZ?nt7t3YY3 SWM'M1km3?EEW VVV7L?iVF'0ZE PW?FW'MZr'2H . wif 46- We 4'-Mails W 'VE,.SS,iiW'NWPM' frWi.wSiB3.'5QZvu m f 6 M twwl ww N 'www vwrff 1' Nvvww w v wwwzswsiyfgf V N 4 enlws ,f.,a,,,w ,Na v , 4 ff S Q Q . ggmggfs, - f -'Ji f , zfgggiggggg-,, 'f',J5Al?4st3'g?S:1fg r wmv,-:r:::, sstszsrzq I-I1-www.. .mfrvgyg sg wasgggffsfgyvggw-rw f-.zfw G wtf--Qi-afzmwaw-mf get 4 m1M..m.ssgf-Mwwfm-g- we Ws.,z::v:wf1gfw-5-, gm,sfs.wr::s:.fs Q-fWt,eft.zf,,::m:,zgw, wr mm.-as wr rf gg '6'ag',gp,f,.iq iiwwpfg 5 AD wyrgg ,pa f.f,.QQs,.gsm: ,Q Mi hkgwe we sw!1vswfmp35wf.s.i ,WARN M, W, kai jgwrgllfwmr is .,w1w5.yh,-,h Jfgjfwgff-458-,Qtqgpywy ag-eQp,..9f?2j,,aQ'mi'W'2, ,g'g3 gg'-95239, setup: Q gy :Q'W 5jqgNi5g'fg ymagkgawsnx,w.,,.,,S,'f1gjS,jV?e,w A aa1.,N.f.w,hMwasBQJQQQHAswM.g,g,,,N,,..,f3,fgSgf wp. ey gang gg 91, Saw 7 f f 1 fs r :rf 52 fi F3 r'twQT9L1'.'i,i2z'af5:-0,Wegyww-1 55.91631-ms,Q.f:f.,z2g,grTgaY?11f'fg-3,rf g4r:0aSi5 fwzwxtwjinsu await:ggrrgip-.ff-wM1:l:.t 2:55515 ' vqyrgrgra- M get an-f::,3:.L:s msgs, M-was wizzigszg ,wwwsmf5s:.:,:,,g?:g,,,,,L,fg5gggwf1-W ,li-fafsfykf -3-.,'rma.wvwgN:., .,,Q-vg,,, g31,Wjg we, A. mari? fgssfsgsfzgrwiwtflfw-wit - EPZA,-.Q 222223, si:-:wtfigf:f?w-Mgzwgw-.miwiiw-fs sssgzgggjggjgggffrrt-f,-M-wi? J -- . U' My 'rf f 1 A r -aifffssmsasiGfee:swiss?ATsiftsiggtrisr-ai:wwf-me-vim-wassays , Q, - we isstyiwug fsizgf:2m:1gf::g,S r as at Q N9 Q , 4 salemggigiygifggggi5.,g,,,,,,,w,,,,,..,, ., ww... -fx ga.t4..: NM.-.?s.wz.y., ,,rggzissstiszsetggqggiggwtit,.EHWWN.iggtzsrsggyggrgfr-tr-.- ..W.,s. , , W.Wss,.1.,,ggigggxggggggwgasWwits,igt,,,,,ggggmgg-iggftfm,,,vt,,,gE,,,,gs,,,j,5igmy -.W .,,s.,,,,,,,,,,,- -www..t,MM,wi,W,,,,gg . .f 0. fs . - I - Maw M we W ,messy ass t1iQZ'555',iiff' 1,75-,,fgg,,ggv,L.,1sm W wil-awww . :sg as -swf.-.-, miifiwrmi wwSsSiassmNw.:sr.f--rfewes: r- ,- -- fa--sit. ff Amari: in az 1 Wm if 1 if --ISffitfis-W2fz21.ae:2::z,:?r::5Gwe sliliwiifwsifipi- -f as.-me 72-saWQz.:.:wfeS5sSwmsi- 255if5S?ESf2f2RZsi1'9 fwrwlfmr- - 1 s :az zrffmisfzw- www, SQ ,M , wi fm - .awww lt:,.st,.-.tt Nb.-I, . - 4 f f fr messmz., tm - , , S 2'-fs iwtwswgsiag 1 is , W 4 , Q , - www- - , , , v GNN Mgmt-, , .tg l, - ws-msmawsta, : 4- M-tv-4 X2------ms we -DMN. V- v v . . ,ts 9 stfgwzssrlssv 53-tiawwwa , gwrwMwMwvsww.,.,m - , 3 I L sgszf. Wmwfsr l,hf.1-swan. .timeWmfwwwwmfamf fsamf WQZASL Vsirwemfswfffffr X 9 Q 4 s'sPt'1Lv't -W wr- 'wfeffw-2' my s M ssJ:A?'t'1't5Pffr'2H'-fl-f'2'Mw5f 'ws ' Q, WWwwwXewwwwsizmfht. ati: wfwtwwwfr-M iszismgtiggy gimgfiisgitiz . - 1 .gggmfg f 2 xr: -,sfitffsfisifi 1 r f 5 Mg v 2522233.52525 -- rg Tir: wzffz--Q -X waxgrfxwfifimz MW' WW www wsfwsspssfssgmiiisrsrsfwgwrgsfvs-s-afmsrm. -, z5i5:':g:,.: sf je'-'wweww -- lzgwzmsgf42:Uwffwswwfeewatsm-.awww2. fmwmwm-,. 1: :lr Q Wstsuw, 1 -itffssere-wwf rs rwmxw-igJ.Ti Wsfww wsmws Q Q- Q -I was Srgww-wwtiwsstsssim-:SF If M lm- fa sms:Etsffwf-f1wgwQwU 04 Q me F2':,:'tfsg':ii s' awwwwfb- firm-:sv-sw J iiixiiiaii' --wwmw-W.QQ'agswiiiafrewwsswfvm J 'P W ww: X as-wg 65353234fvw2we2mM-.,-.xsfgfgzggrr 'M-new wwfItfs'1:tr2g:?PmwM3245 5 Szwizwssw awww M Q rztwf I Q . r 4 ' frfs winvfvx L MW-2-wefwzav. 23 ,Ss -151-WMS: JZT'i'1SE'fVi2?L :fa-fx 22 2 at-wrwzr fmizsszsQHHW2wwwmlzmwfsfwlH mama , 242:15 T7 swf'-IMM-smri ,fl :gma- faiswg-sgvye,..,.fvPffsff::,.f1. ,Q -- sa wwwf 'Wawzw S mwmgmszzagr .sem sz:-.f 1 , fsvspsvtsssfhtMawwwWtvs1,se2ggmw:w -We www. t we - ff --NewH-5-A-t-.mtsstfz tn at :else . w wma .sg ?5WQ',f r 4 W -. -:i-was-I., -Sfssegww:-M,-:tZla2M.4V .l.,,ggQ,, rssww-w-v+vvrewc1m..Qw, g.gg,,.:zp5m 'wwwew-'I A NH' r fwiwmaaawfsf zlftisgffsegswwwmw- 'M3e'4Y- Crt-wwfsgww im Lffzsiwifw - sw.-JSM. -my ,rF'Mf2t's A - 'I wswm- situ:--Y in swggwwriwwpr-,ss EW' Zfurr , fr rf --Q---as-fr :si Wi- ,MM-.ve-:V -wal ,fm-Q sis-siizzwffeww www-Aft sm w.,wf,:'w-wyw-wi yhmsisssksfriss ww, mi awww 4,3 ww' we gw-imwseqwit-3g,::,,,,5Aztsrww- ,W ,f..,:.,,.,, ,gky-fkffw W ssssw.-Z rw as P PM w-ww---tLvs'z:4E63i'w'?ww : 5 'Ma r ' f S' awash- ,t:,f,S t:A'fM,: ff-wwfliiw-W ---.fleixfwsss ,wfiwwgvz-Qsaoww N-'Jaxx-.fwfr lsfsvggarlffffwwf v--MMV ., , f rw,-qw emo Y'Hlwwwwvesmslsfiitfw I-fwxwwwwv mswm-V. -,swwasw visas-wget. . fl wwfrw sv -.-,.,,f.,.,,, Rae M fesggivegwsw wwPvw,szZ'?,wy',.:W..j,: gggylgggwg, --r--We-f,f ,Massa : ,y5Ns3w.falffv-f- 7-..ass.452,3ic3gdfwwwwg-is:a,15Sg5.BSeSws,,:1:,g'frggggw ,wg-.msgs , r fJt..':.W.t..:,xfewgwvq--,Q--fm,.shgggggqggf3-xsssssivsswsts, :gg 533591, -mfwmeim 1,,1fM,ri-lvaww 3. ,,.-.MW-,,,.,,::,,,y3. 3435:-q3'20 ' 3 siisslgwsgw wrwgwp Wzsmww M. . .gslfriki 51:-f , W ww riff: Yiiitui - ' i wffwf-f M - :SKQEPEEQSE 'wwwwgkww ww diva,---iffzfr zz, :wmv-1, , f- : Y wwawvfw- f f 5. f :.rs?:fM-U wwfswss aa: ,tiwgswwrfvewigr him- mmggyl Mgmfwyn ,ps.:g2wg.9ggrg,gg N I mmm?-wt, ,sg 4 sm - tr, , ww Qi, we .- -me sys, 5 f I- W . .J W we .,::vz.:gy,wwww-f- -- ass. tw is--WM -.::::.gqgs-wwf-.2-was me ...Mlm we ,,a1-rw W- ig, I Tl . 2-www-Iffstsigggggggisgigtggifgggimggwgg .ggggaezggrsyfszg ergpgs, y fl gif A- 3-1-omit-sfQ13ig53132353552325:2-'142'fgggaigiisQtgziyigfflgggggsgeQ tzzzsrszzstge-329,55 f f- I-s,s:.wv Q-, Q ,, WW mv Hwy -4 :fwfr-W M zzmfmfzzl fa , , ww fi L .Q .rm 1 , W was ws,-'A ww- M 551--we-i. as ff fa, -rridfifiwhwswzt effmgwr 2rwmsmmiigsiaissesfitflrzarif wgwwfif -3 V 'Qt ' M- W qiiswsfzesfzvzff15r2wS25:a?ss2ti1fzzifigiztiitesxkfwgf 3 a 9 assesses, A B Q -Asrfziszw ig, Sfiffsf Qismiisisswsrws Si s 'ffsir-Kyiv'-'ffi?-i , , yflfflf-igfifsg .1 'I 'X' I 1'-5 X tv N P' g V 'Nl- xx- R E5 45 Q I f . . , QQ --,- t 5: vw Q A.U The Au conference championship tournament held in Eastman, Ga., and the club was voted 'Most Outstanding Club' in the South Atlantic Conference. The Auburn club was the host for the 1982 Intercollegiate Nationals held at Robbins Lake in Montgomery where the team placed sixth among other teams from across the nation. Auburn's team is very active in tournament activities, and the ski club is well known for promoting competitive water skiing at Auburn. - . Ski Club burn ski team won the by Lunda Carroll, president Row 1: John Foley, Eric Newman, Elizabeth Dillard, Mary Lou Buck, Suzy Schultz, Donna Watts, secretary, Carol l-lilton, Ken Bertholf, Bill Burdette. Row 2: Jim Harrison, Crawford Ledbetter, Luke Bloodworth, Anne Tamblyn, John Berry, Glenn Jordan, Beth Eaton, Gene Foshee, Shea Sims, Greg Worley, Bill Parker, Jeff Gilbert. Row 3: Della Nemec, Lunda Carroll, presidents: Lauie Workman, treasurer. Not Pictured: Chip Matthews, vice president. CRAIG SHIRLEY Clubs 441 V v,.,,, , W , ,, ,. v it Q M .. , W -,WW sm z was wi, -sew. , W fern Q -,MN Q, up m 4 9 ww ,pwpu 6 ,wana r-sigywsswi , sgffeg x-fggfff, 3j,Zw Q i ?twetb,V'WwhE'K'-412255 ,2M 57SZ?f'Q5f5l9iS,SPLW?v f2'iiHidffiiifkgiflja7Z!'fK5ZW5553 bZSfQf-iriljgQigiggrfri f is sw li Mgtiwfzitfzgg Mzggifwrssisitftzwiiiriirfsifmwwf? ?f2f2ff5:mi,?lSi:.f V M. 25142512255-H5I.isagSfzifgfgiizsggzagizesgws355fgxmggfjstfizgwimfgfarifmfigsaiizggig1i2N1s.1,3,s?fqgNfi51:mgi,,,izg,qgv..z:2gQgys1sgg,g,ff.15,g,y,ysfg,pg gmgzfgfsg,-v.,,,,,g,v ,,3,,:MJ,,v3mS,,,5Q,s,s,,g.p:5g,,,iesgigsggygs ws, Ugwgwwgfwaj Nisgjwovetzsgaiaggg wslitiiz WSP3-alias: :,w51.w-Mr -s,z,g-si. iwsifwmt..-Pr3,.,Q,:gH3,sifztsggvaswsgwggfsszwwisss,mwsgpgezfe 5'gmag..tWfiifzgwaagw' -JN,.gssamgi'fr.sM.z::ws,g. ftvwfQsiqssM,isjgsefXMsgwssgr--grwwtig Q is , ,sim gf,mi,fgM:f.i,zr'iwfe2ssiaa,i,ma.w.,qgg t5 ?WMR ' 'cttw 0 35' :wir may -as,fsvi.i3,0N fe.s,.,1m,.w,e is f,wr.ag,w . gwqags ,gt-fwfgfvWA:n'waZwMst,':fM rg, w,zfw3f.Mgfaig.effrtlswsvfm.::rwi.:5QM A f::Wi,.sw,f.. ww swim-fs'4fmwa2QmiN,.:Q-v,253 zgwfqzpasws -im. JBA-wiatisw set'-ifmvssfwwsw f assess, ,,, Zqifrwsfifs we 23 Qikdw Mix ,fam wigs m92t,.f. ,wat.: rs- ...c-what ,..wmi.wM..'.. fiwwwmzwmsigiiUizsaswisezw .1 ww this was ,wmzpm.,.w,MMmf ,-.wmwaw-.. fitskssegfu-ra...gqmazvwwi,,,fgf,,ga5,,,,wwvs:.fm is is Vfgggirwgf. wissmggwxgywg zieigmgggsffggfggagsggggpr saw: N52Mfs:y5aM2,,,zfwfmyg,,f.Q2,.,wie:,,2fyf,,.:5,i5Qs.:..yfwwsmgtfU--A.gggmawiwiesargssssivwrssissmsisgwmggwwsigggfeast:-:rqm:gsw.frzfffmsx .'1sfma:3if' sssrsswiswi0.flliswiwvtgmewisff Mgstmfwiktssssw'asftwisssfsggragsss fW,.w,,,,54zwM., 325,521 if as ,, ,, Q, is ,sisqwsh asiiagwmzfgswzsatWi.'ifw::f:ffMa:rw.a1aq-ifisfsfmszws-sf'tisNwas.mass:zfmzsswsaisswssaiQW.::fgwmggm,::b .s:g:w.gw-. r fizfywastwrafsi.-Mgr-wfagzfmsstrsmisiswmt eowiwrfrwtfiizfwizf''rf Mikie? ,Ss ,,-igissf-Mwst 0523 -Mag Qislfiwggiigng 3iS'g:SiwP'ss .,mfw.Z.tw'.g, ma xfgswfig4wzzwwuaaM--.,.:1::yswQmQ.w,mas f2igi.m,wim -ww..:.:.vm.ggmi3.,,Q-ss.,gm..b:g ij- .,f5m.,,5,f f,.,zygmLs.i,q.,,Mi?,,ffg Q...,,,gM3s,.9fs,,wmttsgggas., ,,,,,,g,1,..,,Q,yf was sss..7,g33mg,gw ty., .N ws , ,, . , on . t Q ,, is ...tag,ig:'...S,...,,,..,,.,,,,, x,,,,f,,,. ,.,g,,, ,,,,,W,.,M iN,,,,s...?g,g.,,,,,,:ssss,,z,, s,,,,,.3,.,..?gg.,g,,..,,M,....,,,,5s..,..,,I5,t,,,,,...,, ,i , , .,,,,,3,..,,,,,,. ,g,,,,g,,M,,,,,,,,g5 MB, Ag., N ht., ,E MJ,,,g5,,,M,,,,,,,,...micx ggg5w,.5ws5ggQ,,,gg5iM,s?5,t,g Swsfffifwwga'.,,xw5yW,,a Mt,,gM.i smzgw. .MmMsw.asft.-l, 2 M,gQWm.i:t:if ii.agm.,,3,fgkfm.,gm...g.wma? W.,,5Ma,yK-as . 'warm V MwwgwM.4..,Mwf gym-mt.,tgU,w sgsm,t,,.mg.A.,.Mfffs.:s2i:.wa gg.W,.,,s Www Msfiw za M wmv. tw i was M Ji igffiwffsefiirzfzfwfmw,f:'wssr,:s,tisxrfgwiz gm: E was-meWimszsssfffsiszgmsiige-ef.s:::gzMar::1e- zff , 35155-Y,H5ei5?s'B39awA35?'2ie5?Lq5g'.3i355i '3?'s5if ??,4ffX3Li'5i55'?XS'9WTQlg s1-Qixef'-f?'Z' A F ,sf M-wt.:I3'w 'Sw .Lsgsz Sw ,M ls 'My Q sf' . if :- , 1 M, sffiims 220411,-'teena1y:,.sgffi.ff,f2Aai cgswsiisfr s1:Ut,g?wi23:h .i g23W,? :gm-Mt? -zwsggwii,,',wtQ?fMJ'wi?:Ssf was w'?iPww'33 f2mz:5gm..a,t,'fiwZ. WJsbyiigwi' y,fw4sVgw Xgwsxsswmiigwfm if Mgpwkwew 5 - ' ' ' ,,ii,,iggsfsi:gEwas,,5gt56 iati,.gg,g,a,,,,ig iw rpg H5 Q' .sgggatff ..,.,fgss,,,. ,,y,-a2ggs,.,, ,559P0935a.,4egg,s53igiigxqs.sz:,i..,,5gfgag: fwu.gm.i. egwmge asitismgeigetQfmSsaggssmwglswsgw?gwWw,m me gitgtviiagzggss 22,5-wrsit:,ff ywysww ra tie ' -M, S vltwmtfe.r'gf,i?'5i2:23grew:ggfwmgi-gg5f2g,izSgUisgmgefssggap .ggggw ,ssigg-v1,es.t ss3hi:Qwi:gg,5gx.,S,sev f.'gjLs3::ggy,xrf,Uiifsfgggftist.iifgalsigzggsm5imgf22i,,t,g,w5,i,s5a'N,:g:gsg,,,ggwzsfgzgggef igqigfsiitsngggg .,,,gg5,g 5.gj,g5, gigs,-itmgg sgegmissrngg mm it Z , aqagwsagimsi,ifgsegtmgwzissgggefggssszsI:eya2sSa22sXS:2:f,M?5:kV.zi.s:':g w.is'::w1itfg.' -S 'flsggsmifzzgfzi:Sawwfsggfyissssiazgiigiifi?m?tszvgg5is:5sirwtimefsiwwiissmc.:vw Waste fe'E.if:S1we if-SSW -t S 'Z it A 0 4,-5 ti 'Liv ss. wessfa-fx::f te:Hsifssmifzilgwassggmgtsfwmiffli 5segm,pggM,gxSg'15w f- iifggk rise'--h21:z.'Dws2fe' .ff inwagerQM2iFF:Wmsiim-wr.4:wwsftWMEsisimsissylw ifaasigfga sszgsiwitlffstwsissyff-Mitwvwym Xyf.'T:U'wWs a gs ssgngwss P Qt.-:gsm i tt if 15 Q s -A Aysgq,:f7f'.ugH:.-my gsmsswfeW.swwS0,3fewif6s,,gFQ?5 frwmzgwwzw ..f.2iws:f wawK.rff: '.':: was 2-ffisW:swfissff0-weszsfrwiigwstM,,?5wmiN1fwfw5,.,g,fE,-M,,m...3.,::ms.,,w isismsyggsfsitggsfsszgr if st, is is af ., W. gms wmswgw swgiigzwggfissssgbfaitisimm,-,1W:gt,':w,,,,,gs..,fg .i -.,,,gfW, sg ..,,:55m,, Ji i , Qg55f1,,.fg,gs5.i.i,:v msgggafrsmswiwiigw-1wszzgggmtiagrams m23:f:fW.,.wstw:p, fw.3fge.p:w. qsfgmg , s-suggest.swawssssgwgysshgi M fr 5, gs ,251-1 Zgegmxwfqgg ga sag wiazigm g,gm,f5:5m,ggm,.2:fewmizffa.. f Hffstgw rffeig wsiwmsiwvemtiggm 'equi gggggssiggflgmfmggmigyfwsmstvweifcA'wmwwmfmzvtiawwiw:Alegria 'waatggiitwsiwi-E at . , VW MMA :Aires Q-i mwf,i.,wW i . 'ii' we 'sf' .ala-xiii Me, n me nf Y re' www-fu we f:.2srm,:,fms fs ftswz-fwii mf::i'w 5 Y f.S?::fSewbe if MN5:fLwfffS.. Uwflfsvw We QWQSILS! ws? as we Wmsfzs ms?-zfimiisf, 'uiiwwtifsecfs v ft wflf' si H12 W ci-2 :..-. 3 Q 2.::: an if zz s m f fials ff w - AS W iftmifi iitzs wef gei .. ...Q zf wrshm .sg fe 5g,g Q,,,,.,,55 Mtiss z kffgi eszsi iw f i is 2-gf ezssp ws as 5:41,-gtfM .,s5gfw.: .L P, semi w as we s iv S K ,- .. - me .- Ji ? 442 clubs DECA Collegiate DECA is open to all distributive education majors. Our organization meets throughout the year to organize and develop various types of collegiate and civic projects. The main purposes ot our club as stated in our bylaws are: lj to complement and enrich the education ot prospective teacher- coordinators in their duties as advisers of local DECA chapters: 23 to promote and foster interest in distributive education, DECA and related educational fieldsp 35 to develop a respect for education in marketing and distribution as it contributes to vocational competence. - by Barry Blakely, president Row 1: Cathy Hutchins, Tammi Edwards, Melanie Dice, Elizabeth Colbert. Row 2: Alan Boshell, Chip Miller, Barry Blakely, Chuck Thomasson. Block And Bridle wr? . . ,.,k , AUBURN , B JOHN REED l The Block and Bridle Club was established at Auburn in 1928. The club strives to give students of animal and dairy science an opportunity to practice what they have learned. Activities for the year include a Little International Livestock Show, Ham and Steak Sale, a horseshow, a beef carcass and ham rattle, All-Campus Meats and Livestock Contest and a quadrathalon, They also sponsor a statewide FFA-4-H Livestock Contest, International Livestock Exposition and many civic projects. - by Nancy Ozment, secretary Flob Adams, Chris Alexander, Jenny Baker, Lee Barnett, Troy Bearden, Cathy Boyett, Lisa Bramson, Jimmy Brown, Laura Bryars, Jett Bull, Darrh Bullock, marshal: Joni Butts, Dana Chapman, Margie Chorney, Heidi Clay, Catherine Cole, Danny Cowden, Jenny Crisp, Gaye Crowther, Mary Beth Cummins, Flandy Davis, John DenAle, Meridith Dobbins, Donna Dorough, Bose Drost, Teresa Drummond, Tammy East, David Evans, John D. Evertt, Bess Farsh, Priscilla Gaines, reporter, David Gant, Kathy Glass, Anita Graves, Lynn Green, Beth Grimes, Connie Grimes, vice president, Karen Hall, Phil Hammond, Jenny Hodges, Len Holliman, Vicki Honeycutt, Jamie Hudson, Fiandy Huffman, Bill Isbell, Chuck Jenkins, Begi Jennings, Alan Jones, John Jones, Sharon Jones, David Kelley, Marie ,,f,. r M C M. mov HELMS Keri, Cathy Kilgore, Patty Krivohlovek, Peggy Kuhns, Helene Lake, Laura Lockard, reporter, Jim Lord, Travis Lucis, James Majors, Scott Marshal, Benji Mikel, Roger Moore, Stacy Moore, Pat Nelson, Shannon Norris, Nancy Ozment, secretary, Laura Park, Patty Parker, Ken Prescott, treasurer, Greg Proctor, marshalg Melissa Bayben, Balph Ricks, Alan Flobinson, Tammi Rogers, Janie Sartan, Eric Searcy, Bruce Smith, Kerry Smith, Cindy Spicer, Ann Steinhilber, Lynne Strong, Ted Studedemen, Maureen Swan, Carol Ann Taylor, Nicki Terry, Belle Thompson, Jerry Thompson, Jim Thorsen, Kris Turnbull, president, Kellie Wallace, Tracey Weaver, Susan Whiddon, Carol White, Scott White, Greg Williams, Boss Woodard, John Young. 2 -::.:: :ef M Q 1'5I-C-,-5- - ?Hf'f222i1Ai2? W f 332131152 Qvifssseiisctix tkliil 2195lriassesssvwzzfzrzfeff:JSM.5.?ePQt2MJ:wW SQ My Saw 0 , gy wg ,gaswvgggwgqgs qwgwgfmaisiesgzsw yeSi?2sss5Sxi1S1p,g:fgssijegsge, .af fiftlw S QHMMMD s rgve.m.MlMr.,a.: rf R: we fel:-Mlwrff2wg,3s2e:2iiKmv..,: 1 swiss Xa' Pete: smseaws Waww-wr: we New .9 is A W S?Z,f':w' - '::: Q13 it' 4 We r , is if .1 cage safes FY wi' Qfewrwewslffs:i,:'?25: asskfwemffye gt:5e'gg5egf,,wf,55f'3,fe ,fig e img W 0 gage mir ws' if mei iss r, ern sszztatsshz :ilmflssffggf,fmf:5e?i-gieiwe :ala rig w we gf, W QW v 4 wwe.. ew..e.53Wa,aa,M:l-.ri an was sew?2'1ffl5iazMzaefsafs3522:15rf Q. M azw::::mgfrgjw teewa 4. E as A .W aarsfwwas garage :mam aii?5E a ,,f1'6 tt?EssOxf4t'5 :isZ3'HWW'T Qesfftgmsfe:--:::sfi:egv ggi: ageWMWWwiswei:wimsxfmiiaswwseW geasseggsvseyigesiialadef,WMM -- jggweawys at si' a.i,.uwQ1,:w, X in 2523 't5l??i1s2W2w22nX2if miiiis swseiiwviits ftiiiil QW l 4, 5 nam- nw Mr fer t: M 'l f X2 S a , S s rwllmavf W5 My mgiffiwgttfiiiw isgiefrxif 94521553 tkifafefz:sfesxw::f:::sr::f:Wt 4-if W N Q 5 S 2 , . , . . , fr 2. W-wfgafgsswwfglm A195152 -arises. sa r Aramis x. -::::' Mya A A' iwiwswt:5im1HS:3i2f!i::'wi ftffict 'XQ5Ejgitimszsslszveigxerg'gg yy We 2 as T f l :- Z A no 5? A gg :K ff tv W K 1 SM an f if is ww Zwrff? ,... ii . Q3 5 giwsmig X S ge . rag if eggs 2 :Ez sssilttfgekqg is 553:22 gf?efi3SQS72w?Q ,gist aleggi in six' WT , w - V we z 1 we V 2 we l:,.f::.::,1z 9 iw:-nge. . ' .eggSmasgezs:sx,::sirege::::5y 1, suK.Q,.:2f:,e.hmM s rf X is SM 3 Z as eiiieif :.:l,:5Q:::, sf-:iw it mimi sfeee E.: far. lf: Q 1 my i , ,. 2 , may anEglrfgigggggaggbegmggzggzwgggigii , imfwmww' ff'T 'f V W5S 'i'j2f :ws wawsmfsfg wa - SWS 'A' it Ss avg? wi, Q 5355 as fi,wr,waSs3m.5 ,X 0 ri ie .wx , ., veeiwizttmw. Ns. me News sw W ff : i W wg ,LeguMvwsW,::g ryzgvlyggwgvwwgaw K aaa w',vew1fsns.e,U,s, , Amis mms, wsazwzwza-slMZ,1s 1, Shaykh W as W saa2ma.e.., 1 ug. l.. t,,gWE,33 mg? em:zssz,:::a as , g W .A Memswei saitiZ?.m's 't:g':SrHZ:f3: 4 52.35295 , . at -5 ' 1' gg :Emil 5.2. 6' V 'iii Swiss: EtiPf4:'i?f his9?lSine5tJsiHf.f3sli1ifQJ fir: A : , . , lr- . M, m,,..,s,.. . , ,. M WW: ., 4 v M is 4. +4 - Q 4: be sz Q ., :, we i ,wi ff X ms. :':5.5:.. SEP' sfretsre 'wssfrwaiairiwvii-www 4 :mg-:eww wwe ESE-If-ffft we fpw..,fke'4s'm:. if - vii. vs wasweteam.HeffeimffTif,:.,as:a:3sga:fsz1:?:'i:img.: gp wwgwwg wwwzfzefseasr Rival v:1:f':f-:1ff,,e'2m ' . wvxilrcy A :J Q a,,..wees., Vega wifi, ,gg if any M5131 Qgggfp, ,fave-varewvwisew1M-weWm-S35-aiwfwsyxsfw,V .4 :fee 4 5 ,,, , Y-vf: f-he 1 ff Q' ggggwgzwsrlaa assays mi Rwdaw 'Xmas'-wefgsgifan .fsawewaiwwav,:wr:eq,,g,4,. , twfif-'42 Bytes, ww wzwcfeumwe Ewvf ffewwf- -:ww wg-wwww Q sis sw, ' k?:a::2::E:fiE-fe??f gggfgigwgefzwigsaattv fewgefe., eggs. wewgrjffasssazsssz sz:erasesawwes:etagew?f-wggrfgfrrirsgsees at vszlzw-:isis 2. 'mis - ge rms -.Il VIS' ..1...i mia was Capers the Year' award. Among the Capers' activities this year were the Halloween Bag Sale, Capers Recipe Book sale and many rush during winter quarter for membership selection. - by Jane Redding, commander JENNIFER JOHNS Capers stands for coed affiliates of the their national philanthropy, the American Row 1: Suzanne Lacey: susan Perry: Cindy Pershing Flitles, a group formed for the Cancer Society. The Capers also work with Wagnerg Rebecca Stover: Laura smithg Martha purpose of working with the Pershing Ftifles the children's wing of the East Alabama HUTCHGSOUJ Jane Ftedilinel COmmaflfiQfA- ROW on campus and community projects. The Medical Center, and have several projects 2: Susan Molelalldi Blame HOVVQTW DWG . , . . Howleg Joy Dentong Beth lvlilldrum. Row 3: Capers received the 1982 Organization of for the elderly. The Capers have an annual Maria Emredge: Julie Lmsetterl ROHM Hickman, public relations officer: Susan Robertsong Claire Austin. Row 4: Kathy Knestrickg Anne l-linesg Jennifer Johnsong Other fund-raising events to contribute to Christi Brunsg Freida Daughtry. Row 5: Katie Stewart: Edith Smith Tp Cathy Weaver: Lisa O'ConneII3 Tracey Marino, pledge trainer Row 6: Kim Overstreet, secretaryg Beth Ann Ellackmarrg Tyna Tatum: Elizabeth Adarnsg Susan Langford. Row 7: Mary Ann Bandy. supplies officers: Judilyn Brooksg Ellen Ftobersong Eddy South. Crum 443 W55fs5.f,rf:?fi?is?fl i ' in It gfufgggffgpggtzfg fr Je, we , -m,ew:fs it 45 4f' m f?f a?5 w f T.ff was 1 M effects at fmtff-W ' N453 ' Wx tx if este fffsfw .e?t?t' ez, Nasal? W PM gm A we iff fi 2:5 , 4lw?' f Wie Stat' .g?'fq?at.3f,:gA5YgH.,fgsF im i M, , , -vw he -.pg 2 fsnbagsfsgw.gM.s2,.,ig4rmQ we,,,w,,w2:i.,a4:?t454s5lt 'Y' K as wif: ff an f gm A 5' is tw ass? -2 N f if hifi' Wie Mahi EW? My say f Ww4:tiS:'sirg.: Q tt eg? it News it M M M F t if if ff? if if it f W K if ff was gg. ,Wt kg ri4s,igg,a2?egeg43::st,fS5gjts, e:5351eiiE,?YE - mrqpggigits - tgtfgiit m 54fQSf?f 5'fQ5542?2f:4 4 i fL:4es4:5g5Ma 553 c 2? .,.,t,,,,,, A , A, an Y . t , , , .A s at ,,- ., 4 -. , ,W rw W .- ,,f,5t,w,,,gV :ish 4 ga,11wt.:44rgfagt4g4 4,4 4 D swmwtgwt ww as 33593 ,, wmmzwivwwf ' A if W Q 6 .,,. B' fi ,411 K - A Q , 4 t- at Milan ,f M, fifftmifff-ie vffeffiq 'fw,'awsfefmN.w gM: v.5f'f1f'bif?'wfX st. -ree? if its 4 t ? ti M was Wt t . 0,0 .vS,51f04'm.1s4.w,4fV,-wf:w'eww4. V4 asafvawff wlaamfweiw he rfivmfraytsfs' ' ' QV We new: A Wysewsemw4if'mcs21:'4fgvi4Q4is,Qw4m'Wff53ars:f'ewfswtzwa a2f,tWf'f3pm': ' tt wsibfsfitgtizsifwitwfigs:sslwffkfwasazffkfr4gy- My.,w,5s:M:a4e:4mgr2i'f.Saagfszmfasfgetfgtxwtsfa ff tigewi M' ttf U 2 Q W We A tt A X ' i X gtkffmifirfsaigefsiihezffwita.- -4 W., ,,q5t,,5Z,g,g1 ,QqgfxtS1'44i3E'3Ki'??fiif.kif214:ffig2'6Mf213'i?QT1iyf?SEif3fW?5A1f5 e aww is we sf tr sf 2 it Y as fefsaia me , 4-r ffsfem : - .msvxfgiaf . -- ft Q54 t, tw at . X. ft, xgtmvgfws ,A -. ss, ,xigw 6, fi. aft, M45Vw,yf.f:sga,:ftf2grr:a' it 1-rS32':2?4PH we 111:32 , , ,, t, ,. mf 'M V M if ff' ' 3 - 4 i , . fa ,QQ '4ig,mXg f 4 ay if ' . 4 if ' a- 'effglsef ..,, i . .,. Q A ff . .4. lf. Mwzfa , 4 t A . gg? xiii 5. wsggigrygg Qggagwgw sm-4, gggyfegafy if W sqm is 252535 ggi? x 93-'ff Q, ,f , , U et tw f sa rp,wfm:hYe..sQ,2faffigsmfzfxli ' ftfwgtj saffmw 4 5 'gfg4:,-4,'.wrzrgw:4rgafiayiigfxffmf. gm, fg44:gil:tP5gf:3wf:egmfw,.'r swf?-w'1,3?t wffrfstst 'tiff 'M N. ef Jeff sf? QEW it fiftaftfagftgf at at M 9' 4 A A L in t,wf,:ftf2.eff fwww ff I is 'fs as HW, r 4 as 54 it Qreggegfs., xg 4 mtg? smB 359' eff Ra gawk? eff' fiat stiff 2 f 3 W2Mfi3 fff5 t'5f'fQ54? if W I s ewegfffisfwgk w if ' age?ggghgffleik?-F2.?Q54Kfff25?.4ige??'fa , .vtffw e we .. is B e ,r .. , W is M, U fp, .Q N it 2, We W 4 Q-New if Q 4,4 ,4gftzwega:4w,w as at with QW N if 'P 5 P ik 5 , is 5 ef., tt.. f ,txgwsf as Q sw WWWSXSH tv We weave rege x : 6 f N ff. was ga ewwtirtgaw twist 2m2'fSEw:,g'sm W its .. W Y X at gg ttf me MU wt if ff B 45 1 - . - 5-:: . is W e -. .- .:. 