Washburn High School - Wahian Yearbook (Minneapolis, MN)
- Class of 1938
Page 1 of 124
Cover
Pages 6 - 7
Pages 10 - 11
Pages 14 - 15
Pages 8 - 9
Pages 12 - 13
Pages 16 - 17
Text from Pages 1 - 124 of the 1938 volume:
“
r i V V V- l ?:S'EE? nV1' - fy , ,,, J 4. . pf j . ef ., ,,Vw ?3f:g?n 55 1 'iffwfi L..- ' -V ff -.Q-5 - ff, . F - A A . - if H Q : --m i if .VA x-ww . Agar 1-A, was 5'-3 , .-.f, f x- Q QSM ? . - f -W' i if , .. W- . wwf M U ' me Q , Ns , 1, fa . - V V V . Q V 11-' A 1 'xl f-iif x. N.. ' iffy? ' ,, ,zfl2 'WZ , T'- 'pffff V ,M W QZM L A v nf .7 .,- 4 Mgr ,gf , Vw V,i:4U ., 'LW' - W A A ,V . M ,ff M V au. sf' QW . We W W 1' wwf. .VNV QQ ' 1' 5 V , 4 i' 5:3 f 655, 5 14. M fy if H JZ ,gl 3 F' + . . Wm W ,. V r . ' ,fg s' 1 ' ff ' N' is 0 f A L ' W y 4 A 5554 'f J ff' ff wg y J' wi Wan JW , M. 4 gpw ,,,f'W 4 'T 55 ' ' ' L ' ., .ff V- V ' ' .V , . V - . 'ff?3521iS5 ' 'L if?-if wifi ff . 4 V ' , . , ' , . . -. V ' ' ' -V V , : 1 Vp A V VV , ,1 , V , I 1 V K 3,-,gl , -, wg, .I M A 1.2 . A A. . I ZW . ai 1 , ,,., ,., ,.,f, ,vii . - -N512 -f' Ay: - g2'i!i,3z54f ,g- , -- fwffliw , 4' , .. V V -Q, him V 1, A 55554 it Y ...- 4 VAL' -1. .. .pf ' , 21. 1 i , .:. 1'5 : Vi '-fi 'K aS?2!1e T3f52' ' 25591119 .Zz Jff-fra' ages QM 1 'VHZ-Qafvwaw . Q SM Q ? 5-21 , 1 'Z -W' f' l4LV s ?a:!'U xf -X 'gimme Q .Vg 1 - 1 V .,'y,n-wi ,,gVVfsQ Q 1 ww 0. 'ini . .V is V , . ' ef--V's . .4f1fZ?i.2' i.w'R5 ' I Z- U iw 41, X w A H ' vi! My 1 J MMM V, 721514 Q. , , - .-P 2 1 V 257511-ff ffZ7Z:.'1f, QWZW ' - I ' f W WPQQQU ' - ' . - -M . M5 wif ' ' fgif g: W' . .V 4 Ediror-in-Chief - Ari Ediror - - Business Manager Ediroriai Adviser Ari Adviser - - Business Adviser - - - - Jane Juei - Gorham Carlson - - - Richard Vifeiqel - Mr. Russell D. Brackeii Miss Marion Trowbridge - Mr. Leonard Fieenor TW Mei ' ' - 15 5.- -'4'-5-:Ia 1 xg , 1 g ,a 4' A 1 4 , Kkvbfi 'gg-gf, ax 5 A 6 Q X, O r 9 M: L 'Y X y , ' A 1 '57' 'P '3:3 f'5'7'7'P'ff'W-M Ja1-K.5-E'G'ii'.f'l'ff.5':v1'J'2g401- 4 . . , ,. ,. . . . . 3 4.,, H v :ze-s-:az :e:-.-ar-:yr-my :aV:-:-:H-:-x:f-Q:as49W:-:-:-::f-:azf-we .5-,f,:,-3.-,-.+:..fm- N: -.Qce-we-mfr:-gxif:-af.ew:+:.-:-:-f.4:f-we 'f : .f ..,,x..,,.l.,.,. .-4.4-, 3.5.1, . 3: 4 .ci -,----, W ' V ASH RN WERE , V V r N 1 4 , f 5 2 , ' 3 , f f K Q fi' , 4 r ' f 3 W a 4 1, , . 5 M 4 1 4' 15 W XJ x , -f J ,, - ,- .-,f .,.:.4n.:,.- ' 5 f 1 :4 . '4 Z-IE5Ifkf a+'- , v f Q 'WU v w I 5: 14 3 we ' ' ' J Q' s 1 5 ' 'N I ,f if ' qc f , 5 f 1 , Q I 5 4 4 ' s I , r ' 1 L , ,A ,, s , X ,ix f fm Q we I , , -wal PROUD F W -..,..,..m.,..W W,..N,..,,...m -A.,..n- ..,. ,,., m..,.y. A W....-. W... . N A 4,512 r' W MQ , -N..- ...,,-.. V.- .. ,.-V-.,s,, ,- -.,w......-.. 1- v Y V v V I F WWQWJI f7e'eff?if8?P'fe,' W UW 6, My . ' 7fL3f ' fu W WWW!! H0 Wewwjw if THE SEHIUH ULHSS HF HJHSHBUHH HIGH SCHUUL Minneapolis, Minnesota Presents Volume XI of the Nineteen Hundred Thirty Eight , -Aw -.-,,.......i We f 'gm M W W--Lf A ww- ,,,,.a . s, ,, ,WW W V i v i r I i E i i, i DEDICATION Miss Eva Jasperson- An inspiring teacher, a sympa- thetic adviser, a steadfast friend. A brilliant lite of accomplish- ment. ln memory of whom we dedicate the 1938 Wahian. SCN Q J 3 J 2 4 1 1 ,v 1 I 1 1 4 4 .i I W : Q A I gr'-'H-'- -r a W-Fm----v W- --W ww- -W M- v W-. .. V- .., --, , . l l 4 5 l 5 i S 1 l l i i I l i Q . l i . E E i FOIQE onn E' Washburn welre proud ol you i l Proud to sing, Rah! Rahl Rahl I Sing to our school so dear, lVlalce these lour walls ring. i E As 'we go onward, upward striving To bring you strength anew, uphold you. l t Youre worth your weight in gold, l The Grange and the Blue. I l l l 4. i v 1 3 wa QI: T E T S FACULTY - - IIWe,re proud oIYou SENIORS - - - 'Unward-Upward I-IOIVIERGCDIVIS - - - StrivingI ORGANIZATIONS - Strength Anewll ATHLETICS ---- UpI1oId You SCHOQI. I.II:If - Hgrange ancI tI'we I3IueH OUR SCHOOL 2 .. Y .. A,,,....,,...,...+,A,.-,...., ,AW .,,... ,. ,,,,,-,, ,, ..-,,.4....... , A, A, . i 3 1 in Q S fi 3 , Q 4 ,EN 4 ii 1 1 gi, el l fi gx if -pn----ww-'V Y T-.-W--P--wf1p !Qlf--vw--4wP 'pw-N--W V-W-I - JIU!--W W, --A V S f- -+ wvmll- W Q- 1+ ----sf-fw - - 4-1.- J ,,,T U S 3 vi 55 X fr x im. M-...w,..,MW,M.M.,1.V..W, Fmv. .... MW. ,,,,.-,, U, .W . W..--,. Y ..,. v Ei E E E. E K , F 5 e F 5 L I E 2 5 Q 5 v Q r S Q EQ, 5 WSHYQ- Xxx .bk W v,,.,.,.,,.,.,.-......,,.-7 , ,..,,,Yv , .,..-....,,.- - fvwrm-f V- f-M --X s . 'Wag ,ln vw wk f 5 af , f PM r W , , 0 Q, 5 K I E f ., . , x ---lfgifaygrg , lj Q .4 nf 2 5 i , f , r,,,.,.,,,,,,,,,.,,....,,.,,..,,,.,..,,-,,.-v.,,,,.4,,,,,.,,W..,,..,.,.,,,.W.,v,,,,-,.,v,,..,,,v- ..,,., ,...,.,,-,,.w,,,, -.w,., .W -,,, ,,.,,,,. .,,,,, , , . ,, F i r L l r . K I E r E r . i r E I , r Y. 11 i I P F M fifi fwiygifgifiifu WMQM WW WWW untill ,,-W .,.,, ,. ,WY ,.. . ,,., ,,-,,,.,,,,.,..,H,,.E,,,'W-v,,,, www- --qw-1, -ww 'H vw--' 4 -r'sn-my-,K5,,,,-n.,-W .,,,,, .W rf-. 1 7 r 3' 1,- Bb' s .pe-.-:e Q. ,-..,.3,4.m V z.-+'f.Msp:-1--:-:-1n:-x.- fu - -, -A:--. 93- Wag.. . A 4:3 -'V' '-s-.-fem, vp- .4 .gsggv A 3-:fckfr :-I-limb:-:-:lx-mah:-RE.-iii-523ZE?E .f! .4 HF .. 13, .-Q wwf ',.:-z-:.m:-M ,f.:-1K:Z-1-:-M.-.f:e-:.:.,mf.H.51-:-,::m:+n.:-x-2zsx.ff-.rwmpffzmf- .f .. 9-Sag? . , 1 f -' .. 2 J . W - ' 1 ' Q 1 ' v X. 1 , 2 ' iff , ' r ' ' w ' m ASHBURN WE-RE PR ' P - or You ,1.. T7 If . Af-N T A . A.D.xEVlALki1iJfLRRIE PRINCIPAL OF WASHBURN HIGH SCHOOL DMI I TR TIO ThroughouT his school liTe a sTudenT Taces many problems, decisions, and diTTiculTies. To assisT in solving These problems, To OT- Ter advice in such decisions, and To render assisTance in Those diTTiculTies, Washburn mainTains iTs office sTaTT. Miss Mabel Chris- Tensen guides The girls in individual adjusT- menTs and in selecTing a vocaTion or a higher educaTional cenTer. The boys con- sulT Mr. J. C. Wells for aid in selecTing Their programs and help in currenT quesTions. As The adviser Tor The I2A's, Mr. Wells supervises senior acTiviTies. Mr. L. A. Fleen- or, our assisTanT principal, is in charge of all Tinancial aTTairs of The school. All busi- ness managers come in To Mr. Fleenor Tor insTrucTion in keeping Their accounTs cor- recTly. Our principal, Mr. A. E. MacQuar- rie, has Tinal iudgmenT in all school maT- Ters. He is The acTive head of our school organizaTion. To These advisers The sTudenT can Turn for guidance and undersTanding. Mr. John Wells, Miss Mabel Chrisfensen, Mr. Leonard l 8 Fleenor Miss Helen Lund, Miss Evelyn Johnson. Miss June Borreson Miss Josephine Finnegan, Miss Janef Neel O CD T11 F CID lSeafedl Mrs. Clara Basford, Miss Kalhleen Dowling, Mr. Russell Brackelf. iSlandinql Miss Hilda Blessin. Mrs. - ' M Lilian Gray, Mrs. Viola Hanley, Mr. Lewis Claeson. 9 ii N G Ll'1lllgl lSc-safecll Miss Alice Suber, Miss Margaref Josfen, Miss Ellwel Monlgomery. lSTandingl Miss Kathryn Smifh, Miss Violef Knulson, Mrs. Agnes Mulligan, Mrs. Rulh Nellwercclf. lfxbsenll Miss Ora McLaughlin. 1 TURAL SCIENCE Efffw Y J lSea+edl Mr. John Wells, Miss Zelma Golds- worfhy, Mr. Alvin Roder. lS+andingl Mr. Dudley Parsons, Mr. Edward Slcibness, Mr. Mervin Dillner, Miss Bessie Lowry, Mr. Erling Reque. lAbsen1l Mr. F. T. Janes. GW' XS gl eq ev! H XYNYSXOO vNX55 qbg GX . wf' we lSea'redl Mrs. Le-ofa Goodson. Mr, George Froqen, Miss Hazel Perry, Mr. Fred Curfis. lS+andingl Mr, George Halverson, Miss Elizabelli Klein, Mr. George Hoard. Mr. Roy Lindsledl, Miss Dorolluy Peferson, Mr. Lloyd Alwin. ilu...-5 SOCIAL SCIENCE ATHEM TICS iSea1'edi Miss Rufh' Olson, Mr. Harvey Jacks son, Mr. Alberf Halley. lS+andinqi Mr. Reber? Morris, Miss Sadie Kea+ley, Mr. Curfis Marfin. f5ea+edl Miss Anna Smarf, Miss Margaref Tupper. lS'randingl Miss Evelyn Denison. Miss Bonevieve Farsie. Miss Chrisfina Gear, Miss Margaref Holliday. ffxbsenfi Mrs. Blanche Savage. NGUAGES ECONOMICS HOME 22 OMMER CIALI ISea+e-dl Miss Dorofhy Nash, M1 Dorofhy Sfevenson. ISfandingi Mi Ediih Thompson. Mrs. Karine Ylvisak M r Arfhur Su nde. iw' U n ' Eiiiimisiii Miss Helen Granf, Miss Myra Goode M Haroid Henley, Mr Phil p L ARTS AL I TR S DU i I N LIBR RIANS RT W AND ffaeafedi Mr. George Super. fsiandingi Miss Marion Trowbridge. Mr. Emil Beck- sfrom, Mr. Harry Ranks. Miss Margaret Brown, Miss Wilma Mossberg 1 , ' , 1' V V i dffafifwiiy .- in . J fp f i +- is Ai L54 - V F - 1 ' ' Af ' , 1 ' V A 'f ,-- ' f . 1' .fl-1 T' :.w, w,X.f p A A f W I- H 'J-g.S ,, q4, g1 kv: v M 21' - , A ,, ,.- , , , - J'f 7'Ml . Q - ' -, ' ' :M g ,, 4.1, M, w p f - Tgzyfim-sign, - 'wh .w.,, M Q , M W 7 J A ,: Sf? in f ' 'Q' ' if-v id' Wiwgifiiiixi iifvifilz iv x L'-' J w ,mf.ff:- -'W f wz w f.f.m 'f , Q , .x v 2 53: f w wk 1 fu C341-V' 'Q 1 aw, w ,- 5 L h ,f ' ,.WffQT5'5 ,35, V . .w5,f,1f'i5 p i klmff s, gy f af W A - . A - ' .,,. . i ., ,. aw: -A V H may A af- . -. -W ' V 7 ' ff 'wffj- H-R :fP735'?Z .9 M- -' wx nw f ff' my Wig-'1f.: ' mx-w,' e .a Y f 'ws' f 1 1: Vu-v .f- ,xv --A W wg Mfg, v., , - 1 4 -J' ww fr 4!-,iiugfw 53, 3 ,, W ,L,, my j .3 . 5 -g ' ,, gs' Yg4a -ig. iv : , ' M ,fc .QA ggfmggv fx ,V , -.. w:'a ' ,ix tqf,g3,4N' W , t f gw-555 - K L WQ . .. Wg-x ' .I . ,M A, J 2 , 112 9. A' f kv., f i 1 ':W ' ' K u -Q M 1 fl? . V - . '- X' v A - W x w f' 'fi ' f' 'Q t Q,-1. . ' f f m H ' W w w - ,S ' 4 1 1 i K . ' . QM? f 2 . ' :Es'f-Vy rvaf --P .ziwfzw .w R., . My . J wg f + .A .Q , , W , H J fx X135 A f ,p xg QP 2. ' Q M, 'mga ws- ,- L 4. 'qaf vxwf f ' .-' pg 'T' 'j' V A 'T,,, -qfqw e 4 M sifwvif AM ff Q' wlw-aff , 1, wQ:iQ.5ff ,,V H .. .-- ,, 23f'w , :isfs',Y., Q ,gLh ix A f.,g Kfigv'4g,a:v--V'-YaHv?955,4f V- 15? Q' msw:ffge.fiw ,. gh my , M 4' -:sm , w ',,.- yy f - 'Q L M L V ,, ,V 5-Lf-ff--W' P. ff Y , 3 24,4 X M.,-, M - , I T 'X ,- n g, ,F gf , L- . A' A 1 M N, Q '- -K X A K ' ' '1im+i3'wf'4EaQM 4 -my k i A ., , ' .- . - f .J ry . A. - b gawwwm V wggaff' gu gh u gg-Q ww y pls' V -f Wwyngvf 51,55 - -VV-'- f Y? V gy , - -- 5 gn-g3Q2f,.,..!,. ge , ,L A-, ff, w.Q,,m.-E's- 'af'..ffw.A ,, ww 3 34 - , M. .1 w,,.4- ,l'3'i's-.Q ' cf - ww: ,sw ,E ,fi2,,, M q,,,,,-- .4 4 1 ,.y , , -w w . u f - if 55135 . .1 ...., 91 4, - ,. 1 gag f -V -. f W v , 'Mew-H6 wiszwwafwff af' :www Sym 1 Qwfwjii 'W'i4MAf'4w1v'W5 '5f'-ff ?2-'Mf1a'ff?WW1 +Hi'w',ma4mf,ff-f+ws ' .iWg,f3gfa,m 'wwf if A ,, .mf J af: sf rl -' -4, ., .,,.. , -. l'?'45f1.6 '31 1f '?f' ,, ., , , . . , K , , , , . . . , , ,, , . , 1 1 ., 1 .Jr C ew , U., , .kia MY? ,f i's.. M9 - - ,,.. ...,..v.v.-Y.-x.w'w,.f, .- I 1 , A M- 1 ... ,, V in M v5'44w2.f.f.g.gm +wL, .wpzzaq-..,w Sv-range, f:afs1,f,'.wf.v, W . 1 V .,m.,,, ' 1 v- P M , 'H QWM V .wr qw--,rg-aarfw,.:'1,: mi -, 1, ,, +A W4 , . uw- , ..w ,,L.f.1 X. ., 14 ,Eff MJ 'L-, . S -. wt.. , -Q: h ,,, A fv f- M, 54 ,Ig-'54-gy4','gg.,gw ns,-.1 LQ W:-if ., 'lf'-.L 3 1'-,' . -Q4 1 plli viiw. , 1 , ml .-323 ,g.,1 + 1-va a,4:'V JL' ' -' Nga .1Ia.'L 1 ,.,. ..,:, ' 1 1- 1. yum'-ivy 5 'sw 1 1 4. ,Ja-,g n-1 'xfr-rig. f'1 : , :ra Aw X hs ,'cg2y,e,gw.f :jx f 31-MQIEM ' f Q . 0 ' ?bii2i'lrBf7 U W' .. , ,, Q ,N Q Ig, 5 M' W , ,, i Q W . ,Y K A ,law , Q U. , 2' Q , , H 1,4 my e mmrv if fz2f2 z.. wr-f'-2 '1'?:.'.q 1 :fi nf? 'm2 ':f. .2. ' .: gif H. ,,,, ., , 'ww X9 f em LEW-11 mibfw ' V ' Vie w Gila ,A H YL ffuW 4 Y naman' 'Exam wel H A 4x41! vf'f-wf,71,'A 4 W 'M' ' ci! .f e :f4g:w!3?5g?:S-wwf if - ' wana' 0 A Muay fwzwfsmx, . ,Q I 6:21 3 535' 5 ,' 'B' . , auf Q ,H , if 1 .4., ..:,gsg Q . fs 'A -M34 I h. F w e .xv -A-:df M.: -4 ,. ., 1 wg' ,.. '. W 1- , ,Erylff h mggjfswmia W f Yw ,gwswfzi Amfrvmfww amffiav 2,3 Q vw My ak 'Fwd' g Q ,Q 5, ngifw 535 1 M' . 'W '7 5 ,a.f l ' 'f1,? 4'e' vP '.'f ' ' 43515- ? x WH' .. ' U M , eLfAw?? .' A 41 4 vm ,H-f w e wx. 'J fi 1 1: Xa .1 P ,, . , ' ' 1 Y 74 N J 0' 4 D' . y jpxma ww-mwmfmwqf ww ww w E 2' L 3 H41 , X, -1 ' , H ' . Q, .. , . .. A 6, x .. , f . . .. . . V ,Q -,fzQ.,'?i':'. '- IEWa'L'fJ,11,n'-'iz,f'w-22-14HF-11,1 .ffl-we W wr' wqQgw 'Gg5fM1iwf--hu -M' ' A :25i15?ESLi57 F1?5's'5 ,aw ,A .W t 1 . . . ,, .. .. , , ,. . A., . ,- , , .fg,f+G.-...i.v.Qf L mlm ,V .M Gi 1 ,J-i1'fi5U 5c mm.w1wfg,w.v52ga-.4-'gffl-glwwr wk mp-19wm.umsfmg,,.A.f ,iv I ,, , ...jg ,, ,,., ., L 4, ,, ' 'Xfz?i'fa'a,wQ'P'5iv'.i,'f'v,f'1'-31 :wave 13.-wwmgg my r ff 3 's miwhdlr '- s, azmg-nqu,3,.15n,1Q1,A,g gwqgg'-1..w.r mf -M - ' - ' '-wa . -. nw awe-M 5--,1, .4 1-vm f.-fa., 4, ., , , .,.. A :,a Qxf1, ,F f .A-. QW' ii -aim, , 'za H Tw' '1' 'U nz- 4,.:. ,4' wuz' -LCV.:.'1.mx-f..g-.,, w 1'-. aw, vivf,-1:v :,.ff., 5,2-:f,'f1j-1,,,-, ,ggi 54,z-ral,fwj'g5gq'1gz?'y, 1- ' ,,-.. . ,,., , 1 :ga W , H 5 Y 5253? , , ' f X M -My 4 ., mg. . . , In Q wiv W Eb , f:., we +9 4 fx b, W 1 www s J me Ms1W5', ww www' vw W' 'fl P ' f W 2 WW 4 ,-is mmf M' Me- 4w,wx.g5v wg L ,Q 5: yr f fl'Nl' xg ff my an 1 Q sn K MM., M ' men , f - V 9 ' . - w M .,X., , 'N - ff 'W V' ' r y 'F ' ,-wi lf 5' 3 x ii fv1v:114TQ,1?aQ'fze4Q,g'iv,Qgxv' mmfwm y-,,g,.1ff41,gQ , af 'H ' W , , ' 'G Ku 1-Hr nf . 'f f r 1 it ' J vw' f y , , ,.,,. fwfwwma V ,, j g . f - L M' ' 'f9Yfi'5'4?W14'fEe'3E 'W GWYWWEW' q Q' -l r ' '4 GH J' ' Lf, in ' TAL- fag A ff. 3.2 ' V X If 1,3 wa, w' .flgf z 2' - 9 mg - , M5.,? '. ' ff wa 2 YW' ,raw . f , fi-b giggiimamuy , .L '- , i 2 ..., wif : . -V A1 Q, 1 QM . . ,, ,vm Wy' . , ,W , ya , s im , ,mmm ., ., A l. ,.,,,r, my gimm ,. X. 1 WS: , x ,, W W' 'G I if QW QM A 5 QA Y QW, . 5?k ?5i if Jw? Nga gf? N 3 ' W S' E, f ffm , 3 . 1 ,L-, - - '- vw-Hia, --M Y. --51 ,5 , t - 'L 'f ---Q p -NZ k -. H V 75- '1' -w ka. W ' 1 5+ av m e W , V1 -, W QM l- 4 b 5f11'f5?1. -fi rm N A A J- f' f- A - -' - .r I. A 1 f - ' ' f 1 4? , 'M . , 1 nw wh 'w 3 ' ,2 xL':a ' A . 2 0 lg, M Aaw gu 1 v' ,, A wr sv g , vw , by , mrmggr Q ' Www, su dw aa: 1 x ,. N Y in ,fgfggggh amy, vw + 5, ' ,ggi xwag-giwsgyywxrgh gg 1 q fy M U P , Q. mi' . fiigsgf 'swf A 54 Q-+aqf,g,Qfff?fL mm 5:36 ' ww w e faa iiii , wigffim w A 2312 356 H ww 'WL I EQ' M gm ,A , mfwems, . f N sw 5 , ggmw gy 1 +1 LM:-:.--wW.,,. F M Q A , gm .. . .Ji . V- A - ,. . . if Mg A N -- V' ., ,. ai A -K A ,. . mmm? ,, 4 , . 4 W -. , V ' V -. 2 ' ,. PQ J..-,,.wff,,,:,-'ff ,- ,-. xv ,aw Q ia- Q . p K - s. HUA . y 5. ...M , X. . 55333 tw, V K. ,KE 4, -X Y Y?-W 'f '31, 52'-5' 4 . . Q Wim H5 Wm f ' - W9 i Z L Wk? W is me 1 Z, is X A ,, , , f 0 zv 1 4 r x 1 V, , F w gymgfggfigvmw-wfyvg iygw mw,g,g,f 9 x fwwm awww ,,.,ng,,,,? My 4 J ww, , i,,,,gg,, my ,551 ' - ' : P- L ' 14 , , X WW Q WA ? X 'WWSEV' wr ww ka?15,mZigfiwiw,efw 2 Www: yiggffiiif . ww mz4W?,Q-Mmm wiv? M W: in Egg F551 1fv:.,LM,g +mJrw.1.4if 'M f9.w'wa'w1 -M. man., wg gg, if-vg.,M+kW,f , ,eiffgqg no 14'-wwf? afwwww w ,Ls-Mu WWW 11:23,-gt , 4 Q. L ?-gi M y 14 ,f1L,i?i?W:'.,Qgw. vigb. 4 2' . ey-4.7 4,-AQ., f .?W-'gi 1 , n I ,V Qfl.:'4::3'i 1? A , V - A' 'H L ,V 1 gF3,52f3ii5f'Lw1w- . f fi:fQ:'pw4fe,Qbz1P4 lffM4fgE?fg2m2w45e+1.f 1' 1: x4z?,ssfQgf 3agQgg,,sg?5s Q Wu ug, 5 wiv Q www A-:Wm 'f ,. f21'V'laf,s,gi'W44Q-'vftlw-331 f, ,wr ww 36 fww. 1 M Mm 1 Q J fe Q W A .ff v . Wm, A 1.s:f1ie1'Fyiwx-,,,Ew:'f' s3:vimiwg 1'r1fw'1a:,gbe43im2s1m-ewfy,mijgggwfgxgmgfmgwffwgifigqigigssiygffqgveqvggfvgga-ew -'.am33-gf W WE bln. gugfmg 4 ' ' FMR? wif We nm- fx -- 'M Nigga as E, , A , , 9 if 1 Aw Q can Hx, KI.M..5,... ,Q .rw .Xi Q Q as as H Eg t 1- , s , 4 ,z , 1 ' ' - , f W5 W 'A ' 26 efiy if v f g , , we 5 3 2. g Q V ' , 1 ..p 1 .1 A g B k V A' f- X, 1 .VVV 'V f , :Qgg,Q:,Wlff-2' W , . 1 W ,,,V r F ms ' L w I .wiiifgw -is :ww w vf -- V i f Q Wk Q M , W K -P31 few., X 2 -Qs Q C- M mx, -if fb M ' ' LW 3 ga g , any , ZJ V ' W? V ,J -- .V -.-: ,Q W Q 2 5 53 T , -, ,Q Qi f n 16,71 V - .t g . v. f n - J -rglvdbfa . 11,95 A , M M, .,.,,.1. ,., 1 .ffm ' . VVV. . .,, , .. . ,- -1 V . .. M.. ,,,f-www f fv s zwywvag. M ' ' v 'Wa K 'J wb Wm A 5 W ' xv as 'y ' A Qi Y 1 d 5 M , , W , f Q ,.,, , X W N Q X 'ima i Y J w. j Q :B f xv W1 Wig V e , 2 W K dim Ain M, Kam WWWJ E . mggz Q gf '4' .M 4 Q im gi it wfEQwQ2www2 wi Q- WWQVLW wawwf www Q 322 A av . x wwmw W ,, sw, M Q, fgwmiafm kiwi' w e Hi? W' W V 3, W vwigw W1 we Y M2 Qfglmywmlww WWE? W m ww iw firifqgjfawagffw W 'W 'Q weigh 'R , is iii Q 4 Mil? J Mmw wwmm Kimi A 1 if,,w?'f,?fngjL ,pk img VKQQW 5q2s , m wiff AKW?abV?,f,42gf5 mf yank wmffrKif'afAigeik4,g2'1'I?'i,vmAf,y Q15 ,grail-rfwm MWJ-459 ,. ' W 1 'if 'Ii.'1f - QP ,VV, 1 0, 1 '15- f : ' -, - J 7 11 51,5 '7if' M V if 'K '5' ,lffkcf f- vm V .fn V 1f.,,Mfa. iff 'ffhf f X Q, M -, iw M Q2 wi? ., fjfwfp-fa M A , ' f, , A my M K, y N W1 1 Hgh W, , A Q ' .A 5 p i ' ' ' ' . , X, . b .5 MEX '12 - H f f ix ,ggi X, ' x4?3l?, i 51 A ,ifffi 'Q I - ff, ff - is-,f if 4 bg' 42.-,grim ,fi ggqfw wwf? 4 ff. 92825-sa m NP W ff W- Q 251355-www 1J '9js'? qw? if W , I M-Wai: 1 , wish J Y ' - V 2 ' A X 5' 'h an A 'kwsfzi ' 51? EXKJWV 'wiirkwgwfm ' g 'A J X '!1f4W'WxW5'W::f 'VPRYWEQY 1'Q'ffW9 mv' 'WNV 34 .52 Mm an ,fm fi 'Y' 49 A wi 'R gfffiavcgji ff 5. :Q ,g Q 7 M ear wwawvivgafgi' 2:21 www ax Q:1Eif, a+bEfrggZP 55-'gg 5,22 ,Q gg ww M Q if - ffwwkmqsifiw-ff 4133 ,f5f5?-W figwgwffffga QW! W SW img. Q - 1 iw f A Q ,ff M23 , W ffm gf? -ff. ' , W ' W 13 iw 'gf ak , J X' 5? b A A , ww f fa, we , Mzfwggwwgkgz 4 , 3- , H W ffigflgmw ' A fm? V- f Q' fb, -1 , 41: ww' 5325511 4 I f WWW fm 9 ,wwf mM,,g,g'5g-4 1 ge XM 'Sm Sem f SM :F Q ' 4 1 , Q -X'1 Q J 1 X ig i X N 1 , . W ' ' 5 ' 'Q in HK ' ' 1 C af f ,f - M W Yu GMM 2 P1 5 as kim 5 K A fmwwff + ,f.Q+m.,L, gif? '35 il ww Cf f -'- 4. A V ' , Q .t M , ' v i ,L Y ,f'j .M PA - - 5' QQ 5:5 m,51f'vw27w 2 B5 1-BN v -ff ami? wfgmqfg Q A fm? ii, fmnwew, f wr' g. K H e f Q52 ' 'lj Lim QP' 1 A f A' 9' - Q1 JY: ' ,f 7,0 f A35 lf ' 15, 22, 1 W- , w w, f ., -- ,, f . . ,F A 5. ,WA ,W , Jw, 15gQ ig3g5KWi'u9' fs ww 491 . , win ' ik g hwwxm ia V, wi 'b 2 1 www A A-ps:-ww? ww 4 kggrff wi W, Q we , Xi I N Q if L V ef W Q Z 4' ' ' Q L 3 'E I as h til 1 -, r 'fa M W 795, gre 4' iw ' f Z ' 5 Q 12? ,. ., -VVV + 'Mg' gf Q QQ 'EXLWKQ N ?EHQ?W53Q B?w!Q9faW WB- WL awww 55 ?i M ' W 4' l im 5912 M , 1 A, ., 'V v 1 J ,J ' 9? . , 4 I W ,,, Q V f ' A x ' H . , , ,A 'WNQV--gg 1 gp? W EwW Jikevzw A K- f,?'SExvwM mw5a1wwQ 232355 EMM wg? 3Qf:,.gQ.'ijq,? - KVM w24gai L Q.-4' 4 75?9vw7'19fSw3,, Qi! fgs Zig! if M5544 qi. W W3 ifwlr 9 WWF ?wxi5 Aa W'Miw QQQQZJQQW E'Q+ff'xf'V'5?1i A Q Q Qfwgfiif-E155 f '3 HS If ' Qm., , . rm , , ff., M ,fn . ,X 1 .f . di., Fw . W ,. . W , 4 fm Q ,, ,EWMQH - .9 . ,- Y S V , 1 - y ' wwf- N ,Q vw-ff . -fr-f'f + x ' aww Ms-w r .e .. 'W' A sr u ' K' -I '- T . V - ' b. f . Aw . ,m .. Xa., , --ww ,, 'PJ -' -1 ' H- ' .f.-- w v.- A f. A .. M, .,-x, ,,, . ,. K ' 'xvxmxmdgfgbwr vff i A Ev TSN 5 L Wmvfhf KSQKG' 419163 A5352 MQW nazi QM t ag: wx fggprgras Q .5145 V A M Q, K Mis K 3 -gems 65,-3'1iVfJ A57 My I, , 1-X QiQiwF W1wiiWwi5A!Fqg N' ,, 'QSM 182' Mx in 55? 5,Rr??1'QE?w?9f R5m 44 21 Y '1VNsH?,Qf igiii-'gixaff W Jgg'V39 S'i3m. 7' 1, 4 X954 1, 1 Q L if L 1 J ? W A M a 'Q' N M ' X g, iv wxf-'ffm ' fm gQwQ NQ M1 N ' lg 6, giyimj' 'AEE . XM' Qt ffl gfk fffff MV K. ' gf QW 3 wwww . -.- 1 4 ,mf , ,.,,.. . E535 . --423 1 A Wk . 2 ,f-, 41 V, , . .YU , . :Q . f t A-nh fQHA , - ., 'fxk '1 fA'- M w h' f '- f Q' , - '- f A,, Q iC7 ,zj,iA xr X j E n gl H .M 3 -..A M M, ,T Jig' m i -.1, 1 -gf.: IXAKVJ 1 :gg-yi' -5 -ai.fi,in,34fA fl W I Jig xmfr mffj , ,wg .Q M wa J www? mia.-Mqggwwgwafmvg wwiqgffw ii QW . 4. N , , .A W . ,N ' 4 s A .ff Af gf ' fff+A.'1,, f,:91:. ' X M A- ?' Qi .1 f'Q?515 fiflft ., v '. -il iff ff fzi- 7. X 4 , if, ? V -M33 ,M wwf V .x I AK , A in my V t .lm I geagwfguiyr twggh QHEN. :I gigzblf? HONOR ROLL Barbara Beach Donald Bohn William Braasch Helen Danelz Arfhur Dienharf Roy Downfon Roslyn Engler Roberf Eusris Fremonf Flefcher Harrier? Friend Roberf Gaus Berry Hansen Helen Hari' Adeline Johnson Priscilla Jusfer Margarer Newdall-Vice-Presiclenl, Fremonf Flerclner-Treasurer, Alene Sforkson- Secrelra ry, Bill Du nsworrln-Presidenr. CLASS HONORS Paul Meelwl-Salulalrorian, Mary Janer Noyes- Salulalorian, Arr Dienlnarr-Valediclorian, Mary Painrer-Salurarorian, Roberr Tlwompson-Salulev Torian, Marian Kruse-Valedicforian. HONOR ROLL Joyce Kerr Marian Kruse Peggy Malcolm Mary McLean Paul Meelwl Jeanne M. Mulligan Mary Jane? Noyes Mary Painfer Gerald Prenfice Cornelia Rockwell Lillian Sallrin Lois Snyder Babbeffe Springer Alene Sforkson Jean Taylor Roberf Thompson . -..sn .. . 9 MARlON ASPER: Blesr wiih common sense and good reas- onfi Girl Reserves: U.C.Club: lEnrered from Roosevell High Schooll: Vocalrional Guidance Commiiiee. 9 MARY LYNN AUSTlN: A well-lilred girl wherever she goes. G. A. A.: Girl Reserves: U. C. Club: Quill Club: Spanish Club: Vo- carional Guidance Cornmiriee. 0 BARBARA BEACH: She's quite some peach, ihis Barry Beach, Girl Reserves: G. A. A.: U. C. Club: Girls' W Club' French Club-Presideni 37: Grisi Slaii: National Hon- or Socieiy: Class Play Come rnencemenr Program Cornmil- iee--Chairmari, 9 DOROTHY BEARMAN: Denies are her iavorile iruiff' G. A. A.: Girl Reserves: U. C. Club: Girls' W Club: French Club: Grisi Sfaili Class Day Commiiiee. 9 PATTY BERG: Pars rhe queen oi ihe linlcsf Girl Re. serves: G. A, A. Board: Girls' Club: U. C. Club: Li- brary Board: Memorial Com- mirree. 9 CHESTER BERG- MAN: A happy lad and so carefree: never worries thai we can see. Foerball: Decor- aricns Comrnirfee. 0 LOUlS BLAiR: l doubl ihe wisdom ol being rec wise. French Club: Class Play: Class Play Ticlrei Cornmiiiee. 9 DONALD BOHNf Jusi ihe man lor a friend. Narional Honor Sociery: Wahian Carn- rnifiee. 0 AUDREY ABRAMS: Life is shori, and so am l. G. A. A.: Girl Reserves: Girls' Club: U. C. Club: Grisr Siaii: Spanish Club: Girls' Dre'ss Commifiee. 9 HOWARD ANDERSON: You've goiia be a iooiball hero. Fooiball: Class Play Program Commirree. 9 JOYCE ANDERSON: She loves bur one-ai' a lime. G. A. A.: Decoraiions Comrniifee-Chairman. 9 RALPH ANDERSON: Shyness is an asseif' Triangles Hi-Y: Swimming: Traclr: Science Club: Pholography Club: Class Movie Commiiiee. 9 BILL APPLETON: Women are such an impedimenf 'io progress. Harlequin: Class Play: Class Day Program Cornmiiiee. 0 BOB ARNOLD: l-lc-clrey's his game, and he's our-io win. Boys' W Club: Tennis-Capiain '37: Hoclcey-Capiain '3B: Boys' Dress Comrniiiee. 9 LAWRENCE BORSHEIM: His ready smile a warmih expressed. Decoraiions Cornmiriee. 9 WlLLlAM BRAASCH: Lillie pun, you've had a busy day. Ger- man Club: Glee Club: Naiional Honor Socieiyt Pho- fography Club-Presideni '37: Triangles Hi-Y: Blossom Time': Sweeihearis : Movie Commirree-Chairman. 9 BOB BRADDOCK: The siuli from which Braddock was made. made Washburn! Boys' VV Club: Fooiball: Swimming: Class Movie Comrniriee. 9 BETTY BRAM: Her smile is as a ray oi sunshine. G. A. A.: Girls' W Club: Girl Reserves: U. C. Club: Commercial Club: Girls' Dress Cornmiiiee. 9 CATHER- INE BROWN: A lady oi color. Girl Reserves: U. C. Club: Girls' W Club: G. A. A.: Records Commiiiee. 9 ROSEMARY BURNS: There's Rosemary. +har's lor remembrance. G. A. A.: U. C. Club: Commercial Club? Decoraiions Commiiiee. 9 ROBERT CAIN: When Bob's around you don'+ need 'ro raise Cain! Boys' W Club: Golf: Decorafions Commiflee. 9 MARION CAMPBELL: Sweet clemure, and prolly! G. A. A.: Apprenlice: Glee Club: SweeIhearI's : Commercial Club: Class Play: Class Day Program Commillee. 9 THELMA CARLIN: Sweel' and Lovely. G. A. A.: Spanish Club: Class Play Properfies Commillee. 9 IRWIN CARLSON: AbIy acl'iveI Glee Club: Swee+hear+s : Sfudenl' Council '37: Boys' Dress Commilfee. 9 HERMIA CLARK: I fhink people have more fun Ihan anybody. G. A. A.: Girls' W Club: Girl Reserves: U. C. Club: Commercial Club: Records Commillee-Chairman. 9 VINCENT CONOVER: Greer hopes make greal men. Slage Crew: Memorial Commilfee. 9 EARL CONRAD: He looks shy, buf oh my! Baskelball: Foolball: Track: Boys' W Club: Boys' Dress Commilfee. 9 BETTY COVNICK: A bundle of good cheer. G. A. A.: Girls' W Club: Girl Reserves: U. C. Club: Refreshmenl' Commiffee. 9 MARY E. CRAWFORD: Laugh? I 'lhoughl I'd dieI G. A. A.: Girl Reserves: U. C. Club: Glee Club: SweeIhear'rs : Decoralions Com- miH'ee. 9 RILEY CURRY: Did Your Molher Come From Ireland? Chess Club: Glee Club: SweeI'hearI's : Wahian Commilree. 9 HELEN DANELZ: Like words, well mafched, poefic To The ear, her charm and grace were known bolh far and near. Apprenlice: Choir: ahonal Honor Soclefy. Quill, Commencemenf Program Commillee. 9 VIRGINIA DAUGAARD: She Iouched a piano and nalions heard, enhanced. G. A. A.: Girl Reserves: U. C. Club: Choir: Orcheslra: Class Day Commilfee. 9 ESTHER DAVIES: Sweer disposi- lion, sweel voice, and red hair! G. A. A.: Girl Reserves: U. C. Club: Glee Club: SweeI'hear'Is : Blossom Time : Class Day Commiifee. 9 PHIL DES MARAIS: Here's hoping you like you.r capIionI Grisf Ediforial Board: Poliiix: Chess Club: Class Play: Wahian Cornmiffee -Chairman: Senior Exlra Commiffee. 9 ARTHUR DIENHART: Ar1 s always a 5A aI rracIion. Nalional Honor Sociefy: Valediclorian: Credil' Bureau. 9 SAM DITTENHOEF- FER: He goes sleadily on his way. Class Movie Comrnilree. 9 JOANNE DORR' Her face is her Iorrune and if runs info a n'ce . , u figure. G. A. A-.: Girl Reserves: U. C. Club: Glee Club: SweeI'hearl's : Class Play: Spanish Club-Vice Presidenl' '37: Girls' Dress Com- .H 0 mi ee. ROY DOWNTON: How's fhe wearher up There? Glee Club: Narional Honor Sociery: Sramp Club-Vice Presidenl: Creclil' Bureau. 9 BILL DUNSWORTH: Qualifies of leadership in him are born. Boys' W Club: Foorball: Track: S. T. O. Hi-Y-Vice Presi- dem' '37: IZA Class Presidenl: Class Play Ticker Commirfee. 