University of Wisconsin Madison - Badger Yearbook (Madison, WI)

 - Class of 1920

Page 1 of 718

 

University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collection, 1920 Edition, Cover
Cover



Page 6, 1920 Edition, University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collectionPage 7, 1920 Edition, University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collection
Pages 6 - 7

Page 10, 1920 Edition, University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collectionPage 11, 1920 Edition, University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collection
Pages 10 - 11

Page 14, 1920 Edition, University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collectionPage 15, 1920 Edition, University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collection
Pages 14 - 15

Page 8, 1920 Edition, University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collectionPage 9, 1920 Edition, University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collection
Pages 8 - 9
Page 12, 1920 Edition, University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collectionPage 13, 1920 Edition, University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collection
Pages 12 - 13
Page 16, 1920 Edition, University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collectionPage 17, 1920 Edition, University of Wisconsin Madison - Badger Yearbook (Madison, WI) online yearbook collection
Pages 16 - 17

Text from Pages 1 - 718 of the 1920 volume:

,. . ,. ,..,..- ',l ",,.-f' . 31 . . ,gy-. '. . ' " .-5,1 .V . 'W JM LP' .XL S., Ulf, ji - 'dd-i,,f ,f"' lf X rf' ki XM' X- if .til fx-"" 7'F"S..11 l' - ,TJ fffff .-A f 5.5 .ZZ Z ff! ,,,:rf I VNIIVRSEIY W9 -'fi 4 f ' A W i f 1 fi V.':' V lzizzi 1'11i:i 'ZA.q:W' g pyrwghfed 1919 LINCOLN A QUARBERG 1 X X . V , , sh .W A Ecffor-in-Cfuq' M. VINCENT GSHEA BEN M WISHNEFSKY Bzuzhej flffangyerf 1 K-F141 'V T:'Lf"'-Xu ,- Y V.. ,, Wt.-g X, ,- - 11 -H - f ' Y' f ' if "f Q , Z.- g ,, K 'M ' ' "Ei" ' -WW" " W J" " V ,A E5 ' - A - in l' TS ' ' ' I . -. ,A M-, -X ff Em L 1:ETQ'rY B DCJER Ass emb led and Published bythe S QF 1920 of the University Of W1s,cohS.1n Q T --,k , IA + fav Y CONTENTS I ADMINISTRATIQN II CLASS ES III THE S ATC IV ATHLETICS V ACTIVITIES VI C0 EDS VII WISCONSIN IN THE WAR VIII QRGANIZATIQNS IX N0 IVIANIS LAND ,"""'N--. ,. -"M-ix-. A' ' -Vy,.,. 6 'xxx If .1 ' .t K V V ,- rm 4 J: f V 2 .sw fi' g Q - -,Lf fi - , - I , , V x. .,,l..,,i, DLJLIUJZ ,: r -., :ng , V- -W. A nli' A :X f: 5 . ,,ff I f, 1 51 . ,AJ 3 .jf .1 5 17e.?sou,I.o.f.an .ll1StltUtlOl7L.W,b0SCS01l5. have gone forth as Wrsconsm men bave gorge as unberslcfobpnlg 11 those who know was l1me'w1scons1n, cf? Q 234 Ycgyf 'IW . T ...LF 1 . i A W!! 1'1.lHNrwf"'-H-A A W ' W- X ' H' N1 l 9 lx ' x 1, 1 x , 1 bf 1 l J " 1 ,. ""f llf f' Ui, 1 TQ '.,',,, E2 '-,' V4., 1 :i1?'ij,i' -"- 'Af.L . . I ? Q A -,,r 1-3l'Q,Qli.1Eg,.:i1c,l :Z -.,.: g,:':Eg:,.g .-.-1',4 41, gli" -cgsj. x tx X "4: 51:4 '-'f P-2 .ia -'rf'l1 ' "ff,-,- 1 -- ',.-:,: ' 1. :'- f. T. 2' sf .,,.: 31 4---,: 1.10 ..'.. ' 1 ,-f-', f. .f '::f'f lf .Q .4r.'. -11.1-.1-.q..::.-.2111-.1'F.'f'faf LHS. ',.' ."1f f' X :', .",1 2 '," .,-',,'N --.,' IQLQQ Y .-4 .A-.. -.-, - - .....4.k ..-. . . .,. ..-,.-,., - ...,..-. -- .- ,- .,.f -.'. - .. - .... 1 ..'. . 1.--.. -,,,,,-.' ,.1, .. V ..-.. H 12 .'1-: K1':' J J '.'4" '1"" f A"" '1"' A5 ",W' A3?52TiEf-Q5 I .N W1 ,.., . l., . ........ , .. 1 . ..' .. . 4 EV 55' A .." . SLQQ ' -.... -1.1-.:..gE31 .'..' Q .-,.. ..., ,'..,'. 'T, ...,Q. ,ffl ..,'-. 5 ,...5 Q W'x F 2.' 1 iff W ' if L A Olyxs Book is lnlercbeb as a monument bw cv as E5 'XWQ L F Q?-A W l to the part out lCmvm-stty bas taken m the ments, arab, a grapbmo xnterpretatwrp ofb r 'iii66ihif4BIEQQsljairiEQA f5?:a6get...111Ietpmls that wx! accurately cmb .preserves fiiihngly 'wlSC6WSm,S prowb war fume record, it ul ills The purpose for Wlymcly nl! was beflaken., 0116 The dass of 192 Takes prtbe in 'feehnfgf Thai? its ggi: Ib wmxmsm is cy hrstovxcaf arab przimanexrli wistful: t7 il E """""'l P VW X 5 'I' QPU Q L, J QQ Q QQ O I 3 .J C 'X .f Q W, f In .1 .. . ,..! ,V . 1. ,. .AA. , . X... , :.,w:3: -, . 1 1. .ck-Q 1- fi ff-:af -M .,,, . 4 fgirizf 52:"S,r.Ii -1-'.s:3jf.1'.1'e.E5.z5gf.-5. f-.gj.:5Q:.,Z1.15r'751. -oy. -1,4--::':Q', . gg :ifg.:I1'ff.L1-.1g.fi'.f.'55,,1g.1-K 1 was ' 1:35-1.11-E-' EEL' JE.. ' 2 -Z.,:24f :"3' 'T I ,' 2. ' 1' ,- 1 -' fy '-5.151-,rg :V -,1 fi X .ay--,z.?3:. X'9j Vf' ' 53aj:,-5'jiu:.1Q',e1fg":5i1" 'giffp,Q:.g'.,2pf..3,i1zk2gE12 wg FN , ' 2Ez:1ij:jg1. 5 112',lj:5.' ejz .J 1. 1 , ' 1- 6 -' ' N ' I 1 4 'fffq1f.5yef:f.a3.1..gL5::.e:-g:a3:::-iw: ::-.:v.S:3'i1::f1':111i2nn'E -'1.'::,.-'.',isf1-141-,1'..5.-3E,-ww.-ajgq, agff,-Qs..it:5q?gga'1:,: wr fm 2 IQ? XP cl 15. .f'T . 1 1 ffa-'iz' I 1 '1 ' 'Fifa s .1 1 2 1523 '1 4. . F 5 1-3:2'-51,-33:-,-:.1z:1.:f::Qi22api'J 33,.f:u,pqf'-1':rj.-.ffwif-:J ,...y1'.:-3515,.4.-mf:-'V-1e,f.r11':::f .zif-, f1'5Tjf?'5i.i 1 Li' X S -:Gaby-ff .::-rg.. :g.:qf:a-aff' 5Sffq-:f.1.'.,f:.-:p:.2:"-r' fa-.gf q:,-gg.f,.- Qfylfig.-fr., .3-3 ,,.5:.g,:N' 'gg-133:13 ,v .gawi-.:1:fi. 15.:g:-at,1v,-'.- ' ' Q' 52 .3 pw.-14,-.-c1111 1.1.1-.-ggfx -9:-e. .L .rf-:,-u.g:f.-f15u'f..w- -,g.j'.Q:'.ncgLTffuj g,.'.fg2'pa':':52j-111155.-.-:-.ff:i..,:,.ny:4:.e.xiii iQ.rJ5anbq-:1'.'.2'-fg.3::rf1:..- I -.1 A K -22::.9fg?.'- 1 , .-.' ' ,' Q.: X . 3 Rug,-.15-51:.g:3u.,a.'.-V.g,'1.'-,-,gpL-.,.fggq,,5:f:nC'-if.-5.A3:,',-,,1::,gf:.g:,-,ga-,1I-1-5355.11-gig-. rg - I fff.:-.'.'-:IZ1-'-wil..fa Vw PJ ff' ff faiiiii 2151152131252fs:ef53.s1-e113:2-'.,-2'Ep1-23.13.-vzfi .gncf:1525:-gg.'agya5f:. ffm 'f 15.7 , . ,xxl'g1-Q,z3tf1gg-.3451 rg ff..-!:f.1gI1 ,f:1,ff5,,--.2 gi.,-Qff1'f.7:31:1:E,f1-35-.-.1,Hg 'F:.9"'::32f'.5 X 55f:55.-?5:g,g5-,.:,- . -' ,135 .1-.f.-:121 . .15 1. '15-'.'.'5-'J-::-,.5:o'-.-.:C '-'-gn'3E1r'1:1:'.-, -:":.E' ' 5,55.:jg51. , H i :e1:-:x-.:-'.g.-,-:fg,'.- : 4+ -X Jak- -1-:g ., . lag.-I+ I .- ,V 5-11, . - .- ,. , ., - . 11:57 .- .p,4,:..:,g W 11.11,-iv.L1Z'1n-jg'--J-17:31,12-f: ff,:,-mf,-, ,-':g1,,,1 1. ff., Tj ,,:,X..,.,:..gf- 53,--.3 .Q ...gm 5: ,3.,,,..:5,'.,.'fE5y5:1gg1 535 -214575: '55 3-fg.1 ,'.43:Ef!-2518.5.5:Sag.fi:Q,E4'3g.Ew3.f925'413513 I j.2:.i Z-2:1 1:11-'-33:1-I-.1 C- Q25Z15935,Qjjv.-,I.E-.'Q3.Qg113:3i1 -fgffgqsgg1.3351532155 U .:?2:11E':2:QT1:1'.E2v'5:.11 T511-if!,1:?1E.E:'g5::'--1.41 "fi:f-1,-J:1:j:r-,nz '15'-'.:,:fE'.g11':7:.fe:1.5-5:'.i1::':71::5'ri'.:a-,-1 K - 931:41 -i.11.:fqa5,::522q A -'Jr12'fcsP . .-:r1i?: 1: . - 1.-Sala' Y iilf: , - ': - .. 1 253: ff - : - :' 51 .-jiae:-i-ra . 1 . 7:235+,::. ,, ,-.-.3 ,, . , f, . , ,, 2- -157, Q- ,fggi 1z,3 KN., 5 F1 ,P-, ATLJEY 1 , , . ':,.7-1143-'jwr Rf- -'7 f.5an2:1mE,-e-1212-122413.-2..,.e1.f--241-fr-145.5-,gf.'.:in-9:13-1...ease..1:-1.-:21:1'azA:.f.1...2:.s:'-:arf'c.w.g.'::f4p:.1e'.-Lv....-:-. :1f'.:.'s:.::- .z.1L--fffyaqrs ,W .- zcnq-.vzv-.vrg-,vgzg,qg,,5:y1-,-,55:2-,'.:,.,1.--.1f:.'1,1:,-g5.f..31g..,,-3,gg:4::.-,J-:Sg..-z'.y:,.11mf.-35,,. .f,f,g.1q15,.13:-,.,.,,,.g-Q,-:,-.-3553153 ':,1.'.g:.1f.g,1g.5151.:g f' 4 K -L 'lg A 3.-Jxggygf, '-gt:-,13:.::..-,'g-1y.yuba:.v.:..!1:g,:'511-2:1,::,-x.-1 -n,:,1g,-.15-1315, -'Jia sjr,-5:gg:.r-pgpfzfpl., .l 4.,.55.:q:-g 53-,,g1.g1q:. 1 ,- fkl - , . -1' .:. fI.r:5'a1.2gi1:f::-isa-if-err!11.1:f'a:f':61.::fa14ef-14:92..En.-H-LQ.-fj45g.':2-Fai.15.-:.:f:."T.2:-1-f.szfznaz:awrrivia-5:--2-211+.'-af.-:I1-ilifrawlfi-fffiflie1. ' f 1' 'FP Qvfl F 2 5 1 ' f"'ff!' 1" 7"'Ef'33i5 ff' 7 "pia?i2.2 4532522 ' P - 4, ' 3. zJ,.,.1,,f:Qe4.,.. . ., :,.,.,,. Q' "7 fx, fda:fqigzrm55.aifi113sQj.qsgkn-s'f.-g.g1,.1'1af,if5533412151:55.-.-3553295525-31-.4Q42-m',?x.vs:3:1ee:1Q'Jake12.555321155242521:,4q5.5.5?2::-,Q15:-255245.Qirgfe X- - . .V ll .- .-..,.. .- 4-f... .,., f., Nw.. , -...--.4--. . ., ..,....f..- ,v---- ..x, -. ..w..... ... - A. ...,,, ,. Fw rf' 1' I . A 1-515214-'-.1 -0 - , f - wi? 5 - if " 2 4134 1 'fi . 1-' '- ,241-P ' ' '- f- I2E'EC2-?EZ:fl1 " f ' 'Yr R3 EY.--rr2:':2.:'-' -:-'Q-14.154-1:?m.i'1:'11mrGrilizbr' iw43::::.vr.v1. gffifrni 2:11-f:,fF:f:5,1:?-.:-151.1-.,22::3s',i ixifzvrpt ' S-Qllrg fy ff 'N . . '-::- -113.2-IA LQ ., "1.'J,-'.- Pj ,-'-: 5212.15 : 13:5-5:I'5, '- :I-,-sy "L, . 'gl-l::Q31'2.'oI - W1'5g2.g.,". ,ql"',n'i.Am.--11l::'-S ,-?6:',-'ff-R" 5:33 , KA' 4 . .- -f 2, i 5 f C' 'fff ii eff'-Ai ..-iw . A 1 491 -Juvx".:f1:c.'1.--,-vez.-af:gr- .' .9-fr.-fm.:11-g-g-':.cg 221 2:51.19'.':1'11y-fy:--1fg1:..1 yi., 1.11.12 :11.5111-,.::qf1fx5risgnrw-fy-,qr'gg , 5 a. fE?frn'.gJ'aiviwa-':-avivfi-':-E!1'fl'.111gi:1:-Emp.:1:1-"'.f-:3?u':1.i-,:!w- ' 'f.-.-9.21-gbiiegfgz-.zggznwffgiq-.yyrqguhuifgzxgiejaia-rg3'z:5u:m:'?: 31 . I 1' " 'fialff "4'-ZfzEa1sw41:G:f:+?:1v14ve.-.':'.v.-,'.f -r.1f,111.,f-J-::::.f::-,-2-51:-114i:'::bI.:'--bf-'-.-:mv'fcm::!'.4if51!11-"f- ' I wi 1 13 11 Y 4 " ,-NR ., V ....,,. MDN N ,N 1 ', , " Y -,,....:.. , ' ' ' ., , , . ,-.lkki ,--W . H 1 -pix-, ' 3:1 .1-:fig .Ff.T X- 11- -TQ MIL l MQW.- g.. , . .. , .. ""'i . .- - ---- f vt , '- 1 A ! +L- 3 ff-QT, .f A Y -Tfi ,733 -A X X. I., :ri .f- Af :rs-ff ,l A - N..-,LAX . :L-fr:-.-is , " .ka-1-ifgff ,.., : 'P' - ' . -Jr L.J flvrgif.-:A ' ki'-v ---' 2 ,W .vi " A .4 U-K' : 1...E,X fa- -,.,.-W. - . L "1 x f .L .V ' ' 7- 'f-,,. N"- 1 . ' ' -,G " r Tj Y -' ,,.f . 1 5 .,-,,.k,jf , l , 0 X-f'ffQ 1 X x I, X Ein Menxnriam Charles Xicharb Van Iffise "We rejoice lhal he has bwell among us, anb ihal his spirit will conlinue lo moulb the life of the university. 'Ebay may resi from Iheir labours 3 anb their works bo follow them' ' ' ,. ,Qi aiu Y ..,., ., V 251 eff Qfrzocrac E , "ive will keep nA'. n Grue faith with you who lie asleep. with each a cross to mark bis beb, ' Hub poppies blowing overbeabf' -2Nmerica's Answer. fffmy, X xx ., we ,.., ,, , ,, 1 Q . ., i ..: 1551 ' . ' - V, , W Y , 41251 g,A, - 4+g f 111. 1: -1 11 E N- . V ' 17 r ,4 L--qi! j .,1,A,.-A,,, . ---vi-in 1 A M21 5 1 ee - ff 'Y 1 i f.fW " - ' 1+ 'X E1 ' 9 D f-'il , V' 1' --Q'-51:1-as Q' f l 4 Q 2'-Z1 , 1W11m..-"ax X - 1 3 1 7 ' . 1 l 5 1 morgan 5UacZDonalb Rnberson, '18 . milwaukee 1 , , 1 7 I Iieulenanl, Infantry - - ' hile articipating in ' Q Z K ll d in action October 5. l9l5. W P , 1 f the fhgsierican oEensive southeast of Chateau Thierry. lg: 1 1 2 Z , was s senior law student at the .time ofhhrs eggincg lf'2t0ShF 2 Z Z service, and was a member of Sigma C 1 an 1 e B I j- Y 1 Z Z lelenentered the university wit A.B. degree from e olt 1 E Z X 0 ege. 1 1 1 Z ' 1 3 1 1 5 5 1 7 1 5 1 , 1 7 1 7 Z ' l Z Z ' 1 5 Z ' 2 5 1 H 5 ' ' ' ' S reve rl' Ia. f f 2 , llferberl ilaflm Avery, 18 . . b P0 v Z Tieulenanl. IC. S. 51. Y.. 7. mls bo d E 7 ' ' ' N mber I2 a al' 4 D d E S anish influenza on ove 1 1 1 , Y 1 5 , . the 5, 5 S,pHubbard, then enroute to France with Prmen- Z 7' 1 ' 5. Buried at Arlington National Cemetery in ac- N 5 4 1 can troop . G f h d th 1 7 2 cordance with a wish he expressed shortly ore is ea 1 . 5 i Z While at the university he was enrolled in the course in Z 5 1 electrical engineering. At the close of the second semester 2 Z 1 1 of l9I7, he enlisted in the Navy, and took his training at Z 5 I 1 Pelham Bay. In three months he was .advanced .to the Z 2 L rank of ensign. and was lagerdinade asgiistalxt ILBZIEBUEP 2 4 h l s i u erry. ort y e ore u 4 4 officer on t e suppy I P l 1 4 death he was commissioned lieutenant and transferred to 1 E the transport service. l-le was a member of Chl Phi. 1 2 5 5 4 l 5 5 1 4 5 . 1 5 'l 5 2 ' Z 1 1 1 3 ' 4 3 l 2 5 5 Z 1 5 Charles Walker vsawwan, '19 . . was: Allis 1 2 Seconb Class Seaman. 16. S. UI. H. T. , 5 Died of heart trouble after swimming hourAon August l. 1 . 1 5 l9l8, while in training at the.U. S. Naval Auxiliary Reserve , 5 2 . School, Municipal Pier, Chicago. The firsidgold star on 2 Z the monster service flag at the Pier was plac there in lm 1 g memory. He enlisted in February..l9l3. 5151 WHSPOY Called 5 Z into active service until july. While at Wisconsin he tool: 5 2 an active part in athletics. He was a member of Sigma Chi. Q 4 1 ' 5 1 1 6 2 1 5 5 1 1 6 1 1 f 1 1 1 5 l s u I 2 1 1 William Gu Bartlett, '16 . . . New Glarus 4 2 1 1 1 1 ' ' Dm-ivule, mebical Corps : 4 1 f 2 N Died of spinal meningitis on ,lanuary 25. l9l5. when Z 2 1 stationed at jefferson Barracks, Missoun. He was a gradu- 1 2 ' l ate of the Pharmacy Course, and had been in the drug 4 if business for a year before his enlistment. I Buried at Mon- 5 2 1 l roe, Wisconsin, with Masonic rites. While a student, he 5 g 1 appeared on siveng Hiusical programs and was a member 5 1 ' ' 1 f O the Var5lty ase B team. 1 1 , 5 . 4 4 , 1 Z , " 5 Z 1 7 l 7 3 1 5 g 1. 4 1 5 1 3 . 7 1 ' Guv Black. '17 ...... Tori Blkmson xg 4 - 11 5 1 , I ' Lieutenant Klnfanlry ,Z 4 , , .1 2 5 Killed in action while advancing toward enemy line: Q 2 east of Chateau Thierry, on Septernlbbl' I4. l.9l5- He WU' Z Z a member of Artus, Delta Sigma Rho, and Phi Alpha Delta. 5 2 He was a leader in forensic work at WISCDHSIH. WHS on the 12 Z 1 staffs of various student publications, and was one of the 2 2 most prominent men in his class. ? N 1 2 I rf 3 , Iln Fflanbers Tmelbs the poppies blow between the crosses, row on row 1? 4 Z 2 1 2 2 H -.. . -. W U- - if 2' 'i',,g, ip, , H 1 W M1-W - 1 25717 1 11 1 11 111 11 1 11111111,1,,,11 111111111111111 11 1 1 1111 ,ahh !,,11111111 1 1 1111111111111111111v1r111111111 11 1 1 111 1 111 11,,,,,,,-11,111,1y,,,g,pf,,1y1qgQg1!iff""'"nj 'a 444' 1 , - ,a 4 4 "ff -' w ' - gwxwm'-wr W f '44 0f44....4,4 4 4 44 44, v ! rf--f. ' X f- 4 ' ,ff ,444,,4 44 44 4.44. 'V H, ,,,, , F7 Q X X Q X W if K xxxxxaxxxxxxxxxxx X xxx , .mxxxxxxxxxxxxxxxxxxxx xx xtxxxxxxxxxxxxxxxx xx xxx xx xxxxxx xxxx xxxxxxxxxxx xx xxxxxxxxxxxxxxxxxxxxxxx xxx xxxxxxxxxxxxxxx xxx xx.xx-.xxx 4 4 4 4 7 4 4 4 4 4 4 4 4 4 Z 4 4 4 5 5 6 4 Z 7 4 4 9 4 4 2 E 5 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 I I 4 4 4 E 5 5 4 7 4 4 4 7 4 4 4 4 4 4 4 4 4 4 4 4 4 4 1 Z E Z 4 4 4 4 4 I 4 4 7 4 4 4 I 4 4 4 7 4 f Xi, .SX .. --- "' ' " 4, F L AV., -H1145 3, xx A' ' -4 ff --- + T .ix 1 ws L ' an HNNQ-R Ulaymonb :francis Bloeclyer, '16 . Wittenberg lieutenant, lnfantry Killed by a bursting shell on July IB, l9I8. the first day of the American drive at Soissons. He was a member of a machine gun company and, a few hours before his death, had taken command of the compan followin the death of the regular commanding officer earlier in the day. While in the university he was a member of the varsity football team. l Q Tern Bristol, '18 ..... . Oakfielb D rivate. 'Jnfantrg Died of pneumonia at the Naval Base Hospital, Brest. France, on March 9, l9l8. At the end of hivunior year rn the university, Bristol had enlisted in the isconsin Na- tional Guard, leaving for Camp Douglas in August. ln late autumn, he was transferred to Waco, Texas, where he was in training until February. On February l2. l9l8. he sal-led from New York as a member of the now famous 32nd Dwi- sion. He was the second Wisconsin man to die in the service. 