1 Jett a age? az M ffegzgssglgwhg,fm.,gyrgfJpm.5:fey3,f4t ig 145:31-ifs,w ,mei M s 4, Q I-.. :- e4,?w,fgaQ52e, ag , K4 :faery www: aiwa 34 4ge,gwg:4 gf 4 Q 'ww 9 g .4 0 wtf. rig if 0 if Q ye if Sjwmgwgig it 2 M .' CRAIG SHIRLEY , ,hm ,mi.,sQ,mf, .44 ga 4 Ami t M zsgmfsffgpfJ.:,524tawisfgxms-rsassfafx:t:41w tt Q. st, 4 ,eff My . ,Q-at Q-cw , A sage fp 2 J tr , f4,.4,szewt1mg .. K 5 W3 sg, ,gag -gfmggg Wage at rgaivgst 4 ww was Nw X 5, 'kf3VHF:aeX?i'iXe2t,fx eg,g3Z4 TREK. fwfw ww fi 2 use Wicefiififv STN ff Vi? if -Wt . Delta Nu Alpha Delta Nu Alpha is a national transportation fraternity that promotes a greater knowledge of transportation among the members, the University and the community. Delta Nu Alpha encourages the study of traffic and transportation management and promotes professionalization in the industry in order to attract persons to this field. Members can find assistance in their search for a successful career in traffic and 4 transportation. Various field trips and industry speakers are planned for the year. l by Ernest Honey president Row 1: T. Dwight Hicks, Ernest M. Roney, David Hudleston, Row 2: LeeAnn Mills, Jane Ogle, Dianne Laumeyer, Lynn Johnson, Kathy Baker, B. Scott Reeves. Row 3: Michael Sanford, Eddie Yance, Mark Digmon, John L. Ogletree, Guy E, Young. Delta Sigma Pi is a professional fraternity organized to foster the study of business in universitiesg to encourage scholarship, social activity and the association of students for their mutual advancement by research and practice: to promote closer affiliation between the commercial world and students of commerce, and to further a higher standard of commercial ethics, culture and the civic and commercial welfare of the community. by Odefte Yeager, president Clubs 444 Row 1: Charlie Nesmith, Laura Hauser, Gwen Bailey, Odette Yeager, Marianne Tidmore, Eric Thim, Wayne Barfield. Row 2: Bart Carlisle, Lori Thompson, Marian Sams, Carol Frantz, Carol Colquitt, Nancy Merritt, Leila Welch, Holly Harrison, Elyse Hauser, Belinda Black, Ellen Ellis. Row 3: Karen Crawford, Ed Byers, Stacey DELAINE PANKEY Delta Sigma Pi Tepool, Lisa Todd, Nancy Haisten, Martha Rieser, Phillip Moultrie, Debbie Linder, Linda Joly, Jan Hobdy. we was 01 iwirrrwrzffiitmswt S mwtwtstfwtw? we W Q rf Set ..,g5 g5Q ,eg i . if gr moe, ,gg www wg at i ..-W., as west. .agms,,.,,m:.s.f?s? , sffswwsgd was wwe aiEMi?gi..E,gg tmsi.f,.r-is-sf s fmm fav sw wntiifzfgfivssiw tv'5mz..:6 Wr.irriwrrff .3s.f,Q,,sw??3Mmggw,,tgrfW. ww g- mwitygt ,M amiga ., Wggfmin? W, wmH..c,, W. my gg: ..W.r..-WWE W w w W sag ri .gggwwgggglggnm .N ,,, ,,,,..,,gw. f,5:tgw5w..m,..w3yW sd We ,.,,, 1 WM.....wg.iav9..aff.we 1.rw..M.w1 New 1rwQrq5fSH43riv.v1wt2x'lQ3sii-tb , fewer. igwwws .....ia,..,..,.,,xy6trt.gg,,.,f,W. .Mg rwtwfgy gi Q E 61553 it Q W. .. cs.,,sW...sft..e ..s.,..,gv1..a...,.s. J W Q mg, .tr smgiggggi sr '- -'-' I -2 ' siiS,i3.,W2'3Q big:LH?x,s.aft2.,rwy,.,,Sff,wg-gif K-imna witgiw 445335 gkmssrmgiis ,2atigggrgjwiik.fffseas5ia,m?w:wa5.g5S,fwq....ag M537-ggvgwsw We Q gygggmwq ,X New ggi M B, time mfgggiswia 22: .aabiggiggys gqzigggg ww gwgy. ,swagger 59b 2 we sv ti' ,ss tt Wsr22.m...,fE2 ww stscfiyrws W 2 we .' is wtqwtwifiiwtif as z: We aaWSLi?fmf.w... .wgwssswtwf .sizes wmitisgatis ilsiarsrssew . Q5 xg f.gW?Q versa. 4w5M2:5.:r wffl Ffiwfzzff,-. Www Wigwam s5i2s'fy1 afe.fE:Mwg5'Q?s2t.g, 3g ite-tm X st rf N333 W ----- Q as me si vests at Big-Ee ssssw a.:rfs?MfM.fe.rfwwee wiwrzeftewa-twsstgiiwig ,fgswrs2.sesf w..iwigfa sssizwtwMwiwwz.szErfw ggisza gs: is Se MW 92' wigs' sw Mi.swsa. xii: an f A M .ts Qgsggitggq QtsgaggigfgwfaieihrQgeffigssesi3w:.wif,eW:s:-.grfsfgsrsgse'ggffiat15tgtweszfeiyggtirrftsrftwa israel' sagem.assweetiefs2:.1a?:ai2es.se.:rbarffzfwagsw wwe mr eiv1?g.S,sQ?gst5 gs- Sagem. Zii'f5'5w'fq?'5w 5 .gf if 0 2. Q Meier ring, QM. :l'.g:gfaz.:. ,wffg K. war, W -Q LJ, L Sigma 'Z zgffigswfggyiegsg Symiiawsff Stsirlxfwsfiiwtizggg-g?svw+.f,a0 swag Zrfirwftawffssgz ey?itfgtStiQ5.iw,Sww?,,Lgm.g, W ir?w'mt 1:-ysggfirixtfagwmtsviggsf,ga31r.2'13?3fiife-frtsffivotfwrs QE gg lQiS21:3,mw'i21?33wS5?tQQ?I3IEeiX?:g51Q,S- ...,:az.zfEgigw3e5siiwisgeazee tgifgwiiegvwggsseis ra,sgaargrwa..i,gwg5aisz:seiegg 5.53515,fQSWfeg:misxr.5s ityrsgwgrs 35,225 f2f22g..m5mByr::559,g,as-amaiazswwa ::grz?2W.fgf awp- ragga Ns 25, ,- an 91 w assi, Q kgs r :sis .1 -: s eggs reitiigwfmzsafaiawfge ae. .ssli,.:.g 5 'Eta it . 93g?z.?5Zs:ez.M ww 2 0 i1r.z3Vff5saiswsrfsfgtesfirsbrtsiieafal:smQigggizaxsgasrgwarmeggs-5sgra:eigrixgQessvWs'sr...,.,Seii,,. .sggevssfastsgmgwivzzfzgwSgazrsgsvsqss1atK-itQwastarrpsfgstsriarwggssgwis,eggs?. sgfgggi:222tZR'ga2e fs. gs M mgssveifrs ggsmwsizfariiizwzffqsissfffrzrwvisfrfrsrrw. fsrrrskstpmfesxgesfsevswpgmi Qtfsgtrew-SQ Iifcffrrfw knit-Sfwtsrffsisrassagieth fszf aie .rf 2-srarertkggvt its A W S 55535522 .eT8,ig?..giis SX?.Sv.s'sfg..sZsf5.ggQgjvTEff,iysfi.iigsi,g:6?t??i'Si2..f.. 5 .wig-Q. AES. Fspsirs izsrmf gs? if gfg2:s...,,m id , .4 .. W 4.5 ,msg egg sggggsgig mg f 7 at jg Nw M My g:igggggg5g,.?gggXgi ggi gf? A i Q sh Q, me Qt? r if twigs g55a35s,gSfsissti sie??f,i'iv was fi -i A Mar 5 we A is W if 4. rw as ,, serif? 355929 wax. tt Wagga tg? 2 EN N3 g 2 wg matt 55533 Eng W e it New v ri as W. .. ,. , . M ., :mt W. , ,. .W A -i .M .W ,, eg si., M. :sw sifM.i:.s,gts:igsa2::Tss1aw fzczzsae wiQ.,.-vs: Wt 5, in W.. R1 is .s wf .cr Q .Q .Q ,J ,ls av may 2,2 ZW wma: via Q W- 4 , rf. ' 3' . .M .......v rr is msefrsw sam-:V X tr Q glissgm wi f we . as y .rr '.:a--:-gg.: r Q H as 1 vit. W ra mm vs 151-eg3iwwZixz.f..ggfvgsv ig Nia-ww ' 'Wt' :ww ,, ye? W ...iv sz. ,MW R. z.. sw35fff1.vZ2f341:::2'w'if'f ,wZ?2sZ'z5s mfs WW: .fiwitfttwwif W - Q55 3 gs 2 N at lsvstrrfriitiliiiie safe miie ?st2MW':W1M r it ts K E e 2 r2w ,5fE22z3 wi iisiz fwff m M'1'?? tW' r eff S Sfawa5tf1:5es,...,w.ff ew MN W. .. .. 0 or r'.f'M t1'9S:3' w as W Zr' 55.w e2-:aZ:222f32,ea mf' t2f:.sr saws g n .: 5,-' . if 4 We CRAIG SHIRLEY JOHN REED, BILL SCHNEIDER Diamond Dolls Diamond Dolls are the official hostesses for the Auburn University Baseball Team. Selection of members takes place during fall quarter. Diamond Dolls attend all home games, hand out rosters and cheer the team on to victory. Banners and spirit signs made by the girls promote the Auburn spirit. The Diamond Dolls sell stationery as their annual fundraising project during spring quarter and sell season tickets to promote Auburn baseball. Coach May and Coach Renfroe serve as faculty sponsors for the girls. - by Anne Citak, president Row 1: Caroline Snow, Tracie Howard, Leigh Anne Hickman, Robin Sanders, Michelle Grimes, treasurer, Anne Citak, president: Lynda Denney, vice presidentg Susie Scruggs, secretary: Bee Martin, Tara Lanier, Amy Murphy. Row 2: Dana Goolsby, Molly Lindsey, Jenny Jones, Toni Lyte, Leah Alsobrook, Mellie McCraw, Teresa Gordon, Patsy Francisco, Shari Rees, Kelly Ptabren, Leanne McFiae, Ginger Hall, Cindy Thorn, Tyler Williams, Marty Blakely. Row 3: Tereza Hall, Barbara Waller, Susan Keaton, Sally Beep, Leigh Lockridge, Marianne Vondracek, Sherri Ponder, Jeanie Bowman, Lisa Leberte, Julie Cook, Amy Cowan, Kenneth Wilson, Amy Cranford. Not Pictured: Boo Connell, Debbie Webb, Beth Whitehead, Cindy Wilson, Nancy Wynn. Engineering Council The Engineering Student Council is comprised of representatives from honoraries and professional organizations in the School of Engineering. An Engineering Day will be sponsored in the spring to help promote the field of engineering. The council also helps to broaden the interest of Auburn students by increasing their understanding and appreciation of engineering. - by Marty Conry, president Row 1: Tom Espy, alumni council representative, Susan Wabely, Maria Sanders, vice president: Marty Conry, president, Gloria Garcia, Bod Jenkins, faculty adviser: Mike lrwin, Steve Boswell. Row 2: Renee Carland, Greg Fox, Beverly Tanner, Timothy E. Bradberry. Row 3: Wiley Morris, Deborah Buisa, Mark Miller, Jay Denney. Row 4: Brian Key, Kyle Lech, Roger Whitson, Barry Pike, Tim Cook. Row 5: Tim Maloney, Alex Luttrell, Pete Jemian, Mark McClellan, Theron Cater. Clubs 445 'IT Hs - -..:'3:::.: -5:-l iek: M S tt ts ' sr a ge S W sg wmge it ,fs.mew:a:fg,w, ggsgw ,w M 3 V' swf: ryggwxf-'gm w ww fywggbx , was Q - M bw A . me ts 'i izw f WW ,W 'WM Q was :, 7 , Mit? , ta . sf' M ,. , Q., t J 2 , .Q , , , ,J - sf sf H V we W A rw 1 -ae. ata we -:-if '.-.-.-:-:,v' e:.'::. :---:1:: E Q 'W Q? ww ,,g,,., ., greek... 32,39 MQ. at mm es , , 2? ,i Q W :ri ,, SQ., , Maze: .sm Jr s M. e B' 2 if 2' 2 The mesa segsrtrt sa :wi News w25Qf23 S5ff22gSKfs:'S.e sgwiskia,.get Q ---:,,, -ee. .1 ,,,,s.,,, 1 ws we ,fail , M el, M., ,,,s,,W3m Mxfigfggs wJii'Sif?X3??33 SE?Zr?55fm grxfgsixfaeqteefeilfeifa eiiivavizlfssttwx fr wegiiwtfw seiiigsgtttf tntsttii smxetsfwiewttslziresstifwsem sew swagger ' ff.'::::.:,: 223 51 We slawsifis rssryg Sigma: Wifi: iizmsweeigwieXisiigigwgswss gee e4SsMs4.ggi2,iggy,, xgggygergt-ggagggfQgfeissigwesvsslizigttst sggxghmg. r sigigwisigggssiitiiiegge rr 1223 '53Q95?Sa15??Lgg,52'55sE ---- : :: ::,:s. ',:.: 15' its steamy si zigsmiteeagisgxr 'few -.-. 1 xg? asiagig:tggsaziaigxszmswgyseaseegtgsgggggsgswifsiggfssfrtszriftiig-,gs5ggtgis:W:ggs:rg as,s:zz2:fe eserszefwagiegsre if fm isitigtggxri atifgt' :SMQWWW -' its ..5,: W ' I far.. , gsgigmgyfggizs tQssQiwns5:w5wf4-1253 sigsiigsi:mfs52253:225:12253weifffsfwasmiffftweis trrtaiggsgsg filet M EMMsgzreifestszegs--:ei-theses: :.:.::: f::: ::.', ..-::: N, 1 Q aww w 4: Q: tm' itiesStteiiieitegrgggiisgiffgtatw QisassagiftzeieQwggmgggfswraswV1,Vsfz2gsas:.:gsg:sswssae:ehsfg Qzswsisgiee ssieiggeasgwggewtmvf' wggggf use frgfifigt EN 1 .... ,.. 3? M Jsw fzsesrgzxigegzzxzsztiffif? ,,,,e3g3gg522e1g, smash? ggmgggggiSigggggggggseggigzggsgfzsgggwggggmg. is Qzmggggggmimgs Hgiggggmyfsgsgggg ejesgszggsyaewg at ew s . 2 - f tfeeeesl ,.,rf' g,,',mgEMgd3igm3gi3megt J r gsbbmu ggiga wyggv iywh W Diggs? 1 235-vgsgfgyggrbgw 5 3, -.'..:,.: .... , ESP ,gigs agp,5gggg?sgf5g,3gm,gi5fgg 2'Z3gQ:tsiggmijtgggg glqfggggggiggvgiggi Saeiieegxtfia.. fl? agtgisggszs '43 xiiiigstgigfsgstfts s E - :,:A E 'I525 ii' ' : at as . t A i Fashion lnc. Fashion, Inc. is a professional organization for anyone interested in the fashion industry or any aspect of the dynamics of fashion. At meetings held twice each month, speakers share their experiences about the fashion world. By sponsoring various activities during the year, Fashion, lnc. gives involved students a chance to gain first-hand contact and experiences by working with fashion. - by Beth Ansley, president Row 1: Beth Ansley, president, Kim Robinson, vice-presidentg Terri Shoemaker, social chairman, Linda Enfinger, secretary: Elaine Fowler, Daryl l-luff, liaison. Row 2: Dedra Kelley, Ftuth Miller, Joanna Kimbro, Juli Barnes, Jill Whately. Row 3: Jodi Johnston, Terri Taffet, Fran Baker, Lisa Copeland. Row 4: Mandy Godfrey, Steve Clay, Alicia Murray, Karen Belsterling, Linda Belsterling, Tommy Huston, Pascale VanBoy, Row 5: Willola Ashely, Lucy Kane, Kimberly Jones. Row 6: Bic Simms, Lisa l-lolliday, Buddy McCook, Laura Gelgrest, Alan Norton. l l i Modeling Board Modeling Board, sponsored by Fashion, lnc., exemplifies Auburn's fashion image. The board provides an important link for students by presenting the newest seasonal fashions by working with stores in Auburn and the surrounding areas, The Modeling Board has presented many shows on and off campus this year while projecting the fashions for Auburn. - by Elaine Fowler, president Row 1: Elaine Fowler, chairmang Daryl Hutt, liaison. Row 2: Jodie Johnston, Terri Taffet, Joanna Kimbro, Julie Barnes, Lisa Copeland, Dedra Kelley, Row 3: Alicia Murray, Ruth Miller, Karen Belsterling, Fran Baker, Jill Whatley, Linda Belsterling. Row 4: Willola Ashely, Lisa Holliday, Lucy Kane, Terri Shoemaker, Beth Ansley. Row 5: Steve Clay, Ric Simms, Buddy McCook. Tommy Huston, Alan Norton. 44 Clubs BFITZlMAFtGARET STRICKLAND BFITZIMAFIGAHET STRICKLAND ga:-:: : - . ,s'2: P wg gamma: ivgsyt-:wer V -4 fma5s'a'7W 'a' r :3z3wyW,:'p3gf,rMW2 sqafstttgw W was awww ,A . 'r,2pgsewwasw:gQrf:L:,fWWW, ,:t,4,,wig-wa, i A we is czww ' vw, is Wf ::- -- rf W M i m W f A 0 ,,, , iWi:x,s:.X,,,k ,W :MQW ir, it , Q , cgwaygffzsegisbggssfag2513553553g,,,.:f,, Qrzifgiggyfaqasximssaisffmiw seg :fav wwf ,age Q, wswsgg W 2'2':22: ' A 23fz,qrWaff:maewwMf sf at fr arfafiass xswwksswsgggawis eras?-iafivtmwzgggmssas was wsmanage:-Qwe-azizfszm Wwmriiessgfibtisazfffa agile , wage mastery? swtmifwfmatififtzcwwMt:fgmfsm..s 2:-' asgasszs,saf3Z?e:fg:2fgQ,vaf::1x::4:NQff14125:fit1 Mavistifsissssiiisimssragiiiagai'2ii:S53rsiswssstesssssbbtiassazssssza:Ncis:Ti::awww Wwmazsfazwfffaiizzeiw mast: as mpgs tgrwtii i - ti s2mziZg,15Qma,si?wSJwsssfafwgwiwe2:,::wMQsf1si2:m Sm Qvtsszfazvrwawwiirsssifwitiiss 5EtiwSi1QiM'Ws253g2' swefeeaswizztrsfam its ' wwwwassafffmwiiiszfssiffivif ' 5 .1-::': -:gs Q eigisgvt :ww 5 ggym .vsegvsvmgiweh ,yw age 0 H H ygia,-.t 1 gbfaifqmsw as21Hav2QiJWEPMi?rNt6t5s,,Ewf'f?gEf'f3? xi gfxwf-fsewwgxfvmwsmsiarlff -fs: Pr:W3?Wtvwxw,f,,:i?4i2vsew wk Wfiltggg e W-I ' '33 9'Kfz'Z'52f-wikiH i 'f513f2+'ti t 55WWfwaifalvwffq-waz? Lwsffiy my wwississggmmaisytxfestrtW: iwiiiiizssewfs jgtzmwifiw sasswmwififzsszm--we.1 raise-if-w+5kXwwwfifw M -gtfgvssfaiits Q sgsZ5:s,,w 2 'tg kwsfiswagwgzfzatgafwwswssaefweMksgzzggwfwgsszqqayaiif 'nssvssesfgagrgixfiisriiitswf:amass, by :ifeisszrrtsge-UrU:s::s'i6.s5,,wR56se::i?gggtysssssssfwggmailiisseggwfkvisfgemy is ,M-m1:v.e W sttwfrgfzwfrwwigagfrwmsgzsggf ivvssszagagg ff 2532 gg 9 xgmyaw is ffA2wi.w',Z':i::a-vgiiiiiitiffwwtwfniiiawtwafi gigs: was if-A as Uniwasrswaaiisfswemiskii fa: :grams zzsaradeevasssawsettt me i:Q7i?T22f!? 5:2 irmifssfi Mesa Wg iw rowesvfzsmwfaykseiwsfiszsawu Qbggigssssssifaisszssait Maczzrw V ii, I :,f.cg::,:-,-giiiiwffm,s,?i3memsfs.e22,,maiwfitixgiem swgwmxwwxatsiamsffm, A xuzaqizz fwiiwffaiwfmszai gwgsg i Wffcsyiii H ,,, ei essimgawaaiemggggiwsm ietgmwsix Miaaffisfwzsfsiagzww , itssggvayswgiiissrszakvmfygikafww? waSlit:2:55219rmFiiffifwiflisimgazws2MiffsEagX?f3ggs,2g4 if gsitssisggeiqsfzasags .isSswwisfszaaigirfeee55335223fizfigwgggfgiykiig saggisizggmggiiwamHaggis:awry: f :gfgyiQQssfgggfggysfgafggaggfgyrmsgrw Amistad sis 2: WSW ggmmsmi emsasczfzzwsa stltszegezi f' ,, ,gpzgg Q 5Q::KfizziyaayfswWassaisggggwwssggsggweaszsgggsme WzisgfsibiggsasargsgwwfxzzgwggwM r 25:35:30 i kagfggigsfgsfsfssrif wif? asfiysfsarfssgrgaewtsgzfewsifSmwfsasatseywwwziisfiraw wi S:f5:e:,,ege2sa2assmSims:,issw,tr -1: awz.,zig::fwwasmsfgfazsfs:WeiSememssfisssfsWzzsfsassxifmsisriswwsessisxfga-av:sasswwms4223: :,?,:1iss::wisti:,griysssi atgggfgy W vm 5, g2s,g5:-235594-'2:2f1tp5gtm,3 ggs:i,sygg55ies:es,,gg,m:,:,is,,,gwf,,:,ggg,,y, 1sgzggigsggsQ:siarsegsgigggggggfssksgskiesQ m:3?fswaeaWls:::f gei55fts:sm:aw54a:riffs if-tmiaifs ifAsw233252:ow,ssifiiifawftiffimfiisswifmfiwliDisssw Qiarfwwmaaswar wasiaisiiafwmifwlitii Qrffgsirtrgfasws' M fs-45f2s1i?sWwiisswzawhfasziwtwmffn-tiw-150axlisgwtgtf -,, Q wear w ,, ,Q-mm iwsfr' '-seiahfvmttffe-i'i' Wmfkii' iw RM '27ZbfrgwwmusiitigmMWM532fWin-45it5'24vw3wsss5'sfmbaw,UZzZMrf-vm1,,:.,:31fi:sfV'Qis AMsiffgwWwre3ff'ZSE5N4sxMhmgg?,'f-w5v1efai'i2'?K,iY,f5xg3s'-1.v:+ss,i1vi'3ig5 QWQFQHKE Sfeimm 2 r:xvas-ragzeitewwsxggf-zmimmgfgmines am is mimi: if :Q :trims w.a22ffrfwmr,.1: 5:2 wwrzzmfzrwsiaiiwfepa :Maw ,:gm.:.:f.f:m:fg armrests wsgagssggi eye: af sgeeesg gwiayazea aawfammgge aswgmssizae f EaseiS5fm?z?sgf-wit?wfazssiwiaiisrffr:igawssmfsiisczeffasfaigtsifttfftfwamiixi MwfixywfiimsffbaQssrszizwsisitgiggmm smnzv ,?s,:5.,sg,g4ma,wgfgfggywsmgyifwwggesm::,g3gggy0452,,zeg2mW,wgsgggggsa, I, e5?f?g.gf::2:srraxeizzavtsggemiyzsgwgkgym its kifslti, M-,Ffa ?iE1f5Q'M,5 ffgk av fm gestiawfsasss-siaimzzqgsfwf waiirteaggy-gtqmiitgiiggg-11515551sg:fggwifmeirrisggswmszi fesmvwzfzggswmfzfafg gawxgrgyggeAszrsagzpzmmiazgif pi: w swsw swiss? '.'fWw:fSL::n s:1fwe,,e.ZS:if-:vias.eaim---fwM2:5:f?:t,wQ. wzetfiiiiktazfw Q,t5?1f5t:::?1:efw1aSS:'amtf's?s,G5'SpmfWe2wHNs'W2'wff5?iSsitiwwJawa, we-5::I:::vf2?wHSESS:wfs':Amiw ?':fQMfimza,fgsiiikzesiitftbisyiqfr M2382VseffX?2'r':3irMwA-lsmstsfiwwma w.-fmaifgmgsaiasszwgfewf, -M r wzqzsiaa22?S:2z2::ff,se:2vs?eamsFs:rsgwfmrawrfgaszhz, rtsiiwr W fmsmz igi .iiialsfw Sei?ri5fi:whensgssagfigfsasseaxmgkMftfvxawwmisasgmwefas sfszgmgfmswgfmf wiggeggggg Qeswxssggw Essigqwhsss 5:62 gggvwmeiswifwiw :s wsw fi .W N5 22 amtf'f'ftfrivgw s3::F,:,g,,wi Wmw:,w,gi15'M5m,.:6ssgtiwwigmf Mgmwasmga,:.MmaW-awsome? csswmws:gggt,w1mi,53f'2S0e'Za, c,gggvmgg2lg5i.3ig3,,gi'garMs mg,5wiwm:m:Q:,,f,.mms3S,1::,e krfgnm.W,,Waggantggzogsssssmiswgsehszvs Q, fmkiffaziggw ef ,: was swiwfiigk k wax - 1 -. a52z.z',, , 4 22525 - - sfmfafa rsf mimics: Xs srsaazz vw smsi fw fam ? :. issms g- wsz w isii ??2s2fs : E,-1 as , swf' JOHN REED D. BEINSON Flying Team The War Eagle Flying Team is a group of students, pilots and non-pilots who compete regionally and nationally in various flight and ground events. The 1982 season saw us ranked first in the southeast region and eighth in the nation. Pilots and non- pilots are invited to join. - by Linda Burton, captain Row 1: Linda Burton, captain, Scott Barland, Holly Roe. Row 2: Jim Nicodemus, Teri Godwin, Rich Collins, Virginia Fetz, Ted Leslie, Jim West, David Cowan, Jerry Dye, Charlie Jinks, Neil Bosmajlan. Gamma Sigma Sigma Gamma Sigma Sigma, national service sorority, assembles students in the spirit of service to humanity. The Delta Zeta chapter at Auburn is composed of young women who willingly give their time and efforts to serve the campus and community. Secretarial assistance to the Red Cross, helping at the blood drive and campus elections and ushering at plays are a few of their contributions. Gamma Sigma Sigma celebrated its 30th anniversary this year. The Delta Zeta chapter was established at Auburn in 1972. Rush is held twice each year during fall and winter quarters. - by Rebecca Greco, historian Row 1: Liz Brooks, Lisa Nunley, Lorraine Scarazzo. Row 2: Jackie Burgen, corresponding secretary, Jacquelyn Hathcock, on-campus assistant: Rebecca Greco, historian: Teri Johnson, president: Cynthia Kilgore, alumni secretary, Becky Cassady, publicity chairman: Leah Huddleston, Row 3: Pam Morris, adviser: Lisa Atkins, social chairman: Barbara Howell, Melanie Wilson, Donna Dodd, Andrea Juno. Row 4: Linda Raytield, 2nd vice president: Renee Burdett, recording secretary: Allison Lanier, pledge chairman: Kay Brown, vice presidentg Lynn Fagan, LeAnn Kirkland, treasurer. C lubs ' , 3 , sim 'Si tt :tt Wszsfwfgg Sfswiaff 1fr::2Q:222:5s:tefii.2::g,zif2wz,.zy.fh ff s 23331 3,5 . , ' Pigs eggs . seams-Qafzargg,-gfiiwzf:?lifz':t::Ml::m sim swQ53i?argd2Q??5'3fMtiiiwg ,wig sims,:wtmmmHwk5:z,:wmfS22sfr2seSss,gig ,aisvzggwif sera?-swzx1:wQ,..,y 5.5:-wasf:g,.:etfgg-w::ag2w,sggQsg gm isamzsssihmy ggggsms:saggy-swasgf-QW ge-sfzfffsgil :,- -,ag msszgmggssgfizgmzfadt,eyM, aff-,...t,:.:55wis,sgegss v,,.s:ggws-2,3,,,M,qmsyssstggigss-ssawggggst c,,,y3,wS,3m,,gggwM.: asszebgggggsyziga ,E ' ,asgfggggsgggssvs sk-'gg-gg wswgggt ssststvvggwmfsasgls- :tw ..:fgv1-4,35 - 1 t if D ' 'a ff Mt-t?s2ve-K-asswzsff 125' 'fzwrfzwwissvfwwfsifwwissrfm-ft? SSW-M wvswwmfitit sw? D225 we swiftism- tcmwf.-fw2.MffwX+: ASQ-W2 W W as give 'tem stuiwgvri-ssfswffst N V A X-etatsif--G ,2i5tgg.gg3gfg0? 'gQ?3 igaggwaqxla gggfaawqzm -ca, .i,.S,s,nw-ftxaimfyyaqwiseweyassrtiietwgivfssssgwuvgstssiwgeass5,,-gwzisgiafggggs-M6,cw . ,, , W ,agawywssawsistgwfgskheseaagis awe ,ggs?tE :W5w5?u5ssY ggi?-aww:-A H,-fm-mg,,yw QS -sgssgg Gigs 1-tfavitsaitl---iss,-Myai:,:ft..,,,,,-. M, offslf,.,,m.:MM:aw-s eszfgwmam H-mstsssaswsissgzgsbwwearwwwzzftaatazs , ms,,s:tfmW,m,s,,.fg,, gsgtsszfte ,Q is gg,,:tf2aW,,s.ig,gs Q:xz,,ww,,w- ,smffi-, , X- 0 tt 4 if w,wgmgggsefsatzggs--Masm Www, wa.aszggffimsawsemazfizgwggWsszffmwa.sgw45sss:wfst1 , , ,, azsewspmfg,-,gfygswlssz-25.,.-.Mg,psig-as gggssssgssgggwq sfzwf-W.a:tts : 2 Wmfsfte 4 with 2?-igwgtg. A552322 Wwmiwgse yt::wffw1f'f-- was :vs--mzf:v:f,fst:s:amssmazszfw smtzfzw :smiizsswsmsssw-as-seize .113 fzwfsziaawksi 2'13Psw!is?mt:sssw,,5gE' sw-toss'wwe:-vimssfzw-is S .ww , Asses-s-Q-rest: 2 twwgvt' tm ftsiggfsgwswi-,ttse:-wtssw - i. afisfswitgwl J sfsswgwmwgffwfsws:Mm,a:- W W, ,, , swQwgfnssmmssawtsgg-A ,N Q ttasteeir-ww:0g,.,ys-wmssaagm If --Meme ,wtf 7.s.,.,t Szfgsmiviyiassstw f3Q?ts5ggm:,:,ggst6-:sg 1 satan:1Qag:zasemtzisqfgstMszzazgiemJsazsewswfsasQwiitggghggssgggggmsQ -- W f ,. tw ,ew-mszgggggggggfaewmgggggsnttqssgaggx Wst,:,wg55Wm:gaww.:Jeg 13125: tgtgf-sm:,:sfgQ.,,Q Ms,53?f?S21fs,dgn-Ssssztwsw Sifitiwffila :fri7X55ZYQ:-aifsst-522:12-:QHSS-ii'52wf Sf'3S25?S5via'2t2if:55MHZifiiwwSis.P::W22::a,, 1Q--wsW,ffM-WS:as:zeag-KRSifzeztif-wfw53S25232::smxQk2t2f:SSMssiesisswfdtifskss rf Swifizst.:11fl::Q:':-4--Jtrg ikszsbsfvgsisgkb giigggjgmgiizw me Qfgysfgghmszaisfg -asmay5tegriismgswgsgfgggwviagggmsvgssesggsg-Wiiziiiifgfsrflfiatiixm:35sS5iQ3:t9w5?Zi':iwS W:Msgffwa35:ggg,f-gsmla,gzgmgagsWsszgpggggwg,5,,,,g,,,1gggasawgwggggggW,53'ggwgw,t:,. ,M ,y:f5.mgggg5w,4a53,R5,f ar.i:tM2i2SS:s.:2w52-3 iiiwwgiiiiiif ttawsifwfz- .f ,,gsM,m,,,,5Qgs,smsssgsiisf:WiresQfiffmsssmftsssfi-WSmzmsffts.:: as:3,QRezzfgawsfsr-:essays23152123333wswgggbgfwsaesifww:gwgfa's:p,f5ms M-Eaiatftwwifwtfif-f1'?35?t2'Y Sgf ,em we 'P S52 fi ' 25? 'twevtwfcmvigifafw :r5fu.si'Z2SftW2ff5S5W'?2wsftiiftfwgiiw'ff'mi,::u:ws as :M ,,. sasM5512afwmtr-L5,t?fe-mwltziafafti'tw-ws ittfiegmieigiffmMskiiisfgsfifaiitttzrkff-2iws,,t -ev Usftshmsiggelwefssg westsaisfwmitgggm 32,952 emi: 3, tt.. 5 its M , , wmihrsg'few-asset-2,52'wwN2e15yss,giZf:wwW3l:w has fmumsigse K sw asm:gswww-misaveewmmeftwmgwa5 fmmrwixtweqsssg-,i,g:w,s2f.g3'ewm,cUrsfyboiqfatrs-Asgsrgswasfa aygafatssw Nwgk' is Swami, Q:-Qantas? at ey A is , .3 ste mfewtwasfwfews.m5rf'fgffwa23: ff-fm. :Mmm swam tw:-ms,i::. , wffifrz- -1-62.z:4::+-Msifftfwwss.2'.2t'wmm.?Wgtt 1f W Miiiwwmsftttf-mms,an-sims-M11M1tfzasw-sfsswmWazmfrf Q wi, ,aww iss-wimtt time Www W U fe .W , K M smsvets :awww -.M ms sssmxagfqmsmi--exMm w-w.yha.,,wx sms., , ,mW,, -ami-tw ,ga -at-1si.t,,,,.,gfg wmss, sms, ,Qwmtw 2 ,W t,,v,sMxW,.,,s,, ms, was V WM, xgttegatswwkivitigsgw MSM wwssww- is M W x sw-swatssffffwm-1szmfmtazfsffme -t:s21fwM.::-we-Q mgm,sst:.f:lf, . 1-:lf'.,.fywm,ragga--M.,asM.massWmaMws,.W,5::zweQoktifwwmzgimw barpezs-sgufzsferswtttitzszwffwxmg-vf 5, Q 1221255 ms,g,yg5Sf, :sg 232554: Wi Y., gg? sm, isgfgsgsiszfzslwwzfssggemzszss-3-Mrwgifmxsufyf-W ,Na.s,:5-wastgqqgsas:mg5,tat25:55Qfzmssgzzwggsggazsgg'sigmahmm, My :Si:sgw2St?:5E'gfw,..iwswisizsfi ' - -S atrzimwsgqttzt sw . ii Q , a. . fy t , ,Q 1 1,4 ,t ,ws , M.. .vs ,, NM. . me .. Q .1 , qw ms . W, J., , ,s l W W.: , M , . . W, M- Q. . . .vt.a..t.. W ., ,. gjgsigeggggsigzsssgwsggmysgggga N , ?,,,g2-msg Piggy ssssg,-12:5 afeg-Msggsssmst,jwgggmygssa::.f53we:t:sg:f:.':f?5iSass.:ffmiizzqzwfr:ff:fnazeassiziffrifsisegMS?mn,imsksgswfsrasmggszszfwfmzmszzfggslgsffsggrfge Sfrfsssgggmisfssggftg-yazefzrgfgstiisssawiifizst:2ggm1s:5::t5igss,seQ5aQ5qg?gw .wirfmsz -25 ssvgfw f?'k5'4Mw4'!b-Fwqiffii Rf-Hiatt: 'r Q st?