9 BEATRICE EASTHAGEN: Her eyes as siars of Iwilighl' Iair: like Iwilighr. loo. her dusky hair. G. A. A.: Girl Reserves: U. C. Club: Class Play Properfies Commiflee. 9 DOROTHY EMERICK: YehucIi Menuhin? PoofI Orchesfra: Class Movie Commillee. 9 HARRIET EMERSON: I always smile: iI's easier on my dimples. U. C. Club: Decoralions Comrnirlee. 9 ROSLYN ENGLER: I didn I raise my laugh Io be a giggle. G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: French Club: Grisl' Sralf: Harlequin: Narional Honor Sociefy: Class Play: Senior Exfra Commillee. 9 BOB EUSTIS: I musf go down Io 'rhe Beach again! Nafional Honor Sociefy: Awards Commifree-Chairman. 9 DONALD EYRE: His voice will be his forIune. Glee Club: SweeIhear'rs : BIossom Tirne ' Sl'uden+ Prlnce : Delail Commiffee, 9 WALLACE FISH: He'll manage Io manage Class Movie Commillee IEnIered from Hoover Hilh School, . . g Glendale, CaIifornia.I 9 JIM FISHER: He does no? sfudy 'ro excess, buf yer we wish him greal success Chess Club: Science Club: Baccalaureafe Comrnilree. 9 BOB FJELLMAN: Mama, I wanna make rhyIhm! Band: Orchesfra: Social CommiI ree.- 9 FREMONT FLETCHER: An honesT man is The noblesT work oT all. NaTional Honor SocieTy: A. P. O. Hi-Y-PresidenT '37: All Hi-Y PresidenT: l2A Class Treasurer: Swimming: Track: Spanish Club: CrediT Bureau-Chairman. 9 ARTHUR FORMANEK: TeeTh like pearls and eyes so Tair: girls iusl' rave abouT his hair. Class Program CommiTTee. 9 PHYLLTS FOSDTCK: You can Tell her by The noise she doesn'T make. G. A. A. Girls' W Club: Girl Reserves: Commercial Club: Records CommiTTee. 9 ROBERT FOSDICK: Friendly is his middle name. Golf: DecoraTions CommiTTee. 9 DICK FRANZEL: ModesTy is The besT policy! Science Club: House CommiTTee. 9 HARRlET FRIEND: V!lashburn's Girl Friday. GrisT STaTT-Second Page EdiTor: German Club: PoliTix: Girl Reserves: U. C. Club: Quill Club: PhoTography Club: NaTional Honor SocieTy: G. A. A.: Class Play PrompTer: CrediT Bureau. , 9 PEGGY GARDNER: Mr. Gardner's TairesT Tlower. Girls' W Club: CiTy Wide Wearer: G. A. A. Board: Girl Reserves, U. C. Club: Class Play TickeT CommiTTee. 9 BOB GAUS: His devious ways are lined wiTh puns and plays. ApprenTice: French Club: Glee Club: SweeThearTs : STudenT Prince : Class Play: Quill Club: GrisT STaTT: NaTional Honor Socie-Ty: Wa- hian STaTT: Class Day OrganizaTion-Chairman. 9 HELEN GEORGAS: When speaking oT Georgas, fellows usually orniT The 'elf' G. A. A.: CiTy Wide Wearer: Girls' W Club: U. C. Club: Class Day Program CommiTTee. 9 JOHN GLASS: He is every inch a man, buT more a man Than inches. SergeanT-aT-Arms-CommiTTee. 9 JACK GLOVER: l don'T know whaT There is abouT me ThaT makes me so popular-unless iT's my modesTy. Glee Club: SweeThearTs : Blossom Time : Boys' 'WH Club: FooTball: Track: Boys' Dress CommiTTee. 9 MAGDELENE GRONSETH: She shall have music. Band: OrchesTra: Baccalaure- aTe CommiTTee. 9 LOTS HAGUE: Precious Things come in small packages-and is she precious! CiTy Wide Wearer: G. A. A.: Girls' W Club: Girl Reserves: U. C. Club: CommencemenT DecoraTions CommiTTee. 9 MARY JANE HALL: WiT all The day long. Girl Reserves: U. C. Club: Commercial Club: CommencemenT DecoraTions CommiTTee. 9 DOROTHY HALLONOUIST: Kewpie, Kewpie, This l know-all you need is sTaTT and bow. G. A. A.: U. C. Club: Commercial Club: Social DecoraTions CommiTTee. 9 BETTY HANNAN: IT isn'T whaT we know ThaT counTs, iT's whaT They Think we know. Girl Reserves: U. C. Club: CornmencemenT Program CommiTTee. 9 BETTY HANSEN: Oh, sweeTer Than The honeywell. G. A. A.: Girl Reserves: U. C. Club: Commercial Club: GrisT STaTT: NaTional Honor SocieTy: Records CommiTTee. 9 WILLTAM HARRIGAN: IT There's anyThing l love more Than a Two hour nap, iT's Two of Them. VocaTional Guidance CommiTTee. 9 HELEN HART: l-iere's a 'HarT' Tilled wiTh music. CiTy Wide Wearer: Girls' W Club: I G. A. A.: Girl Reserves: U. C. Club: WaparThian Club: French Club: GrisT STaTT: Library Board: NaTional Honor SocieTy: Commencemem' Program CommiTTee. 9 JANE HAUGUM: Why were blushes ever invenTed? G. A. A.: Girls' W Club: U. C. Club: German Club: Glee Club: SweeThearTs : Class Play: Wahian CommiTTee. 9 CHARLAND HAWKINS: Here comes Hawkins To baT! In baseball he knows where he's aT! BaskeTball: Boys' W Club: Baseball. Mem- orial CommiTTee. 9 GERALD HEACOX: A dancer, romancer, he's quiTe a man, sir! Commercial Club: Class Play: Memorial CommiTTee. 9 MIRON HEINSELMAN: Washburn's rowdy! Bird Club: Science Club: CrediT Bureau. 9 JANN HERMANN: Jann always geTs Hermann. U. C. I N I T f Club: Class Play PubliciTy CommiTTee: lEnTered Trorn Beverly Hills High School. Beverly Hills, CaliTornia.l - 9 MARTHA HILL: l've known many. liked few, loved one-maybe fwof' G. A. A.: Girl Reserves: U. C. Club: French Club: Social Enferfainmenl Commiffee. 0 BRUCE HOCKING: l'm an arlisl, buf alas, lhere is nolhinq l can do abou! ii. Pholoq- raphy Club: Commencemenl Decoralions Commiflee. lEnlered from Denlield High School, Dululh, Minnesola.l 0 JEAN HOGAN: There wasn'l, There isn r, There won'+ be a grander girl lhan Jean! G. A. A.: Girls' W Club: U. C. Club: French Club: Library Board: Commencemenl Program Comrnilfee. 9 DON HOHLER: May his parh Through life be lined wilh success. Baseball: Alhlelic Board: Boys' W Club: Awards Comrnilree. 0 RUTH HOLMBERG: l'm bubbling over! Cily Wide Wearer: G. A. A.: Girls' W Club: U. C. Club: Chess Club: Commercial Club: Gris? Slall: House Commiffee- Co-Chairman. 9 HELEN HORTSCH: A magnel aflracls wilhoul a sound, and so does she when she's around. G. A. A.: Vo- caiional Guidance Commillee. 0 ROBERT HUEBSCHER: He really qefs around. Summer School Graduale. 0 CHARLES JACOBSEN: As fine a friend as can be had. Awards Commilfee. 9 WALTER JACOBSEN: 'Somelimes classes were so boring l could hardly keep asleep! Chess Club: Serqeanl-ar-Arms Commi+'ree.' 0 ADELINE JOHNSON: A prelly girl is like a melody. G. A. A.: Girl Reserves: U. C. Club: Apprenfice: Glee Club: Swee'rhearfs : Commercial Club: Nalional Honor Sociefy: Class Play Properlies Com- mi1ree.o BETTY LOU JOHNSON: Silence is more eloquenf lhan words. G. A. A.: Girls' W Club: U. C. Club: Records Commillee. 0 CARLETON JOHNSON: He robbed Washburn ol all ils knowledge. Foolball: Track: Sergeanl-al-Arms Com- millee. 0 CHARLES JOHNSON: Chief Heap Big Smile! Foolballi Swimming: Track: Serqeanl-al-Arms Commillee. o MARIAN JOHNSON: For a sfenoqrapher, l'm iusl lhe lypef' G. A. A.: Girls' Club: U. C. Club: Commercial Club: Decoralions Commiflee. 9 PRlSClLLA JUSTER: Shes The core ol lhe Biq Apple. Girls' 'W Club? Cily Wide Wearer: G. A. A. Board: Girl Reserves: U. C. Club: Grisl Slarl: Harlequin: Library Board-Treasurer: Nalional Honor Sociely: Class Play: Se- nior Exfra Commilfee. 9 MARY JAYNE KAVANAUGH: Modern lo The minu're, G, A. A.: Girl Reserves: U. C. Club: Class Day Orqanizalion. 0 JOYCE KERR: Her lace should adorn 'rhe billboards. G. A. A. Board: Girls' Club: Girl Reserves: U. C. Club: Commercial Club-Presiden! '37: French Club: Glee Club: Blossom Time : Gris? Slall: Nalional Honor Sociely: Class Play: Baccalaureafe Commillee-Chairman. 9 NESABETH KlLLMER: A merry hear! makelh a cheerful counrenancef' G. A. A.: Girls' Club: Girl Reserves: U. C. Club: Grisl Sfalliz Class Play Publicily Commillee. 9 BETTE KING: Kinq's some queen. G. A. A.: Girl Reserves: U. C. Club: German Club: Girl Reserves: U. C. Club: Chroma Club: Glee Club: Blossom Time : Sweelhearls : Class Play Properlies Commilfee. 9 MARION KDCMOELLER: 'lm happy aboul The whole Thing. G. A. A.: Girls' Club: Girl Reserves: U. C. Club: French Club: Grisl Sfalil: Class Day Program Commillee. 9 KENNETH KOLLEN: Wha+ would science do wilhouf him? Chess Club: Delail Commilfee. 0 MARIAN KRUSE: Marian qels lilly-one queslions correcl on a lilly quesfion fest G. A. A.: Girls' Club: Chess Club: German Club: Ouill Club-Presi- clenl '37: Nafional Honor Sociely: Valediclorian: Class Play: Social Commiffee-Chairman. 0 AUDREY LARSON: Hlnlelligence is i+s own reward. G. A. A.: U. C. Club: Commercial Club: Office Assislanl: Decoralions Commilfee. Class Play: Vocalional Guidance Cornmif+ee. 9 KATHRYN KINGBAY: And super dainly Kale. I l 9 MAXINE LUREN: Skilled in The genllewoman's arf: hers is a good and gracious heart Vocalional Guidance Commiflee. 9 BOB LYKKEN: His siudy cares are ended. Class Play Ticlcel Commiflee. lEn- lered from Cenlral High School.l 9 FRANCIS LYNCH: A boy rhafs sure lo win. Gym Team: Vocaiional Guidance Commillee. 0 BETTY JANE MacALOON: The Washburn Belle. G. A. A.: Girl Reserves: U. C. Club: Class Play: Class Day Organizalion Commillee. 9 JOHN MacDONALD: He fried lo mix elec- lrons and prolons or some such rhing, and +hey flew back afom. Science Club-Presidenl lll: Awards Commiliee. 9 BETTY MacMlCHAEL: God loolc some reason sane, a smile, and called ii- Belfy Jane. Ciry Wide Wearer: G. A. A. Board: Girl Reserves: Girls' W Club: U. C. Club: Class Play Prompler: Class Play Sales Commiilee. 9 ED MAHLMAN: Did someone menlion Astaire? Class Play: Traclc: Senior Exira Commillee. 9 PEG- GY MALCOLM: No idea is worlh much unless a firsf class mind is baclc ol if. Ciiy Wide Wearer: G. A. A.: Girls' W Club: Girl Reserves: U. C. Club: French Club: Gris? Slafl: Nalional Honor So- ciely: Class Play Properlies. Commillee. 9 BETTY LOU MAYNARD: Her humor, lilce a yawn, is so inlieciiousf' Girl Reserves: U. C. Club.: Library Board-Vice Presidenl lll: Class Play Pub- licily Comrnillee. 9 GEORGE McCLlNTOCK: The polilical siluarion in lhe world loday. . . l Thank you. French Club: Sparlcs Hi-Y: Sramp Club: Class Play: Vocaiional Guidance Comrniiiee. 9 DONALD MclNNlS: Never do 'romorrow whal you can do nexl week. Memorial Commillee. 3 WESLEY McLAlN: No one bul' himself can be his parallel. Boys' W Club: Traclc: Social Commil- +ee. 0 BILL LEBElS: impari'ial as a lralific light Glee Club: Sweel'hear+s : House Commif- lee-Co-Chairman. 9 HELEN LeBLOND: Which should l be: Paderewslci or Gerfrude Slain? Girls' W Club: Cify Wide Wearer: G. A. A.: Girl Re- serves: U. C. Club: Wapar- ihian: French Club: Grisf Slalif: Library Board: Quill Club: Sec- reiary lll: Wahian Slaff: Class Play Properfies Commiflee- Chairman. 9 BARBARA LEE: Wi'rh a brush in her hand. she fell' quife af ease, and would painl lusi' as nice and as quiclc as you pleasel 'Ci+y Wide Wearer: G. A. A.: Girl Re- serves: Girls' W Club: U. C. Club: French Club: Wahian Sfafl: Girls' Dress-CommiHee- Chairman. 9 HELAINE LOEWENSTEIN: Always in rhe lead wilh a song. G. A. A.: Girl Reserves: U. C. Club: Commercial Club: French Club: Grisl' Sfaff: Rec- ords Commilfee. 0 LLOYD LUCKMAN: My music malces +he world go round. Band: Or- cheslra-Presideni: Class Day Organizalion Commiifee. 0 BERYL LUNDBERG: Silenl' and sure, she resfs secure. G. A. A.: Commercial Club: German Club: Commencemenl l-louse Commiflee. 9 MARY MCLEAN: A lead' er's poise has made fhis name emblazoned in our hall of fame. G. A, A-: Girl Reserves: U. C. Club-Presidenl lll: French Club: Harlequin-Secrelary lll: Library Board-Treasurer lil: Nalional Honor Sociefy: Class Play: Memorial Commiflee- Chairman. 0 PAUL MEEHL: A mind wifh unlimifed possibili- lies. Chess Club: Nalional Hon- or Sociely: Salulaforian: Com- mencemenl' House Commillee. 9 ART MEYERS: Why lake life seriously? We can never gel our alive. Apprenfice: Glee Club: Blossom Time : Sweel'- hearfs : Class Play: Class Day Program Commilfee. 9 GEORGE MlCHALSON: Worry has killed many a man. Why die? Boys' W Club: Foolball: A. P. O. Hi-Y: Ten- nis: Boys' Dress Commiflee. 9 JOHN MICHELSON: Wash- burn slarfed him on The righl' +rack. Boys' W Club: Fool- ball: Track: Boys' Dress Com- millee. 0 JEANNE MARIE MULLIGAN: Charm is lhe very essence of personalily. G. A. A.: Girl Reserves: U. C. Club: Grisf Slaff: Library Board: Na- lional Honor Sociely: Ouill Club: Class Play: Records Commillee. S 9 HELEN NASLUND: Shh! She's even breafhing uproariouslyl G. A. A.: Girl Reserves: U, C. Club: Girls' Dress Commil l'ee. 9 MARJORIE NELSON: To worryabouf Tomorrow is lo be unhappy l'oday. G. A. A.: Girl Reserves: U. C. Club: French Club: Refreshmenls Commilfee. 0 MARGARET NEWDALL: ls lhere anyone who doesn'+ know her? ls lhere anyone who doesn'+ like her?'.' G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: French Club: Girl Reserves-Presidenl '37: IZA Class Vice,Presidenf: Class Play: General Commencemenl-Chairman. 0 MARY JANET NOYES: A successful presenf. a promising fulure. G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: Grisl' Sl'aFF-News Edilor: Apprenfice Club: Glee Club: Swee+hear+s : French Club: Narional Honor Sociely: Polifix: Class Play: Salulaforian: Class Day Organizalion Commilree. BETTY NYLANDER: Nor one good qualify does she lack. G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: French Club: Class Play: Class Day Organizalion Commillee. 9 DON M. OLSEN: The liH'le man wirh lhe big voice. Band: Orches- ira: Foolball: Track: Delail Commiflee-Chairman. 0 ELMER OLSON: Five days ol: English lileralure makes one weak. Awards Commiflee. 0 ELAINE OLSON: Gaining friends wifh kindness. G. A. A.: U. C. Club: Chroma Club: Decoralions Commilfee. 0 BOB ORVlS: All The school's a slage, and all fhe funny sludenls merely slayers! Apprenfice: Golf: Track: Class Day: Commencemenl Program Com- miHee. 0 CLAYTON PAGE. The world knows Iiflle of ifs greafesl men. Chess Club: Science Club: Chroma Club: Decoralions Commilfee. 9 MARY PAINTER: This girl is known for scor- ing A's as well as for her kindly ways. Girl Re- serves: Ciry Wide Wearer: G. A. A. Board: Girls' W Club: U. C. Club: French Club-Secrelary l2A: Grisf Sfafl: Narional Honor Sociefy: Credil' Bureau: Wahian Cornmillee: Salufalorian. 9 JOHN PAR- SONS: Washburn's Clark Gablel Polilix-Treasurer lll: Triangles Hi-Y: Class Play: Boys' Dress Com- miffee. 9 BURTON PAULSON: ll was fun while il lasled. Wreslling: Boys' Dress Commiliee. 9 ETHEL PELLING: Worry and I have never mel. G. A. A.: Girls' W Club: Girl Reserves: German Club: Girls' Dress Commillee. 9 EARL PETERSON: Al'lhough he likes alhlelics besl, he fills his school days full ol zest Fool'- ball, Track: Delail Commiflee. 9 MARY LOU PIERCE: Typical ol Washburn al ils best G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: Grisl Slalll: Girls' Dress Commillee. 9 GERALD PRENTICE: His name is everywhere revered. Sludenl' Council: A. P. O. Hi-Y: All Hi-Y Secreiary: Glee Club-Presideni: Sweelhearl's : Harle- quin-Presidenl: Class Play: Class Day Program Commillee. 9 JOHN REIGSTAD: Silence is oil lhe gold slandarcl wilrh Johnny. Glee Club: Sweel'hearls : Class Play: Baccalaureale Commillee. 9 MARY ELLEN RILEY: Nebraska's plains are wailing 'lo be wrilfen abou'll U. C. Club: Commercial Club: Ouill Club: Re- freshmeni Commillee. lEnlered from Ceniral High School.l 9 MARY JANE RING: Modesly is woman's qrealesl asset G. A. A.: Girl Reserves: U. C. Club: Grisl Slahc: Enlerlainmenl Commirlee. 9 JOHN RITCHIE: I have my momenls. Decor- afions Commiliee. 9 STEVE ROBINSON: There's nol' a doubl' lhal Sleve's 'rhe squaresl guy about House Commillee. 9 VALERA ROBIN- SON: She seems nol dull of wif. G. A. A.: Girl Reserves: U. C. Club: German Club: Social Commiliee. 9 CORNELIA ROCKWELL: Websler couldn r lhink ol any nice new words. so we shan'l 'fry lo describe Connie. Cily Wide Wearer: G. A. A. Board: Girl Reserves: Girls' W Club: U. C. Club- Secrelary IZA: French Club: Nalional Honor Sociely: Gris? Slail-Business Manager '37: Senior Exfra Commil'ree-Chair- man. 9 JAMES ROSE: The Reverend Collins-in lhe flesh. Apprenlice Club: Boys' W Club: Gym Team: Track: Cldss Play: Class Play Sales Commillee. 9 JUNE ROSE: Can I help il if I only see lhe funny side of life? G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: French Club: Grisl Slafl: Class Play Properiies Commillee, 9 ROGER ROSELL: Work lascinales me. I can sil and look al il for hours. Ap- prenlice Club: Class Play: Decoralions Commilfee. 9 LILLIAN SALKIN: With loo much 'quickness' ever lo be laughff' G. A. A.: Girl Reserves: U. C. Club: Apprenlice: French Club: Grisl' Slafl: Harlequin: Nalional Honor Sociely: Polilix: Class Play: Senior Exlra Commillee. 9 HENRY SCHMIDT: Who conquers me shall find a slubborn foe. Science Club: Slamp Club: Memorial Commirlee. 9 JUANITA SCORE: She's so greal. lhey named a song afler herl Cily Wide Wearer: G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: Commercial Club: Social Commiliee. 9 ART Sl-IEA: Ari for Arl's sake. Social Commillee. 9 JUNE SMULL: To know her is 'ro be her friend. G. A. A.: Girl Reserves: U. C. Club: Relreshmenl Commillee. 9 LOIS SNYDER: We all know why we love her, on lhis we all agree. We somehow have lhe feeling il's iusl because she's she. G. A. A.: Girl Reserves: U. C. Club: Girls' Club: French Club: Library Board: Na- lional Honor Sociely: Quill Club: Gris? Slall--Edilor-in-Chief: Class Play: Senior Exlra Commillee. 9 SUZANNE SORLEIN: Wilh my wil as my forlune-boy, am I rich. G. A. A.: Girl Reserves: U. C. Club: Spanish Club: Girls' Dress Commillee. 0 DANIEL SPENCER: He plays The game and plays il' well. Foolball: Hockey: Triangles Hi-Y--Treasurer '37: Commence- menl House Commillee. 9 BABBETTE SPRINGER: She has rhe will fo do, The power of doing, and beffer Than all, she does. G. A. A.: Girls' W Club: U. C. Club: Waparfhian: French Club: Gris? Slafl: Nafional Honor Sociely: Class Play Properliex Commiflee. lEnIered from Soufhwesi High School. Kansas Cily, Missouri.l 0 BETTY STANLEY: Dashing-daring-doing. G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: French Club: Class Play: Class Day Organizalion Commiffee. 0 CHARLES STEVENS: Thirly-eighl' model-guaranleed noise- lessl Sparks Hi-Y: Pholography Club: Senior Movie Commif- fee. 0 ALENE STORKSON: In her quielucle fhere is charm. G. A. A.: Girls' W Club: U. C. Club: Nalional Honor So- ciefy: Spanish Club: IZA Class Secrefary: Class Day Program Commiliee. 9 ROY STRAITON: An aihlefe of olympic heighI'. Baskelball: Foolball: Boys' W Club: Sergeanl'-af-Arms Com- miflee. 9 ELIZABETH TAYLOR: A lrue exponenl of fhe ar+isfic. G. A. A.: Girls' W Club: U. C. Club: Chroma Club: Wa- hian Slafl: Baccalaureale Commilfee. -0 JEAN TAYLOR: A quiel Tongue shows a wise head. Girl Reserves: Girls' W Club: U. C. Club: Nalional Honor Sociely: Relreshmenl' Com- milfee-Chairman. 9 JACK TELFER: A cheery word. a friend- ly grin. Glee Club, Wreslling: Sweeihearls : Commencemenl House Commilfee. 9 ROBERT THOMPSON: Philosophy begins when one learns lo doubt Band: Nalional Honor Sociely: Phofography Club: Salula- lorian. 9 GORDON THOREN: Will someone make up my mind? Social Delail Commillee. 9 EILEEN Tl-IORNSJO: I'm here for an educa+ionl G. A. A.: Commercial Club: Awards Commillee. 9 ORLAND THORNSJO: l'm on lhe brink of a greal career -somebody push me oil. Glee Club: Swee+hearl's : Slamp Club: Decoralions Commilfee. 9 GERALD THURSTON: He is known for ioyous manners. Decoralions Commilfee. 9 RUTH TOWNSEND: Sincerily is a viral power. Cily Wide Wearer: G. A. A. Board: Girl Reserves: Girls' W Club: U. C. Club: Commercial Club-Treasurer: Gris? Sfaff: Commencemenf House Commirfee. 9 MARIETTE TRAVIS: The smile lhal won'+ come oil. G. A. A.: Girl Reserves: U. C. Club: Social Commiflee. 9 BUD TROOP: Life some ioys for you does hold. Derail Commillee. 9 SHIRLEY WEAVER: A smile goes a long. long way. Girl Reserves: U, C. Club: G. A. A.: French Club: Library Board: Social Commifree. 9 BETH WEEDING: Slwe'g so individual, she hasn'l' even gol a carbon copy. G. A. A.: Girl Reserves: U. C. Club: Social Commirlee. 9 JEAN WEIL: Who said brains in girls are rare? G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: French Club: Grisl Slali: Senior Exlra Cpmmiliee. 9 BETTY WEISEL: True she is. and she has proved il. Cily Wide Wearer: G. A. A. Board: Girl Reserves: Girls' W Club: U. C. Club: Grisl Sfafl: Credil Bureau. 9 EMMA WILLEFORD: A friend in need is a friend indeed! G. A. A.: Girl Reserves: U. C. Club: Comrnencemenl' Program Commillee. 9 WARREN WILSON: There isn'+ anyone he wouIdn'f help. Commencemenr House Commirfee. JANUARY CLASS RLAY PRIDE AND RREJLIDICE In The class pIays Pride and Prejudice, pride, pre- judice, and The eTTorTs oT Mrs. BenneTT To obTain husbands Tor her daughTers, Jane, Lydia, and Eliza- beTh precipiTaTe noT only The marriage of Jane To an eligible bachelor, Mr. Bingley, buT bring abouT The eIopmenT oT Lydia and 'The reconciliaTion OT Mr. Darcy and EIizabeTh aTTer misundersTandings. CAST OF PRIDE AND PREJUDICEH January Class Play EIizabeTh BenneTT ----- Mary McLean Jane BenneTT - - - - Marion Campbell . Lydia BenneTT - - - Roslyn Engler I Mrs, Benneff - - Priscilla JusTer I Miss Bingley - - Marion Kruse I Lady CaTherine Mary JaneT Noyes , Mr, Darcy - - - John Parsons Mr. Bingley - Mr. BenneTT - - Mr. Collins 34 Gerald PrenTice - Bill AppIeTon John Reigsfad I ArT Meyers ' I James Rose IT Takes Four Years Takes place aT Wardell Col- lege, a Typical middle-wesTern universiTy, during The spring guarTer. Included in eighT scenes are skeTches OT college life Taken from views oT The quadrangle, sororiTy Tea, bedroom of a sororiTy, boys' dormiTory, oTTice of The school newspaper, and locker room. IT Takes Four Years was an original producTion. CAST OF IT TAKES FOUR YEARS June Class Play Diana MiTcheII ------ Marge Beacom Madge Greer - - - - - Filis Yager Susie Sheldon - - Barbara Bowlby Peggy Blake - - BeTTy Ann Brang Marilyn - - - Suzanne Morris Carole - - - Timmy Sabor Dennis Tisdale - Jack BeaTTie Chuck Tisdale - Dick Brisfol Gerald Thorpe - - Bud BarneTT David STanTieId - V - Ralph I-lays Wallace Flanagan ----- Doug Lindsay Douglas I-Iaynes ----- Dean ProudTooT IT TAKES FCDUR YEARS Jumii CLASS PLAY BeHy La Blanl'--Vice-President Ken Block-Treasurer, Doug Cravens- HONORROLL Evelyn Ahlgren, Joe Afkins, Ken- nefh Block, Jack Beaifie, Phyllis Boofon, Berry Boyer, Spafford Cavanor, Harrison Cochran, Mariorie Collins, Helen Copley, Charloffe Cox, Barbara Crisp, Mary Deeds, Bob Drake, Mary Drake, Rufh Eisele, Bob Ervin, Lawrence Erickson, Berfram Fein- berg, Jane Foulke, John Glas- rud, Georgene Hansenj Ray Hegna, Bernice Hendrickson. Helen Henley. Kenneih Isaacs Elaine lsackson, Beffy Jenkins. Kennefh O. Johnson, Mary Eliz- abefh Johnson. President Elizabefh Schrufh-Secrefa ry. CLIASS PIOTJCDRS Berry Boyer-Valedicforian, Parricia Smifh Salufaforian, Jane Juel-Salu+a+orian. HONORROLL Jane Juel, Louise Keafley, Mary Jane King, Kennefh Kinney, Bef- +y Kruegger, Charles Kunz, Berry LaBlan1', June Leslie, Douglas Lindsay, Vicforia Malkerson, Thomas Maffeson, Janet Mc- Carf, Kafhleen McDonald, George McGeary, Suzanne Mor- ris, Marion Norfhfelf, Helen Paulson, Malcolm Pfunder, Scoff Richmond, Elaine Rofh. Murray Salkin. Roberi' Shaw,Rober'r Slei- ien. Pafricia Smifh, Wiley Seu- ba, Laird Waldo. Beffy Wash, Richard Weigel, David Wheafon, Mildred Wright Filis Yager. 0 VERNON ANDERSON: A frue exponenf of fhe scienfific arfs. German Club: Science Club: Junior Academy of Sci- ence: Awards Commiffee. o ROBERT ANDRE: A person- alify twice his size. Awards Commiffee. 9 CATHERINE ANDREWS: Her nickname is 'Bunny': her blonde hair is sunny. G. A. A.: U. C. Club: French Club: Social Decorafions Commiffee. o EUGENE ANDREWS: A worfhwhile, unaffecfed friend. German Club: Sfamp Club: Phofography Club: Class Movie Commiffee. 9 EVELYN ARMSTRONG: Pafienf The while and fran- quil and confenf. G. A. A.: U. C. Club: Class Day Or- ganizafion Commiffee. 0 JOE ATKINS: A hearf fo resolve, a head fo confrive. and fhe hand fo execufe. Apprenfice Club: Glee Club: Sweef- hearfs : Grisf Sfaff--Third Page Edifor: Nafional Honor Sociefy: Polifix: Boys' W Club: Sparlzs Hi-Y: Vice Presi- denf-I2B: Presidenf-IZA: Swim- ming Manager: Wahian Sfaff -Associafe Edifor. 9 LLOYD BACHMAN: His feef barely fouched fhe cin- ders of fhe hack. Orchesfra: Boys' W Club: Traclc: Boys' Dress Commiffee. 9 ANNE BACON: We love her for her smile. her loolc, her way of speaking genfly. Afhlefic Champs: G. A. A.: Girl Re- serves: Spanish Club: Credif Bureau. o GLORIA ABBOTT: l was born fo giggle, and giggle l musf. Afhlefic Champs: G. A. A.: Girls' W Club: Class Day Organizalion Commiffee. 9 EVELYN AHL- GREN: A brillianf, diligenf lass, one of fhe smarfesl' in our class. G. A. A.: Girl Reserves: Commercial Club: Nafional Honor Sociefy: Office Board: Commence- menf Decorafions Commiffee. 9 PHYLLIS AITKEN: Speak fhe speech I pray you. Girl Reserves: U. C. Club: Chess Club: Social Enferfainmenf Commiffee. lEn- fered from Easf High School, Des Moines, lowa.l 0 PRISCILLA ALLEN: And wifh fhy bow made sweef music. G. A. A.: German Club: Orchesfra: Phofography Club: Vocafional Guidance Commiffee. 0 CATHERINE ANDERSON: The heighf of fashion. Afhlefic Champs: Cify Wide Wearer: G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: Commercial Club: Glee Club: Sfudenf Prince : Records Commiffee. 9 DALE ANDER- SON: An all around fellow in worl: and play. Memor- ial Commiffee. 0 ELSIE BALL: Coy, cufe, and clever! Afhlefic Champs: G. A. A. Board: Girl Reserves: Girls' W Club: Wa- parfhian: German Club: Wahian Sfaff: Opera Business Sfaff. 0 GEORGE BANG: The world gefs a 'Bang' ouf of him. Class Play Publicify Commiffee. 