4 John Wiliam Buckley, '20 . . Granb Diapibs lieutenant, Aviation Corps Killed on November 8, l9lB, while on a photographic ob- servin mission in an aviation school in central France, wherein was acting as an instructor. He was one of the first Wisconsin men to enter the service, having enlisted on May l3, l9l7. Previous to his death he had done several months of service f-lying on the Flanders front. Air condi- tions on the fatal day were unfavorable, and it was noted that he encountered rou h fl 'ng while ascending. The lane made a tailspin. and as 13-ii attempted to right it, the horizontal stabilizer crumpled. The machine made a two thousand foot nose dive. crushing Lieutenant Buckley and an oberver to death. Rlexanber Brabley Burns, '20 fDowner's Grove, Illl. Corporal, Tielb Zrlillery Died in the Chaufontaine Hospital, near Luneville, France, on March l0, l9l8, as the result of twenty-four shra nel wounds received two days earlier while repairing the battery telephone line under bombardment. He had been cited for bravery in American and French dispatches dated March 7. As the results of his efforts on that day, communication between neighboring French and American Held artillery was restored after having been broken by enemy action for more than six hours. He was recom- mended for the Croix de Guerre, and was awarded it after his death. being the first man of his regiment to win a deco- ration. He was not yet twenty at the time of his death. Bvilliam Batman Cairns, '19 . . Xllabison Sergeant, 3nfantr2 Killed in action uly 30, l9l8. during the drive of the now historic 32nd ivision towards F ismes. As a. member of Company G of the l27th lnfantry. he had been in the :ireryhmidnt of desperate fighting for two weeks before hrs eat . -Gbat mark our place: anb in the sky the larlis, still bravely singing, fly 4 -.,.., ,Ye wwvvmg-g gm- iw W yg V Y WW we 4- es- A A . 444 441714 '4 - .2404 1144 4 4444444444 4 44444444444444444444 4 4 444444444444444444444 4 , In 1, 444 4 4444444444444 44 4-44-4 444 444 444444 4 ,,4 4444444 444444 44444444444444444 44444 9 . 7 ""' ' "' I ..,,, .fpfffffffff ff 11,11fmfmffffvmn,-ff,,,,,, , 'v ffl!! 1 ff 1 1 1 111111 fr nf 1, fffffffhf, fff,-,mf x xx N Q-w X A x N X-vmnx NNN xx NNN mmm xmxxm. NNWW-.N www-X QX A k A, ,, , MA- A, Lf 4 'A AA ' A A A A 4'i4wA',fi iufk A ' X X, 4, M 4, , ,A , A N S' SX Q :X S I s x 1 M' 44 44 A A -f I Q Q 1 - X Q E z : I S X 4 'Q Q ' S X - V. s + X ' ? Y 1 , X f I 'EM Q m wxwll 5' 15, Wm! WX? S 'A a Auf 5' Smksif S 5 ENN? 'I 'f qs", i Z' I, 5 .js 5 M Aw-:vzruz W -v Ml.:-61. 5. -Q -nn :rm n 0 5, W if G1 gl :SHN 5 6555355355 i q,EaEZE5',, 2 521.22556 5 2 85.25-199229922 3- Q.-. -f:'- so--4 o2.g...O "',,, fg -vu... gg-1 Zag- n Ejuegg' n..U -1 Fan--,45..5:w,HnU 5 10011453-. nn 5Z',.p,4:,g mmm ,gy n. wen- u-u,,n.,..w-.1,,,,D5- g -:-,,w-za.:--M Lo 5,-0 5m,,..,,w,.... ,1- 5 f ia 23 s-53 2 L? 5 3,53 La 5 5 gg Z,E.gl5 3 'ig-iam 'A Egg-52923 Q, Ifg F' ggg g 512 if' 21 Q - .. - - . - --can-1 ' fm In g25W',.,Og- 5,"' "' 5' 5-'cNf'rv.... un: Q5 -wwf' 9. '40 3 9 O no 5 QD- I qw '1 W n.,-O ,F L1 'U I 2' 057 ..:E :1 9. r-5-"D..,D2,5l F-H' my Q.--UK: '- g-15I:r0- ,..v .ln-an p, W ,wr 0' 'U Q 2012-v Sf -ww--Q-vb 0- --s":-:.'-- 9. Q11 if v-fm 0-.0 0' pc. a'fvCf:::-'-,.--c, - ff eu :.,-1 no:-1,-,son 9 Q an-15 Gam ,, 900.-,..,,..p9' 5-5 -wg, H5-.:Z 9 mob' 'Ui 4-,C-,W-' O' . - Ou- .0 -s: -. ww -1 n D...-:-ever-5-KD-.,, 5 ...-R40 :14 '-1 ...m0f'pD'H'N:sQU""'5 1 -1' 0 E-ogpna' 50-0,5 ,,, o mon U 2, D D-E.-m,,,...,,-,aims 9, 5- E.,-, 9 -.- S55-Qrmmn mums Q , 5. 3 USE.: :Z --- Q :S P50 2-c,..5- 3. Ur DQ- - 9 D rv ,q7!,:v-rp: , Og' 5...-:gg--,,,,,3v N J , no.-MNC-, ffl O : ,1 3-v-.5-,,,-r-ng g...:,g,gN -Img B In 01. rv...f-v--rv g Q -- an 57,2 5 Q . fl. or r :Y W o . - 5 T' :sol - F: :VU 5' ."EL -' I 52-Ma.s1ff-+95-ga we-QD., H Q 2-sswiwfsb-2 .Q wwumia 2. gmsmwsf can S V-,-A 5,:5.wia.- ang., D ,g ,, ga-5'p0g-H 5 g Qg:oa'g,.1sgzr5Za' E' 3 :Eg-nggzg 5. fy ,,w5Qa55g:'s-:3.5s- Q 9: w N 'B' gi 55h:"Zc" 3-' 535: gem' " :F""" 'gsrrgo 2 0 Q5 5"""'0 S . n'S"'eT'U "Of"-w"'0n.g 3 5 ? W7 V -'- :r'g,M5'1"Wu" -- - 5:45.-,ww " 7' "'f""J""'i.q-...fffv D "re E0-D'-E"W"' ... "" "'-v-mf-+ogE:S0..w fx 9 11l'2 :Q--H 54UD": .- ru..-gf ,BS Q :rig-.:1,,,,,m-+-.-. 0. ,, 5 0g,N3OS 25:05,--. ,,g,::,.U-0 ,-4 ,wnpwg , .ru .. 00 -v-- ...gm Q - nsown. .Ln-woo., :r L,---,nm 0. 5- un w.,,.-,.,,-400-5 I.: .., ., , 1, H on-' v..:: vf :1 n : D, rv- :fn . :,. nr rv --0 mg ,,,,,,'fmZ Q Q-mg,-Qbww mm? g,,m.Lb,- QQ 5, . gggmrgmggmmm 3 ,,, gp 315511139 glng-3,1,.4g'o,,vn0 5. N , f-35.?L?535'5?S5 K- laifgg-3,53 5'wig32g:9,1?fvL'IH" 255559562-' 552225535-gE5E5'3'sO , wmrp-B "5 ,pg-' -.mlm r:..., mg , 1 um og F, H950 ' -1 -.5' as ff and---Nw., 'J ' 'r:P'5- :,'.-wg,-M w:10"'UE,m e 3 rn 5149:-'o.'i.-fr-K. 5nf'o.,,C 0 5. .., Og Q00-Q 'mn-'o n V Q 3- TUTSF '4 I Hnwnm : .1 - ...Os mgfgiaozj, n g"w"mnDJP-H: 5-r-rmof' -10-10,,5",,,':,': ' f Q 1 m -..mov oo!--:qw : QE! :pp ,fn wo, : 1: mme.: .-,:f5,,.2of,Lf-:,-n-.,, -- L,- - g,nD"5-1 '-' U 3 "4 "M U-gm 5-100 on "" "m05E ng Q fl Q 'Dpi 9:71.-"' Smnfvz'---rv0QZ'-i Hog' ro, . ...Q --gpwg'.!ow,, ,Q - onflm glomo' ff 'U :go-1 H " D' 4BQ:'D-OH' ' ' 25:8 05- -1-'f'2'c:'5'n.""'J"" """ 'S' 'C " my 35D"""9"Qa""o 1 urn U-m,.,"'1e -1-Tim-P.-fu W F -foo: ':r'2-vs 'uQ"'E :"5'5 V U73 "':"'.':.'.0" FW' f 'PIPES'--' oE5'D 3 v-,Zinc-wg '19..ng::-can-3-----1 :,- f,,"'g- ' 'H gw4n2"m?o U-5':.'43, - ,D-U-UU -nv" - mg.-1Ng:-. W' n pu,Q.0,'000 ...c ,.,!v,.. 2 nw5'o-higgongm VA 'yas-15'45.?"3 .TE 'Qs 5559.5-as' s?HQgf'sos'5'2El 5' v:33gSSg,?5 51152 I5f29,5.s.S'j,gwS 3 H ...5 ' .... - Q' gr- . UH,-, W" ' m,.:Q-. 5- :,'5-rn mg, ., , :raw UJ,,45,,," 5 55- B ...p. 5:0216 mah--P' -U ,ur co -oc ,,n.wgm-- :v-...rn X rv:s2go,,g,,q...'E, sq, :',.,2c w :cIm mow? .Ural mlllmg, 5 -4: -qw-1 -'5m5-rv Q l I . .D...:m 'Un-vm x ... 550-4 '11-1 'l1uJ,.,n- Sum N- 3 C-105-aimfvgg L mgxw?-.Qi v my-30-0 14 'U 'WUT 'U Q 0 2533.5-'VNU "' SZU' N 1 5.3.,,:,,g-...snr 3 n QEAL: iv 5-..3,3.,aQP,,g'g g- U,a-cpu-310, : 5,-g-, 2-pq ,g3. 5 eoln' 3-uf' D H2 W' "' C tm. 3055515 S' o'i'05E"gm 9' Wham-2 "2'g-:wo-. 5 S nga-155'-,,,,D,.U : 55.571-r ln -Un U-,h.,g'U..-f 3 gm.-,Qi 5' 'gp pQ'.... ...oiayg 0 Q T-'F'-'T-N" 5' UPS?-955 5 2TS?52?L2zs'a'? 3 v5'59.z5f3w if 5i??f92?+.?5E9hf.5 3 2 " 5' O' ? 3 Q . , 4 x X xX S x X x X Nm X NwwNmx--- Mxvxw-MWX..-.mx-W..-N-W. .N N vm, MXN x X , -N WA .Nu , Wm, ,mug mx-W. -.X Xxxx-A -xmwq xvuvN-xxxx..-wxw-NX-wxxwv.-w xx -. -.N xx xxx xxxNm...Nxxm xv. xxx -xxxxxxxxxxfsuy Ss' f 1 1 K f M 1111157 - - F , c - , . f X f , . . . f- Q a , W, f 11 ,, , ,uwm 11 .,m,,.,fLe ' -- fm F "' r' W' 'W Z 4 "-'lea K N' ' 4 '11 J y, 1 - " 4 .R Y S, " -.rS' -J Z 4" X' XX '- Y T? f 1 9 X - - v , . H f f- ,c 4-"f!1ewq,, .-ts, me X- . Q, . -f-' ll 'Ilvnvrn-nrn11nnnvufv1f1111011110111 4 ff A . ' f A Y f gina, ""'- 5" ESQ - ' - V 3 ' , ' ' - V-'4w,, --4' 11, -,S . -as . , . , 11, , xx W , 1 Q-. "H ' if 4 . , .-r-ig'gf-1Q:-- - -:elf .- lf,....tQx A' H " N., Harry Worlbinglonfiraig, '19 . Gllevclanb, Ohio lieutenant. Kviulion Corps Killed near Soissons on October 20, l9l8, while making an observation flight over German trenches. He had been in France for several months before his death, and had iloted gunning. bombin , and observation planes. For his bravery at Fismes, wiiere he secured important pho- tographs of enemy-held territory, he was awarded a Croix de Guerre. Ten days before his death, he successfully conducted a bombing expedition, destroying large quan- tities of German stores. For this he was decorated with the Croix de Guerre with the Palm just before his death. He was a member of Chi Psi. mation Charles Cranefielb, '18 . . mabison 'lliontcnonh Elnfantry Killed on the Field of battle on jul 30. I9I8, at Chateau Thierry, where the famous 32nd lgivision of Wisconsin and Michigan troops stop ed the westward flow of Hun troops and, almost unaideg, routed them after more than a week of desperate lighting, turning the tide of victory in favor of the allies. A member of Company C, to which Lieutenant Cranefield was attached, states that although badly wounded in a charge, Lieutenant Crunefield crept along, urgin his men forward, until he was struck in the head by a ixullet. "He fell with his face towards the enemy." auliflonserz-Currie, '18 . . . minneapolis Iiculcnanl. Rvialion Corps Died in an aerial collison with a second plane at Kelly Field No. 2, South Antonio, Texas, on May 27, l9l8, just before completing his flying course. He had not yet been commissioned but, having been recommended to be made a pilot, his commission was sent to his parents upon its arrival. He was buried in Lakewood Cemetery with full military honors. He was a member of Chi Psi. frank liloysins Daley, '12 . . . maoison Sergeant. fficlo Fffospilal Corps Died of pneumonia on November 20, l9l8, at the now famous Field Hospital IZ7, which is attached to the 32nd Division. As a non-commissioned officer of the l27th Field Hospital Corps. serving under Major Lorenz of Madison, he was in the thick of the fight at Chateau Thierry and at Fismes, going out upon the battle field to give first aid to the wounded and directing their transportation to the Field and base hospitals. During the decisive struggle of the first week of August, he was obliged to remain in No Man's Land for three days and nights, under two Fires, unable to return to American lines. He had enlisted in the summer of l9l7, and after being trained at Waco, Texas, left for overseas in january, l9I8. He graduated from the law school in l9l4, and was engaged in the practice of that pro- fession at the time of his enlistment. Marry Eillon, '14 .... . monbovi Lliculcnanl, Ilnfanlry i Killed in the battle of Argonne Forest on October 2, l9lB, by a shrapnel shell. For three months before his death, he had gone through heavy fighting in the vicinity of Chateau Thierry, among other things, leading his men over the top on four consecutive days and taking all ob- jectives assigned to him. He was cited for conspicuous bravery in the vicinity of Soissons in the operations from july I8-23, l9l8, and won the Croix de Guerre and was rec- ommended for promotion as the result of his gallantry in action at Chateau Thierry proper on August 5. He was a graduate from the College of Agriculture. -We areltbe beab. Short bays ago 1 1 an 111 111111 11111111 111 ,f 1u11n111u,11 fffpfffn 1 1 1 1, 111111 ,,,,,,,w no ff ml X we liveb, felt bawn, saw sunseliglowr- Qxxxxxxxxx na st ww Qxxxxxxmmxxxaxxxxtxx NX,QQQQQQXXXXNxx,XNNXXXXXQNXXxxxxxxxxxxxxxxyv.atQxxxxxxxxnmxxxsxxvaxwaxxxxxxxxxxxwaxoxwsuQxxxtaxxxxsaxxxsxxxuQxxxxxxxxxxxQQ-vsaxxtu QQQQQQQQQ an Q QQatQQQQmeQ-.QQQQQQQ-QQQQQQQQQQxxxv.QQQQQQQQQQQxQxQQQxQQsQxxxxxnxxxxxxxxxxaam-QQ'-xxxxxx-aQQQQQm.QQQ Qauxxts Q-an Qt t Xanax awww H Xi " 3. Q N t t s N w , S : N S S Q X S : E. Q m e S Q Q m t m t S t Q t S N Q Q Q X t Q Q X Q X X Q t m z X N i Q N S . Q E R 4 xx xx xx x 0111 funnrnlfnfuffnuu,1ufuurununnn nnffuu 1 u 1 14, nu up I ww, Ns . xx X xxx xxxxxxxxxx xxxxxxxxxxx wwnunxxxxxxxxxxxxxxxxxxxux xx xxxsxxxxxxxxxxxxxxxxxxxxunuxxxxxxvxxxmxxxxxxxxxxxx-Av.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxuv.nuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxuxxxxxxxxxxmxxsxxx xx .xxxxxuxuxxxxxxxvmv.xxNxxxnxxxmxuxvxxxxxnxxxxmuXxxxmsmuxxxxxxxsxw.xxyxxxxxxxxxwxxxxmxxxxwxumxxsxxuxxxxxmxumxxxxxx-muxsxsxx NX , . A, , A A AAN, ,QA4-,, A A .4- 4 4- A' X U A 44 ' AA! 444444' ,SNR NX s 5 N s x 5 Q s . ' z 3 I S . 1 , : mai, 1 :?f , NAT 1 , Q. I 1 y : , H x r' f V O w ' 3 Q , S Mr, ,, , . 5 ,CNA "' x-Xf , Q 4NJ .- -WRU 2 x 'SW D 1:-6 1: 'Sli 3 A, lr O, If I . ,., , ,M ., 5 .Z .,. Q 0 J,-'.'?n.1', 2 Gi ' za M Q 4"i'f' X' P 4l.4:'. - - f Q. ro oo 0 cgv:-"M "nv '- a':w"!n'- , 3 23? mz Q 24 5-50 0 Kggdggqgggm 5' ggzgoga mga- 5 Us pro Q' ro55::1Z5E- D g'45f,j7'v'2. Woaiv Wnwf' If .- Q0-1 5 mv: rom rv.-f-0 n ..-1 O- rn ...mn -1 f"l.' 9 W-5-:4U 2 E" :13U 5, gm!-'I-. DQBBGTW 5 mpsgf' 43.-u .045 -wg n":'m::-'ga'-.,Q'g.g9'U 0 WJIWIVV i- w' ww-H U. -' rn.-faq-0 'ogwz . 1 -+0-Q4 ww-f-5' - -15'-qw -f-1 "'-' :s -- 0 -1.-v-...rv ,UD 14170 xv 0,5 5-. rv... Q, TWD-wp-p m.,o 5 v -'QU' Q1mpQO--U",,f' n fyh 0 -1Q"'D- 0 -v-."5rn00- mg- mmm'-g""rh W fp as gy FQINQ- ,,."y gr-:aWrD,.,fL 9 -' ,fr . 511:21 "' """""' 0- s-40:E1""":.550- 5 FM55'---,fvs.'5- R F1 : 'Noding N' 0 rv W 5 gggwggh 5- 253.532 Q in-,.5.,,:-S.gug 2 2Snm2-Eggmggif g mfgfffggunsighxj-h O Wnjf. QQ! g0Q:':'E.n 3 '-:,,0mO5'2mrb5"f-v 3 25250-mgmiupw 2 ENE:-5Q":5ZS"f31'G S N' Wf .. uP,-gag' O www:-wy, 3, ii,g-E?gf'?swSm2?F -Q:.2,1-f"'f'6H-239.15 Q agfws H1,nO5asq,, g WL' 3 5'w""' 1 hhlfa' '? . ZTWQ' 'SSW 'S FVWEWSSKMSMH QM "fh5'3'5'?5z3'3b'8'i: -1 0, 245-1Z0,g'f:4: W-.3n:'f,.-.b5 pmgnugpomil o ..fQ-Jung Omggo ,S gvgmwwn. 2:,.S':-gm Q ' X 9 Emgvgw 5 . gogmzz-E 0 5,36 ra57-5""'g'fn-1-.1Hi- g'g'wn':Jwo0rg5'g-0: G 0 nmmrargggnlmo 'S F VA " 04 :JM D3 - "" ..."" - -fWW""1"'f-fn ' -:Hn-'fwn'u :1 'O wg "-'TI E. :1 Nf- n , w , .- . Q vu cu -. H 4 9' rf 5 fr 04 ,I : n lx "'- 8551932 e MSS-52,2 s35'Ei5'E142Q.2 4952355555950 5 0 ?'i4'+'ii?s.fSlE?5Ua f 2: , .W -1 . 4 w ' ""' - u. fu -4. -H ---4 ' ww -N-fo 'H - rn. ,-. ,, rnlfc, 1 40:1 How f' A 9. wg-mp-,... -- , -fn... ..,n. ,..wH.Q5 , x 2? zggfgfgg ff gigyig E N 5-35,5955-QKQQ 4 wmiiiggaaaizgg H ghgsgemiilsafg-E155 in f 1 4- f-r.,5- wiht: 15 mm.-'Dm-'L"' np- 250-1 :Oni Nl Vmspn D QQUEW-1--00 ,.,"'l-45-0p,B2g:I'...-1 ,I A of :fm -1-cc wi: D 'www :gin-Ear' R4 f'-H' 0 :wwf 3-.-,.n,,4 -. -own W S0 g.,q5:S':NE Sgwziwg 5Fm,'2.5mBHE,g.Qm g12:Sg549.g2E59'gSg 0059-gggggggvgdfs 'X' Yi Op -TN --nm"""s ' " 5-:r" "' -1 5 f 4' rn fr ypgwl' -1. 710-1 rv ---nv,-rl ,-4:-x -- Rupp lf' n rn. O ,ru nv-'-1-K D-"- 0 '- ... -13--cu ff mn N, 05500 5 .-- nam v- .1 on-.o,.,:rn G n ,.,:1",-,rv R--F :I ,,o'Um 5 ...mm -4 in 5 :Sufi-' Q-1'-ff' pn wp- o E-H mp-Q,-' "',., xn ,,,u0 .+rnqqoBo"'a-'3,"' ,5 E""'.'2'v --. O'-f.-,rv 0 "' R I-1":',,--.-vw--5 i :I Q :K-:r..E noon:-5 -.-.052-1 Z - 4' 2--,ES-ng W0 5' - Urn o:r"4:r'f'71" 57" Z' 'Vw"'0Fl- :1""'1ff'f-f"" o"':3-1 . 5-.nn - '-11 Tr - -4 -5:-Jn.,-,corn Q.-e-5091: --.N 5-ntl 5 A 5'g.gmgg,:,' -6-0 mghgugv Q 3,,5.M.3f,,Z9,,Q. 'Q g0,,g':2QgiE.g?g.5 fig-gag:-mgg-2-m5g.S1. .1-r"O0 5 nog - w:w,,,g-nO:sZ'.f"-vo --:rl 211.5 Gp ww ...:v -WS: WHO 0-1 u rr WWW VI," DF' -.O 75 C700-0.5" 5 bn 5 rpg-'B vga "Iva 15 5' :Riga 525 V' SWE-5 g 95-in egg awe.-S 2 2 5.5 Q 'Z' 535062-rr ifaapg W - '4 34 00" 5 :re : "nw rv SC ' nn " D 0 C ",... V40 -".. :, n ... ,,., 0. Ng mm ,.. n!..-vm....,..mn2- . rv-:1 xv 5-Q-.,,gw ,M ,. 253:55 Q 3.9,-:Z if gm 5-g 3 Q5-151 42:25. swf' 4 2 442:14 Q-,M S fs N L3 r-nag- --52-.. "" :E.Ww o nu N "'nD.Uf-' 9- reg- ,.. Ugg.-r mo"..0U501w 1. :l, - ,T vf 5 n4f"' 0'o:1-,1"':r9 5 Wo. -.OW 30:1 - 9,-.Taxa 53,5 E2."1 5 12 -...Q-ln mg?-,.Q Q- w,,fv0vwf-f,,5'm- Wg ouugv W 5 5-'mf 50-.o.0:, K4 Q ,: 5-mfs If na D Q-2.2 35242 sf 2 2 42 rv: gf aff-:as - 3 we ag Q s :Ein F' 0035:-0 5 fvnvlf' --:fo-vm "' n-17950 '1--5"'.L: 4- 0:.0Ivnm17rtv:" F it nELw9"Q 5' as-H.: y Fawn?-::Q0mm9D lg own..-.-.wn.::.-.za Ed -'r.:1:v-a.n.wn.m'f 2 ig 4 td -. Q f-1 .1 . IS V5 is Q K , X . W 5 X X x 4 4 4444-44 4 4-4- -4' '-AAA' M 44" , Q xxxxxs-mmsxwxxxxx xx xxxxxxxxxyxxXxmmNX,,xN,,Nxmxwqxxxxxxxxxmnwxxxxxx xxxxxsswxxxsssmxxxxxnxxsxxxxxxsxxxxssxxxxxxxxxxxxsxvxuummwxxxxxsxxxxxxxxn-nun nxmu ss wmvxxsxxxxxxyxxssxxsxxxxxsxxxxmxxxxmv.xxxxxsxxxxxxsxxxxxxxxxxxxxxxyyxusnnsxxmxvxxmyxw.-xusxxuxwmW.-xxxxuxxmwxxu,vxxxxxxxx-..