-'if W: WP-f'fw5'::' www News-Htsitfegn-as ?:'aw'.:agL'+5gt3ws t ..:5:ff:M::t::'fww sf.'g:wf--45371551m..'2g,geMswI.img ssfsxffzggmm::3,:wgw,,gvg'ii.m12aQBSW-w-A s3.F?S'i,1g:m-sffwzfsifw:-vm,,.a'e :Hgwz3sf,:wkmY.tggsgws tgtbfwgwyassem My ss,-,Q iqtgiitsm I-ll-IAO The Health and Hospital Administration Organization QHHAOJ represents the health administration program located within the political sciences department. The HA curriculum celebrated its 10-year anniversary last year, In this decade, Health Administration has grown from a handful of students to its present size of more than 100. During this period, HHAO has also expanded and developed, The Health and Hospital Administration Organization provides career guidelines for persons interested in the fields of health administration and hospital administration. Monthly meetings with speakers in conjunction with parties, field trips and our senior advising system enable such persons to learn more about their chosen field and the members of it. - by J. Lee Spruiell, president Row 1: Geoff Brown, Becky Whittemore, Liz Brooks, Arlene Carrasquillo, Lee Spruiell, Mark Burns, adviserg Jim Spearman. Row 2: David Schroeder, Barry Clements, Amy Yates, Gray Park- er, Elaine Zipp, Vicki Moore, Diana Rankin, Kari Jenkins. l-IPR Club The Health, Physical Education and Recreation Majors Club is the professional organization for all students going into the field. Our annual events include a jump- rope-for-heart marathon to raise money for the American Heart Association and a 10- kilometer HPR run in the spring. We also provide opportunities to attend national and statewide conventions. - by Ginny Ingram, president Row 1: Janet Solomon, secretary: Marie Pugh, Lou Ann Burry, membership chairman. Row 2: Debbie Lytle, Lori Tabb, Barry Gilliland, treasurerg Ginny lngrarn, president, Randy Sanderson. Row 3: Ann O'Mara, vice president, Matt Flood, Sandra New- kirk, adviser, Matt Wannebo, 448 Clubs TROY HELMS JENNIFER JOHNS as sa: .,.,. W-Wvmfffw'-'MWA-samwcmawe M sms N we-feawmfsmsmswc-A' M W NW., A-Mm-M mash. Nye-1 ..MW....,,,. Vw-me V-MP2 .,,--.5 www X, W-ff-f-M A---M .M ,Q XQNNWWWMWWNWKWMQDWMW WMMWMW M. WW N A A was W V .. at Wm .M .,,,,Q., ,, sa -. M.,NMW..ga.,1.aaaM, WMM i?.'?'x1f'lQ? E i4'-51A5 s,-MMQ .ffTl.WM,gJ2-4'a'XZ'E?' MMMWN Msg' .r we-'mt'fmwwf1zww'?WWM - 4 swag,-9-,gwmwu ...... - .. was te . mwwmm ,Mm .Macaw , ,WW W., lfammas wemwrf f seeae wwfaefaemtaew aw W. -, M V .MM ...... ,. A A .W W GWMWWW ..... hmmm ---- fm NM w . ri Wi ... Vw WW k.... - .. ... fa . ...., . , aaa -Wag www ..... me . ..., tw .... .... .aa V are W W W ggywixitff me x, gf- 35 ' MW 'rv Mmimww Eg w ,get-faxes? W M X f .fm vs Aw W wi a?!f lim 2 H, gauge' t ....... M .. Exif! - -V'- ,.,.., acts if .-..-- -2 ---- ..,...... .-.-. .... .aww X x x ....., . .... .mwp W A 5 t J +vggf ' i my gym mg if at Pix 333 :Qt cg 5 tvs 5 , 5 Egtxfq w 1 , X X Ex ,f 2. B itatf- :--'.5:ef'?-':s- ev ' .f- .wi---Q-P-tr ---- - ..., ...... . ------- ff .... - :....:...a..s ........ : + .- V y . mam W W ffg.. s t re-.gEi:g:5s:.g: .'E':a, -1-ga '3f3.,.3.3.'t'??E'.-'I '2'W'2 2'2'2- , if -i:5:s:rt:. 2'--212. -I-5- ,. ,... , .. ...: ':.'::- . .,.,. Q . .Q-ax., Wwvnwvrm rsiwt ta Ia.: Zi.. M M Wulf: fl? ,ag .::.- tt f -:,-1g5:,g-:,-ag.:-.. tt X :g:g:g: PM ,H 'tu - .-.- 1 W I as '- '2:E. ..:. 2:-2:.-' :-:-Z: -m e -:V ,. A w ig? ! i':tmef'.af.A.gE, t 1 V Wm 4 X .... , . M . .. , .. .. 5 , tilt ea ww i::::::::': E'IrI-:E. ..-. QEEEEEEEIETE -..- ---- :-g-- ---- 5 -5 E:.:E'5g2::gg2. ei: - a--H : .1-2-::':.1tf. ---- Wm gg as MXWXM Wm .-.- 7 .--- y 4 , .- ---- N W ,-:,:g-:g as-4-'ig-g:ag:g':f'::g'.-:g:..:- fd g-- MS, V, N 5 -:- -., -:-:,:g 2. :. :fs -:+-5-'af-.mga.-sg:gax::.:rt:: :g:,-5:'- ew sf. uit T H-,Q ' A f w WW :1:- ---- 'gg-.-a-g-.,s:is-:- -:-: ----2 ?ff:-.-'. ': 2'142-7 - - -if 'W 3 296256 Z f xwigez gggmf - ---- - si -fz. - Ii f fz egrgwfa . - 2221 2-w e-f ...2: ff-f:.1ff-aH2.2f2- eg- ff- :Z 2 -2 1 gi s wg w ikgiilx mt? - j41ii....: -:-:tt-. f x r ....,..... 565, -.m..l. ::-ei.: :.-g,g:,g,, i .,:,:a ,a--.- nys A s WWW , y zsj X x t as -'f -'-': :'.gj.5aEg:rfieErgr-if -',' f :. :g::,Z .,1c. ...:.r: A 3 153 x 92 X sgfg wx Ew X F2559 A 323 Qvft, if ,Sf- f gtggga gg yggggigam gasvaftat , S .,.,,. A k Masai' A Horticulture Forum The Horticulture Forum is an organization that strives to give students in the horticulture curricula the opportunity to practice what they learn. The bimonthly meetings feature guest lecturers from Auburn and surrounding areas. The meetings also provide a channel through which new students in the curricula may become acquainted with the department. The forum's activities include maintenance of the fragrance garden at Talladega Deaf and Blind School, plant sales on campus and assisting with Ag Day and Fall Bound- Up activities. - by Connie D. Davidson, secretary Row 1: Barry South, plant chairman, Barbara Shetter, newsletter editor, Rodney Cowart, president, LeeAnn Glidewell, treasurerg Connie Davidson, secretaryp Bill Davidson, vice-president, Row 2: Dr. D.Y. Perkins, adviser: Kathryne Morganp Jean Potter, Bennie Westg Doug Adams Flora Whittington. Row 3: Beth Snider, Susan Howe: Scot Craig, Daniel Websterg Gregg Clarkg Glenn Knight, Myra Sandersg Elisa Serecigni, publicity chairman. Russell Scofield Clubs 4 1... Na., M.. . .V -A . ,.., . M w e 'MM1f, f .... , ..,. g -:-tim g- 'ww ' M mm A ' i 'ziifm' wmzgzl gfa4Q5,s1,w5t:sMrntvaa5.'iTIIlkE?9fWWV 'SQa'iww'ViMS53?E5QWv V5n5w i -W . ,:: - ,:'g-gi i g k ' :' .j',5- 'sg- 52,2 as ...., .. '-' W f. 'K A ., W 2 .Ei-1' fits T 'wliitsfz'-if if . .... .M ..... . -.-.-. . 5.1353 .1-I . - ..,. A AWK if .- its .... Q y sv wi .W ts. f ff -5-:.':.: .., - . .N .- ..... 3 at .5g:g-,,:..gg- N ,fe is gs -. siysntgiwyssywe g, - ? , ., 9 sggis siaifa-'fa ,gg Sys .: -' ------ : ivs'aa'255gfi2ggfWpxg?fH f 55ts,, '-'- I -2.2- z:-z .. Qisgsft ww xr .... twig? Efififigyf - . :gag .:,j,:- g- g- 1 .,,. - :::,.: --.:. :,-:,:::,..:3---g:9t.,f-- :,-:,,:,,-,g,g:,:-g:,:: ,g-ga g-g --.- ::-:,:,:,:- .tg-5-,.,:,:-,:g ' ,, W 1 ff. 1 -, F f S' ,.. .i x -f'--,:-t.:,:'- -:-1 -fi. ,. : ---- .-:-:gg-:i . . , wwf fig swf 33335: f-SEN-feats-E I - ig :-.as-g-:- g:,:-.- ,y5tfvi554i5?2?Qg,assi?is,'?,5?ss'f?i? ?t'SiZ5Z,f?5 is J 5 -'Si e -'--- -: ,:fs233H?-'wg' af., Qstivwbil , at I i ,' i , f ..l2f1:i E i f--f .:'.:-735555 Qfsefsgigfgiifii sfjiiiffsefittiigassagiigsreigiigtsgfggggiiftft . L' -fi fr- fi.:' ' . i 3 , xga w ifiw ew. sit: 2 . ,J .... ---- ..., . if gaigrixsiiii ,ge skfyligsgpamagf., -W:waf5m..,tf,ss 4. .i Q as 2 ,spew twesttwl : i k2im..swM.w:.ff i sf , ., .. .-. ageztae eyqsaw esewtssaspgaagysgwt ssxflitwiggtx swsm sw iifwrsti5g::zw:s:Qgf'5:t4,:eiwswssssitting:et '- . , wiseQgfsfgyffisgattefietaviwikszfggbemsfsifgsgwfss Ksgwegftgg giggsimgfgiy raises? i . it Stats sts J j ---- ,,. xggQ,5.,we:,?fmQ:s?if5g5g5f .T iwttiw its -figs ss Pfsgfmtgm , 2: Wise, I j -2,22 :j:'. its f i QMSEXMWRSESZQQ5'?2:fV5i5T2f:i:3?ts:2i'iE,'aS.ii3:?iis3f4iHfQ2t'ei?f wmiiiiififiwfi wxigg iiftg ysiiss spits? WX? -2itsitQi,-ig?WEE?'X4355215?t'5??5li'EVtit?i?f?W53fiW5?25 . I 1 Q., H :..?,5g.,. ,,, , f5m 5w55t,1,,Qg :Q 9,55 Q-585,5'?gt.,.,,M5? gm, is gggmgggggtsgw.,5,,g,5im,g,,y5g,.,,g,g:,5gfg.ifgfasseg I -.-. . .- -'-- - - wfgkgsi ML st .wggggigf we :stiff 5 i :a '.: -f-.r:- TMisSt?i2Q4ti22:sii22?QxftP2?iQk52s2tww: i t:i 3i1F 2' iw 2 555 ti fi x e d? iii'ifit?:W2'sfW55Sfseftsiiaiisittffig I it IEEE The Institute of Electrical and Electronic Engineers CIEEEJ familiarizes EE majors with professional engineers and their companies. The student branch of the professional IEEE organization had a fall and spring picnic, a career night, an alumni open house at homecoming and several membership drives. The club emphasizes a student connection to recruiting companies. - by John Watson, president Lorri Allain, James H. Alton ll, Kenneth J. Anderson, Allen R. Andrews, Douglas K. Atamian, Brett A. Ayers, Jim Ball, Eric N. Barnhart, Robert D. Barton, William E, Batchelor, Barbara J. Beaty, James M. Blackmon, William M. Boggs, Richard A. Boutin, Edwin Briggs Jr, Reggie S. Brown, Scott Brown, Edwin J. Bruce, Barry S. Bryant, Karen L. Burdine, Greg Byrd, James F. Byrd, R. Dale Calhoun, Eugene P. Callaway, Cathy E. Cameron, Brent D. Carlson, Steven R. Carter, Sokha Chhak, Jeff Claxton, J. Scott Clayton, Institute of industrial Engineers provides industrial engineering students the opportunity to visit and tour industries: to meet professionals from major corporations such as Union Carbide, IBM and South Central Bell: to socialize with professors and classmates in activities including interdepartmental sports tournaments, intramurals, IIE fall banquet, spring picnic, E-Day, quarterly parties and senior chapter joint meetings. ln the past year, IIE raised more than 311,000 in the AGF Phon-a-thon and participated in the SGA Organizations Day. The group also attended the Regional Conference at the University of Arkansas, the IIE National Conference in New Orleans and received the Award of Excellence from IIE National. The chapter is active every quarter and welcomes anyone interested in the field of industrial engineering. - by Miriam McGhee, president 450 Clubs Timothy A. Coddington, Warren L. Collier, Daniel T. Cooks, David L. Cox, Robert J. Cox, Wade E. Culver, Kurt W. Dadd, Tim Daniels, Keith N. Davis, Douglas Deaton, Victor E. DeBrunner, William M. Duke, James N. Duncan, Eugene E. Eckman Jr., Timothy D. Eden, Kyle Ellison Jr, Russell E. Evans, Tommy C. Farinelli, Ed Foreman, Gary W. Friesen, Thomas W. Fuller, John Gamble, Alfonso Garcia, Patrick A. Carrett, Tony F. Gatlin, Sean P. Gibson, Susan B. Gillimore, John E. Gipson, Charles T. Golson, Terry C. Gordon, John A, Gossett, Russell K, Graham, Ralph L. Grant, John D. Greene, William D. Gross Jr, Robert O. Haack Jr, Sameer S. Haddad, Mike Hale, Clifford L. Hall Ill, Michael J. Hall, Tim Hall, Roger S. Hancock, S. Hamilton Hardin Ill, Gary Harrison, Glenn D. Harrison, Bruce A. Harvey, Joseph W. Hopf, Clay Hudgins, Gary D. Hulse, Steven P. Hultquist, Sally Humphries, Doris C. Irwin, Edward F. Jackson, En-Jer J. Jang, Joanne W. Janosov, Gregory A. Johnson, Timothy A. Johnson, Timothy K. Johnson, William D. Jones Jr, Kevin Keene, Joseph G. Kenny, Andrew E. Kimble, Carla M. Kitchens, Edward A. Kosiba, Claire E. Kuhlow, Stephen A. Langston, David C. Lea, Crawford R. Ledbetter Jr, Robert L. Lock lll, Michael M. Logue, F. Alex Luttrell Ill, Marc D. Maclntire, Robert Makofske, Ken Marchman, William B. Marsh Ill, Jennifer Martin, John, L. Martin, Patrice E. Martin, Timothy J. Martin, Lee Y. Mason, Anthony J. Mayhall, Charles McCarver, Charles A McCombs, John McCune, J. Franklin McLain Jr, Michael L. McMiIlar, Suzanne M. Moon, Gregory J. Moore, Doug Morris, Michael A. Morris, Douglas E. Morrison, Lama Mouayad, Kimberly Mullin, Richard A. Mungenast, Thomas A. Norden, William G. Obert, Luther E. Odom Jr, Bradley Overton, Robert M. Parmer, Jerry L. Patton, Stephen D. Pearce, Ricky J. Pender, Bobbi A. Perry, Stevan P. Popp, James R. Poteet, John C. Price, Guy Ouedens, C. Michelle Respess, Kim J. Reynolds, Daniel A. Richards, Michael R. Riggs, Donald Roberts, Chandra Dv Satish, Jerry Siegel, Timothy B. Slay, Frank Smith, Anthony A. Smoke, John V. Stewart, Rodney W. Stewart, Ross Stocks, Larry Stokley, Byron E. Sturgis Jr, Linda Sumners, Vicki M. Sundberg, Donna R. Swinney, Patrick A. Talley, James A. Taylor, Norman E. Tew, Suchai Thanawastein, Amy C. Thomason, A. Duane Trimm, Phillip Trussell, Steven S. Twigg, C.W. Upp, Maja Van Eysbergen, Scott R. Vechinski, James E. Vinson, Amanda Waldrop, Lawrence A Wall, Joseph S. Wasley, John S.Watson Jr, Marc S. Watson, J, Allan Weaver, James M. Webster, Debra L. Weinberg, Carole A. Welch, Wayne Westerhouse, Roger M. Whitson, Llgon Williams, Paul M. Williams, Wyatt Williams, George A. Wilson, Samuel Wilson Jr, Oliver Wright Row 1: Richard Washington, treasurerg Elizabeth Dumas, corresponding secretaryg Barbara Sands, secretary, Miriam McGhee, president, James Bray, vice presidentg Tim Cook, E-council representative. Row 2: Lisa Proctor, Laura Ward, Nancy Denning, Amy Sharpe, Jeannine Sladky, Lisa Hamilton, Cindy Barron, Rose Chu, Amy Walker, Lisa Fallon. Row 3: Jeff Colquitt, Thomas Harris, Louisa Harrell, Suzanne Baker, Melanie Herring, Beebe Etheredge, Debra Eastis. Row 4: Roy Rhodes, Paul Butler, Jimmy Bass, Roger Williams, Jim Littlefield, Ginger Atwell, Teresa Prochaska, Fred Kirksey, Mark Corbin, Bryan Drummond. Row 5: Kip Browning, Chip Williams, Mark Carpenter, Tim Homen, Mark Wood. tt' PW ,t s2'rW'ttf:1f ' W 2??i?'TSt'R' E2EII2' tf E : IE'?:1 M .. W.:,n-w ' mtg on sgsfrvtg , 235:25 aggggwftagg .. 353,29 H 6:,3b,,,,, ,gt1r , rg,.32t:zf:Y-gt, - W 5g:e5,,,5 -W i . .::i.s:f-iii-1--F-ff A -f-Aw :,. w 3.35 at Vsfgsgv'-imap gtZ':Z'st,,, .2 ww . , ' ' W g: -.Q 2 Jesu ::.: : :.,.- is Q? tum-' t, me Q, , 5 .f:::5..2:Q:2-:i'2:, ' r i1::::':-5-::-1- -I-:-:-' -iff-arr rr.-5:'-.2:g: 2:55 .:,-,- Y., W..,,,,ff'M ra .-A gifkfgairi ait':1ttQf3v-fr'?V?y?QgAt5?g:sg52g'gv255l ggwgif-awk Qiigigg-v5',35ff1ffv'Ef2ii55?z5 Wfe? 2i.fFT:- : :-..':-:':'.'- :--? - -5- --'-' :-Q -it -..- gi .-.. N-::.:::, 35:-em, M afeww t-:Sr-Ee '- ' I . . ----- wi: .- , ss w ' r ft.I',,J'f Hrwlsmmrr-..r f- f 4 Zwrxfasrfwtmni ,, Ara? it- as - 2- Saw ' ::.:. . :. 6-2110- W stuffy it s - M B? rm .:.:.:: Weaem ww -' e -: X E-rf: ..-.f. :h .:.:-:-:-:-: .-e:N- -::: it-:-: --.-: -'-' . :trs:::t:: a5s:.p::.-:-: 2 it hw--2-2--t-::-:5:Q: KW--M-A ir l s-:-Hi: ' 5 -. twxiwkisisigwti...,-wr-fsfrii-fm fl rlgffiiiwmf-3--Mvteexggsiifex,tkffgfigviiumtt , ea?-ty -msgwa - . Q -gg-- .. ,.,.,. , stiff:-anew ppm ffafgtka ttf.- t ..,., ,.,...,. .,., t ,. 9:5--: ..-. me ------- -M, tat., I-11-. :,.f,-ti., -- -1- .... t gmx ww srwibtiwt-'Mwiwmw'faWtf5s -ww-ea-Q amine wa 353 s'?f-SSW-is-f' 55it2 it -'-.-:'-:-:-'- ---- ::s: ::w-s- , .S i n it.. tgiwfiftwli st-K-fgsfaft ,. gg .-:. - ti , tt .-.-.. t .-:.:,..,,.,.., ,,,,N,,,t:::g5 l Q, X, ..... t r:t:. ...g,- .tgtsiftitggmjkgwts-A-1m.5a??5Sitti?,1:421-X-flag-fagmfitffQe?.Wtfli5tc2'agr-kiwi ap t-mggg'78, :,--,:-:: .:.:.,:..:.., :a:.:' we -gg:-::fg 5E.:. tpa-fi-wr t giityke ---- M - l - :-5:-:r:---: 1. P S-M fs vaftsztz-R0-pfgegyttywfBMA? Weggtiwf wisgstiiiissfgwiggfiyevrratg-ag M3 ,t ,::-:,--:,:-:- v 25,-rg--Q -5- i:-sa vage .,,. 1- ,tx- ,.,:-,::: - :rs ----: - ga: im., mwnmw-we Nii r-PSS- Qifiig :fg5H 'gt m:2ii2!g'2 gg, wisfaifftrsg-itffffimraktv2353--5-ar--5515gt3'fZ'iE?v?fI?f04151-wv15Eft 5fzHisf2-A -ivgss M122-ei2q'i'iTI5Ii'-:I I iIiI' V 'tm-i--I-2:-iii 2: -4--: : : :2- :.f' -v-,gs ' '.: ...-W.-. :I -satire, - sgsgfgraggatgtgggh-ts- 5iQl iSZt?'fgyA tz1:.,:-sw ift at -as 2 Wamkfsssizflzgt-its-rfttf-ffw-5 egwtffiis-xi - QQ: 126555332-E-fr-mixer wvvifaxsrzefswfzJwfxfsrz-555:31-ms, we - -gt , ---- -Q ww is ..... . rf- r ssigiaweti-bfrgefsxs-atprgggmtixggffsfsgshfsy N3 giigxazfggffggizigtgggtszeesf z'fn?54fgsw,f-:A-2350 N-0gtSXfaar,:3Q , +uu,2f:2 K ax is, ':iir'925.?r?15?3Et,fQ?t3i'iS4?5.ftt' ----'----- - ------'-'- : . S M- Sy-smfzstza wimsfff z-feltrss tit '-22 -- ----- ::. wuszwffrm Qfmxmii effirf rt .: 55n2wt its A Lilttstsa ietiieif aiw 5 - ::2:1:': -' wwf M2 2 Rm a:ag':--ta ::::t5 :ESEx12g:,,?t-sggisgjgisiftfsswgffiigf-55152fxigwwcfisriicgziggzii-sign-eligigg X wfisfigggg-ggi :-.-aes- .saf:::::.:f::: :f,f-::.. 11 1 - . P ,:, ,??-pf-Z-fm--Q fem- r --H, -:Q-.:,.f..,:.:,:E:,:-::E 1: :, ,. mwgtt, siassw--sm we rms: .int ff We M--yn-1 f 25Q.t,:t.:-N ll . W M5 r - . we - -:--:,:,: f-tiff, .--:-:--5-at, .... ti ..::::. ::::.' z ---- -ff? mt' -W 3' .:.-.--:f.::-5: -1-.: ---- , - -aft. ::::: . :-ta: --:m2:- :- ------ - g:g:g:t.4, l U --::i:-ea :-'f: e- f2ZQ?3?iZZib::55f?r5?55 2 t g . E MWA . : 22fg5g?s3gS2gg 5 6 mms wif' 0 .... ew- Q . .. Kadettes The Kadettes are the official hostesses of the Army ROTC at Auburn. We sponsored a covered dish supper, an ice cream party and a skating party with the ROTC. The Kadettes also function as a service organization. We raised money for Muscular Dystrophy, visited the nursing home and took goodies to the residents for Thanksgiving. We also ushered for plays at Telfair Peet Theatre. Our winter rush pledged 35 enthusiastic Kadettes. They too will march in the President's Day Parade and attend the annual spring cookout at Chewacla State Park. Kadettes is a way of serving the Army, the University and the community and have lots of fun while you are doing it. - by Liz Ard, public relations chairman Row 1: Capt. Dallas, Lee Crane, presidentg Dedra Kelley, treasurer. Row 2: Carla Kitchens, Casey Cook, Mary Allen Hamilton, vice president: Jodie Brantley, secretary. Row 3: Julie Boswick, Teri Williams, Julie Rogers, rush chairman. Row 4: Eva Bonney, Kimberlie Hall, Susan Daniel, Row 5: Laura Bonney, Jane Nichol, Kelley Burleson. Row 6: Paige Faulkner, Susan Hutto, Doorthy Mullin. Row 7: Yvonne Orzech, Sally Thompson, Kimberly Hicks. Row 8: Jan Skipper, Harriet CRAIG SHIRLEY Woodbery. Row 9: Sue Robuck, Liz Ard, public relations chairmang Lori Vaught. Row 10: Julie Williams, Lori Leath, Karie Coleman. Row 11: Kaci Tranum, Janet Kinsey. Management Club The Management Club is an affiliate of the Society for the Advancement of Management. The club is a national organization composed of campus and professional chapters. Throughout the year, members hear many excellent speakers in the management field. The club plans several field trips to local businesses each year. Dr. John Blackstone is adviser. - by Mike Cox, president Row 1: Kathleen Basile, Stephanie Diamond, Cindy Poole. Row 2: Margaret Strawn, Scott Elliott, treasurerg Tom Foley, Lisa Tucker, Lisa Ford, Kevin Connolly, Michelle Grimes, Raw 3: Gavin Thorsen, Mike Cox, president: Ad Cash, Steve Moseley, Robert Pinkston, Tim C. Wood, vice president of public relations. nick Hott Clubs 451 We' 'ill' 'MIL N Awe -Ulm-me ' iw News Ma,a...,,:?'EM-WM me Mwmmww J? fi tfiff S5 g et is- :2'2 :f'f?5?Ef?f3 i 'iE'- ':::E' :2 M E wif? CM wiiiifgwgfw W ,ecgigsftgsggrgg ggrsggiiiw gszggggegeg . 9 M Q12 552 stein 4? swam - ' MM '-'--'-' - ' ' -5: 1 451 . , ft Q. Wfw Q P is -. fi-.gil fi sim ?-IEQQI2 r W .:2E:E::2I2I-::... ' i, .,:E: if : :j-:I-:':j- :':,g5 ,. ' -1j'a':Eg:g g:r,:3'i-j- -' :'2IfgE: .2f2, .:- Z 552555, -j-,255 0 s ig? 'Y f? , ft Q iiiigifggi ..... lm... - f Qf ij ii iffg, F' 'EWS E-EIEIIII-EQfI'iaf5fIfQ:I'55 f ,Q 5355? :j 'E.5--Q-ISL , ':Ef, ' EI 1 3 ,f 1 E 1 N uf g, -'-' T45 Q 5 as ' as g was sg it it 4, E t f 2QZ sss35Bi?g,m3fgsf?fsg5g,Ei-em. Qgf ff :i fff ig ws i-r2. 2 -Qtr: 5? Z E MR U wijsgq . -: :::r: ..fi- E'-: : ' :.:s ' .. W' . :i: ': :.- .: ,-E5:' ::E3E5'5:5E-: '5Mg?4'2X 'uvT?g?9w'i ff ' MW bf' YS ff 'iff if Lgffs. 222 Q at af K W 'ffm 5 ,E D. t M1 M' , ., .f - - fi 5?f?3i55 9mffgs'i A vflffif? ativg V M 'iv ff 4,4 will emma i are . 'Slim W We.. - ' - ' wi I W M i PM .... 5 sm ,e ff ,awash f Berger, Bruce Boyanton, Kelli Campbell, Stacy Cayll, Dianne Cooper, Hazel Crump, James Farmer, Michael Gilbert, Mark Gootee, Stephanie Gustin, Leslie Whitt, Lynda Jackson, Lisa Jancer, Ann Laster, Nina Pawlowski, John Presley, Phillip Floberts, Amanda Yancy, Patricia 452 Clubs Kappa Epsilon is a professional fraternity Smoke-Out and Poison Prevention Week organized for the purpose of promoting On Valentines Day a faculty tea was held pharmacy as a career. lts objective is to to bring the students and the faculty stimulate in its members a desire for high together. A major role of Kappa Epsilon is scholarship, to foster a professional to serve as the official host of the School of . consciousness and to provide a bond of Pharmacy. - lasting loyalty and friendship. Activities for the year include participation in the by Linda Whitt president American Cancer Society's Great American to ' J rw 5 .. 'wfircmwezcfft - at ffyft.,tp-iw , .fn N ,SEWWZ ' ---- M CHNWOWWLW if if -. 12 t -, -' -. - -'f- fi wi ---------- Q ..... - '5 ' tif- :: ., . -- ............,.... , f ' gg P at 2 ' tl , ..,A... . .. :f .. ,w s - Q -' ---- -'- ew -'- -' i WW! X t .-.-, iw .V.. .................. .... .-.- -.--, - . .-.-.-..-..-- . - ..., . ,-.-. , , ,.,.,.,..:., AI.: , ,,,:,a, ,,,,:,,,.,.,,,,,,,.,,.,:,. ,::,,. :.: .,.,.,.,.,,, I ,,,,,,,,, , , ,,,,,,,,,,,,,,,,..,..:.,. V M V , . . .L,, .,., ,.,., ,,,., , , . , ......... ......... ..., . . ., ,, , ,:,,,.:3.,.,.,.,: , , ,., ,:5 ,.,,,. ,.. .X........ , we N ,, .,.,:,:a:,:f,: ,.... N .. .:.,.:-.-. , M ni K : : : .,... s swsasm? ----- H H ' Kappa Psi Chartered in 1963, the Delta Gamma chapter of Kappa Psi Pharmaceutical Fraternity serves as a professional fraternity for pharmacy students. Begun in 1879, Kappa Psi is the oldest and largest pharmacy fraternity in the United States. The fraternity gives pharmacy students the opportunity to become involved in many academic, leadership, professional and social activities that will benefit them as well as the community and the profession of pharmacy. Kappa Psi strives to establish a spirit of professionalism and a bond of true friendship among all of its members through the many varied projects carried out through the year. - by Keith McWilliams, regent Q Q ,,, asart its , -X x x M fl --., K K . , ' .is ..,, if , Alverson, Jeffrey Baskin, Jeannine Boyd, Pamela Carpenter, John Cashwell, Germaine Chastain, James Coffee, Arthur Coker, Samuel Collier, Patience Cumbee, Lisa Darling, Charles Foster, Lisa Farmer, Michael Dollar, Penny i A f. hs-w g k Sal-3: 'fire s 9 ' 1 ,N 521.22 W YE 3 its Q, g R 3 ,Es kgs 12. . , , i Y Gaskin, Paula Gibson, J. Hassell, Joe Hill, Elaine Hobbs, Keith James, Cathy Johnson, Sara Jones, Cheryl Jones, Susan Markham, Julia McWilliams, Keith Morris, Penny Plott, Carolyn Sanders, Patricia Simenton, Bonnie Smith, Laura Swallow, Alicia Tania, Jon Tew, Tommy Thomasson, C. Weeks, Kim Westbrooks, Teresa Wilken, Leon Wright, Carol Clubs sm-W Q V. ws W www 9 Q ,MW M, W1-www: mmgfmgdf eq ,., 6,545 ww 1 Q8 x mga H ww W . N, , .W.,,.W ww. . an N V .... Xwggw . MAS wivxgw, is W, :S ,y as awww, 2 Q? by QI-xi-i52'5?5 WMN,:.fwm 3WwQ MmwM Agway L was ffm -'------'- . AMW . ....,.. 