9 BYRON BARLOW: Modesfy always wears well. Commercial Club: Records Comrniffee. 0 ROBERT BARNETT: He's gof everyfhing down 'Paf.' Glee Club: Sweefhearfs : Sl'udenf Prince : Harlequin: Boys' Club: Foofball: S. T. O. Hi-Y: Baseball: Boys' Dress Commiffee-Chairman. 9 JANET BARR: May nofhing 'Barr' fhe way fo her success. G. A. A.: U. C. Club: German Club: Commencemenf Decorafions Com- miffee. 0 MARJORIE BEACOM: We see in The sfars above, good forfune, wealfh, and love. G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: French Club: Glee Club: Sfudenf Prince : Harlequin: Wa- hian Sfaff: Social Enferfainmenl' Commiffee. 9 JACK BEATTIE: Up Io his ears in aciingf' Choir: German Club: Harlequin--Treasurer-IZB. Presidenlr-IZA: Naiional Honor Sociefy: Sparks Hi-Y: Sfamp Club--Treasurer IZB: Wahian Siaif. 9 JANE BENNETT: Ready fo work. ready Io play, ready fo help whenever she may. G. A. A.: Girl Reserves: U. C. Club: Phofography Club: Social Decorafions Commifiee. 9 FLORENCE BENSON: One diminu- rive senior. G. A. A.: Commercial Club: Social Decorafions CommiHee. 9 MARGARET BENSON: Good nafure precedes all virfues. G. A. A.: Girls' W Club: U. C. Club: Social Decorafions Commiffee. 9 RICHARD BERGERUD: The world's all righ'I' for Dick- he makes if so. Social Decorafions Commiflee. 9 RALPH BERSELL: Here's a boy who's I'alI and blonde: of playing pranks, he's very fond. German Club: Glee Club: Spurs Hi-Y: Social EnI'er'rainmen+ Commi'H'ee. IEnfered from Offumwa High School, Offumwa. Iowa.l 9 LEE BEYNON: A diligenf boy worfh knowing. Band: Glee Club: SI'uden'r Prince : Defail Commilfee. 9 ELAINE BISSONNETTE: And all IhaI s besf of dark and brighf meer in her aspeci and her eyes. U. C. Club: French Club: Social Enferfainmenf Commiffee. 9 BETTY BLANCHARD: She has sferling qualifies! G. A. A.: Girl Reserves: U. C. Club: French Club: Credif Bureau. -9 KENNETH BLOCK: Ken-Ihe genfleman of fhe press. German Club: Grisl Sfaff-Execufive Edifor: Nafional Honor Sociefy: Polifix--Presidenf IZA: Boys' W Club: Baseball Manager: IZA Class Treasurer: Credif Bureau-Chairman. IEnIered from Cenfral High School.l 9 ANN BOHEN: A maiden wifh a merry heart G. A. A.: U. C. Club: Awards Commiifee. 9 MARY BOONE: She musf be descended from Daniel. G. A. A.: U. C. Club: Band: Science Club: Junior Academy of Science: Girl Reserves: Class Play Sales Commiifee. 9 PHYLLIS BOOTON: Skin more fair, more glorious head, and far more glorious hair. Chroma Club: Nafional Honor Sociefy: Quill Club: Science Club: Wahian Sfaff. 9 ROBERT BOWE: Success for him beyond dofh lie. Band: Refreshmenf Commiffee. 9 BILL BOWEN: The main spring of fhe Iumbling Ieam. Boys' W Club: Gym Team: Senior Exlra Commiilee. 9 BARBARA BOWLBY: She has fraversed many wafers, buf she sfopped for 'Brooks'. G. A. A.: U. C. Club: Apprenfice Club: French Club: Glee Club: SweeIhearIs : SiudenI Prince : Grisi Sfaii: Class Play Reading Commilfee. 9 BETTY BOYER: MozarI' and Beeihoven were her predecessors. G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: French Club: Nafional Honor Sociefy: Class Play Publicify Commiffee-Chairman: '38 Valedicforian. 9 HOWARD BRAINERD: I-Ie came Io Ihe school new, bul' his friends are noi few. Vocafional Guidance 'CommiH'ee. IEn+ered from Towson High School, Towson. MaryIand.l 9 JOHN BRANDELL: A squanderer of smiles: a spendfhriff of good cheer. Class Day Organizaiion Commiilee. 9 BETTY ANN BRANG: Full of spiril, color, and unquench- able fire. G. A. A.: Girl Reserves: U. C. Club: Glee Club: SIudenI Prince : Harlequin: Quill Club: Baccalaureafe CommiHee- Chairman. 9 MARSHALL BRATT: We refuse Io pun on his name. Baccalaureafe CommiH'ee. 9 EUGENIA BRAVINDER: She's always ready +o ioin Ihe fun. G. A. A.: Girl Reserves: U. C. Club: Class Play Properiies CommiHee. 9 KATHERINE BRIGGS: She hafh a clever pencil! G. A. A.: U. C. Club: Quill Club: Social Enferfainmenl Commiflee. 9 BURTON BRINK: I-Ie's on Ihe 'Brink' of success. Glee Club: Science Club: Senior Exlra Commiifee. 9 ROBERT BRINK: A confinued blush. Boys' Dress Commiffee. 9 RICHAR-D BRISTOL: Yeah! Rah Rah! ObbiesI Harlequin: Sparks I-li-Y: Class Play Reading Commilfee. 9 ADRIAN BURCH: Twice as much qualify as quan'IiIy. Senior Exira Commilfee. 9 CRAIG BURNS: He will carve his niche wifh Pasfeur and fhe rest Bird Club-President IZA: Chess Club-Vice Presideni' IZA: Science Club-Presidenl' IZA: Junior Academy of Science--Vice Presidenf IZA: Awards Commifree-Chairman. I 9 JAMES CAMPBELL: A quiei man bul quire a man. Cogs Hi-Y: Vocaiional Guidance Commiliee. 9 PATRICIA CAMP- BELL: She was wise, she 'Simon-ized'. G. A. A.: Glee Club: Swee'l'hearls : Sluden+ Prince : Class Play Program Com- mifree. 9 MARY JANE CANTERBURY: To be merry buf becomes her. Alhlelic Champs: G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: Opera Business Slaii: Social Decoralions Commiilee. 9 PHILIP CARDWELL: Ouief bul' resource- ful. Band: Cogs Hi-Y: Pholography Club: Class Play Sales Commilfee. 9 GORHAM CARLSON: 'Ham' bul noi on rye. Chroma Club: French Club: Wahian Srarl-Ari Edilor. 9 ROBERT CARLSON: Meer Mr. Esquire! Grisl' Sfafi: Senior Exlra Commillee. 9 SPAFFORD CAVANOR: Some day I shall 'fry ihe luxury of being on +ime. French Club: Grisi Siafi: Nalional Honor Sociely: Ouill Club: Triangles Hi-Y: Memorial Commiilee. 9 WILLIAM CHASE: 'I-9' is his line in 'Ihis life. Appreniice Club: Commercial Club: I-9 Hi-Y: Boys' Dress Commiliee. 9 HAMILTON CHISHOLM: Baci: 'io fhe hills of old Scollandf' Science Club: Defail Commillee. 9 NANCY CHRISTENSON: A darlc-haired miss full of fun. Aihlelic Champs: G. A. A.: Girl Reserves: Reireshmenl' Commifree, 9 EDITH CHRISTIANSON: Beware of her giggle-il s conlagiousf' G. A. A.: Girl Reserves: U. C. Club: Commercial Club: Office Board: Records Commillee-Co-Chairman. 9 JOHN CLARK: He will always be a manager. Orcheslra: Cogs Hi-Y: Wahian Sialli. lEn+ered from Norlh High School.I 9 ROBERT CLEMENS: His aim is lo have fun. Class Play Sales Commiilee. lEnlered from Nuiley High School. Nurley, New Jersey.l 9 HARRISON COCHRAN: For he's a iolly good fellow. Choir: French Club: Nalional Honor Sociely: Boys' Club: Triangles Hi-Y-Presideni I2A: Foolrball Manager '38: Commencemenl House Commiliee-Co-Chairman. 9 ORRIN COFIELD: Live, laugh, and be merry. Social Enlerlainmenl' Commillee. 9 MARJORIE COLLINS: A cameo of loveliness. G. A. A.: Girl Reserves: U. C. Club: French Club-Treasurer I2B: Glee Club: Sludenf Prince : Grisl S+a'Ff- Third Page Edilor: Naiional Honor Sociely: Polilix-Secrelary IZA: Quill Club-Presidenf I2A--Treasurer l2B: Senior Exfra Commiilee-Chairman. 9 OUENTIN COLLINS: He sloops lo norhing bul fhe door. Class Play Sales Commiilee. 9 gHARLES CONDIT: Ready, willing, and able. Apprenlice Club: Sparks Hi-Y: Baseball Manager '37: Class Play Sales ommiilee. 9 HELEN CONLEY: A peppy lirlle number. G. A. A.: Girl Reserves: U. C. Club: Commence- menl Program Commirlee. 9 ELAINE COOPERMAN: She is generally speaking-generally speaking. G. A. A. Girl Reserves: Girls' W Club: German Club: Grisf Sfaif: Senior Exfra Commiffee. 9 HELEN COPLEY: Thai 'peaches and cream' complexion. G. A. A.: Girl Reserves: U. C. Club: French Club: Library Board: Nalional Honor Sociely: Wahian Siaif-Senior Album Ediror: Creclil Bureau. 9 CLARK COVENTRY: A would-be alom-masherl Chess Club: Junior Academy of Science: Class Movie Commilreez 9 PATRICIA COVERT: A+hlelic fears are quife her meat G. A. A. Board: Girl Reserves: Girls' W Club: U. C. Club: French Club: Oilice Board: . Credil Bureau. 9 FRANCES COWIE: Monday's child is fair of face. G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: Waparihian: Chroma Club-Vice Presidenl IZA: French Club: Wahian Slali. ...4,.....v-V- Yvi-,- --Y - --..- -v---'-- v-----v-f--- - 0 CHARLOTTE COX: She Tinds The ioy in' life. G. A. A.: GirI:Reserves: U. C. Club: French Club: GrisT STaFF-OTTice Manager: NaTional Honor SocieTy: Wahian STaTT-OrganizaTion EdiTor. 9 WILMA CRAIG: BeauTy charms The savage beasT. G. A. A.: CornmencemenT DecoraTion CommiTTee. 9 DOUGLAS CRAVENS: Every inch a king! Glee Club: STudenT Prince : BaskeTball-'CapTain IZA: Boys' W Club: FooTbaIl: I-9 Hi-Y-PresidenT IZB: All Hi-Y Treasurer IZB: All Hi-Y Presidenl' IZA: Baseball: IZA Class PresidenT: STudenT Council: AThleTic Board. 0 BARBARA CRISP: A musician oT high merit NaTionaI Honor SocieTy: OrchesTra: Spanish Club: Class Day OrganizaTion CommiTTee. IEnTered Trom Los Angeles High School. Los Angeles, CaliTornia.l 9 RUSSEL CROFT: Joy, iolliTy, and I are all Triends. PhoTography v- Club-Vice Preside-nT IZA: InTra-mural manager Baseball CROONOUIST: The more we see her, The beTTer we like CommiTTee. lEnTered Trom Bismarck High School, Bismarck, 0 FRED CURLE: Sing high-ho The holly, This life is so iolIy. gold oT a merry hearT. CiTy Wide Wearer: G. A. A.: Class Day OrganizaTion CommiTTee. 0 ROBERT DALTON CommiTTee. 0 GENEVIEVE DAMKROGER: Up, up my G. A. A.: Girl Reserves: U. C. Club: German Club: Comm and Baskefball, '38: Class Movie CommiTTee. 0 JEANNETTE her. G. A. A.: Girl Reserves: U. C. Club: Class Day Program NorTh DakoTa.l Class Day Program CommiTTee. 0 DORIS DAHLEN: CounTless Girl Reserves: Girls' Club: U. C. Club: German Club: I am The masTer oT my TaTe. Band: CommencemenT House Triend and quiT your books. why all This Toil and Trouble? encemenT DecoraTion CommiTTee. lEnTered Trom MankaTo High School, MankaTo. MinnesoTa.l 0 MARY DEEDS: SinceriTy is The greaTesT virTue of all. AThIeTic Champs: G. A. A. Board: Girl Reserves: Girls' W Club: U. C. Club: NaTional Honor Sociely: ReTreshmenT CommiTTee-Chairman. 0 HELEN DE JARLAIS: A mirThTuI maid who defies anyone To keep a sTraighT Tace in her presence. G. A. A.: Commercial Club: GrisT STaT:l: U. C. Club: DeTaiI CommiTTee. 0 WILLIAM DELANEY: Always on The iob. Awards CommiTTee. lEnTered Trom WesT High SchooI.l 0 LOIS de WAARD: A maiden wiThouT preTense. G. A. A.: Girl Reserves: U. C. Club: Social DecoraTions CommiTTee. 9 BOB DRAKE: His aims are as high as The baskeTs he shooTs. Band: Chess Club: NaTionaI Honor SocieTy: Orchesfra: Sparks Hi-Y: BaccalaureaTe CommiTTee. 9 MARY DRAKE: She's wise, she's preTTy, she's in love-whaT a piTyI A+hIeTic Champs: Girl Reserves: Girls' W Club: U. C. Club: ApprenTice Club: German Club-Vice PresidenT IZB. IZA: Grisl STaTT-News EdiTor: NaTionaI Honor SocieTy: Wahian Sfafcl-Class EdiTor: CiTy Wide Wearer. 9 JOHN DUFFY: LighT-hearTed and con'IenT. Awards CommiTTee. 9 JEANNE DUFOURD: Always a rollicking. Tuneloving sporT, A very good-naTured, likeable sorT. G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: Commercial Club: Class Day OrganizaTion CommiTTee. 9 PATRICIA DIJNHAM: A conTagious giggle slips ouT aT The wrong moment G. A. A.: Girl Reserves: U. C. Club: Commercial Club: Social DecoraTions CommiTTee. 9 HAROLD EISELE: Game Tor everyThing. Class Play Sales CommiTTee. 0 RUTH EISELE: A Triendly smile and a cheery word Tor everyone. G. A. A. Board: Girl Reserves: Girls' 'W Club: U. C. Club: Com- mercial Club: NaTional Honor SocieTy: Wahian STaTT: Oflice Board: Commencemenf House ComrniTTee-Co-Chairman. 0 BETTY ELLIOTT: A qeyser of pep and personaIiTy. AThIeTic Champs: G. A. A.: Girls' W Club: Glee Club: STudenT Prince : Spanish Club Secrefary IZA: Wahian STaTT'. 9 BILL ENTZMINGER: Good humor is beTTer 'Than shining armor. A. P. O. Hi-Y: ReTreshmenTs CommiTTee. 9 JACK ERDMAN: Tall, dark, and handsome. ReTreshmenTs C Ilil ommiTTee. 9 LAWRENCE IERICKSON: A kingdomfor my camera. Band: Ger- man Club-Presidenl IZA: Nafional Honor Sociefy: Orcheslrat Pho- Iography Club: Class Movie Commilfee. 9 LEONARD ERICKSON: Be gone all dull care from me, you and I will never agree. Class Day Program Commiffee. 0 MARY LOU ERICKSON: SinceriIy and friendliness slamp her as a rare personali+y. Girl Reserves: G. A. A.: U. C. Club: Commercial Club-Treasurer IZA: Wahian Slafl: Records Commiffee. 9 ROGER ERICKSON: Always sociable, jolly and gay, here melan- choly linds nol' a way. German Club: K. O. D. Hi-Y-Treasurer IZA: Class Play Sales Commiflee. 9 ROBERT ERVIN: There is nofhing Iruly greaf in man buf characl'er. Glee Club: SweeIhear+s : Nalional Honor Sociery: Boys' W Club: Foofball: I-9 Hi-Y-Vice,Presiden+ IZB, Presidenf IZA: Sfudenl Council: Credil' Bureau. 9 ANN MARIE ESI-IPETER: Calm as Ihe summer sea. Girl Reserves: U. C. Club: Commercial Club: Commencemenf Program Commiflee. lEnI'ered from Procfer High School. Procfor. Minnesofa.l 0 ROBERT ETKEN: OuieI' buf good na+ured. Phofography Club? Boys' Dress Commihkee. 9 HAROLD EVARTS: The 'eyes' have il. Orchesfra: Polifix: Boys' W Club: Foofball Manager: Sparks Hi-Y- Vice Presiflenf IZA: Track Manager: Credil Bureau. 9 ROY EVE- LAND: A diver of renown. Boys' Club: Gym Team: Swimming: Social Decoralions Commiflee. 9 HELENEVERETT: The world never discards merit Girl Reserves: Commercial Club: Baccalaureale Commiffee. 9 JEAN FAI'-IEY: Kind- ness is her passport G. A. A.: Girl Reserves: U. C. Club: Social Enferfainmenl' Comrniffee. 0 DORISMAE FALL: Bur she hasn f yell G. A. A, Board: U. C. Club: Credil Bureau. 9 JAMES FARR: Above all a good fellow wifh a world of friends sfanding beside him. S. T. O. Hi-Y-Presidenlg Class Day Program Commiilee. 9 MARJORIE FAY: Joy's parlner in crime. G. A. A.: Girl Reserves: Girls' Club: U. C. Club: Opera Business Sfall: Social Decoralions Commiifee. 0 BERTRAM FEINBERGI A disposifion nol' Io be surpassed. German Club-Presidenf IZB: Gris? Sl'a'Fl- Edifor-In-Chief: Nalional Honor Sociely: Social Enrerlainmenl' Com- miHee: Credif Bureau. 9 LEONARD FELDMAN: A fashion plale ol colors. Boys' Dress Commiffee. 9 MARGARET FELLOWES: Any sporl I really enjoy. people once called me a +omboy. Alhlelic Champs: Cify Wide Wearer: G. A. A. Board: Girls' W Club: Commercial Club: Class Day Organizaiion Commillee. 0 FERN FENGLER: She's nimble and quick wifh Ihe Iypewriier keys, her dainly appearance always will please. G. A. A.: Girl Reserves: U. C. Club: Commercial Club: Credil Bureau. 0 BARBARA FENTON: I Iark, hark l'he IarkI G. A. A.: Glee Club: SIuden+ Prince : Refreshmenfs Commiffee. 9 MARGARET FOLEY: One so beaulilul should go lar. G. A. A.: Girl Reserves: U. C. Club: Gris? Sfaff: Social Enferlainmenf Commillee. 9 JUNE FOSTER: She 'Foslers' no malice for anyone. G. A. A.: U. C. Club: Girls' Dress Commirlee. 0 JANE FOULKE: BeauIy plus, brains equal Jane. G. A. A.-: Girl Reserves: Library Board-Presidenl IZA: Nalional Honor Sociefy: Polifix: Ouill Club-Vice Presidenl IZA: Class Movie Commiffee. 9 JEANETTE FREEMAN: HarkI And Iislen 'ro ihe melody. G. A. A.: U. C. Club: Glee Club: SfudenI Prince : Spanish Club: Class Day Organizafion Commihlee. 0 STEPHEN FREEMAN: A diller, a dollar, a ren o'cIock scholar. Band: Orcheslra: Boys' W Club: Boys' Dress Commillee. 9 ELIZABETH FRENCH: A champion af every spor?. U. C. Club: G. A. A. Board: Girl Reserves-Vice Presiden? IZA: Commencemen? Program Commi??ee--Chairman. 0 JACK FRIEDL: In vain do ?hey worship him. Harlequin: Baseldball: Boys' W Club: Fooiball- Caplain '38: Commencemen? Decoralions Commi??ee. 0 DOROTHY FRIEL: She pages success. Girl Reserves: U. C. Club: French Club: Social En?er?ainmen? Commi??ee. IEn?ered from Coolinga High School, Coolinga, Cali?ornia.l 0 MARGARET FULLER: You should see her on a polo horsel G. A. A.: Band: Class Day Program Commiflee. 0 BARBARA GARLOUGH: A swell combina?ion of worlc and fun. G. A. A.: Girl Reserves: U. C. Club: Gris? S?a'FF: Poli?ix: Class Movie Commi??ee: Choir. 9 RADFORD GARNER: A happy-go-lucky lad! Social Decora?ions Commi??ee. IEn?ered from Wes? High School., 0 BARBARA GEHRIG: Doing and doer. G. A. A.: Girl Reserves: U. C. Club: Commercial Club: Social Decorafions Commi??ee. 9 DOUGLAS GILSTAD: He has ?he heigh? of a baslce?ball cenfer: ?he brains of a classical men?or. Class Movie Commi??ee. 9 JOHN GLASSRUD: In design. in ma?erial, in workmanship-buil? ?o ?he highes? siandards. German Club--Treasurer IZA: Gris? S?af?: Na?ional Honor Socie?y: Credi? Bureau. 0 RICHARD GOETHE: AI?hough he has much wir we know, he seems a?raid his worfh ?o show. Class Play Sales Commi??ee. 0 DONALD GOODSPEED: One very swell fellow! Baslce?baIl: Boys' Club: Foo?ball: Sparlcs Hi-Y: Boys' Dress Commiffee. 9 DANIEL GOSSELIN: A s?raigh?-shoo?er. Band: Boys' Dress Commi??ee. 0 BLANCHE GRADY: She has rhy?hm in her fee? and music in her soul, G. A. A.: U. C. Club: German Club: Gris? Sfaff: Social En?er- ?ainmen? Commi??ee. 0 ROBERT GREATHOUSE: His hear? was pierced by a 'Sabor'. Boys' Club: Basl:e?baIl: Boys' Dress Com- mi??ee. 0 JEAN GRIERSON: Always on hand, when she is needed. G. A. A.: Girl Reserves: U. C. Club: Spanish Club: Commencemen? Program Commi??ee. 0 ROBERT GUNDERSON: A??er fhe game is over. af?er ?he field is clear, s?raigh?en my nose and shoulders, and help me find my ear. Boys' W Club: A. P. O. Hi-Y: Hoclcey: Awards Commi??ee. 0 LEONARD GUSTAFSON: I'le's a boy wi?hou? a care. Awards Com- mi??ee. 9 WILLIAM HABER: A fellow o? infiniie ies?. of mos? excellen? ?ancy Refreshmenl Commi??ee. 0 MARION HAGBURG: The mirror of all cour?esy. De?ail Com- mi??ee. 0 CHARLOTTE HALL: '1Her friends, 'rhey are many, her ?oes. are ?here any? G. A. A.: U. C. Club: Chess Club: Choir: Refreshmen? Commiffee. 9 FLORENCE HALLEN: Nice fo know and see. Girl Reserves: U. C. Club: French Club: De?ail Commi??ee. 0 ALFRED HALVERSON: Spor?ing blood is in my veins. Cogs Pli-Y: Class Play Proper?ies Commi??ee. 0 GRACE HANSEN: Her pain? brush slipped and beau?ifully ?in?ed her hair. G. A. A.: Girl Reserves: U. C. Club: Wapar?hian: Spanish Club: Commencemen? Program Com- mi??ee. 0 GEORGENE HANSON: A musician fha? rales wi?h Ihe best Ci?y Wide Wearer: G. A. A.: Girl Reserves: Girls' Club: U. C, Club: Wapar?hian: Band: French Club: Gris? Sfafi: Na?ional Honor Socie?y: Orches?ra: Science Club-Secre?ary-Treasurer IZBI S?amp Club-Secre?ary IZA: Baccalaurea?e Commi??ee, rms, .,. Y..- . . .Mivfll My MLW ul .WIT :mil W' iw 0 EDNA HARPER: The very essence of sophis'lica+ion. G. A. A.: Girl Re- serves: U. C. Club: Apprenlice Club: Class Day Organizarion Commillee. 0 MARGARET HASLETT: Peg My Hear'r. G. A. A.: Girl Reserves: U. C. Club: Social Enferfainmenl Commiflee. 0 WILLIAM HASLETT: Laugh when we musl, be candid when we can. Sparks Hi-Y: Class Play Sales Com- milfee. 0 WILLIAM HAWKLAND: He malres business a idleasure and pleasure his business. Photography Club: Baccalaureale Commiffee. 9 RALPH HAYS: A guaranfeed ionic for fhe blues. Sparks Hi-Y: Social Enferfainmenf Com- miffee. 0 RAYMOND HEGNA: A+hlelic prowess plus brains is a combinafion hard lo bear. Boys' Club: Nafional Honor Sociefy: Foofballz Com- mencemenl' House Commiilee. 9 WALLY HEIN: None buf lhe brave deserve lhe fair. Class Day Organi- zaiion Commirlee. 9 MARY HEINSELMAN: Pe+ife is lhe word for her. Ciry Wide Wearer: G. A. A. Board: Girl Reserves: Girls' W Club: U. C. Club: Waparfhian-Secrelary l2B. Vice Presidenf IZA: French Club: Class Play Properries Commiilee. 0 ROBERT HEMPEL: Things may go righl. or may go wrong, he's happy go-Iuclcy all ihe day long. Class Play Publicify Commillee. 0 ROBERT HENDERSON: From Engelonde lo 'Can'rerbury,' he'Il wende. Class Play Publicily Commiffee. 9 BERNICE HENDRICKSON: Perfec+-in every sense of fhe word. Alhlelic Champs: G. A. A.: Girl Reserves: Girls' W Club: French Club: Grisf Sfafl: Nalional Honor Sociely: Class.. Play Properiies Commiflee-Chairman. 9 GRACE HENDRICKSON: Her 'femi- nine wiles, her perlecr slyles, her lovely smiles will 'lalre her miIes. Afhleiic Champs: G. A. A.: Girl Reserves: Office Board: Class Day Organizalion Commiflee. 0 HELEN HENLEY: A Rembrandf wifh brains. G. A. A.: U.' C. Club: Chess Club-Treasurer l2A: Chroma Club: Nafional Honor Sociely: Opera Business Slafl: Wahian Sfafl-Assisfanl Senior Album Edilor. 0 KATHERINE HENNESSEY: When Irish Eyes'Are Smiling. U. C. Club: French Club: Com- mencemenl Decoralions Commilfee. 9 MAYBELLE HENSCH: Ease wifh dig- nily. Commercial Club: Refreshmenf Commifree. lEnlered from Sheldon High School, Sheldon. Iowal. 9 CHARLES HEVENOR: He will be a'winner. Commercial Club: Commencemenj' Decorafions Commirlee. lEn'fered from Columbia Heighfs High School.l 9 JEAN HOLDEN: She's quife a raclreleer -al lennisl G. A. A.: Commercial Club: Baccalaureale Commiflee. 9 SHIRLEY HOLT: Shirley's cerrainly shorl and snappy. G. A. A.: Choir: Commercial Club: U. C. Club: Delail Commillee. 9 DOROTHY HOLTON: A 'Doi' wiih a dash. G. A. A.: U. C. Club: Chroma Club: French Club: Wahian Sfaff. au .bane Awe-A 9 WELDON HOLTZMAN: A carnival of fun. Class,Play Sales Commiflee. 9 BETTY HOWE: An acfion picfure from dawn 'ro dusk. G. A. A.: Girl Reserves: U. C. Club: Class Day Program Commiflee. 9 CLIFFORD HOWE: He 'laces life squarely. Pholography Club: Social Enlerlainmenf Commirlee. 9 ROBERT HUBER: Mirfh, admil' me of lhy crew. Graduafed from Wes? High nighf school. 9 WILLIAM HUBER: He smiles all over when he smiles. Triangles Hi-Y: Social Enferlainmenl' Commiffee. lEn'fered from Wesf High School.l 9 LOUISE HUDSON: Sophisfica?ed Lady. G. A. A.: Girl Reserves: U. C. Club: Spanish Club: Program Commencemenf Commiffee. 9 FLOR- ENCE HUNTINGTON: Ambi'rion will succeed. Commencemenl Program Commiflee. -..,.,,,,v.-.. . .-..,gnq,....-.... - .w,,,A,,,. . ,.-. 9 WILBUR HURR: WhaI would our sfage do wiihoul him? German Club? Sfage Crew: Science Club: Class Play Properfies Commiflee. 0 LOUISE HUSTAD: Fun as long as she's around. G. A. A.: Girl Reserves: U. C. Club: French Club: Glee Club: Swee1hearis : Class Movie Commiffee. 0 RUBY HUTCHINSON: She sews a fine seam. G. A. A.: U. C. Club: Baccalaureafe Commirfee. ' 0 ELAINE ISACKSON: 'Moore' power lo you. Elaine. G. A. A.: U. C. Club: French Club: Nalional Honor Sociely: Commencemenf Decoralions Commifree-Chairman. 9 KENNETH ISAACS: Wa+ch for +he laurels his name will bear. Band: Naiional Honor Sociefy: Science Club: Social Enfer- fainmenl Commiffee: Wahian Sfafl-Pholograph Edifor. o VICTOR JAEGER: He came. he saw, he conquered. Class Day Organizalion Commiliee. IEn- fered from DeLaSalle High School.l 9 BETTY JENKINS: Never posing or prerending bu+ always herself. G. A. A.: Girl Reserves: U. C. Club: French Club: Gris? Slalif: Nalional Honor Sociefy: Senior Exfra Commiifee. 0 ANN JOBST: BeauIy halh charm. G. A. A.: Class Day Organizalion Commi++ee. lEn+ered from Sullivan High School, Chicago, Illinois.I 9 BARBARA JOHN: Soli1'ude is sweeif' Band: U. C. Club: Commencemenl House Commiliee. lEn'rered from Ellingham High School, Ellingham, IIIinois.l 9 ALLAN JOHNSON: Common sense is noi a common fhing. Cogs Hi-Y -Treasurer I2B: Vocafional Guidance Commifiee. 0 KENNETH L. JOHN- SON: Everyone agrees fhaf he's a good sport Choir: lnfra-mural Hockey Manager '38: Class Play Sales Commiflee. 9 KENNETH O. JOHNSON: A nofable man in boih characfer and sfaluref' Nafional Honor Sociely: Science Club: Awards Commiifee. 9 MARY ANN JOHNSON: A mannequin-no less. G. A. A.: Girl Reserves: U. C. Club: Social Enferfainmenl Commirlee. 0 MARY ELIZABETH JOHN- SON: She may be Mary fo all 'the world, buf she's all fhe world lo 'Maury'. U. C. Club: French Club: Glee Club: S'Iuden+ Prince : Naiional Honor Sociefy: Class Play Publicily Commiflee. 9 OWEN JOHNSON: Genial humor for every occasion. Class Day Organizalion Commilfee. 0 PHYLLIS JOHNSON: See her charms, hear her voice, and call her beaufy fine. G. A. A.: Girl Reserves: U. C. Club: Commercial Club-Vice Presidenr IZB. Presidenf I2A: Glee Club: Sfuden'r Prince : Records Commifiee. o RAE JOHNSON: His hockey slick is his banner. Class Play Publicify Com- miI Iee. 9 VIRGINIA JOHNSON: Long, lean, and lovely. G. A. A.: Girl Reserves: U. C. Club: French Club: Class Day Program CommiH'ee. 0 VIVIAN JOHNSON: CheerfuIness 'Ihrives in The company of good healfh and good humor. Afhlelic Champs: G. A. A.: Girl Reserves: Girls' Club: U. C. Club: Senior Exfra Commifiee. 0 WILLIAM JOHNSON: 'Towhaid' is his middle name. Boys' W Club: Foofball: Triangles Hi-Y: Hockey: Chess Club: Class Movie Commiiree. 9 CHARLES JONES: The secrel' of his fufure success is consfancy of purpose. Gym Team: Awards Commiffee. 9 JANE JUEL: A prefiy girl, so dark and smarf, A likely mark for cupid's dart G. A. A.: Girl Reserves: U. C. Club: French Club-Treasurer I2A: Gris? S'ra'I'I: Library Board: Nafional Honor Sociefy: Polifix: Wahian Sfaff-Edifor-in-Chief: Credir Bureau: '38 Salulaforian 9 ALICE KAVANAUGH: Tuesday's child is 'lull of grace. G. A. A.: Girl Reserves: Choir: Harlequin: Spanish Club: Class Day Program Commiflee. 0 LOUISE KEATLEY: A modes? miss who's always welcome. French Club: Gris+ Sraff: Nalional Honor Socieiy: Ouill Club: Senior Exfra Commiflee. lEn'rered from Swarfhmore High School, Swarrhmore, Pennsylvania.l 9 JEAN KELLY: A wee bif of blarney, a real bil' of brain. G. A. A.: Girl Reserves: U. C. Club: French Club: Social Decorafions Commiliee. 9 MARGARET KEMPFER: Goor friend. good sfudenff' Baccalaureafe Commilfee. lEnI'ered from Washinglon High School. Fergus Falls, Minnesora. 9 HAROLD KINDEM: His cup of good naiure is full To The brim. Glee Club: Boys' Dress CommiH'ee. 9 INGOLF KINDEM: A red head full of vim and vigor. German Club: K. O. D. Hi-Y--Presidem' IZA: Defail Commiffee-Chairman. 