-annumsxxvnxxxxxv-xxx? A? N S x ,,,,,.,,,,l!,,,,,,,,,,,,, ,U,,,,,N,,,,,,,Wm,,,,,,,,,,,,,,,,,,,,,,,, , , ,, ,,.,,,,,,,,,,,f ,, 1 , fnunarfrzn any fr lun r 011 f f Ill? 0,0 ff X , S Y K , all 5 f,,,,,,,,mm,m..,.,,,,,3a V' ,ml ,JL Y j , :XX 5 M f X N W "Esgsq? ,,Xw wmv mm , , ,,, .,Wf,Wffff,? fb, - WW' if so "' , :,-v A 111' AV "'V'..,' Y K i was s- 'felaub Hagmonb fDuxburg.'15 . . . liffixlon ilanbsmun. Hobie Division. IC. 5. DY. H. ff. Died at Camp Perry, Great Lakes. lllinois, on Septem- ber 28, 1918, of double pneumonia, following an attack of Spanish influenza. He was landsman for the Chief Elec- 'trician of Camp Perry at the time of his death. He gradu- ated from the College of Agriculture in 1915. Slat Scbgcwicla Talon, '17 . . Jllabison Cupluiu. yufunlrg Killed at Thiacourt, France. between Verdun and Metz, on September l4. 1918, while the Germans were makin their last stand in that sector. While a junior he enlisted in the Wisconsin National Guard, and served on the Mexican border during the summer of l9I6. ln March, 1917, he was commissioned second lieutenant, and served as instructor at various mid-western camps until May, 1918, when he was commissioned captain and ordered over- seas with a casualty company. He was married just be- fore sailing. Hia First action was at Vaux, where he won the Distinguished Service Cross "for extraordinary heroism in action." He had captured a large number of prisoners and much enemy ammunition, and had personally lcd an attack against a machine gun nest, routing and cap- turing the unners. He remained at the front and was in the thick 0? the decisive battles of the war. Tmery Talough. '15 .... Slurgcon :Bev 1s1GIluss Sergeant. flnfuulry Died of pneumonia at U. S. Base Hospital No. 7, France. on September l6, l9l8, as the result of gas wounds at Cha- teau Thierry some weeks before. Enlisting in july, 1917, he was trained at Camp Douglas and Camp McArthur, Waco. Texas. As a member of the historic 32nd Division. he sailed from Camp Merritt late in February, 1918, ar- rivi.ng in France the first of March. Held in a military hospital at Brest for two months, following an attack of pneumonia. Rejoined his company on the Alsace-Lorraine front in May. Later he transferred to the Somme region where he took part in the battle of Cantigny, escaping unhurt. During the severe eight-day battle of Chateau Thierry, in early August, he was severely gassed and re- moved to the Base Hospital, where he died. Wilmer iff. ificke, '17 Narragansett Diet, Y.. fd Drivale. ffielo Artillery , Shot by a German sniper as he was helping shell an enemy ammunition train near the Belgian border. He died at his post as he was about to man his gun. Enlisting in the summer of 1917, he was trained at Boxford, Mass., and was sent overseas in October of the same year. He had completed just a year of service when he met his death. At the university he was a prominent member of the Cercle Francais and the Germanistische Gesellschaft, appearing in every dramatic production of the two clubs during the academic year 1916-l9l7. He was a brilliant student, and was candidate for the Cecil Rhodes scholar- ship at the time of his enlistment. :frank joseph Tfnlrop, '18 . Glevelanb, Ohio Tfnsign, Hobie Corps, LC. S. ffl. UW.. ff. Died of Spanish Influenza at the Naval Hospital, Chel- 593, Mass., on September 30, 1918. Enlisting in spring, he was sent to Harvard University for training as a radio operator. He had been commissioned a week before his death, and was under orders to report at New York for as- signment to the transport service, He was a graduate from the Commerce School, and while in the university served on the staff of the Commerce Magazine. -Galie up our quarrel with the feel- , m fu anfunnfunuuufunnnnnvu,1u1ruur1nQrrnfLuvfunn11 funn,innruff,f1n1llf""I11n1f,,, f Illlfflllul "lull1111111711l11l1nvxvI77huu1111111111121121111nip,frurrrnnfffffzffnlflf111111171I lflll affffvmy ' ' Mama 1 Q, if " .rg W ,.,..- , .. ,.,,-gg ' -,V . - - f r , wg ,,', H , ,, ,, , ,,,,,,,,,.,- , H 4:73, si I Q' E 7: 1, YI' ' 1 Wm..W...,.,.,....,...w,f,,,,,,ffff4,00? ,Q , - ,e .. ,. ,fe-fm ,ibn w L r-'ew-r- 3,1 I .yi -Im - A: sg , .K . ,, . Y ,mfjfr rf, . .. . v W .YM f, 1 W4 f A of f i 1. .4404 -54 ,l5'55 ' ' " - ..- L f fe- f .,., ew- J , , N e- gg f - s , .l77f,......Vss ' - a Z 5 A ' Z 4 l Z N Ilobn. ily-'man Galvin, 20 . . . Collage Grove ' I 2 ' N liorperal, Tielb Artillery 5 , 2 " Killed near Fismes, in the battle of Chateau Thierry, on Q 2 August I I, l9l8, as result of shrapnel wound received while 5 Z rescuing horses picketed in a. patch of woods which was 3 2 ' being shelled by the Germans. Their rescue was necessary 2 5 , to kee an entire battery in action. As a member of the 5 1 P . 1 Z W ' liasson detail, he had been called uion to repair broken 2 2 2 telephone lines under fire for nearly t ree weeks before his ' 2 I death and had been cited for valor.in several dispatches. Z 2 , He was a member of the 32nd. Division, and received his g Z I ' training at Waco, Texas. He lies buried on a hilltop com- 1 g L, manding a view of Chateau Thierry, his grave marked 2 Z with a special cross for bravery. 2 , , 5 ' 12 , , g r g 1 - , f , r Q g 5 ' fbwarb Grant Garnsey, '19 Qranb Haven, mmcb. 5 9, Y 7 1 2 1 iieulenanl, Rvialion Corpsl 2 A r l , 5 5 , Killed in action on October 29, l9l8, while in pursuit of 2 5 Q enemy aerial raiders who had been bombing an American 2 Q g supply depot. The.94th Aero Pursuit Squad of the Third Q 2 ' Army, to which Lieutenant Garnsey belonged, had fol- g Z f . lowed the enemy destroyers and was some miles back of 2 Z ' the front line enemy trenches when anti-aircraft guns 5 1 9 g 1 opened fire on them. Garnsey fell to the ground and was 5 2 E crushed to death. Eddie Rickenbacker, Amenca's greatest g 2 ' of all aces, with whom Lieutenant Garnsey was associated. Q f paid a visit to Gamsey's home on his return to this country. g 2 and offered his sympathy to the grief-stricken parents. 2 Z Garnsey was a member of Kappa Si ma and won a football Z f u n - - g V Q W ln his sophomore year. Z f 3 ? 4 5 , , - - , , 4 Z Albert .frank Gilmore, '19 . Tllzabelh, TLQ3. Q 7 - 5 2 lficulcnanl. Rvialion. Corps i , 2 Died of pneumonia in the American Aviation Hospital E 3 near lssodun, France, on October 3, l9I8, while on his g Z , way from a French aviation training field to the American 2 3 aviation Held at lssodun, where he was to serve as an in- 2 g structor. Before entering the American service shortly Q 7 after the outbreak of the war, he served for nine months 5 1 . . . 5 2, with the American Red- Cross Ambulance Unit of the 7 9 French arm . He was cited in Paris dispatches for good f 7 . 3' . . . f Z Q , services ren ered at Verdun. Buried in the Amencan ceme- 2 3 V 3 tery at lssodun. g 2 V i 1 2 r l . ' 5 r l 5 i 4 5 , 5 , W - - - 5 1 william Huge Glogcr, '11 . . . Watertown I ' 1 Z Slnlislician. Geological Survey 2 I l l ' A - . . , QQ N f Died at the George Washington University Hospital, Z Z, Washington, D. C., on October 2, 1918, of pneumonia, Q 5:1 W which followed an attack of Spanish Influenza. He was 3 N employed in the field and office work of the Geological Z E Survey from October, 19.17, and was stationed in Colorado, f gf New Mexico, and Washington representing the Bureau of 2 25 Nlmes in the western manganese fields. Z Zi Q I at s 2 f Z' f Zi Z 4 , s I . 5 I , William Henry Graham, 'lb . Wbnlcwalcr Z i 5 Corporal. Elnfunlrg 2 f, . , , D N Killed during the American advance at Chateau Thierry Z Z, on the morning of August 2, l9l8. just before his death, g Z Corporal Graham and his squad of men had been sent back Q 5, for ammunition. As they were returning, a high explosive 3 Z. shell burst in front of them, killing Eve and wounding the Z ? other three. Of the wounded, only one recovered. Pre- Q Z ' yrous to his European service, Corporal Graham had served 2 Z in the National Guard for five years, and had been on the Z Z vw G Mexican border for two years. 2 9 f 2 5 Z 2 0 YOU. from falling banbs, W2 lbfow lbe-Torch. Be yours-lo bolb il biglyl- 9 , ' - rr f-- - 1 W e 7 6,515-N '-1 ---- V - , W K , i - V ' .. . Q Mmm., U, ,f 1 ,M mm , , ,, 1 wif muffmnwf ,wwf 1' K mf W V V il rj , I ,Mum , W, , H .. " h,,, ff' 'f""f""" fm fffwfw N ff ww 1 wwffmwwzzmazrfwzewm!rL2ff"" Q ,. , , , 7 2 , 1 , 5 , Z 1 1 1 1 1 1 5 1 1 Z 1 5 1 7 5 1 Q . 1 1 9 5 1 1 1 1 1 5 1 2 5. E. 3 wasmamwtxsxxxxxxxatswaxxxxxxtxtustxtxxxxxxxxxxxxmtw -at-rasatxxxxxxxxxxxxxxsssxsvaxttatx Nastxxmmxxxttttxxxttux ttmwtnttxtexsxsstt-atttattt-.stttatttt-A-stttswstttt.. txxxxxxxxsmmxx Z 1 1 4 6 5 s E s 1. 1. f. 5 I ,. 7 1 1 ,. fl 7: fl 1 Qi 4 2: 9. 7! fl gl Z. fi 45 5. 51 fl 5. 1. 1 1 fl 1 Z Z Z 11 who, ff! i . ln il 1. 'x,n.kg M 11111714 'D-nov. B., ,XX "" ,vwm 1111 1111 1 111 1111 1 f If ffff 'A 4,5 .xx . Q-.ti .T g 5 , Ghomas 'fbwaro maleg Hcgeran, '18 Chicago, Fill lieutenant. Enfanlry Killed by machine gun fire at Chateau Thierry on Au- ' gust I, l9l8, while leading his platoon in an attack on an enem machine gun nest. Enlisting in the French service as a lied Cross ambulance driver in February, l9l7, Lieu- tenant Hefferan was one of seven who formed Wisconsin's first contingent. He served in the Verdun sector until October, l9I7, when he was discharged from the French service to enter an oH-icers' training camp at Fort Sheri- dan, lll. He was commissioned in December, and returned to Europe in january. Before his death, he saw active service in Alsace-Lorraine and Bel ium. "Tom" Helferan was one of t.he foremost students Eflisconsin has ever ro- duced. He was one of the founders of the Wisconsin ijt- erary Magazine, was University Editor of The Daily Car- dinal, and was the author of many popular poems. At the time of his death, he was wearing a Wisconsin arm band. Buried at Chaumery, close to the rave of Quentin Roose- velt. He was a member of Delta Kappa Epsilon. lfarmon Ilorlcr Hook. '20 . . Oak Dark, fill. Gabel, Aviation Corps Died at his home while on furlough from March Field. California, on December IS, I9lB, of Spanish lnfluenza. Enlisting in the University of Chica o Ambulance Unit. he was in training at Allentown. Pa., wiiere he became a Ist class ser eant. He remained there until March, I9I8, when, at his own request, he was transferred to the aviation service and sent to the Princeton Ground School. ln june he was ordered to March Field. Riverside, California, for actual flying training. He was a member of Delta Kappa Epsilon. Icon Beck Hook, '16 .... wauwalosa flying Cabal. Ulaval Aviation Detachment Died of Spanish Influenza at Seattle, Washington, on October I4, l9l8, while in training as a flying cadet in Com- pan 5, Naval Aviation Detachment. Cadet Hook at- tenriled the University in l9l3 and l9l4, later graduatin from Harvard in l9l6. He was a brilliant student and established an enviable college record while at Wisconsin. He was the author of several articles on historical subjects, the result of research work along original lines. Harolb Herman Fffolling, '18 . . . :plymouth Observer, Dbaloon Aviation Service Died of pneumonia at Columbus Flying School on April 4, l9l8, following the contraction of a severe cold while doing practice observation work in a rainstorm. He had completed his ground school training at Omaha, Nebraska, three months before. Ghcoborc Xobert Moyer, '12 . Syracuse, 51. 31. lieutenant, Ilnfantrg Killed by enemy machine gun fire on july l8, l9l8, at Chateau Thierry. Was a member of a party of volunteers to carry in the wounded. Hoyer entered the First Officers' Training Camp at Fort Sheridan in l9l7. He was commis- sioned and assigned to the 32nd Division as an infantry instructor and sent to Waco, Texas. He embarked from Camp Merritt, N. J., when the Division left this country in February, l9l8, and saw several months of active serv- ice on the Alsatian and Belgian fronts before meeting his death. He was the most prominent member in his class, being editor in chief of the Daily Cardinal and The Wis- consin Magazine, a member of White Spades, Iron Cross, Sigma Delta Chi, the Student Conference, the Y. M. C. A. Cabinet, and the Wisconsin Dramatic Society. He was a member of Sigma Chi fraternity. ..11 X : 1 Q11 i X ' -f . c g r , 1 X ,,,...,,..- .. . . 1... 2 ,, -fc-reset.. .,.-2 , f 9 A . , Y - V f ,594-.-. .ML . 5.1 gs-u .t,. - 11 - 1...,.,111., .,.. 11 1 f, ' 1.5-fi- ' ' -Z -Eh -. 'z' ' ' i ,,e ,- . w'??5Eff'9"' - -" ' Z , -- ' -t-11.4 , - 1 4 . - 3 -3f 'ge break faith with us who bie we shall not sleep, though poppies grow in fflanbers' Tielbs. v 1 f 1 1 l if 'Z 1 , 4 l 9 ' Z 41 -5 l 2 1 7 1 1 . 1 5 1 Z 1 1 1 1 4 .. . -.., , - - --v-----------V 1 - - -1 e . . -J 111111111 11 11 1 1111111 11111 "1"I1f'fn111111v11 1 ,1 1 , , ,, 1 1 ,,, ,,,, ,111111111111 11111r1111111111111r1111111111111111111111111 11..11111v1111111111 11111111111111111111111111111f 111,, X 11 1 4 5 5 fl fffmqbai 5 5 ff I I 1 411111 f . - .-1 we-L gg, , f"lr,1'Kxj'I.g ""'f1,! 72 'afwfffl 141' ' ,ge 4 ffisgf ,,qi11:71fit'1fg:fC""iTZiQffQ,,,j,,Q gf.. 'H' -sff-ff- - v ,, f- -- -W., -M' s -su a pas, 1 A sf 4 ,.-..--.. M-. ,Q my 4 if so if H-a'jg'1 ro' .-.ffwfffm is :RQ f --A-offer 'L 1:1 '4 , X, in ,ef V , ,-V. ,,., gms - r., -X - -gg e ,Kwai w 5 V 5 5 1 7 5 ' 2 9 ' 1 1 1 5 , , y x - 1 'N 2 2 W 'Eugene Blancbarb Ilomzs, 17 . . Wmlmellc, Jll. 2 - , , f 2 . fT,iculenanl,lAvmhon Corps 2 Q 9 . - b , 3 7 ' 'll d ' combat behind the German lines on 5ePtem er I 2 l I3Iil9li8,ll:1he second day of the St. Mxhlel offensive. As 'a N Q 5 l mgmber of Major William Thaw's .l03rd Aero Pursuit 5 2 , Z1 Squadron, Lafayette Escadrille, he, with three others, had 2 Z ' Cygsged over the Hun lines to bomb a road over which 1 2 1 . , , Z 1 , enemy troops were moving to the frornt. They were at 2 5 ' ' ' " asse" lanes, and in the struggle. four 5 g w tacked by elg t P . H 9 3 , Huns and Lieutenant jones were brought clown in ames. 3 2 7 l While at the university, Jones was a student in the College X 5 I ' I 5 of Agriculture. 4 5 1 9 4 5 5 5 1 r I Z Z Z l ? I , 1 , - . ' 1 Z. W l Ilulnus Eco Iforban. I8 . . . . ANUSO g 1 , 1 Z u Drivalc, Chemical warfare Service , 2 1 Y , 1 Died of spanish Influenza at Cleveland. Ohm. QD Ogre- 2 ber 15, l9l8. At the time of his death, he was statione at 2 2 l a government gas mask factory and was acting as inspector. 5 4 Z 5 5 5 ' 7 1 1 5 5 1 , ' 5 1 . - 1 Z I Asher fsaias Helly, '17 . . . Rice fake 1 1 1 2 ' ' ficulcnanl, Kvialion ferns 2 9 , 1 I ' - ' ' ' trenches 7 5 , Killed by a direct shot while flying over enemy A , f 2 near Bar Le Duc, France on September 26, l9l8. As Hxght 2 3 l commander he had led many observation tours and bomb- E 2 1 ing raids in the six months preceding his death. He had 2 21 been recommended for- promotion to captain. 58 WHS 9 2 ' awarded the Distmguns ed U Cross. Entering t el. mi 5 5 l chanical engineering course .in the fall of I9l3, he en lste 5 Z l l some months before graduation and was granted a diploma 5 Z 1 , in absentia. His training was received at Rantoul. illinois. g Z . and he went overseas ailarl-f5i:'st lliutenant. He was a mem- , 2 l ber of Pi Tau Sigma an eta 1. 