'im Mm as rms ww f f we gf fum my gms mg :2gg :: Q X f 1, ::':?:a:a:gga ,, 2 ' .. , Q ' 55 m5,.ff.w-W,,WW vwmrg: I ,.wWW' w WWW my z T M at M -ffywffggz w gr w:.:a-.gre- MM -um-:'f.3 ---.: ww? 35155, 'H fgxwxump wvriifxf aww, wQ224.:aA .., .... ...... 55 zfggigi - : ,.,.. M vw wx my N. if 4 A 'LEM + iwhsm Vzfl W' f Ma5wgi,Qf5v'4 E Wm? SWA ggi,,j,, fm Ms mem Hemi W Wim f fi 332554 WE Q gina Q ..... : - W v Vx qw Mwgww , 5..,, .... 5 M23 ...... . .. .... , , X 6 ,, wg 1. A qw QM ,ff aw.. , . . , Af:-12:- X 'fW-2--If-v::'.-.-w.:L :W-:--rf::ff-:::-12:-'Q 3.-:Q -.-. , -. ----- ,U .... gg:-:,:-:g:g-gags-,-g-5-5-1-.-.- -.-::5-..,..:g. q.Q..m,', l wmyg 4,52 P 3 'W H4 Qz., 1 .:':- Si-,V 'Q .,.:'::g:g-' - 1 4 S ---- 9334 QWWTZM ' giwggglgimmg., W ,Ag-gwmggag 1'-fi mm- NW-10 gg g 'N ff 59 Qi' N 3 Q fra' 32 2-rf S :- W 4isi5f5?5i? v 3 EWS? ,S essiifw W: N W' ws 2 ' .. ffm ..... A M S if A Q' w kggigiwsay gziagiifgzag .,.. .LE K f Tw N RWE WQNWA A 1- 5'-5:52-'ff :f::-.:s. 5?3?g5ggQW?35?5i3?i g55gi5EE355ggg,EQ 5+555?'5Bg? 5k5f53Sh gvyfggggfgggg ggfii ,,,, - if Q 51 , ..., .,.x. , ,.,.,. , u l, .,...,. .. ......:.-. .,.: ,.:., , mf ,.... , . g,,, 4 U N ,,,M,,,, . .. ff' f Q ff 4 ' f Q, :Qs 1 QW H .:--1: 1-15-si .:: A :M .... .. M 1 A X342 ' fw Q Jifizvffzs., :,: gg2jE:f-55- 2 - Q5 Xgwgfi gpg, gg? ,Mfg .... W, ,3E,gQX,.M,5 .fewuwm l Q www .. Qisl pi m ss, vs ff XMW fieggffffiiwiq 55 sy ww 2 A pf- Liiswfmayviffffxw2fhZw,fy52 Qgigljfigfggf X s:-: W1 ,fi fnxfzw ml- -I W A :5'5 E':5:5-52-IE 1 M x,m4fxx, Q R ,,,.Q...ga N .. M mmgwggwgg ...... SN agp mm as yfgw 55:5 gym r ,V W,-m urmzwjgg ---- , ' Q-g:.g:gg-rs,25:35:a-.g2:,:55aE,:,f:::::-:g::':jwi:552f2.5z3'.g:5ge:si-:E',Eg.g1.E-:E--:-M:.:-.,...gf:,55-:5,:g:-55:5-5-fj: ,. 4 x .5 A - Q .3 . 55 W5 Nec, A Q ,3,,ig5f,QgL:,agg,,, kg: gigigie v u f . . ...... . ..,.,......... f ..,.., . M ., KW ........ K , ,.,., 5 .,.,.. ' ....... ffgxf: ..,... z gSfQf x 5 . ,, M ii .,.,.,., if iw , . A eff ..... E. H Wg? Wg, 5 . . ag, mwswsfifw, .Kim A A mf ,SX wsgiiw, if .. 6' W 1 4 fff mf-15W my 5 A 1 ....- gg ,2f?23f2'5S g gi? Kfwsflffiizk 9551? A A 5 sq 1-1 3 +1 Qu, 'Q 4 ,X v SW , RY Qggqggg sign Ewigggggf E 6 QM W 4 M hy N, va ix Q 9 J' w'Y,Q:5m , Q 9 Q52 gy wgegmy 5 2 ' Q K. lgmmgxgsm, .,.. : AM.. ,.,:.,., S ...,,5.,.,. W ,QM I, .,., . .,.. Q.. .... ,, ,yqs f i l ' r z ' Q Ki . f fi 5' Nl mx ,..... - 5 i Q , gg 'f s V w A is ,iq N f ...., ..... ,M :E gt: 5,525 f X Egg Y fs A? M5592 L fm K' N1 fm? 2' if ' 'fx 5 S 9 5? 2 M , ---- SEQ 5 'f R gf? W 5? f 'Q wk Q Q 5 ww? A .... ...... , . . Q Lg ,y 1 W M .,...... A ,....... ,,,.,. . .,... . H A KV ' m'X,gj? Q -1 sisfiv w DENA CREWS 454 Clubs CAROL MATHEWS F JULIE EVANS LAURA MCFGAN ADDONA SPEAR ELIZABETH DECKER A 1 N N JANET JOHNSON E SUEIE WEST KIRSTEN WHITE ALL PHOTOS - B FITZ .7f ':i'V QmQ5E?33XW 4 I-f i ' Ifi .: -vg1,' j,'g,:,5:?- Zf!'!E?3,...'? Ei -gjE'I5E:'1.-253323195 'N',,,.Q , ,- 12251-2- mm Us A iii NM sw Esgszniiswxfgwug Eymx g v W gf Q1 N355 xv 6 eg gi? gi ,Sig pm M, K M is H My .... er: .., ..., 3 Y-Q ,iff 3 ?g'4ffX3q1?E5' M ,Mg,g,,,f5'41 Q if ffrsviig :Q 3 5 5 vgygv g rgg W A , K Qgaig fi W 4 3 i 2 WiSf3mW 5 5? 555,15 rijaii? fi, 2, 5? 3 ii fs 5 df' as r F? 5 t Ss se M 5 at W fe ,f A We Q Q gg 4 S Q g gratis? Q .gf ge fs A yfailita N422 is sgyxf .fat 5? as SWK? W WM l News s 5, 8 gf Viz i Egg 'S XEXQQQQK so W Y W ,s ' iix Ei W WE A Q :gi wma ..: Ms. .... : ...,. - -g : ---- -.-f: ::s-: .... - - 4.35: -. .. . ,W V ... ,M W--N We . ----: ---- -: WM M. N .ig ge,1w,e2fK,fv:sif?:,sg We g t ? ',g3g,s:,s', , Q egg any we t it at me , X5 ff , J gtk ,gt ff KM, Q 53155 23325 ,isa W ,g tr M45 ',f::Qs45,G as Q 'Swag Sn, is igwzivlizadlrfi AL, ,wif 13, Q WY, s tew:-' gm tgp fix. KEN J iiigmg 5Q?siMsl,,,gg Q, H15 N f asf, 5 'Q . 4 .... J ..... cg, ., Q 2' ' fgis. x, g? who 'tis ' . .x 2 .1253 mf J , liz 3 fag? W ,Uk i 7 .G N-,w.:,,,,,E -:.:-:2i:2:-'a- -f.2'.2 ::2:-Q-tai-:E-.Ea:fg:.:i5.5.7--IS-' ,M Q aw' Q-1 'ww ff, ' ...s-'-:2f222':--.2:-:5--it-5I.I'-I:.:E.E2-::2-i22:2E'2:':iF-fi-.5E'-:2:2' i 'E'::.e::-222 .2-'iti Z, as asy g ,,,,,,,, Q-32.5-gs: ':2.gE' eww :giizrefi , ' . . - . X Q X M ilf :ff S' E ' t t, i iiiii - .2 r ,XX 5 . my 3:12222 -: :I.!'.E' , ' -:siI':2'.2--:-.2--2'.-:':3:-'--- , :fi If -.-.. : 3 ::,- ..,,- .-.- : ::.,gg.-i:- :.:.as:i:- - .:gg:,-w:-.- 4-all Nw M A -- '-'-' gJ,:E.g'::3.-.:2'f:' :i:?i::. mf-uf ' -5 ..-',,.,...,--MW 5 A irq ' .,.. N :SSW if g ., ., E ..... .. .,..- W WRWMW, W ,.-,-, 1 mm RW, H, V .WW 545 ,aff -,LJ xy S' as KQV ya ,Q kata sys fits, fi, gf r A I g ym: X W in '- -' ,,,,,:gf WM3 A W W,,,,,, W M'm' Tf,,,,, Q. Professionalism is our goal at the Auburn University Collegiate Chapter of the American Marketing Association, most commonly known as the Marketing Club. Through professionalism, we can show the business world that Auburn marketing students are leaders. We strive for greater variety in career alternatives by hosting company speakers who share their job experiences and other advice on what businesses are looking for in marketing graduates today. Above all, our most important function is our aid to students in their employment search by showing them that - yes, marketers market products - but moreover, we market ourselves. - by Lise Orfllion, president Row 1: Lise Orillion, president: Laura Thorington, secretary, Darby Gaskins, treasurer: Tim FitzGerald, promotion chairman: Wes Pearson, promotion chairman. Row 2: Blake Thomas, director of fund raisingg Lisa M. Damiano, director ol faculty relations, Ellen Williams, Donna Hudon, Kurt Blumthal. Row 3: Janelle Hobdy, Judy Shephard, Alison Hendrix, Karen Pennirnan, Wayne Sims, membership chairman. Row 4: Ellen Ellis, Kip Guin, Paula Holt, Jay Ellis, Kevin Thompson, Debbie Akin, Row 5: Jelina Allen, Carol Freeman, Tom Dickerson, Fiick Butgereit, Cynthia Jones, Kelly Schilleci. Row 6: Flichard Fuller, Kay Brooks, Carolyn Kell, Gil lsbell, Janet Couch. Marketing Club l Clubs We-2t,,Q,,, 5 W ' MMK, ' ??f3:eff2?3azz?1-3'-f1G s4'W ma2ffiw'244-4fQ,QrWLi2mQ,c,t:aaa.L:r-1':aSf New 't'Mrf ,:1'W Mfwg-Mwggggzew mms HQ:-W WMM N-f-WWMWW - ew- f We f .... smmsatwe ........ N- wwmwwm .1 ..... .f f wmswwa-.M W w-www-we-mwl s ismaw Ego: U gggqkyv ass MWWN--V www ravwowww M Wa-wmmmewms N1::-.eW,..mmwm MMWW M-Meek J Wav ..., r wr awww: r ' awww rf WIS- Wm , -rw WMM? Kre w - :'t'Hrs amseM,.,..w.mW.- la - Savane MW-mm fe ..... V . mes. mess, sw , W at X A , L, fs 9 ,.,, ess M- ..WW.sfa9r5wt22N W-www , , ummm ,swarm ---- Nm maewaawr .r W. - ,amoems m.z,m,,,, .... r l swxrsam es.tewRg .WWHW M Nam.. mmmut-as .M sru,.,,W.. ...wr saws g WW ? t . M .,... , YQ? mi l :rf :afar -: :- - -- :- ll: -.gr r . ---- : Sr WWSMQQQSYRWW r ' ' simmer , . A- :'-.'--':':': : -- :1: 1:15 . -: :f:-:ig-2f.:': :t:: l. 2: 2 3 :: .-:- -.rf-::-: xiii? NMFS Q' at 2: li ff ' W we I is , , .h.,. ...- we ----- ..-.- 'M ':'Z'i' . . r - - - M :mm V -f -'---------------- Q -v- ------ - - . . -.-N ..-.-:A:r:::.:-::,:::.,..:.:.:..-.,.. v..,... .. . .: -- --W .a.-::v:-..,...,, , .- ---- .- Wwwwwf -:tea-:::aaea- .-.- 1 ....... . N .. . MW W -1-:--.t:::,:::x-:::wea:-l.-:rl-: -... .... -..-.- - .--. - MMA- ---------' A Weis: ,. l Navy And Marine ROTC .1-r '!N Marine Corps Birthday Ball Navy Football 456 Clubs - Mariners is a service organization Mariners affiliated with the Auburn Navy-Marine ROTC unit, They serve as official hostesses for the NROTC unit and conduct service projects throughout the Auburn area. Mariners sponsor a blood drive, a food drive for the needy and visitation to a home for the elderly. - by Major Chrisfenson Row 1: Charlene Moy, Stephanie Diamond, Donnell Glenn, Beverly Copeland, Shari Barcz, Barbara Olson, Christy Armour. Row 2: Marily Helmke, Trish Carrbey, Anne Nebergall, Martha Cash, Lisa Gibson, Susan Lytle, Leslie Beard. Row 3: Amy Allen, Julie Turner, Marty Heaton, Laurie Frantz, Katherine Henderson, Patti Snider, Susan Isbell, Janice Gilde. Row 4: Lt. Greg Hartung, Kay Nabors, Kathy Saal, Sarah Mackey Donna Barry, Sarah Hall, Faith Gibson, Kathy Chalfant, Candace Moorer, Lori Wilson, Cathy Cave, Major Eric Christensen. eewewewmfrre News w V : Q mfs. Q. ,- U,-W , ., was , ,. ,, . , M, ,M 2 ,gsm Q Q ,Q eigsaa its M 1 Westie an ak f -H- E.::. :mi '-2-rs--:I-: , . :2.1::.. re' f t wr : 15r tZ , slfrfrwtaiiktiw , Mf:'12YtEW .:::E.-1: Sfttiai s Dewi? :Signer55tf1S'iS'is??'5fGN5?w1f,lrwrrf Jia., ' 5- :I-:-'.. r: :-:-z -:.:,--.-fM ,4,,gQ:g:,..:,w: ,:..,::.- -,- rival f?2S5i?St22 v S22i2s2i42fgsaem:siK3?2S-Heir E,5s r'rrQz5fz2eEes Szifei fsvzrw g??e wSg2. -..::.:.-: fi sf isesziszsa , 155' sgatg,ss.,. rsst, egassggwr' 3, -sf: -:::: ezwiserffasiftg, tfftfi issrfs v 'Se e If 'w s-a a: e: ':f ty H an glee? , Q r gg, Egg ,M A W j We , sc.. .Egg rmswigg E ASM Q2 ggi esgkrmm vggiglyhfg. , as s5S,.,.ggg2.,.razs agar. saws ? A an N ri . is 2, 'F ,.,.. - '2 W M C' 2 We 1 Sf r K rf sa Q X 'W ,Gigs sw A X s -r J Q .1 ,ters W .fr M E 5 T, t f Q s ,. W M Q as 1. tr Q H lrgg Zi, TQ ffawag ig Qijtw ,fs Nmigrsgrwgr 330 sg V eww, it gtg bf Y v A J 4 2 4 x .2 We 9 x ,W i as v af YM W ,Xi se wers ,cgi is X15 in iasfiis 53? Taizbfgiw VSV BWP' 334355 TQ? 'E as divas 590 f't'5'5im? f QM?-Q veg? .1 at v in WSH? S3505 v ix K 'N we 0 sf E A Pr R ff 'Q 1 vgf XM 0 I f get ij' :ME saws :ir is te P ' few 4 is tr taxa? ef 2 was asf N sr vi 2 er 4' rt 'I ear 12 Fi E W Hs sir watt? :girlie l ' ' X' 0 9 t at N Q SW QM-SP Em A' tf ef-wr m4'e ff M: vt W fr Q sv Q s is Y Yr 01 'Em a t t rv f 4.1, SA s, 'SEM N + z 1 gpg E A gssa v A gp, if , gg , massage r A, M, ,ages wig s if 3 y Q Q 5,2 my ,s V is 4 S, J E ,. X M, Q 5, M A s 5, W, X r Q Q 44 fy ,V 1 , gm ,A R, i Q 7 Aggww 1 ,fx 4 W as N fasts fs rt we r We ar if 3+ 2 Qs Q fr Ri tts: ,, ef S get gf? f ,img Q , . .vs ...r .. i ass be 2 -.--- tt s J ff mf. s w ee., 4 in is-3 Q? X 3: X fs Row 1: John Brow, Lindsay Kirkland, Ray Row 4: Major Christenson, Richard Schmitz, Brian Summerlin, Lamar Buckelew, Daniel l-less. Row 2: Davis, Calvin Williams, Joe Bauknecht, Jett Robert Toth, Sam Mandy, Mark Holladay, Ron Dearolph. Row 5: John Von Achen, David Barber, Barto, Jett Pugh, Row 3: Steve Driggers, James Wendell Riley, Chris Hardcastle, James Carroll. Wilbourn, Tom Gibson, Tim O'Keete, Robert Tye. Semper Fidelis Semper Fidelis is the Marine Corps Honorary and Service society at Auburn, dedicated to promoting the pride and esprit d corps that is the U.S. Marine Corps. Semper Fidelis sponsors the Marine Corps Birthday Ball, a field meet and field training exercises. - by Major Chrfstenson mg- t... ., X . - 7 U ' ' ,vs .Sw ' J lr 'fri : . v I fm Y ' 'Pi I- . , , fs .. V .. . .- sr a rym 1. 'frm rrswib Ig 5 ' . f-.gy 4 , ffl?-Y' ' . ns .Q ig: 'Q W N' X ' M fx. r t r -' ' 4- - Q, -- - ' A -A 1. x S 'P K ' ' f-r ' . 5 .V , ..,. ,,.,...:. . D r . H ST 1' - ' X ,T ' ...lf-, .1 . ' .M . ,. , : Akk ,.:. T .X A Q. ,. -K is Navy And Marine ROTC The Navy-Marine ROTC program provides an outstanding opportunity for students to learn about and earn a degree in the Naval Service. Some 315 students participate in a challenging and rewarding program of drill, Naval Science classes, summer cruises and social events leading to a commission either in the U.S. Navy or Marine Corps. Founded in 1946, the Auburn NROTC is one of the country's premier NROTC units, sponsoring rifle and pistol teams and a drill team which competes nationally. lt also sponsors some 50 Navy and Marine enlisted personnel in the ECP and MECEP programs, who while on active duty are earning degrees and commissions in the Naval service. - l r i by Major Christenson Clubs 457 .. . . W , ,Q , ,V ... : Q Va Y ' sv we , we .mga , 15, We-fwfsswr sw aw Aww A591 ,W ri wr-fr Yti,f,me?W :sms ffiw-is wleqgtfk saga sf , ,samgsysfftfswafwsmfsB-taxess::Qww.::fwJ :gifs :M Nts. - 1 fi? AQQQW gtsfrfggfkffas frpfiflssizcffgagssftyafraggffmargfsfgfrafargfgtrrrisigissggafwge fswrrsrtggwfsixzgisMffggsfw::wZsit1:may:wfzgnfsffr.r:5y:wf1f5s3gagrfrgsgssgsfggsQghfgkifitgfggsavffsgfgawezlfrffglrgstrgsaflbfffwjiitrfffsrwmtssrggfgfge nf Nt N 2 MB arf N mcg 1-if Hass' tw raw? W tfsfgmr Pf s',ffff21fg7igf3l2tp?t2:31r.Lgf5W5Q.,E,f P?9P-5 , ww r x ff f as U sgffgfsrrzttfffg,-fs as riwfgfs wfferbwr wzsgirwxflwsf f 'g r :M girgg -:.3gasssffa,,,21,2'r' fy rr -- 5 tzgsgggrggfw - Xkkwtxrafviemgiffifsra iikiqrsrr wtggMa5f'2afQr:'-rt2'r2Qfwfs5:ffsQvJm, 1f's,ggga.wfivvafwfrsgtqivgisife.if'r3.?'5E.?f.f525,fn.i:fw??r?'it??f1Jw-ffg vm-1'wm,,w 5wy.:fQfAwa3:frbMw ffmsrfgfggfku. wwf Isfwg 9 siwiwfffr my rrgveisyfar Q - fc ,J Q , K . W sr sm rv g.f,,,,. Uaunt, may -f, , 1 me ,gba ,ff WMS as M,-ew ,wma ,gs , 9 mtg 5 Q s, VW, ,yn,,a,,w,.q,,gs,,3s,Msm rf., s,.3s,vtmga,a,,g:, 5fWy,wrg.ggw gesyseg M gwgagkiikgwq ,, fqa9dygggWfG,Sx,s,g,:,1s,r -2.2 - 'hlfffvgqwgi if -1 mf -W - Afzgsiffggwffwsfsisirwsffifz-aifwifwfff itsiiiirwsffbzsszasfswfisaybit tfwgsgifiaxtthgvsifr-39533als?05H695M..iw5t'fr-r':rr'2g92tire5:m:.m. fwffmisrkfwaff'ezaitw.gi55w 'WSESQMQ t?Q1ra ff5r?' NPI' :5'sg4 :t'awf':b sgggrttts-tt wirlrffbgiaf ffm? an - .g sew ., - ,barge s fa trmattgwhivvr gfa ggga,,sgy:tfw,f,t,rM,'r-gm wget:-,srssgaag gsfmwm 3 :pawm,,f2g,gtgrrff':sgtr2',:,r2s.tgfMime,ywuwlzgflL.,rtaf,e,.p.t:whswtrrrfiygsisgmsw zrsrstsgerrmmgglfssrr m:3rg1S'e:M?:t:sw QS:sm,gfiggvrsfggwistlrsixfwiffgfee'g-Swtklfrftlfrftg .- , : ,sv H errgxasgsrra 55:39-ffs ,arrgtfrgfstg wr sgirfmfwi:fw,5:rfr':srw5'zwww:'ffm-frsgsfarrewwlf-ferr www-fs Mmwirgwwmtswifrrrmfzirgxwfes rsweaw M552 'gg' wt - . f its trams-'f'g,57rrdf 4 gif' 5 M Sam wr?ww:-zmtfriflrsf?1ww::a1t2f?4sw.r: wrists-wfswz-sry:L.-siasflfrm emvsvrrzsbw :KHWSKSX -twat ey-362. feiwfas'swsmzfsmtsw:wvf:,5f'wr,,swtzsffqfszrmhtsfww ,sw me 4 fw 0 Q sw v sativ a A M .- 49 sggasfgwgwglfggi, Mwsggrfsw gazfsfgfawsgwamass,aegws,M1fiwgmwe-swfwsgw rfgwzwrt aww: y::w.e,,, ggayrszlksssftrfzzfvfsgviasfffrvzrfgw afstwagg rsgwsgwf 'ew 559, gg 5? sr r g m swaegfs ,, gaining Q tr .. 5552121 :Marla 4 - 1: .. .2-.r ste Q - wfisrgf ga me, ft . sf fre fttstaiffm Wssfqrtsffatwwswmrrfrim Mfr:rxrwffsfiffeafzfHifswffffafriifriffifrffifzfrffaflstesszsfsrstf,Mflrrrttwst T' getfrtftritrsffrs.22lrrfQrizrrffS22:: 4 f H . fr- - 2 -: at f .N rftfsstsgfsswfw-c 4 latter fswwsafrigswiiwfirssrff-M:-ws:fi .sm mf::f.a:'i2fr-rsvewrztrwsf rasiirria Www vwwfasfraefrwegs asians-RsrwwesmerwawieszuyNfrfws tw 1-s evg sgmggggiss .- Q . . ,xi I 5:9525-fifgegft gifts Etta: sf '!3?2MsFQs'f3gag?,WQ?5: watgfvzsasmgfwfW:wmf :syf? 1aVs,i,1'wwsiir1-a2sQvsgrv?,f:3?t?gwfsf 2,?755a-ww,fzfasrwssgwsmevatesat kigawgfatgvytfgvr mfflewtfs is-rg .. .. f , . Q . f Q : .- Pharmacy Council The Pharmacy Student Council is composed of students and representatives of the various organizations within the School of Pharmacy. The council serves as a medium between the pharmacy students and faculty. In addition, the council coordinates intercommunication between the groups in the pharmacy school. Some of the activities in which the council is involved include Pharmacy Day, pharmacy graduation, a pharmacy picnic and many other events which help promote the pharmacy profession. - by Phillip Presley, president Row 1: Tim Brown, Keith McWilliams, Phillip Perley, Jimmy Crump. Row 2: Mary Martin, Linda Stevens, Pam Boyd, Connie Roebuck, Robin Rich, Lynda Whitt, Stephanie Gootee. Row 3: Ruth Sternley, Bonnie Simonton, Jeannine Buskin, Keith Conner, Row 4: Anna Brooklere, Shain Guthin. Row 5: Jerry Beaird, Roger Burnett. Phi Chi Theta Phi Chi Theta is a professional fraternity that furthers the business cause among women. Speakers are featured at meetings, and members participate in Business Day. Rush parties are held each quarter. Requirements for membership are a 2.5 GPA and classification of at least a third- quarter freshman. - by Lori Vaught, president Row 1: Sylvia Ayers, Lisa Ayers, Nancy Street, Rebecca Harrell. Row 2: Janet Pinson, Anne Rowland, Lynne Greco, Rebecca Greco, Lori Vaught. 458 Clubs CRAIG SHIRLEY M, TROY HELMS 353-ffveftiiis w h stssftyss 'Q W'WTtW'f Mg0?.fif3M2FWm'?fW3El mxf'Mm'M5'LiiZt2mfW'15-gssilm ew K-165' EIZTTMM 'NWS' W . :elm-,fs iw ,.,. . wssasstsisf mm h.,...,.. Wwe . Ma ftifga-AN ----- ---- 2 -'W t:: E. :az2: ' ---- '-'-'- - fej- '22 I:-:'j.-.:f:i, :5: . - 5, 54 firgrtfgfifgrtr 52256 f-1 ---. : .,:.:f...:sfa:5:.,:5 'W 25-if ...... . X, 3 ' ig ..... . 3 , , ,,,,,, .... r l f . r l I ! Z T ' '. .,..,., . ...., . si. ..., , . . .. .L 5 WW -.-.-.- is i ----- ...... : E: IIE' 5!--135' ' f i his vEs.ww5f.,Q,.WM, ,,,,,,, m.mW,. MMM' M.. ' A.-v- - ---- ,,,, V WM- -M W -'- femmes NM mt sew if '-'- B -ff? ....... W -M-wp-ff M enezes? 'C Mt 'swf-wrvwvffm ,,,,f,Hs1. ' ,m m-fagvw, W f---M Mg iweffiffzf .. tml :QW W2 1 W st5 f Qwa , 6s:w-WANNA .,::Wf . asmra' -v-- wwiwtelfm-sswmy wwe-L-gilt ................ - ...., , . ..., v,v.. Summer orientation leaders help incoming freshmen attending Auburn's pre- college counseling program adjust to college life. Orientation leaders welcome prospective students when they arrive on campus and assist in introducting new students to the various facilities, services and organizations available at Auburn. - Row 1: Carolyn Plott, Carol Arnold, Jane Harrelson, Suzanne Lacey, Michael McCormack. Row 2: Willola Ashley, Pamela Edmond, Sharon Guest, Cynthia Wagner, Cindy Childers, Row 3: Elizabeth Leer, Wayne Strother, Sharon Bailey, Andy Bailie, Cindy Wright, Todd Holloway, Pam Moore. Row 4: Rafael Castro, Linda Knight, Lisa Copeland, Ted Colquett, Kris Bolton, Thomas Neely, Betty Neel, Mark Morgan, Mike Day. Not Pictured: David Hatfield. by Mark Morgan PHOTO SERVICES Pre-College Counselors Clubs W T MM5,,m,,,,gMj,, ,.,,,.:ea 5 ,.,. ., .,.,. , g:.:. ::,. Q' mam rm ' twirl 1' 'T'T739Ti52YQ'2 S'3i?'X?5322g?3R5HSEWEXNTWZWWZ -' j f T, : ' 3' f: : :' .2ig: ::--T ..... - ..... V A EI52:'.'sI: .-:?.15?.2.5:2' :i ':' -'- -T-a xe? ':,: 133,92 'lei gin ,,Eg,g+g: - : Wt at -'QI-,:i:j 'Z ?35f5gQf1,gVfiNes:5gg3g5g?, T Q , , f ::j:r .... T A 'Qwgewe tis :fag 1 4 if E Q: ---- ::,:f9i 5:::- f - f43iiff-1- -:. ggwiaigigaixt .L ,. .r -?- 5 Mg555 Vg? Ehglslggggiggsgggtzszgzkx Ei - .. . me Wigs ?sg?s.3iigf2f2w, W i 5 2 2f25L2! E 5 rf .slff fil 5gf3i::. :g,.1T: 1-2221: ,L.,T:E?ii3EW A325535 EESMJZQSQ 3 22322545235 'Vim W l V A Q .g,4 ,EQ5EVVf'2wgge 'gms Ts -V fi: , -.-.. :H: ,T Qwmgvg, W g S Wg egg? ,4 E V .. 9358 W9 -,-. ,, ...1.. .... . M' I-an ------ - ----- -.-.- : ---- ' 55833 st 'f N -- W mm - :.s- '-'- if 221.2- -isa-2 'N Tz.. :z:i:g, 2: -T' -'--: NEW 555229515 Q4 Robin Adkins Beth Alt Robert Aplin Lisa Armstrong Tom Arnold Patsy Lee Ayer Betty Camille Barn M, Gayle Barnett Dr, Charles Barr Donna P. Barton Jerry Beaird Robert T. Bishop Lisa Marie Bock Timothy Boozer Anna Brooklere John Brooklere Andrew F. Brown Roger Burnett Connie Burt Dr. Keith Campaig Rebecca Caruso Lori Chesser James Clanton Dr, Randell Clark Dr. Samuel Coker Keith Conner Been Cooper James Crump eil T13 Dr. Charles Darling Anna Dennis Marion Doegg Mark Donaldson Dave Ennis Bill Felkey Mary Frye Connie Fulk Mark Gilbert Karen Greene Jenny Harris Terri Hearn Gay Hembree Lisa Higginbotham Sandra Holladay Jeftrey Humerick Vickie Johnston Lissa Jones Rebecca Jones Judy Kohl Catherine Krause Johnny Landers Joseph Lane Elizabeth Lawrenc David Loftin Phillip Lyman Frances Lynch Mary Martin Syble McClellan Steven McDonald Mary Monk Mark Morgan DeAnna Nelson Thomas Nowlin Robert Person 460 Clubs 9 If-' -I- De- 8 Phi Delta Chi is a professional fraternity i1yD9fT9V1SiOlT and diabetes SCFGGVWVWQ-H which strives to advance the pharmacy profession. Members actively participate in by Ruth Stanley, president various service activities such as Chi WF W W' T. fei!72'IiZ'T . 'V 5 1.14 1 4 - 'f ' iikijjflsia -V f I 3 fe: T A T ' : T ff f T -WV - 'M , ff? ' ' N T T ,..t .4 .T M i 1 QV: f A ivfbf A AE' f 1 ' W, Jr ,f ' Q R., ' ., fr, ' p ' T ff -P ' ' -ss it . , V :T , K ' , - E1 'gp A V V' V l 'K y4,T,,,7, , I H TTATWT U,.,mWM , T , H ,gffgm ,,,,, T , 5 T 'LV ,.. f '- . A V, . ' ,LT ,, wh T f - , r W' H, ' 4 T' . 2 -fV , T ' 5 L K I , ' T 9 ' ' ' ' V '1.TT V T V ,s I T ' f sw V , -V 1 h T , .H '-4. ' W ,. T T 1 , V A A- W , T ,,,, .JV TT , , 'Y A f 'E u ' A Ks , 4 T T X -f , f B A i s V' fl Q if MVQTVA Www VT W V V W' r A fi V Pi ,,,,,,,., , -,1f,, , ,V.1 ,, V as A I In , ,T I, ,,e, .V 'r f .V T- V V 5 it ,,, .,,, :V-2 V V ,V - L, ' . T ' 7 VH 2 7 fT 4, 4 ., 2 , T T V iv ' ' Y ' .5 ' , - , 'QT ' . fr V I V T, . , . 8 P V' W A - ' T 4 W ' -A V V , T, ,,. ,, 1 ' V f x' ,V A ,X . ' x ' , , - T f T. V,c,V ' T ' 'L ' - Al A it llyrl T T f . ,, D -' '- R V 41 'Z , ' i T V T. f Mix? 2' gg V is T f if Y T T V J . az., A , , , 'S Q ' V I, , ' G , ' T Q A 1 1 I ..,' , , :arse 2 'zT:Va1VfAVq 455,g,Vg,V ,. twxizitxf ' ,z-T x f W -I ,M , .I ,TT ly In ' gT I -V T T.-I , f at W f fff ' 1 r .f T Exim ,m,,: iii 'W' wk Pr WZ t Wi' if 1 A tg l X , x L is , A 1 Nl is 'W WV . if M' W w ey ....,. . W 51' f ,X X wg S Q 4 Q X 6 Q S Q -1 Q it ,,.. fi? u - , t -bf si- , his x . J. Q A L X i ' 'WW' . -,.- N.. if in Xxli iff' of 1 ri V g.fk,22g K 13511: e tv YF' ,A - -, iwvfsfl f -l - if .. . X' z Ki- W- .S , . warg-.. . Q is-awww ' . : ,J . . , 1 ? J . .. ' gg C ,, M , 5? Z, is if wx? 'rx 1 .. H. it Q at 3 I xx ftww xr' W' ,, M 1 N ..i Kerry Prickett William Ravis Robin Rich Thomas Riley Connie Roebuck Julie Rogers Kathy Sawyer Melanie Scarborough Donald Scarcliff James Schmidt Mary Schwartz Sarah Scott Lisa Shippey Sherry Silvey Charles Solomon Ruth Stanley Linda Stevens Michael Stone Pamela Swanner Jennie Swearengen Christie Thomas James Thomison Cheryl Vann Greg Weeks Dr. Byron Williams Mari Wyckoff Clubs J 5 QS s 25 24 .. ...., s.,swMM so ,,,,,,,,,,. ?4i,,,s. W U ..,.... . ,.... W . ...... ,, .,.... .. .. .. ,..... ,.,., m,iW3,1g.. .M V - 3. tgvssgwigy ,Q gm, has Q Qg4,gmmZQ,g? EyL? Uk Qs ,- .W 563 , , ,WL , M-M3 it A A FWAMQ Mg? P3 5052 We -' .::' -'-' Wim 'N '?fi59Pg rtffgg' s5rPiS s?lf5fM32. 