9 MARY JANE KING: The duchess has a dulce, Mary Jane has a 'King'. G. A. A. Board: Girl Reserves-Secrelary IZB: U. C. Club: German Club: Opera Business Slalii: Nafional Honor Sociefy: Wahian Slaff-Girls' Sporis Ediror: Social Enier- 'rainmenl' Commiifee. 0 KENNETH KINNEY: A genfleman from ihe SouIh. Nafional Honor Sociely: Boys' Dress Commiflee. 0 JAMES KINTTZ: An honor fo fhe afhleiic honor roll. Boys' W Club: Foolball: Sergeanl'-al'-Arms Commiffee. 9 JAMES KISTLE: He's a ferror for his size. Memorial Commifiee. 9 BARBARA KNIGHT: Her manner-quief and refined. Girl Reserves: Class Movie Commillee. lEn'rered from Rochesfer High School, Rochesfer, Minnesol'a.I 9 JEAN KOLSTAD: Wha+ is 'rhis life if full of care? G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: Opera Business Sfafi: Girls' Dress Commiffee. 0 MARTHA KREITTER: Gayely is 'the gif? of fhe gods. U. C. Club: Glee Club: Swee+hearls : Sfuden'r Prince : De'rail Commiliee. 9 BETTY KRUEGER: She's 'lhal' drummer girl in +he band. Cily Wide Wearer: G. A. A. Board: Girls' W Club: Girl Reserves: Band: Naiional Honor Sociely: Orches+ra: Spanish Club-Presidenl IZB, Vice Presidenl IZA: Deiail Commiifee. 9 CHARLES KUNZ: Wi+ and humor-unusual qualiiies in an arfisif' Band: Chroma Club-Presideni' IZA: Na+ional Honor Sociely: Commencemen+ House Commiffee. 9 BETTY LA BLANT: Versa+ile and vivacious-+ha+'s BeHyI Cify Wide Wearer: G. A. A.-Presidenf IZB: IZA: Girl Reserves: Girls' W Club: U. C. Club-Secrefary IZB, Vice Presidenl IZA: Choir: French Club: Grisf Sfaff: Harlequin- Secrefary IZA: Nafional Honor Sociely-Secrefary IZA: Polifix-Secrefary IZB, Vice Presidenf IZA: Sfudenf Council- Secrelary-IZB, IZA: IZA Class Vice President Commencemenf--General Chairmam 9 DONALD LABOVITZ: With perseverance and accuracy he accomplishes his purpose. Chess Club: French Club: Grisf Slaif: Pholography Club: Opera Business Sfalif: Credif Bureau. 0 JOHN LAIRD: Tomorrow 'rhe world will Irnow him. French Club: Cogs Hi-Y: Class Play Sales Commiffee. 9 ADAIR LA LONE: New smarl' clofhes are her delight when she dons ihem, she's a pleasing sight G. A. A.: Girls' W Club: U. C. Club: French Club: Comrnencemenl' House Com- miiiee. 9 GLADYS LARSON: Charming, lovely, lofs of fun. +ha1's agreed by everyone. G. A. A.: Girl Reserves: U. C. Club: Glee Club: Swee+hearfs : S+udenl Prince : Gris? S+a'Fl': Awards Commilrlee. 9 MYRTLE LARSON: Timely as ihe nexl' second. G. A. A. Girl Reserves: U. C. Club: Commercial Club: Glee Club: Swee+hear'rs : S+uden+ Prince : Wahian Sfafi: Class Day Program Commi++ee. 0 WEBB LASLEY: One gallanf, genuine, and generous. Refreshmenfs CommiH'ee. 9 HAROLD LATHROP: A genfleman in word and deed. Glee Club: S+udenf Prince : Sparlcs Hi-Y: Refreshmeni Commiffee. 9 HOWARD LAWRENCE: A iolly young man. Memorial Commiffee. 9 BEATRICE LEDBETTER: Her cloihes are sfylish, chic and near, Ihis lovely girl who's known as 'Pe+e'. G. A. A.: Appreniice Club: Glee Club: Blossom Time : Sweet hear'Is : S+uden'r Prince : Class Day Organizafion Commiilee. 9 MARGARET LENNON: She's sweet demure, and Icind, prerfy as you'll ever find. G. A. A.: U. C. Club: Choir: Refreshmeni Commifiee. 9 EDWARD LEONARD: Life holds big Things for him. Social Decoraiions Com- rnilree. 9 JUNE LESLIE: She does nol laclr for brainsl G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: Commercial Club: Nafional Honor Sociefy: Commencemenf House Com- miilee. em. . em smmwn. e M. i 9 ViRGlNIA LINDAHL: Blissful, bli+he, and blonde. G. A. A.: Girl Reserves: Commencemenf Decorafion CommiH'ee. 9 BOB LINDERBERG: Jusi call him 'Tiny'. Boys' W Club: Fooiball: I-9 Hi-Y-Secreiary l2B: Senior Exfra Commiifee. 9 DOUGLAS LINDSAY: Chugs around Town in an aniique perambulaiorf' Harlequin: Naiional Honor Socieiy: Poliiix- Presidenf I2B. Treasurer l2A: Sparks Hi-Y-Presideni l2B: Class Day Organizaiion Commiffee-Chairman. 0 MARION LINDVALL: Venus smiled on her. G. A. A.: Girl Reserves: U. C. Club: French Club: Wahian Sfaff: Opera Business Sfafi. 9 KENTER LOCKS: No one regrels his approach. Memorial Comrnifiee. iEn+ered from Lillie Falls High School, Liifle Falls, Minneso+a.i 9 WALTER LORD: Hail fellow, well mei! Triangles Hi-Y-Presideni l2B: Credii Bureau. 9 ANDREW LUDOLPH: A quiei, congenial fellow. German Club: A. P. O. Hi-Y-Treasurer l2A: Memorial Cornrniiiee. 9 MARYON LUECK: Peppy and Peppery! A+hle+ic Champs: G. A. A.: Girls' W Club: U. C. Club: French Club: Cornrnencemeni House Commifiee. 9 LYLE LUNDQUIST: His ihird eye is his camera. Phoiography Club: Class Movie Commiifee-Chairman. 9 ELLEN LUOTO: She argues a very fine debaief' G. A. A.: Awards Commiiree. lEniered from Liichfield High School, Lifchfield, Minnesoia.l 0 KNOX MACKAY: He has shown greal' efficiency. Sergeani'-af-Arms Commiifee. 9 ELIZABETH MAHIN: She packs all her froubles in a box and siis on fhe lid. Senior Exira Comrni++ee. lEnfered from Brookline High School, Brooicline, MassachuseH's.l 0 VlCTORlA MALKERSON: Viclry's ixnaclc oi malcing friends is io. be envied by all. Girls' W Club: U. C. Club: French Club: Nafional Honor Sociefyz Social Decora+ions Commiffee-Chairman. 0 MARY MANN: Con+en+men+ is rhe background of characferf' Commercial Club: Credii Bureau. 9 JOHN MARR: Happy, cheerful as can be, why can'+ we all be as gay as he? Bird Club: Siage Crew-Manager: Social Decorafions Commiiiee. 0 HERBERT MATTESON: A cheer- leader of renown: you'll never see him wirh a frown. Band: Orcheslra: lnira-mural Baslceiball Manager: Class Play Publiciiy Commiifee. 0 THOMAS MATTESON: Did you ever see a drum walking? Band: Choir: Na+ional Honor Sociefy: Orcheslra: Science Club: Class Movie Com 9 GORDON MATTSONg Lighi hearis g. Cornmencemeni Decoraiions CommiHee.7Z 7-ae M A5 LL fewl?iZM,e,fa.s. ' ihian: French Club: Grisi Siaff: Library Board: Nalional Honor Socieiy: Quill Club-Treasurer l2A: Awards Commiiiee. 9 KATHLEEN MCDONALD: Her sense of humor surpasses even The greaiesif' G. A. A.: U. C. Club: Chroma Club: French Club: Nalional Honor Sociefy: Poliiix: Wahian Sfaiii: Social Decorafions CommiHee. 9 GEORGE McGEARY: Laugh and be merry: remember, beiler fhe world wiih a song. Choir: Nalional Honor Socieiy: Triangles Hi-Y: Commencemenf House Commiifee. 9 ROBERT McGRATH: Free and easy! Opera Business Siaff: Senior Exfra Commiiiee. 9 NORMAN McGREW: He who is rich in friends is poor in nofhingf' Boys' W Club: Foorball: S. T. O. Hi-Y: Siudenl' Council: Class Day Organiza iion Commifiee. 9 WEBSTER McGREW: Always a lilceable chap. Boys' Dress Cornmiriee. 0 JANET McCART: Willing, wise, and wiHy. G. A. A.: Girl Reserves: U. C. Club: Wapar- :sr fl . -af eQ..'f..e. Y V , , 0 EILEEN McINERNEY: Clever 'Mack' always has a quick comeback. G. A. A.: Girl Reserves: Social Enierfainmenf Commiiiee. 0 JAMES McKEON: Wir and humor belong 'ro genius aIone. Class Day Pro- gram Commiiiee. lEn'fered 'from Monigomery High School. Moni- gomery. Minneso1'a.I 0 GEORGE McPHEETERS: Possessed of greaf abilify and fhe will io make fhe mos? of if. Cogs Hi-Y-Presidenf I2B: Vocaiional Guidance Commiiree. 9 BETTY MEACHAM: On field or courf. she's one grand sporiI Aih- Iefic Champs: G. A. A.: Girls' W Club: Commercial Club: Com- mencemenf Program Commiifee. 0 HOBE MELBOURNE: A man wifh no prefenfionsf' Spurs H-Y: Science Club: Memorial Commiifee. 9 LOIS MELVIN: Fond of work as well as play. G. A. A.: Com- mencemeni' Commifiee. 0 MARJORIE MEYERS: For her size she cerfainly has Iois of +aIen'r. G. A. A.: Girl Reserves: U. C. Club: Commercial Club: Grisi' Sfafi: Harlequin: Polifix: Class Day Program Commifiee. 0 MARGARET MILLER: Friendly and likeable. G. A. A.: Girl Reserves: U. C. Club: Commercial Club: Class Play Publicify Commiffee. 9 DOLORES MONAHAN: She is a phaniom of delig-hi. G. A. A.: Girl Reserves: U. C. Club: Waparrhian: Girls' Dress Commiifee. 0 HAYNIE MOORE: He's never wifhoui a book. Library Board: Refreshmenf Commiiiee. 9 ROBERT MOORE: You always wani' more 'Moore'. S. T. O. Hi-Y: Social Enieriainmeni Commiffee. 0 SUZANNE MORRIS: A peppy girl who's ridin' high, everyone in school knows 'Ki'I G. A. A. Board: Girl Reserves: Girls' W Club: U. C. Club: Treasurer I2A: French Club: Grisi Siaff: Library Board: Naiional Honor Socieiy: Social Enferfainmenf Commiifee-Chairman. 9 JANE MOWRY: Possessed oi quiei' charm. Vocaiional Guidance Commiifee. lEn'rered from Easf Orange High School. Easi Orange, New Jersey., 9 BETTY MULLIN: Breviry is fhe soul oi wit G. A. A. Board: Girl Reserves: Girls' W Club: U. C. Club: Girls' Dress Com- miH'ee. 9 MARGARET NANOFF: Quiei and good-na'rured. Com- mercial Club: Girls' Dress CommiH'ee. 0 GEORGE NELSON: DependabiIify is ihe keynoie of success. Sparks Hi-Y: Deiail Commiffee. 0 IRVING NELSON: He has a serious mien. Reireshmenf Commiiiee. 9 CHARLES NIGHTINGALE: When a baseball io him is handed, ii brings recollecfions of a 'gang' dis- banded. Boys' W Club: Baseball: Class Day Program Commifiee. 9 JANET NILSSEN: Sunshine is red when ii shines on 'rhis head. Girl Reserves: U. C. Club: Commencemenf Decoraiions Commiiiee. 0 MARY NOLANDER: Lovely io look ai, delighfful io know. Choir: U. C. Club: Commencemeni' House Commiffee.-9 BOB NORDIN: A greai big boy of sfafure fall, he siands a head above us all. Choir: Spurs Hi-Y: Social Enferiainmeni Commiifee. 9 MARION NORTHFELT: Eyes of blue and heari oi gold. G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: Choir: Naiional Honor Sociefy: Ouill Club: Science Club: Wahian Sfaii. 0 PHILIP NUTTING: Someiimes I work. mosily I play. never ioo serious. always gay. Orchesfra: Sfamp Club: Seargenfeai-Arms-Chairman. 9 ARLING OLDEREN: Modernisfic composiiions are his favorite conip+ions. Chroma Club: Wahian Sfaff: Sfage Crew. 9 DONALD OLSON: Cheer for fhe Orange and Bluel Defail Com- miifee. 9 LORRAINE OLSON: Good +hings should be praised. G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: Choir: Com- mercial Club: Grisi Sfaff: Records Commiffee: Social Enierfainmenf Commiifee. 0 LYLE OLSON: I doubf noi of your wisdom. Social Enferfainmeni Cornmifree. 0 PATTY OLSON: Have you go? a sficl: of gum? Aihlefic Champs: G. A. A.: Social Decorarions Commiffee. 9 RODNEY OLSON: Swell. sure, and sfeadyf' German Club: Vocaiional Guidance Commiffee. 0 ROBERT OMAN: A real sporisman! Vocafional Guidance Commiffee. 0 MANFRED OPPEGARD: Manners and modesiy are fhis genfleman's keys. Memorial Commiifee. lEn1'ered from Ceniral High School. Croolrsfon. Minnesoia.l 0 SALLY OSTEN: Her mirfh. fhe world .re- quires. Social Decoraiions Commiifee. 9 IRVING PALM: He and gloom are no rela'rion. Band: Choir: Cogs Hi-Y: Siamp Club: Class Play Publicily Commilfee. 9 HERBERT P!.RKER: Dancing eyes and dancing feef, here's one lad who can'1' be bear. Sparks Hi-Y: Commencemenf House Commii- fee. 9 MARY LOU PARKER: Born 'ro wrife. converse, and live wifh ease. G. A. A.: Girl Reserves: U. C. Club: Choir: Senior Exira Com- miiiee. 9 HELEN PAULSON: The busiesf girl we ever saw. 'Friendly and pleasanf and can she drawl G. A. A.: Girls' W Club: U. C. Club: Chroma Club: French Club: Nalional Honor Sociefy: Siege Crew, Wahuan Sfalif. W : C I ,L 4 W 'P- rin i A it 9 JEAN PERKINS: Her hearl is light Girls' Dress Commiifee. lEnfered from Si. Mary's Academy, Faribaulf. Minnesol'a.l 9 BOB PERSCHMAN: They only live who enioy life. Class Play Publicify Commiifee. 0 BETTE PETERSON: Winsome and bonny. G. A. A.: Girl Reserves: U. C. Club: Waparfhian: Commercial Club: Commence- meni House Commifree. 9 GORDON PETERSON: Sing away sorrow, casl away care. Glee Club: Sweefhear+s : Sfuden+ Prince : Sergeani-af-Arms Commifiee. 9 LOIS PETERSON: Preffy smile and pleasing wif, A girl who always does her bit G. A. A.: Girl Reserves: U. C. Club: Commencemeni Decorafions Commiifee. 9 VIVIAN PETERSON: She has a world of ready wealih, our minds and hearfs 'ro bless. G. A. A.: Girl Reserves: U. C. Club: German Club: Social Decorafions Commifree. lEn'rered from Calurnei High School. Chicago, Illinois.l 9 MALCOLM PFUNDER: Did you ever see ihe honor-roll wifhouf his name? German Club: Nafional Honor Socieiy: Orcheslra: Spurs Hi-Y -Presideni l2B, I2A: Memorial Commiffee-Chairman. 0 BETTY LOU PHILLIPS: Sugar and spice. G. A. A.: Girl Reserves: German Club: Girls' Dress Commiiiee. 9 DOROTHY PODANY: A happy face. a happy heart G. A. A.: Girl Reserves: U. C. Club: Commercial Club: Records Cqmmiffee. lEn'rered from Roosevelf High School.l 9 ELAINE POLARDY: A sunny disposi+ion. Choir: Class Day Pro- gram Commiffee. lEn+ered from Rooseveli High School.l 0 GEORGE POMMER: Life wifhouf laughing is a dreary life. French Club: Glee Club: Sweeihearis : Social Enferiainmeni Commiffee. 0 REX POPPE: His 'sox' will lxnoclc anybody out German Club: Spurs Hi-Y-Secre- fary IZA: Wahian S1'aiT. V 47 I J M7 74-'Eh ,fc LfI.....' 9 SHIRLEY PROTHERS: Tac+ and Ialenf malce good Team- mafesf' U. C. Club-Secrelary IZA: French Club-Presidem' IZA: Glee Club: SIuden+ Prince : Commencemenl Program Com- millee. 9 DEAN PROUDFOOT: We'II applaud your Melro- polilan success. Glee Club: Swee'rhear1s : SIudenI Prince : Commencemenf Program Commillee. 9 BILL PULS: He Iaclcles lrouble for a 'ren-yard Ioss. Glee Club? S'rudenl Prince : Boys' W Club: Foolball: Delail Comrnillee. 9 CLARA MAE RASMUSSEN: A friend Io everyone she knows. G. A. A.: Girl Reserves: Girls' Club: U. C. Club: French Club: Girls' Dress Commiflee. 0 ROBERT RICE: Irresisrible, irrepressible: irresponsible, and irreproachablef' German Club: A. P. O. Hi-Y, Dress Commillee. 9 WIL- LIAM RICE: Good and honesl Io be. Class Play Sales Com- milfee. IEnIered from Wesf High SchooI.I o SCOTT RICHMOND: Our baffle cry is 'On fo Richmondl' Nalional Honor Sociely: Spanish Club: Awards Commillee. 0 ELEANOR RIEGGER: Smiles are worlh worlds of sighs. Social Decorafions Commiflee. 9 HAROLD ROSEN: FIoaIing 'rhrough life on lhe cresf of his waves Grisl Sfafi-Assislanl Sporls Edilor: Senior Exfra Commiflee. 0 ELEANOR ROSENDAHL: Trouble and cares are unknown Io her. G. A. A.: U. C. Club: Class Day Organizalions Come millee. 0 ELAINE ROTH: To sfrive, Io seelr, Io find, and no? Io yieId. G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: Choir: French Club: German Club: Nalional Honor Sociely: Class Day Program Commillee. 9 ALICE ROWORTH: Sincere and always reliable. G. A. A.: Girl Re- serves: U. C. Club: Defail Commillee. 0 TIMMY SABOR: On wilh The dancel G. A. A.: U. C. Club: Choir: Harlequin: Class Day Program Commillee. 9 THOMAS SAGE: Ambil'ion, energy, and nerve. Science Club: Class Play Publicify Commiflee. 0 AUDREY SAGER: Kindness is wisdom. G. A. A.: Band: Choir: Commencemenl Program Commiffee. 9 MURRAY SALKIN: Napoleon played chess foo. Chess Club: Nalional Honor Hociely: Science Club: Senior Exfra Commiflee. 0 PAT SANFORD: The fops-in beauly and brains. French Club: Glee Club: Blossom Time : SweeIhear'rs : SIudenl' Prince : Grisf Slalil Znd Page Co- Edilor IZB: Harlequin: Credil Bureau. 0 MARCIA SCHNEIDER: Charm sfrilces Ihe sigh'I. G. A. A.: Girl Reserves: German Club: Class Play Properlies Commilfee. 9 ELIZABETH SCHRUTH: True 'Io word, worlr, and friend. Cify Wide Wearer: G. A. A. Board: Girl Reserves-Treasurer IZA: Girls' W Club: U. C. Club: Gris? Sfalil: Spanish Club- Secrefary IZB. Presidenf IZA: IZA Class Secrelary. 9 JEAN SCHRUTH: Exuberance of sparlrling personaliIy. Cify Wide Wearer: G. A. A,-Vice Presidenl IZA: Girl Reserves--Presb denl' IZA: U. C. Club: Apprenfice Club: Gris? Sfaff: Spanish Club-Treasurer IZB: Class Day Program Commiffee-Chairman. o JOAN SCHUBERT: Red headed charm. Girls' Dress Com- millee. 9 BILL SCHUCKNECHT: I Trouble nor sludies: sludies Irouble noi me. Sergeanl-af-Arms Commillee. 0 JOHN SCHULTHEIS: John, old boy, you'lI do your bif, your base- ball's sure Io malce a hir. Baseball: Boys' W Club: Vocalional Guidance Commillee. 0 MURIEL SEARS: Carefree and cooI. G. A. A.: U. C. Club: Chess CIub:- Social Decoralions Com- millee. IEn'rered Irom Norlhern High School, Delroil, Michigan.l 9 MARION SEASHORE: A likeable girl wiTh a likeable way. AThIeTic Champs: G. A. A. Board: Girl Reserves: Girls' W Club: U. C. Club: German Club: Glee Club: SweeThearTs : STudenT Prince : CommencemenT DecoraTions CommiTTee. 9 CHARLES SENGIR: 'Are you psychic? Science Club: Class Play Publicity CommiTTee. 0 ROBERT SHAW: 'He's fall, he's Tan, he's TerriTic. Glee Club: SweeThearTs : NaTionaI Honor SocieTy: Memorial CommiTTee. 9 BOB SHERMAN: A swell boy wiTh a swell sense of humor. Spurs Hi-Y-Vice PresidenT l2B, PresidenT l2A: Hockey Man- ager '38: Awards CommiTTee. 9 BOB SILLOWAY: A carefree voyager pleasure-bound. Band: Vocarional Guidance Com- miTTee. 9 ROBERT SLETTON: IT we iudge The TuTure by The pasT, he'll be a greaT man. NaTional Honor SocieTy: Credif Bureau. 0 PATRICIA SMITH: Even wiThouT opening a book, she's Twice as smarT as ever beTore. G. A. A.: Girl Reserves: U. C. Club: French Club: NaTional Honor SocieTy: Ouill Club-SecreTary l2A: Girls' Dress CommiTTee-Chairman: '38 SaluTaTorian. O VIRGINIA SMITH: WaTch The sparkle in her eye! Girl Re- serves: U. C. Club: French Club: GrisT STaTT: Girls' Dress Com- miTTee. 0 CAROL RAE SNYDER: A 'Rae' oT sunshine in our midsT. Girl Reserves: U. C. Club: Choir: GrisT STaTT-Business Manager: Library Board: PoliTix: Wahian STaTT: Class Play Sales Commilrree. 0 DWIGHT SORENSON: His goIT club is his TorTiTude. Ap- prenTice Club: Boys' W Club: Golf: PhoTography Club- PresidenT IZA: BaccaIaureaTe ComrniTTee. 0 WILEY SOUBA: STeady, sTudious, honesT, fine: such good TraiTs in him com- bine. NaTionaI Honor SocieTy: Triangle Hi-Y-SecreTary l2B All Hi-Y SecreTary IZA: Credif Bureau. 0 JOAN SPEECE: Shy and sweeT, choice and neaT. U. C. Club: ReTreshmenTs CommiTTee. 0 JOHN SPENCE: He makes a good show on The green. Triangles Hi-Y: Social EnTerTainmenT CommiTTee. 0 ROBERT STALLMAN: SmaIl oT sTaTure, buf greaT in prowess. Boys' Club: FooTball: Class Play PubIiciTy CommiTTee. 0- ROSE- MARY STANTON: OT all The arTs in which The wise excell, naTure's chieT masTerpiece is wriTing weII. G. A. A.: Girl Reserves: U. C. Club: German Club: Ouill Club: Class Day Program CommiTTee. 0 WINIFRED STARK: An air oT good humor surrounds her. G. A. A.: Girl Reserves: Girls' W Club: U. C. Club: French Club: Memorial CommiTTee. 9 BETTY STATT: Charm and viTaIiTy. CommencemenT House Com- miTTee. 0 SALLY STEVENS: Full oT Tancy, Tun, and TeeIing. G. A. A.: Choir: Class Day Program CommiTTee, 3 LESTER STEVENSON: He's Tall: he's brighf: we know The world will TreaT him righT. Opera Business STaTf: Wahian STaTT. 9 GILBERT STEWARD: Ask him To do someThing and iT will be done in The very besl' way. I-9 Hi-Y: SergeanT-aT-Arms Com- miTTee. 0 MARCELLA STOTZ: Truck on 'up,' Marcella. G. A. A.: U. C. Club: Commercial Club: ReTreshmenT CommiTTee. 9 9 PATRICIA SUTTON: She looks. she smiles, she wins. G. A. A.: Girl Reserves: U. C. Club: French Club-Vice PresidenT IZA: Class Play ProperTies CommiTTee. o DALE SWAIN: Look- ing Them over all around: A beTTer Tellow can'T be Tound. Gym Team: Social DecoraTions CommiTTee. 9 TOM SWAIN: WhaT can we say? His deeds exceed all speech. Glee Club: Blossom Tirne : GrisT STaTT: Triangles Hi-Y: Class Play Prop- erTies CommiTTee. 9 VIRGINIA SWANKE: Her wish is +o be an arrisl great and whai' a lovely one she'II maize. G. A. A.: U. C. Club: Chroma Club: Spanish Club: Wahian Sfalil: S'I'age Crew. 9 SHIRLEY SWEETNAM: Cheerful, cure, and very gay: her smile will brighlen all Ihe day. G. A. A. Board: Girl Reserves: Girls' W Club: U. C. Club: French Club: Glee Club: Swee+hear+s : S+udenf Prince : Grisl Srafl: Polifix: Commencemenf House Commiliee. 9 JAMES SYME: His limely sirolces malce smoofh sailing. Band: Grisl Sfafl: Boys' W Club: A. P. O. Hi-Y-Vice Presidenl' IZA: Swiming Team-Co-Caplain: Vocafional Guidance Commillee. 9 ROBERT TARALDSON: He laughs wiih 'lhe world. Ouill Club: Opera Business Slail: Class Play Publicily Commillee. 9 DORIS TARLING: Good cheer in any Ianguage. G. A. A.: Girl Reserves: U. C. Club: Girls' Dress Commiflee. 9 DICK THAYER: An all around good sport Awards Commiffee. 9 ROBERT THOMAS: Lei us sing and be iolly: 'ro be sad is such folly. A. P. O. Hi-Y-Secrefary IZA: All Hi-Y-Vice Presideni IZA: Science Club: Class Play Properries Commilfee. 9 HUGH THOMPSON: All high school games he supporfs: he is a lover of many sporTs. S. T. O. Hi-Y: Track Manager: Class Movie Commillee. 9 JOHN TILDEN: A congenial fellow. lull of lun and Iaughlerf' Chess Club: Glee Club: Sfuden+ Prince : Class Day Organizalion Commilfee. 9 JOHN TILLOTSON: Daddy Long-Legs. Chess Club: German Club: Spurs Hi-Y: Class Day Organizalion Commillee. 9 MARY TILLOTSON: The Icid's i'aIenled. U. C. Club: Glee Club: S+uden+ Prince : Wahian Srail. 9 GLEN TORKELSON: You can always counl on Glen for a good +ime. Chess Club: Choir: French Club: K. O. D. Hi-Y: Class Day Organizalion Commirlee. 9 DOROTHEA TRAVIS: Friendship is an art Alhlefic Champs: G. A. A.: Girls' Club: German Club: Social Enlerlainmenr Commiriee. 9 RICHARD TWEDT: Webs'rer's diclionary in disguise. Chess Club: German Club: Cogs Hi-Y: Ouill Club: Boys' Dress Commilfee, 9 MARY VELIE: 'Velie's' always bubbling over wilh fun and good cheer. Spanish Club: Class Day Pro- gram Commillee. 9 EDWARD VIHSTADT: He's iweedle-dum! Pholography Club: Slage Crew: Class Movie Commilree. 9 ERNEST VIHSTADT: He's rweedle-dee! Class Play Publicify Com- milfee. 9 LAIRD WALDO: He halh a noble look, Glee Club: Swee+hear+s : Harlequin: Nalional Honor Sociely: Boys' W Club: S. T. O. Hi-Y-Treasurer IZA: Hoclcey: Wahian Slalf. 9 BABS WALLACE: Swee'r as a Song. ' G. A. A.: Girl Reserves: Apprenfice Club: Glee Club: Blossom Time : Swee+hearIs : S+udenI Prince : Gris? Slafl: Spanish Club: Baccalaureale Commillee. 9 ROBERT WALLACE: Ball, bar, helmet glove, baseball is Ihe sporf I love. Baslrelball: Boys' Club: Baseball: Boys' Dress Commiflee. 9 MARY WARING: You shall know her by her capabilifyf' G, A. A.: Girl Reserves: U. C. Club: French Club: Girls' Dress Commiflee. lEnl'ered from Wesl' High School.l 9 BETTY WASH: The marlc of qualify. G. A. A. Board: Girl Reserves: Girls' Club: U. C. Club-Vice Presideni IZB, Presidenf IZA: French Club: Library Board-Vice Presidenl IZA, Secrelary IZB: Nalional Honor Sociely: Wahian Sfall: Credil, Bureau. 9 GEORGE WEATHERILL: OuieI' bul capable. Vocafional Guidance Commii- lee. 9 RICHARD WEIGEL: We have compefenl execufive abiliry here. Band: Nalional Honor Sociely: Orchesrra: Boys' W Club: S. T. O. Hi-Y--Presidenl IZB: All Hi-Y Treasurer IZA. Vice Presidenl' IZB: Tennis: Wahian Sfafl-Business Manager: Credif Bureau. 9 LYNETTE WEIK: Her Iaug-hier' rings clear. G. A. A.: Girl Reserves: U. C. Club: Commercial Clube-Secreiary I2B: Girls' W Club: Records Commiifee-Co-Chairman. 0 JIMM WEISS: Wha'r brain power! Band: French Club: Grisi Sialif: Orchesira: Poliiix: Quill Club: Phoiography Club: Track Manager: Wahian Slafl. 9 JACK WENGER: Hefll never sink! Swimming Team: Boys' W Club: Commencemeni Program CommiH'ee. 9 JOHN WESTEEN: Behind 'the silence of his mien. dwells a mind i'hai s brighf and keen. Memorial CommiH'ee. 9 DAVID WHEATON: WH and wisdom. well-combined. Harlequin: German Club: Nafional Honor Socieiy: A. P. O. Hi-Y-Secrefary I2B, Presideni I2A: Ticker Manager: Wahian Siaii-Boys' Sporf Ediior: Choir. 9 GEORGE WHEATON: Blow, Gabriel, bIowI Band: German Club: Orchesira: Spurs Hi-Y- Secreiary IZB, Vice Presideni IZA: Baccalaureaie Commiflee. 9 ELAINE WHITE: Dari: eyes, duslcy hair, and flashing smile. G. A. A.: Girl Reserves: U. C. Club: Commercial Club: Baccalaureaie Commifiee. 9 HENRY WHITEMAN: He +eIls 'ihe Awful Tru+h'. Triangles Hi-Y: Wahian Siaii. 9 THOMAS WHITTEN: A hof irombone blares 'forihf' Band: Chess Club: Orchesfra: Science Club: Sfamp Club: Social Enierfainmenl' Commiffee. 9 ELLEN JANE WIEDER: Always cheerful and ready To smile. Girl Reserves: U. C. Club: Com- mercial Club: Girls' Dress CommiHee. 9 ROBERT WILLETTE: The 'Campbells' are coming-+ra- Ia-fra-la. Commencemeni Program Commiiiee. 9 BOB WILLIAMS: How he goes 'ro iown on +ha'r gobble-pipeI Band: Orchesira: Vocaiional Guidance Commiffee. lEn+ered from Souih High SchooI.l 9 JOAN WILLIAMS: Wisdom wiih quiefnessf' G. A. A.: Commercial Club: Social Decoraiions Commiiree. 9 MARY WILLIAMS: Grace and good disposiiion 'fend your Iadyship. G. A. A.: Girls Reserves: Commercial Club: Refreshmeni Commiifee. 9 MARY WILLIAMSON: Ambii'ious. arfisfic, and aHrac+ive. G. A. A. Board: Girl Reserves: Girls' W Club: U. C. Club: Wahian Sfaff. 9 BARBARA WOLFF: She has balance, digniiy, and poise. U. C. Club: Library Board- Secreiary-freasurer I2A: Class Play Publiciiy Commiifee. 9 ELIZABETH WOOD: Naiural charm -her foremosi qualify. U. C. Club: Commencemenr Decoraiions Commiiiee. 0 MARJORIE WOOD: Able and acfive wifh brains and poise she does a loi wiihouf much noise. G. A. A.: U. C. Club: Glee Club: Sluden'r Prince : Girls' Dress Commiiiee. 9 BERNADINE WOODFILL: A clever, colorful cui-up. G. A. A.: U. C. Club: Girls' Dress Com- miriee. 9 JAMES WOODWARD: Having promise of success. Wresfling: Social Decoraiions Commiiiee. 9 MARY WOODWARD: Song hafh charm, bnd so haih 'rhe singer. Commence- menf Program Commiffee. 