5 7 7 I W I 4 1 Z 7 , I t 1 5 Y Y 2 1 1 4 l s Z w - . . I V -r 1 V ' Marolb fvcrcll iifmnc, 18 . . ,0rofln0- Jbdbo 5 5 Q ' 4 Z ' ficulcnanl. ynfanlrg 5 ' 4 2 l Killed in action near Soissons on July I9-, 1918. the SCC' Z 5 l . ond day of the big American offensive, which marked the Q Z w turning point of the war. It waslrvhika heading ofia Hman g 6 1 ' truc in t e 1 ounter attack towards evening t at e was s . ' I , 2 1 ' C ' ullet. A member of Wisconsin s Z , head by a mac me gun A , 9 2 N ' n ' ent which was sent to Fort Sheridan in the 1 , rst co ting . , , , fl spring of l9l7, Lieutenant Kinne was commissioned there Z Zi' and was one of five men from the camp sent overseas for 2 1 2 immediate service. He was an ofhcer lh the first regiment 2 gl of Americans to occupy front line trenches. He had been X 2 2: in active sectors for six months at the time of his death. , g 21 As a student, he was' one of.the leading men of his class. Z Z! ' being prominent both aZarL1nterclt:llf8l5l:F debifff Tlevfm 4 an athlete. He receive t ree sc oars ips w 1 ea is- ? l consin He was a member of Kappa Sigma. I Z' ' 5 fl 5 I I '1 W I Z g , 4 5' Y Z I , ' , 1 Z' Alfreb Karl Moss, '20 . . . . mabnson Z I' 1 I Q llrivolc, ilfnfnnlrg , 3 1 . A 1 Zi Died of Spanish Influenza at Camp Grant. Illll'l0lf, Oh ' Z 2 1 October I3, I9I8. He was working in the Depot Brigade Z Z l 1 Personell Office as personell clerk and filer at the time he 5 1 . 7 3 was taken ill. 5 7 1 I 3 Z 3' ' 5 1 .f 2 w -Dies! ye nn peace, ye fflanbers beabl- 1 2 1 , 1 Q - -1- --1 -A Y... sQY..fiYfff,1l,, Q1 WM' .. - .f,, ., ' ' . Y Y . . . Y Y is-S 1-. .- s . . .- . - -Y --V - as ' 4 - . . ' 11111111111111,111111111111111111111111111111111v,,,111111111111r1u,,,111111111,,111 1,1 u7111u1111111111111111 I f11,,1,,,,,,," y,1f11llf111111 111,,,,,111v111111111vru111111111n11011111111011,,,,,,,,,,,,.,,,,,1,111111111111,111111fu1111111111,.1,,a'! 1,q !l""+.,, -xx X X K XNXXxNx'x'WxNxV"Nx"'NV""""M"'Xx""xxX"VVN"'N"N'H'xxxQw-nxxxxxxxxxxxxxxxxxxxxxxxxnxxxxxxxxnxnQv-xxxxxxxxxxxxsxxswaxxxxxxxxuxsxxxxxxxxxxxxxxxxumx-xxxxxxxxxxxxxxxxxxxwmssxxxxmxxsxxsssssxssxxxxxuxgxxmvulnynvswlvyitfvisit?-ss-anwwwmfs-:er2Erlwww-WNNwfxfxwmmitsxwxqifvmfflffgfrxrgfttfxxsmxnxTYxwX .4--4 44 4 - 4-4444 4, A 4 A A 5 A -A AA 'A" Af - AA A A - - W- fum Af-AAA' 4AA'A'fAAfm'-W-' "?7"A 'Q , .z',g,4,4Lg.Qf,44g,.ae,,L-4. ,14.f:.-44-1 144-44---4444 44:-.44 5 A, , 4, ,W .,...,A ,ML ,4.,,,,, 44- Mi 4, , , , A A , , A 4 4 4 -4 4 4 . f.,4x,,.,.. .. -4444 . 4 44.4 4 ' . A A A' ' 1 N f I , AX V QX 1 1 ,P X , : Q ,. I :fa , 1 Q4 Q G1 , no w 52 1 as 3- 5 :wa s aim args 5 52 S'-gg S U 5- ages 5 ga xg 55.215 5 gpgggwz 3 , www -' :VU-'o:vfv...' yq :x 45':n 5...-All -- --W ..,,- :VU + "': ' -va.. U 0 W"..,c0-ff orv40"'... aux' Gsiffnvs... ln -'-3-1 Q- 9 M 5-5 N... .-, -.04 -momgv -B l ws.. -1:-'.,, , ,N -Ogqmg-1. 5-on 9 --.U:'u- 215- .1 ,Q , fo ' 500-' FQ- EI. Q. ww 'fa GW ...-1 'c nn. " " -"' of LA: s 5545? 54 Q95 555453 73 Sig-5538 S lg 55E.:9.Q.fjffg, D eq 545 QEAEZ' 5 qi N 5'-h UJ,,5 Nwvfv 5- O, -'W ,on 5 o 'UO -4- :r'g""n D Z':-nu"-"' 145 f 5"'ln4v 2 E225"z'+f rn., g 552-50 55 1' 9f5zE2f??','1.:E9 'E Qz:"?:?'gE 2 +54-f ', -wo: 9 , mon 5-:Iv-5,5 'f' H, go- -- Wg-.. 5'xmfI f, - .nga 0 -Aw' n n.o:o eq .. :.-1:-ggoww-, 3 H' 'L 310, .1 f' 5: ...- gg'-,gum -1 0 H,--g C H' I 5304: 5 4-r Nrx'4o on 5-,,, :E Cr-0 .,. ma- ,A 5 0, of no 3 U - -1. x - fu rv -- -,,.... Q. 1 H U I If 0 , L 2 45.2 2 3 5? -12-4357 5.5: H 5 50 5 S af'-Z 55 'fi 55.asf?"" 5-3 GUS-:P g 2 23 52225 2- 4 1 5552: 0 :4Q22s:':i.10'gS' -- HSSPZQO:-22 HQQFQQDF--img? PM f?'fQsQ9E-242 vw, r p' 9. 0 -fm... -UU, nl... : g woo one vw ,, -- 5-.0 53490 ,, 5' f, gyms. rv n L- '1 mam 0 .., .., .O W, 5 5-O.. :rg nn,-5 ,,, cg fn-:E n.,go....: 5 .gm Ag- yy I spin: Q 0 -.,f'.,:,', :fp D "W-gofffvb -- Ruff,-4-o"9,,Cru -1"-.0 n.-+79--e,g 14 Q 4-v--mf' ' 253, :""":.-'Qin - Q." 52" 5 1' 20" 0 """""" u- 000 -.. A" en Q . - so :v-NY.-v 5 '- -.::. wah 2 :' o-"fa 0-aan' .D T5 I 11? -"' n 1 vo., 0 mu .-1 0 - ul I5-4-1-H , :I . -5--"" ,U n ?' S or .- , I, 0,129 Q U' m5"Si:93,'-'L' - "'rg5-Q'544'5'-9"'- 1i'iwf,2H5"'55:1",imE, 05- 'g""'0' V U I 5.175 F '5'uw?oijIlfg VZ 33:1-EW' 2' 'X' SE'5Awng15,Ufrf5'55'Z Q -5 '5?:72,Eg',?Y' 1: .-P40 O Zigm-f.-1 EW' 0 warg-.-. Gown' 'Q C...n GN H ,0 f g -1""- . ,, -v woes U1 vm :......"' :r"'9-" 'pl Un- 5 nU1"'gf0 ,V l 2-' Sw? 51 sBeTP'?Af95's'?' ' - imglwi' g as 5355 221955821 E '52 5135 2 ' - ' w ff 0 cr 00:15. ."' ng c n. Oo "0--v-'o... 9 ... D -- V eo o wr. cz-an 0 -IU! 'HU' 615- -1 on -nr-:,,., . ,,-n nge- -,, X -1559 ' -1' UJ029-DUPO ' 79:97 5-0 g " 4 .'.1.inf"" my .4 n--Cx gi' - 1 .V - -- O as - ,umm Ot., UIHN: :I ,H 5900 -U Q U4 3 la -is-Q in Qoiessmogfm M445-3 2. sfnfae-+a+2xs.E1'.1 Kw2,sy:'2 we o- fn-wig" g"'s5'9gn'5-15'-H' Ogcggi' " ':-239a?3E."3.H'52':" ,usa-g'Q.'L': . pw, ' "' 55:10 f1C'JmQ"'ovol-1 ' 50:-o n- P "' :"5 -4 UU :"""n"'w' " 'N-f A 5- USN '. gfwg-S5554 B'S.:.a'g li' l2sAng,Hs22:500 ,Ar z':.f'-2.20 n My A '-' -' -' .-. .,, ww mm' W ,, 555- 7. w -'lug 14 2. Q32 fmiggg-3.248 5 aging E: Gio-a3O'L5'E5:ag 2 55-Maas 2 sag . vw F' 0 fo- o 'orffvu 'cw - -1: 5 --5 -V' 'U 1. .I M D-Wo 5:""40 --W oo -- 0 ng -mn 75 -5 p . " 'gr "' -- 1 " 0 -5 B Q1 cob:-5 .- "gP:',,-,1 5 5- Qnrnnnvcgc V, -ewan,-:SO o G 5 5 5' QEHB'-2 OV' 2 5'f'0-YQT' ' 0-2,5-" 2Sw4:o- 05' :Iwi 2 f' ... , . IW m ,RQ 2, -3,-04 mg-9-WZ D on-Sr,-S 5 .,,5'g3gQ'3.-5,.nv2 U EIU-?,'2 D , is V 0 '33 G' H553--'W5' S- OAS!-was ' Oz-2:2505-as" 'J as"""'3'-2 5 I "" -' ,-, u- '1 1 1 Q - nd' , . 5 V 0, rv-1. 0 rv-m..o:l..-fff: 0 1 lt, 5 woo 5 tv, f "f -1 0 - " 0 .1 x . 2 sfjfi 'X Wx 2- "3f"u . , 5' '. I H J " f,'L-Wu A l l F 4 ' Midi R 0 1 lb. M , Q 2 A24 . f a 2 ZA ' ' A W 9 ' , 1 5 . E' . I ' 5 2' W fx . Z 1 ' my X ' 1' Y! 1 I N A 1 . 4, k.. ' r, Q . -x- -A' -4 2 1 A 3 , , 1 , l 1 Q I , 1 1 1 ' Q 1 ' ' 3 X . - .x L SSE W 44-444-44-444444 -v4-- K x '-4444-4 44 44 4 4 4444 4 4 4.444 4-444 4 4444. 4 4 A A A A A ' ' . J.- ,. 4 4 - A " 5 XQ- NNXXNXNXNVKNXXXXNNXXXN NXNXXXXNXXXNXXXXNNNXXNXXKNNNXNKNNXNNNKXXXXXXXXMKRNXNXXX NKXKXXKKSXXXYSXYKXXXKNXXNQNKNNXXXXXXNXXXXXXXNXXXQXNXNXXXKXXSXKSXNNXKVKXXXXNXYXXXXNNxXNxxNXNHXNXNxNN K KNNNNNNNXNtXNNNXXXxxSNNWXKYXXKXNVNNGXKXVNXXXNKXXNNNKXNKNKXKXXXNWNKNXXNXKKVNNNNHSNWXXXSLQNQKNNNXXiNsxxxxKsNxxxxNNKXNNkNlliVxKXX xxXNXXX S xxx xx KNN Xxxxxxxxxxxx S AF , , Q, A ' ,, nf I N 1' 1 Il " 'ff' up 1:un1011111110111rnunuv,,,1unnn1uunu,1nn1,1 fn 1 fu fu fn 1 uunf4,,, ,,fnf111n1f anfufufuffulzzflu afuunnnzufnf fnffnulnfnlzfffffvffffffunrzfnl url f V I Z 1 f f f 1 f fffffffg X f - v f 4 we-H ' A- - -cg-r. ff - Y ,.-4 f X if N, 1 ,, ,W M 'e' ,. ,. H c i"' , I -. g.,i.F. 1' '-S - ' France. av death. P Rub we will keep lrue faith with you who lie asleep Benjamin 'Harrison mueller, 11 Alma Q lieutenant, Ifnfanlry Died at an American Field Hospital at Beauvard France on july 27, l9I8, of wounds received the day before while leading an attack against an enemy machine gun nest He enlisted on May 4, 1917, and was commissioned at the First W Officers' Training Camp at Fort Benjamin Harrison After being stationed in several American infantry training camps, he was transferred overseas in October l9I7 He had seen five months of front line service and was slated for promotion to a captalncy at the time of his death Buried in the American cemetery Bezu le Cuery Axsne A Ilfenry Xicbarb murphy 15 Beaver 33am 1Cnber call unassrgneb Died of typhoid pneumonia at Trinity Hospital Mil waukee, on April 3, l9l8 He was to have entrained for Camp Stevens, Oregon, on the day of his deafl' Eobn Bastian Nelson, 14 'Eau Clan-e 'lllieulenanl 'finfanlrv Killed in the battle of Argonne Forest on October 8 l9l8, while leading his men against the Kremhllde line He was commissioned First lieutenant at Fort Shendan l9l7, and assigned to the 32nd Division which was being formed at Waco, Texas. After several months spent in training men there, he embarked from Camp Merntt N J Although stationed in the quiet Alsace Lorraine sector at first. he was later sent north He had seen four months of constant fighting at Chateau Thierry and along the Bel gian front at the time of his death George Bernarb noble, ll orllanb, Oregon l Tlliculcnanl Jn. anlrv Died of infection following wounds received near the Ourcq River in the American advance northeast of Chateau Thierry on july 28, 1918. Although he had been wounded at the beginning of the action he refused to be evacuated and remained in command of hrs platoon until ordered off the field b his superior oflicer rn the late aftemoon He was awar ed a Distinguished Service Medal before his s Y vpellborn Saxon fflribby 17 CC :cage 'lieutenant 3nfan!rv Died of gas poisining near Badonvillier France May 29, l9l8. He was one of Wisconsin s first contm ent of l5O men which entrained for Fort Sheridan a few a s after the outbreak of hostilities Commissioned there was sentgto France in September l9l7 for instruction and observation with the first unit of the new army officers to be sent overseas. He had seen six months of front line service before he was gassed He was awarded the Distrn guxshed Service Cross for ' heroically defendln an im ort ant post near Badonvillier against a large orce o the enemy and continuing to perform his duty after having m been fatally gassedf' He was a member of Chl Psi ,,, ' ,HHH If ff ufffffwfffifnffffnfffnff 0,11 f 11 lun af fn , 1 ,ff nn, f fan: ff ,nn 1 an uf l fl" A Xff? ' 1 1111117 Qwaxxsxxxxxsswxxxxxxwass.ttttxxttvassxssxsxxsxxxxxxxxsxtttttttaststssxxxxxxxxxxxxxxxxtxtxttssxxsxtxxxst w.xsxxxxxxxxmsssssxxxxxxxxx-Asuxsxxxxxxxxxus-measasxxxtxxxxxxxxsxxsxsxuxsstsxttxtxstnsssttsxxtxxxst x atm- tsxssyt-ttsxxxxssstta..want-.tts-tus -xstsusut.t,...astsswsxsxxsssx-.stteassstx.Newstwa-stutxss-ssxxxxxttusts-sxwx-ss-sw-sssw o S A . K s if . we ' I , 11 ' .r 1 J' . 1 V il? fi A . rl I . I l I I 1 .1 '1 r I Qi 1 ll 93 ld all F l I l. il ,ew f yllfv SQN "1 ,,. vil- S"N3"l'-'55s " ,,, .Y . - 1 , '6 . . . ,, ,N 1 . ' - ' Y. ' X :""'W Z of-ftxiolix. ff' ,,...- f f!7Ml-L1 1 maui mf u 1 1 , -Vawvzv VZ' fm . xg :?f?z V M-L -F-.4 5 -x.-,,..,- , , If WAX, I 1 . rs A- -H .e , 1' - xt - 'fil Y 7 -L? 'i " 5.5ig':'5.t--.1 R W ' r -L f-1 J ff ' - 1- .q..,, ' , 4 I 'T 5 s ffloyb Allen Ramsay, '20 . . Beloit Sergeant, 3nfanlry Died of Spanish Influenza near Nevers, France, on Au- gust Zl, l9l8. Enlisted in the Wisconsin National Guard .in February, l9l4, and served on the Mexican border in l9l6. Before the outbreak of the war, he reenlisted and was stationed at Camp Douglas. ln the fall of I9I 7, he was transferred to Waco, Texas, where the 32nd Division was being formed, and after six months of training there, sailed from Camp Merritt, N. J., at the end of anuary, I9l8. He served in the Alsace-Lorraine sector an along the Belgian lines. and had gone through the battle of Chateau Thierry before the time of his death. :Eugene Washburn Heath, Grabualc mabison Cabal, ihvialion Corps Died of S anish lnfluenza on October IB. l9l8. while in training in tie naval aviation ground school at Minneapo- lis, where he had enlisted five weeks before. Before his en- listment, he was acting as an instructor in the department of patheology doing research work leading to a doctor's degree. 30511 Basil Xolacrts, 'IS . . mabisen Tieulenanl, Hnfanlry Died in an American Held hospital near Drevegny. France, following wounds received from a high explosive shell which had burst near him the day before. The same shell killed his commanding officer, Capt. Myron C. West, of Madison, with whom he was in conversation. He had served as a private, corporal, and sergeant on the Mexican border in l9l6, and reenlisted at the outbreak of hostilities in the spring of l9l 7. He was in training at Camp Doug- las, and was later transferred to Waco, Texas, where he was assigned to the 32nd Division. then being formed. He em- barked from Camp Merritt in February, l9l8. and had served in the Alsace-Lorraine sector, along the Belgian border, and had gone through the early part of the battle of Chateau Thierry at the time of his death. Zionalb Sage mciormack, 'l9 . . f'Delavan lieutenant. Rviakion Corps Killed at lssoudon, France, on August ll, l9l8, while Hying alone over the field where he was being trained. His plane was at an altitude of 3,000 feet when it fell to earth. crushing him to death. He was to have been transferred to the front for observation work in another ten days. Carl Searle, '15 .... Gopeka, lifansas Tnrivale, mebical Reserve Corps s Died in the Johns Hopkins Hospital, Baltimore, Mary- land, on October 9, l9l3, of Spanish Influenza. At the time of his death, he was a student in the johns Hopkins Medical School and, as an enlisted member of the Medical Reserve Corps, expected to be called for immediate service at any time. During the summer of l9l8, he was engaged in ex- perimental work on war gases at the American University, Washington. .ff ,ith X - -with eacb a cross lo math his bob, anb poppies blowing overbeab, W W wffffunff fffmm 11 uf uufffmffmf 1 1 1, 1 ff uf m11u,,,,, -k,p11.r11ff1ff1 f ffuunffmmmnm:11fff110,fff1,f1ffm,f fn 1,11 fffwf 111011011111 ffffff ' ' " .,b 'a XX 1 ff 4 . I uw' !,,1nfffff1 f ff, nw, 1101111111 11 J, 'a 4 1 ff 1 mfnnffpffnfffzff ff zffnufufnnMunn" X X X XX QW. XS - XN' .N ,XXX XXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXX X XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXX X Y uf 44444 - 4 4 4 4444 -4 44 4 4 f A4 -A 4' 44 - 4 4 4-444 4444- 4'4 4 44 444444 4 444 444 4444-W 4v444-4f4A"-f '--'A i '- '-"AA ' 4 ' 5 5 A44 AM N M M A A M4 A4 A A A All U NAAAAMAAM-R44 AA , 1: X S l 535 ! 1 X i if X , 1 X ' 1 X t X X Y A Q N , F 3 E '1 fl: 5 51 l' ' X X 1 , , E ,. -': X w i E 3 g X .Nu W, 4 , r E J ' I ' S Q + K E " W! , Y 5 ' ' , X . i, X L1 I Y -J' , , 1 I , i W: ' X , 1 . 2 ' Qfwgh 1 0 1 WX 'T U 2 Nxt. ' ' 0 .X ' XX X I , 1 0 x .Xy X X 5 S ' 3-X e 1 D -. '41 Xa' J' X 0 ,M 8 bldg -Y' 3 A , 1 q . 1..'Q515" . hx F1 rn Q Ph sw! V, 'T vi '--sv Q w0cr"- OU' Go' D" f+ . "' :""f' D yrs' :vs gif? '4 gfngimhi -1 svn' 3 g""wsT,f!.w :Gaim 1 5-2 jgwsl' "4 z1'ff'2'hv"' :F o :r' rn nv n ffm 1 " Q-.Bo ig' Egg22.5-rc - D-5 sex - Qgg 2,3-g:,o:9,7X 5 fgaegwfc-3,557 - 7if.y7f,guI U.. F2--5. -09:1-1: U-Sana'-r: bg 0 fv...o-fm5'.'4,,E g.,,u: pon' FN ig -,, - I U--1 n 'P '1 "' -' 5 "' 3' . o " 43.0 ff ' "" rv D.. f Y 0 gpm. gc- -,Xia .-- :X cr rv - .XNg':r a.,, Q .- w B: g X ,, O ...nn .7 Q ,o Q. Q nv 0 sv E f, E 8 :gig G' vang?-no ci 5' 555 go 5 S-Qggv-Ig 71-IQBEE-gs. D 5023-Q12 Qi lg X Mil 1 O. " 02 wig "' U' 5 O 09' ni 0 0 27 5 n5 rf,-HU ' 'fl ,. .Q at gp W 5-cm D'n.nn' 5 5 ra 0 T50-1 5 ,.,. cvmn,,,., O: :S A -, N, n wow 5- :Agn--. 5 CQ rvnD.,.,,., 1:2 ww -was 9 XX 35-fpL:0,,-,, N 2, , :1 '-7:3 87 " 0-054' P' -r" 32.50 " """"'m"n ."' rum: wma - ' in fn :sw Xu' 5'-'U-:QHGQ o"O,.JPO 0 O FX pw- .-I , 051-v""l Wm 0 0 D" -nnwm-1Cn""m 9' NDBHE U! W' , "V '4Q,mV'X WZ Wg- 9' 140 15' 'XC W o4,,,,5U"'Ul -lm"- - 1 1 ' ' rr 4 -- .- -. -X- ... ... 3' V5 F2 - Uggfghii' .X 3 997125552 3 555558553555 3 H Q'5'0mTZf'3 5- r fe 'i 5555 5 gggsgwg 3' gg 25,5235-F 3 5Hg+:azgEfg'EQ.afg5 Efgigxsiylif- ' u gg. 0 -g 5 , --sv :S ' "' 11.0 o . ' ....'o U"-Q A ' ' W Ie? M. gigg' D 3 F 3253: D i Q-TG9f-9 E"a?5'H"' . "' gE',9'51:s ,.I I ' ' ELG- 2-aes-EM - 12.0.1195 - 22- as ,Haw .4 IUSZMXEX X. X X. - 'iw 3' 535056 a Z. 23.592,-L 1 'Xl SX-2 5,525-:Fai P 01 2.2 SLE,-5125 2. X ' 5- " p , 0 pq, ...' o,,'4,,,,rv 2 Q-5'fv",,:,-'X U 5 ... W5-X 'Tm ' o ET? 5' ....5':.v-I: 5 Q P fn rv 24 3 H, - E 3 g gg 0: o' Q-9192.13 Q NJ, , M Bn' ' 'S-'fsai X-:'G"fQ' '5-1?5B'fv2s'v"wv- .4w:S2?4'52X' Eg: fs - 924:12 EQ Q ' EIMS af 2 12:-grfL21f--N 'E -fm Q aww' Sw 2 ,-wg-if -1 1: n:':1-v'ru-X-.