3 fa ,355 5 :2 -'-'-' :??5: vis? hseigisstt t' Ki -::-:5..::, 'r it xv wx fs i L r st ' fl 1, 1 dw Q ts f G W fm 1 Q xr t Ti it fr ff tw nw Mes we we 2 31 533333 9 5 Q 4 , g ,Hs if x Si -is SY' 2' if ei 'F ifmggsgxiigfqiysg mtgjgl vifvgiggt' K 3 V SE5 Q ggggaggggxygkgigiggggswgg A aqig 'S I Us s te S r t' fmt? Wigs 2 gi 555 M if :AW as rs gtg s , e rf Wigs, Q 5522? Ae, gg? ggggrggg Q sg 2, sg ,tty MM, wk , 5 tsrwg 5g as ,::,:,:,EW f 3.511 if lf:-ififlf f f ,B 5:f5f'ff : .,..,.,. EW 'aff YEHQE Iiififii' Lfw47f Q eff ff '3s,,55 Q gg, 233 v WS rr? We Q Q it 2 22:1 , it -.2-:n s-2 ,,,iiis3s2rE2g? if gi I.:-::.::: as A 251: '-use Mg? 595: ?'f::zEii Egreffi writ: QEHQEHW :f, g2? 22. :. :t2' 'ik has-if .ve-z-.sv - ,- .-2 ....., : Qg:g1..1f.:if.:-94'-.: s-' -::--:-4- -. . .1..-..va' - - S' '- I-f'. -:I-- J' .' A H .'!. r - - I-.-2 . , - we xiuawiss A' 11' SQ QV Amir' ir 'ez - 2-Y-sis is ,' .-'I M Pr 4 r 7 r , -ww fb D iw 'rs , P' ' T sf W ' t f 52 - ,., .... EH.,,...,,.:-5.5.5,-g-, .W , ..: 3 . -:.:.:..- A Y i .Ha ew V: is 5 , get-in Zi. sms :P -Ae mst s a w ww Q d ,si-'er we es, it iw W , . ss g as me R2 it kr M ::, :2-: 5- ::,.::sz-::, '?t' . ::- fl , Q-1g23Z'if W me iii? era? ,yi rgiwfffiwi t issesi ,Qs fgfgsgwgflmi his M if ' zswkww at is PW' 'Viv it 't 3 5 . :4:.'.:: - 13:Q:--ai-:f-,.:-arg:-ls, -iz , 5:13 ,me 'gr ezgifggigf r wg'Mgwbelessl',.fg,s,,g,,?wg ,L 2:5 5: 32 Hg K, ' .X 's2.23s2.-I M sw if 'iris it sm, X ge if it ,sag ws t mf gf, i E ri pf? s is v ,. M t i . M W ,gs , N W N as its segg,,iwW ,mb my vmsfws we gr weft Er ,, Ss A rgw A fe Q a? s Q f '43, 5: A .gz sw if st Za? 3 Qi at 5 Q23 ,, Q ws ta gf-wt as H2834 xx J, K r , H' avi get am, at ss., is E Q X ia s ' me., 1 A ' .ii . Y tt' ft 4 2 it ss if wt' 3 t is e tag s S st s P' H if M si at sw Q as Z s if 1 c.. + E L2 X K ,K nf .nf Z k V7.4 at we tt tr it t, st ,ts ww if B, 8 , im A f fi Q .9 ,seg R5 it if 'Z' Ks 1 HG 34 F 7' '43 xi i nf y ' v EY ' 'ip s we gi Aw figs J WM 'Ns v s Q' fr '-4 22 ri v wsu A W i 'l rn, jgfeiiifg jiri it 31 Wx ' :r f 'tis 1 0181 SQ st ! yt' ' 1 3 Q M25 Wkygfisgigfgi v tm .Ns ,its 535 Q 6 its Q s er, Q91 ,gy ,QVEQW f ti H ff, 15,2 ,za r sits is games, ,Sages eww tsrrglj if ti, at i ri Q xr if , r its, rssesir rg earrsees it f X L ,QMNI 4+ Q ,mx ssw its saggy , kggggsgf S, y g m, 5,3 ,Q 1:5 s -Ms tm a w if fgg gfis gs 2 ,, ,sig all 5 aft? firm 1 fi jam,j,,gs:5Zf3?,sg?igZ,s,ga w s gggs., NW I '1 'V 3 fasts is was f it s feEg?iggEHz Wgektjwgggssggglqi gf ts gm. M Ks :Mrk 53,353 gig, .ss ti 4' VE aw, 'tag -. -,---- 5, . , -'-'- at f fa 'ft wr t iss we we grew' W me , :rf . Q, .. .-,.., .::.- , . - .,.,,:, .. , . . .:.,.,, , , .. , , , . , , Q V ., .V .. , .,. . .. Q ' 9 f ' Z? 19 is 4 ,X S asf 3 W A ' S ti Qs, sr Wig, 25 5 fig ties ti his gg i s, ,Siem 5. , M is Q 52 t Q 1 rr Y e A , at tt 1, .2 2 0 9 g Q ss Q Wg ,, Q Q. t af i ' .- 'w ,..gf' ie- - :3:'g:':g :-4:- ..:e:a.-: gas:- ::g5::gqg,,. ,--1-3:- - .,.., : :i,- ,g::.5.:f - :az , fy misses isis, wwf '25 A XM e is it 4333 is is itz, Q- ,mwmiti :i sis-el :-:,- We r l , -: :.s:.:..t.::.::r-i-1-:-es,-: :::..-ig: ., ,g ---- - 1-:A--..,: .g.,. 5.,:.:,:.:.,:. ,. .,.5.,g -g.g4g,g,- .w if i m e t fwawdwe W ,A 2 Q, S. . V, :Q r 9 .:. v - vwwess ' ..4:..:. we s : ,.2sz :r:5- tff gww t,,s'emw-s'2 'my Q33 51-s .3 :a':::.:s:'ft:--,- .- T 1: 2 .. Ha w ' Maw r it . . Project Uplift Project Llplitt PRO Volunteers - People Reaching Others iformerly known as Big Brothers and Big Sistersl. Project Uplift, organized in 1973, is a community family service agency funded by local communities through the department of tamily and child development and is located in the Glanton House. PPO Volunteers is one of its programs, and approximately 125 Auburn students volunteer each year, Included in each year's activities is an annual Christmas party for volunteers and children. - b y Tom Westmoreland Sonya Wood, Michael Batts, Wes Pearson, Lori Pearson, Steve Grendae, Dawn Hastie, Brenda Slaughter, Karen Yingling, Jean Seickel, Cindy Chaney, Steve Staff, Steve Graham, Mary Jane Mitchell, Anna Armour, Bon Martin, Lydia Campbell, Gus Lind, Jim Johns, Jan Goldman, Nancy Courtney, Candy Edwards, Jim Svacha, Terri Allison, Traci Detchon, Treva Harris, Sandi Shute, Elizabeth Primm, Nancy Burchins, Ann Dominick, Ann Osteen, Dottie Martino, Emily Logan, Maria Baker, Lisa Batts, Angel Childers, Lane Dugger, Lucy McQueen. Pre-Vet Association 462 Clubs The Auburn Pre-Veterinary Medical Association strives to stimulate student interest in veterinary medicine and to familiarize its members with what to expect and what will be expected of them once they are accepted to veterinary school. Another purpose of the club is to give members a chance to meet others with the same interests as they have in a more relaxed situation outside the classroom. Club membership is open to anyone with an interest in veterinary medicine and animal care. The club has several special projects during the school year. The biggest is our annual Stock Dog Clinic held in March. The club also has a volunteer work program with an Auburn veterinarian and a local Angus farm. We are planning a dog wash this spring to benefit the Lee County Humane Society. by Jim Thorsen, president Dan Gentry, David Filer, James Thorsen, Gary Yates, Cindy Spicer, Bose Ann Drost, Meredith Dobbins, Margaret McTighe, Donna Moore, Cathy Kilgore, Dara Fleming, Beth Boyd, Denise Weaver, William Allen, Dana Franz, Catherine Boyett, Janet Tinsley, Elwyn Powell, Troy Bearden, Tom Williamson, Anita Graves, Steve Epperson, Cheryl Blankenship, Ftandy Davis, Hank Hall, Shannon Miculek, Janice Machen, Marika Laszlo, Bavi Tolwani, Ann Daves, Barbara Findlen, Teri Troutmon. mv JENNIFER JOHNS JOHN REED X it' My '.E: i'-22 521 W ':if '1?t'f SW tis 1'-ri 'MT W - - M T - -g .:-.: .stzvzfs-zwmsm lsxs. V: M- -1 : - K -W' try- 51151: 'Q' -ei? - 375, :ffl W4l3f7i' f'xeTl-Lf'i'5 - St ? ::'.-aft .Q 5252: i:'.2'--? 5 -5: 2 ::i5'fi' E 5?E2 : I5IEEi? - .i g ----. 2 ' '-2 f':Qi2f,:'i:E: .g::i -1' Hg? QNX leak gwikwiggegeftwe' .,., 2 .. gi.: W 4 if S sw 'V if .gsggize - - - were ' austere:-s-2 -.-.- . ---'- . - -.a: :: S W 'ti QEWNVRQX We , ,Z 9595?-52-Eiga: f in 2-iiv ftxszfs ..... we - '- ' i't't:: -: :':2:-- s xwew :::--: 4'.' :'.2- Q xii Q ,N .-,s is tam .- ,,--M 2' .... it ' xii' . h Q , WA simiif? '::- 1-'2 .- 2 :- '. -' r-:i:.- - :-:2 -i:ig- ,- -:,.-.,:5:g-,r- ,,,,j-.-.-5 5? .-,... ,.,,, 4 s., .,. 'V i' is Q Q- sim M5 f' ' bile? 'Pi NS' ' gif --- 3 ...Q- Sgigw-??s r5 2f3??XY5:55-Ps: its-is Y:-tfdsaw-i2.f,t :' -, is W- w -:?trf- .- .:. ---- ' i-3.. . 1- ...--:-haw : - ..... : - .:---.-:f:g.-g-1: -- ,:.:-.-1- ...:: -:ma --.- 1 ---- .- ...'. 'V ..-- fa as mr-wa www-.-f..s-wr,--,als-:Q-aaa ..... .1 -.ff fi is is fi - Q 5 -v-- ---. .,., - .... - --.- ---. - 2 MN' SL- MQWfM:sSif 'Wssst?PEtwt?3iki S W ----- - A 5' 'P -....::-- -.5-q .-.. s 5 --ste, -. . . -at if . wfwig W, wi ,pe it , is . . time .-., -. ---- -5.5: 'te -' rq,2s, 5i--M swf-igisgavmset-.sfwiwa -0-155.452 33 is f re if-we -wgfibstzmg az--1-sages A gg fe -. S .- ..e-fa :- af Witt? 2 stir? M ,W . Q tr 1553?-E,:sgzs,i,sgs:sf:::a5y....,,gaae::,?:-2tN't:sf3ew5? -.. ' gsm gi st-iw -tmigttrisfssa-sava ge s - 2 'wr -f m- .fn-:stir A-vgawravg s 52?3fgfag:,w,725:65-xfgwsssyim-, Y, We wwgggggrv, ..::-.-::': -.f.:g::-g .... - ---- Ha-, vzttsgwwi-agiiggfwiif we , cg:-5-. .,. -. sg--.. ., :2E-?- -... g .-... -. til 9' 5 4fjS2? Qg ?:g i E s 2 ?1?e'gf QafiQ 35?5 . fi, gg QM-Tffiw 2--2I.:2 ..: - f?If:3ft2 if-5 1:- EES: :'.: -ia:-':E -:. ' -.-. is ' ---- ' A 6 . as .- .'.:f-:.- W s. tmmgw, at wtf 5325- tsssw-igavfft -is W-fm Q rf 'tis .. ::- ft.-,a: -af- '-'- ...' : - ..... r - --.- .,:- -, -: -'-' 4 1 it-Q: if ..,... - s i--Wi .,.., : .. ,.,. i , t- .,,,3, , 1 - - ,-Q, -.tg , ms.: fs g : gf. -- as - , -S, .r ,ji fgg' ,,0m.m2,i-sg -'Mig .-: -aw w A W it is-2' 'tl C if - .asia ' -- ---- - -- C Enicfiibff' Racquetball Club The Racquetball Club is open to all students, faculty and staff of Auburn University and is designed to promote racquetball on campus. The club offers the best competition and instruction that is available in the Auburn area. The RCAU sponsors several tournaments each year and sponsors a University team for the State and National Intercollegiate Racquetball Championships. Auburn was the 1982 winner of the Alabama State intercollegiate Championships and placed fifth at the National Championships last year. - by Jeff Woodard president Row 1: Darren Shorthouse, Ed l-lonicker, Glenn Donald, Schuyler Felkins, Maja VanEysbergen, Sallie Greene. Row 2: Richard Lopez, Alan Robinson, Ben Pope, Jeff Woodard, president: Dave Capets, treasurer: John Brooks. Not Pictured: Ray Ybara, John Goodling, faculty adviser: Rodney Fyrmanski, Howard Epstein, David Hayes, Jennifer Fall, Mary Shepard. vice presidentg Steve Hagen, Craig Huff, Ligon Williams, Dean Ritter, Ted Shoop, Phillip Joiner, Michael Dendy. vice president: Jan French, president, Sue Savoldi, secretary, Robyn Francis, parliamentarian. Row 2: Nancy Brady. Carol Ferlisi, Cydney Thornton, Cindy Law, Natalie Rogers, Sandy Malcolm, Carter Holmes, Becky Owens, Candy Phelps, Patti Moses, Kristen Glasgow. Row 3: Cecilia Bodet, Leslie Haynes, Angie Strain, Sandy Johnson, Melanie Borden, M. WEEKS Row 1: Elizabeth Barton, treasurer: Lea Weston, Laura Ratcliffe, iris Dabrowski, Andrea McCain, I Cindy Ayers, Stephanie Forrister, Kay Norlander, Amy Spidle Michelle Russell Carolyn Jones Debbie Triestram, Pam Mosley, Tracey Hilliard, Kim Roberts, Jill Whatley, Toni Ledbetter. Not Pictured: Doug Baxter, sponsorg Lori Antony, The Spikettes are the official hostesses Renee Carland, Leisa Chambliss, Kimberly Hicks, f0f Auburrfs track team- Theif duties Michelle Hill, Letia Owens, Jill Roberson. include acting as hostesses for all home meets during the cross-country and indoor and outdoor seasons, timing events, taking measurements and keeping score. In addition, the Spikettes travel to some of the away meets to promote team spirit and to Show SUPPOVT- -' by Jan French, president 463 fr , as ,.1g .f..t.fi..,g?...ii,. 6.2-sis. I . .il,g.iz, r W, ?g,,2 ,gwg,issgfjsiS5,-Z iggy :est-msiig gg, 64,5331 QW e isggirggfrsfjiiggiw mgigsfrywi . , .. .K ., w ere .:j.:,-',:,,,j.5:s,:gv'.f: .5.:,.:g..:g:::- 5.g:'.f::,.:.g:g.g:,,:j.,:g.-..-.:52:,: ,: .., s it 5. :':2 ,f - ' N s,MQ,,.wffe 2:-. , 1. W I -.': .2 -: I -. .M , S gr,-5, we ,, is ,, t , g:,.j:,.,..2 :V :.':-a rms: 0 , wk . W 3-:j:5 - g :,s':: Er '-II IE-2,3-g':g ' - 2 is it Eiga s ss ff f ww rr f l 2, 'XZ :giv e sf, rf si, :,. .-. J., Q,-,gm W W3 ,Q W isiiwss We ,A Msyms g, , awe QE, Zg9,M f,sW ski fswfss s' -,:: - asm ' as ,J 1 .. A . , ,sa i s ,Q . Ti S A s ais at X ,,'bfW'ffe'i my List? ee., -.m.,, as is as in N52 -,V m r W ,M N ea - M -gg-3,53 0 :-:,::-,-- :- ,g,.--. ,G -,ZZ lg- s h ag A Q f ,V 'f A - .-, :,,- 5 .-Lg: sw W? 2 X533 rss 'Ty s? ,,5figwS?M i w. 53533, ly ffg gga W :'gf ,2..:,. w gg ., as gg , ,gd il- 5 ,g:,5: Q -532:-: ' 5 gag..-: .4 r 3451 fi gs'-r't-f '.lj.. - - .f .. i n Q Q -,'.j'-:f el-'2.e2-Ie' : Z-1E'..'-fl, S as is Eiini iiwf 4 ir 'W sy 391.53 34 :i':r:' .....-:','r:' 53-3.9 3 N i s -. . ,, .. , .: is gsm, is get 4 g , Q, , E, . , E, ,,,,,,, ,,, , gs, W , 5 as na.. W , ,.,, 4 ,Jr ,Q ,i , -2 ---- N- -- ,i ,wp rf ss fi is ss mf Messrs tries. messes iss Qgw sss M fs is si JE? if sf , rt fl I it fe: . .,.... is fe + ff f t... -'II'-I M25-2:2If:':EfI:Z:.l:..'E'I'I,..I:I:'iI.Il Z:'I'QIfE ,z S 4 LF , - - - ..,a,ef:s- :1a'f,:Z,.-.4 .-'sim' s :, x Y Y 'i ,Ei 4 A X s s 1 'f W ng l,'g:.:.-:K fr 4 4 5 s sf : .g.,:,,:,::--:,:,:g:5g5:,s H ,ff tw, ,X -' 1,-gif: ,Mi ss ess? isas ms M i g? M, A 'ei 353.8 , , , ff V 'ft nm gjg5g5: f if g:':j5:j: 1, seg. ,wq,,,,,, f ,gs,g, ,gg:,:: ,... ,- . - ,,2f f:55g55 , ,: :,:g.': :r :j:g:g.-Q: ' sf Q W , ' S 'sir aw, :sr we i siszrtwssis zig?52ss 23 2523222 2g yf2N'5wgS'gg2-ev : :sis: ':.':s :2's:s:':f- ' r.:-::..:. :.::. wi f 'rs tiirirfzssisxtsm sms, wiizfis miss V, if 4 fMwg1f'iwsys' .re 5'f.is.asses wma - - 'I-:I-I -22:-if 'wg an is 423 2 a we as 5 A 1, f gags? 2 elf sizes 4 J P J 1 we few? ag sf 2 if Sem is rs., anew P Zwksfgwggw ffm TE,QZ ,,fIiffZ .... fi ,Q ,fi .. ,faamiiig QW gr Q saggy? 5, QW s, . ,,,, Eyisxgtgg-5t,,, 5,,g,,ff .e,,,,5,3,fik,,, E:a,,, m,g,.., , , EW Y, , .. ,.,. ,U ,,,., , f is is as sir Si? iigiteimiieai Q fig r ff se .fs s ,Q 5 if Q if fs ff E A g fi A ggi? 'Aww A my sf W s 6 1 ,559 ....i 0 Ei. A W ,E , lst? Q ......... ,gig ,i ,3,,s,,E,s.W,,,, Wm,.5:i,.m5??,i,:, ,, Evwgsfggs 9,390 .... sis is gl gif si . .... . at W -- Q, M r r f W , .Ji QW, ,,,, ,,, iW, , ,,iZM ,f,.Vg?5.2 at my gg ggggggfg 2 :nigga ,Q ,, M, X.,,,,,l M ,Mg ,W R, , W, i n aw ,,.,., in ,.,. .... , 5 E EM M wi 0 gi W as r M sw, write f Q1 gg Q 5 Mex A522 QU Br :fe Eiga 6, g is 3253 if ZW 49 sq, 5,2 xi! sig, s ate Meir seg we :gf ss KW si? 2 sa were 5. igesetrm? iw new es W 6 it vi QQ :' its if ' ' x i ss.v3k'f fL':s:S5 msgs ?igf,g3Ql+ri:Qs?,'fQ:E,4' 2335 Birdgiiiig 50,5 MT we Q K Y ffm fr: 3 if ima :ft same: r N 3,5 ' J - f at i K' sf M Nr ft , ,, , .... .... , , ....... . xg. V .... . t. .... X ,0 isis sims ? swsifxfim ,Fifa W sig? W 1 ti' , .W MA J as A is - . g eggs N ,g,:, f,.,. :,'5'.5: ,f1I,Z, . i .E,Ef.f:I': 'P S 5' , r :Q,.':.EI-5I.'E. ,SS if 'G S354 5 5Qfl?iZ271fj33if' ?mS5nfr-fgvsflsgffifjvy ,yiammvgsfbg WL, .E 123: i f53'QElIE 'Ya V 222557325 22 2-figfffl s Q5 M 5 ff dmffif E: : f:'I'.' .:h'- ' -F - Q: ,, -ig ggl-. lm-::. sim Women Engineers The Society of Women Engineers seeks to inform young women, parents and the general public of the qualifications, achievements and opportunities open to women engineers. SWE meetings are informative and create an atmosphere of fellowship for the members. - by Holly Gruber, president Row 1: Bod Jenkins, adviser, Teresa Prochaska, Beverly Houston, Jeannine Sladky, Flose Chu, Becky Jenkins, Dari Miller, Kim Kilpatrick, Sharon Moorer, Sheila Howard, Patricia Reese. Row 2: Renee Garland, Melanie Herring, Lesa Luker, Ellen Flogers, Amanda Brownlee, Julie Wolf, Patricia Alturn, Louisa Harrell, Claire Hamner, Leanne Hereford, Lynn Fieaves. Row 3: Molly Brown, Kim King, Miriam McGhee, Holly Gruber, Lorraine Morris, Denise Overstreet, Mary Lin, Sherri Ponder, Lisa Proctor, Karen A. Bishop, Nancy Emling, Beth J. Malon, Sherry Wilkie, Linda Lowrey, Pam Gilmore. Row 4: Susa Addy, Peggy Williams, Row 5: Donna Bassett, Anne D. Mclnnis, Beth Garrison, Cindy Chassay, DeeDee Johnson, Lila Pegram, Madeline Mariani, Lisa Williams, Addie Marie Ossi, Angie Jackman, Phyllis Short, Cindy McElhaney, Charlene Moy, Michele Sparks, Lisa Adams, Debbie Dubble. Row 6: Jeanie Mangum, Kelly Ashley, Mary Thompson, Heidi Nguyen, Kay Davis, Leslie Hicks, Row 7: Theresa Varn, Annette Fulwood, Paula Chung, Pam Floss, Fiegenia Blair. Row 8: Debbie Hutson, Kay Brown, Charlotte Cooper, Beverly Tanner, Terry Ann Osiecki, Peggy Anthony. 464 Clubs JOHN REED rE ??? M 53' M '?:7'2'3 ?f'V'fi?f i z' ?Y '?WW f he ii .av -' ,, f?e,gfg,ia? 2HW!l2S'26m:?Q5Ssi.1EsXe7t'5.tsxi 3194962442 :ggi tr- :'-.rg,:g'ggx.2js .:-.:E',,-.Maggie-,:5g.5igE3,5'.5E..:'.,E,E,Q2i-5EiEh.- .-.- Q73 V ' stasi s W 2 gag QQ1-ifi'??i,ria5J?5iz?-YQQW ve -stage. sg? Sa -E 1 i ,E i- ia? tw 5' .... 2 Sgeiggfgiiraasaf :i1zgKv:gfiriix!5'igsafae.twsiiseggrfrist i,v2t S:g39? - ---- - we Ygggtmfiggisdigwigrggftfszafi-z?L'i2.sg?5:'m51,, :SZMEQ555 se' tv- ,, Z:.:- Atggmwe QAM 5 W is szf Q, it at it ,Q l Qggssggwwsg kglsqfggmtrrkrfssgga was .: 5 1,4934 yggsifttiistissifairfaawfgiississ.-.fre F' nfiifimzgfifet Qgsxwkieadawwff-Miiiig am 2 'fitsfiwifgttxr 1 Ewr5vS'f?'wf i ieiswfggi- 'fieif ff tt 'W my 333ff??,?'53s3?,iirglibtif-tiwfwsf-3'a31M5t3H SAL if ' ,e S :--as-:..g':'15:1-a..:..:-I:-:.....:g.::ffg- -i , r , -5 WP-H' ,iw +1 may Wi?533?,,g,,'6 W 1 :.:-':- gi? .:: ---- .-.. wistgwgifsgevfv tngsgtiiatwtggs xii was Hi 2 '-'- -fi -.-. , : - : .'-I-:--: --. -- -9: e Ymg2K k fist A035 333 .. ----. .. m24t5'iffQ'N'1s,,2yiQfsfiSi efrswsfiswgfgfmt 50 :. :-.::-::- , ,- --:5 - 4' Z - rf we yggig5,iy ziJs-,,,,.ihf wg , We 4 ,,,, S' as '?'tf'ffm:.XaJ2 P2,f5SSiSftZgsw: M 581 ---. ge, ,-:::.:: mike, 5 ....,. a gfifwaa .if 1.3 Q6 wifi ai ,v , i NWN .'.. : tw atwfiesmafe r egggit 53' ia - .:g-fr: -2.-.i:::..:-,: gg as--:,:-g --.-. V .,: 5 Hgiggw i Q ei aetf:2Y?25t sfsg g wst s fr rt .... .. at ,123 E ..-.- - - f'-' 1 ia a we wap, i is iegwsvw iiltzf - smaisii? Q 2 0 EX ex xxsgwx Sn 5 s f'- r MQW 'Pr '- - 'Z S - . .. .,.,. - -.-. ----- .- a wialagagfq .-.... . .V 1521 f 'f 5 --'- 1 att' -g . l n DOUG BRINSON MIKE WEEKS SAPLA HSAPLA, the Student American Pharmaceutical Association, is a national organization for all pre-pharmacy and pharmacy students and a subdivision of the American Pharmaceutical Association. The Auburn chapter has approximately 150 members and provides social, professional and educational opportunities for its members. Programs in the past have included Annual Hypertension Screening and Drug Counseling as well as trips to regional and national meetings to share ideas with other chapters. - by Bonnie Simonron, president Row 1: Hayat Haddad, Connie Roebuck, Penny Morris, Jeannine Baskin, Bonnie Simonton, president, Rebecca Jones, 2nd vice president, Mary Martin, Keith McWilliams, Cathy James. Row 2: Angie Barrett, Kylee Grimes, Gay Hembree, Linda Stevens, 1st vice president, Kelli Boyanton, Jerry Beaird, Lisa Bock, Tracy Bishop, Diane Welcher, Kathy Sawyer, Ellen Scott, Lynn Vann. Row 3: Terri Hearn, treasurer, Stacy Campbell, Sandi Wiggins, secretary, Tommy Tew, Yvette Marion-DiCampli, Mark Morgan. Row 4: Matt Colby, Merry Monk, Kerry Prickett, Karen Greene, Stevie Harris, Joe Dog Hassel, Jimmy Crump, Donna Stewart, Sheryl Wilson. S11ELl The Student Council for Exceptional Children is an organization which serves to inform individuals about handicapped persons and special education. This organization also gives special education students a chance to interact socially. The organization plans and participates in various activities involving the handicapped. SCEC was voted the Most Outstanding Student Organization on Auburn's campus for the 1981-82 year. - by Lori Pearson, president Row 1: Dawn Hastie, secretary and treasurer, Maria Baker, vice president, Julie Warr, Sharon L. Price, Laura Seibt, Paige Freeman, Lori Pearson, presi- dent. Row 2: Kim Sanders, Anne Birdener, Deidre Speir, Becky Ennis, Angela Bates, Camille Freeman, Kelly McKinney, Anne Tamblyn. Row 3: Lynn Brockman, membership chairman, Lydia Babb, Toni Markham, Kathy Collins, Edvique Daccach, Chris Cushman, education council representative, Mary Louise Aemmeter, Dr. Judy Tomlin, sponsor. Clubs RWM -All-sf, M -2 me We-fm l..Q-E:'e..,i,,,,,.fef-siaifm mr-'MM ' M1...f f . ' ...2i'-if-A--Lt' ' 'W T' -W-'w?WM t5Z?T'i Fwiffjvlfslla -'N '1-S-fs-?'5T31 '-'3'5 'il4? ...W :a wwWMgZZN.:eglWWw:wsisfssgt Wsiwm H Wmmfm me -- J W M': 'W Egzac2mms:sf,wxQsag.2..,s.l.-E fff'f1?gge ...saggy gmg gggfff, ,g,,W'M'1ii.::MWMe::5Q gat.: ,F -W W. assume s2'W3g5 ....gMw,si iw W--HW tww,mwmZga w3we,,x:::,1....f-ease iitm f M T,-.M W W, We TWW ------- . 'S'-A liiQ.,.,,,- iMW 1 mmatafwwmmfm' Jixirr' M ' 7FE i7immtW W --'- W:TWS:QewWf irsa?LmeMsmHsammW WW-efw'T'2NwM.sMwf?:'1f1:: 2.4 M N 'W-:im-17: 'T mf--Miwwf-fefwm:-mi 'i ----- its-Wmqrggw hmm Wmms swsaqik wssgwxgslfmsws--mwwnmvmfM Q, ---., M- cashew W - iff' 'aasf,.m-fawf -'----- , News Wwmlssff mffwmm iiii-r- M .Wf- W .ee .., W W.. WSW:--:,,.,sfmsf:t': , - usfffgzi A f.s.M W Wm' Rmwlxm ' - ..... 5.55, ,.., Mews:-s,QM.,.,,.,. ,, ssmmmmwc -------- 1 We , M -:N W N M51-sm W H 22ir:E:f:,.. A mm., --'f- ---':.ww-Wm - - M -W ' W W- ---- A-M:-wswsw-wwwm W - MW--we N .,,..m-Q-an Wmgmm mM?1:g:::::::'x:WM N53 M ' M .....,. - --in MTW ,...,.M- W... . Lim ...... 5?m.,,,,,W MQgm .. wTi,.:Mw . ..... .i,,.,,,.,.w 1vgM wq W ...,. L -:Mm M ' .,i...W ff:W , Wi....,m-swf-Macau:-f M WWTTTMMB lj - ' .WW 'C 'Y A W W X-W 'smile ' Mm W -W ,., f.:,':21 V'3'5E,,'Q'Z ' U: mm--we-pawf'mw.-. . ' ' N' l N..,...,,.a,m.wmwwe-lvl -:I-:if-2:tfEEi 'ii:-.. agtigsgeg ---- V .,...m,.s11 M' M3:1.:: - 'janv--W as MMWM W N s 'Wmm ' MMM 1 'M NMMA WL ...., , W ' .... .,.,.,..,. , .,..,. ' A.V.lVl.A. The Student Chapter of the American Veterinary Medical Association is a professional organization for students enrolled in the veterinary school. - 466 Clubs by David Fuller Ill, president Row 1: Steve Allgood, Mike Bagley, Fairfield Bain, Al Baker, Bob Baker, Jan Ball, Mary Battistella, Diana Bayless, Clyde Beggs, Mame Bodner, Pat Boland, Kenny Brock, Andy Bradley. Row 2: David Brown, Michael Brown, Mark Bryant, Lila Carpenter, Sam Cartner, Jeff Cavanaugh, Jim Chambers, Lisa Bauer, Ray Coble, Karen Colson, Charlotte Cotton, Debra Cross, Greg Daniel. Row 3: Gary Davis, Paul Diehl, Melanie Donotro, Chris Duke, Gary Duncan, Hardy Dungan, Wesley Dunn, Teresa Edge, Sandy Edmonds, Joel Fisher, Scott Fisher, Bert Gaddis, Sue Gallop. Row 4: Jim Gardner, Mickey Golden, Lynn Graham, Mike Gross, Walter Haines, Becky Hall, Kathie Hamilton, Kristen Hammett, Paul Hannon, Roger Hartsell, Mark Hayes, Robin Hayes, Steve Haynes. Row 5: Dana Heck, David Hertha, Craig Hines, Kitty Horky, Billy Howard, Al Hudson, Karim Huneidi, Kathryn Hurley, Scott Jackson, Keith Jacoby, Kelsie Jennings, Louis Johnson, Lisa Jonas. Flow 6: Mitchell Jordan, Greg Kelley, Rosa Kersh, Donna Lauderdale, Andrew Lawless, Chip Lazenby, Wendell Lyon, Roy MacDonald, Linda McNeft, Nora McSherry, Robert Milledge, Caroline Montgomery, John Moore. Row 7: Alan Moss, Gus Mueller, Susan Muller, Steve Murphree, Mike O'Bryan, Scott Owens, Steve Petcher, Mary Proctor, Elton Rogers, Sara Rowe, Kenny Schmidt, Joel Schrader, Sally Smith. Row 8: Paula Thorne, Tina Stone, Davis Lee Sullivan, Robin Temple, Rick Tubbs, Tim Tucker, Debbie Wagner, Jeff Waits, Margaurite West, Don Whitener, Dan Whitlow, Diane Wilhalf, Steve Wills Row 9: Lolly Wilson, Ann Wolicki, Mark Woods, Joe Woodward, Joe Yocum, C Zekoft, Wendy Zellmer. ole Younger, Zekie my I t . I - 'KI ,.,, fy if ,, J ,, ,,i.Z::L 515 411 . ,,. in ,V V. gg 4,1 T 2 f 'V fell L ,. 'A T T' ' ..,., Q ww' 'f we if :tt ' V523 r - A t' A f A , V Q A fig A ' L ' V,V. ,, 5 V H V V V A , ,. T ,, ...f K K i ,V ' . ' Q if' ' ' f f I i A H 1 5 ml W A A is V 1 A L v Q ' , Wjgf ' .1 , ,Q Q i , 321 eg, .f 4 I ,V 2: ,, WLS, I L, 51 ', W, ,ff - 'eff' ,Jw X f. . ' C 4. af t 1 '34 , I - ,vi :.' 