0 MILDRED WRIGHT: An arfisiic girl wifh a clever mindI Nafional Honor Sociefy: Spanish Club: Commencemeni Program Commiiiee. 0 FILIS YAGER: Talenf illuminaies her pafh. G. A. A.: Girl Reserves: U. C. Club: French Club: Gris? Siali: Harlequin: Nafional Honor Sociefy: Poliiix-Vice Presidenr I2B: Class Play Reading Commifiee. 9 JUNE YOUNGREN: Dark eyes, darli hair-a perieci bruneH'e. G. A. A.: French Club: Class Day Organizaiion Commifiee. . .4 W I I I I I K, ?iif'QR:'lLf1 Q 'if' Q Lg fblliirivm 'fl -Qmewmfwfwvfd1iJ1'rwPWivW?ifP3'?fA . a,f2,Qq1awgaw,wfa have 'ffl 'vim 15,?,Q,fff,,Q,.,,M4,,3,,,fX,t4 ,,.fv4.,m,9Vw,,w.,x, W7 42 4 wry-figs my :Sw ',-rf'-bfq'qgfS-ff 543.1--A-gf f3f'fffw5gfi,y5f ,KA -31,,,g,L,,'ng.wL ifwi K isivgf' A- I .'12,-.M pf X 1 f f xf+m'w r ?f,:5gQw vqffrwy, 19 f4wHfQ4fW??eNP:1QifiwfSw X 21' ,,-k 'V ff .- . :za-.-Nfl' -ilbw, K 'L 'J ugi, 1'X:nM'-14 --Ln! F'eff?w?'f, .f1r f?f11:V'Emi?-I',t-14 f i'JKFf 'f xui:c354'Q'1 ' ' Q 'Wai 1 f' f -K . M Pff' Ks K 4' Qxigfffvr w'- 'X 9-ff. w' ' an 'ri :if jf, 6 ESV F' 'ef' , ' Lmifi- If-4 wif.-'e'?' :Eff -. f gfgfg f M , ,,,,z, ,.,, ,, .,.A4 ,. ,ilx 1 , ,,..,., , K. kqzk A V,,, .V,A ' 15 , ' ' .,., M vw fx -5 A' X f r . A- , -5 ff 1 .. , . A, . gnk, -, ., !,-, g ff .1 . ,, Kp ,,:,r M ,h A ,..,.mrmr Swv H Y f m 3- iwfgw L. Wgffawi' Mf1fi2.f+iifm44.-.a'f2:s2fwm2,,w,1s,f: fW:ff,v+-M-1-ww wi 1. ,ALM 11 -Q '-,wsffWRf :. :m 1 15:22 ,, -1 D ?51?,,g3,W-,,-wm'4B?49,x L .Nm ,, ,f:,.,:,,,g-,-'f 3' , My .4 W . 1 -. 'A -- H V Lev. f w v ,1, Q 315 ffia:' 4sf,f4.,:Q,w , ,,,f1.,.fbf'gf'Pwm?w w f - W ' A ' ' ' 'X , - if f M 1 -m , WM, W. :,'-ffm- Q Mfr- Aff M ' W , .Af , . f ,s L..' g - . . ,- My f-. wr :1 q.. -,,. . ,-ra. 5 4 W , 1 '. , - . '11,-'3,f,wEl 15 q 2 1 JW- M W g f . 4 2 A A fl af gf. Q 'HH Av: 'Q'-'g ,g, , ' 1 f 'I ,Z -'jvweggg -4 '15'L' ,4,i'w,', ' Fgvi :,fi93we-mgg-.,-.X -,ftsfjq 2 ' 1 , 1 , , . 1 . ., - . W A , A R '- ff . :Aw ' 5 ' f ' - in f . , .. n Q .? 43 f, F? 53 If' V .jk ' .,.,u,.q.:'vM, ,4.mwf,Ww mpw+4..a1 M. www. .N ww-fi ,.'5wg.w,H,w.,ay, 1.4 1, .M J.. M Lmk ,L -2 um ww W Q mrfwcmww mm fw Wee 1-N 4 A - V , .J -4-.f-.., 1 .M--.,. f-,WL ,:gM,W,.m fe,-. .51 H- if W 1.3.-V w .--M ,,N..M.A.,4.Q,',v .gm -wi ,fffggw ,QW-'--wqf -'- 11, wh J','1-- f, ., fa '. 1 , ' -15 if U M si:-f ' . it , y -f4gg4a3,11x-Aagxgs'-stamfz y , 1 . , 4. f- Qi :'z,-L2 asm: 5:3 f . Q- . Wwsffwiw gF1e'4f,w2m+Avg41 , 'w.'. A ' ,ggfM?iiW' vii-' 4' 1541 '1 i'.jfQ'.: .... Mg ws, H., V ' .gs ' -rfsl.-wafavf 'aff!S 5'ffff3'AS'-SQPWL . -1 v TL: :Zuml'H:a,w1m6Luw'1i'1r1M 15,1 32.14 g.mv.:qwaQ.'eS'4Q-pf1,,,i ag, ' t +3941-1-S. 1? fri .,, 4 X,,,, ,,., ,H . .. .. nay? Qwwi., fxsm. uw, 4 ,-.4-,ff mm-fel,wg'+2eiw-:V-grvwuf-a':f-,iMffscelig ,Nw ' f 1 .,3.,,.,..i., ,,.. .J , , ..,,, 3 , 5. 4 w H , . y, f . af Gu' - 1 - w Q -.z Af: uw 4, --f,-,ww -.gn-,- ,:..,.,.,,. Q . :' .,x'!,,..,.f. mi.. '.:.-f.n:.f,s, 1, .:, -, Q ' ' .W i'-Wir ws.-1 qw .-fb.-Q.1,,:p-'we we mvfwtxf: W -.M.:m:mm JM. -xa'w?:',w ,513-,iw mes y1.e.f?,w4Zh+g-mefq-fwgfp,g:.w1wq4X-wi:Q-:,w.gJgwgr1 ymififitxqilp ' VM., m 4 .L .e .mu ,.,f,...f, -. , ,1 A-.,., M, ,, ,f.,,.,. ,,x,,uw ,..4 .hx ,, 141'-Sm aim-wrmvv f'!'.91f244'-5: 1 4 -H ww ' ' ,. V1 3mW.4zv.e.w Mk. Q ., .+f.:,M.. 1.5. ,.,,.1.,.,,L- ,A ,,W.5m, -M, V,-:lax-5'?a-. 2 ,, ,L -, v 1 fi ,H Lai :fb 3 ,..1': fi: 4 4 . V, 1.31, f - Y 1- ww., 5 ,'jj'.5 .,, Lg.-ug' 51Z'g:.- , 4313, 'rw w 1-.LQ1.'? fv,-M1 Hg Hz, vQ1.:ywE5x-1 Q .4 JL. MU 2 . ,j1w-A -'few ,, q7f'ig3fi3 ',Ay.:. -' 15: ' .nw -,., --- V93 . f , . ,, ,, , .. , ,. . .,.. ,. ,, , ,, . ' A X v , s mnnfrw-1' uw Yi, 2 .,--1 .1 -.my-'1zf .' .1 J-11. .' .,,,. 'HEL ...,Z?ff'f2:2:f. Jviifi- '-3G1'.'t's+: S1--itW 54-QQ!-1 n- :sf-r-:'4z..:hgf3.'iif we-4 - sal -1 .. .f '1:,h.-:a: fJ ww 'fe 'Maggy 'M ' M f mimi-1 mv ,vm-qwu,wmvAwW:wa2pwymW:a..m a-p.1,Mw-ew-waz:ksmfwmn-.w,mw'wQNfwglgh-ffw.21fl-Jw-Q-gm-aye-smfwfjfsrwqanwuwwwwgwwwff--wffwfiwix-f1wv'a'541s.1m4Ef-v14aw1fsvmv,wvrfrH - X if , :fsruf .wp ' 1 wwf- t .. my Q 35 S,i.+2's41g:s5bp5g,mQg-ZH fic-walsfjw ia ww W ' - , 1 , V A- ww 'V' 1 me Q wwf? m.'.f.n-m w wif 'Aw fkimqwwg 'Q ww qv! mrs we aww HP' 5'ff1ff14'f1 'F?4f M'w'f'-'U 'V ' i ?',E' 9 5 1 'l' X N V A' 'QP' S li . f ' ' f ,Z ' K ' X v W if is , . . IEA . , F5 . 'f ' 1 ' ' 4 R., ' ff , ,. sxf . , , A 4 .. a ' 1 uf g 'f A J, bww 33: k wb ggli r gg zlglyl Mvg w - V ' J g ., ,gi f 1 ' f t T W, , .i ii V5 warms ,grmpz wg .gf,,4'g1uAww3s?' ww , awww-wvgalgww J, .Bw-.w Gigi W Q- MAQQQQ -,yr y if D aug A 'S'+s12m3k,n, ,K Vwmgifj . a x f Q A v f , ii? 45? , - ai f 1 ww u 5? , , g I ,.',,, , , li V F N i ' f b, y 1 'Z 'w Ax' f f - f + A H '5Wl 'Z' 1' Jie? .- xii- : L. '., P M-.var--43' -1 rm V, , : ,.J.'+ 'w.l .' mf M - ' ' 1' - 3 'Q' iff' I le? N 'ik M ' fy- - ,f MW w th, -' 1- ff 1 .V 'gfFf+ fv-f,,, - , . , . , 4, ef if yi ,-fr, ,, V 1 .. . ,.,, r r .. f .- 'ga ' .1,. gwmiidg lg 3 W . X525 A Mmm, ,f rf 1ffA 5-,f'g'fe A ',4, ,, , , ,',1 , ,.x-M' -egg 1. W, za - P , mf ' , 1 ' 2 1 .M - - ww- -1 .1 f ' iw ' af - qw:-3,., :K rg 2:-'H 2, W2 '-1--1. - ---'W , I - q ,Q , U J rg? 1 A ' 1 M M ,. 'if - ,T ,V w2S: f f iw QQ.. z fa gf' his 154 my :E 4 F 11: gy mv- ff V fum 5, 1, v ,gg 'd l wht-fmm '- 'rf - ' mfwww-1:eww-ifnfsvwefffmmzmfffdeeavwwfwfmw-zwfww-m - wewgfwfwmnfw-m.M55frhvw1ww-,wgyhrzfvfs'eam-fLseiWfSWw 1. .. ifxiaws- was 1 ,. 5 Q . A -- .' f . I H 5 MNEQ-'iix . f :Aw fm f ff if -K ff -we 4 5 K wi , g X wmv -ms ima wwf: is G' -. Q wav ,, , . . 1 ,, , MA, '4 1.82 ,, U-fx k n,fw-Qrafx-flea. ,Q as nf 4 4 fm., .A am 1- ,-,mv gum qrfww wwvqvfk' we an ,vw mm ,ma ff. .Q f my ww fw WN 'Y if ' wwf-mem? .ff-f.W,A. ., .--.-B ak. :-. , ,. W, ,.-QQ..gm,5g,. f,,.MAM,f. A,,,y.g:'.zw,-.v.4g.f' 51, 1.M,4if4,,,c, VW: :ww .,v5..,,.., L fwa.-. Y :flip.W-4,41a,i3,fgm,iwfg'a--.avWm,,..,m.g,may.,i,iwm,,-m4y,M,W,,gs,,,,,in. tw, Y f- Q X- 1 we v.: -wg.-5553. J- 'ff-131: .y-Amgen 1, fm- ,e,Q.3. ,fs fwwvg 13,7-53.13-', 3+ -- W 'f2'?'w, ffh 3- gm ,gli up-4 , sg-,. 5 ff,:,'m 1,-1,4gg:5:': ..41+f:.--, ,.1 A F , M' ' 1 mg 1g'Q,,?gg5,,6ua.gLs6 imma '1-rw mx-wg wi-af' '-wf-uma wwe wf svwg:.'1M-ff f -aivkfxwxgswfi mf W-'Q-2-fff 'VH 4 rr sw-' -si'fm'iw-Wa 'dw1-wawaN-f:.,,Qffgw'fM'gQi51tewg,wf'ffw 'Qy w: waQ+QwgfaeWs:Q , V 'f -1 ' -H-M F - . '- 14-wif-1 , I 31 , 1 . 55125: W If, 31 if ',,:g,,g'3S,g:,f- ,g -.,,,,u:4,mg,fv:f 1: '- 2,175 :fm-f '-1- 1-W--',, ,Fw wg' .,,QAm-V ci, - ' J . V vw . ' 'mf gffgfm, wvgvzqw ' 1 . W ff-gwfwk 5 W MVw mfur3LzgW wwwwa QM-,wmrf wfmfbiwam fe-5 .W . Q W U fwwwwa w ak 1-az, , , mmwwefwef Bmw MWQIV- fvfmws if ' M ,M wp M ' A-Q, i 5 , M M, ,K mm. wkhivqnvsqvg wpvwggggaw ,Q WWW? ,,,.,,g,,1 'wma-1 WW 4' 'J my 2. ff' M My N' ir, wh w ggkbif, -1 W1 3bf-MMM L, ., A f f .www-Wim 4 Wf+1z2Mjh,,wz,k. , WW l m g K 'Tw'.gu:Q,3A 5111? f' ,J 'i 3' , 1 11' J-'QT !,,1?'fiQ ' f un , W ' T4 79 w 3 'fi ' iM' 5 . Ti l l, -. WL -W1 ' gf 37, Q . 'A 1 U, X ' ik' , e v ff-Vi 173 5 f-11 f, JJ ' ,,z wQ1L J!tWh ' w ' 'i in f Las- W V if x mi f gm-Sf f 1 fri Nj A i af f., - 5.1 7 43 1, :1-E . R M , 4,--,jf .V -1 -A , . ',., y' , W A-jf, :J gif ',, k ',, ,,:g' A, gr- j ,.: . :, V , 3 v W, ,H H ,L y a ' .H-w-. H mf' H1 Y' , ,al M Ir v., - ' 'L -, 'R 1'f 'P ' ' sf, ' r, : ,. ha 4 T 'im' 1. ' H -ff 3 , 13 M ,G r If 15,1 ' .v w iw ,-q f y u , f,-, E X W Mxwm, Arn qv n gh 3 f r Www J r 4 N if -,A ax A Wi MQW' M 'V - ' 4 55 'VW 1 V Q Mg, WWW 423554 iwww m wawff lwixizww xg? aww w? M +R Q 'gf' ?'2f'5.+ f W EVE-zf Awww Aww-'v fwddifhfgb SEL 1 4 ,M ,,wg,-,gf JQWYQMQ gi if f 1-, gwmm zg,Q 'g,,, P ,x ,ggi Axim, Mm ,ag 3 . fm 4ww4Eiy ,:w ak 56 w ? -'53 Ra -, H A W2 4 f w f Vg, ,gag I1 ,K fx fJ'!r4'w,- U ,Q--1-,,r i,1,.-iw, Q' A' J Q ew y. w: ,Mf.- E15i 9 w ff P ,k K-1 A- .ff -. ,Q 'pi A - Q V. P 21- I . ,, 'Y ' -f 1 ,V - fkf A g Z M, J l f - .: 9','gL' ,yi fQ1.Q,y. f1fU7J1?: fi 1: w w . V :f'Y.,4'a11,Q.,,fL 5.5 - Q' . .,.. ' - f ' ' ?5F'?f? f-' ff, -A-J. Jgmf ,0,,h, Jk ag , ' 'L,wy11,- ' 1 pf ,J-, U WM A -mf Mfhw ,-. . - I 1 ' ww 1-N ...V v .,V ,MA fu ,.',.,.19 . . , A 4' Y , vw , mfg- V -Kaiim Mm. wffffk-N23 vw, W5 fem! ,Q , 122ffvs.f3f1k'2:5f2mv.,,aag, I Q 5 , Q M I geffg, I fw ,W w4 -S- MQW, .,w.,.m-wsmwwwffifwm , N K W 'f , , .vii ,. , V V .V , , . Www. , 'Wi' fu' z... , 'i?'k,, .. f f ,, f ' ' MJ ' A JGP I W 5 ing, ,fx Q? K f gW'iH . xg 1 Q . F , . E wg Wi w QW Wwww 'mu Qlfvwwiyvhm 'f Q Wm 'wr' f- :N ff N ' . f - -' U' , 1' ' .. 5 . ' W ' v, 4- 2'--M ' X N. - ', ' Q 3 .' V 'Fw . ' A ' A L' , . L vi , if? 5 ' A -' f ' ,,1 ,- 1 U f' , -V . n f -ff' -f m f - f , ' Q 'a V , - fa' we 'ff' . A. I ' A 1- -44 M' ,, - W' , W- 1 -A 1, .a M . .,vM.., ., Y 1 wWf'f'fM'MWP1i' 1.9 ' '1 4 img? f ' ' ' 4359? GMM -Ki Q? . 1 5 sa M, 'jk 'G' wwwwwifg- avqwqfaxwffwkisql mwgiw Mfg? V' Nfzmw x,,,,,,i ,M?m,,,.W iii? fk ,f,-fl W gWYW'S dL, 1'3'H z mmf, 2-fm? Q 1,9 QQg W veg 8:3 , M ' L, 'H fmgfwmwl 1 Q ,wi-M Qemmw Q bww R, WW-fwiwfsiwww. A ww ,, ,W M 'ww 'S',fQ'gN?fj'Zf9Xr5114Qyvw!sfwaw15wg: fig-f a P ' f' ' tiki .5-1!F,u,...f 1 -v M aggrwm is sa X' ' wf',.'?:if W ,, V J W4-. ,N ' 'A rg .',,, -, , Y. V 7' Q-'W R , , fa -Siu. f , . 4 .,': 1. wwf ? gm V 'jg .V -ip, X. z, .15 ,yrs - 2- ,f5,':f v f'f W-WH:'Ww,1 , ., '51'55'f'. J' my ' 'Wgww M 'iw-y,vE'1-zwmgwa .1 L ff -' if gf ,gsm-ia msPW':r'?i .gw:QQwfew:WwM . , V, X 4 , ,, ,, 5, w uggg w a' - -:i ll QM:.1 .:, -M,-5 QW? V W , ,gfmmf wig M 'R L, 1 f L 'f N' gg b W.: , V F N Q, A-qv, ,f' A ,4 f ,wa1 V, ' f v V7 QV, fmw-fn fm f51?1,:-KQN 5, ,A . .Q 4 4. I . .,.V WMWMWW M mm VHA? 59 ww y .5524 baggy ,qw ww mf'-wgfaq' vwmmifwffl ,H Miki 5.1 563 wffsiaiw' xvifgpr,-135-,v,.7kg.,i, 417: my NW. U 6 3 AF , , 1, A ,3 ,4, 1 ' We ,f.f , f f .q v -,m f . QQ, 1 I J, -I H V, . , , -, mf A 6 Fw- 1fff1f..l?,L,.'i6, I ff f V up . . , f, ,, 1, IM W, -f .-. er- , f in 1 V L 1 Q WW 'R 5 Q 'wafiiw '.'V ' IW. 5! if Q2 he 5 ' 'Q' V'-V A s r V ' , Q f f y 0 5 fl ff'?'3f5'46'5'2. 'Q-f14gUvfvm 'Y fvvgA,,l, 1,-,V 1 1- F ' -,Army Q f.L?l,,,wm M1,L, . '- M ww iw , . W .1.,. W -f f -- 'V - A V x N, . 4, , , , , f K. M Q 5 wwggg WWW M ,fi f www www ACSIWG-sim as Qs: wa'Wamf+fef,' 'A f ' I ' g g Qi Vg95'5 f4? 1' -.A ' ' ' . ' : X ,,., 1-:H ,..,',s 'wx ds :-fx -Y, ,.W 6-1,1 L J-5 Ae , .ws rw L q,g - Q1-,.. ,fe? ,',,.. N, . , 3 V ,M ,- 1 ,M : 1L',?.f,:v ' fm H' 32jh5f51 'W . if A U y .... ,N , v, I ., ,. , , L. ,E , W V' I , Q ,Q ,A ,., if ,M 'QF M 51 W guf Q ff X 2 V M WW? 3 YQ wf -V - ' . Alf 'Z ,M W sw A 1 4 ..,. A K ' -K AP f , f wb 'A' f ' A -wPZ7.A'ffx?4L'5f?-f45Sxe-1H1x3?n-'s'svf1Qs'Wr?4'b1x h1W'g'57'g'A 3 , ,-1 g .. 'fKW3 9!'La4'PM'2?t1'5 b '54 W'4?Y1 I iff- 5 ,4 H+ 1 .: - g 51 f 1,5 iff ' al L: If 1 - V.- Y . ' g a 'W ,my 6 UM 5 HV- S mm , we-wx fgp2Wv,Awm,mfpw,W,w 44 ' ' r Q: 4 W ' fa, Q N-r '-- ' . :ww www:-wfffiffflf ff Af nn. 'v irfvrf'55'2-1 'yilrdE5'fw12'iM M. - 5-Qrfgff 3'1w1- 3-Nnw-w'Ez'5zf,:'5gg21:mHrrmfQfVm - 'M iff-Lwnfwiw1fWiffi'5vQi45f'fi'ff1miQ1 vm EW ififv 1 V ' .5615-ww sfkgvaaqvggwig-v-riff af' . 'V Q! qsiwgrke J 2164-Eifikwi4f1+i9ff5w-gqug-1af1,wfi-Qnvff5 we P fwgwi-'f1wew1wgf3 we L4 :nw xr fM'rf' ..,- .Nyf-,.Q,,q.0v, -.Mag 1.-.w2-wnfP2z1- Agwgaf-m: Wfwsm , 1 f ' 1 3 , , X ' fi ffl 23, JJLJMW.-w2fflwkQi1w.v1,'1 -fkxfl-r1wwffHf':'r'.f'P1 f'2f If --1 +-JT., ,M1,4,,M.,5,,Q,W,,h,,..',4M..A..,,,,,,,i.,Mf,,-fr-0., wawxfw-qm.,.,,g.,,,f.Nmv.yfM 'xfifwmsw wg-s L. , . , W V, ,VHHNN W -r, .,+v, v ' -AFR. ' -J. -' f, ', ,UM '1-'H ,'f 4.,ewv.., -, . -wiv. 'Q' - H' L--ffwmfv:ffff:ff?w:'f'1'-iff? 'fff11 fa+ffw- '- -A 1 ' fb 1 2 :Na-A an 45, N up :w,,,4 .Q.,5,,,,,:,w,,,,,,.., Jw -wi-3 Q,:M..f,uf-fp MLm.f.xf,,,,.,,f.v..1vf.f:-v.d,.a....,X-. , ,,kyM.,f+.1.4,m-,wi j ,., f 'SJW SN :Mm wi - , , 'J -3 -'Luz ' ,g,,-:fm V, 'Q' X '.E..,,.gXg:f. 55g.1xN2MQ:QNw Hfciqf Wk graph-ml Eff if-f1'X f'wY?M1?,W '7'l7 3f? fhf'ff5'5'?'i3'Y:W f yi' ' W3 M4 53f'f'X IFL WNW? fr a,1Wf1Af Wt+vif+w'vf r S'FZ'f1f'7 '5'Y5 .!f'f1Af5 fx. 'r1s3'qg2kfqfgj,'w-:wfwmwwm ,5:f21,eq51-,V .,f.,g,ygef,9f'Hfvmwqg,x'1gk.5, Q 'iw ' wvw ,mg-W. ..-,, xp-yr ,-fwmu, y Dy ., 1 'VW M , ,. , - x- 4 ' J' 5 H ma - a W' ' ' me vw-Q' ' wan Lw -M A imrc -vw11-wiwrmgmwvagwffewiwnmw'-.-Mya! -rr-arvr,kMwAe+-v:zgnfLe1ggw.'1,1'e.1ey-fe'2e,swEq,Lgg4..:Q-11n:+- M wi V AK -W '--' ' 1 ----- -X g N if ., - nw 'X 'g ,,':3,J4,,g4..'-, 3rqU,.fq,, 'A i1 igiiljev' LW, V .wi sf-nfvwym ww! 3 .1 MLWQ., 6 X N, .4 M., ..-, - -. ,. . . : , , . -, V A , , W, ,. ,M . , Y MA Y. .,,N,,., .W-..mg3,,....,,. ., -.,. ,, , ,V ,,,f.fw.Q-fy W.--. -Q P ff V .1 M -,fmff - ,,1-.rm m rw-wg, eww.fsmw-f-frwzwh'-wvivl'-ui g f' W Mqwime,-f,'mf-xfi fam if' ml, .1- -A f f ff 1 'L '-Tf'1'1'WF' ww- fwf'-,Aff? -3 'J 'PW-?f'5'f 1?'!WA'1f'.f 2i'9 'TP f W' Lg,,'3u1.k1pQ.,..'.,.g,...f,..z,f...M L....,-W W1-Ama:-MM. ,,..fwW .Q-1,iw,wlw,wi-a,a- :F.:Ef.mi.:J.-2. ww-wfA:,zw,d.a4-um-ffw-ka2v..1,wf-wr, fmw,.-wi'fNA,1:ww5f ,,'4-,..A.f, .ww 2, 5 ' - A . EFT .12 ' S: - ' Q 4 4, - V .W gf. -, , . ' 3 , . L 1 . ' 'gs-if H ' f - . ef. z N 3-:.'--v?w..'1I .Zw, .In I al Q V .VVA .E A Ap V .. . Z' .. . was .. 'f' Q 0 5 541, ' 7 in 5' E Q K M WM, 4 fx..-X . , ew Sf ' s Vi Y ,. . ,M Y MSB!-BEEN. my 1 K f 7? 6 W a LM, . ..' 4' Q . - ffwwifff fs' 'gig' 4. gi vs. 'W' nf. Q' 5 ,ex , ., t ' 1 1' :5'5'f5', 5 . E., ggi.. Nfxwbz .Y 'K 'il' ,,, ,Q r ,x 5 ' is ,Q Q Pi , A .. 50.1 1 A 2 2.- ,A , 4 ,N 1 L. L.. 'Y 'V , K Hi sr f. , - 'Un 4, . is 1 , .1 .. J a ' xy gh - . Kb Q X, wr K LW , ggi iw . . j' Q, '4 . gi-K if Paw -si Q 2, fa' 'if ff z ' A ' A '-1 z, 1 55 E? . f' ff . 'lf 'f 32' ' , w. K 7, ,. L. av . M, . - W -af 1 ,::. 2 A? .fl , 1 .f fa if BQQ H Nh ' E 3 Q I 5 gf? 7 4 M: V ' gg W 5 if 'J 392 - MW X v ii 3 Qi 'L WJ xt X t mr. - .M if wr S Q 5 Y? ' fM fS ?ws5 3 Q ig 5223 22 lf' if Y ? Q w 'we , 9, F fer! 3 gr 3 i?',5 K if 4? w 1, , Ax , Q i QU 1' , . jg UTOV il son Vauken. YK ROW: Beekman. YXec,YmofSecrekaN OUVQYXA ROW: B 'dank UN. 0 YWT RudoX5 , 0 Y' ' df? vesx oXds. X Bl rpm, E. Brown, E. OX- Vxoxoer Y, Gav- ONN: Mu Skevenson. 6Xascoc Wash. Sex Rego s Vxda Sham, ' Mxams. NQNIXXO. eskhke, B'xssovmeXXe, TYXWXO VXOXN1 Doxhe, Vx. NN'xWxom . oomeq, Rodnxord, Boixqevfxfxce Vresx- denk XXX, Romfmq, 0 SECOND ROW: ndevson, Lucas. McCann, Sc.X'me'x6er. ' 0 BOTTOM ROW: Yiyom- ekaw K7-X, YNXCXKBXZ Nfvss Veier- Wt G. Fx Thom, Rxce. skad, Gr'xswoXdfSecr Vveskdeni K'?.X.Tve,asurev Skensonfvxce Vveixdeni WX, 5 v UN. son, f'Yreasure QTO Hu P Ro Qglfgfg' m!QCBef+ie L. Ti, OfV,SROW:OgeY' Ffjow. 5 sonmg RQ'WM. Nfiffew Bakkihan. . : ' Ifl - . Q OND' befg. s Wofkfion' FUqle'O 'H T Son RQW Peece 5n,AH eberg 5- RO' Tolzm :Web ' F5y T Ofd F ' 0 W. an! A Sfer ' aylo ' , Ne' Pre5idL5n+Kiy-ChS+Qf5r'I, Ehgiamre FMD SEC. e G ' . A SVTSOHI C'r Fgwlelm M' fm 0 BOTJOIM1- ecrefar OWIeY4Tre5Su OIWHSO TOM Y' Presiderrir. Iris?-EYECQ ' inelineev. i 9 , X iq., 9 M 4 af? T ig 3 J 'gm W '? A A f' A W.-v -QW W ies ,: . M vo V W! 4, I M is Q, Z3 Th lx! 4, N w Wi? W fd Wi W wwf? 'iwd Mi S W, A I litki., E V ' ' Q4 yr I 1 1 Y .5 K X , 1 1:2 I in-' , Wu iffm ff W f L W f wg , , ,L 4Q.g,7,.4 ..,, , -N fn. 2 1 5 1 W J A Q l if A 2 - 1 M f . , 1 7. - f f . K ji 4 kkik E L H, ?LL+.- 5 lacoxo- Werr, Xl , xrrarr. r ROXNZ LesXKe, NCQ Rm Varrrrdqe, Xfrrra Xrqerrs, OXson. 9 rouraw Xe, GTO? Yrr, Wa . COXXON. bor. NNYr'rpp rr Gar ONNz err Ca erm' ra row K oi. ' O se , rxrrvr Vx r 5, Sacoxos . an, Broqrerr. son. 0 MAN urer WX. ECON se , VNONN ' SQXYN O Bohn fxreos 9 'S V irderrk 6 erxoxg , Xdoourrr N er son. Nfrce re ow ar Waker, Carkorr, Hao 5, XCoXXerr. rrcifxerreqf XX, XXNX'rrr, Vx NN: Ororrq, Xcf arx, Xiu ee, Bra K ekcrq RO X X Y: eq oc, .KW YOOXN' L Secr orrow UN. son 'L Vx . XXX, Burrf Cru'rdrr5'reNd. 9 5 son, Sm'rXRrfTreasurer I Nlkce Vreslrderrk YLX, VVNSS WGN - fVreQrderVi KW, X7-X. Newaaxx OV VXOXNL Wunder, Smqer, 3. Siko- WOYY, iepsorr, Bernard, C. Srm- RONN-. Xiouqhanfireas- VroorefYre4rcSerr'r w. 0 SEC- Xerk, merrrrarr Secrekarxg UN . 0 To 6- P R agfselb Bgml mam ,e:2dgOrdenFrpTAdkCE' .Ngffedm K I A r J W, ' l' Pm., r Enffr Cm - PS,,a, 'op 'VJ 'OKC 'OH Presid ndefso OURTP1 Neko hafeel ard' Wenf K nlwl RO n, Sch . Silver Feisnell- 0 ijel, OSW: Med'- gardLSChW F' Vrom 'RD good, SIQS. PM Secreffv, Q Sim BUCEOW, Rwe dr AT W, I ink r ll : . Hessia residenftzj- H arburf '0 Bger' so n..V, fl Gy-.P On-S T. H' 'Ce P,eQ.g Miss 'E1Siden,eFre. ' emi 0 2, Q21 ntqom ' . HH' ery . Carl' NN as 'YYXWXO rXsorr, xJrarXo Sen M SOB, son. okx S C r X, . a 'nXae,Norkorr. ' Y0oerq,Le'rcX'Ker. , 0 BGTTO er WX. xo. UTS XXX, Maksc, ON0 VXOXN -. Hrrs gurxorr, lamskq, NNaXXace ROW .t Yrarrl rf, gmxxrfireasur 0rMfSe,cre'raN XSMSS LOWN- VXA ar frfegraenr r1r,Ner4fsemraw N NIR:-,e Vreixdervr HAI2 97'OP R S OW- ecrefa f A 5 '5 . F-' aff f!,b,,-Q , y JL ,Q .C ,jiri 4 if 5? L D.. X V ' glrff L, ,-bg, .,,,,1'f ' C . Q H M' K .',L,4,P' V AMEQMNYVX , , -M 7 , V7 I 4 J 1 1 VV-Jw J Y.. ff N, ,Q Q x x GTOP now.. Ecibfaof McNuffy, D. Sfnfffv, Afwood, Sandenfxwce Presidenf ffl, Haffesfacf Brfgnf. 9 FOURTH W: Grosfepnen, Hofsefh, Gerfnoncf Saufe'r, Defby, Beaudofn. 9 Tl-HRD ROW: Nearfzood, Dofpnin, Burwefl Noble, Lob- nvann, Conen, Refnsey. 9 SECOND ROW: Jacobi, Forfnanei, McNaffyxSe refafy-Treasurer flj, Hogan, F son. 9 BOTTOM now' Presfdenf flj, P Lalonex . Twfng fy ff! Aflasfon C C. ox, Mun- . Page, Pfeynvenx . Anderson PF6SlHSNf f2l ff rfee. We e e, C or Woo , Eusffk onra V. Hu dxfr , Benn Of H! Darb gnesx easurer f2 eff, 9 FIFT an Sprun y. Burch. 9 F fnerg, Efffo O! H R W- 9'77Gfl, AMS! OURTH EO f, 3. Olson son, Scfzufz binder , Mr. Lee. , Baile, Burner, I-x K3 ,fr akkgxipgi 1 M f sian W: Lfebenx , Herfson, Gef - 0 Tfvffeo , Cox, Wfefe Affen. 9 SE 7-red-91.1 ger, ROW.- nof C COND fer ffl ioprf Foss-V Wofe, LOref7QeI RO -' Hefmfi R L , Ofderen, Haffesfaof WC X ose, fnnfi, P A' , 0 ROW: WSIDQSA 5,919 er ms Pres1o'eni,- f2j H Snyff 0' efs- HOTT ner, A4 , Presio' f1x7r en! K2 OM cfnnfs enf fl easurer J. XV' ff Miss 511656 Q Msnffn WA, L, C CJ , U' I I' .ff f' .VL 'yi' xfores fi I iff a 4 f ' ,kj f 7' I. , Y .Jff .4 . C :of 'iff-'Q W if J'1fL'4 Lf,-'lr C bg Q? ,pg 'gif Af. Q 4 I f x .tiki ,Qffk ,Lx .if ' , lf! fi, , if 'utffhl I, yu!!! 1 -,f Af zlb IIB3' 'qv H. LNSOHQIRD N- oT r. rOn' rd- ThaYe. W1 5551, NYgf41n f ROW1 RO H ND ag 'f ' ' ll ' , 3 ' - i'2sW1,z'1F?::fkR2:ss14 Gro ,Dobfmeraap-+I M5 Onafildsurerl Preiiden - ISY- . MO' 1-IS. . i I i 1 4 7-4 U M W f' f f P52 T J if 2, Ti U1 M 'r- f -f .Aw R 111775 f IE! - X Qi ,L 3 In W' .wif 2' LV QQ VIDA! fi fn Jbjf I EDJ! iid, x 1 1 u rf - Xu - JJ if T3 ff 0 I oTOP ROW: Denclceri. Nord, Delion. Powell, Mayhew, Lord--Vice Presidenf Ili, Nasby, Widmeier. 0 FOURTH ROW: Rahders, S. Johnson. Kahlerf- Treasurer Alsfrom, Kiesner, Naswali, Erickson. 9 THIRD ROW: Hurd, Corne- lius, Recfor-Secrefary Leslie, Gohlke, Cooper, Romig, D. Nelson. 9 SECOND ROW: Lund, Esfes, Marfin, Nichols, Van Ash Kyfonen, London. 0 BOTTOM ROW: E. Carlson, Solie, Buf- 'rerworfh-Vice Presidenf 121. M. Smifh- Treasurer IZT, Miss Farsie. Pickhardf- Presidenf Ui, Secrefary 121, Rosholf- 1 1' Presidenf 121, Lesher. vip mfg' Ui! WWW W To fliry P ' ' 71, W, . , FAOarf'T'Soirp' Pofglschen , UR 'YXV . fer ' 61 A4 Tx., I I 5 L ills, RO C e P fedes efsef, G masse. D, P W, fesfden, bl, osse from, f7. Q Tsfersen Scfuym en, 171-,ee 055 P171-M. HLQD . pay er, H lf! 0 0 8 S' sf, feowndsi ,?M,,,,,. ff X221 277-O vens B .IHS efler -Eey R . , - A4 ' o '77 I ' 1' ,j I ,Q r, ,Den e s. I, M pdfflclgw' FZ? ROM Aldr,-lk C5770 Rn . . I 1 1 'ngxpf Jack Seve, fxwc' 5f,uH7 Do. I U: ' vi i ,ggi ofsoq. es,-demon, Bro ery fl e pres' ers. . .......... IWW. .... :um ---4 . u.1,,,,,,,:::m.:m:::f.: 5255555555251ggtvssaiissif fly, SZ'7xpre!1 Tmagifenf Cfe 'de 'Sr fary f'7f KZ! 2 . rf 'O gE5Msa1mffsaf::i:z:f:.:ms:ff::::n:::f:z1:::::::::::m--W ., .. mi.,-......:m--,,:, ::-T::1..::.f-.f::,m:.::fQs az :lg-1,.,:mEyman:.5Q:.mm:.maQ::.f.1m:a, 4.L...n1,, . .Has 'x::::a.:E5fEEE5555::-1EE2E5EE21::::-.:::EE3EEF J' .. Jw AVS? 'iii iffy' llsk , .! L 'iff fx ,J F, fi YJ If ' 9 Si! ,J ,T ,Mo ,fiy U fy: FDJV'!-,.iw ws, 31 ,fff',, l Zfljt LL - Lf,-fjffpx' I . M-17 f J V ,f I . Af ,Lf - V. -T --A . ,f . A, , -T f ' - fl! ' A g KAW JA' 1' 1 Ie!! .1 . I lf 1 ,I ' . 4 ,fn V' . .I M!- N A 'M' ' 1 by ' .Q I -, ,fa.f'V VI 11,51 ' 2, lr' F ' -7 T Y .' M' 0 TOP ROW: Kinney, McEnary, Gorder. Gibbs, Green, McOuery, Holrnberg. 0 FIFTH ROW: Brafrud, Exberqer, Collins, Cvrapp, Carlson, Benfley. 0 FOURTH ROW: Jorgensen, Berden-Secrefary- Treasurer lil, Doble-r, Croqness, Mayo, B. Johnson, Can'rerbury. 9 THIRD ROW: Elliolf, Guanella, Moe, Kinsefh, Andre- Presidenf Clnrisfensen. 0 SECOND ROW: Pofvin, Anderson, Colleff, Easl- man, Swanson. 9 BOTTOM ROW: Blank- enlworn, Burnelf-Secrelary-Treasurer l2l, Miss Smi+l'x, McMahon-Presidenl Hessian-Vice Presidenl l2l, J. Johnson. '!lCff ,if .113 F, ,ln-fs-57 ff 4. Lf., F. A A f ' A f . , f f -. ' lf' I ,:,,:, 3 TMJ- ,T if 2f,.Q4'f,fa1f' f ,,e:' J sr.s 4. sf R F K G l j'?1 Q..j -.': 'i 4 V lf f gf sl RATQI gg ,'.r xi j gf 1 1,1 , Tw I ..,, 2.22 .l..E .,A..l -. V Q xx gk, X .13 1 . ' Q. 'r-.X i ' . . ,'-' . ' ,A,.v' Q s ,L,. A all Vx, 1 Xxx , ','- F- F z flfrf 7 Sen- A r ll XX' .iii ,,:A-,f ..., ' ..'A, Q .v., ...-A up -v., -, 0 Vjjekvxkky I X. E5 il1.Q.,-.511i5l3.i.'1f'2.5.1 3-12.54 V XNBHQPQO I' ONR F f XOGT' RO SEC , .T lx' A U . Wk . OW -,URN e Q Xlfll nd. 0 xN awe! V xy b KES? v '-f' iff: '..' '::: ':: ' XO? 9 QAM' XNKW Bova . xM '- . ' 5 A Bk 5 - 'F if T ' ' 11006-il'fWOSw'neSeln Wien- GTS fi ,fv 'E C., A ,,,. A+ K ij P. Xe, ne, O-GO 9,69 A ,' 'jx ' QQ -I Ski 0 2 onedxlz -1 . , - e - v. . - ,. ix '17 Vgatknogginesg,Nmeasnve J -1 A s We ee Q C .2 sk vol F 'S wc: T -lb 'fiwf '3 J 'C' 14,0 , z 441 I E T 3 A Q ' A of ,A XXB-I L .9 . fl 1-, I5 1' 'K J ,R 1 , w 1 :Nj Xl! . xii v E 1 .VJ 5 Q' U e l ,.: l K . ,., ly R 5 'll' x wx' 5 Qi! , , fb s W WWW Rf RFFF fN X bl son. rnwaq. YKONN 1 Johns ' Bess, 0 SFC RONN1 Tvfrko, Fxuskedr Bruer, Fo XN'rXX'rarns. F'xsNn, Hxnnerf xr 9 FOURTH 'WL UOQTT. UTOF as, Farnson, -Treasurer K . Tack, Sdwrn . QTYTTRD VXONN: ' nf TTT, ecrekarq NN' Freernan. u'rsk Wansen, R Vrce Fresxde FT Fsandkrause, CON RO . 0asTn.FTaTTq . CFxr'rsk'ransen, Scok f SnedeYer,Updec,ra , 'xdeni 0 SF Wreqqer, X.. ns. 0 BOT- 'dank ONson nfFres F ad-er, Crave Vresr NN andre ' SrfN'xfYN, Maqers, T5aTc2nf Secreiarq- WT ROW , son, Cxnnskrnan, TOM ROW: Waison. UT. Vw. Xfxndsiedi, Gakesf Treasurer WX ,ROUCT'TfN1'XC8 Fresxdenk O. Soxnnson, 01 OP Qaard RQW s ' T' 5 T' Hiwgx iDEBP5'iTEf!?ST:m, Paul. Tin' 0 TCEQ' Keniovvzhgne' 1512+ Efis CA CwwerD Roedf swnwu 'Nw Coffman- ge' SHHZN1 MCgx1'T'id+,' Felb fe., eg MOFSSECQSB- LOne'nfgck, 'jef -lgrury -I P BQT?OBr9nna5OW': F Vfiwfolpg reasurer resrden M Rowgibbarrbanksr Ill, US SAIL cg Sffonhgl Ag r F. Claellj Jenrjeeler nx Rod FL... Q!-Er 50n..V. Secre 'Ce p V VS' aw fzbsrtlf fl, my m5n4 -Ch Secre alma fgry F5 My ROW: Farnham, Henrq, Lund- Xsfx NQXSQQ, BQTCTWBY, EYTCYY Gannon. Fxereki. obson. 0 xnaT MqMrnn T Urine. Mark YTaTvorson. on, Sdnne e Orfrn 0 TOP TO aser, . 0 TKONN 1 Rn, .Sac Weskp , XX r n Shu FOURTFT Ward. Norion. 0 THTRO ROW. Wxn. CrosTes4. A XJ. Nason. O O co enron. ares, Nfrkaqawa, Sa ONO RONN: Kun-L, LanqTan . Maknews, Sundeen. Sears, Fsornan . BOTTOM ROXN1 Oorr, S'rssonff5er,re- karq, S'reqeXfV'xc,e Fresxdenk, Mrs. Sax! age, TXwa,d+erfVres'rdenX, Pqers. Trl M rclv r, Wnl BOTT : MINS 1. l2l ego:-xi' ' jr Mr Eilundx llj V' onxfree enf llj Drop ROWI Mcleuglvlfn, M Vice Presfdenr ll G Mllfon, Suflon FOURTH He errlllx efcnell Tanner, . Heflfg, S l ROW.' Ne' 6 rfley, Golof H Nelson. 9 Fo '77Sl'. lfT1dl7, erfsgd Tl'lll?D ulie, J J TOP ROW.' Brown, lfllcl, Offersf Benson, Walslz, lflnn, Smiflv FOURTH ROW- Alvlgren, Fu! Olson ein , lrlassel - finder geberg . 9 TH! 5077 fb-fe son, Slv ' , Han RD RO . Anders fnenx ' erffn. na, Warner, W: Sfewarf, ' 1' l on, McCann, Fl Wce Presfd f j 9 POW: Plnl n c Be f TOM l? L Mic e Seeger enf l erlo , n on, Le , eo'-Q . SECOND M Cormfclf, Burn, men, M'll , M OW: F Joflnjon esslg lVelsonXTreas Vice P ' e XSecr ure reSl Sf? Pre ' s 0 B071 efary r lfll l2 , of f l2j, nx sfdenf fary fl . I8 ll2l. . O Mrs. G I l2l, M son ray, Kling- . JOANSOUXSECFS- l'lo,oHns, arof Baflvefn. D. l?OW.' C. Gustafson, oyslfn, Clevenger, Wef'fzel onnsfone. 9 SECOND ROW son, G. Carlson, W Planf, lfauffnve Droege .' Dlelr' esf, See n. 9 , Pinin ecGr I lefl. OM l? ecrefery f l , resldenf K2 . Morris, TFSGSWSP , Ice Presfdenf , Wfls surer f2j, AuranxPres- 05 IOA6-2 Reiq' f. 0 ' Tiansonfh Elegavgank' W: ChrIEfOnSThaNliQne'ROW: OP Rofrand' ofon' TH'RD Eck' '-'Ll fn Os EEURTTF Kne65COrPgND Rciefh. in' C055 'Rubenb Siinlev- Sivhifakfgi Geolqio+'nSO,ar1Qke A,,de'5Onn Freebe rf. ' Iofv W: grip ' 4 iisfii gomday Ilock' picfure- Bu .n Na+ ' d'rsT'r, Br av- 0 9TOV VXONN1 YT. Vekerson, Xiu Knder, NN'rTX'rarns, Vaikerson, Swanson. VCTYT TKONN: Owen, Schuknechi, Xrer, ?urc,eXT. 9 TYTWXU rsen, TnuX'rn, Swen- ON0 TKONNL Tneda. YOU ss, Vo G. Yoke 9 SEC Worse ' en, Vnoxsne VXOXNI Beck, son, Goeiie, T'xT6en. T'nornpson, Erkdf-son, 3enTrfxns, Hansen. 9 BOTTOM ROW: Markrns LevqfN1'rr,e Vredrdeni, Mr. O'rXTner, Ma XSSCYBTCYY-TYBDSUYGT, Joxnnson. Enqek. s NNKne- Demo . OXson. RONN -. T:nqTe, on YT. OW '. T'r'rsV-, XTX, lacks . 0 YWTYT SkerYrnq. NN '. TO? Tl V eiroenk ?xeRc,T'mr6. XNeTsxn, RTW RO ren, Tend! r 'nT'rn. ' CarTson. YOU X , Berg Aix Mcxauq Jenna, Verr, ' aeXson, Boyd. 9 'nq, Dempsey, XCeN O VNOXN: Tfrosieve burg, T'Tendr'rc.Y- Ki. San- SOG. Vres'rcXen'r Mrs. X'TanXeq, Ma seXefSec,reXarq UT. C0 rk owen, Tlx 'rTson. 