- "'fv5c,'-" g"of, D--H 90 01- gow"755H--- jeff 'X w'U:,w mmm an 5,-,mem-1 , :....,g"5g,.,4N.,.... O 4-,mn-.-X-.., -,QF GEM 5' ' Sim' fv"' 'Q ' "FMS rw 6: 5' fQf"9h" F"'1'-323 3 ':P"5-E" F5 " 'X' W IJ. "' "" W ' '1 ' ,. D D' ua rv 14 ff "' , -3 25232152 :ww 4 25o2:mf0?.if-Hb ' saozif? ' rn 0 M - Su, 4'5'ru H0 -X" -' W :IW 'ww-1 m9'.,.,F":1"- 4 'sv 0 To w rife: "' D ogfllarn U-5' '40 c'-3 '4 -Q1-' fm ug f,U..g N, Q,-,rnpon 'f-f, mc-.goin ff 5 n.oUl '- :ug':" f'c3o.,"' cog-nm 3 Oigrmgmggujg- Q HIV? 342 32 gag Q 2112352 S2522 ff 5wS"H9ff'-2:12 3- 92-M2-522. J' "fig: :: S-9-105.0 SKUFE 5 5B"53g5f-XF -91" ,S 359555-3' O :r' - -I -X ' D X 2-1 3 eg Hi: 1 Q S: gf? 'P gs E 'Lge H S sim Q iw iff 2- '43' Q 00511 gC....En H nn- :fn ' B1 ""mE.:h - --Q C s " -X W "1 , 5- I : -'-1 0 -' 5 " :1 F' . , av 4 mapa: 2 :Xena 4 fisnazfrxffasw 25 :wave g .5 0 'J' D " Xa- 4 Q D I l Y , S N ' QW SS X -4 X ,, 4 , 4 4-1 SXXX 4 ,444 4 4 4 X X g 4 K' X WNN"KN'-"-SNNNNNNK XX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN-:XXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXX X XX XX X XX X XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX .XXXXXXXXXXXXXXXXX XXXXX XX XXXX XXXX XXXXXXXXXXXXXXX XXXX-XXXX X XX XXXXXXXXXXXXN? XX? X X r fmv, A 40' V . ,. t , Warn? U, . ' --l - - f 1, 74. . , ,w,,,,,wNm,.m,m.a-i Q Q,,, r' --x ' X " uf ' - ' J-:i'ix " .-,,-,..-'15 V "W, f fe 'ef ,W ZTJZLT' W L. . , T ,fp gn "4 , f' fI','A1"Q:qgqk, 5, -5 A-tx - f- 110 yvvmfm.-m,.,,,,,,,.,. , mfwlff, 4 ', gfffy. , . , - .. .- - . 1 Y 1 - .5 f-jffff' . SSR' .-,f.-4.:-'-'5'-f A - - - M ' . -'?'?0w 25 gf'-f ,. . , a'1r.q-- 'f 4-L+ 'I l 4 :L A ' ' - ' 'Q Qzifi N ' 4 i. ' ,f,1Zgsx l Ex Q 5 'H f Z ll 4 if L. , , 2 Q r. Karl Wagner, 21 . . . . . fmabison I Z Ilrivale. 'Engineers Z li Died of- pneumonia at Brest, France, on April IS, 1918. g Z l-. KEnlist1ng1n February, he was assigned. to the 20th Forestry ' g 3 Engineers and received six weeks of intensive training at Q gf- Washington. after which he left for overseas from Cami: 2 gl, Merritt. While on board shipxhe contracted a bad col , 2 which developed into pneumonia shortly after arriving at 2 Brest. He died in the American Base Hospital at Brest 2 3 five days after reaching France. 5 T l ' Z 2 1 ' Z ? R Z 25 l 2 ' 2 9 H ' . . . - ' fy willnain wallrich, I7 . . . Shawano 2 5 i ' 5 5 ' Iiculcnuul, flnfunlrv 3 z' - 4 Z ix Killed in action july 23. l9l8, near ,Iaulgonne while par- 2 2 ticipating in the allie offensive at Chateau Thierry w ich 2 Q I started on July IB. He was a member of Wisconsin's fa- 2 it mous first contingent to Fort Sheridan, and was eommis- 2 Q 4 sioned there. He received his university diploma while in Z gl carrap. Arriving in France indtliixe jpking no L9l8. he was Z gy' ma e regimental gas o eer an a en in c arge o sev- Z 5' eral gas attacks before his death. Z Z Z 5 , 3 2 I 7 5 3 1 5 7 ' 1 5 ' 3 Z ' I x - - - 5 I vman Case vvarb I6 . . Sl. fours mo. I 5 , ' v - 5 4 , Q f Z r major, .infantry ? 5 5 Z l Killed while routing an enemy machine gun nest in the 5 2 4 Verdun sector on the morning of November 9, l9l7. He E g enlisted immediately after the declaration of war and was 7 2, sent to the First Officers' Training Camp at Fort Ogle- Z Z l thorpe, Georgia, where he was commissioned captain. He Z Z ' sailed for France the latter part of July, and was a member Z 2 w of the First unit of American men to be placed in front line 5 Z , trenches. On October 30 he was made a major. One week , 2 later he was fa-tally wounded. His grave at Haudroment 5 2 lgearslnthelxnscription: "Killed while gallantly leading his 2 5 ata ron in action." 9 5 5 5 3 5 1 I 5 5 Z 5 2 5 5 Z 2 , l 5 Z Donalb William while, '18 . . manilowoc ' 2 5 1. -4 3 4 ieulananl, Jnfanlry u 2 7 I 2 Killed in action on November l, l9lB, while repelling an ' Q 2' enemy attack northeast of Chateau Thierry. Killed by g Q 1 machine gun fire while leading his platoon in a charge on an Z 21' enemy machine gun nest. Was awarded the Distinguished g fl Service Cross for extraordinary heroism under Fire. He Z Z" was a member of Alpha Sigma Phi. 5 1 l l 5 5 1 ' f Z1 l l 2 7 'x l L 2 5. W l 7 2-x ' 9 4' l . f fr l 5 7 7 -v . . . . ' ' gg l .franklin Charles williams, '17 . milwaukee , Z 1 N . 5 if l - - - - 4 H 1 Sergeanl, flelb Artillery 5 7 l . . . . i I ' Died of pneumonia in the Mossley Hill Red Cross Hoa- 3 Z 2 1 pital, Liverpool,.E.ngland, on April 3,. l9lB. As a member Y 2 Z ' of the 32nd Division, he had been trained at Waco, Texas, Z Q 3 until early in the new year, when he was transferred. to 2 2 1 Camp Merritt, New jersey, for embarlcation. Leaving Z 3 near the end of March, he was taken ill on the transport Q 3 Z 1 M just before England was reached. He was a first sergeant: Z 21 'Q and had been recommended for admission to the officers - Z Z 1 training camp at Gaumure, France. He was a member of Z 5 g Chi Psi. Z 2 , 4 Z . 13 ' ' 5 Z 5 I ,N ' I ' , .. , , 1 2 I ' -So le! your rest be sweet anb beep m Jflanbers' 3Fxelbs.- 5 2 5 6 9 , , W 1 lg---H --..-.- ..-.- M-, -seas ..... - ...F - -- - 2 wx, f , Mus., .mn ,..,.. Y. ,. s. -- -. --- f , 4 i' 1 ,rj f s V. 1 ff f, wnnfuuf 1111111111110f,,,,,,,,v,,,,I14ffnfzznufuffzfnufffnf1 1 1 11 fn, In uv 1,un,,,, ,nfnlffzfuf n11f1fzvfffnfu,u11nmffnfuffflffffffn f ,,,,,,, nun, ,,,,,,,,,,,,,,1ffuf1if1 auf af 'M xx us xx xx I x x xxx Sw , . : X S X : . X X V Q Z I - N 4 N 5 . x Q ' 2 ' 2 1 N 1 . , .,. 4, V1 ' 5 Q w y 5' ' 1: av' N we -X 2' ' 'V 6. My ! n -N . Q QM 2' ' N' 5- Qxxkx-Gr mg. I 0' X A -buff Q xv. '17 1' . ' 'gli '1 1 ' sf: z 4 3 'xl 3 2 .-TS 5 xo 6' In xg: Q . 5z:L0e,1',X- ' --ggi V , , lv -4 M w 5 mg: 3 5 :rv 'Z o rn .-qw w my 2 H -no G' 84 ?.!:?f,u'1.x ' X "' k ' ax 'L-yiff-' 'h' 1 i Ss 2 21: S m 57: 2 if S U If :22?5g251U 2 ii'-2555, 5 22 w a Q Q-.MM--. ,,. ow-. 1 -...ww H nv-. D Q., :H fs can ,cz Q ww uf. S 5, gnggasiagz rr-:sg-K wogovninnbj 5 ziwqmpngg 4 no--.D. .... .., ,MW - ofvE2. of "oo--005'-' ggof' 0 , ,fl g -as og W, wma gg gn 5 mc, Eg , Q 5, H- o eo -fain. I - .Url s: ':uwZ"f' W5 ""'.-v I o :r'5f'::1f1- rv"',,H:r- Q f 1,- Q- ng um rt---,... C ucv C ' sv: nwg-Rom '1 0 O 0 y 50 D'-.0 -M, .1 mg.-vnWD-5:1 In gr... wwf' P rp 5 .U E-Spa' 75 .1 'K' -- XM S A ve O-ff.--'4nf" -f :1 M: 0 fffo O 'U S44 -...U- :v--4 Q f'S:- -u : 'f' N. 0 N C... np .-. og.-v . 0 5 on or-M l V .. ?2.59.3s5f' 3. 5 'U-gs '-f'- 5:55-2 55 P2 54 S SE" gilug gg, IFEQS5 5 z 5 2' 2.-v3d9,3-'flag Ug EEC- Q a.E.O5'fv2Hg5 D :I n-5'E'g'3g 0 :F-"o,,:.S 3 ', .X Q .o-1 515- v -5-1-1... 3 24- 5-g 0231- 51 Qin 0 4 ,.,i-.wc ' a IQQNSSPMEQ F: 5 50352 gr 5555511522-Q au 9052?-'21-'i H g Qegiii 2? W g Q rr. :10.. -- .-.- in pu --. n. W gg, "- a- no -. W' ,-- U 2g,?:5Qa1g9S2 ' :.f' gs?E.1xaa- Qggsmwg-2 Q ?22s'S:5H'5-'g 1, H- , U 1: n nn g -v-.Q , H :rv-915. 5 Q -.W0"0"" 0"0 :"' ' + 5 wiS2lfE':a,H ff. ass: 2- 2 zfsfie--iw irgfvr-asm 5 gg- 12255212 af- ' Q, w 9- ,,,, .on 5 . ,.: 0 . Q-....,, 0 mg - 4 or 5-mov : 5'...-1-1-, 9 :s 5 59 5:20-155 f mfsw :'s--aispcaa iw gafrf wsS',gwQ 4 5 wig- E-lg - ed- ,,g-4n,r-1 - 9, n a D -s ,,E,,.,Qp .-.,,gO 5 Pg A S 2 52.59255-E-1, U' :ag-w F o3.S?5S.2m5f' :.'. gipgos :1 ' g'm,,'.'l.Q "5" N wg , 3: ow' ----,.. 2 D 5' , - 5 -...Q .-. "- : - ua. 'g' "' 'of' : . ' ln 5355-Sf?-S'fDi1. F352 .:' Q-FQQEHQNEQ Sfezia-5.51 N Wifff. 5 9: 9,12-Pgoguqgv-5 'G WSPQ- win. ig aj:-gil. Q' . agua gg .2 giogag 51 - ' V .. 9 .1 53 u .5 . 5 1 afgfnifasil O gil samlsgggi. Emgmg ' SL?-fps: 1A 'ug :VUU am 09,191-v-' S' ' ..,.:1O'o W -f-. 3. 3. :v-gzfv' Q-uv Q 5 v ' 'S-H Homo- ' -12-.D-5 :avr 43' N 1 9 ang, rv, ,,- S -. rv- 3,2 :r' xo Q ooo..-,Ui ' Ugggiiiief H gig 533,55-EEEE. E 535 552 3' 3,1292 1 Q 0 v g Q -wgm g o ' :S :ro W ... -. ...ogggm-1,.1,,q 5 ngrrg 5 .... ,.. -.0 -.-.go O, nv C ,D , X H H HD. O ohh 0 I-fm C0 ru' oog -5-.. :,- y mf : P2JS'o3f"m5.g S, gag, E 0-53. og.,-U Q' -maxim 0, Q-van'--u 5' E ggg"g2:Hq ,, - sin. 3 15 5-s.5"Ef 55 Q Q'2'5.L2f'5 C D-gf? B 11 5:5 A r-T51 3.0 ?'i4:' w ?-LE g 2'E5SFf'3E5'? 5- :2lE'f?i A 555 9,52 E ' 5 X ' : K. ' - 0 ' z Q, , ill 0 2 3 W E ci ' , z Q .N z Q SX '12 ' as R M X E is Q . x X EX- ' A A ,Am W ,g,A ,Q- X'4xixxWn.Snxxxx xxxxxmswqxxxxxxxgQlsxxwxssmg-xxxxxxxxxxxxxxylx.Q-LQxQxxv.wlxxmxxxxxxfxlfxwfmxxxxxxxxmxwxxxnxxx uwxxxxxwnxnn uwxmvmnwxxxxs x-.xsxwu N x unmuwasxw.xXxxxQxxxxxxxxnumuxx-.xxxxxxwxwxxmxxmxxxxxxxyxgwmyynu-xv.-.ww-vmwww..wxuu.,.w.mNvN.N'...xwxxxxun-s sumxx-xxxxwxxxxxxvxxx? ey, fb Sw 1' 0 AF' ff' YW' swxumm-.NNxw-wwmmY.-ixx-393-5.x53x-,,w,,,1.5y9w55g355yN5vv-rx-Ngwwxx.v.NxN-mmNKmx-Nxv.W-.Nxxwx-.wmxw AX-NNu-.xwxxxwNWNWXXN- www-.XNN-.w... Nwwwwmmx.....wwN.,w......-N..mx.Nm----W-ww-.xX-.v.xwmNNNNWWWWN-xwxx,w.x.-Nm.Mx-.NX-Nga , ,wfdi -- L, , A 4 - -1 4, A M , , , , -4 4 , . , ,, W, , up M , ,,,,,,m, -K! 44 A , Qi 1" H, -2: Q - ALI, -4- -- -4- U44 4, , A ' A ' i 4 , A f , A , Q, fy., ,Q . ' 4' X' '-In 'Xe Q 1'5" :SX v 5 . -QNX I 3 -- , fji 5 1 3 .55 ll! H Pu 15 I-, SFS: Ea g L'-sg: 0 3ggogg:.'gss'g'g- g ggfszgneg D sagem- D M :Egg-HW 3 Ea-fo 3 sf'af5f'25-sign:-vw 3. :JE-Bao 3 Egan'-327: 1 2 X , ... .. ,J , -- -. , W mo',,a,:B: 2. 0-4305 6 'g,m,,olPS'...:v"a...,-woe 9 0553: -15. U, n'pa-sf: bg A X gg"U"W-'-S4 5' "'rv""'Q' 5"-'g3n'arv-is 9953- 5 "' 0o'2Bg0- :YI :DH p, 1 3. ,.,,4w:-,T , 5-o59",, gt :v-QSQQ3 mango u. g-gn-,aggo bi nm-13943. ., 5 W HWWESWE A 5"'9-on Q a0w'gW2o Tomo- g 0 go .":'-N 5- For U?" 'D E f- Q53-2!.:"'p ' 0-2-g:'5'q5: 'vm0f'-q5"4"g5"4 gag'-g"'5Z'on'S 5' Sings D 91 fi wogoggq- 5 309,125 R' Igglg-9'E'U5'i'.'f752":, Pl .-,wg'53,'gg Ho Sggnigg- ' 2. X rv-D.. -and g 0 -rg-Us 6' 0 ., m',-y W Q we 0 oo 3: --- W 5' :ivan - -L ', V I 55"a'fS4's'5E Gr S M225 E' 5 22325-55553325 3- 5-'E5"2?95 2 S' SC2S5"5'o :- + Q if-'Sz-me Ls 'mf' gs- me-we-:E--e-2 v -2:---2-as 5 g,'2-'-'-me - . vu W ' I- gr ., - .4 -1 - rv 5 -f - -1 3 S5"5.--0Q.,"o- 55' "' Woppg 'H "g..'D"' "' ' 5'-in :v wh' 230 D' 2 ' 1, .":1P'-gf-E - ...."'I""' 9 55- U35-gmwa -ml "' H 0-fv3'.-V5 0 U'm9wU7:" - ' ir' . 3 MQ5-2 Q - pf' F97 5.--00: -. g"c0F":f' N1 E4'g.w'O 5 'LL '--No.3-v.. 3 1: 1' ... rv'-50:' :J v5"'5-33 ' ".,'5:.1.3 " -3, 2.1 :'p0-I.S-fv"m- ff-Zmnw 3-1 W- P' "Wm 5 ' ". 0 - "' 5 I Vw W -- ' On?- 10 0 , CTD' 9 . - fr' l gf Z,Sgh'so?ff?O gsadam IEE-ima:E529g-+ ggwizig- 9.5222-52 H ' - H- . ... . - 5 F3 SS'O59+Z0' mag?-Q-3 "E..,'PDi'9?.3,E-S,:".1. 0222.0-:mg O 255-3-' ,,. , 5 12' Sa rs'?f2 D' ' 2 90-s' 3 9-I' 039:-TE"i52"SQ' 0 ' 5' 3 f Fa A gl' as? ? - f . . ' -ff - D :r"---1 ra p -1 -Q V 1 U"W 25 1' o5"'0Q 0 PpU3:0 0 an g :H " W Una n 'Wg g 1' 1 ' 5 ,Ang ,., 2 .-fb .,, ... 2? 5-, W 3-5 -1 536.93-an : . og-Hn . -X , N - 0 ,. 4 -1 U3 N -U , IN p 5 5-3 73 . n u G. 9 Q 9 n E' I w s -'Z' ."i'f.2"-2-233.-':1,5 ' 5?-Law 2 - ez'2TQ55:sf'i.??,."2.a 5 51aL,-9E-- 5' 5.252-5 .1 X , 1 5 -1 - --1 re -. . , . A 1 2 rr? -I--f' SIZE' U"2-' 3.11121 Ps:-5' U .Ci . f-:gm :1 ,, 5a'B':S.' 'f 1 J 5: n.-151-o-og, f-'Sas D' nEZgS'g:'fNE!3ow'fl9. Q If-mg?-, G gc:-. 5- 5'1" N '- 5-225591 :QE-ig ,g ,igmgpgginhis-9 g giznsig gmfigzg, 'wwf 5' "' ' p, ' ,,, EI.. 0-1 4 - -" 0 . F' 13 , YQ"- W 2 2 Os H 5-12' 2512 S 2125 2 mg-.fs 0 22-229 ---SL - - - -. H ... -- :: . ' , wmmog -1 N132 -"fa 1""o .--lg 3 na' 5'-3-cn O 230- fe lf 'ww - :.- Wx., 5"-H 2 w., 0 . 9.--Zfr-E35 FO- SL 9' '-,L--mg' 5 U-few sd ,-as 2' E,Eg'g-SEQ Q 353 S' 25225825855 O 9223?-55 '-gf: EWE555 .2 ' :. :r' "' av' " w . -1 -- - an - :1-'-1 "' - V lg, .vn.,,9L:' gg' .-.3902 3 f:lf'S53.'-.vn?r'v 37 1-?i'?9.?:O 3 EL'rS.f:S5 0' , ' 0 fd 0 c' n N 31. ,' l 5, s 5-ll' ' ,q ygflu,-'-.:'--.R , Q-3 4 f"f,'fM. 1 -1 ' V' .fyyfk 1 n ' If ,ffvff . V JIM ! fo VI ,. M7 3 5, g rf, 1 I' ' uf I- - ,LTI I ', A ln ' . pi' f ' A ' In AD' rx 2. , ,- I 'n 5 I g A -f fs gg 4. , ,Q . 3 3 - Q I E , X 5 N S , Q x --A MXN ,Z 5 Q xxxxsvRTAixii.RRRcmiiiixxmxxxxxxmmxmmxxxxxxxmxxxxumwmxxxxxxx xwxxmwnwmxxxxx-.x-Nmxwxxxxxxxx-.-Nxxmwmxx-xxuuwxxxxxxxxxu-xmxxuxxwww.-.w.-.mn-Awww:-mx-uw-s1v.w.v xxx xx-M-A-Mxxswnw-xxx-.w.-.-mxxyx-.wwwwwx-xvxuxnNum-xx-.xy-.sq-.W-M W. X A xx .A xxx-.x -.. X wxwxxxx-.xxxxx-5 My N- - 1 , V f . , N ,mf ffmlqfyqlffufufl 1111110 nuffuuf, ,uf 1 1 111111114111 1 ff , 1 N 11 ,, - ,,n1uu1 11 ,yfnnnfurfnnfrfun-ff11fn,11ff,,,,,,, , ,, , -- ,,,,,,f,,ifn12f1l1l' 1 f 1 ,M X, fmfnrrfufz 11111 111,11 x xx 1 1 1 fu 1 mf ' f ' 1 , ' I""""""'f f ffunfnfunfvny 1 .M "' 19' mf' ' I H wffful mluffafnwfmfafnfrfumffn ff 1f111fuu,ruW,,1 1 x YW. xg X Nxxxxxxxxxxxxxxxxxxx xxx -A uw. xxxxxxxxxxxxxxxxxxxxuum xmxxxxxxxxxxxxxxxxxxxxxmumxxsxxxxx-.xsnxxxxxxxxxxxvxxuxxxxxxxxxxxuuxxxxxxxxxxxxxxxnsxxx-.X-.xxxxxxxxxxxxxxxxxxxxxxnxxxmnwxmxxwxxxxxxuwnxuxsx wxxxxm-.xxxxxxxxxxxxmxnxxN-xxxw-xnxx NxmxxxxxmxmQxxxummuxxxxxxxxxxummmmxxxmxmxxu-xxnumxxxxxxxxxxmxxxxxxxxxx-xxmxuxxxxvx f NS N , Q SX E FX 5 : Q m E - z S K X . Q . X X 2 x S, 5 E , S 5. 5 A S . I ' I N x Q X Y , . 0 6 . 0 " Y 9 X " 1 E ,lk 'Aw 0 fw f E.. AN N W 9 X-.X:N.X'hj 1- I uh" Nfl ,- no ,gg 3 A S xl :Hi .., - f" er .X sa ,whim H' l'7f19'.. 'g 0-va -Us p-align: F -1-.-'gpm'-v rm ak. rv U-fm up Q .- it ggi kv ... ' ,., "" F, ,,,- an rn ' ... n- -Q. '.mA B' Sigfslszgiwq F 52225350 2 22225220 P. ?'f?5?SZ?rvU 'E S5?'i2sU 3' gnigvkf-A E 5'o m,,,.,"'a,., 'Q o4"f:r 5'-U-,.. ..on:vraS2fvL'g .-. 3 'Ag :r- : 'H'-19-'--g flw'!: X9 a.7r'wU'gD-p:-'rT:1: 1 -,,5rvv5'inf' Q mpooE 5' 0 ima'-'?-,,Lnmxa5' 0 Fv'5jo:'m5' 61 6"-mf! 0' ... 32-,, :W D-'-If' W-. mm HD- 'U--w-f. --9LD- V1 N:-rj""gO -0- 5,,,.,,:x"' G- - 'KM -r gr: :hn...."D- - 'gimp 2- 'W 'gn Tn- w -hcioo 1 9, UQ 0 'WIVJ 5- of FW Saw 5 ga- Q .gigs 2392- , 2, 5-2 95 fa N 9.2 2 I's'f2g.2- E' as E.g::.-an a , g--h o-- Q pn" F- -N o 'Um r F, ' 5 '-'- 0 .f 3.4 EQ 25 225-E 1 afg,s5Qff Q5 2 aim 5:35 22 329 WEE I 159231 2 f 5 . :foo own ... ra :I xv m "5 I " cu : S2 : g "" -c A .- 4. -1:-f-..,,,, wma on .- 'cw vsp.. fa mari c : ,,n.mE': , ' A ,-gl Go.-ro D,-5 Hin ar -uve:-n 0 Q HP-Hung! o-S.:-Q-no 5-3 Gm mm-HPQ 1 , 5 Pr..-'p.n..g-.Hao -I I gcgimgo. 31: ga D"Q-QQQHK rvnqmru.-fggwo 5.0 5:-5:5 N ... 1 0' -"-:1 "m"':r-L 5 5 Q rf. 2'0ml'fW 2 D 'U Jvwmmm -- "9 2:1 0 :s uf IS mf'-.... sv .r'T' 1A 0 E Song! 4.32: I wcS,..::w::1"-.-5 of' ::'1o"""' " O3-5--vrph'-'m "mE'0UI Pro' '4 '1 " ff gn---. w D :a,:2,r':.::1: ' -':"f'n. '02 C 3 "'05j0::,'5'uqUW -5 wsvqcmm' -- Q Vw N755 :-N4 : "' '1 Q mu 5 RWE OU'-'-m""n 5 V' gg-pkg g,H-f."""' - l - Efvompovqh-119 " vU'G rg.,-f:'Fl fvf-+ .0-1 ..." .., 71, --.D"m,.,,,,, rw 3 0:1-1:.'-:UC - K -- -4 0....: 9' 5"'f,50 rvf's--- D-D-Cp-Snug: . nv aio, fr 0 rw 9,-v-.mow X' N Q 2U'DS"'-1-2,:1w..'0 Q' W -.rJ.Cra-2: sv,,ff4fv,,D 'ugmo-.ng-w gr- "' f4un.f' .- 1 N in g--, rr wg. -1 D- U'-so B 5 5 Sm- --nw 5 . ..-.-1 Gig B -,n 91:5 -- '05 0F"'o"' ,' wuonw-15' -. -1 o --25:'-.S.D'r" N HTWWST--r D ' 40 U' D N ' ' lg naw-ifnfavszkn . awww gf- - :fn wgww- Q f:g,.o8v,,E: - 5525 zfmao 4 0' Iongglbx-nz' Z' O -:r 'WWE'--2 l :15-Sf'---"5 H 3'fPg,pg:--v-hE'f' "' -152.-E503 ' 7 1 V. n.9ngw-cn.-:r,,-nag, T5-so-g-w ,R a.,,.