4: gf 'tv ' ,, , ft fizr filled' KY' Q , . , f ,, mi V u - ei, asv .f e, 4, 1 .fi W Q , W, t 2 if , he . ,ya H f eg , - , .,.,t V lk A ag -1, 'ai we :L , ,f 47' 5 V f Wy Q, ' ,f ' , , , W , Z ,A V, ., 4, ' ' , 33995 4 ., A J t 7 'V L V tivl A J' 1 'Hi' w e 1 v .i'a. . f 'T W . ' my , W .Q 'L W f K -V ,1 I- f. I , 'V L V V, I 1 -1, .M t f' 7 :VL .1 Qi- 4 . A 121424 , 2 , L , ,- ,,i,,, , , .,,7' -- .Sa '- i l A YQ 'QQ' ., ' QQ? it . , ' I T , , ,, 1 f A .-.. ' ' . ' Y 6 . X, MJ V ,q , V ,L Y as V, ,av Q, . -sf:-., ,, H My ,if V, 'wg tt mf, CA? f , ,Z 'WMS A ' W ' We ei V7 f K. N - . . ,ti ' W qs, er ' ,i 5 ea, ,,,L H .,., ,,V. - Q '. L T T .W is is. ,- . A, W. Mi, -ff' . , . :I . . ,V M, V, Q,-at M , ' V , I t r ,A 6 i F, Ly Photos furnished by Club we we 'TWT t .. W-W ---' - Nw 45314, f-MM-ft-esggpgmawm ' ,...... g 'wmlmffmlm it ftggtbv-?'H '..:.wam:,g-Qtqtift .W.m 'gWm: M-f---Tien:-as-as mtf wf, M mme-sea 1 gt ,.,,A..,,. ...,. f :Q-f111:-'---:meme-Wswmsxwq V ' gtfttt': ::...,:,':e..t::e:e-ff'2'f.t,5'1::w W2 Mfet- - mWw,s,f ssMNmMs- ' 'gasw .,.,f Sf mt- j:r : f 'Qgi' ,5 fQ 2T':,'f WENW3 Wt 'mzzwaaxszgggg f tefw-f-awk: TM , ffg . wp1..f v .:Ett . ?1ff.s5Wz:ua::f:g:2W:tf: 2 Awww 2 V -v-- -W'-:E WM l mms ..... 1.5 s N... - . , , . if 1 M .,,. I -Z., se. .Ms ,, at ,.,., ,.,.,. . . ww, fa f T is , 1 + MW M was s .. ,Y 255, 5 f 3 N twewma: ...,.., . . at ..,. .,.. . .L,..,. .. .,,.-...M ., ..,., , .,.,.,.,..,..,, , .,..,., ,sw .. l 5 gt iiiiz? -- '- 'W .'.... ...,. mm, K , W 1 MMT., me 'W We tit ew R ills... TDM t y fi tiiswii, i T - 35 5:-Ww:i?w'W::Q:wws 3 , M -' Illlllff ,wut gt ...,, . Wt st-f't'WMwvffw 11n:....:..s.r: W. me QW t ,rMs3t ' mn-- 5fl gl too. W 2 t n- -'f-Q- -WM? it it Wwie l .. v..... .. ,.,,.. t vi- . .. DELAINA PANKEY l RUSSELL SCOFIELD Student Dietitians The Student Dietetic Association is an organization for all students interested in the profession of dletetics and in the American Dietetics Association. Most members are nutrition and food majors. The student chapter gives students the opportunity to acquire current information about their profession through its link with the national association. - by Carol Lawson, president Row 1: Edie Ryan, Carol Lawson, president: Gilda Cristobal, Karen Goggans, Katherine Bliss. Row 2: Ted Cristobal, Jennifer VanderWerf, vice- president: Lorraine Harley, Susan Perry, Sally Perry, secretary, treasurer: Nancy Kichler, Dr. Robert Keith, adviser Tiger Splashers Tiger Splashers are the official hostesses of the nationally recognized mens' swimming team. Selected each fall by open rush, the Splashers not only help time at the swim meets, but also play an important role in the recruiting process. ln addition, they work with the Aqua Tigers to help promote spirit for Auburn's swim program. by Nonie Waters, president Row 1: Kay Acton: Nonie Waters, president: Lisa Copeland: Brenda Austin: Kitty Cattaneo: Rhonda Childs: Barbie McCool, treasurer. Row 2: Janice Byard: Katherine Howard: Sally Slawson: Terry Hansford: Jamie Hendrix: Colette Jackson: Laura Nigro: Nancy Herrmann: Alice McClure: Alecia Golden. Row 3: Pam Scott: Lynn Tankesly: Amy Cowan, secretary: Lisa Robb: Mary Gardner: Lori Watkins: Lori Smith: Alyson Humphrey, vice president: Leslie Gingles: Marni Crosby: Beth Woods: Shawn Asmuth, adviser. Row 4: Amy Funkhouser: Lori Herman: Bessie Mallary: Coleen Hyland: Betty Judge: Patti Denny: Melanie McRae: Ruth Miller: Elizabeth Barnes. Not Pictured: Dell Smith, Lisa O'Connell, Emily Logan, Beth Duke. clubs 467 .... WMM --.v.,-- WMYW- - , ,g,,,,.,M,,,WwM'-,,.s..s 'M-mf.- 2 :g1:-. N z- ., we--wm wswfi'-s, S?:::3'igs:rs 95 r A gr '-'- , : : if 5 M rK4 f2'Hfi'9at..Sf m3W5Y5E:1s Egmwee gfm t ..:g ,sw Q55 , 2 l ------- : :-,i r - -.-. .-... -. :-:t.g:,--.:: :.::s::- ,W ,mwgggztisgs i W?wsiY xzrzfruwr - .... .WWW ----- , :tw'Wms :::' -We A g-.:ff'.:: ..,,,,,. 1- . ,,,, -. ,. -. -.-. ,,. , f'T- :-WE..g' i 1 : . :g:a:i.,i:.:g..,:.:.,-s 1-1 :em-..f r :H- : -1-- ---- I :-,Q-:.::.:5:g-:-,f -.:.-,a,:g--g- 4 , , . , Yswevsesgiwi' h 'W43 ? 5W s : -:-.::.:'.2'- I-f-I-ft- ,.,. . :g:- -,: -'g ---- . -.--. -, K 2 ----- vw-wwfi mmm MQ Q we Awww: ----- f ,.,. - .... .. it ,,V, ,.,. -:-::a::.-r-.- g.,::.:f,,. 5g .,.,. .. 1- www -..- +--5,a -:1..s:- ,... - . . --- af -g,:-g::. ,, g5,,5,g,s f:-35353-g-Q-7 :E-Eg:- . ::gj-gg-5 :-.5 5,-:E-.1::.:-:5:,:-'gxg-- - lg-3. :'fsr5:,:g- I-2:L .E:,g:g-f '-.r??:2 :252:i:'i:::::-'z--2--I2.f::g-., at 5 l - , AL '-'- Mfiflzgw . ------ -'-'- ' Studert NL.rs'r Assoc'at'on Auburn University Student Nurses Association is composed of students in the nursing curriculum. The purpose of the organization is to provide information and programs to further nursing as a profession, as well as to involve members in the Alabama Association of Nursing Students and the National Student Nurses Association. Student Nurses Association meets four times each quarter with guest speakers at each meeting. The organization also participates in various health-related community projects. - by Caro! Howe, president Mrs. Sally Stroud, Gerrye Stegall, Laura Omundson, Angela Hamby, Carol Howe, Susan Cohan, Kathleen Voss, Lydia King, Laura Muse. Row 1: Leslie Wright, Lydia M. Cox, Julia Smith, Sandy Veazey, Andrea Jones, Susan Faucette, Karen Harris, Cindy Lee Henson. Row 2: Nancy Brady, Kim Franklin, Jennifer Miller, Sheila Atnip, Kelly Bernstein, Lydea Kling, Krestin Koski, Laura Muse, Evelyn Holley, Renee Jones, Deborah Ferguse, Holly Belser. Row 3: Mrs. Sally Stroud, Kathleen Voss, Susan Cohan, Alicia Davidson, Jane Clark, Susan Kipps, Kay Oveny, Holly Fussell, Gerrye Stegall, Tamara Lazenby, Patti Callahan, Betsy Cohan, Carol Howe, Laura Omundson. Row 4: Kathe Waller, Daneene Barler, Sheila Matthews, Debbie Flower, Shari Thorton, Denise Yarling, Leslie Vaughn, Jay Mann, Angela Hamby, Janine Harris, Michelle Ash, Beverly Powell. Row 5: Ritchie Zorn, Jett Freeman. 468 Clubs .,- rw ., . f F 2 S RICK HOLL RICK HOLL . - si-'f-::--2. i1'2tw 5 tf'sm fr we -529.33 it -' 'W . W 4 ,W aww W sm, r safest- M new is WWWN r-WWW emwwfww-AM We WW oMMW,.,,Wu 4 t tiimw Q,',,,,mx ,ie i 1 of-1 vswwvdrgwwfi H SLM ,Mg eiifiignf Wtitfgwssm iiiaksfezie 5t?ttff:S3t v3?9'2'i2Se r ?5 425 QQQ -- - 2 - :r,:s.s-:as :,::5s- -.--.-.- s ew, wttzrtwrfig Wm 5, Rif t' ifflaii1gfgig e3fAsXegAW?fgmv3g?i?3g53?ifBYW gdtsgpf Y ggga,Eg5Qf W Qip4,, g-4eeS gWwtgAQ5.g sarpgawee e v e, ,gg --.-. -:-: :: -:r y- .- -:.i ne3 amemsg5g ., Qgsavkwegg a QE 43Q?Qi?gw2iScgm?s'5s?s QQMgfv 2I-- 2222E:2E5:5-E- - f2f5 Ej ,5-'g- -2 I2i EII5E2,:gi-E532 it I5--EEWIEgEQ:gI:g:1:g5-L.:2:5 S gee se N 1' X ---- , ,rt twat.ftsmiifsist'fn?Jf'r'Q:wr3?a5:s,mm stwflgxreffisz mv sf:z 22m ,asset 'S -:.::.ait:-:-.- W Wwwtfwuswg-Yip:ir:3?t2'gmh-aw:M:s'g ra- -2-:s.?:st-:iz- -'2 2--: .-.- ' 1 1 i'i5Q? ?w Egggygzriwsefwzggataiagwesmmsiyis egsmwgftwgawia,-e32iafizQfgs?:i,g isQ Hei st, ,,f gfg,f M'ftzasf:E:g4.sh,,,gp2v tggisegg igsf m f 1- ,, 5 if v ....... ?a,2-QQQMQEJXSKN ,Sim tt iv 9 tex ff5i':33?g'1nnQ?tW' 5 +i'f?S5At WE tGsfff2f a.Qwe3'S6ef61wtiYtwew?'W'?rS? :E:::::-':-f: -f..2.'.:.s:':':.- -:-:.:f:::::. -: ::' . --- :::: ---- ----- I '-'- ,X it, yasegttgsms snttgyftmwv was A 553,353 .2-, swim .,., , . ,yt5,,..fsggia, .-.. Aygwgsityemgggmgiygngvt ees, ----t tt -A -' ia A N 1 0, if ., . tai r w ' .... KRW ----- - titii ew Reiter w wfrmnwvmga Mtlssw ----- .-.-. age nt Mei W e Mix' s weetly www ...... V g f-1.-1--- ., ----- - ------ 1 ...., 1 3 T' 35'? 22: :- ft -r N s t' , V ' i m' .2:g:': ,- -. :-::1::- 'WSW fmt g ?'5'25?15ff2A F' lfetmf '-,::.:' JQSTB 2.2:' :- S w t1E??g ' t'Wm r t M + -f:: g-f- -- . :-'.-:.r'::':s,:5- ,.:-. , af..:'g--- gg-: g::5-tg.. fe.gjgsg.-55:5-5--Sz:.g:f3-5gg .... , , ...,. The War Eagle Girls and Plainsmen Row 1: Fran Wingate, Monique Key, Joy Loard, represent the spirit of Auburn while serving C0f1f1iG Dehlaney. R9QiVla Bradford. SUSSU Connor, Dell Barker, Cass Trotter, Amory Benton, Greg Henderson, Rob Godwin, Ken Guin. Row 2: Jani Pipes, Nancy Wingo, Lehman Smith, Paul Roberts, Gary Hughs, Greg Schmidt, Angela as the official hosts of the University. The group acts in conjunction with the Office of University Relations and works with the SGA, the Auburn Athletic Department, the Whittle' Keith Chappell. Row 3: Dr. Dame, Auburn Alumn' ASSfOC'af'On and members of Holsenbeck, adviserg Clay Brown, Alan Barnes. the school's administration and faculty as well as other campus-wide organizations. Twelve men and 13 ladies, including Miss Auburn, are members of the group. Selections for membership are made each winter quarter. Dr. Dan Holsenbeck, the director of Universit Relations, acts as the ' ' faculty adviser for the group. - by Rob Godwin, treasurer '??f:: 'iw MS , LT' la' -I' 4-3 dr rtir. B . 'X' i'i i. '-'il' , f t Q T r.,. QQ its 1 x Q 5' :wi A X gs 5, t , . ,X , , . tt , ., WEEK' X t an :TWH ,kv.:?ti'7: l-'- MW ' . 119. -.rrsgfi N... , ' ,Q so smut, ' - if ' i 5 we t 1 , 5' ',-r-,. .. J .A ., v-,,.. S., . , .. ,A ., t C35 T irr- rf! li, ' Ai fsieei-A Q'fW53l55 iir' -,,, tt .if Ni .W -tw 1 some-R-A-'W ' f A-5- ,- r.g,,,,, N'-'-3' ,..., JOHN REED Clubs 469 nl I- .Hmm L - W W- M H' . . v.-4 .EIIff:,fEIZ1Eg5E? In-NM W--me vm' m NM' ' V V ' W 55:25 is mi mmm ,.,.... W ..,.,.,,,. ..,,:,,:.,.: .:....... .,,.,., '-TF E5 Conce't C 'oir The Auburn University Choir, an auditioned group of 110 singers, is under the direction of Dr. Thomas R. Smith, director of choral activities, Open to any University student by audition, the group consists of both music and non-music majors. The Concert Choir performs a wide range of choral literature from all periods and styles of choral music history. During the past years, the Concert Choir has hosted several guest composer! conductors. These have included Jester Hairston, Eugene Butler and William Dawson. ln addition to campus concerts, the Concert Choir is in demand for community concerts across the state and performs across the Southeast on its annual spring tour. - by John Wilborn, president .gil its ' 2 . +4 ' ,, Inu , ., .,,i,+,N-.W- A A . y W' M .af Y. my t l Row 1: Deborah Rickles, Leigh Anne Smith, Kate Marshall, Leah McKnight, Tamara Davis, Laura VanLeer, Missy Burnside, Susan Wilkinson, Shawn Hale, Chris Nichols, John Wilborn, Barry Smith, David Atchley, Gerry Moses, Ken Looney, Andy Smith, Paula Pitts, Dawn Finney, Gwen Owens, Pam Morris, Laura Reynolds, Jane Grey, Melanie Magee. Row 2: Jennifer Hudson, Rhonda Summers, Jan Gunnels, Tamara Lazenby, Penny Martin, Susie Crook, Lee Ann Chambliss, Grace McWaters, Burnie Berry, Morris Driggers, Mike Hobbs, Allen Tinius, Steve Fleming, Matt Gaines, Neil Martin, Brian Elrod, Ann Dominick, Karen Black, Mary Smith, Kristen Brice, Linda Lowrey, Laura Thomas, Linda Kaufmann. Row 3: Ellen Vice, Laura Perkins, Tamara Renie, Martha Jackson, Carolyn Dantzler, Laura Rohmer, Ginny 5 .W +223 --l- .. ......,. ,unl- Andrews, Jonathan Dew, Robert Melton, Tim Hall, Stanley Hendon, Donnie Long, Jett Funderburk, Salvador Rodas, Robby Payne, Alan Pate, Jay Davis, Roger Harville, Lori Hatcher, Ellen Moseley, Pam Gilchrist, Laura Andrews, Beth Gravlee, Donna Ledbetter, Diane Claybrook. Row 4: Julie Evans, Susan Benner, Angela Brand, Ceci Norton, Susan Pope, Melody Bush, Lee Gibbons, Jennie Johnson, Cathleen Owens, Darin Windham, Scott Stewart, David Mann, Chip Wilkes, Scott Starrett, David Harris, Owen Bailey, Jonathan Doyle, Charlie Lang, Greg Stone, John Michael Bush, Chris Thomason, Greg King, Lori Bentley, Brenda Jo Austin, Sharon Carleton, Leigh Ann Cutchins, Rita Johnson, Lee Henderson, Caroline Chancey, Julie Rogers. X .A . A-'df' .fa f -- -' was L- f 1+ . ,. . 15.1 S ' ,. , , si t, , Q ,, ' eggs. s -4-'gy' ,rf 5, -fvjxsux V.. ,.-. A X ...-N.. 'V ig f, 5 1 wfq- .tw-if 13, f' K - f ,..,,4.-r'- ,g i:f'g:t:..- t ' ' A i ' .siYs'7rs'rff..'Q.ff.fff gQS g'?,i H , .. . . -, 2.x,.5+'-f.'l-,QWV W-is iffy' I --1 2 - f . .' -Ig . ' ... ' A X ,N-3' M, I- . ' .rm .. .W x . , , . , . ,.,. . F ss... . ' ' V frm -..t . . A-.V S Mt - , . , .tr r- fbi' f 1 U . ., - wr . .1 - s .- sew ,,,,,.: Q . ' . . , - ,S 1,1 . I R, , 5 ,' .l AM . A ,sag s,-,ag-. Vgggj' W- ' ,. , 1 . we ' .313 93' N. Q L- , i Q I ,gf 3, .1 if ff., NN tix , .-' ., - .Q v. V X.. ,P -f V,-ss. . . 7,6 f- , k gk- .2-5 . . ,,,, K., Aw at est-f - as -. . - f .. . .. V- .. . .. ww' 2 -- . . 1- ' , I 'WI' 'A .l .. ' . - - -J Q. A ' - ,' Q- wi' . Q'-L KJ. - 1 Q 'fx' g. ' .iw Has-9. lu ' 1- :X 'ff -is i 'i' 7 ff A rf ' .f ft .i .ss-1' J, ' W - .- S ' ' ' ' Y .. its f. -sf 'g I tj fi s 'sis-gg' W, ft .N H 102. Aft -'t j '- .21 ', ' -Jem Q 'ff- A ff . - J, .. ' PHOTO SERVICES NM T' ' M 5:7 My r .. M, 5 :MH mm . ..... . ..., ..., ...,.... . . . ..,. W... I me ' A ' H 1 --W M-W so - ' ' A ..,,...... . . W , ,. , -A ... film , tt..- mf-:W wwf B S-fm N s. ,... A PM or .,,..W.., W 'W f ,W mm. .,., me-sa A MW- .s...,:nz' - --1 ,,,,V W -Y ,W ,M -- MT M 'f . M- .. lfffW32.. at---ws: M ,..., . ' We . M - N ef AAPVV A ffa,.,,...m-is -MW-1--H me as-M.. W was 1 ...Me -W.....,. . - W 'asm' fw 'MM'MT' Ak 'TTT' - 'T W 5 as ..,. MWNWM' --Mom , ww .-.- v---- UMW' - -A S me WM S D-we-at-efa311..,,.a.. -3 stu., A' ,.., . ...Q .M eil .H W1-ei.f- My M' -f-1:2-Q it 'A s time Wcdtxxmwmi 'wa-w- WW MWN - '112-H ' n M as i 7 W i-x:i'T'-faf:fi- l' W ' W 5 X: ' .sealy X 'DM ,M M' mm' ' R' W Qw U V WWW A 1 'wi sg Y MM -- , N .: ...,, - f,-,-,S-1.-.-c u : W3 M --', . Q W Lum - Mi.. ,A H W W V Wu Mes ,wx - --V Y V MN,. JW --YWL MW? V Mmm E 3 25: ' ..,..,. W at ' 'NM f 7 .,..... . .l . 'K - ,Wm Y Y 'W' 1' N-f-Y ale-imwm Y - , , W' WW Vffffmfw ,,,V Wgr -W mf: M' .. ..... W I .., - . I - ' ..... ..., i I .., I , . I .,., i , I . I . I .. . Il ---- -- ii i- -- -.,. W .,.. ..... ----'---- E 2 W . 3 i-f rl ....., 515 i i -I Ili I-li' .f ata Q tx 3 .2 , S 4gg?l2H97T?21if?e.2'fT' ' ' L' ,gyda N 1 'xfw Row 1: Barbie Pendergrass, Jeff Funderburk, Karen Mills, Andy Storzini, Doty Spurgeon, David Taunton, Jenny Harris, Don Kaylor, Mary Monk, Ben Garrett, Kim Curley. Row 2: Cas McWaters, Mitchell Cooke, Penny Martin, Matt Stewart, Kay Weaver, Matt Moore, Stacy King, Shawn Hale, Amory Benton, Andy Morris, Jan Gunnels, Matt Gaines, Susan Jones, Skip Welsh, Susan Benner, Kenny Kirkland, Regina Howell, Mike Bedsole, Pam Gilchrist, Darin Windham, Tammy Saunders, David Galloway, April Southard, Robert Grant, Rachel Rosenbaum, Tim Hughes, Linda Lowrey, Russell Eiland, Nancy Wingo, Greg Stone, Susan Godwin, Pound Lamb, Paula Pitts, Bartley McGill. The Auburn University Singers, under the direction of Dr. Thomas R. Smith, was established in 1973 for the purpose of performing predominately pop and show music. Much of the music is complimented by choreography which is created and taught by members of the group. In 1974, the University Singers toured Romania under the sponsorship of Friendship Ambassadors. In 1977, the group represented the nation as singing ambassadors of goodwill to the people of Poland and the Soviet Union. In 1979, through the Partners of the Americas, the University Singers shared their music with the people of Guatemala. - by Matt Moore, president PHOTO SERVICES University Singers Clubs Communications Board i CommunicationslCommunications Board How 1: David Herrick, Marc Watson. Row 2: Philip Brown, Rick Froehbrodt, Lynn Brown, Noni Waters, Alyce Heggeman, Ruth Showalter. How 3: Bill Godwin, Bert Bradley, Grover Jacobs, Brent Craig, Grant Davis, secretary: David Penn, Emily Leischuck, David Housei Thom Botstord, Jack Simms. Not Pictured: Pat Barnes, chairman: Kay Loworn, Tim Dorsey, Karen Lovoy, Dave Bean. JENNIFER JOHNS The Student Communications Board serves as a supervisory, as well as advisory, council to the various University publications and the campus radio station at Auburn. Composed of both students and faculty members, the organizations authority is outlined within the SGA Code of Laws. The board oversees the financial operation of such organizations as the Glomerata, The Plainsman, the Tiger Cub, the Circle and WEGL, and approves editorial policies governing them or any broadcasts supported by student activity tees. - The Auburn Circle Almost a decade has passed since the formation of Auburn's student interest magazine, the Circle. The campus literary publication has provided a medium through which students express their creative thoughts and ideas. The Circle features short stories, personal essays, poetry, photography and artwork. Subjects included range from the arts to the sciences and from the abstract to the practical. An editorial board and staff, advised by Kay Lovorn, are responsible for publishing the Circle. - Left to Right: John Dodd, publicity manager, Billy Flenkl, Tina Trngle, managerg Ruth Shoualter, editorg Les Capouya, photography coordinator: Matt McClendon, Flob Lotafo, art director. Tiger Cub The transition to college lite is made easier by the Tiger Cub. Auburn's student handbook. The publication is designed to introduce beginning students to the Auburn way of life by providing information on the various organizations, fraternities, sororities, honoraries and student services. The handbook also includes the rules and regulations governing the University. David Penn, editor of the 1983-84 Tiger Club, is assisted by Brent Craig, business manager, and Grant Davis, adviser. - Left to Right: Grant Davis, adviser: David Penn, editorg Brent Craig, business manager JENNWER JOHNS Communications - CirclelTiger Cub 473 9 Rocks Rick Froehbrodt, Station ManagerlFlUSSELL SCOFIELD Communications - WEGL ' ' WBUSBELL scomeun Mainstream Announcers Row 1: Paul Kelly, Tina Crocco, Jim Westenhaver. Row 2: Alan Byrd, Steve Estes, Bob Ward, Russ Lockhart, Mark White, Shannon O'Brien, Barbara Anderson, Steve Baum, Gary Boddie. Row 3: Bobby Holcombe. Specialty Announcers Row 1: Chris Carey, Chris Swartout. Row 2: Peggy Butler, Cathy Lund, Paul Kelly, Hap Haas, Dwight Hicks, Todd Halloway, Russ Lockhart, Gary Boddie. RUSSELL SCOFIELD l I WEGL-FM, The University's radio station, continued its tradition of offering a large variety of music and programming. The station took great strides in publicizing the broadcasts under the direction of station manager, Rick Froehbrodt. ,t Despite budget cuts, WEGL was able to purchase a new antenna and other new equipment to improve the quality of reception. One of WEGL's largest publicity events ever was the co-sponsoring of Wendy's Hamburgers attempt at the world record of , hamburgers sold. The event took place , , November 7-13, and with the help of two- for-one coupons and on-the-spot broadcasts, the record of 37,000 hamburgers sold was broken. Located on the dial at 91, the student-run station featured a Sports Central sports , news-talk show, a bluegrass revival, Golden Oldies, Jazz in the Afternoon and many others. While also providing the students with , If entgrtalnment' the Haley-Center 'ocated Tom McMahon, Program DirectorlRUSSELL SCOFIELD Stephen DWYSV- MU5iC Di'9CT0ffRUS5EU- SCOPE'-D station gave approximately 300 speech and mass communications majors the opportunity to receive first-hand experience at radio news coverage and radio entertainment. - by Lynn Brown Communications - WEGL 'ibn wiiw ,aa 2 1 l , Y, JoAnna Names, News Dafecxorrnussau SCOFIELD RUSS LOCKHHHV Sports OirecIorfRUSSELL SCOFIELD Communications - WEGL RUSSELL SCORIELD General Staff Row 1: Hap Haas, Wayne Rowan, Bi!! Bolen, Lori Leath, Jim Westenhaver. Row 2: Calhy Lund, Todd Halloway, Bob Ward, Russ Lockhart, Chris Swartout, Tom McMahon, Dave Schindler. Row 3: Bobby Holcombe, Mark White, Jeff Glidewell, Steve Dwyer, Rick Froehbrodr. Stacey Milam, Public Service Director!RUSSELL SCOFIELD Harry Haas, Chief Engineer!RUSSELL SCOFIEL General Staff Row 1: Jeff Oswald Dan Ftice, Lance Kinney, Chris Carey. Row 2: Joanna Netties, Kristen Glasgow, Steve Estes, Sameer Dohdy, Shannon O'Brien, Steve Baum. Row 3: Alan Byrd, Tina Crocco, Gary Boddie, Stacey Milam, Paul Kelly, Barbara Anderson. SGA f i 7 I -L ' X h xL mhhi W 1-.MQ 6 President, Bill GOdvvin Communicatlons Q- SGA ' M X Russell l tV'C9 PV95id9i7T i :Q Pissvideifpresiidentfot Riu sselliii,i4endrlck presides over , all meetings of the Student Senateyftlns this capacity, he must .elsof-appoint the members ot all committees ot theSenate. Russell is proud of the work that the Senate has done this year Q3Ifid,'fi,l7i1 particular, notes the accomplishmentsot the new i, Housing and Studentiforum CommitteeszrfAtter being involved vfith the SC-tAstor'ytourWyeairs, Russell feels that participation in, student government is a great ,opportunityiior students to learn morefeboutftheftlniversityland all that it offers. During his term, Fiusselt says thathe has 'ftried to upgradeithe physical operation eoirl,thei,i1icefpresident's'oftice and that he and the entire Senate have tried to improve relations with students. He has really i vvorkedgto discover their various areas in which the Senate can work for the studentsand has estabiishedeseveral new A cqmmiiiBGSsIo help carry out this task- internally, Russell has strived to make the Senate interesting. ltisra big responsibility and ea lotot work,f:but?it'should also be fun and enjoyable. A Russell has really enioyed meeting somany peopleithis yearp Not, onlyehasihe met students, but he has had the opportunity to meet theitaculty, administration, and alumni, Whenpeople say i thateAubu,rn is special because ofthe people, Russell believes thatit isg In retrospect, Russell likes tojthink ithatiumaybe we the andthe Senatel have done something that has made Auburn a beiterplace. '+- , 4 be 4 - 1 f i ., by Kate Gorman .,eftThomas, Treasurer The 9051 ot the otticexot theitreasurer primarily focuses on the financial organizationiof the SGA, As treasurer, Jeff Ihomas has ther' responsibility ct planning and implementing the budget, as well as overseeing student ,activity fees. To providesstudentsiswithf more information about the financial , system as a whole, an internal auditgiduring the year provided l aqcheck onfthecurrent financial standings of the SGA and suggested policy implementations forfimprovement. These implementationsias we-il as others were incorporated, and, a g procedural guide will have been developed by the end of the ' currentterm: Thomasiitelt that more control and day-to-day knowledge was necessary to achieves more busiriesslike organization? Hetteelsfthatithe steps taken by this administration will enable those ahead to plan and form 1 programs that swillgbe achievableifbecaese a sound financiai system isin place. , g , , Thomas went into office with specific plans and goals for thetduration ot his term., My, main goaigis that when we leave oftice,we:,will.have1,our procedural manual fully developed. s This will aid the next treasurer, inean easilyunderstoocistorm, to budget, purchase andikeepl theibooks. What we are trying to do is estabiish a standard by which to gol' it He ehasrnade. great headway as far as organization. We have restructured the internal ,bookkeeping ,operation of the SGAQ, We ,havegrevarnpeQdrto make the system more responsive fon a day-to-day operating basis so that you, at any minute, cansrknovvwhetsyouihave and what you don't haves' . 