9 TYTWX Vrce Vreirdenk XXX, Wed son, GnXXwfSec,re'rar4 XXX, T,eCro derson, kJVrTXer. 9 SECOND ROW: VKT1.. osVne'xrn, Sian-1., NN'rX5on, Troop, 6us'raT- 0 BOTTOM VXONNz T'TannarnfX1'rc,e UT, Le'rqxrrNonf?res'r6enX UT aqfTreasurer UT, 'Er Wrer. 'JT OP Son RQW ' D : A amlcro eflllmorel C Hankinsoirlson S r Dgu wen- Phine L ofhropt og FOU RTH RQW I Morse. J,-,ne s, Sollenber ge,-V W under . Sam pS0n N36 renhausenn 0 T HIRD RQW : Mielg Hess Sym! Olive Joh - 0 sg- D, J B H50 V CON oh 00ne.no Kara+D Rgiifn, WO BOTT Z' M :A Odwa OM Rofwow mbrose Hg. : Haverijrnhngt OCR! Secre + my fry, T reasure F 123 - Men. IH.. Presid -V. enf U Ice Pregigienfgjv Mr I M' margn' Wh- . amp men orop ROW W '9hf Woboril A dfews' WM' Cvoffey. Schell mar. 0 FQURTH ROW l'ef7, Wong, M THIRD RO xT fl enberger, S17 .' Dexfer, N C ONS, Rice, W: W17son, W' ' reesurer fl Rofgreenp 8 aflup T2 . ' ,Miss j R em' flj enf flj crop ROW-' Swenson denf TU. 77n Aulus. 0 fve Kelfy, 5' flllqm N T. Rand efl Bo an 3 S, Gilfooly 07071. Mar ulies, 056 9 SECOND Raw. , yd' Safe-ff B- Nefsorf, D N Urfemci 0 BQTTOM ROW ' F!efcf1erx5ecf-efary Woe Pregfde essx e!son,- : G N . f M fu, Presid Presfd 1 1 HIRD mms OND ,O'B er. 0 j Trans 1 L'VSSff107Sf'XP gdale, Beryl, ' r FOURTH RO '77, Shari, I-ff ROW' P B esf- W. Bffrlfl r , E ' nel' S - eel' ue!! F I7 ICR, - 0Of. Gill- . CH , 0 T , Corbeff, F5127 , osfer. 0 SEC X7-fedsurer f2 Penn acfuex' Sffldff Near. ' T211 Ffosfxwcs 1 Treasurer f2j, , Auel ROW: ' rfery, H HOTT urer fl Secr Cros uber, M I7 I J S ?M IROW: Fegljsi , ecre ary 2j, ,Q B STGFY Presfdenf f2j, Miyrlgggj: dl.L7.Smffl7xl6ce Rresidenf ffjl pl' Nor. I4 l0A'2-2 K. DGY' 5On' AT 52i1eMweIT ROW1, ' Pon ROW: bay' QTOPSOHV TFSIEOFURTHI-1ef'5' Kmliaan' Q Wm. 0 lly- S+-an Kougook. V- Geb preSiden. Sfrom' Smifh-. Tuckeh' vice Rowgurn. J- D ROW,Q,Cefa+: TH'RD Black ECON, wh' ROW' Nelsoggwe, glint SSUTBSTTORTM UT. U Fx I-Iueflfson' Vi4ickSOn'dsen'Treis Tuppi TI . rd. 'bran 1, M hagan Couslan Guwv cfzl Trap ul' I re I 'signer -5-ePCreSiiin+ clerk' Rgvglalgjesidenf C VIC iq? wig! M 'if' J . rw ffm , wi Sn , I 9- i .5 fb Q 1 R n mm ,Q 'ig XX . Q' xy if Q , sq one if 'F 5 fgi ff?i??fii,J W ' QW I Q W m X ki xt s . V - - X XJ . , M, f Q H M , A H mgwwf A . f ' . n - ' A- if A ' , L.'-' 597, wffxff 2, QmQf? 'f . , ifkww 'Huw M ' Mundi .,..., K . g ,en M . , M is 3 L Ei R 5-fum' Gif HQ? 35 iM'55,59 f xii sa.. 9 TOP f?OW.' kearoy Daniefs, Downhq h7OW,' Fo el' y, Full.. X Tr , Sedfg. News fn, Borfon. 9 rd, Van Koer , Eafon, Lars f2l. 9 FU. . Corb e. 0 7' en, Pe crefdry-T XPres'd ffj Mr F fl FT H seh B on, H FOU Paine, FT oyef, Spenc . Smffhxpre ' ETH f?OW.' Cooper, Brow 0 THIRD 1? erf, P GTOP ROVV: Hafe, Foofe, Norb Whffesefh C:U'77'77l'f7Q5, Scnb arfson. 9 FOURTH affe, Afffffer, Roclw e orn, Lou: s ROVV: Bafzer, La Sofefn, de Weafd eff. 0 THIRD ROW Roddy, Juclenv, H 9 SECOND A , Sur .' Jeo'h'cK'a, edfn, Hoh Borshefm, f?OW.' Erfandsen, Dfenharf, . Johnson, Wachman, Chapman, G. Johnson, Consfdfne. 9' BOTTOM ROW 19oyefXPresfo'enf, BGDASXSSCFSTGF SC Mrs. Goodson, Bryanf Mcfirafh SGSUFSF, R. J srdenf n, P f ow- e azano' 9 S ohnson, erson L . Hffyer ei, Mo ECO e . of ren. , R. Sm. Q 4 seson, L f P ND ROW- Le, Ky!! 5 K RO 19 L T21 5 lfh, Ac A undqufk. af . Townsend O, Mor, fsff Wi . ers . e eff, BOT OM l'fyXVfce Presfdenf feasurer Convporf I 6f7f , Sewefary-Treasurer f2 foge-n, Fergusonxlffqe S. Johnson. Pfesfdenf 03 l0B6 3 - -mf? ,Mm 'sz- 5B A WWW' my whim' 5 Il, D' dwa r. .IHamSv Fmlhjn- W1 W'n. Be'qSoWf MGX' OP Ri r AHeURTH Esmifh' T e - . Saigon' If 0- Ffgewardiowi wooaecs.. B. ,51fii?dBf'an+H1RDA. ,Nifili radii L' 6 rev- Le'X' -fy D. 0 WSI, Wxensfsgvfz Pifncgrseg' Pefeiil 5' D I ' I I ,. LUVQECOS Clqagij ROWPre5ldSrlZiden+. H- OI? BOTT,er.HfCfSTfiCe son. Tfeasu KU5'c -Hh- Ief' . I MC DUUSWO fiiNs!l:2+cfy- Lem- fm .X ,, .. ,A , ,aw ws,-.. iz , fm5fz 41!f-953 MQMILMWMQMMMQQW mwm44ax2?QMw'ww4Qwwu?wvwwwfQWQhwvwmQv whaviw 15557379851 5? fffawml M-Y nSqaiS 'N 'M Q., .W -. , Ei-W ' -LW gawk it W M' ww S4.N '?w-Qimqgfm , A RM : I -gg,,q ,, Ah -, ., , V ,,., ,V , - ,.f,.l::.i.- 1 sv: Lffiiyzffwi wr, ja-Qi2w,,,5gfg'L 435' 2-ij-5.f,x'ij53gar.',Qi:pj?Qff'gh12'.:idfjfvzi' 152. fi .4.., W A il A as 'Q wfwiwgww ffy :A T a x. . ' T m -4 , ' Q 'ii i f F '51 -1?- 3' Q L 'f' f f 1 M -i t i?i, ' ,, ! 4 m y Www-aw 1 2 WH? f15'zs war ,gg ww vwfw 1, wvfmwz mg-vw wvqgfg M M W Q W ,, Ma.. . ,, , . '4 vw' 1 Q ,y M L jg r w Q .gf mbsf we ' 'H i,g.,,:' . ., W9 53515 , A Q. y,f Qn ' . A w f , 'f x- U' 3 4, vw 1. ' 'A , ' - W . i ' M 1 ,, ,,. ,. ML. N , , ,, FQ -ff' g T? , ., av. - ,W X , We , i f-f ki gf,Qfm y f Msg ? age J .x ' ,f 1 ' M V V. . Q ,. fl? v Q1 Q. 5 Q Mis? 4 f?3 if ,V g 'H ff if-9 4 W fx W Wifi '45 G ,gm-gkgggjaw 43 ,e , H :fl ww V 'V .,,, f. . f m ' ,,: -ww My -We lf J 'f w ma 'B l K 'Q , Q W W - W M a s fffgx M iw M M Nw v 415 Kama? MM My W 3 753 W F P V f 1 Md. Q MW. '. , VG., .' fn. 1- A--3Q..1Li a-' L- X fv . i2 L1L f,gb , ?J,5 S 'f ' 5'W -L wggqfg ' W .Q .. 1-' ?4 w..'41M'1H- V-fw ' W ' K, G , v ig? Lf : vw Lf? 5 - Fil ff wmiqfwaksu gmgggsqzygzwa 2 ,wr 4 F' QU Q9 meg? fe M Ba 5 k . A 2 91' x V ,W L . .m.1- ,m- . , M if-Y, kQ,X,xs 4,, g3g .y.3g,. .x V fiifw . myiumgy ,Q , , W .. , , , . K ' ' 1 Wf wi' W . - -A : ww f-- X , f . . ? n 2' mg 1 fm, W L A WWSWQ 'S in N Q ff M QW M95 Q , iw Q H 5 ' f o 5 v K mana A gm wwf d ,Q 1,3 T 34 fb fgt ww w Wffh W M kiv wfwmfww- Wg 6 H ,. M wma 1 ATE-25 Qigi wvfwmign xx W 9 'W' 531 bggferrfgxgf W ww A ff.. ,, L ,A, - 1 , ' M 1 Y- f 1 L mgwmw? Qwkw-MWF ww? ,Mm ,wwwwffffwfsfg QM WM wg? ,www W4 SWT 's We fe wio 4 4' ,x -ef, 1W59!'j'if 'K' SM 'Fisk WmWM fig' f u-6:98 :W Q' E784 Wf 'U gin wwtg m,.mq+zaf-:af sv sw awww f an W: 1 ff an Wg? mwww ffw ,.-,Q A ,Q . . . Y , 1 fx . . 1 - . 4 ' V gf ,Q A 'i Qs A f . ' .I W - 9' fu- We Y Q , ,, W, W A Sgfffqgm . g . kv. . ,,,. 1 . f M ' X h W . ' '1 A M p f X , I f f if 4 G , 5'-Y HA P ii W' , 'ww 0 : ' X ' I ' n X.. ,. wg 3. .' ,- W 2 ' , L 1 ' 1. 'Z Q - Q ' 5 . , , Gif-fff f fx . f 12 Qa ij i .-s 5. A i w: 4 4 , ,,,, y H M , . f 1' - fi' uw : - 1 f V . A- k .- x 7 Nw M , L. 25211-'P .. Af.. J' ' 55. M k i f ? i f M ' 5 ,f ' 'f li v f 14 ' ,-li af ' 5 ' , 1 ' A-, wg' J '-, ww.. ., ,.,., Gym,- v i i -14 - W ,. w. . ,Ji X -,af f - g ' -J ' fx 4 -., A. -.gr ff.. H A Q -. X f ,mga W ' R ' -'1 A M ' x X W? v 'af S Q af E E A A I 4. B 1 ,Q 1 9 K . H A wi A W if JW ,M A N W ' ai v f N 4 4+ H 4-5' 1 bk 6 ' - x ' X I , Y 'l ,5 J, v ig J r, Q y 5 W f 4 aff? . 1 if ' fm ' 4 1 . A N fam. . , .. .. , . .. i f s - find p 2 ggf 4 W, I 1 1 , 1 V ' .W 5 ' , X: ' Q, 'f Q,':1Jf-M1510 f. 'R 42-gas, 42, ,, Vg 2. xx?-:J , ' , v ',-5Z? 'g .fm W v gi' 134 Q! H ,tllqk tr:-M ,:J H ,wAYw ,,4H M fw wg g Mg: N V , - 4 k' . A T M ' U 1'Q , f,1 , ,' fl , A' fy 7, f' l - 7251 ? -. j i 1', 7?'Jg S J' 3 ., H5 , , Q r -.f 4 . g L-- ,f wmIf1M- 2 Q 'W HN 1 W? 5, I Q. A ' fy .V Q ,N gs.. 'fv A4 Ji sig? Y 'HWY' Q 1 Q A2 df W x f K' -f 'S fig' U' 4' G+ ,. s J , ' e J 4 5 :- ' ,LN t . , 5 gg, J 4a', Q C' T i , 1,L4' M 5 ,, , -in W K M 'ff-2? 11 MM 4Z4!Q.g11Ea-xi-farfyqf'-w Af M 1.1 9-N f '- sf 1, ,, L amd M Sim N mg Sl um Q fv M H, 'K wavswiysv .fa , M' 9 X M32 if W W T f- as nf ' A .L I , - V. V .L H5351 W fi Avmtiiixm F we 55:3 Q. W QW' A ff X f -', f'?.i ffg,jA z - ' W NQ':i - fi . HM 4 M555 fgfmg Q .M ig- V- 7 iw? , , . , . 5,3 va L4 V Q f , , gi? , , QA if H i 4 W wwwwfma f Q ,g f f 'HQEH W vw qt W fm' , 1, Am y M M bww, LJ, R F 1 4 ff ' 'H W . A K ,wp Jw i v , , H , ' ., 1, W:- A ' T? n S. ' ' --Q , ,f fm -x ' ., Af3V' ?-' yi i' W'i , , f fa- 1 F' i J , ., ' f fl , 0 'P ww . Wfffw 2 My , H 1' ff 'hw we U f L f 1 AJ . H 4 .v -' 1 f ,, .. ,. am, , Ae, A, g A f 'A l Q Q if s f . 'E-me Q ,, it Wagga j'gfm3h'u'w iw givin rw V as nw' Mia 54 If V-L1 Mk' b-ggwggv W QYQQQ i' gifigfwjwkwifw wif' 5' 1'-efff k if fhvvm, wwf .gm sm, fm wwlwmlfitgfw +214 M R ,Q .,' , - . l - 11 -. R S- ,- -7 -f . .-U ,, A. 1,. -. .W , H.:-J M .- M . we, ,-p A ..,, , V .zJ '1f' ' 1 w1?3L sv 1' Mfi'f3?f3:5axfs v4,+k-yfvvgsf f ww .55 h?fMfRfm?i53GHx3iWwWTgmQ5 H5 .en , , 5 ,,, .,+J f fg4.f-1,Ws5w,m aww' W ,,a..1?w5Mg-Mnfg W5 5 fem Jaehg wmm wm MW gm :Ny,,y EA wg . ., ,., .. ., . ,A.a A . .,, T ,,A , .,A. .,,. , , , . 1 Q, .Ap - ir?-'ffeig nf- 'f - i ' wi' 'Rf-'iff' :Sway f - 1, .--V--1, 1. , ., . V V e-Wm Z- : ri 1 f, , L, s M ' ' N x 'K fszwihf,.fzmzlmgff 5 1, S., is,-gtyaivif-. I 0 Hi- - .. lm. .. . Q, N, V, Wg: , W, .,,,.1,?.,.sp.5,g,. 5 '-4 5'z 0 as N iw Pu yi wwf Hiwwwxwwg A-ww fbi .wma-4' vm,-MQMM VMMWNS-1 as wmv rf r- A-+5.15 m1 Q 2-V v :Q-v la Jw -q .4 wa- , 4 ef ' wg, m1,,11vgi2Lxi4 5,1 wgffw-,iw,g, M,mMgQ W? new ff M gg M1 ff ep,ww2 M:Q-,9cfs,f 'swM ww-Qfffwff , .Jw wil , WM J' X,-'.,u.1a 7-.H an ew vw-M., .4 JM mn.9,,g U., max In Mm' Q wi M vu. ,xv-lbw f M: 'F' www- zN'1 ffiEi. ZH' '15 K, rf QJ,f'v,Wii' U flea f,,,L,.,i, Y 1 ,,.i..9.gP 3 ff kg. A j- sw Q Mm.-F 'Q ,M ,N 5, ww 41. ,la at ff - N ,, U h A My 5.-W Www-we-4: '.,,,,u'Qi,,,f.',., Mg,-figqff , if gk and-1 :raw , Y X Ll V M M gy 3, gg R2 Q4 M -'vs . P ,vw -mf -vw-,-1 frm-2. mm- 1::1,Laf.,-'W ..,... ,, , . M .. -..N . . Y .- ,M .- V f-4,.r.w .Wu , .. , ,. . .. V bf . ,., V. .. .. M ' ,rw V-.VV mi .M ,, .VV-V,.- ,VV. , 4VV- , ,V.Q 4 3 , 4 , , H , 1 If e'5'? ii !f'Z9x?'Tfi?iFEL'3 fl-5lW3fa'Z2r5 ?'?i 15, M, ,Y W1 :gi ',,- .M,.J,t,N,. 55. .w,a,.ya V: 1,4 ww -,C-,-ww,xggvw,:,y,-M .V-V t rug -,gg-ww, ..-1.wwwv.- A ff., 1 lm f av , . LWf??3U+ fA'y '., YN, ' ?5M',,,,' ' -.:w.:J..'-A1-':1:v:fwrm-fb'-L-w ff4,'--:-' :w1,f.s- aw-f-.:H',Q:,:a21sw.g f-1 M .wwmmwlfiw wwsmw5.rifw-Pde14v4- , 1-'tx f- if-rsfuiftw rw-f :qv ,- J1,.,,,,- X ,f M ,lf-if -wfw j gfn '55 .,1fw.wMf- if ml ,wj ji-'f.:.m M, Ly? -s f N W -4 ,. X wg, J: mv.va.Aw3m W-Egg, vzwgwa wvzigwm ,mg 7 -av kprg' S :ken-zrs-zw vamfifwsv-9 ,Awww 2- ,tigsh wg We Mifiiw , N s43,,...W Q qwwwxewbgyngyfsqqxywwfiwlw .ffiwggwg .mgsfflain 'EMM W - ,2f,w aff ,k 3 3 ' 2 W ifi , , . ,W , W ii w, , I V iw- M nw -. .. ,A,.,., fy W , - . N 4, . wi, f ur W ww K G JE- T! ., 5- uv . ' 3 1 4 , M - N msamv . ' f . -. am., -1 M b y - W , A f . . K '11 F ., WL . - Gm ' ' L' ' ' Q T ' f g fw v , M ..g.,m H - , fn f- QQE ' J : . ' W gym, -, Q- M .-V, ,, :f f af E ' -Av 2' Q my 1.37: ' Wfxad, g1 f -- 'W' P HL, '1 WWW f wmwsvf Jgwfa? 3554 Q Wi , Q Y W me 'W 'M S 4 f -L' 'ff 1: ,- rn, ., -xrnnf wi- .-, mid. 4 : Lu N, -ww -L' v4 .. 14' ', 17 Tyr' - Av auf m,4:Lm?3.a 1, 'N-J '7f, .-wi ,111 :Kilim L .W-.dev 11 1 A-24'- W wif H191 wi, , W , , ,Q ,,.'35ff9k'1,,qlN5 ha? I'Tw,'1.51,.,a'? wgxmfiimfw 5 sw, :Exif wa .tw fgmw f fwf6 hf Eqw wxkfnq as . g, M 1' v . ' M - ' -- ' W 2:21 .52 I QQQ f 'Ht n ' .- 3 ' Nifi A ' - i f J ' Af - f' m f W . if'S x... 5, L, ,. ,IRM Q., , :A 4s'fQx,4:w'w4.1,-Egxfw-WN.fmmx 452:40 -vffwf' i, ,W . ...., ...,. ,. .4 ,,V.. . , , ., 4 J y H , - - 4 t W 4 w v ff vw HC Q 1+ ' 'sw :ww ,A M. 5. -i w :U i - - w , , M. H ,, 3l4QiE4,gk??iwfS'gM f.Q5ffE'?f'3fA vs 4: ff MW 2, 4' Jn b K , A 1 HW 4-mg+w'MffWQwiw,..a2 55246 M My w 25523 5. W ,ig Q1-.AH .ex PN!! V L , Ev , ., - 'I - .L k - .5- J J' 1 .'T' ' A . Fei M , '?z - ,MH ., ,,, ., 5, .. ., iw K ., ff my .,,.,....1 ,X my , . , 71, 35543 3, x,., ,L .K P , .fwfsWf. Www. LA WM? M wg W kg EEYM www Q, W Q M Wi, ' V, X, ' i I Q S5142 ..,w,.,....,, ,..ef - s,,.N ,m M ,imf.mme:Z, QAM . . dm-4.,:Ef.em .W 'A .1 .wx -..f . 'Visif '-Q--m1'..,x 1:-:mf,:N-wwf-f-vwm, . M1 Aff 1 , 1+ 4 bwwwv ymwzsww Srffmmxgf -Y xN'5W5N V1 ' if 'M- E p Aww:-'M fm 5 + gAgXfhkgfA4,Q. 4-pggfay n y-gsiagg,-.,5?v Aga 'V fx, , wiv swag A A ,, , , - X -V , . , V YW - . V . ,H f , ,, ., 13. lvl '. , X . . ,v gg y ,9 uL.,,. 1 ' s.f 4 1 -fu . -QQ' EM ' , .f V 2,214 -5- '1 :uw ,Q-1.': ' f 5X'y .. 1 g A , 'fx V-53. ' . 2. - -- --' .Wig 1 ,, Q 1, 1?-5591 A wmeraa 1...,.,p. Lam v-fmw.JMxa.w4 fW..wf..w .1-wwnqwqasfz swam-M '-wwf'-H-'W -W'-'nuux'-f1wM+.m.efvwA' -saamamsd 1 Q ef Q v W, M , f 1 1 'Ff wr if ,fx gt ,.. In-fan fl if 1 ls , dvi' ww- if 3 MY ami? . 511 2 W, ,f AL 'zu - f. , ' ,,,, , 3- M f Wm f 5 - r W , x , . . .A 1 12 f' 'if H+-' 5' ' V, H - V - 'W man n . .. V Y 2 fr ff .fm f ?m1f - M 5 -. 1' f ' QM dj' A n 9 A ' : p f , , . 1: 'Y Wa' ,af '- f ' . f f f fffi af . f , M y ,ww ,gan V A ,S . N,3,mAimM,!E5,343Qiq,. 6TwaAuF.W 4 WM I T V ., W H M 1' -K ' Lf W ww V Q, ' H Y- 4 1 fyfxik 1: wffrggwf-f 5533411 :,wm vw WP , ,Q 4 ,gig s 4 ., w 'iv1x W v W yi Q 2 5 www M ' , + ff ff' new Wm X M1 'W W 4.ZfL..v95'Q' r- y ff? ' U 'L Wh , N fl if f f Q .Jr fffff.-Mies, mmf N K as ww ir MMM V-W mMmm+M.ww9 Qwaywmafyhhmf fawmwfws y R 4949 . H ' .,.39figf515Wlff2v fges?22ff f,ge M., 4- .Y .v . ,,w..m V Q -Y. .M 'i f L 4 ' ' L' i f- -, iif f 3 is M 'gpgsf in 1996 , wa, 1 hw ,vm - M ' , A5 W M-M mwmswwf if-fm . mm wa W em ,mm My , .. .- 1 ,. ,W AJ? . ,,, , , . ,,..,K,A , K,-W, W, ,. www X M x A G , . ,. M. H f.72 :N' a 'wfi ft-.X 1,Q7' 4'3?j , ,, -,fN'U '-- iww l Af 1 vf Ev, . HQ, ,, . . .V -,-- ' f ,. 2 -' . ' A 1 H Af, ' W -1 df 5 x 4' 5 - Q 41.4 V :M Q' 4 ff: -, ' 1 V . as ,M -Mxxfigin M , any - 15 4- 5 f , ,X ,3,. ,- V .A V 1 r y e, s X . nm - 'W: f f : 1- 'Q - 4' W ff fi. 1. X31 1-' - V M nv H .Y ix . -. ,Was-,mm Y .f We-33 ,. . 'Y - . . x,,,k,.,, 'Lugz wk . 1 gw n- na- ,-4 H. ' fi .' 'f' A ' 4 , v '.':f .- , vu' ' 1, -' . -' - he e? W V , 'w my ww-W aw gig Q Q 'Lv M ' f f . Q . . H . . A , ,, ,, . . , ,M . VV-- Q 7 A as A , A 1 X wg. ws-WMMM a We W ,, , VV 1 ':3V ' ,f f g l if '. 2fNf wgli A WV' Q :vi p fi f ' ' M , -, 'iff + . yy W- V V N 4 --V- 'WW ' A N f W Wilw ' 7 Q ' WT Q mf A V ji I - 1 f f mwwww 3. f igefwf ' 1 . .. Q1 1 - v95QQVf?3fR4 ,,':ir3whV-.' , ' 1VfV- ws -. K f ,a V. .f Wggf - , Mk V.V-VV. ., ,M ,.w3fiK.,1S+,:-hi S W VVV , . W V v :QSM A' f l? , T ll .1 may Mig' 552334 WW ' 1' 'i im ww M2 Bk SQQ' Q W- ' ff sf K :,,Wg,:pW,--aw Qmwgwi y ww .W 3, PM A f Wai? 3 ,V W ' ' . ' ' fix-m mf' ' ' . C. . . ' 'W 'N QV ---L-J 5' '3 'fi wi 5321-gwxym 353:33 034, V A ag M + 6:5 A ,,, Ah ,J as Q 4 in 1 ip?-f ,, K , ,.. gsxqs Mgihfg. A-'fp ,, Q, ,, '31 My .im-..y, ,,. 5 , ,. J, r v- ,- M' A f is we m fm. , , Y 39 wi ' 51 12 , 442, lf Q 7. 1.5 ,V ,.-M Q 3 i, 1 if ra 11 ' T' , 5 .412 J A 1 ? x 1 Y 5, 3? X SQ fm, b if MH W 9-mf vagal -we gi Q qwgngf mwi5w4,.-Elvis? :S yu f ' w a ' 1 fi mg1Qf.gzs2fr?i.1ff iii: -1:12, A z Gsm t ff' .gg-Q' fwfwihm-W fgwmwf M ww www vmvwwwif , ,Im 'WW ' fa WW? ,, 4 ' gsm, M M V , was . - y v i 2 ?51. f 1 V 4 L1 V Q - gp S' :'f.,,'.5,' .M ' , ,AQNQQ fx' . ff, 1725 ' .wJ 'C- J ' v ,-N ,, .., '.,!,fri 3y'4HL 1 MP5 R t Qewwmwfwwfiwfwmfb L Q-W fbgwlwwswbwx ,Q awe? W W f' -V-- g 1 I g Q X V, V... ,, lg , -4 Ms , l ,Mei , ' 4 f FQKEEQ' 54, .55 M . . M , 1..,2,56, f. - S M . ,. -gm, , wi fm ky Www wwsifw wgwmwww www! new W FQQQWQW WQQWXN 'ffw P ---' f l 1 1 , --- yi A . A 3 1 535 I 5, V533 W fmjff gun?- ,'1., -X f fffw -- ,M Awwfww 5,55 +V, WM if - - - xwggggkak, wp, V 7 - f D 1 4 ,N VK? 1 Y sf W? Q 3 wx? gf? gismee ggi wg? il ?'3F5P4 +?s'N 'f W2 wins 55 W AMW 4 W2 ' www J -Sgigwvafk fm? '55 'Wh iw W2 'L X W 'zwwmfiaw f ' Q' Pl ,E4QQ3WiPFi ' ff 'f' , wi 'iw' A My ' W f Wwmww wo M H-ww ww WWW? MM fwyzfrifi Sfdfwifs :WV wi? wif? 5' WW ff I f . 4.4 -'V-V wwf .QQ Q7 1 5 g 1, 1 7 TA 5 'A 51' '11 1 131? A W f + L A .Q YN ,, Wmfiw ,,,f6mfq M 5 W vw 3499,-:sm wagwx ' fi !!f'f gg? g'fiMiV V'fe,i, Lf Li B Maw Hi Ewwf C aswfigv is gp H ' WW fwmn wf yjik my 'iff-vlwp? vm .4g11,-S55 U X i iglvisqm K 1 J 9 wfinifff Miwwmwwgx V- - ' Q 7 9 4 4, ,Y Q 2 ,f r A 9 , f ' Y 594 A yKQz1'mg.f'x , '2 ' ff- -.ww 4 , t..g3W. , jP 1H.f?,1iv WWW V f y 1 ' ' , Q :Sw Q rgiagm iw , ,,-g gi . , if ffl 5-Q , L p, A , .-1 A ffkav- 3' x 'y yffg 2 df ,w ha ji Q Q, s , AA ,,.,,,1W,,p- ,Q-,,,.f:M, 1 - w w W www Q '42 :A 1. mf ,xx 5, ,, 3 , M' , I, .I pg,- ' , y ff W ' W A ,, 1 4 ' :eff 45 . ' :,.gfw'L K X QM wal , ' - 5 xv 1, N I K: my A0 'iw 9' N . ,Q ' M ,, W 4 H E , 2 4 Y Q 1 'P v QQ L A X ' M. ' ' 'fd 'W ? E 1. ,g f 4' 9: W S eww, Wav . he . .M ,J A M ffggx , r xx E 93 Q W H-Qu. MN, Hi, 'gg-af V xA gf M ,, fp i x qs H, Y 4 gk ,gk 'Q , Z , J -5 5+ 5159? , rigid , ,K .- ,ff-92 .. H , f . Jw Q -1 wig? wk' ,, 1' LA '5 1 F 2 W ' , w A Q .f ' 4 5 L 'avi M. ,fn v N x 3. L t W w iff ' . , H M N ' V 'vs 624295535 M 'mu M '-S W , X wvhr a it , 5 fx, use , - if Q x '7 'm 'i , V '-1 .. r 'ZEQA 11:-if ' 1 U 332.7562 653,521 W 1 f v x ww 2 f ' 'x . Q E W U ff +2 ' 1 ,, Q f Q f J 4 M' , . kv . L N 1 J w ww ,, W W Q , M . 1 v M g U, 4 .git W i t fki f g 1' Q' ,fi NMI M f- A A S 1 4 F2 - H.,-g, P 1 H, 1 ,is 4 3 1512 -, 45 .uf 4' , W 1 . , Y Q r,fu-r'avq - nf 5: 'vi v 1a,,,,,5m':a - ga 0 a M 1 3 1- 1 bw mg, A f 1 glggxfv-Fw-J-,- .. ga? MQ' E W, 4k r x mt, 'K A ? Q W ' K- ffwmaw mi. Q gggw f 2 m 1 4' 1 Q H U 1:42.41-1' 5 , W ' 413 , K hif , 'RL ,A K 35 ' ' Q, :'s-LJ.,--L: ' fi' ' J 4 4 Agn 'N P R '?':'f'T 5' if Hg' 'Q ' 2 if 1 my ilk! Jw. nf? . , 1 ,W , 15,9 L 17 Q ,gg S ., f , 1 Y t , 4? ,aa ew 6'.'V 'f 'F3 W 1 1. fb ' 'W 1 f f ffifiv w .Jimi . , ' A A 'K' N' J: J f my . s g H - , '. U Q 1 -A Hn' ' AH 1 ' ' 'Q 51.4.3.2 4 5 Qi A1 ' YS ' U PW A, Q YQ f K 'fl ' M , Q - N , . Q Why, 8 2 Q Q f fr fm Q fm H RQ, ' , 7 4 ' 1 , Ni ' 'ia Qs ' MQW ' , ' g w t f iig , ? 3, Sir M' 'Egg 'f Q Y , ' ' W im at Q ft fe A N' Y 4- , W - an , my e 2 3 Z W Y. .+ 5 ' f P 1. ' .lx a EBI :W A K , 3 t 3 W 1 if an V 1 '...'3 V X' X. , sk Q55 ,ww A Q -if 5, 5,55 N I if A M - My , M .gf if ,, mi M fl f g .M f W 4 .N 051 , k c gg? J 1 1-1 A 1 1 My eg, 3 , wr, 655 A , Jia ,,, ' ' mlm, Q'-Zim : WW' 'wx ' M 'WM sf 523,57 f L L 1 1 W Y ' A f k f K f 331 KW K Q 2 A ma , ,xi kgitksfk 1 M We M 'f - X 1 V , ,A , , A ew X Q N H, , N , xc WJ v wx, f P- ..-' f vw v 4 1.9 X m Mmm 14555 3' , 'iff 1 , iw lg f M P1 -1 K 1 5 1 , f , F Jig Q W, . . fi wg ' l , x , M iff? - -, Aw M: ff 1 r, 1. +9 4 v 1 ,V f , . '. .. 1 Q t I . f I 9 X 4 'X IME 5 A QW fa. I Q 1 W 4 Sf Q3 N ? . ,, W K W 545 1 W I as Q f f -'AM N ' f ' 3 W 5 L 55 A 'Q 3. 3 4 , Q M W x 1 , 4 gegm 1 AW N We fs il? J Wx WDQW, 6 YW A gl ..L. Y, ., W A I mga, WM WE? W K? + if 15, f 4 . W Wig? A. , Q J , wg ' A f A ' www fwgglffifgsg' SW 2 ma? f 1 ' V we 4 Q EW: Q, Nik yr 1 k , if 'f Q xv: MAE? A' L51 Q ' Wave Q, If . M gg A 5,3 'Xian-xabyr L x 'f'- P' N' v m? K L I K ggi H: M 'Q , A AV M, W f MW? in A 2 l 0 Syme, STorkson. 9 BOTTOM ROW: Merrill, McGraw, Mr. MacOuarrie, LaBlanfQ SecreTary, MacMillan. TOP ROW: Carlson, PrenTice, Files, Cravens. 9 SECOND ROW: BuTTerworTh 9TOP ROW: Mulligan, NorThaTT, Olson, HarT, Hannam, WolTT-SecreTary-Treas- urer Maynard. 0 THIRD ROW: Juel, Files, Owen, H. Wash, Copley, Snedee ker, 0 SECOND ROW: C. Snyder, BiornsTad, ViTz, Foulke-Presidenl' l2l. Le Blond. JusTer, McCarT, Hogan. 9 BOTTOM ROW: McLean-Treasurer ill, Morris--PresidenT ill, Miss Mossberg, Miss Brown, L. Snyder-Vice PresidenT ill, KAI I f' I I I I ll' IN ' I I IGI I ' I 0TOP ROW: Siegel, LiTTle, Hay, Olsen, Meyers, Nelson, Cox. 9 SECOND ROW: R. Eisele, CoverT, WesTaTer, D. Eisele, Anderson, Andrews. 9 BOTTOM ROW: Maag, Leslie, Miss Johnson, Miss Lund, Miss Borreson, Ahlgren. THUST UN THT HHHHHS Sillllili IIHIINEH Any boy or girl who is elecTed To The STudenT Council musT be especially ouT- sTanding and a True represenTaTive of his or her class. Two sophomores, Tour juniors, and six seniors re,presenT The sTu- denTs in decisions concerning school aT- Tairs. During The year They sponsor pro- grams and speakers of inTeresT as well as overseeing homecoming acTiviTies. This year, under The guidance OT Mr. Mac- Ouarrie, The council successfully under- Took a new TeaTure, an ouTdoor audiTo- rium, including hockey and Tigure skaTing. HHHHHY HHHHH Washburn's library is one oT The mosT appreciaTed deparTmenTs oT The school. ThroughouT The day iT is a consTanT source Tor obTaining books, and also a place Tor quieT research. ln order To meeT sTu- denT needs. The librarians musT have acldiTional aid. Library Board members assisT The librarians in general work, Take charge oT library passes, and also have compleTe auThoriTy over The Book Week display. BeTore becoming a member, rec- ommendaTion of a Teacher and an ap- prenTiceship of one semesTer is required. Uiillli HHHHH Girls who have Taken a commercial course are eligible Tor membership in The oTTice board. Under Their advisers, Miss Lund, Miss Johnson, and Miss Borreson, They are TaughT The mechanics oT The smooTh- running oTTice and are given pracTice in operaTing adding machines, disTribuTing mail, Typing, Taking care oT aTTendance. . .,,, ,,,. :'ff1?::i.-. f:fE f f f1f2fe::-1:---- 'E ',.,., .,,.,1:5,,,,,:'.'- ' 5, .,.,,,,,,.,.,.:',,.,., s.,,:,,1.,.,5,,,,.,,.,:g' :.,, .... V ,,.,,,g - 251:-1' sxxxsikg Q NHTIHNHT HHNUH SHEIHY UTOP ROW: Meehl, Dienharf, Thompson, DownTon, EusTis, FleTcher, G-aus, 9 FOURTH ROW HarT, Mulligan, PrenTice, Braasch, Noyes, Beach. 9 THIRD ROW: Danelz, Kruse, A. Johnson Springer, Engler, JusTer, Friend. 9 SECOND ROW: Rockwell, Snyder, Salkin, Kerr, Malcolm Taylor. 9 BOTTOM ROW: Hansen, McLean, Mr. MacQuarrie, PainTer, Sforlcson. Membership in The NaTional Honor SocieTy, a naTional organizaTion composed of sTudenTs who are ouTsTanding in scholarship, leadership, characTer, and service is one oT The rnosT coveTed honors oT The school year. Members are chosen from The upper one-TourTh oT The l lA and T25 classes by Their Tellow classmaTes, and Tinal approval is given by members oT The TaculTy. The socieTy meeTs wiTh Mr MacOuarrie To discuss quesTions viTal To The welTare oT The school: The group also discusses and conducTs experimenTs in new Tields oT educaTion aT iTs meeTings GTOP ROW: Cavanor, Lindsay, WheaTon, Kunz, L. Erickson, Shaw, Waldo, Paulson. 9 FIFTH ROW: Pfunder, Leslie, King, Glasrud, O'Kie'TTe, Mayhew, McOuary. 0 FOURTH ROW: SmiTh, Weiner, Haas, McDonald, BooTon, Deeds. 3 THIRD ROW: Yager, RoTh, Morris, Crisp, Balch. WeTTerIin, B. Erickson. 0 SECOND ROW:.Krueger, Isaacs, Mallcerson, Hahn, Salkin, Carlefon. 0 BOTTOM ROW: STolces, Carlander, Mr. 'MacOuarrie, Miss Goldsworfhy, LaBlanT-SecreTary, Henley. v H30 95101-4 :,,,-2 9fE'Q 1 Z LPSTZJO77 050650 05222 l' ..1 -. .4 291' 5 . mm 57: 0 2Oo.gg g-I11-. F5255 IZVF JT fiifgeg 92035. HSS-Ln Ol' Q o' GU' fi P' .1-,X ELO. . OCC- U3-750 am-IT ,-Q13 9- WO 3 530' -9277 '5-w Zu- T 0,023 5:6 -. cfgp' 5352 E'?T7'l .5 5, Sag? 3322 CD5'P'!. 27 Q o. 0- Qcf Omg-0 1-m3'1'1 703- '4 - 'I'1 . 2 -, - PI SU:- ni -Z7 QWO 3295 P0125 ?km2 523 ' foam A -1 M - ' !7Q ZOQ 5' OO-:J 'f'ofUm -.K 'li INS! 2.20 021112 E :T7'U Hia? H IH III HH IHI HHHH IH 'S 2 N IH HH IH HHHHH -+-3-mo: Q-0140? -4CDj1+ 0coJ4f7w' infix 55223 -.U'IS' -0-5'q 3 QWEQQ alan -3-C2 Q. C53 miiwa HQQI3 IGS? L- -+- DT n1 '-1-gf 3-0-01,90 mgg-mC 3332? cn on 315' x:0fD ',,, 2019+ a3ma? vw-51.0 3 .9500 oi 33001 9:2369 ROC--U-. 21263 lgpgi K -. Mm?3: Q'moD m'O-,-'H'-Q 113.01 0.01 O O.iD,,4 1 igmmo momma -.Q--F7-O LQ 9' -+- 50013128-5' 3- Ln yi F1 lmgqm U1-' 3 Qjgiokgo. ww -.C-, 0 33260 'l,'23 l?38l mm' 39'- 0 mlm 3-CD3 00.9-an 350-02 03522 -.Q.Q, 23330 8553x007 QQIIOO -Vi -41-9-1 QTOP ROW: Clark, Olderen, Waldo. Wheafon, Slevenson, Henley, Paulson. 9 FIFTH ROW: Norfhfelf, King, Beaffie. Erickson, Larson, Wnifeman. 0 FOURTH ROW: Eisele, Cowie, Lindvall, McDonald, Copley, Williamson, Boofon. 0 THIRD ROW: Swanlce, Isaacs. Hol+on, Taylor, Ball, Weiss. 9 SECOND ROW: Elliolf, Dralce, Tillofson. Beacom, Wash, Cox, Snyder. 9 BOTTOM ROW: Carlson, Aflcins, Miss Trowbridge, Mr. Brackeff, Juel, Weigel. 9TOP ROW: Benlon, Asper, Haxby, Hockell, Larson. 9 THIRD ROW: Balch. Workman, Shirk, Craswell. 9 SECOND ROW: Everell, Grapp, J. Schrufh, Bishop, Geiger. 9 BOTTOM ROW: Noyes-Secrefary-Treasurer, Mrs. Nefhercoll. Drake, Afkins-Presiclenf. 9TOP ROW: Waldo, Brislol, Wheafon, Friedl, Pomeroy, Lindsay, BarneH-- Treasurer 9 THIRD ROW: LaBIan'r-Secrelary I2I, Engler, Meyers, Sanford, Yager, Jusfer. 9 SECOND ROW: Salkin, Sabor, Beacom, Shirk, Kavanaugh, Pear- son, Snedelcer. 9 BOTTOM ROW: Cooperman, McLean-Secrelary III, Bealliw- Treasurer III, Presidenl I2I, Mrs. Nefhercolf, Prenfice-Presidenl' III. Brang- Vice Presidenl III, I2I, Applelon. 9 TOP ROW: Bush, Ausiin, Cavanor, Gays, Haas, Danelz. 9 THIRD ROW: Smilh-Secrelary Rankin, Foulke, Norlhfelr, Riley. 9 SECOND ROW: Friend, Snyder, Keafley, McCarf-Treasurer I2I, Briggs, Sfanfon. 