-U5 vc-, ga, M, gwpgw on ff' :ww L, ,1 . w gina-1 U"wE9':'g,Q-1 m 0939047-1 5.1-v 5U",,::nq. -v-N sworn: fx - g, '1' ,, ...w . pf-vm :s . - n.o-1 "':r rw --, D' on c :nn Q cu --- N ... . ' 0055 rgophf n-- wwf' 'Q' -fm 0 " :s ww 5 nro up-h so-.UIQ Q5 Q0-v-rv-' 3 O WW rr.. -nv-'C . OU' 2.i5gfgzSg23 fEgw25.2glEf4 sggzrggiai -agga.-Snag? V' 59,525-fa 5 . ...gg-1...-I,-'gf' -'I 9,,' 3 mc -1 4,4 OU-..."r 2 7.-+ 3'-. NUS cr 00412, .4 ' :,,.4f'w!':r-,C-,O f. oIn,'Nn G...w-n,,-- 23-0,Lig'f1w, . ,.lm9'5'P'.-. 'Ac "5'If':ag55f. 'Im 92? '5'.0-' " v 0. 3' ' :s-'F-" WSL g,,5j.f D-Zo-gg' zmggsgg 1 U, a245E.'-20212. tg ' ..E55g3g,,n H H95-52.2 'V O 2 na rv cu P, 1 '1 C pa ru V' nu n 5 H' ' ' W 0 cn 9 127035. 1?--1D'W an 'rr' nm E. .1 rv -155. U1 , '-gy-2107 O1-Q 2 --n'J0 -.gags 25-n.-.c OWBQQBO, f. ng--'coin A w ,,,,fv,,n,.- -g,,.CowH.' 3 .,, nga 5-Q 0 fo g .-. ,.,. NO -HSD' .... 5:5 W 1 -. 41.51755-1 -f 5 Hnofvooo f' bf -'ff 319'-' U, D520 nz Q -"'-'ru 5- 1 .4 , -,- U-,U Q gp 4. nnmm ... m n. 6 fren-UQ If29.Z3g,?2w 9 22305 F50 S U2'?4e.': Ii 33259022 3 ff75p?l'ZZF rv cu ,. rv :,.. 1255-agcws S QE-S5-?Ug6':' 9' SEG .155 Q 29hl3'JIgS'I5 5? 'QTJSE' S I.-,5'2'a'5s,1z,g -'I 5oi.?.5.sQ9 Q1 gggi-'g-.g . g.9,PPagm2g' LQ S,-9,S'2rQ 1: x uma:-1.n.n.. 51' -...n.- . : .-,mm.::. 'ta .n.n..:r--. -- n.m.-.r:.T:1 av' Q 6 O' 9 3 S 3 2 S N Fx Ss x S R X NNN ssNXXNxxsxxxxxxxxxxxxxxxxxxswN-Mxxxxxxxvmvaxxxxx wmw.xw.sw.w.sxmumxmvwxxuuwwxxxxwxxwsw xsxxxxxsmxu-wmxxuu -.N wwxw x xx xxxxvxxxxxnxwmxxxxxmxxxmxxxxx-xv.xwxxxuxxxxxmxxxxxuxxxxxxxxxxwxxxwwxusxmmxv-sxmwxNxmvm.,-xxx-.xx-My-xmxN.NxxxxxX xxx ww xxwmxxxxxxxx -s QF Q ,s W I fly f Y M r V W Q. , V ,alll if N 1- .P " Q . 14 ' , g ' :Q-figs.. If ff, 4 r f-gf ,9f4i'f1r:qgm,.A.j,, jeakgv -- - . 4, - --- ! i M 1 1,11-11,,.m,,1,,,,,. V H --f-if gflff wg -ESQX g ,F-t"f3'i"Q, ,, 2- ' 1, f ,-, 41-1.-. K E -'rf' -----S,g,, so 2 .. 2 Si' ,,,, - l if .ir Dieo for Democracy Augustus Toss Bell '16 merrill manning Benson '19 George Wfarl Brainarb '15 ffreberick John Curtin '10 Charles fllaul Giessing '16 Holm Barton mciarthy '20 walter Effenry murphy '15 members George ffitzpatrick' 22 Halph william Gorham '22 michael mathew Qruber '22 llfoseph Ifohn Mans-on '22 ffranla Emil Ftfeller '22 Clarence :Donato Mill '22 fflowarb George nelson '19 Ralph Etfaney Derry '16 ftlarolb Sargent '17 waltcn Ufimball Smith '18 Stanley Story Stevens '14 fucien Dorter Wetherby '12 Otto louis winter '11 ofS. 21.6. cc. y Clarence milton flfughes '22 Bohn william martini '19 'francis qfowarb mcwermott '19 morris william nelson '22 fflomer :Eli Derkins '21 flflurcell william flliper '19 :Burr Tavio Koberts '22 illn memoriam fDuoley Flfubbaro Ghase '22 Kenneth Soverhill ifarle '22 .ljfenneth Sterling Tay '20 fDonalo 7!V.e33.oy Iffoisington '22 1 1 111 1 1111v,,1111111 111111111111-11111111111 1 1 If ,Ha !,,111111111 111 1f1111111f11v1m11111111111 1 11 1 111111111nw11,1,,,,,, ,, ,,,, 111r1 I 1' ,,,,, v Spirit of Sacriice :By Kucilc Sclk '20 Greater love bulb no man than Ibis: that a man lay boxvn his life for his fricnbs Tlfome 1'ZXgain! m back, boys, back from the mubby, sbell-torn Iielos of Trance to the smootb green slope of the Big Mill, the best place in the worlb to be, our Alma mater, twice as beautiful anb glorious after we have been away, lighting for ber, breaming of ber, anb ob, olb pals,-longing for ber - 's great to stanb again in the familiar boorway mlb look with ORS Abe bown the tree-borbereb vista of green- , it's over the lop every lime for a Wisconsin man wbelbet be is charging into an enem'g's trench or up the winbing roab of the bill of learning- fl ly! A stroll past Ialbrop, mlb EI bear as of olb lbe shrill sbouls of the girls at play-Q ' u . .IA u' -.fi Q u i' 'E-.ff ve learneb what real fighting is since fl last left the olb :Armory tbat bas been waiting on the shore like a grim but kinbly castle, for ber boys to come home- .J 5 , .x. -1 ' ' A A ' 'i-.g'1a.Qg.J'- - ' 1 -' 2 4-1' Q. 3: " fsgf v 1 'S 7' Fw." .V .. "F2.'- 'xii-,L Vw W4 .f . " 4 ff' A . x , 397 ' -."4-1-Qqw:'f:f:-iff: .,r 1-V:-1-w2'4f.-,, 4' 1:5 ,vm V -' ,,w','fxf.',:g -. vq,ff ..7m1?wffZ' f,',z .- MJ? t 11 ,H A 1,--..I Q S' ,- , " ' ' ' , Wig, --5, ' " QIMLL "'-,ag ' 1 l -4, a :"'f1.w-1: f 1 nf 1 x lr:-'. SQ., -., '31 " ' ' if 1' - wwf? 1' . :fa-f.,..,,,..,,.. 2513514 ,Z , . , .. ow Ffve longeo to slroll lbe sbaoy coolness of the fDrive as Ffve lrampeo the roabs of Trance with the teb muo heavy on my boots- 'be clock Iowan' of a shell-Rom 'M cl-purely in fflanbers brought a swift sweet memory of the happy bouts this olb clock bab rung out for me- - -2 : , x l9al's Ibis? Gbe splash of a - pabble, anb a browsy ripple? Cilyese spring nigbls are worlly living for-anb believe me, pals, worlb figlyling for, looses- ? nb the rustic agrics-what a joy it bas always been to stare along the while ribbon of walk that leabs over Ag campus- 'W' ook al that vista of calm water W Ibtu the trees! EWS the soul- inspiring quid lbal TW bremneb of when the earth lrembleb with kbe Ebunber of big guns- '9' nb' there is Ilicnic Iloint, stretch- Q ing its long emeralb finger out into the shining blue of our lake- -3 nb this breaming sunset water where one can brifl, anb with Mer, fotgel that submarines anb batllesbips ever wrecheb human life? 9' nb the observatory, bigb on the E Mill, trying to plumb tbe twink- ling infinity of the skies, un- minbful eitber of the bitterness of strife or the glory ofpeace- 'N' 2.621157 'N 'T' be frienbly willows ever sbabow- ingl the gray olb rocks willy slenber leaves ofsilver green- fflolbing bere lo reminb one of war- oys, lbe1'e's not a bit of sunsbiny blue in all Trance like our own lake on a summer afternoon 'W' his glorious goloen after-glow which fills ones heart with flleace-the inspireo emo pur- poseful flleace that comes with a return from strife emo horror to the sweet, mah youth olof t Wisconsin- . .Q-"L: 51 5.5 'v':'?'7'WH" ' -L r v y,e-g' E39 EMR? -.r ., -.mm-..-,L.i,..... ,..,,,W...,.o.,,1.f' 'QQM "' , yu ml A , 4- we is b 5 M, A B' -+' +,..'f?Q".n-we K .wk - , , , 'fN"k."1L' if W 7- ":mf,1f1i.,1i1i-!7l.".,,.,.sQl..e"f2 fwf .Q,r. if H M ,, " . -wx .e ilsikw, - ' "' - k : W f...,!.,,,f - ' ' 'X BL-:Sis-X fi?-15'3f52 4-tsiuj? X f X xxx . ,,, - N - A -. . - " "'x"'s: -fc -' we io - .V - r x x -xg , , ig Wear - Qgmf wa- -.. me R 4. 1' ,f . V , e....-e , . A ,Y , Q, 1 - KS - ' A ' F Q- ' -'-- 5 A IA. r s Miers.. , ,ol-B V 4 ,- T' -si.--5.1 , N-U' . .. - f ...M , , , 1 MN.. ",. . . - ,fi-.'i53" ' 2 -. A. ,,,. X me J, A, in 'A - Q .f " -QQ s-,XX N.. A . , -7,- .wx N: -"ffm-ef-se,, Q . V, 5 ' xr--'Jw-5 " . 'N . f. Sa g, so . -V - wg-A.: we -. Aww--sg Q5 ,., oe, 4 - X N--1 f +L - . - ,. -. -wrffqxo . ' k H cfmi1xiS1?aTTo1x Photo Copyright by Schneide Zin iiiiemnrinm Charles Xicharb Van f'l'l'ise "lift was the supreme merit of Er. Van Iffise as presibent of the Kniversity of Wisconsin that from the Frst he conceiveb the problems ofa state university in a new way anb with broab comprehension, both of the buties arab possibilities of such' an in- stitution. Me saw clearly its- outy of carrying knowlebge beyono the campus ano making it birectly effective in the life of the stateg anb he conceiveb anb executeb this outy to an extent arab on a scale never before attempted"-Dresioent TE. ZX. fifvirge. m,m.m..wmvm. m.....mm..m... ' resibent Charles Uiicharb Van Tlfise 352 fDean Scott ffl. Goobnight Hs a scientist, as a conservationist, as a thinker on economic anb inoustrial problems, ano as an ebucator, his name will live in the minbs of men in the worlo at large for generations. Ellis co- workers in anb outsibe the lliniversity will be inspireb through life hy their memories of his unflagging zeal anb persistence in the attainment of high purposes, of his gallant bearing when assaileb-unafraib, un- resentful, anb unfaltering-of the well-reasoneo justice of his jubgments, which might err but were never petty, anb of his vigorous self-biscipline anb ever-broabening scope of interests. Hlgfe was in truth a man. A fbhe stubents, however, the true beneficiaries of his life work, coulb not all meet him freely from bay to bay. Ehey knew him at Rrst only by his cheery "good morning" on the hill, but from that time on their love ano reverence grew apace. Ehey soon aomiringly learneo that he was an abvocate of manly sportsg that he himself excelleo in walking, ribing, anb canoeing: that he hao a keen interest in competitive athletics. Ellis innate "squareness" was proverbial. Fife consistently sponsored stubent self government as the one principle of stuoent control wholly compatible with the proper training of citizens for oemocracy. One of his great unfinisheo tasks was to provioe an aoequate Knion anb Com- mons for wisconsin men. none of his preoecessors for many years back hab maintaineb such close contact with stuoent leaoers or possesseb their confibence to such a begree. r fDuring the war, fAmerica's iust cause hab no more earnest champion, the league offflations no abler aovocate, our boys in the service no more loyal frieno anb arbent supporter. IH is last public aooress, belivereb from the library steps three bays before his beath, was an inspirational ap- peal to the stubents of the S. Zi. TJ. C. unit. f55ut the full import of the great lesson of his life comes to the stubent after college bays are over, after experience anb responsibility have begun their long schooling anb oistance has lent a bit of perspective to the view of college life. fnhen the first vision that rises before the retrospective glance is that of a sturby, virile incarnation of the Wisconsin spirit, of the genuine Wisconsin spirit-whole-hearteb, altruistic service towaro fellow man ano commonwealth. ' Elle was in truth a wisconsin man. gas sea EEE sts ..,W,l.....,.H,.W,..,..N.m.,mmm.,.m.,..,,,.m....m.n. ,. ,..., .,.,.w.m...1.,..m.,K..n.,.....n. ni. .m.m..,..m.m.m.m,mm.mm..,m..m.w..m..m.,m..,.mm.U U mm uw1-11in1In1.1iut1.IwwI.11H11111.11u1in11.11-wwimmmwm ummummmmlmmm mmm-umnm1.ummmmuummmmnummmlmm nn nmumn mmnmumi I nmmminmymummmmiummmummmmmmmmmm: Page 48 A Oribute by the .faculty e, the :faculty ofthe lCniversity, woulb pay our tribute of respect anb love to our beparteo leaber, Dresioent Charles fi. Van Wise. Ftfis beath has afflicteb us with the beepest sense of public anb personal loss. we rejoice, however, in the service that he renbereb to his fellow men. He preacheb the gospel of service anb he practiceb it with insight anb energy. Ztfis service was not the conoescension of the great to the humble but the solicituoe of the elber brother for his brethren. Tao him the great obiect in life was to release the capacities of men, to help them learn how to help themselves. "Ellis broab conception of the part that the Mniversity shoulb have in this work of spiritual libera- tion was Hrmly grounoeb in respect for pure scholarship ano his success in securing its fuller reali- zation is one of his titles to grateful remembrance. File hab a bemocrat's faith in the ability of the people of wisconsin to recognize the worth of university training. no opposition, no boubts or fears, coulb shake his confibence in their unfaltering anb full support of the Kniversity which sought to open to all a boor to richer anb nobler living. "He was truly a bemocratic leaoer. Ztfe was simple in his tastes, belighting in the curling smoke of the campfire anb the small. still voices of the wilo woobs. Ftfe was accessible to everyone anb sought abvice from all who woulb offer it: he respecteb honest opponents anb workeb with them as harmoniously after a conflict as before: he enoureb even malicious personal criticism with serenity, Ftfis tolerance was inbeeb amazing anb it sprang, not from inbifference or oisbain, but from single- hearteb bevotion to the larger, benign purposes that he cherisheb for men, and from the concentration of his strength upon the effort to realize them. "f'lJt was characteristic of the steaby ano consistent broaoening of his interests that he passeb from the stuoy of the forces which have knit the outer fabric of the earth to the investigation of some of the potent influences which make or mar the welfare of men. Ghe well-being of the people of wisconsin, of the people of the nation, engageb the probuctive energies of his mature manhoob. when the great war came ano threateneb the bestruction of western civilization he bent all the powers of his minb anb heart to the great problem of gaining the victory for liberty anb iustice ano then, in these later, stu- penbous weeks, to the greater problem of making that victory secure through the organization of a brotherhoob of free nations. 'fihe leaber who began his presibency with the noble ibeal of freeing human capacity throughout the commonwealth of wisconsin Httingly crowneb his brief bays in the fulness of his powers with well-wrought plans for ensuring to national ano to inbivibual capacity a free opportunity throughout a liberateb worlb. "live reioice that he has bwelt among us anb that his spirit has moulbeb anb will continue to moulb the life of the Kniversity. 'Ghey may rest from their laboursg anb their works oo follow them.' " Funeral Ceremonies, November 21, 1918 -m.,wm.u...wi.mm..m4..m.w mwmmmmunnumumumummn n u Page 49 sig D m....,..z,,..,...z,'.L'u41'wz:1':4r"iz Eli E 2 Z its EE E52 E-5 its 5 5 5:5 EE EEE Eli sis sis E55 Y: E E.. s, QE .RE Our new 'filrexy Wisconsin After the War By President E. A. Binge isconsin after the war will have more students than ever. War has shown to the world the value of college training with unexampled force and clear- nessf The youth of Wisconsin will be no slower to "catch on" than are those elsewhere. Technical and professional courses of study will be crowded and new lines of technical instruction for both men and women will develop as a necessity of preparedness for peace. The moral training of war on the individual will have its effect on the university. There will be a new earnestness in college life and a new appreciation of responsi- bility to the state. The "big tent" Cto use President Wilsons termb will be the center of things. The side-shows will be numerous as they always have been in university life but they will be side-shows. University men in the west have dreaded the invasion of our universities by the eastern conception of college as a chance for four years of club life instead of an opportunity for vigorous intellectual work. We no longer dread this situation. "Carry on" will be the word in university life for faculty and students alike. A We may be sure of these results. Others no more important are more interesting because more doubtful. War concentrates attention not only on preparedness but also on preparedness for immediate and specific duties. There is a real danger that this limitation of purposes which is necessary in war may be carried over un- changed into peace where it is harmful. A university which limits its teaching to vocational instruction ceases to be a university and students who look only to preparation for the immediate duties of the future are not university students. The Morrill Act of 1862 in establishing the college of agriculture and mechanics made it the duty of the land grant colleges to teach the "branches of learning related to agriculture and mechanic arts 5" thus keeping the institution as a seat of learning rather than making it into a vocational school. Here then lies one of the most important problems of a university like ours-to serve the immediate needs of the state and not to lose touch or let its students lose touch of those wider aspects of learning on which the intellectual life of the state depends and on which in the end rest its prosperity and happiness. n The Hill ii . .mix iiiimimmiimniiiiiiii ..i...i.ii.i.m.i i . 