5:2 V r V V 7 A The SGeAesupportsimanymajor activities financially and incursfrdayito-day operating expenses. Jett says careful i f budgeting is necessary when you have so much demand for the money and such a limited supply of it, - gy t Q 9 i ii 3 i M by Kate Gorman SUSAN BRQWN iyhy f, , Communications SGA Amy Propet SGA Cabinet g The executive secretaries serve as the centeroi the administrative office of the SGA, consisting oi four administrative assistants, two speciai assistants to the president and the i director of SGA volunteers. With the initiation ol the aides the daiiy tasks ot answering phones, monitoring ottice hours, issuing correspondence and organizing cabinet meetings, the SGA has become more efficient. New ideas are being introduced to the cabinet including a new documentation process by which the experience of a cabinet may be passed on to the next. This allows for greater progress within the SGA administration. - by Amy Props! A Kate ., Gorman An increase in University activi it r projects handied bythe public relations office A brought an expansion otstatt from an initial , 5 - seven directors to eight this year. head such committees as thehigh school, reiations, blood drive, student opinion, campus' . calendar, artand minority relations and serve as liaisons to the Plainsman and WEGL. Public 1 . ,. relatiorts' successful year was highlighted by many notable events such as the ahnualblood . drive, tor which Auburn again received outstanding recognition 'for its excellent student fturnout. Freshman orientation and conterenoekepthigh sohoolfrelations busyg a i student reception for special alumni guests, + 'astronauts Henry Hartsfieldzand Ken Mattingly, was also hosted by SGA this year. --- Z . Communications - SGA , Rob Godwin Administrative secretaries: Row 1: Leslie Greene, Tammy Moody Holly Hamson, Maria Rogers. Row 2: Greg Scott, David Shaffer, Bill Wade, Mil-re Dibenedetro. g Public Relations: How 1: Tracy Hoots, M0101 Lindsey Patricia Wok. , Row 2: Steve Anna Stephens, i Meredith McGion, Valerie Bendall Row 3: George Powell Jr., A.J, ' Dees, 71-,L Lee. ties and These directors a leadership by Kate Gorman Political Affairs: First Row: Dell Barker, Ted Colqult, Second Row: Ron Martin, Cory Thomas, Glen Fradenburg. Student Life! Firsl Row: Jennifer Smith, Suzanne Lawrence. Second Row: Laurie McGraw, Kim Overslreet. Third Row: Bryanie Swfliey, John Hargrove, Sid McAnnally. ' The office of political affairs serves the students in three areas - state, city and student government. Our directors of student lobby inform Alabama's legislators as to the actual needs of the Auburn students and share with them the positive aspects and tremendous potential that lies within our University, . Thetiaisons to the City Council serve as the students' link to the council. it is their responsibility to keep open communications and a good working relationship with all council members, promoting good city government for both students and residents. The director of elections is entrusted with K the operations of all student government elections. The aim of the office is to ensure smooth and efficient elections for all parties concerned. - ' sian McDonald t ,Harold Hamilton All Photography by BOB GAMBLE Academic Affairs: Nm Seeger, Laurie Patrick, Jill Lawheaol Linda Bridges. The area of student life is made up r of eight directors, each responsible tor several projects. The spirit director plans the traditional Wreck Tech and i Burn the Bulldog parades and directs pep rallies and cheerleading tryouts. The publishing of the oif-campus housing booklet is the responsibility of the director of consumer protection. A pamphlet describing guidelines to obtaining residency was introduced this year as well. The student volunteer services director keeps students , r The office of academics affairs concentrates on activitieseand programs that enhance the learning capabilities of Auburn students. Work has done this past year to improve the effectiveness ot the students evaluations ot instructors. ln addition, a new test tile system was initiated for the benefit of students, . In February, another successful session of the Southeastern invitational Model United Nations tStMUNlwas conducted. During the same month, outstanding students and faculty were honored at r the annual Honors Day Banquet, -- Ftonna Hickman informed concerning volunteers needed tor local organizaticnsg a ,director of athletics and recreation informs the' SGA of happenings in those areas. For graduating students, two directors make available graduation invitations- and class rings. Finally, this year saw the formation of the Eagles Escort A Service which is handled by the student safety director. -- Communications M SGA Jim Gorrie, parliamenteriang Mr. Grant Davis, adviserp Russell Kendrick, senate presidentgfhleiil Lee. president pro-temg Ed Allen, execuiive secretary. h 'Row 1: Connie Rowbuck, Susan Pettit, Sue ,Wakely,' Willola Ashley, Terri Moore, Mary Jane lrrgang, Amy Gaddis, Juliel-lerbarger, Donna McElroy, Keith Chappell. Row 2: Ed Allen, Jim' jWGorrie, Russell Miller, Jim Hancock, Todd Floth, Ben Robuck, Rolaiambeth, David Carradine, SteveGraham, Barry Pike, deff Mullins, Rich Humphrey, Marc Watson, Mr. Grant Davis, Row 3: Pat McLoughlin, Neill Lee, Bill Alverson, Ronnie Williams, GregDryden, Lee Gresham, Ben Reeves, Chuck Ellison. Greg Schmidt, Ken Guin, David Herrick, Scooter Lee, Russell'KendricK., r e f -mlb. 2. WN, f -V SGA Senate Y' eos GAMBLE 482 Communications - SGA V BOB GAMBLE W, SGA Banquet for Astronau!s!Pho X 'O Semces . SGA senaxe' in A5u0n7 KATHY scnuscs Blood DrivefJOHN REED Comrmlnicaxions - SGA UPC From the symphonies of classical and modern composers to the music of Jimmy Buffett, from Dickens' A Christmas Carol to George Lucas' Star Wars, the University Program Council provides a varied array of entertaining, educational, cultural and recreational activities for the Auburn student. The organization is lead by student coordinator Reese Waite under the watchful eye of adviser John Burgess Jr. The council is further divided into eight areas: films, fine arts, horizons, indoor recreation, major entertainment, outdoor recreation, publicity and special events. Free movies are offered at Langdon Hall on the weekends as well as plays at the Telfair Peet Theatre, lectures by distinguished personalities are planned in addition to classical and contemporary concerts. For those who yearn to get away from it all, the UPC offers trips ranging from skiing on the mountains to rafting on the rapids. Classes in Red Cross CPR are offered as well as ceramics and aerobicise. The familiar windows of Foy Union's cafeteria colorfully publicize UPC's events. Also, other campus organizations work closely with UPC in organizing and scheduling events for the University. A quarterly calendar gives students a listing of the UPC's events. - by Dave Riley John Burgess Jr. The King Union Programming Coordinator 484 Communications! UPC Rees Waite - Coordinator Marshall Poole - Publicity Mike Hecht - Films Preston Morgan - Special Events Maria Rogers Assistant Coordinator lf, ..... B.J. Adams Major Entertainment Director Marsha Mitcham Program Director ra 'A j1+-s Richard Norris Allison Hamill Dudley Perry Flow 1: Dudley Perry, Stacey Milam, Rees Waite, B.J. Adams, Steve Baum. Row 2: Marshall Poole, Maria Rogers, Preston Morgan, Allison Hamill, Richard Norris, Karen Boetlger, Mike Hecht, Marsha Mitchum, John Burgess Jr. Fine Arts Horizons Outdoor Recreation 'll MARRS pny by susAN Bnown .4 Stacey Milam Steve Baum Karen Boettgef Photogra All Religious Affairs Public Relations Indoor Recreation O O 3 3 c :a 5. 9. 5. 3 'f' C 'U O U1 f al Maior Entertainment!JOHN REED Films. Seated: Mike Hecht, director, Joseph Kelley. Row 1: Kurt Kuersteiner, Michelle Slay, Sylvia Ayers, Cathy Weaver, Tamara Massey. Amy Allison, Sally Shaw, Kathy Jones, Cindy Nunn, Abby Watson. Row 2: David Montgomery, Kathryn Mims, Lisa Copeland, Scott Arvin, Mark Loveless. Row 3: Ron Barkowski, Robin Shumpert, Kimble Manley, Todd Holloway, Cissy Allen. Row 4: Richard Corey, Donna Hudon, Andrea Juno, Cara Cobb, Lynda Hopewell, Connie Burgess, Philip Solomon. Row 5: Chris Upp, Rachel Phillips, Nancy Moore, Kathy Fletcher, Amy Marvil, Will Lewis, Mike Mungemast, Brett Ayers, Lori Allen, Joe McDade Not Pictured: Monica Mosely, Marni Crosby. l Films!B FITZ Special Events!DELAlNA PAN Special Events. Row 1: Preston Morgan, directorg Lucy Pennington, Jeanie Morgan, Elizabeth Adams, Donna Corless, Linda Luttrell, Connie Shih, Karla M. May, Jenny Miller. Row 2: Kathy Lehner, Terry Hansford, Sally Slawson, Pattie Holton, Cheryl Fortner, Lynn Geiger, Anita Blackwell, Karie Coleman, Terrie VanCleave. Row 3: John McCormick, Jay Butgereit, Jelina Allen, Philip Jones, Joe Feyka, Alison Hendee, Kelly Cashin, Beth Henghold, Kelly Brown. Not Pictured: Alesia Blackwell, Beth Pryor, Tara Cremin. Maior Entertainment. Row 1: Lisa Herman, Mary O'Brien, Kim Campbell, Anna-Ruth Taynton, Debbie McElligott, Anne Winkler, Suzie Greggs, Tracy Sieniawski, James Taylor, Lisa Ross, B.J. Adams. Row 2: Alison McClurg, Belinda Black, Phyllis Schwartz, Lisa Ward, Jill Siniard, Watt Crockett, Vann Farrell. Row 3: Ann Boohaka, Dan Rice, Lisa Copeland, Meridith McGlon, Mark Goodwin, Lance Kinney. Row 4: Linda Gilbert, HoriZens!CRAlG SHIRLEY Debbie Sconyers, Bill Boulton, Russell Moore, Rusty Broome. Row 5: Wayne Rowan, Tom Kozar, Dwayne Maddron, Tom Parker, Roger Andretta, Wood Herren, Tom O'Connor. Horizons. Row 1: Green Faircloth, John Greer. Anndria Brady, M.J, Rodgers, Jay Burke, Elyse Hauser, Debbie Byrd, secretary: Suzie McCulIers, Lynda Whitt, Scott Beckey, hospitality chairmang Karen Logan. Row 2: Dianne Horvath, assistant director, Marian Sams, Cathy Weaver, Mary Ellen Hughes, Kevin McKinney, Coach's Corner coordinator: Julie Spencer, Susy Meier, Juli Williams, Bobby Porter, Amy Craddock, Beverly Byrd, Paula Nabors, Row 3: Tommy Bauer, Allen Collins, Missie Harrison, David McEcchern, Susan Pope, Carl Creasman, Allison Hamill, director, Amy Allison, Holly Nilson, Steve Sasser, Betsy Houseman, Tina Crews, Melanie Threatt, Janine Harris. Communications - UPC Qlhciluhurnidlainsman These people have sacrificed a normal life in order to take part in a dangerous mission. They are subjected daily to various tortures and battle against incredible odds, they wage war against alien forces including SGA, Communications Board, UPC and asbestos. Armed with only archaic typewriters, defective headliners and dull exactos, crew members heroicly continue their mission. Because of the loss of back-up forces, the faithful few are forced to endure all-night vigils with a lone popcorn popper and hot pot as their only consolation. These brave, long-suffering, undaunted individuals are the fearless editors and fearful assistant editors of The Auburn Plainsman. Their mission is to produce a paper every week despite these seemingly unsurmountable obstacles. Voyage commanders were chosen for their unique abilities, strong character and because no one else would take the job. . . . Captain Tim Dorsey . . . the paragon of masculinity , . . encourages crewmembers with prophecies such as it flies, it cooks and it's solid .. . his deity, Lenny Bruce . . . mentor, The Who . . . life sustained by left-over salads and coffee , . . ultimate goal: technical perfection. . . . Second-in-command Monique Van Landingham . . . forced to take control for 30 seconds every half hour . . . canonized winter quarter for quitting her only vice, gum . . . hailed as Her Moniqueness . . . devoted to the doctrine of physical fitness - Martinic style . . . president - MHA ultimate goal: spreading good will in the midst of chaos. . . . Associate Commander Alec Harvey . . . entertains crewmembers on THE couch . . . M-O-U-N-T-A-I-N B-R-O- A O-K . . . favorite pastime, Miss War Eagling . . . Opie . . . suffers from identity crisis when answering the phone . . . i loves 64ing , . . ultimate goal: getting entertainment editor to do her job. Joy Bullerd, Secretary: Thorn Botslord, Advisor Pamela vick, Asst. News Editor Tim DOYSSYV Editor 488 Communications f Plainsman 'Q dingham, Managing Edit ,it-sta 4 Q Q 4 4 4 xg sk Mary Harvy, Copy Editor Keith Ayers, News Editor . . . News Commander Keith Ayers . , 4 organized to the max . . . crew advisor on alcohol information . , 4 early bird . . . man with connections . . . patient with muckrakers 4 , , ultimate goal: finding time to see wife, Donna. .4. Features Commander Melissa Shubert .4. dolphin expert .., president - MHA 4 . . headline material . . , successful business trips . 4. Of ' ' ' ' Melissa - art in a clinch 4 4 , Honorary Flanger and wilderness expert .., ultimate goal: getting real features, , .4 Entertainment Commander Katheryn Barlow .4 . closet punker 4 .4 favorite pastimes - eating and sleeping , . 4 examples of Barlow wit, Whaaaaaaat, Leave me alone and l'm hungry, saga of a high priestess . . 4 president - MHA . . . caffeine and gum addict 4 4 4 ultimate goal: to get Alec to do her job. . . . Sports Commander Stuart Blackwell . . . Plainsman playboy .. . Stu-Baby .,. Hot'Lanta child 444 formal man 4 4 , Stray Cat strutter .44 ultimate goal: resign from fleet for financial security. . , . Research Commander Kaye Dickie 4 . . neat desk award 4 4 . kitty mom 4 . . space shuttle fever . . . ultimate goal: keeping Melissa and Katheryn away from her desk, . . . Photography Commander Brian Easley . . . waiting for the right one . 4 . swanging , . 4 precious . . . crew athletic trainer 4 . 4 survival instructor . .4 ultimate goal: a darkroom to himself. . . . Copy Commander Mary Harvey , 4 . Garfield disciple . . . plant mutilator , 4 . nutritional adviser 4 . 4 president - MHA 4 4 4 compulsive shopper 4 4 , staff champion bubble-blower . . . ultimate goal: to receive her very own exacto and dictionary. . 4. Art Commander Victor Wheeler .. . the man with a smile . . . mass-producer of fleet art . . . bearded Michaelangelo . . . super cooperative . .4 ultimate goal: to receive assignments at least 10 minutes in advance, preferably typewritten. . ,. Technical Commander Karen Kirkpatrick . .. Personals person 4 4 . Hooty-hoo 4 . . can handle ... service with a smile . 4 . actually does homework assignments ahead of time . . , ultimate goal: for Alec to do his job. . .4 Assistant News Commander Lee McBride . ,, idol, Jane Fonda 4 4 . subject of ignorance by news commander . 4 . says what she thinks, knowing the consequences . . . love affairs over the phone . , 4 President - MHS ultimate goal: giving Headlines Boy duties to another assistant commander. 4 4 . Assistant News Commander John Peck . . . journalist Communications Y Plainsman Plainsman Karen Kirkpatrick, lec Harvy, Associate Editor A on wheels . . . on the wagon . . . spying for The Huntsville Times . . . lobbying for Visual Display Terminals . . . utlimate goal: use combat experience gained at Plainsman ,.,. in becoming a war correspondent. . . . Assistant News Commander Lynne Hopkins . . . girl with a purple heart president - MHA . . . ZTA bunny . . . bartender for rent . . . pledging romances . . . ultimate goal: coordinate a mock telephone poll in person. . . . Assistant Photography Commander Chris Shirley . . suffered from identity crisis for first few months in fleet . . . one-half of a freshman sensation from Greenville, Ala., . . . midnight trips to Krispy Kreme . . . Godfather's Pizza . . . New Year's Resolutions . . . ultimate goal: to find fault in Katheryn, Monique and Melissa. . . . Assistant Entertainment Commander Angie Chandler . . . unyielding faith in her editor . . . comes to all the right parties . . , singing writer . . . ultimate goal: to get Glen to do her job. . . . Assistant Photographer Commander Tom Palmer . . . in quest of the impossible dream to get a job . . . crew psychoanalyst . . . ultimate goal: to die and meet Carl Zeiss. . , . Assistant Features Commander Terri Knott . . . Plainsman sweetheart . . . food donor . . . crew member who studies . . . ultimate goal: to make the perfect chocolate chip cookie. . .. Assistant Sports Commander Mark Stevenson . . . computer brain Southern gentleman facade . . . Kitty originator . . . ultimate goal: to finish his article story without falling asleep. . . . Assistant Research Commander Doug Leyshock . . . office clown, comedian . . . fat-hater . . . displays discharge like Walt Disney . . . ultimate goal: to reach destination without running out of gas. . . . Assistant News Commander Patricia Vick . . . Little Miss Muffett . . . smiley face . . . ultimate goal: getting the smile off her face. . . . Assistant Technical Commander Cindy Hall . . . MHA President . . . likes Three's Company . . . remains calm in the most desperate of situations . . . ultimate goal: looking for something to be mad at. gness Casady N i-, , f n,.,a., thf Assistant Egntgrtailnvepg Commander -'glen gskew y ' ' ' Lee McBride, Asst, New Editor: Melissa Shubert, Features Editor In IDQ pfeppy, 9 ef 8 G an I'1GVel' , . . IDS TOCCO S pen pal . . . ultimate goal: become an editorialist. - Mike Marshall, Asst. Sports: Stuart Blackwell, Sports Camille Editor: Mark Stevenson, Asst. Sports Phillip, Staff Writerg Karen Kirkpatrick, Tech. Editorg Tracy Sientawaski, Asst. Art Director Communications - Plainsman i . And Then There's The Business Staff There are two parts to the Business Staff: 1l the ad reps and 23 the layout specialists. Everyone contributes in his own way, but at oddly different times. The ad reps and the layout specialists rarely see each other due to different work schedules. No one ever sees the circulation guys. A visitor would wonder how a paper is ever put out. Let's make a visit to the Plainsman Business Office on a typical Sunday night to see how they do it. Harriet walks in smiling, Do you have the Greenhouse ad done? What ad'? I think I saw it on the floor, says Mary. Hey Eric, did you hear the one about the sheep and .. The phone rings. Margaret chimes in, Eric knows about them sheep. By the way, who wrote this ad out? l can't read it. We'll have it ready in the morning, Harriet, says crooked copy Chris. Who did this ad? Everyone points at Mary. As Diane eats her pizza, Terry calls the Escort Service for Diane. They want to see what the guys look like. Eric stabs Victor with an exacto knife accidentally. That's OK, says Victor. Do you want all 19 of these drawings in the morning, Chris? Understandingly Chris says, Of course not. Have them by noon. Has anyone seen Bram or Elizabeth lately? The phone continues to ring, Bram said something about court again and said she'd'be in in the morning. What about Elizabeth? All Photography by JOHN REED and TOM T. PALMER The room becomes quiet. Uh-oh. l think she's still typesetting over at Haley Center. Somebody was supposed to pick her up half an hour ago! Alec sticks his head in the door and says, Hey Chris, Tim says we're only having 98 pages this week. Where are the dummies? Margaret, Mary and Eric keep on with their ethnic jokes as they put up a sign over a poster the business manager made ot the Bama game that says This looks like sh l Tuesday afternoon comes along, and it's time for the ads to go on the pages. All the ads are down and there's still three quarter page holes out there. What do we do? asks Margaret. Fting, ring, ring Hey Victor! How'd you like to do some art real quick? The last bit gets taped to the page 15 minutes betore deadline. Every week, for 35 weeks out of the year, this goes on. For experience, they say. And what an experience it is! We would like to acknowledge those who have contributed over the year to the business side of the paper: whether just for a quarter or for the whole year. They are: Frank Berry, David Harris, Terry Toth, Mark Warren, Grant Haygood, Bram Gresley, Chris Jamison, Harriet Glasgow, Diane Six, Jim Campolong, Susan Goodwin, LeeAnne Patterson, Bill Stone, Betsy Casey, Neill Lee, Elizabeth French, Bill Dillard, Brad Wetnight, Mary Welhaf, Eric Gronquist, Margaret Strawn, Victor Wheeler and Chris Karabinos. Will someone get that PHONEl!l - Row 1: Eric Gronquist, Margaret Strawn, Chris Karabinos. Elizabeth French, Mary Welhaf. Row 2: Victor Wheeler, Jim Campolong, Harriet Glasgow, Brad Wetnight, Neill Lee. Communications - Plainsman Gr John Reed - photo co-editor. Investment tycoon, a photographer and a gentleman. He invented the word conservative. RUSSELL SCOFIELD JOHN REED Lynn Brown - editor-in-chief. Better known as Mom. She has a tactful, yet humiliating way of letting incompetent staffers go. Her enthusiasm and genuine concern has comforted many frazzled section editors. 