9 BOTTOM ROW: Le Blond-Secrefary III, Kruse-Presidenl III, Miss McLaughlin, Brang-Vice Presidenl III, Collins-Treasurer III, Presidenf IHI IIHYISIHI IHINII Hlllllllllll Following llie fashion sei by medieval lrade guilds, Washburn mainlains ils Iwo dramalic clubs. To become a member of Harlequin, one musl firsl be an Appren- Tice. Tryouls are judged by lhe presenl Harlequins, and successful candidafes are casl' in a play which is also raled by ihe parenl club. The nexf slep -in The rise lo fame is membership in The Har- lequin Club. In order 'ro oblain member- ship in lhis club, one musl possess +alen'r superior lo Thai of Apprenlice members. HHIIIIIIIIIN From 'rhe ranks of Harlequin, Jrhe dra- maiic club, come Washburn's mosl' promising conlribulions lo 'ioollighl lame! IT is here I'ha+ poise and personal- ily. so essenlial lo good slage presence, are firsl pracliced. A series of five plays. direcled solely by sludenls, is presenled for audiloriums lhroughoul' lhe' year. Lasl year lhese plays were presenled wirh much applause: The Valiant The Pol-boiler, The Flower Shop, Red Carnalionsf' a n d The Rehearsal. lllllll From lhe pens of several of 'rhe Quill members has come lilerary work which has won Iaurels for 'rhe wrilers, as well as for lhe club. In lhis club, crealive com- posilion is encouraged, and advanced. Three limes each semesler 'rhe members wrile and hand in original manuscripls fo be discussed al a meeling. Olher meel- ings are devoled 'ro 'ralks on wrifing or lo a program. Quill CIub's membership is Iimired 'ro lwenly-five acfive sfudenls who show lheir superior merils in wriiing. PHINTTITS, PH A noTiceable TalenT in The various phases oT arT work is The requiremenT Tor Chroma Club membership. This club meeTs every Wednesday aTTernoon To discuss par- TicipaTion in, or hear abouT The various Tields oT arT lmporTanT parTs oT The club's programs are speakers, craTT problems, and Trips To arT cenTers, and a parTy is given Tor The graduaTing seniors oT The club each semesTer. Chroma Club is also responsible Tor posTers and programs used in The school Tor school TuncTions. Washburn's PoliTix Club deals wiTh po- liTical and economic condiTions Through- ouT The world, The naTion, and The imme- diaTe localiTy. ln order To discuss Trom boTh sides These viTal quesTions, The club is divided inTo Two parTies, radical and conservaTive.. During The sTudy oT labor relaTions, Rabbi AlberT Gordon, promi- nenT Twin CiTy labor arbiTraTor, spoke on labor relaTions. The club is also en- deavoring To promoTe correcT parliamen- Tary procedure in Washburn home rooms. PHUTHBHHPHY The candid camera craze has reached iTs heighT This year, and cameras have been clicking ThroughouT The school: in classrooms, aT aThleTic compeTiTions, aT club meeTings, even in The halls. There- Tore, The PhoTography Club, which has developed rapidly since iTs TormaTion in I936, is one oT The mosT popular organ- izaTions in The school. A dark room be- longing To The club is equipped wiTh modern phoTographic equipmenT and is available To The members aT all Times. TITIEIHNS, PHHTH-THNS 0TOP ROW: Henley, Olderen, Wesley, Anderson, C-3. Carlson-Treasurer T2l, Dean. 0 THIRD ROW: Jenne, Cowie-Vice Presideni' l2l, Morlc, Rudolf, BooTon. 0 SECOND ROW: Burr, Benlick-SecreTary DeiTrichson, B. Carlson, Forberg, Holfon. 9 BOTTOM ROW: Kingbay, Swanlce-Treasurer TIT, Paulson-SecreTary lll, Miss Trowbridge, McDonald-PresidenT lll, Kunz-Vice Presidem' lll, Presi- denT l2l, Taylor. 9TOP ROW: Evarfs, K. Block-PresidenT T2l, Des Marais, MacGregor, Cooper- man, S. Block, Kaughan, Huenelcens. 0 FOURTH ROW: Haas, STevenson, Noyes, PainTer, MaTher, Collins-SecreTary l2l, McDonald. 0 THIRD ROW: Sallcin, Balch, SweeTnam, Meyers, Friend, Weiss. 9 SECOND ROW: CarleTon, Snyder, Garlough, Johnson, Waldron, Sriedelcer, Juel. 0 BOTTOM ROW: Foulke, Yager- Vice PresidenT lil, Lindsay-PresidenT Til, Treasurer T2l, Mrs. Hanley, La Blant -SecreTary Vice PresidenT l2l, Parsons-Treasurer ill, ATkins. 9TOF ROW: Ericlcson, Pomeroy, Sorensen-Presidenl' T2l. Vieau. 9 THIRD ROW: VihsTadT, STevens, LaboviTz, McEnary, CroTT-Vice PresidenT l2l, 9 SECOND ROW: Mclnnis, BraTrud, Friend, SmiTh-SecreTary-Treasurer Hes- sian. 9 BOTTOM ROW: IldsTad, Olin-Vice PresidenT lil, Mr. Janes, Braasch- PresidenT lll, Hughes-SecreTary-Treasurer lilllll Nllll-Hlllllll llllllll GTOP ROW: Mulligan, STruble, Cavanor, Rosen, Des Marais, Gaus. 9 FOURTH ROW: Rockwell, Weisel, ATkins, Drake, Townsend. 9 THIRD ROW: Sanford, Le Blond, Salkin, Morris, Yager, Weiss. 9 SECOND ROW: Snyder, Collins, Noyes, Garlough, Malcolm 9 BOTTOM ROW: Black, Friend, Miss Dowling, Snyder- EdiTor lll, Feinberg. UTOP ROVV. Moore, CarelTon, Cox, Drake, Ogden, Weiss. 9 SECOND ROW: Snyder, Chapman, Afkins, STruble, S. Block. 0 BOTTOM ROW: Rosen, Collins, Hayes, Miss Dowling, K. Block-ExecuTive EdiTor, Feinberg-EdiTor-lnfChieT. EdiTors and reporTers alike cornbine Their eTTorTs every oTher week To presenT a school paper Thal is ouTsTanding in every respecT. Re- porTers bring news Trom all sources in The school, and The ediTorial sTaTT classihes IT and puTs iT inTo page layouTs, lT is The Task OT The edirors To seT Type Tor Their pages The Wednesday beTore publicaTion. The GrisT perTorms a valuable service To The school as well as provid- ing enTerTainrnenT. This year's GrisT has been a pioneer in new and diTTerenT ideas ol journalism. One oT The newesT improvemenTs has been The addiTion oT The posilion, ExecuTive EdiTor. Through The ambiTion and originaliTy oT The edifors, The G-risT has been awarded The All American raTing in The NaTional ScholasTic Press Associa- Tion, which is awarded only To high school papers of disTincTive meriT. HSHHHHN EdiTor-in-ChieT - - - Lois Snyder Co-Second Q - l-larrieT Friend Page EdiTOrs -T, A - Paf Sanford CO-Third - - - Joe ATkins Page EdiTors - - - BerTrarn Feinberg n S - Peggy Malcolm News EdnTors .N Mary Janef Noyes Q Mary Drake Business Manager - Connie Rockwell SporTs EdiTor - ExecuTive EdiTor EdiTor-in-ChieT Third Page EdiTor News EdiTor - Headline EdiTor Business Manager SporTs EdiTor - - - Ken Block - - Ken Block BerTram Feinberg - Marge Collins Mary Drake - Jimm Weiss Carol Rae Snyder - - Bob l-layes IAKYIAYAYAYAI 10' illf INTHHMTIT Ill SEHIHH TVTNTS H3 llll llll TH 9TOP ROW: Pierce, BerTrand, Hayes. MacMillan, Carlson, Cooperman, S. Block, Labovifz, HarT. 9 FIFTH ROW: Killmer, Kixmoeller, Hanson, Moore, E. SchruTh, Snedelcer, Chapman, J. SchruTh. 9 FOURTH ROW: Cox, Wallace, Juel, Hansen, Olin, Bowlby, Ogden. 9 THIRD ROW: Meyers, La Blanl, Olsen, SmiTh, Larrabee, McCarT, Hendrickson, Abrams. 0 SECOND ROW: Sweefnam, CarleTon, Larson, Kerr, Painfer, LoewensTein, Rose. 3 BOTTOM ROW: Foley, Haas, Bearman, Springer, Beach, Weil, Engler, JusTer. Speakers who are obTained Tor meeTings, which are held The second and TourTh Wednesdays OT each monTh, increase The knowledge oT members oT Commercial Club on business maTTers. To be eligible Tor membership in This club, a sTudenT musT have a C average and have Taken Typing Tor one semesTer. STudenTs have been well enTer- Tained during The pasT year. Among The acTiviTies have been a Tallc on STaTe Laws Tor Wage Earners, a slciT, and Two banqueTs. QTOP ROW: D, SToTz, Leslie, Lundberg, Podany, M. Larson, D. PeTerson, Ahlgren, Erickson, Williams. 9 FIFTH ROW: C. Anderson, EvereTT, Burns, D. Larson, Miller, B. PeTerson, Eisele, Knudsen. 9 FOURTH ROW: Dunham, H. Johnson, Dufourd, Hansen, H. Anderson, Thornsio, Riley. 0 THIRD ROW: A. Johnson, Clark, Ourz, Bram, Cushman, Larrabee, Hall, Wells. o SECOND ROW: Olsen, Gehrig, Fellowes, Loewensfein, Fosdick, M. SToTz, HallonquisT, Chrisfianson, Holi. 9 BOTTOM ROW: M. Johnson, Weilc-SecreTary, Townsend-Treasurer, Miss Thompson-Adviser, Miss Nash-Adviser, Kerr--PresidenT lil, P. Johnson- Vice PresidenT lil, PresidenT l2l, Holmberg. HHNII niiuiisiiin 9TOP ROW: Taylor, Fillmore, l.. Bachman. Roe, Jackson, Luckman, WhiTTen, Pederson, Nygaard. 9 FIFTH ROW: H. Bachman, PTunder, B. Fiellman, CroiseTTe, Williams, Davis, Drake, Weigel. Bleecker, Phillips. 9 FOURTH ROW: EvarTs, Daugaard, GronseTh, Mayhew, Brown, RisTrorn, Bell, Lee, Mayhew, Hanson. 0 THIRD ROW: Maclfwen, LiTTleiohn, HunTley, P. BuTTerworTh, l-lempel, M. BuTTerworTh, WebsTer, Cushman Wurz Drongeson, 9 SECOND ROW: Krueger. Freeman, T. MaTTeson, STevens, Minar, G-ronseTh, Hawkinson I Morse' Berggren, ColleTT. 0 BOTTOM ROW: Emerick, EasTman, Airharf, Weiss, H. MaTTeson, Mr. Super Allen Hall: quisT, D. Fiellrnan. Crisp. I I The Washburn orchesTra annually conTribuTes a greaT deal To The enioymenl' OT school liTe. MeeTing second period every day, This ambiTious group oT youThTul musicians sTudies The orchesTraTed works oT The masTers. IT plays under The direcTion oT Mr. George N. Super Tor all audiToriums, class plays, operas, and commencemenT exercises. The Training gained Through working wiTh The group has aided many sTudenTs on Their paThs To a successTul musical career. 9 On The oTher side oT group Type music is The band which meeTs wiTh Mr. Super Tor an hour beTore school on Mondays, Wednesdays, and Fridays in The audiTorium. They rehearse selec- Tions Trom marches, overTures, and novelTy numbers To play aT all of Their ouTdoor school TuncTions. Washburn has one oT The TinesT and largesT high school bands in Minneapolis. GTOP ROW: C. Lane, Beynon, D. WhiTTen, Bravinder, D. Gosselin, T. WhiTTen. Carlson, Palm. Erickson, Roe. B. Gosselin. 9 SIXTH ROW: Jackson, WheaTon, Fillmore, Biesanz, Sumner, STinson, B. Lane, Boone. PeTerson, Hoch. 9 FIFTH ROW: Hollzman, Maclfwen, STevens, PoTTer. Hellekson, Shroyer, Rasmussen, Gronseirh, SaTTerlee, Bowe. 9 FOURTH ROW: DunTley, Syme, B. Fiellrnan, Murphyf Brown, Drake, EngebreTsen, Cash. Hanson, Zalusky, Fuller. 9 THIRD ROW: Dalby, Noble,'McNally, Parker, Kneeland, GronseTh, Olsen, Weil, Hallquish McElwain. 0 SECOND ROW: Freeman, D. Fiellman, Kreuger, Walker, Burfeind, Nichol, Sager. Weiss. Johnson, Bragg, Hempel. 0 BOTTOM ROW: TwiT, Slingsby, Williams-Vice PresidenT, Luckman-President Mr. Super, MaTTeson, Kunz, Isaacs, Camp, Levin. W,,, Www 4z3'7mWViM CL,l!,,zf' pw 5 I gr. BUYS' IIIII EIIIB 1, mfr' ,p ,J 54 . . ., if l hi lf? U J, UTOP ROW: I.aThrop, GronseTh, Sandahl, STewarT, Pommer, AbboTT, Beynon. 0 FOURTH ROW: Schirmer, Hyre, Bersell, Shaw, MacMillan. , BarneTT. 9 THIRD ROW: Yager, ProucITooT, BasT, Gans, Eyre. 73 SEC- , 4.,, ,,,,..,, ,,,. ,,,,,,.,,,.,4.,,,,, ,,,...,,,.,.4, ,,.,.,..,.,... ,..... ..-.. - 4 b ..4.-.--.-..- - - - OND ROW: RoTh, I-labaTa, Comb, CawcuTT, La Lone, Hogan. 9 BOTTOM ROW: Thornsio, I3erTraud, Mr. BecIcsTrom, PeTerson, PrenTice. The G-lee Club is responsible Tor many musical hours aT Washburn. TryouTs Tor This organizaTion are held every Term and are open To The Choir, and To any chorus-class mem- ber. An annual opera and ChrisTnnas concerT presenTed by The Glee Club become sources oT enioymenT To everyone. The IighT opera, The STudenT Prince, was presenTed This year, The members wiTh ouTsTanding voices singing The lead' ing roles. Any member oT The club is eligible To compeTe Tor These opera leads as well as Tor solos in oTher programs given during The school year. IT is The cusTom oT The Club To presenT programs on borh Memorial and ArmisTice Day. UTOP ROW: Phillips, Wallace, M. Larson, HusTad, Powell, C. Anderson, Johanson, CrawTord, Beacom. 9 FOURTH ROW: Dorr, Luce, Brang, M. Johnson, Bishop, Geiger, Collins, G. Larson. 0 THIRD ROW: Carlson. Romig, Freeman, Bowlby, Ozrnon, Wood, KreiTTer. 3 SECOND ROW: Cobel, Freeman, Seashore, LedbeTTer, FenTon, WesTaTer, Miller, Naswall. 0 BOTTOM ROW: EvereTT, TiIIoTson, EIlioTT, Mr, BecIrsTrorn. Sanford P. Johnson, SweeTnam. I II Sill K IIIH Il HII I H HHH NTHTH lllISIEHl lllllllllli The Choir oT abouT eigh+y voices, under The direc- Tion oT Emil J. BeclcsTrom, is The iunior vocal or- ganizaTion oT Washburn. This group uniTes wiTh The Glee Club in presenTing a Memorial Day Program and a ChrisTmas CanTaTa. 9 Three hundred voices Trom The Glee Club, Choir, and The chorus classes Tormed The chorus oT The elevenTh annual ChrisTmas concerT direcTed by Mr. Becl4sTrom. AlThough There is no admission charge, a collection is Taken Tor The purpose OT giving Tinancial aid To needy sTud.enTs aT Washburn who prove Themselves To be worThy. UTOP ROW: Palm, Miller, Hayes, Thorson, Brink, McGeary, Leclrie, Bollum, Hoch. 0 FTFTH ROW: Puls, J. Nelson, M. Johnson, ParTridge, Davies, Andrews, NorThey, Fleenor. 0 FOURTH ROW: S. Block, MaTher, NorThTelT, Lennon, Snyder, Zoluslcy, Jacobsen, EusTis, Slocum. 9 THIRD ROW: Owen, SmiTh, J. Swanson, Sager, La BlanT. STiles, McMahon. HolT, Flubacher. 0 SECOND ROW: RecTor, Hall, Lee, Lundberg, Birlcey, Mehlin, Olsen, RoTh, Vieau, 0 BOTTOM ROW: Cravens Thayer, Sogard, Mr. BecksTrom, KiensTad, Davis, Maass, Parker. ,T EP lHl Sllllllll llllllll This year Washburn's Glee Club presenl- ed Sigmund Romberg's charming classic, The Sludenl Prince. The slory is con- cerned wilh Karl Franz, The dashing prince ol Karlsberg, played by Dean Proudlool, who came lo l-leidelberg 'ro sludy, and fell in love wilh The lovely peasanl maiden, Kalhy, who was porlrayed by Babs Wallace and Shirley Prolhers. Ruder, who owned lhe inn where lhe prince lived was played by Ray l-labala, and Grelchen, The bar maid, was played by Pal' Sanford. The prince was obliged lo relurn lo Karlsberg as lcing, when his granclfalher died and he became belrolhed lo The Princess lvlar- garel, porlrayed by Doris Phillips, 'rhrough lhe influence ol her molher. The lwo main comedy characlers, Lulz and l-luberl, were played by Bud Barnell and Bob Gaus. This opera conlains some of lhe mosl beaulilul classical music of all lime, including Deep in My l-learl, Jusl We Two, and lhe Serenade The produclion was one ol lhe oulslanding evenls ol lhe year T UTOP ROW: Wallgren-Treasurer lil, PresidenT l2l, SchmidT, Paul- son, WhiTTen, Palm. 9 SECOND ROW: Maass, Boone, Wafson, Mc- ClinTock. 9 BOTTOM ROW: DownTon, Mr. Sunde, Hanson-SecreTary ill, Pomeroy-PresidenT lll, Treasurer Q TOP ROW: LaboviTz, ThursTan, CovenTry, TilloTson, Swanson, Page. Henley. 9 THIRD ROW: D. SmiTh, Salkin, Kollen, Waldron, Riley, Kruse. 9 SECOND ROW: AusTin, Hudson, MilTon, Heilig, Bush, Curry, Danelz, 9 BOTTOM ROW: Drake, J. Wesley-Treasurer lll, SecreTary l2l, TwedT-PresidenT lil, Mr. LindsTedT, Owen--SecreTary ill, Presi- denT l2l, Meehl--Vice PresidenT lil, Burns--Vice PresidenT 9TOP ROW: AbboTT, Cross-Vice PresidenT l2l, R. Anderson. Brink, Melbourne, Boone-SecreTary-Treasurer l2l, V. Anderson. 9 THTRD ROW: Burns-PresidenT l2l, Allen, Kollen, Heinselman. Sengir, MaTTe- son, 0 SECOND ROW: SmiTh, Spencer, P. BooTon, Maass, Arneson, J. BooTon, Collier. 9 BOTTOM ROW: Page, Kincaid--Vice PresidenT lil, MacDonald-PresidenT lil, Mr. Skibness, Hanson--SecreTary- Treasurer ill, Isaacs The STamp Club has a deTiniTe program QT achievemenTs which iT Tollows each Term. Mile- sTones in iTs progress Tollow a regular sequence including an annual Trophy case display, an auc- Tion of sTamps, 'inTeresTing speakers, a special bulleTin board QT announcemenTs, a semi-annual parTy and Trolic, as well as regular parTicipaTion in ouTside exhibiTions. The club exhibiT won an award in The lasT sTamp show sponsored by The Twin CiTy ChapTer oT The American PhilaTelic So- cieTy, a naTional organizaTion oT sTamp collecTors. Our Washburn chess Team usually raTes near The Top in inTer-scholasTic chess compeTiTion, de- TeaTing The maioriTy oT Their opponenTs. The January graduaTion oT some oT The besT players in The club was a greaT loss: This loss, however, has been amply made up by new players who are already demonsTraTing Their apT abiliTy To push Through a TasT win. This club meeTs under The advisership OT Mr. l.indsTedT To pur- sue iTs pasTime, chess, The sporT OT kings! SIIITNET lllll The Washburn Science Club aims .To TurTher scienTiTic inTeresT among The sTudenTs OT The school. MeeTings are Taken over almosT enTirely by members, an ouTside speaker being occa- sionally inviTed. The club sTudies The basic Theories oT The specialized sciences. IT is The TirsT sTepping- sTone Tor Those sTudenTs who wish To ioin The Junior Academy oT Science, a chapTer oT more advanced work in science Tor Those wiTh greaTer abiliTy and inTeresT in scienTiTic developmenT. l UTOP ROW: Block, Rice, Bersell, Haxby, Thorson, Tilloison, D. Wheafon, Poppe, G. Wheaion, Zingsheim. 9 FlFTH ROW Braasch, Hurr, Kucera, Pfunder, Sfruble, Damkroger, Nofhafl, Pelling, Twedr, 7-7 FOURTH ROW: M. Nelson, Spencer Leslie, Cooperman, Ludolph, Glasrud-Treasurer l2l, King, Lohrnann, Robinson, Peck, 0 THIRD ROW: Grady, Seashore Ball, V. Peferson, Jorgensen, Haugum, Berdan--Secrefary l2l, Reynolds, Mehlin. 9 SECOND ROW: Wieland, King Taylor, Hogan, Sianion, Kruse, Rofh, Friend. 9 BOTTOM ROW: Barr. Schneider, Erickson-Treasurer lil, Presidenf T21 Drake-Vice Presideni lil, lil, Mrs. Savage, Miss Denison, Galin-Secrefary lil, Travis, Feinberg-Presidenf Der Deursche Verein is mainlained in order To give srudenis iniereslred in German a chance Tor expression in Thai language. Deuischland's lang- uage, cusioms, culiural background, and geog- To inieresi siudenis in Spain's background, im- poriance, and language, la Alianza Espanola is conducled on alrernale Tuesdays. Conversarion in Spanish is encouraged by The exclusive use of This colorful language during The meeJrings.Games and songs of Spanish origin are played and sung in assemblies. The programs are based on an inieresi in Spain: her cusioms and her hisiory. raphy are enjoyed in German movies, slides, 'rallcs and various oiher ways. The meeiing, The enier- iainmenl, and The refreshmenis are connecied wiih Germany. Truly, Deu+schland Uver Alles. SPHNISH lllllll 0 son, Norfhfeli, Mulligan, Nelson, Linn, Wallace. 9 THIRD ROW: Bacon, Jusfer, Crisp, Ellioff-Secreiary TZT, Kus, Fay, Abrams. 9 SECOND ROW: Rudolf, Freeman, Hansen, Swanlce, Velie, Hudson. 9 BOTTOM ROW: Weiner Siorlcson E. Schrufh-Secrefary ill, Presidenf i2l, Miss Tupper, Krueger-Presideni iii, Vice Presideni' l2l, Dorr-Vice Presideni ill, J. Schruih-Treasurer TOP ROW: Sfolces, F.iKrueger, Flefcher, Asper-Treasurer l2l, M. Johnson, De-lion, Ausiin. 9 FOURTH ROW' Grier- l I S HNEH TH HUS -V lll PHIT UTOP ROW: Paulson, OTTedal, A. PainTer-SecreTary l2l, Waring, SuTTon-Vice Presi- denT l2l, STark, Rasmussen, RosholT, Rahders. 9 FOURTH ROW: P. Smirh, Snedeker, Owen, Weil, STenson, Wash, Rockwell, Swanson. 0 THIRD ROW: Solie, Rose, Thayer, V. SmiTh, RoTh, UlvesTad. Yager, RaThbun, Weiss. 0 SECOND ROW: STebbins, Oppe- gard, Shaffer, SweeTnam, Snyder, Salkin, Thom, STanley. 0 BOTTOM ROW: Thomas. SchwarTz, Springer, Miss Holliday, M. PainTer-SecreTary lil, Profhers-PresidenT l2l, SmiTh. The secreTs oT French culinary skill as pracTiced by M.'Jean VerneT, French cheT, France as The Frenchman sees iT, and arT oT French correspondence: all These have beneTiTed The members oT Le Cercle Francais. The club has successwfully aTTempTed To bring a deeper undersTanding of France and iTs language To The sTudenTs. Le Cercle Francais is divided inTo deparTmenTs: The deparTmenT plans one meeTing during The school year. 9TOP ROW: Gaus, Lee, Huenekens, Beach, Lindvall, V. Johnson, HarT, LaboyiTz McClinTock. 0 FIFTH ROW: Noyes, Mayhew, M. Nelson, Hennessy, Kixrnoeller, J Nelson, Hessian, McOuary. 0 FOURTH ROW: HusTad, McLean, Jenkins, lsaackson McDonald, Moore, Andrews, Hay, Howard. 0 THIRD ROW: Hendrickson, HolTon Morris, Hineline, McCarT, Nylander, LaBlanT, M. Johnson. 0 SECOND ROW: McNeil Malkerson, Mann, C. Johnson, LowensTein, LeBlond, KirschsTein. 9 BOTTOM ROW Hogan, Newdall, Laird-Vice PresidenT Miss Gear, Malcolm, Juel-Treasurer l2l Lueck. Kelly. Hlllllll Hlll i 1 0TOP ROW: Boyer, Hanson, Bissonneffe, Cavanor, Kaughan, Berglund, Hallen, Carlson. 9 FIFTH ROW: Bennison, Blanchard, Cowie, Haas, Cochran, Cox, Copley, Freeman. 9 FOURTH ROW: Hahn, Bishop, Files, Anderson, Beacom, Coverf, Cohen. 9 THlRD ROW: Ellison, Cole. Benliclc, Hamre, Heinselman. Bearman, Andrews, Carlander. 0 SECOND ROW: Cobel, Engler, Chapman, Glascoclc, M. Andersen, Crowley, Esfes. BOTTOM ROW: Blaylock, Balch, Fowler, Beach-Presidenf lll, Miss Farsie, Collins- Treasurer lll, Everefl, Garreff. As fhe girls' service organizafion, fhe Upper Class club fills an imporfanf posifion in Washburn. The Big Sisfers have been incorporafed info fhe U. C. Club 'lhis pasf year fhus providing anofher source of service. The Big Sisfers fake care of IOB girls coming info Washburn, aiding fhem on fheir firsf difficulf days. The club has had many and varied programs during fhe pasf year: fallcs on foreign relafions, a membership parfy, sfyle show, and a farewell for Jrhe seniors. Besides being of service fo Wash- burn girls, 'rhe U. C. Club has given a useful giff fo Washburn each year. 9TOP ROW: Boone, deWaard, Henley, Bravinder, Fahey, Harf, Bissonneffe, Harper, Grierson, C. Anderson. 3 FIFTH ROW: Hallen. G. Hanson, Damkroger, Brown, Hague, Covniclc. Cowie, Fay. Boyer. 9 FOURTH ROW: Collins, Beacom, Garlough, Davies, Deeds. Bearrnan, Gehrig, Dahlen. Benneff, Hallonquisf.'i:,i'? THIRD ROW: Emerson Copley, Dunham, Dufourd, Cox, Cooperrnan, Boofon, Coverf, Heinselman. 0 SECOND ROW: Conley. Dorr, Hannan, Andrews, Foley, Ball, Freeman, Easfhagen, Georges Hermann. 9 BOTTOM ROW: Friend, Engler, Jusfer, Gardner, Miss Suber, Hall, Clark Bram. Canferbury. 'n 'H Hll ll QTOP ROW: Pellinq, M. J. Kinq, Mulligan, Lindvall, Noyes, Kixmoeller, Nelson, Speece. 0 SIXTH ROW: Jenkins, I-Iufclninson, lsaclcson, V. Johnson, A. Larson, Killrner, Husrad, Miller, Maynard. 73 FIFTH ROW: Norflnlelr, Lennon, G. Larson, Luce, McDonald, Riley, M. Johnson, Sranlon. 5 FOURTH ROW: Pererson. Kayanauqlw, Mclnerney, Ledbelrer, Hogan, Olson. B. Johnson, Malcolm, 9 THIRD ROW: Parker. I-Iolron, Fengler, Morris, Meyers, L. Olsen, Krueger, Kreilrer, Peferson. 3 SECOND ROW: Kolslad, McCar'r, Le Blond, Nylander, Naslund, B. King, MacMicI1aeI, Mullin. 9 BOTTOM ROW: McKean, Newdall, Mallcerson, Loewensfein, McLean-Presidenf Ill, La Blanr--Treasurer Ill, Vice-President IZI, Hudson, Juel, Kelly. 9 TOP ROW: Leslie, Kavanaugli, Hill, Paulson, Podany, Wieder, M. Larson, Sorlien, Waring. 0 FIFTH ROW: Profhers-Secrefary IZI, Pierce, Painrer, Rasmussen, Weisel, Vlfilleford, Swanlce. P. Smirlw. 0 FOURTH ROW: Sfeyens, While, J. Taylor, Seashore, Rosendahl, Sweernam, Snyder, Srorz, Townsend. 73 THIRD ROW: Tarlinq, Springer, Rose, Sfanley, Woodfill, Yager, Wood, Travis. 9 SECOND ROW: Eriqler, Score, Grady, Vifilliamson, Sanford, V. Smirh, Roflw, E. Taylor. 0 BOTTOM ROW: Lee, Weil, Sallcin, Mrs. Goodson, Rockwell-Secrelary Ill, Wash-Vice President Ill, Presidenf IZI, Roworfh. U ' E I B l U H fs UTOP ROW: Leslie, Lee, HarT. Nelson, M. Larson, G. Hanson, Mulligan, KnighT, Noyes, M. Johnson. 9 FIFTH ROW: Virg. Johnson, V. Johnson, Mayhew, MaTher, Leonhard, McLean, HusTad, McSorley, McOuary. 0 FOURTH ROW: McCormick, NorThTelT, Miller, Kingbay, Lennon, G. Larson, Luce, McDonald, Heinselman, Juel. 9 THIRD ROW: Kavanagh, Mclnerney, Malcolm, M. Hanson, B. E. Johnson, Freeman, Hogan, Loewen- sTein, Le Blond. 3 SECOND ROW: Meyers. MerlcerT, Krueger, KreiTTer, KolsTad, Hudson, McCarT, Jusfer. 0 BOTTOM ROW: Morris, Naslund, Mullin, Newdall-PresidenT lil, Miss Perry, La BlanT, M. King- Secrerary lil, B. Johnson, B. King. 9TOP ROW: Damkroger, BissonneTTe, Cowie, Boyer, Hallen, Ahlgren, Haas, J. Anderson, Davies. 0 FIFTH ROW: Cooperman, Cox, Killmer, EvereTT, C. Anderson, Collins. Grierson, Foullre. 0 FOURTH ROW: DeWaard, CoverT, Hahn, Bishop, Fengler, Dahlen, BenneTT, Bearman, Dorr. 0 THIRD ROW: BuTTerworTh, Garlough, Blanchard, Hague, Brown, Covniclc, Fay, DuTourd. 9 SECOND ROW: Beacom, Freeman, Foley, Georgas. EasThagen, Bram, CroonquisT, Carlander--Treasurer l2i, AiTlcin. 9 BOTTOM ROW: Friend, Engler, M. Ander- sen, Gardner, Miss MonTgomery, Clark, Balch, French-Vice PresidenT Blue Triangle The senior organizaTion of Girl Reserves, has beneTiTed and enTerTained iTs members This pasT year wiTh many evenTs. As an annual presenTaTion, Girl Reserves give a banqueT Tor TaThers and daughTers in The Tall, and Tor moThers and daughTers in The spring. These aTTairs are awaiTed by The girls and Their parenTs alike. Blue Triangle sponsors parTies, conTerences, and lecTures wiTh such subiecTs as per- sonaliTy, characTer, sTyle, appearance, and vocaTions discussed by auThoriTies. A newspaper has been published This year Tor The TirsT Time. lT is a good opporTuniTy Tor The originaliTy OT The reporTers, and iT also provides members wiTh The news oT Girl Reserves aT Washburn and ThroughouT The ciTy. m T 4. 3 TOP ROW: STolces, Weiner, SuTTon, Sedgwick, l-luenelcens, Sorlien, O'KieTTe, Williams. 0 SlXTl-l ROW: Robinson, Williamson, C. Snyder, Schneider. P, SrniTh, WilleTorcl, Taylor. 9 FIFTH ROW: Weisel Rockwell, STevens, Weil, SweeTnam, L. Snyder, Seashore, Wash. 9 FOURTH ROW: PeTerson, Ring, Phillips, Thayer, Townsend. Olin, L. Olsen. 9 THlRD ROW: Tarling, Parker. STanley, Travis, Springer. Rose, V. SmiTh. RoTh. 3 SECOND ROW: WeTTerlin, Wood Yager. L. PeTerson, Rafhbun. Nylander, O. SmiTh. 9 BOTTOM ROW: Score, J. SchruTh-Vice Presidenf lll, PresidenT l2l M. PainTer, A. PainTer, Salkin, E. SchruTh-Treasurer llj, SanTord. SHVTH THIHNHTT The Silver Triangle cabineT, chosen by The oTTicers oT The club, serves as The commiTTee which plans various acTiviTies. The cabineT meeTs To dis- cuss TuTure programs and problems oT The club. During The second semesTer a new sysTem oT conducTing These meeTings was innovaTed1 meeTings were held aT The homes oT The ad- visers or The cabineT members. There are an average oT sixTeen girls on The cabineT during each semesTer. The Silver Triangle is The sophomore and B iunior division oT The Girl Reserves. During The pasT year The club has had many enTerTaining programs. To be- come a member, The girl is obliged To memorize The Girl Reserve code. mf' oTOP ROW: EndicoTT, EngsTrand, FleTcher, DelTon, Day, Andrews. 9 THIRD ROW: Files, Darby, EusTis, Flinlc, Farnham, Fraserl N. EllioTT. 9 SECOND ROW: Exberger, Eisele, Frizzell, EvereTT, Dobler, EasTrnan. 9 BOTTOM ROW: Fay, Fow- ler, R. EllioTT, Geiger-Vice PresidenT lil, l2l, EsTes, Falk. ,7 . Ya, ,, , f' Qi. as swag 5935 E33 sig gg gm Q as S ei! 9' 9 A-, if , -, za ., , 5 W . 