1i.iiin.iiii.i..niiiiimi.iiiiiniiiiinniinii.imim.ii..ii.i..ii mi mi mi.. i im ii i .. ii .ii i.-i...iimi.i..ii. .i..n....... mm ,,,,4,,,,,.,,,,,,,,, ,,,, ,mu miEmEiiianmmmHmm?mmmmmr -,....,-.-.- ......--...,.--....ii-...la Page 51 FBoard of 5Regen ts CHARLES H. VILAS , A. J. HORLICK .... Ojtcers HENRY JOHNSON, State Treasurer . H. J. THORKELSON . M. E. TVICCZAFFREY G. L. GILBERT . . A. H. LABISKY . EDWARD A. BIRGE . CHARLES P. CARY ..... GILBERT E. SHAMAN, State at Largs MRS. FLORENCE G. BUCKSTAFF A. j. HORLICK, First District . . WALTER -I. KOHLER, Second District . CHARLES H. VILAS, Third District . THEODORE M. HAMMOND, Fourth District JAMES F. TROTTMAN, Fifth District , MISS FRANCES G. PERKINS, Sixth District D. O, MAHONEY, Seventh District . . GRANVILLE D. JONES, Eighth District . ORLANDO E. CLARK, Ninth District . BEN F. FAAST, Tenth District . A. P. NELSON, Eleventh District Personnel . President . Vice-President Ex-Ojllcio Treasurer Business Manager . . . Secretary . . . . Bursar Purchasing Agent President of the University, Ex-Officio State Superintendent of Public Instruction, Ex-Officio . . . . . . . .Milwaukee . Oshkosh . Racine . Kohler . lvladison . XVauwatosa . Milwaukee . Fond du Lac . Viroqua Wausau Appleton Eau Claire . Grantsburg ' I I The Drive IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIiIiiIiilliiGiIFIIIIIII Page 52 I I I I I I I III II IIIIIIIIIIIIIIIrIIIIIIIIIIIIIIIIIIIII IIIIII II II IIIIIIIIIIIIIIIII II 2 IIIIII I I r I I I 4 E35 Eli IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII1ImIIIIIIIIIIIIImr S I I II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIE 5Board of Visitors Appoinled by the Regents GEORGE P, I'IAMBRECl-IT, Madison XVILLET M. SPOONER, Milwaukee .1 Ol-IN E, IX'lCClONNELL, La Crosse MRS. CIH,xR1.ES R. CARPENTER, Madison Appointed by the Al ISRAEL SHRIMSRI, Chicago RICHARD LLOYD JONES. Madison Appoinled by the G MRS. CHARLES M. MORRIS, Milwaukee E. B. BELDEN, Racine umni XVALTER A. ROCEIIS, Chicago MRS. HOXVAIID GREENE, Madison 0'U6I'l'10l' I.. J. STAIR, Brodhead W. A. TITUS, Fond du Lac D... 5- ,. ..... -....., wi is 1 i The Lake Shore 1ERiiE1iiiiiEKQKFEMI1niimuiiiuiimiiiiimiim Page 53 gmmnumm-mmmmmnmmmmmymwunuuw 25gmmuwmmmmmmmy11mmm.m.mm.m. EEE EEE E Q 2-1mmm..5!H.Em.E!En..1mm-lm. i-ummm-mmmmnmmnmmmlmlymiium I mmmnumwnvWn1Invu1wunnwminwin1InwnwuwwInInwmanwuwunInmvuwrummvuwmwuwuwInunwnwruinwmwuwuvwuwruwnnvwun1wWnmmnvwuwnuwuvmwuwanvuummnwuwmanwuwwnwuwnvvuunum1uwuwrnulunnvmwuwInwumymuuwuwInuvwnwuvunwunnnvuvwuwmunmvnuuuwuvnnwuvuvwmmminwuvmuuuInwuuuwwu1nwmrnwnwannuInnvwIninwuvunumummmwum "mmmlmWmmm'm'm'mm'HH'mmmumm'm'H ' ,. um. 1.1 N. .m..,,- - .MH . N. , f.. 4 W V ,. .. .4 , H UW... . . W.-1 .N N . ... WL . .u,,..,....,K..,,..M...,.,.nn.,..,,,..,,......,.. . ..,,.. . ,n,,,,,,. n,,MINlI,.lI.4VIAv .,......,..., . ...,K..,..,K.. , ..,...,,...,.,....,,,,,..,u.,l.,,,,,,.. A .,,H.,..,...,...,,.,..,...,...,.,,,...,.n.. , ,,,,,,,m,MmuummnmummmllmmlkmMEmnmmm..,...,...,.,,,,,,,,,,,,,,,,,,4M,H,IMMMW.MWMW-'mmm H. 35 mlumumnIn1Inmmlwynumlmwnm.U1InN.1.mmm.HummHM.WumllnlymW1Wmmmunmm..mmwm.m.wmmm... nu mm u ' ,,,,,,,,,,,,,,,,A,,,,,,,mmmuWmlummmmlmm I I H ..... ,,....,H.,H.,,.............,..,.....,,...,..,..,,..,...,..,km...,.,...,,..H.,..,..,U.,H.,..,u........,..,..,...,..v..W,..,..,...K..m...,...m........k.,....,.,K.,.m,..w..........W...,.........u...........u.,..,,.u........mmr..ma:s::nnm1mn5m..1.T..1.1mammmmmr Page 54 QWMDIIIIIIIIHIHKXUFIWI!H1WIIHIIWWIHWHVI!WV1WWKWHNWIWUUHWIllWIWWllWllWWKWWHWHYWINNINHUHNHNWENU!NI4NHNH1NI1NI4NHNNA11PWNHWWIxMNilNTlNNINNVINInNllNNIUIIHHIIHINIWUEN E 5 ,,,.. 2 1 . ,v .- 5 ' .Sq-f - E , Mlm A NWIWHW11WWWlWblWVUVHWPlNwIUHWHWHWWiWWHWilU!NHNWHNIHHWN1WHWNIWWHWHWVHWilWUW1IWWYHIIWNINNI1H1HINNINNIHNH1llNNINNINNKUPHllNNllNUNNIINilNNINIllNllNNI1NI1NllHIWIHIHIUIHIIUIL E E inIllIIINIINIIHINIHVIHIINII4VHVII!I!HIGHNI!NIIN!I1VHVHNIi!I1HINIINIINIIHIWIliUUIIHIWllNVHH1NI1NIlNll!HHHNHNIllVIHI!HIWIIIPIIVIIHINIHIllPlNNIlNIINll!HHHHINIllNIIPIHIINIliPII!IIHINll!llHI1H1NII1IllIllNIINHNIllNII!IIHINIllHHIlHHIllHHllHIiHIWIINIl!HINIllIIIIllNIHIIHIUIINll!IIHI!HIWIHWIHIIHHIINNIlNIINillH1NKINIHUHIIHHNI!UHIlilllHIHIMIHIhIl4IHilllIF O 3 ii.,iw..,l.i..w..,......,...,.,,, 1,.. .,,.ll..ll.1l..lll.ll.llm,.l,.l.il.i,.,W,iiil..i...l..ii....ii........,..,..,.,,l,.i.. ,.,, ..Wi..im..ii..l,iimi.,..ml...wimili..i.i,.,..,......Wim.,...H.lii....i.m.i.i....,il,....., ..,.. ...l..l.....l.i...liWil..imi.wi...,.....,,..i....,.., l.Hi..ii.,i..lK..iiil..,l..ill.ll..ii.il...ii.lii.Hi.z.isiniam1an1as1isnaii.Uiii..i..i..i..l..,,..i.l,.i..li..l...li.il...iii...l...i.il.,,.....ii.,li.l..li..i....HK..H.,iii..,..i...i..........i..i...li..,.i..i...l,..,i.,.,,,, ii..li.ii.i,.iii...i..iiil.......,l..i.Hiilil...i....l.....,,...m...,.i,.,,.l Letters and Science After the War By Acting Dean G. C. Sellery T is not easy to forecast the evolution of a complex college like Letters and Science, and when the forecaster is a novice, and knows that he is, the results are not likely to be startling. The College will undoubtedly try to do its work better than before the war. The instructors are good teachersg they will bo better teaching, talking less and having more discussion with and from the students, and stressing careful work in the laboratories. The quasi- professional courses will be strengthened to meet the demand, created by sharper international com- petition and the need of repair- ing the war's destruction, for increased production of goods and of trained leaders in pro- duction and distribuiton. Equally vigorous, I am sure, will be the elim-t of the College more effectively to train young men and women to appreciate literature, philosophy, history and the other subjects which brighten life and make rest and leisure a joy and not a bore. There will soon l:e established, I hope, courses in painting and architecture, and these, to- gether with music and the his- tory and appreciation of archi- tectur:, painture, and sculp- ture, will make the hne arts a force in the higher life of the College. The instructors will teach better and the students will work better. The war has taught us what youth can do when they are in earnest: and the peace will not take away from the coming college generation of students that high, cheerful, carnestness, which makes work go. Finally, the faculty and the students will more than ever be com- rades-in-arms, working together to establish, as an essential element of our far-famed Wisconsin spirit, the tradition that Wisconsin loves workers and does not tolerate drones. DEAN G. C. SELLERY iniiiiiiiinniiniiiiinnniimviiiiiiniiiimiii i iiiiiinmmiinmimniiiiiiiiliiiiiiiiiiii .lli.lV.,l..,iilli.ll..ll..ll.ll.ii..,l..,li.ilitl.il.Hll..liiiK.,i..,niii.ii.il.lli..l..l,iiiiil..i...lifK..i..,llil..il.li..i..,ilil.ilill.l..ii...i.lll,iniil,W.Uilll,Hl,l.li..l.ii.Ww ll..l.l,.w,, W..W.m li W. ,. ii . ll. iiiiii..Vli.ii.li.ii.UlDlii.,miiiiiiiiiiif ..li..iiil..,liiiiiilini..iii.Wi,Hi..i,liinil.il...iliill..lK.,i..mil.iK......,..li.W..,,.,l.ii.iii..il.iii.il.i..ii.,.,,,l,.i.V.l,, m.i..,l...,..,..l ,..,,.l.l,.,,i,,....l..i.,,..i.....,...i...,.. l. .1 ii ll .,...i.. . . ,iw U .i Page 56 sn: qwwww3555355553my55555555My3555553535wg3155my35:M555,Hyyry.fm55mn.555Q553,5M1535553,U,T:mmW,E,535551WW51333W5.my.W,ff33.1'533:55K!!WXty5513mm553335,Em,M15,IIH5,mf!33NW,.w.W.., ,.,,,, 1,.,,m,.H..,..u.m.H.HL.X,.1U.W,.m..H.,,. ..,. yX.1,,H,.,,,.1,V,X,.,V..W,..L..XHWW.1,,.1X..1,.4Xy.,,.,,..,,.W.H.,,.., ,..,, ,,,.,,.f,V.,,..,....1.,X..XH,,.11V..,y.1,.,XK..XH,W,.HK..V..W,.1,..XW,HXH.X.H,y.1V..L..m,1.ww.m.m.3 QE E s 2 3 2 12 12 E li EE li E22 EE EE EE g g FMW...H.H.,U,,......,..W.W.....,......,W.,..4,,....,..M.,.H,..,.....,m.,..,.,..H.H..,,,.H,..,......,,.,.,,.,,..,......,..,..,..,.......,..,.,..,..,..,.,,.,,..,,..,.,..,,.,...,,.,..,..,,W..,......,.1...H.mt.,.W..1,,1:5um.,,...,.mw:,M,,Mmmm.:M!1,w,,t,Mm15,15my1,MmmmMT,,..U.,,.,...,..,..,,..,,.,,..,..,,.,,.....,,N..,.,.,..,..,H.,H,,.,,,H,,,w,,,w.3,3M.,:mums:wMw,..W,..,.,u..s I I H M' H 'WM' Mm'mmmwnmwm' mlmmmmwlW'-'U H I-W V W N HllllAIllHIIllNIINIIAIll1HNllNllnlNrnIllWHWllWIIAillLIINIHIllullllNllNIMIllNIINVINvuInLI!lllHMHuU1IIIulul1llul1KIAulnyNVIAluNllIllNIn1Ilul!IlnllwllulvllnlullrlH N N indiaEFI51REEQiiiiiiiifmilhii-iiillilini1I1Rnhi1ERduuiumihmmmuwmmummnmmmfmmmunmuNuumwmmmvumnmmnmmnwmnmmmnmnmnunmmnm lm I age 57 I nTRIGGERiii1iiRIEMFRIEQEREQEILIIIiiIiiiiiiBEIGEEiliiiMMUmmmdmimm.wnmm.mm.mm:,mmummm.mmmmmwmmmmunmm3 . . , .V V, V..VV..VVVV..VV.VV.VVV.V.VVV.VV.VV.VVV.V.VVV.,VV.VV.VV.VV..VV.VV.VVV.,V.VV..VVV.VV.,V..V..VV.VV.VV..VV.VV..V.VVV.,V..VV..V.VVV.VV..V..VV.VVV.VV.VV.,V..VVVV,V..V..VV.VV..VV.VV..V..V...VV.VV.VV.,V.VV.VV..VVVV..V.VV.VV..V.VVVVV..VV.VV..VVVV.,V..VVV..VV.VVVV.VVV,V..VV.VVV,V..V.VVVVVVV..VV.V.VV..V.VVV.VVV.V..VVVV.V..VVV.VVVVVVVVV..V..VVVV..VVVV.,VVVV.V..VV.VV..VVV.V...V.VVV ,. ,. ..,.. VVVVVVV ,VV V., V VVVVVVV.VVV.VV.VVVVVVVV.VV-VVVVVVVVV-VVV-VV-VV.,VV.VVV.VV.VVV,VVVV.VVVV.VV.VVVVVVVVVV.VV.VVVVVV.VVVV.VVVVVVVVV.VVVVVV.VVV.VVVVVVVVVVVV.VVVVVVVVVVVVVV.V..VV.V.VVVVVVVVVVVVVV.V.VVVVVVVVVV.V.VVVVVV.VVVVVVVVVV.VVVVVVVVV.VVVVVVVVVVVVVVVVVVVVVVVVV.VV.VVVVVVVVV.VV.VVVVVVVVVVVVVVV..V.VVV.VVVVVV.VVVVVVVVVVVVVVVVVVVVVVVVVVVVV.V.VV.VVVV.VVVVVVVVVVVVVVVVVVVVVVVVV-VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV- as ...VmVV...V.VVVV,VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV.VVVVVVVVVVV.VVV..VVVVVVVVV.VVVV.VV.VVVVVVVVVVVVVVVVVVVVVVVVVV VVVVVVVVVVVVVVV.VV..VVVVVV.VV..V V VVVV..V. .VVV..VV..VV..VV..VVVVV.VVV VVV.V :RVMVVVVV-VVVVVVVVVVVVVVVV...VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV.VVVVVVVVVVVV.VVVVVVVVVVVVVVVVVVVVVVVVV V V V VVVV VVV V V .VVVVVVV VVV V 22 F,-...Q-MV!M-Wwwmm V VVVVVVVV .VVV .V VVVVVVVVV V V.. VVVVVV V V VVVVVVVVV .V V.VVVVVV..VVVVVV.VVVVV.VVVVVV.VVVVV.V.VVVV.VVV.VVVVVVVVVV.VVVVVVVVVVVVVVVVVVV.VVVV.VVVVVVVVVVVVV.VVVVVVVVVVVVVVVVVVVVVVV VVV V VVVVV VVV VV VVVVV V H I H I I " """"' 'H "" "H" 'H WWIH'-1H'1-wfvuu-1'-Hvwlw1-v-H'-1I mu V1 V- ' WVVVVVVVVVVVVVVVVVVVVVV VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV.VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVuVVV,VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VVV - """' ' ' " ' ""' , .,,,, ,, ,, ,, ,4,,,,,,, I ,,-. .VVVVVVVVVVV VVVVVVVVVVVVVVVVVVV.VVVVVV,VV.VV.VVV.VVVVVVVVVVVVAVVVVVVVVVVVVVmmVVVVVVVV.,VVVVVVVVVVVVVVVVV.VVVV.wVmVmVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVL5 Vu V V V .V V. , . ..,. . .V ..V..,..,.,.,...,..,..,,.., ,,,........, . ,., ,..,. . ,..,,.,,,.. . .,,.. ,,.,.. . ..,.H.... .,..,..,,......, . ,,,,,. ....., .. .... ....... -,...... ..,.. ..-,-..,...........-..-.....-.......,......- VVVVVVVVVVVVV .VVVVVVVVVVVVVVVVVVVVVVVVVV VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VVVVVVVVVV VV VVVVVVVVVV VV VVVVVVVVVVVVVV.VV.VVVVVVV.VVuVVuVuVVVVHVVV,VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVuVV.VVVVVVVVVVVVVVVV.VVVVVVVVmmVVVVVVVV:VVVVVuVVuVV.VV.VVuVuVuVVVVVVVVVVVVVVVVVVVVVVVVVVVVV Page 58 VV-VVVVVVVuVVVVVVHVVVVVmVuuVVVVnu.VVVVVVVVVVVVVVVVVVVVVVmlmmmmnuummummmVVVVVVVVVVVVVVVVVVVVVVVVV-VVVVVVVVVVVWVVVV :K :Sa 1 111 11 1 11111111 1 111 1 11 1 11111111 1111 1 111 1111111111.1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111my 1 111 1 1 11 U: ii: i"""'n"""""'"""'"""'"U"'W'ff'fffffwfYfffffff""fifYfffflfffffffffffwfffiff'f'fTTT''U''TffffffwfDfffT'fTf1"'lfff'ffUf"ffff.'f'1",fff' Il'I.f,..I' "'ff'"'ff'lf.'f.ff.lff1fflff.ff"f. 1,'.fI.,'f..fff'1fff'1 .ff"'.,. ..,.... ....,.....-..... ,.... .... . 1. . 1 1 . . . 1 . 1 EFi:auux1uulmn11mmn11n1unm111111111111111111111u1n11111nm11mmrwnum111111111-n111um:1111 1n11- 111111-11-111111111 -11n 11nnnrv11111uv1ru11A11rv11111I111111ex1111-111111I11111n1u1v11111:1u1111n1111111111111111111111w1111n1m111111111111111111111111111111111111u111111111v111111111111111111111111111111111111111111111111111m111111111111111111111111111111111111111111111111111111uw1111rn111111-111111111u1n1n11n111411111111u11111ru1111u11N1u11u1rl1111111111111111u11111n11nm11n1u1m1nm11:1111I1mn11numuu11vvu mug EEE EE E55 FE Ez E 212 :ii ' ' - 111 Sis Ei? Zell? 533 2.5 335 ' 57.0 552 LETTER no 5, x 'icuam-me 1 .-1.- - '.111 if iff- P1-Sf. C.D.L,oo ' Rorneuice L-aa-xguun. es EE? K 515 iv W1 iii ,' ,f Shaw 1 1.11.1.111...1..1.1..11.1 ..11. 1.111.111.1111 ..1.. 1 ..1..1..11.11..11,11.11,1,.1..,... 1 11111 11.1 ...11.1..1... 1 .11.11111.111111.11.1 111.11111111111111 ....11.......1.11...1.. 1 .111 ....1.. 1...".11 ...1..11......11..... .11.11...11.111 11...1.1 1.11.11 ..1. 1 1.11. ....11.............1. 31111111111111111111115111E111111E11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11 Page 59 1111.1111111111111111.111111111111111111111111111111111111.1111111:5.2111111112211111111125113111111my11M1g1w11.11111111111111111111a g 11 1 11111115 1111111111111111111.1111111111111111111111111111111111111111111111111.111.11111111111111w511111 -.WM lKv.'v-..- W 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111 ..... .............................................u....1g .. ... ........................................................................................... ........................4................................................................................................................................................. " ................................................................................................................................................................................................................EIE.E..........:s5 ............................................................................ " ' ,. '..i'.i1.Pi1.ii'ii'I'. .... ................ ...... .. .. .. ............................................................................................... .,...................mn:mnmmmnq:za:zzz::z:.:::anmx1zzxzzs:::::::::nzzan:::ua:za::snxaxnmamzzzznzzaxmasm::::::a::zz:zz...,......................,.... . 'V LQTTGR N :leave ,1,, Rau I ' The Upper CamP..s 'VK .SH Q2 'Of ,D Ed QCA? 53: . :QA EE E35 232 235 --------.----H----------.-lL..!.l..!!..L,...!..,,,..u,ff,Q1LM313225315221ggggjgggggggggyggggyggwgglgmggg55.533333.5525553535.gm...........................................................................................................................................um........................................................................................................................................ 2 is . . ... .......................................................................................................................................................I.............................E.I......................................E..........................................n............................................... 3 i...1.......................................... .. . ........1.............................................................................................................................................................................. ......... ......... ... Page 60 -...nmnwnunmInmumInumnmmmmmmmmlu.