494 Communications - Glornerata . Charlotte Borden - Greek life LynnAnn Palmer - Greek life . . , . sorority life editor. she fits the bill for gfgfgngifl,Qfifvfytogdmz fglffgl 'with the perfect sorority editor. She s cute, an those hats and going to IFC bubbly and cheerful no matter what, . . meetings. Lucky girl! JOHN REED iii. Ns... JOHN REED Patricia Cook - honoraries and communications editor. She is the amz Qrowrrup , SfCt'OQ ednor Wm? Leslie Williamson - secretary. specializes in oral conversations. The Typica' freshman Secretary She Glomvs Very Own Spadette' giggles long distance and has a cute ponytail. fe rv .,..r.yffe..:.,zt..z pit : V fi ,,1 . we':.'g'v44,,yff.Ms'.ff, ,Y , V 2 1 7 . i , 1- W Q, ,rw , gi- , ,r r-M. 1 j . -1 . M f . .' fi 1. -1 it fi' Bob Gamble - photo co-editor. BWI Photography is nothing unless it is used: it should be used more and talked about less. Does anyone need a picture of a worm crawling across a window? ABBY PETTISS Craig Shirley - aspiring photographer. Always there with a smile land a frank zoom. BFITZ '.f' -. JENNIFER JOHNS David Penn - art director. The Jam Man. Leader of Glomercise. He was in high demand at the Glom, the Plainsman, the Tiger Cub and of course, at Biggin. The Glornerata staff is comprised of a number of unique individuals, each different in his own way, This group of students, although receiving only three days of recognition each year, works diligently throughout the year compiling a conglomeration of the memories of a year at Auburn. The common student, walking into the Glom office at any time of day or night, might run into some strange and unusual people. lf this student happens to stick around for a while, he would probably come across some strange and unusual activities too, Here are several possibilities. just to name a few: Lance shouting, That's immoral! Sonya screaming, What the do you mean you're changing my layout, Brad? Lisa embarrassing Lance every time he comes into the office, even though he is always protecting her. He needs to transfer to Alabama because his face is usually crimson. Courtney being greeted with Can I help you? and curious glances after she had already worked on two deadlines. Ben Fitzpatrick - photo manager. Always in overalls. A giant of a friend to all. Just don't call him Benjamima. Jennifer Johns - photo co-editor. l'll bet two cat's eye marbles that my pocket knife is sharper than her YUS Melissa -Gresham - beauties editor. Saved the section from total ruin. She's a sweet girl - who . wouldn't hurt a fly, and she goes into a frenzy at the thought of hurting anyone's feelings. ABBY PETTISS 2 JENNIFER JOHNS Eric Gronquist - academics editor. Has the cutest little body, a quick smile and a friendly word for everyone. Always makes a point of checking in with the office after his fraternity socials. John working on his investments paper while he promises everyone, l'll print them sometime. Flussell constantly drinking all the beer that John, Ben and Bob could ever buy. Disco deadlines with David's jam box and Lisa getting off to the jam. Eric is in a jealous rage over Lisa and her chubby lover in Athens. A starving group of staffers piling into Ben's truck to go to Mr. Gatti's only to be wildly thrown around the back of the truck all the way there. Bob having nightmares in the office as he remembers the ever-dreaded E-5. Leslie screaming endlessly in the darkroom as she pleads with anyone to let her out into the light of the office. After her release, she really enjoys a big swallow of Jack Daniels. Jennifer conducting late-night photo sessions with such famous models as Lisa Lust of Vogue: Lance Horton lll of GO, and a nameless model in demand by both Vogue and Wilhemina. In her portfolio are such photos as the famous Beat Georgia shot. Midnight runs to Krispy Kreme and returning to the office only to be told that it the bright green fcontinuedl questiony' even for Communications - Glomerata Mike Zaleski - assistant sports editor. King of womens' sports and an athletic supporter. Does he ever shave? Greg Fox - sports editor. The Farmhouse Fox, and ours, too. He quietly puts together an incredible section. ! '1-' 496 fAll anecdotes were written by various anonymous staffers, unknown to the person whose photo it is by.J JOHN REED SUSAN BROWN Pat Tatum - Miss Glornerata Pageant director. Johnny Lawrenoe's lover Super organized and so cute. Brad Mooy - replacement Courtney Quina - replacement organizations editor. Better know as assistant organization's editor. Slash, Brad is the resident radical. l-le Stepped in to help save her section in saves the Glom from the wrath of countless organizations. the midst of the trials and tribulations of JM 101. SUSAN BROWN SUSAN BROWN 2' TW ,ff ww .VIV.,V:,. ,V ,..k .... 5 V M kkrr M SUSAN BROWN Diane Behnke - copy editor. Home of the Wrappers, She is the object of every photographer's admiration. Staff never appreciated her until one hour before deadlines. JENNIFER JOHNS Lisa West - student life events . editor. Lust knows every dirty joke in meLZ33r3SH?dn:gP Etagiiiganrlt itstdem the book. She is the 21st Miss Glom . I . ' ' contestant and the Union basement Stumd' nawe' maybelsleeps Through favorite tests as well as deadlines and group SHIRLEY Mrs. Emily Leischuck - adviser. Atfectionately known as Auntie Em by Glommers, she advises the staff and takes care oi most of our business matters. Susan Brown - aspiring young Volkswagen sitting on the sidewalk in front of the office isn't moved, it might catch on fire, according to the Chief of Security. More Hpunking out at the office during deadline. David, Lisa and Diane having their own Limelight in Auburn. The rnost-played song is lt's Raining Men because it is the fantasy of every girl on the staff. Craig leaving on a Wednesday night to go out to Stoker's and then finding out why no one wanted to have him take any pictures. The entire staff getting uncontrollably excited every time Al walked in the door because he always brought plenty of munchies. Miss Glomerata candidates strutting into the office only to be ridiculed by staffers after they had left the room. Girls who missed the deadline by three weeks and still called about signing up for Miss Glom. The things we put up with! Fireballs, the official candy of the Glom, scattered throughout the office, Generally, these are well hidden in Patricia's drawer, however, in the process of invading her drawers, the fireballs are discovered. Patricia having numerous clashes with the creme de la creme tnerd of A.U.l. On Valentine's Day, the entire staff having a party and exchanging kiddie valentines. Open ears and caring hearts can be found at any time. Ben being bothered by Mr. Village Photo at the group shots that the Glom set up. Size has its advantages, however, as Ben firmly tells Village that No, we're not working on this group shot together. This only begins to describe the atmosphere at the Glom office. The full force of this office and its staff members can only be felt by those who are directly involved with the production of the Glomerata. This group is indeed a fortunate one for having the experience of being a part of this book. - A,-...rt ' J iiis ' Aesv PETTiss Darryl Moland - assistant student life - features editor. Better know as Delicious Darryl, is part of the Guthrie's gang. He's Abby's left hand, or is it the right? Row 1: Russell Scofield, Jay Sailors, Susan Helms. Row 2: Bob Gamble, Ben Fitzpatrick. Brown, Delaina Pankey, Connie Shih, Bill Hart Bill Schneider, John Reed, Kathy Scruggs, Troy PATRICIA COOK 2 HQAIUYGS es: i ,,,,.w- WP' BFITZ Abby Petliss - student life features editor. Longtime veteran of the Glom. She is a standard feature at the Glom Off and always has an interesting idea. She's the real Dear Abby. photographer. The staff expert on horses. She's like a child at Christmas when her new lenses come in. Spring break is coming - let's go swimming! SUSAN BROWN .tk . is ...t ' 4 lf X QW 'tif 3 wt JOHN neeo Alex Luttrell - classes and composites editor. This quiet, mild-mannered man quietly types long hours at the Glom office. Little do the unsuspecting Glommers know that at night he parts his hair in the middle, unbuttons his shirt, puts on his black leather pants and becomes Alex, King of the Disco, better known to the women as 'fthe heartbreaker. Communications - Glomerata Ware Ag ' C404 Gil Sd' KRISPY I 72m1wNDr,.4f, All-you-can-eat Buffet - 52.99 11 a.m.-2 p.m., 5-9 p.m YOUR PROFESSIONAL .IEWELER I SERVING THE AREA OVER 35 YEARS A . 'E LLIIWIJIQIIE I I I If 2 fig I I I it E If II IIIII-EIII' I ' ' If-EIUW 3 I f AI ' I 0 DIAMONDS bg' Q 5ILvER 7, K LAMAR WARE A REGISTERED IEWEIER , CHINA If .I RONNIE WARE E CERTIFIED GEMOLOGIST . GLASSWARE an EMILY WARE -CERTIFIED GEMOLOGIST C., J AMERICAN GEM socIEw O WATCH 8I JEWELRY 1 P I-gl REPAIRING 8. ENGRAVING E ACROSS FRLTJ CA J? UH Ill S l'Ol LLGE AUBURN 2 7A2I:,,QQQ5 n Majorellest Dena Crews and Carol Mathews ' A SALUTE TO THE AUBURN BAND AND MAJORETTES FOR THE GREAT SERVICE THEY HAVE PERFORMED FOR AUBURN UNIVERSITY THROUGH THE YEARS THE AUBURN CLUB ' THE UQHS CLUB ATHENS, ALA. ff 6WADUATf0N AT M57-.f , I IT? me :WD or szwoaz. H 45 2 , , N Bur UEPMINLV fvorrffe ff A f. 4 Em: arf sfwa ANAZTIVF LEE mm' OF me Aagww S la 5'PlF!1Tf BEXAIHANA 617115 J E Awm 1: seem mv AMD S A keeps V011 IN cease mom ff: TJTT , IJITH me l?ES'T 0F THE II 1 AUBURN PEOPLE -AN . -ve 'I AUBMRN Tknnfrfam TE B I WA R EA G L E! Alumni are an important part of Auburn University. The Auburn Alumni Associ- ation strives to promote a continuing relationship be- tween Auburn and its former students for the benefit of both. We, in the Alumni and Development office, look forward to a pleasant associ- ation with you throughout the coming years. War Eagle and congratulations! Sincerely, George L. B Executive Director AUBURN ALUMNI ASSOCIATION Ad S 5 1E.1TR?xRkg9.XR9 P31 8' SQPUES ZQHVEWS - l:12 , -,- - , - f . 1 X ,,. , . l N . x ....-X '7'7'LL:1 7 A ' 1.1 ' 7 1HA',yX.N,'fxQR KU if f,J1TTf7f '+?.,',I ' 31' ..: . T-MTI 'L rl' 'HN ,' 1 ' 1 ,, gif ' fTY',7,f', Y,f5.XA-LL.,-,, 'wwf V vm- A- - -- - f - V '- ,' .' lfX ,H-7-V,-,l, ,A--A-V,-Y-vA,v v--'E ,L+ W., .,. X xx lx . 1 ,pm 1r'Iv4 ff' vf L X 'MMR x,- ,X V-,ll -y-1 Q' 1 f' J ' ' 1 1 1 - - 'ww-A ' iizgglgk Q-ZLL I- - rx --7 AM Q , 7 Q, f 7' - -f--f,f 4, -fi CT-.,,.,-,,, ,ng V 115 s. coirisfsi. 887-7007 QOOAJQWG , S 6 DDU' owned and ' ii KXWQM n f' 7 gg .-z:--zzz. 3: 9 113 ,QL Q9Z C925-42.47 6 QQZQCL ook 205 qw 'Imuvsnsmr nooxsroni Official Yearbook Photographer Yearbook Associates Millers Falls, Massachusetts 01349 l BLEIU AND BLUE U AUBI RN TIGER Q., 'wxww THE STAFF - idressed similar to their sectionsj seated - Lance Horten, as a shaker: Lisa West, with the Thanks Hanly sign: Alan Cook: Jennifer Johns, with her cherished assignment book: David Penn, with paints and equipment ready: Ben Fitzpatrick, directing this test-strip photo: and Diane Behnke, with her faithful typewriter: standing - Bob Gamble, holding the fire extinguisher: Russell Scofield, with the tripod: Susan Brown, with the new Pentax camera: Patricia Cook, taking the oath as Spadette: Darryl Moland, preparing for a weekend roadtrip: Abby Pettiss, Darryl's partner: Pat Tatum, with the stolen Miss Giomerata crown: Leslie Williamson, acting as our efficient secretary: Stacy Spier, along for the road Student Life - Events Lisa West, editor Lance Horten, assistant Ann Gehnarelli Sue Boyles Sports Greg Fox, editor Mike Zaleski, assistant Lorie Joyner Deborah Woolbright Academics Eric Gronquist, editor Melissa Gresham, assistant Laurie Nickchen Ann Murrell Mimi Boyer Chris Gattis Kelly Glover Lynn Brown Beauties Melissa Gresham, editor Eric Gronquist Lynn Brown Diane Behnke 502 Credits Pageant Pat Tatum, director Angie Jackman, assistant Jennifer Howell Rose Scott Long Tara Lanier Stacy Deason Cathy Jones Leslie Piat Janie Riley Tina Terrell Danny Webster John Conren Cathy Johnson Student Life - Features Abby Pettiss, editor Darryl Moland, assistant Sonja Baucom Brad Mooy Kim Judkins Stacy Spier Phil Pieper Diane Behnke Beverly Hurley Kathie Dawson Kim Carlisle Lisa Milberger Luci Cook Tenise Deaton photographer. Who's Who Leslie Williamson Lynn Brown Classes and Composites Alex Luttrell, editor Judy Buchanan Jacqueline Coar Jennifer Howell Beth Miller Elaine Scharnitzky Bernetha Sims Maria Williams Carol Woosley Copy Diane Behnke, editor Leslie Williamson Art David Penn, director Alyce Heggeman, assistant Business Karen Lovoy, manager Jim Kelly, assistant Diane Behnke, assistant Gena Sewell Darlene Barber Susan Hutto mee- . trip: Courtney Ouina, as a ROTCg Alex Luttrell, posing after submitting more than 8,000 mug shots illljg Lynn Brown, performing the role as mom complete with the appropriate nagging: Brad Mooy, dressed to try to finally please the military groups: Charlotte Borden, with plenty of Greek parpahernaliag Greg Fox, imitating his idol: LynnAnn Palmer, ready to participate in some sorority Toga parties: Mike Zaleski, putting his finger in LynnAnn's ear for some unknown reason: Eric Gronquist, trying to practice what he preaches: and John Reed, everybody's Opening Lynn Brown Matt Lamere Photography Ben Fitzpatrick, manager Jennifer Johns, co-editor Bob Gamble, co-editor John Reed, co-editor Craig Shirley Russell Scofield Kathy Scruggs Susan Brown Bill Schneider Delaina Pankey Jay Sailors Mike Weeks Doug Brinson Connie Shih Bill Hart Rick Holl Malinda McCray Honoraries Patricia Cook, editor Communications Patricia Cook, editor Dave Riley, assistant Fraternity Life Charlotte Borden, editor Diana Houghton Donnell Glenn Brad Mooy Karen Bayley Paula Kinby Stacy Spier Suzanne Northam Sorority Life LynnAnn Palmer, editor Dwight Potter, assistant Lysa Woodward Ame Satterfield Saralyn Smith Jana Wasden Gayla Smith Denise Martin Pam Hartley Organizations Brad Mooy, editor Courtney Ouina, assistan Sue Whatley Secretary Leslie Williamson t I I I I I I I his has been some kind of year. It's been one of those things you just don't forget, instead the experience actually become a part of oneself. It's been a year of actually becoming the Glom. That is, being called Miss Glom fl wishj constantly by a roommate and a friend. Also, you just can't forget being referred to as Mom by a 22-year-old graduate student. The endless question of How's the Glom coming along? teven about 350 miles from Auburn at the Tangerine Bowl during a visit to the concession stand after Bo Jackson performed his infamous over the top playj will always be with me. It's an identity crisis. I even caught myself signing my name as Lynn Glom once. But, it's not that I want to forget. This experience of editing of the Glomerata is something I'II never really give up. Probably the greatest thing l've learned is just how great people are. This project has been a gift and I thank the Lord and the people who have helped give it to me. A special thanks to all my friends from Andalusia and especially my sisters of Alpha Chi Omega for the enthusiasm you all gave to win the election and this position. Thanks Kim and Cindy, y'all are wonderful. Mrs. Leischuck, I don't think anyone realizes the behind-the-scenes work you put into this book. I realize it and have appreciated it. l've certainly been glad to be one of your children A special thank you to everyone in the journalism department for the encouragement and time you've given me this year. Thanks is too small a word to say to a staff that has been so dedicated to this ,si ...it taken book. Y'aIl were never a staff to me, instead y'all were my friends, my family working with me. Ben, Bob, Jennifer and John, thanks for making my management theory photo staff work through cooperation and high standards. Ben, your notes of humor and encouragement kept me going and Bob, your quiet way of demanding quality was terrific. Jennifer, you made a tough job look easy and John, my business partner, your calmness always soothed my nerves. Diane, your dedication and warm smile were an editor's dream: Lisa, it's a wonderful sectiong Greg, you won for having the most perfect layouts and Abby, your enthusiasm overwhelmed me. Lance, thanks for the humor and especially the excitement tl love ya'jg Brad, thanks for taking over: Patricia, I think the entire staff admires you and Eric, thanks for a professional job with no previous section to go by. Melissa, it looks greatg Charlotte and LynnAnn, it succeeded and y'all deserve all the credit - thanks and Alex, I truly don't know how you did it. David, thanks for giving a new definition to an art director, and Craig, thanks for all the smiles. This book has been through so many changes, not necessarily by choice, and I thank AI Haywood for making the transition an easy one. You've been a dear friend to us all and we miss ya'. Sandy, thanks for taking over. Kim Lyle, of Josten's, thanks for all the cooperation. Most of all, I thank my parents, Mr. and Mrs. Sammy Brown, my sister, Lee, for all the phone calls asking How's the campaign? and then How's your book? and Matthew for the patience, encouragement and belief that has begun to mean the world to me. It's over. My book is now your book, and I hope it captures just a small part of this untypical, unusual year. I think our attempt has succeeded. Lynn Brown 1983 Editor Auburn credits 03 W laxed K V fx l 'X i I wx 1 4. ' 'if K: I enough caught that Can there s there to do. You up an stop break. do it Students are napping or studying around the trees and the campus' brick sidewalis. m1 and WHS Sa wwhma plac 9 9 W8S 9 H IIXJAY SAILORS f rg K Efiiiki Zi-55. fi -Qi -Q, 4. . Q 1 ,Mil xx LNlV1iRSl'l'N xmw.m'. 1 .hw fm 'xmmw 'uw -mv W..-H by 1.-lm ,,, ,M vyxwpfa .mx Jr M-1-1.4 1,-.W A u I mwnlh In urvm .wrzxu lu um, nun,-4 lim -at r.n.Innw1 n.-nw Aw-.rn um: . vw -my mm. in 1.-wxmq 1-, sa.-W-mn X fn me xmzm... mm mum. H, ma-5. Mcnmvxem 'num mnmp- vuiam 11. 11172 nu xv.-come. umm' umm-nl... fu wmmuu-.n L umm,-f-,x ww- 1- f Ah' kin lxmu. mm -lm-nn I w:,TA'4 Ammm If-nywl-iam u--In 'frmms 'n 'h 'M , .MEN f num, nk 'JH' ' 1 as fi E Z i N M. g,.,fff, hxA 2, ' fx, if ' Nr? SJ' - SJ- if - gal I I I vssfafsiif ggais. . i Y H 1 a 3 f ' m LL , Q ,, .- V 'EVN' P 'WSH L - ' 4 'L il fig' -5 I Q gg , z ' . K I - ' f f A .Q 'Yi on X as ,V., Wm 'Q I 7 Oomer s after the Q1 .ww , Q JU -f'Q7':'?3 Delia lota's wsnuouu REED S0'0f'fY C0 ., Erin ai the 9 2 f mNm ' W V ' J 1 fxiwtk 1' ,Q . ww 1 1 f sf? k A1251 A EW N X ' iifeigx. ij ' ffm' -'fi ww X w A ' UH .M least ther w could one and different from others: having like or equal. Using this unique e body an get along in unlike campuses. could begin to ord besides 5 he year + each to the group SN student building, were construction with associated noise of the finished The year saw USM! around world demanded A successful gave an added fall quarter. A 9-3 a Tangerine Bowl first b owl game for SHHWG GVGT Q.. 'l l ICF? AIG S HIRLEY NX I, ,., ,- - -W-:,.V-ibm rwfx -wi. 3,4 .C-V . . ,- .-.. flfjy Ay, , - . A A A 4 N: M5 F5 i 553:55 ,p Quia., es 4: im:-zlfiy k . . -, 1 NF? -f 'Tl . ff gy 4' A P113 Wwe .. nn ' ' X ,, .,,, xv , 4 i n A, dx f, 1 ,K Q Y w u 'Q x N... ,,,.l , ,1 WN., - wgw, , M. D - -- -, w...,.,fv,,,Q... x ,, ,. . 1 53 i . H Q 9, ,, V , 45 n f , , - V if .f A V. W sf f uf k ' ,.., ,,. , is . Q 529 1 fs Q x 3 xg iw . 2. W i 'SQ . . . .. 4 ' .-. alll! di . hV, . il 1 f M V M M f A L w Am i if ww' 2 , K. K,.k 1, LLW: xi 4 .L 1 , Y :,. f V V up A Ji - Q fd -: . , WS I 'Cf M 'L is . E ., X, QV' 5 -- ' W - Q ,au ' ,, rf' A fs: .- , . A sgvkfv ai' xr - t fvm ,Y 'Lf' PE' - ,g ,H I 'fl ?': y1 Q 5 'x. rs 1 ,nt , ..,. A, m I 2 l 1 h' i g E 7 , V Q , , ,ff , ef v A avi ,.--.f.......,, ,A , ' f Ewa, v f. 156: M ,m ,mfs 1 . .ny -54 ,Y pw: Q rd ,ffl ff QW? A5 ,,q,,vfm-sf ,M ,ff I fr ,bfi AM J' ,aa ff 40 .xv 'iv ,W -WF -us .1 , , . .. W ' K X , ' i 1-055: - ' I V K, , 4. , 5 3, , 4., W ' 1 , 122. 1 - , 'ie L - ,L , ,V E3 A .T , 3 - ,j5', - jk L. ui! ik. V -, - , i ,,,---W4-'I ' w . L ww- AV - ig-I - w ' fpjif.-I m 1 ,I -,, -1' -fi 'j ' f, f - V. 1 f i . - . 'wif - 'Li - , A f ' C ' 1. 1 1 - i 1- , if 7 f J-7.1 ' ' X . w A K- , MW ?'-wi i, .. 3 , - -1 , ' j L :E+ I 8. H E . Vi: ,, Q51 ' A I Q ,ffm i, A i K -. 7 V1 , i ,f ' , -ff ff ,, ' f , w ,, --, --V+ Vkkk, ,v f , ,Nf .1 4- , V. Q 3 1 ' f 11 ,jj gf, , F. -, .2 M- l-,J I ,W H ,. ' ,ff :WY 5 K A i I , ' 1,1 -,-ff' ' ,mf ' Q -- , A' ' :if . -- -- .f ,, , - ' I f - A gf 'M . , , ,, ' l 'ff 'I+-1-if - ' pf '. J Q' f . V ' ,K qw, ,L Qgfg. L t K f Q jfi 1 fi j - fix? f - ' i ' .:'-,rw , . A gg-1-:iw 151, in-,,?.rff,k Fiii., fy QA,-1 f , Al MkLI..ElV,3v:eff!fzQgi,Zf J 1 I ' ' ,, - , , , L, ,, - i ' ff A ' 4 , X '- A Z 'T ,Jw - ' vf- I in - ' m 'fy i ' ' 1 , if-HM fy -I ,, ,wash Q f -if -' , V-:g g gk ,75,:i,,,f..:zzg. if ' 9, 5 . , V 57525-f:.:,--'5 L?f,'1,iw lfw 1 k ' . , ' Wa'-' wf'-Lssil2 fffiz, 1, L if ff: L f- f -. if' iff' .fir-If lr HL fy nl' ' , iff- effing' ... A wr ' ff ' K J' M . -,. yA . -33, V, CQ 1 'ZH .. , 3 x . ,K , , 3- v' , . 'B bi 'L . 4 1 w ? 1 Y ,,.....uof- , , , , u-n...-..,,.....q..-,..,., nf--v , ,vw .. ,,,,. 1, NA.. . 4. , ,.... , 'WJ' V g -1 -1-+1 five- v I Q R . D F A A 'Q v av 0,5 vga 12? 1 i

”

Suggestions in the Auburn University - Glomerata Yearbook (Auburn, AL) collection:

Auburn University - Glomerata Yearbook (Auburn, AL) online collection, 1980 Edition, Page 1

1980

Auburn University - Glomerata Yearbook (Auburn, AL) online collection, 1981 Edition, Page 1

1981

Auburn University - Glomerata Yearbook (Auburn, AL) online collection, 1982 Edition, Page 1

1982

Auburn University - Glomerata Yearbook (Auburn, AL) online collection, 1984 Edition, Page 1

1984

Auburn University - Glomerata Yearbook (Auburn, AL) online collection, 1985 Edition, Page 1

1985

Auburn University - Glomerata Yearbook (Auburn, AL) online collection, 1986 Edition, Page 1

1986

Searching for more yearbooks in Alabama?
Try looking in the e-Yearbook.com online Alabama yearbook catalog.

Find and Search Yearbooks Online Today!

Online Yearbooks

1985 Edition online

1970 Edition online

1972 Edition online

1965 Edition online

1983 Edition online

1983 Edition online

FIND FRIENDS AND CLASMATES	GENEALOGY ARCHIVE	REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today!	Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly!	Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.

E-Yearbook Home Quick Search Advanced Search Quick Browse