1 'X A me Q Q 5 5 Q Q 2 4 ggigsaegaaais 35? f Sw? 45 5 gi? se .1 5, 'H A Q., 4 l Q 5 v 2 5 la. .Q Q 69 3 Q QQ 5 33 ,fl X , 5 rx 3 II HNII IH 9TOP ROW: Slocum, Royal, A. PeTerson, Palmer, Powell, Reichard, SchulTz, Pardee, RoshoIT. 9 FOURTH ROW: Medgorden, ParTridge, Pankin, Romadke, Nord, Seidl, Schellenberger, Kneeland. 9 THIRD ROW: Scanlon, Ogdahl, R. Olson, Rahders, S. SmiTh, Shumway, RecTor, Shirley, M. Nelson. 9 SECOND ROW: Singer, Randolph, E. SmiTh, Rachie, Reed, Sears, Schneller, Quinn. 9 BOTTOM ROW: Siegel, Shirk, Pol- grien, PickhardT-SecreTary Ill, PresidenT IZI, PrenTice, Salkin, H. SmiTh. IVIII 9TOP ROW: STephens, STerIing, Snyder, Wineland, Twenge, STevenson, Woboril, Rudolf. 9 FOURTH ROW: TrannsTrom, Taber, Widmeier, Wiik, Weigel, Snedeker, Solem, Upham, Shaffer. 9 THIRD ROW: Thacker, STrom, Sogard, Solie, Pink, Taylor, WeidT, ThursTon. 9 SECOND ROW: Sosrheim, STenz, Williams, STenson, l- Thom, WeiskopT, Taney. 9 BOTTOM ROW: Swanson, Thomas, TilloTson, WebsTer-Treasurer III, Wash- Presidenl' Ill, STewarT, Workman, TeTzlaTT. ' S HI-I' IIIVIIIIIIS EHHIIHEIIII HNH IIIIIIIIISHII' The Hi-Y clubs play an imporTanT parT in The daily rouTine oT school IiTe aT Washburn. Working To creaTe. mainTain, and exTend ThroughouT The school and communiTy high sTandards OT ChrisTian characTer, The clubs aim To aid The individual in developing his body, mind, and spiriT, symbolized by The sTrengTh OT a Triangle. Bearing service as Their purpose, The clubs have assumed duTies ThroughouT The school. lvleeTings oT The clubs are held each Tuesday evening wiTh programs which include discussions and speakers wiTh a ioinT meeTing being held monThly. The clubs carry on Their own social program and ioin TogeTher To presenT Hallowe'en and May dance. Several Times during The year, They assisT The Y. lvl. C. A. in conducTing a world Triendship and Tlnance campaign. IT also donaTes To The CommuniTy Fund. Hi-Y's are sponsored by a TacuITy adviser and a leader. lHl HI-Y'S BUGS 9TOP ROW: Roe. Moore, A. Johnson, Sfone, Card- well, Maser. 0 THIRD ROW: Benfon-Vice Presidenl l2l, Clark, Palm. Wilson, Meyers. 9 SECOND ROWg Laird, Parsons, Glover, Maass. 9 BOTTOM ROW: DYfJ?r'r-Secrefary lll, Presideni l2l, McPl1eeTers- Presicleni' lll, Mr. Lindsfedf. Campbell-Treasurer lll, l2l, Twedf-Vice Presidenf lll, Secrefary UTOP ROW: Kroeger, Asper, Euslis, Hellelcson, Hock- eff-Treasurer l2l, 9 THIRD ROW: Halch-Secretary l2l, Willeford, Sfeward, Fleenor. 0 SECOND ROW: Weil, Sfevenson, Bean-Vice Presidenf Chase- Treasurer lll, Freeman. 0 BOTTOM ROW: Ervin- Vice Presidenf lll, Presidenf l2l, Mr. Halley, Cravens -Presidenf l I l, Linderberg-Secrefary ll UTOP ROW: Haxby. Tillofson-Treasurer l2l, Nordin, Owen, Bersell. 9 THIRD ROW: Poppe-Secrefary l2l. Mifchell, Jacobs, Cooley, Simons, Bros. 0 SECOND ROW: Gill, Decker, Presfon, Bush. Pearson. 9 BOT- TOM ROW: Wheaion-Secrefary Vice President l2l, Sherman-Vice Presidenf lll, Mr. Larsen, Mel- bourne-Treasurer lll, Pfunder--President lll, I Il 9TOP ROW: McGrew, B. Moore, Awes, Brown, Mac- Millan-Vice President 9 THIRD ROW: Hall, Waldo-Treasurer l2l, R. Moore, Punch, BarneH'-- Secrefary U SECOND ROW: Fuller, Bell, Farr- Presidenf l2l, G-ebhardf, Thompson. 0 BOTTOM ROW: Hayes-Treasurer lll, Dunsworfh-Vice Presi- denf lll, Mr. Curtis, Weigel-Presideni' lll, Kucera- Treasurer I I ' 9TOP ROW: Stenson, Rice, Bond, Enhminger, Gun- derson. 9 THIRD ROW: Vieau, Dahlen, Anderson, Ha- bata. 9 SECOND ROW: J. Smith, Michelson. Syme- Vice President IZI, Ludolph-Treasurer I2I. 9 BOT- TOM ROW: Prentice--Treasurer III, Wheaton-Seo retary III, President IZI, Mr. Ciaeson, FIetcI1er- President III, Thomas--Vice President III. Secretary I2I- 9TOP ROW: Swain, Anderson, Parsons, Spence, John- son, Rose. 9 THIRD ROW: McGeary, Wachsmuth, Cavanor, Grattan-Treasurer IZI, AbraI1ams--Secre- tary 9 SECOND ROW: Whiteman. SmitI1,Vivian. Folsom. 9 BOTTOM ROW: Spencer-Treasurer III, Lord-President III, Mr. DiIIner, Cochran-Secretary III, President IZI, Souba-Vice President III. IZI. 9TOP ROW: Goodspeed, Lathrop, Parker, Bristol, Condit, McCIintock. 9 THIRD ROW: Beattie. Larsen. Nelson, Wiley, Hays. 9 SECOND ROW: Satteriee, Moore---Treasurer I2I, Haslett, Boe. 9 BOTTOM ROW: Evarts-Secretary III, Vice President IZI, Lind- say-President III, Mr. Morris, Atkins-Vice President III. President IZI. Drake-Treasurer III. I I I 9TOP ROW: Hankins, Nickey, H. Smith, TorIceIson. Walden. 9 THIRD ROW: Bredesen, Neff, Warren, Vieau. 9 SECOND ROW: Noble, Whitesel, Dobrin-- Secretary, McNally, Banks. 9 BOTTOM ROW: Erick- son-Treasurer, Kindem-President, Mr. MacBean, WaIIgren-4Vic:e President, Mr. Reque Iabsenti. .F ,-.,., - v -wc-. vw- Yvf-v ,,.--V. .- ....,,- ,. UTOP ROW: Jenkins, Swanlre, Diefrichson, Kingbay, Bryanr, Benliclc, Cole, Jacobi, Fripp. 9 SECOND ROW: Everefl, Jensen, Smifh, Vih- sfadf, Hurr, Olderen, Slcibness, Brunsell. 9 BOTTOM ROW: Grigsby, Paulson, Barron, Miss Trowbridge' Hyre, Sedgwick, Atwood. Each Thursday aflernoon unlil Tour 0'clocli, The S I H E E E H I W members of Waparlhian Club may be found in Room 3 praclicing marlcsmanship. Waparrhian is open lo all girls inleresled in archery. Each sem- esler The club sponsors an archery fournamenl, I h 1 I The winner of which is awarded a prize, Fifly Each school produchon musl have individual pOin+S for 6 leger may be earned for regular Scenerl' OT Wlqlch everl' Hal and IOVOP is made arlendance ar rneelings and for aloilily in archery, Through 'rhe painslalcing labor ol The slage crew. The arl crew is divided info groups according To 'rhe number of scenes needing sels. These groups lake full charge of complering Their assigned work. This,plus lhe work of The indispensible con- sfrucfion crew, consrirures Their imporlanl job. UTOP ROW: Lindow, McLaughlin, Olledal, Paulsen, Royal, Cowie, Roshoh, Slevenson. 73 FOURTH ROW: Seidl, Frislr, Schellenberqer, Walsh, Syrne, Srnilh, Orvis. 9 THIRD ROW: Lueders, Thom, Johnson'-Treasurer Buck, Cox, Wars burlon, Tuclcer, McCarl, 0 SECOND ROW: Connelly, Grant l-lay, Kahler, Hanson, l-loward, Anderson. 9 BOTTOM ROW: Norris, He-inselmani-Secrefary Vice Presidenf l2l Oqdenv-President Miss Smart, Snedeker-Treasurer lll, Ledin-Vice Presidenl Anderson, Garrell. l W W i Y i Y 1 1 1 1 i ! 2 2 E E 1 ,fff Tx X, ,fn ff!! fff 9 Time ou1'! 0 Line up..Of Coaches! 9 Profec+Ion7 M... . - 121,-1 .... ' ,. , ., ,, f, , ,T iii Q ,il--A f 1',' ., Q fi , I fm fr 'R A q 'M 0 Firsf down! , P 0 A+hle+ic appe+i+es. , 1 by QSM: as , no 1 A' 1 l 5-slexmfwidfkc' ' -35 f lllllllllll iNlHllSIHSM HUNS HIHH rs, . U is ' A aj , Q85 x ,, T , , ,ss ' ss' 7 T J V i Y I .7 , A Q u:PyR.4j,:41,t '-.f, MQ.-2121:-L Q 9 TOP ROW: Ross lfrainerl, Sfraifon, l-lolzsinger, Woodward, Bowen. Hoclceff. Wiley, Friedl iCap'l'l, Brinlr. Wesf- hotcf, Conrad, Puls, GronseTh, Braddock, Dillner lcoachl. 0 SECOND ROW: Ervin, Kiniz, Barneff, Glover, Sfallman, Higgins, Gunderson, RoTh, Lind, Leckie, Goodspeed. Johnson. 9 BOTTOM ROW: Cochran lMgr.l, Peanufs lAss'T Mgr.l, Drury, SuTTon, Rodgerson, Hegna. McGrew, Moore, HaTch, Bean, Cravens, Gisvold lAss'T Mgr.l. WiTh Mervin Dillner as new head coach, The Washburn gridmen began The season wiTh hopes of placing high in prep raTings. SouTh meT a hard-TighTing, deTermined eleven. buT The Tigers conquered The Washburn Team by a lasT- minuTe Touchdown, I2 To 7. Edison, Too, was given a real TighT. OuTsTanding was The Millers' win over RoosevelT, which was The TirsT homecoming vicTory in Washburn's hisTory. Losing a dispuTed game To NorTh was discouraging, buT The boys rallied laTer in The season To deTeaT Marshall. Final resulTs gave The Team five losses and Two vicTories. OuTsTanding in I937-l938 were CapTain Jack Friedl and Washburn 7 Soufh I2 Charles Leclcie, who received places on The all-ciTy Teams, Washburn 0 Ediggn I2 and Douglas Cravens, who was awarded The Foofrball MeriT Washburn 26 Rgogeyelf I3 Award. AlThough The Team did noT approach The cham- Washburn 0 Norfh 6 pionship, Mr. Dillner expressed his opTimism wiTh The view Washburn 0 WesT 37 ThaT Washburn's prospecTs were increasing and ThaT soon Washburn 6 Marshall 0 The gridders would be in possession of The ciTy championship. Washburn O Cenfral 28 'Sis ,, r ' is rri' 'IA .A .mi 9 Loud speakers. 0 Run' man' run! 0 SkyrockeT yell IIHM II I II I Doug Cravens, Washburn's ouTsTanding sTudenT leader was deservedly eIecTed cap- Tain of The I937-38 bas- IceTbaII Team. An excepTion- aI player all Through high school, despiTe his heighT, he very ably Ied The Team Through a highly successTuI season by his sTeady play- ing in The guard posiTion. I-Ie was one of a few To be unanimously eIecTed by The ciTy newspapers To The aII-ciTy Team. Doug has been presidenT oT his A and B senior classes and has been a member of The sTu- denT council Tor The IasT Two years. In sporTs, Doug has won IeTTers in baseball, basIceTbaII, and TooTbaII, and was voTed The mosT valuable player by his TeammaTes and coaches. The Rossmen compIeTed one of The mosT briIIianT seasons Washburn Alumni in The IasT decade. The Miller quinTeT romped over SouTh Washburn SouTh and CenTraI. Edison, ciTy champion Tor Three years, van- Washburn CenTraI quished Washburn, as did VocaTionaI High. The bucIceT- Washburn Edison men Took ouT Their revenge on WesT, as well as Roose- Washburn VocaTionaI veIT. NorTh proved Too sTrong in The IasT game oT The Washburn WesT season. The Tinal resuITs were Tive vicTories and Tour losses. Washburn RooseveIT IT was Through ouTsTanding Teamwork and cooperaTion Washburn Marshall among players and coaches The Team aTTained iTs vicTories. Washburn I6 NorTh 9 LEFT TO RIGI-IT: Punch, Brandell, Purcell, RoTh, GreaThouse, STrubIe, J. WesThoIT. N. WesThoFT, MaTchsIre. Goodspeed, Higgins, Wallace. Crevens ICapTainl. Ross ICoachI. Eff-:a 0 Spence. Wheaton, Leonard, Dahl, Hoban, Andre, Gebhardl, Carlson, Halley lcoachj. The purpose of 'rhe second baslcelball squad is lo develop malerial lor The lirsl squad, and 'ro furnish recreafion lo alhleles who wanl To play baslcefball merely for fhe fun of 'rhe game. During The' season Coach l-lalley sfresses fhe fundamenlals of 'rhe game 'ro give a good found- afion for laler worlc on lhe lirsf squad. For several years Mr. l-lalley has been very successful. The Miller second squad had a very successful season in I937-38, winning six games and losing only lwo: Marshall conlribuled bolh defeals. The ourslanding players who consislenrly led lo lhe wins were: George Whealon and Bob Punch, forwards: Ed Leonard, Bob Andre, guards. 9 Grea+ and Wally, HNHIHS lllll 0 BUY YOur liclcel nOW 0 Mr. Ross d fD 3 O :S us -9- 1 OJ H- CD cn Nil llll W' 0 TOP ROW: ATlrins lManagerl, MaTTeson, LaLone, Johnson lAss'T Mgr,l, Eveland, Freeman. 9 SECOND ROW: Lasley, Turner, Lee lCoachl, Syme lCo-CapTainl, P. Anderson. 9 BOTTOM ROW S Mr. Lee's Tanlcmen splashed To a second in The ciTy TournamenT again This year, deTeaTed by Their Tradi- Tional rivals Trom, WesT High. Washburn's candidaTe lisT displayed perenially Tine swimming maTerial before The season, buT noT quiTe Tine enough To overpower The Green and WhiTe. WiTh several veTerans reTurn- ing Tor The nexT season, prospecTs are beTTer To Talce noThing buT The loesT as Tar as swimming laurels go. Wenger, McMillan ICO-CapTainl, Garniss, Mcf-Sregor, I-laloaTa, Mr. Dillner produced a balanced Team This year which sTrove To reTain iTs championship. Clean playing, co- operaTion, and Triendship dominaTed The Miller rink as much as The ambiTion oT reTaining laurels oT vicTory. SouTh's Tigers displayed excepTional hoclcey in de- TeaTing The Miller in The ciTy Tinals. Team spiriT and morale are aiding in The campaign Tor The re- -O- r: 1 3 O -01 -O' :- KD 0 O 4 CD -O- KD O.. 0 C 'U -+ O OJ U1 :- U' 1: 1 3 uv- -W- '1 O 'O 3' N4 O on U1 KD 9 TOP ROW: Kennedy, Waldo, Bollum, STevenson lAss'T Mgr.l, Malrnsbye, Dillner lcoachl, Moore Sherman lManagerl, Bell, Rose, Johnson. 0 BOTTOM ROW: Leclcie, Berg, ScoTT, Thayer, Gunder- son, Hellickson, Dahlen. Hlllllll 9 Indoor sprinfing. 9 I-2-3-4. 9 Hold him down! 0 They're being roped in! 9 Pushing-up. IIIH II IIH Washburn's gym Ieam has been improving sieadily year by year. Experience gained by parlicipafion in many 'rournamen+s, has placed The boys on a high rank in compari- son Io ofher schools. This sporf requires arduous pracfice Io acquire 'rhe necessary skill, and 'ro masfer Ihe fundamen+aIs. High efficiency is a prerequisife To membership. 0 LEFT TO RIGHT: Fremling, Wallace, Hanson, Bowen. Hebling, Carlsen, Dobbs. 0 STANDING: Eveland ICap'lainI, Larsen ICoachl. 5 cf: -1 :cs 2 i cf: -':: ::: :1:: li cf: -1 ,.. T.: -1 l -1 l :.: -i :Z 2 -ll P Y' 9 LEFT TO RIGHT lSfandinql: Schulfeis, Andre, Wallace lcapfainl, O'Brechf, Barnelf. Hoffman, Wheaton, Kennedy, Pinchon, Gronsefh, Brown, Rofh, Thayer, Hoban, Cravens. 9 KNEELING: Condi? lManagerl, Mr. Ross. For The firsf lime, Washburn's MacQuarrie field was used for baseball. I+ had been formerly only a foof- ball gridiron, buf when fhe dangerous wire fence surrounding fhe field was forn down, Mr. Mac' Quarrie decided To give fhe sfudenfs fhe benefifs of fhe bleachers. The Millers have several leffermen refurning fhis season. They are worlcing hard and as always have high hopes of a successful campaign. Q i A ll H TH HHS eeggaas-3 gmlm p Ofeiafw 02'ZnO'.: 0 C '-9-LO D91-26113200 zhmez- in 1: Q :o.cnw5+m-5.Q 3035? Umm 1 'Q,cDC 3. .,,2:'Z3639,ni o33wcn0'::-4 - 233-Qgm in .. f.g.,.En':.0 3o.S'o29h.5'5 Oia43S1m:v 3-.j',...3mC- -I-Q,Q,:?nGJ ZTSDQCTQ ,.. 7s' wo 5'+V'O's2F5- QF 3111503 U1 3 C1101 'P 2 nOZ 'E 2 -05'-22731: a C3'-MCS 'os?ms223 . cb ogfngo-nga' OCDQ'1j7-+f V' C0 '4 -4-. 07 1-O--O 1 1 U1 U-0-iOEj ggi -. O u1CDmO33CC --Q-'U--CDU' n ...L . ll HU Rose lCap1'ainl. 0 Alwin lCoachl, Swain, Huber, Punch, Brandell, Hale, Jones, Spence, Sanders, Boa. Boll, Parsons, Hllll Ill WHSHHUHN Nlll 9 FRONT ROW: Marlin lCoacl1l, Glasrud, Bell, Wafson, Lasley, D, Enfzminqer, Sfruble lCap'+l, Weigel, Brifon, Marlin, Cohen, Pazandak. 0 REAR ROW: Hein, Wlweafon, Cavanor, Brown, B. S agzaaag c -if :- 36'1 5+.mQ.3 01:- 2m1 T 3,2io QTE- '3' 3'6 '033 -o-0-014:00 u-0002.49-'- 23242-2:2 'U.,. 0' E. 272-gp-Q-KD.4w 0::QJmQ..g-,+ 3'6.3n, :mg f3333S3 germ--2-- ' 3 c TH.-3 23? -new 4 9.071 CDOW -34 m2-4-.Q -P01 ' -- 3002335 -i- Jn, 40' cb 2,25 339321- mmoi., Q, : T4 -3 ----9225 -.:: Q, 3 mg-al -. ., ,,22,Q.o-33 1O:1N2'CfD., 9.3-3 SDK 2.U'c2'Zow3' 3E1i:3k5' p3'lfD4DQ.:' Enfzminger, Moore, Hickey, T. Sfone, Pfunder, J, Sfone. aesagzg 151151 2o.i5.v.m3- -. 1 225495+5- :T?3'o?e3i mm?-S 'AL Jgong Q Q'cn ',7'f+S'-g 5'T':i5'4Dn':. 0 LQ43g'D O'Dm U9 3 OT:Q3n 70:3-m mg- 00400-1 Ozmrmm 6Z3'mT4-Q-3 4 m4n,: m mmO.m-4-.CDD -cn 3+ '7'5'5!'Qo'cTa . mn,- 3-3?-4 1LE -hm:-Q. 3 Dim QOOS' 0l'U -H 333390 2o.:'-afif-F -I 32 I 2951 aw KDE' U- : -+---4 ,4 .. 37 Q-3-352 D,'L'9. 'F'1 -0 - 5-5gE'g-4+ 0 rs- P90-Q.:'TrDrD 0 TOP ROW: Sfevenson, Camp, Geiger, Wilson, Hanlcins, Swanson, Carfer, Biesanz, Sher, Cooley, Hlll Palm lCo-Managerl, Wachsmuflw. 0 THIRD ROW: Weiss lCo-Managerl, Dunfley, Tanner, Brown, MacMullen, Bryanf, Sfanchfield, Marwin lCapfainl, Kindern, Puls, Bond, Bachman. 9 U SECOND ROW: Jackson, Garniss, Bros, Hatch, McGraw, Leclrie, Erdman, Gunderson, Oman. Shaw, Larsen lfloaclil. 0 BOTTOM ROW: Jouberf, Fleenor, Fowle, Anderson. Collins. ll qzm . ff ,ips f-sf, maf- ,gif 'nv W I ll HNHBH HM H I 'age was 0 TOP ROW: Melvin, Abbot Meacham, Olson, Johnson, An- derson, Travis. Miss Smarl. 9 SECOND ROW: La Lone, Fel- lowes, Drake, Elliolf, Bacon, Stark. 9 BOTTOM ROW: Hendrick- son, Ball, Lueck, Canferbury, Seashore, Deeds. A very large group of girls parficipared in volleyball maiches lasl season. 'Tor volleyball has proved To be one of The mos? popular sporis offered in The gyrn program. The final championship game was played on The siage during an all-girl audiioriumg The IZA ll proved vicrorious by a decisive margin. 0 The fool- ball field was used again This spring-buf by The girls and for Their annual diamondball +ournamen+. Games were played during classes and afrer school. Caplains refereed and scored The games which were scheduled so Thai each girl mighf earn fifiy poinis. VHHTYHHH if 9 TOP ROW: Mclnnis, Piclcardf, Chisholm, Johnson. 9 SEC- OND ROW: Blaker, Taylor, Andre, Hay, McCormick. 9 BOT- TOM ROW: Rocheford, King, La Blanf, Kreuger, Covert Us 7 M H M HI MMIII 9 TOP ROW: V. Johnson, EndicoTT, MaTher, AbboTT, Boyer. Hanson. Mayhew, Seashore. 0 FOURTH ROW: Travis, STark Allen, Fay, Cooperman, Beacom, Drake. 9 THIRD ROW: Ledin, Fisele, Arneson, CoverT, Deeds, Thom, Morris, Canferbury. 0 SECOND ROW: Olsen, Taylor, Ball, KoIsTad, WhiTcomb, Ander- son, B. Johnson. 0 BOTTOM ROW: Dahlen, DuTourd, Phillips, Anderson, Krueger. Fellowes. A school IeTTer is awarded only To a girl who has earned 600 poinTs and who has The recomme-ndaTion oT The gym insTrucTors as To scholarship and general .characTer. PoinTs may be won in The Tollowing sporTs: deck Tennis, Tennis, badminTon, bowling, volleyball, basketball, baseball, goIT, horseback riding, swimming, skaTing, noon sporTs, and The addifion This year oT hik- ing. AT The end oT each year, a banqueT is held aT which and CiTy Wide Emblems are awarded. 0 TOP ROW: Frdall, Anderson, Leslie, Paulson, PainTer, Rase mussen, Lindow. 9 FIFTH ROW: NorThTeIT, McCormick, LaI.one, Cowie, SchruTh, RudoIT. 9 FOURTH ROW: Chisholm, Heinsel- Wash, Williamson, Beardsley. 0 man, SweeTnam, Snedeker, THIRD ROW: RoTh, LaBIanT. Weik, Mullin, Lueck, Hendrickson. 9 SECOND ROW: Hahn, Olin, Carlander, Brand, Johnson. 9 BOTTOM ROW: Erickson, Flink, Hanson, Griswold, UIvesTad, Ogden. I -.ffjgg,.,,L I ,yoe,.7c.1Il? ,z..1L4fz.,w.AQfs5yifl, ., W Q ' , UML' cu Wlpyvso-in affcf Ti MQTO 5.2, A f , of .. m.iaLfe,L.f - M L.os,45ffcQ ,a X1 I W , NM ' , X ,UV V, 1.7.4, fx 3... V L.-If! IC.. vt -., chaf- 1 RNC ,LI J C.,-f,yV5,,l rNf I R I H M H M HI MIM M IO7 . .wli Ill lllllll P A T T Y B E R G CURTIS cuP REPEATER For The second Time, PaTTy, Washburn's own conTribuTion To naTional golfing, has been elecTed To The CurTis Cup Team in recogniTion of her excellenT abiliTy and sporTsmanship in golT. During her high school career, PaTTy has been an eager par- Ticipanl' in many acTiviTies in The school. DespiTe her many ouTside inTeresTs, she has always mainTained her high sTand- ards of sporTsmanship and ,cooperaTionf Washburn has been proud To have and know PaTTy as a sTudenT and a friend. A new meThod of choosing conTesTanTs Tor The PosTure ConTesT was iniTiaTed This year. Finals were held on The sTage during an all girls' audiTorium. IT was decided by a commiTTee of Tour judges ThaT Anne WarburTon had mosT nearly perTecT posTure, and she was awarded The TiTle Miss Washburn oT l938. Sec- ond place was won by Joyce Mary Anderson, while Ellen Powell. Marilyn Johnson, and Elaine BissoneTTe Tied Tor Third place. ATTer The TirsT preliminaries of The posTure conTesT, The names of The conTesTanTs were given To all of The TaculTy mem- bers so ThaT They could observe The classroom posTure, and eifher approve or reiecT names on The lisT submiTTed To Them. 0 TOP ROW: Campbell, Beacom, Johanson, Anderson. Powell. RosholT. BissonneTTe. 9 SECOND ROW: Engle, Maag. Weiskopf, BuTTerworTh Shipman. KahlerT. 9 BOTTOM ROW: BraTrucl, SmiTh, WarburTon, Kinn. a anT. Alla. -RP' ff-My a I. Mary Jane and KL' 2. Keep your eye on The birdie. 3. Twin skafers. 4. Oufdoor speedball. 5. ln- door speedbali. 6. Lacing up. 7. Tennis vicfors. I ,w f ww The afhlehc program of Washburn has on rhe whole been on The upgrade This lasr season. -Mr. Mervin Dillner, head foofball coach. L 1 i S......S lg!! rksiqgifl was 3 BEGINS I.We're on flwe air. 2. This pun will gel your goal. 3.SweeT polaloes. 4. Sl'1ow me llwe way lo go home. 5. l-la! hal hal 6.Grandpa Snazzy from Van Buren. 7. Baffling for balance. 8. The anfique per- ambulalor. 9.Sparlcs wilhoul flames. IO. Ser 'em up, boys. lI.Big Apple Blossoms. I2. TweeT, Twedff' AFTER SIXTH PERIOD 5.GrisI' banquet 6. The way home. 7.CharIing Their course. 8. Eat drink, and be merry. 9. H s a seiup. l0.Whaf's fhe score? II.Truc:k on down. l2. Refurned 'ro The 3rd period class. I. Marie McPheeIers Dionne. 2. Swee+ Adeline. 3. lf pays fo adverfisef' 4. The barn dance. l.lT's Tough luck, Roy. 2.He's oh' wiTh a splash. 3. Did you hear The one abouT-4.Cheer, cheer, The band's all here. 5.lT's my Turn nexT, Joe. 6. Over The hurdles. 7. Any Friday aTTernoon. 8.A hole in one, DwlqhT? 9.AlmosT ready Tor gym, I0.Try a halT-nelson, kid. I -niii5s!6i:EFk.VEE I. Play ball! 2. awarded, 3.A duck in llwe pond. 4. Pos- lure winners. 5. Over flue lop. 6.Scrubs scrimmage. 7.The lrosfy big apple. 8.Tl'wey lceep posfedl 9. Ice Follies. I0.S1op flwal puck! ll.l-landy l-larry, l2.Towels lor flue Rossmen. I3. Pass The puck, Bob. I4.ln'framural manager. l5.Tankman- aqer. I6.Sfandinq room only. I7.0uf lo fhe fnaclr. I8. Asl'1 and lworselwidef' Ql3il,355?Y5 EPIi5!'i?iv 422 Ts 7-f 1 Iv . - f - -2 ' H435 ,,f l.Can'rafa cnanfs. 2.Lancelo+ and Guinivere. 3. Using The new spray gun, 4,The duchess. 5.Tea for madarne. 6. LiberTy Belles. 7. Swingin' if. 8. 'The Valiantx' 9. Slovsky's Florisf Shop. IO. Saying qood-bye. ll. Prejudlced Papa. I2.Sweef and love- ly. I3.Pa?, Jean, and Babs. I4.Carving anofher nofch. l5. Rehearsing. l6.STudy, fry and do I+! I7. Hof work. WASHBURN ENTERTAINS 'T-' ' ff SENIOR CELEBRITIES Gerald Prenlice Bill Dunsworlh - Arlhur Dienharl - John Reigslad - John Parsons - Arl Shea - Arl Meyers Jack Teller - Bob Gaus - - Jack Glover - John Parsons - Bill Braasch - Ed Mahlman - - Bob Gaus - - - George McClinlock Gerald Prenlice - Ed Mahlman - - Bob Gaus - Doug Cravens Craig Burns Dick Brislol V John Brandell - Sleve Freeman Laird Waldo - - Bob Grealhouse - Ralph I-lays - - Bob Linderberg - Dean Proudlool - Dick Twedl - - Doug Cravens Chuck Condil - Joe Alkins - - Chuck Condil - Bud Barnell - Doug Cravens - Jack Beallie - Bob Ervin - - Norm McGrew - Bud Barnell - - Don Goodspeed - JANUARYCLASS - - Mosl Popular - - - - Mosl' Sludious - - - - - Peppiesl - - - - Besl Looking - - Besl Dresser - - Besl Dancer - - Culesl - - - Mosl Talenled - - - Mosl Alhlelic - - Mosl Courleous - Biggesl Drag - - Biggesl Flirl - Friendliesl - - Mosl Poised - - Mosl Cheerful - Besl Line - Williesl - JUNECLASS - Mosl Popular - - Mosl Sludious - Peppiesl - - Besl Looking V - - Laziesl - - - Besl Dressed - - Besl Dancer - - Culesl - - - Biggesl Bluller - - - Mosl Talenled - - - Biggesl Arguer - - Mosl Alhlelic - - - Loudesl - - - - Mosl Courleous - - Biggesl Drag - - Biggesl Flirl - Friendliesl - - Mosl Tacllul - - Mosl Poised - - Mosl Cheerlul - Besl Line - - Williesl - - Margarel Newdall - - Lois Snyder - - Mary McLean - - Marian Kruse Belly Jane MacAloon - Marian Campbell - - - Joanne Dorr Audrey Abrams - Marian Campbell - - Mary McLean f V Belly Weisel - Connie Rockwell Jeanne M. Mulligan - Belle Lou King - - - Joyce Kerr - Connie Rockwell - Rulhie Holmberg - Belle Lou King Lillian Salkin - Belly LaBlanf - Belly Boyer - Belly LaBlanl - - Pal Sanlord - - - Belly Howe - Grace Hendrickson - Timmy Sabor - - Pal Sanlord - Elaine Cooperman - - Timmy Sabor - Barbara Wolll - - Pal Coverl - Elaine Cooperman - - - Jane Juel - - Jan McCarl - Marge Beacom Jean Schrulh - Mary Drake - - Marge Collins - Shirley Sweelnam - Marge Beacom - Kay McDonald I.Pally in acliori. 2.Pensive Percy. 3.M-l-L-L-E-R-Sl 4.The lasl mile. 5. Mosl valuable. 6.Wahian edilors. 7.January Class Memorial. 8.Slep-sons ol pholography. 9. Janey. I0.We. lhe people. ll.A lulure pro. l2. Lyle and his lens. I3. Woe is me. Irs, x N.- DAY BY ' .sxrsx 569 si I. News Hawks. 2. Laboring aT The FaThe. 3.TT1e perTec:T modeT. 4gSopTTomore Eng' lish. 5. WT1aT makes Things Tick? 6. LasT Hope. 7. Come and qeT ET. 8. Leaders from Ramsey. 9.fN creaTTve Trio. I0. And sunny KaTe. lI.STamps in The public eye. DAY I. Angiosperms -flowers 'ro you. 2.A passport To knowledge. 3.The foof of fhe class. 4. There are fheorems and fheories. 5. Teacher's ouf. 6.Where were you las? nighf? 7. Trade you a ielly for a pea- nuf buffer. B.No passes, Jack. 9. The Thinker. IO. The pause Thar refreshes. ,g-svwf-d 'f ' if 2 Q.. 1 ' f s. Y wa gr-.11-za 1:-: nm-1:1 1 1 ,.,- ,.,. . . 2:50:21 :mr ' 5:5222-:E:i:5:1'r 5 295351 S i ff? m i - , '1E1i7 E:E,r ,1.1.1, :Q .. . . :,:a.n::M..:.:.:. i .-,,.,. ,, Y4' W ' L1 Q IP xc fs ug wx N ,ix 2 L f gi 2 2 .- 5 4 :f Z X i' fx . 'H E. .X f,. , Ma, A Q f,f2 ,f',, , N exe' x x 35 sexy, g g? , , 3 ' Q kj Q , .... s i W 5 L : 'W E F '. E 1, 5 .- ' z5 553:,I-7' i gaa x Q. -- . We , g fsf f is 1 4 4 ,.f-W. iq. K I ' ' Q egg s , , E 5:53 Ni 12 'f E' , f.:-. 43225, M Y .. l ., 2- .-W. s :4 c-amp ,...5 E fx -F5 5 V . .m.-,-y. 4....,..-..,. 1:.Q1E:S1M:2 .:-:-3.-szwrz :ff.-xrm SX 4 ::a3::,.5EI::3:: I X , .v '+ www Vfe are graieiul 'iO.ii1E Miiler Sfudios and fo Harrison gl Smiih Company and Their represeniafive, Mr. Arne Aasland, for Their pafienf and cooperafive effori' in lweiping The Wahian sfaff make fhis annual a success.
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today!
Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly!
Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.