-un ,W , .,. ...,.. . ,.,. , , .... ,, .,..,,.. .. . . . , EM ,-.A'- MN --lh -x-.--..--!--!.-, gwggjfgmt hbab X5--5M',55,331,5f55M-I53-3-5L3333,HW35555555w,5M5-353, v4--v- ,mlmjl Vlrv 5,5,3H-twgm5,5ww,y.5X1.1N53355355554-gn,-5133,I-,!.,55H.H..W.,,H,.w.1..H.wm.1u.m..m...,mfW.,,wW.,,,.,,.,,..XH.,..W,.,..W..vfm.,W,,H,..w.,m..wmm.m.w.mww.WW.ww.mm..,..1,.W.Wm.-w..,,,mmm,.m.w.,,mf.H.m.w..Wfm..wm.m.mm.m..w..W 5 .. ,,,,. ,. ,.,.,. ,.,,..,,.,,..,,,, , ,,,,,,,,.,,.,.,,,.,,,L.,,,,,.,,,,,,,4,..,,,,,,.,,.,,,.,,..,,,,,.,,.,,,,,,,..,..,,..,. 1 , ,... , ,,..,,., , ,.,,..,.,,,.,.. 1 .,..,...,.,,,,.,,,,..,,,.,,.,,,.,,,,..,,.. , ..,.., H.. ,l,, ,..,,..,...,,..W.,,..,..,.H,.1,W..i..w.m.U.m.4,..W..mg25 E iss E EF si ESE Ei 525 Ei? - , EEE Egg ,. .f Ei? . EP? " 355 4 2 . Room E15 E 5 amwm1yuWm1InIn'mmInm1IninInm1-mmmmwmvm mmminunHfminmmmmmun.Imf.mmInfnInmInulmrnmmummmmInmmmVHwHfuwuwnvmmmumm..W1.Ifum1Inuvinin-.I11.1.I1.HH-H.NInmmmInmmmmummmmminrnmymuvmmnmmmlmw H 1. Wm H. Wm. H I. I .H mf I1nmWmmV..wIn.HV..N.rm.Hm1H.InWK..WK.1InmnuH.V..vmInmm1I.1mmin1H1WInNI.,mInyHNHUH1flmf.I1InIn1I.1.HW.HN...HH.wmmvuInXyummulwmmmlfEE 5.1ummWmwInummmInummmmmmmnlnnmmmwuwnwnlnuunurumlmInInvmimhmulhirilwiwhiiilnhIiiQiiiiihiuiwminfimiiiiIvi1iuEiiiEii1viiihhiiii?EhFluEihiiiiiiiiiiiniiunlnviiminuxhm1wivmlmulululummmmmmmmnmmummmmwmmwnwvumvuumInrmwInvummvu1mmmmummmnw I 1 vu Page 61 ,,....-.. ..... . ..... ,.,......,:: .mwmmm n uv nmmmumumnu11.11uwmmmwnwvuinwmInInInnlvuwmmyvuu1inulwmuwru1uwmmnlummmmrmmnmnnruwn1Inmmmmmmnmnmms Commerce After the War By W. A. Stoll, Director Course in Commerce URING the war, on account of a shortage both of students and of faculty, some of the courses in the Commerce program as well as plans for the future were suspended. At the earliest possible moment we expect to revive these courses and to proceed with the development of our pla1'1S. We l'1aVC already made progress in this di- rection. just before Christmas a new group was organized in the interests particular- ly of young women who wish to prepare themselves for secretarial positions. lt is available for juniors and seniors in the Com- merce Course and includes courses in Factory and Office Administration, Buying and Credits, Mar- keting Methods, Retail Advertising, Advanced Commercial Correspond- ence, Corporation Finance, Investments, S t a t i stics and Publicity and Print- ing. Still more recently spe- N cial attention has been called to our Real. Estate PROP- W- A- SCOTT group in the hope that this important business may attract well trained young men and women who will ap- preciate its public responsibilities. ln the new epoch we are just entering, American business men and women will play an important role and the Course in Commerce expects to aid them in every possible manner in preparation for their new responsibilities. lts organization is sufficiently elastic to permit such modifica- tions and adjustments as the new conditions may require. :gm ---1- U Hi -1 I 1 -iiimmmimiuuvnii :nu u u v -I : i 'Hi v v 1 i nu innImmuiinmimiumium ri , U .ii Page 62 . is 55 .2 .. 5: 3 . NM....,....H..WH.mum,,.,m,m,..m.n.,,,.4 ...,, Hm..m.u..,.,.,.,.,.,. .,1,.,,.,. M ...,..,, . ,,.,,,.....,.,,,.,, . ,,,, , ..,,.. , .,., , ,K.,,. H .,,..,,.,,.,,K.,,.,,.......,,,..,u,,.,,,, , ..,,,,,., M, ,,,, ,.H..,, .,.., ,,m.W.,..,,..,,.4, .,,. ,,..4,..W.,,,.,,W,.W 5 .-.................M.H,..,.,..,...,,.,,,.N..,,,,,,...,,..,.. .. ., . " ' 'HH'WH'HWY'14'H'WYH11'I"I11I'1'I11I1vIW1vIH+IHIwv1 inW...,k.m......,.m,.W.,...,..,...,.,,..m.,,..,...W,.,.,,..,,..,..,,.,,.....,..,..,...,,.,,,,,..,..,,..,..,,.,,.,,..,..,..,,.,,..,..,..,...,..,.,,,.1,,.,,.,,..,..,..,,.,,..,,.,,,.,..,..,,,.n.4:::L.::::11:::::z:::1Q:1zz,1:1:zz1:a15:11:azz1zz:1c::::1::::z1zx::::::q::,pn:zzzzz:zz:nasz:::::'z::x::1:zzran::sr"""":""""""'"'MWIH5WllmwwW'ffmfWifif'fmffmffffffWfffffffffiffffifffffffffffflffffwffffffffT!!!!1ff!11!'1f'i"f"""''"'"''"'"""'"""""""""""""""""U"""1S 1 E ig: vii nn mu mm I . 4,1 gg .- 515 "'. , :JH f W 3 Y 2 QE EE si 15 E ,Z EE EE Q 5 , , 5 i, 2 5- . I , 5 N ldm 3 w . V, ' - ggQ53355555ggggQ5gltgggglgggggwgfw331555135251.WL...HWHW.H.NK...HK..mw-.1.M-1U...H...mmnu.M.H.HL.,W..U.XV..mmH.Xm.U,NInH.V..mmmlmum.,.HXI.wInI.nn.HmH.K..Nf1H4mmMX.HH.myV.Wfnin,HlmInininmurm.HL..X1.Hn.HH.W..X..WinX..X..1H,X.,X....HminXK..num.mm.HInH,rm.HmWW.HH,wIn.HnuInW,WW..imX..mlmy1.1fm.mu1A1XL..mm.,..lmw..m...mnm.,.HWXWWmmy.IXmXmm,mmmymnu,mmmW.mm.mWmm..e55 x ,..., ..n,.. . ..,,.....,.... .. .,.,............... ..., ..,,.,....,...,,.,... , ..,. . . ,,. ,..,..........,...,.,,..,. . ,,,. ., .,,.,... .. ..,.,,,..,,,...,..N..,..,..,,......... .,..,...,. . .,.-.H,., ..,..,,, .....,.,,..n..,.. , ...,. . .. .... . ,... H... . .,. ,,,.,....... ,....,u..N..,,,, .,......,..,...,.,.,. A ...,..,....... . ..... . ..., .,,..,,,, n......... M .,,...,.,..... . ..,.,..... , , ..... ..,..,....,.,,..,.,,. M.,,,..,..,...,.-.....,...,.,-. 3 ilKIIIIKIIIAIIIIllllll!IIIWIIIKIIllllIllIIIKIIIllKIIUIINIllIA!IIIKIIIIIAIIIIII!IIIHIVIIillIIIHIVIIIII4IIILIMIIYI!IllillkllHIUIHI1rllllllInVllIllH1illUIKllllllllmlllllIllIllIllIllIllIIIIIIHIVUIIIUII1II!IIIIIIIlllllrllUI!lllKIIVIIWIIAH1IIIIIIWIIAKIHHWVIIIlllllillHILIIIIllKIIVIIYKIYKIIVIIKKI4H!IIINIllIHLlllllvllluiIIINllNH1IllNllllmvlNIllIllVIIIII!lllVIHIlullHIIIIIHIVIINlllllllllvlllxlnlllmVIINIllIll:InIlliluHIVIIAvllNIMIllInNII!VHKIVAIHH1MHlllllllIII!IHIllHHVIINVI!vllHHI!!HI!IIAH1VIIIIllVIIANIIVllllllllllxlllllluuvluulmmlmummwln: Page 63 E , -.m,,m.,.m.m,mnmWmmmmumIn:wwwr-wwvwvww1rurw1vHwv'1H'1'IH'H1'I11'I1'H"H"H'H'"''WW'"'"H'"'"''"'"''"''""H'"'"''"'"''"''"''"''E''III'!I"!IfllfffflllF!!Tflflflflf5531FII''I''ffT!!''WllffllY!!IlflfflFEI!!!Y!!'E!!'53E!!'FifiI!UH'IllE!ff!!'fflF!!IEE!!ElfIE!EffflfliffE!!I!!f5!ffElIllElfIEHEff!!!F!!IF!!flfllffflf1251EffElfIlfllffXIII!!!ll!E!ll!!ElfIlil'51I!!Ifl!iffIllTfflYflflllPIIflfIEffE!!1551I!!llllllfE!!fillElffl!U!!Effffl!f!!If!ll!!U!!fl!!Eff!!!!!!f5!1!fflIUflflfflI!!ll!!UHI!!UlfEY!U!!l!!fF!!l!!U!!""" 2 g5,..m,....... ..... ,.....,.,..,.. ,.... ,M ...K.,,.., ,W .,L. , ,.., ,. .,,..,,.,,,..,..,,,..,,., ,..W ....,...,..,,,.,...,...,..,,. , EES E22 EEE 2 EEE Ei? maize:zesuzrfgzzgn2513112535gmgggqggggglgggg115115551M3555gggiggggggfggmf53:5wg3gmmg31,5555,1551,5155355My1,5w,,,5,,1,55M,3,mfan,Em2.55233:Egn..,.mm1.1W..,,.,,.,,..,..,YW.H.......,,.N,..,..,...U,.H.,..,...,..,,..,..,.H,..,...,..,..,,.....,.....,,..4nw.,,..,..,,..,..,..,,W..,,..,.,,..,,.....,,.,...1..,,.,...,...,.....,mmM.,,..........u.,..,,.....,....,.H.,,m..,..,..,..,u.,.....n...........,,.....K...,...,.,......,......m....,..,...K...,...,m.....5gg llluVIII1InumHHnnullNiluWIllNLII!KIHNIllVII!WIllullNIIIWWWIllWHINIllNPII1VIHHINHMHI4IIINH11ulVIIHIHIIIHIHIIHII11IllrlVN:IMulul1VHNHANIAHI1HAVIINNII1H1LIN1ll1IIIHINrl!Nll1VIHIINillNInHI1HI4HArll1VII1VIAVH1IIANIINIIMIIHIIHIMIIHIN I 4-wma W-mm MW WWI! nmiwin -mNWN-'HMM'-gmuwlm I I mum1wIninwn1ulwuwnmuwnninwfumfmnlummwmmlmmfl1fnnumrmmmwInnuInmXHXInmlmIninwInmuuInvmInumm-mmnmmm Page 64 mmmmmm1mmvmInuvmmunnmlwmmw-mmmmlnmmnmwlnzmummflmmlwnmwmmf QUIIIWIIIIJIIIIHHHHlllNIINPIHIUIllWIlWIITIHUIHUPIIHINIHllUlllllNKIM!!ll!Il4NllHIHHIll!llUINH1HIMHI1HINll!VIHIMINll!NII!VIHI1NINNIlllllU1NllHHVIINIHIIHIDIINIllNIWl1lIiH1NIllNIHIlHINlilVIWLIIUINWNIHllWNVIWIlWNI1WIHIIIVIHHHHNIHH1HHHHHH11NIHVIIVIHIIHIIIllNNHWIHHWNllWNI1VIINllNNI1NNINIHVIWIWMINillNIllill!llUI!WillHHVIIIIIHIINIIWIHIIE .2 A - E E E E 1 . ' ,.. - E E 55.3 '.'1, ' - Hi' f -X ' E E E E E E E E 3NIllVHUINIINIllIHIlllllNIllIIHIHIINIllIIIUIIHHIUHKHIIHIllII!lllVIIWIHVIHIIHHIIIIIIHIHINIHVIIWIllIHillIIINIINIIIVIINIIUHIIIlllNIllIHIIUIINIlNIHVIIVIINIHVIUIIHHIllIIIUIWIHFlllllNIINIIIIIINIINll!HHIINIHNIlNllNIllIllNIINIINll!IIINllNIIIWIINIllHIUHIllWIINIllillNllNIlNIHillHINll!HINIHUIWIllIIIUINllNIIINIllIllIllNIlNllNNIllII1IIUIINVIINH4ll!VIINIIHIIVIIHIHIUIIHIUE griculiure iiiiniiiiiiiiminiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiniiiiiiiininiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiiniiiiiiiiniiiiiiiiniiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiiniuiiniiiiiiiiiimiiiiiiiiiiiiiimiiiiiiiit iiiniiniiiiiniiiiiiiiiiiiiiiiniiiiiniiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiimiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiininiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiniiiiiniiiniiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiy 5 5 ess ssh 7- 1 r Agriculture and the War By Dean H. L, Russell cc ERVICEH was the watchword of the NVisconsin College of Agriculture in tl e war. The entire facilities of the college were placed at the disposal ofthe State and federal authorities. From the'Colleg: Halls 553 students and 18 memlters of the faculty joined the colors. Three of "our boys" won the Croix de Cuerre. Twenty-two men made the supreme sa- crifice. The memory of their heroic deeds will be a flaming torch. bequeathed to us to cherish so that the sacred fires of patriotism kindled by them shall never die down, but burn with undimished brightness as the years increase. The Agricultural Extension Service of the College in cooperation with the Federal Covernment, and the State Council of Defense, carried on vigorous campaigns for the production and conser- vation of food. Members of the Department of Home i Economics cooperated with the Federal Food Director and the . State Council of Defense in j arousing the women of the state Q ' to the needs of the hour. Faculty members released from i teaching voluntarily took the Field as county agents, demon- stration and emergency food agents. Farmers were assisted in securing labor. The director of the United States Boys' Working Reserve was aided by the county agents and members of the faculty in a campaign for lnoy labor on the farms. Stua dents of the college, too young tojoin the army, were found in the furrows and fields doing their part to help win the war. Special campaigns were car- ried on under the direction of the college for increasing the acreage of fall and winter wheat, the production of milk, and the saving of dairy calves. Farmers were urged to increase A 4 their acreage ofsugar beets. and thus aid in overcoming the sugar shortage. Boys' and girls' clubs were organized, war garden associations were aided, and county campaigns waged for the formation of sheep and pig clubs. The record made by the Wisconsin farmer in livestock and crop pro- duction during the war is an enviable one. The college is proud to have aided him in his work, and glories in his success. XVhen the his- tory of Wisconsin's part in the war is written, it will be found that the college and the farmers of the state met whole-heartedly and loyally every demand made upon them by the exigencies of the war. i i DEAN I-I. L. RUSSELL :yngiwiiiimiiiywiiyiiMiiniiiiinqwimgminminiiminimuiiiiinumiiviiiiiiiiiiminiiiiiiiimininnuminimiiiniiniiiiminiiniiinuninminiiniminniiiiiiiiiiimiiiiiimniminiiiiiimiiniiiimiimiiniimmnwniimmiiiuimiiiiniiiiiiiiiiiiiiwiuiiiiu imiiiiiiiniiiiiiiiiiiiiiuiiiiuim, 7 - ---- - ----4 -4--------------M ----......---...................-.--.,...,..--,.-,...,-......... iiiiiiiiiiiiiiiiiiminiiiiiiiiiiiiiniuiiiiiiniiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiniiiimiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiimiiiimmiiiiiiinniiiiiiiuuiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiminiiiiiiiiiiiiiiiiiiiiiiiiiiimiiiii iiiiiiiiiiiiiimiiiiiiiiiiiiiimiiiiiiiiiwiiiiiiiiiiiiiniiiiiiuiiiiminiminiuiiiiiiiuiiiiimiuiiiiiiiuiii iwimiumniimiin. Page 66 mmunwumumm1vmnwwmwnlml1fl1wmmwuuuwm1-ml1-1+wnf1InIn1H1m1U1wInuwnv1--1n11Hu-1nlmluf1Inm1mm1H1Huul1-Iu,I1w-1u.1uufulnlmmmwlwwmHmmm 1nmmmm.Hnwmnmnu I 3 MAIIAIAn,..,,,-..M.l,4..,,.,u 1 .--A-. M ,UIHMIAA ulullullullu ullxnul H H A .y , Mw...W .,,. Wm... 4,.,, H ,,,.,,..,.,..., ,,.,Y,.1,.,,i. , ,.., X .,,.,,..,,.,,. .,,.,,.n..,,., W ,.,,. U.. ,,.. W ,.Y.., ,. ,Y.., ,,,,.,,...w..U.,,,., ,,,.,. W ,,,,,..,..,,. , ..,,.. ,,.,,..,,..,,.,,., ,,., ,mm ,.., ,..,..,,.,,, .Y..,,.. mm ..,.,,...,.., H.,,HU.W,,HY..WW..,...,.MWWH,,M.m..4,..w.,,..,,.,,..,,.,...,,. ' is ali U si? w 2- . ,,.,, , 1 : ,,'f1 5 535 2 2 Z , df sg E , is I ,lr -- .n, ii . , ,- -' , Nu. ...Lf:,M..u:Lsw .5 -f , .W ik V 'AGRICULTURE 1 AW, : Q A pl 0 -JR -. As-sis+a.Nr Dmaxx ,,, 9' 1 l ,: eva? AETXC EE -,, 23 5,5 S35 Sai S23 325 '32 as gg: 55 E ' Z2 E 5 5 ' 2 2 2 52smn-m.m1W....u.,.4awww..,..w..w.14.WM.ww.mw-.wumwmmn..m.mm.qmwwmwMy.H...WWyn.W.nm.m..m1m.m.w..,..m.n1N.HV..Wnumm-....MH1.NmXmmmWnuI.,MH..mmmnu.W--mmm-.wmv.-4.Umm..u..WH.H.unww..I..W4..-.mWU....Mmm.,,.m.mm.w...w..m.,.m,u.....u..mmmmlmmxmvmlmmmwmwmummwmmm55 Sum-umnmmmmrmuummmmnnuuummmnummllmnlwvmnnmlmwnilmm,mmmmm.mummmmmmmuumm-nmmmnlan-.mmummlufunu,mm.HH.nmW-Inmlfmfm.mm....1.n...m..m.m..M.1...mmm..mummmmmnmummn-m.m.mmmmyuWummmummmmln-ww-.wmm...mmmmmmmmmnmummmmU.:ummm-mmmmmmlmlmmlmfmmln-lmmlwlmmnwmi Page 67 "'A' :untill nmuuw E WU' 2 vunuff 5 Prof AS AXexe.ndcr Vaierinmy Scwrxce nnumm..mnW.un.ml.,,..m.,.,.,...w., l,., W.....,,H.,K.,WW.,H.,N.f..,...,,.m.,,..H.m..,..m ,,K. ,,H.,H,...1H.W,,.,K..,WK..,K.,U.,,.,.,.,,......H..,.., l..,..,,. .W..WInW..,W,..Wm..m..,..,,...,.,,.. w.., H.YH,ww.nmW..H.,,..H.,,..,..,,.m.,...,.., ..,,., 1..,..,,L.,.HY..,,.,WW,.,,.HH,,H,..,H,,H,.Hmy..WH,H,W..,,mm...WY..YH,.Hm,mV..Km1.WW.Hmy..Y.HH.fuY.U1.1.N..NvmHW..N..NN.1,....HmN.H..,..,,..1..,WH.,H.mm.unm...mlWm..Nnm.,.m.mm.mm..1..,'..u.u..,,.m iz 1 ii 5 si gf ge 51 5a...,...,....,...........,,..,.,..,...,....u....,..,...W.m,..,K...,..,,..,,...,m,...,,..,...,,..,K.., 5 ..... ...... . ..,,,,.,,,,,,,,,,.,,,,,,, M ,,,.,,,,,,N4,A-.. llrhll u -llllnxl A rhrll ....,,...,.....,.,,,...,....,.,,...,,... , .....,..,,,.,,.,,..,....,..,,.,.,.....,.. , ,,,,......,,..,..,... , ..,,.n..,,..,...,..,...,...,..,...,..,,..,..,...,,.,,.,...... . ..., .......... E ,,,,n,,,,,,,,, , .. ..,.......,..,.,, , ,.4,,, , ,,,,,,,,,.,4,,44,,,,,,,,,,,,4,, W ,,,,,,,,.,u,,4,, I ,,A,, H ,,.,..n.-,n,.- 1 llnllhv WW -lln I ..--s M , ..,..,,..,..,. . ,..,.. ,,..,..,...,...,.,,.,..., ....,.,,. . ,..,,.,.., . . u..,,.. ,..,...,..,..,.. . ,,., ,. ,,.....,. H . ., ,,.,..l...,..,..,,. .,..,.,..,, U ,..,,....,.., ... .,.,..,..,,.,..,,.,..,,.,,,... ....,.. .. . ..,,. n.n. ,. ,.,.. .. ., . .K.,....,.,..m..N.NK..,,...,...,...u...mm.,N,.mm...W.MH.WH.,,W.,.W..W.H.,un...HW......,,.m.,....,.....4H.,,...,.....,,..,..m.u..,... U -- ---- .... --,..-:L.-.,...' WL..." .M.L....' W ,.P. . ..- ... H,,.,,..,...,.UIn,...Km..,H.,K.,H.,K..nn,...l.m..m.HV.,..,,.H..,...4..,..HH.,..,um.,Km.H...1..W..,1V,H.H.....11.1YH....,..,.H,HW.,WmM.....,L.,.m..,....HU.H.Uu.......1,H...H..K.,um.,....m...i.....,..NH.,..,1.,H.....m......,.HK.....W...lN.,,.m....m.,..,..,I.,..,...,....,.,..,..m.,.,..,.,...,..,..1...m.......,.,....,m.m.....,V P a g e 6 8 51 me 2 E E E 3 Z 2IHIllH1VIIPIIWIIWII4IHIHVIIWIlWIIWIHIIWIllHIHIHIWIHKIHIHIITIHIllIINI1UIWIIWIIHI!IllVIIWIHII4IllVIIWIHIllIllIHHIHIIIINIIIVIHIHIllIllillWIIWIHUHIHIliillll!VIIWKIWIllIliHllilllllllllIllillIllHIVIHIHIINIHVIINIINIllIllPIUIllIIIUINIllVIIUIHIMII!IllIllVIINIINIIIIIINIllNIINIHII1PIINIIHIHIINIllVIINIINIllNIINKHillNIlllllNIHIIHIINIHIllNIINIllVIHIllIllNIINIHIIVIIVIHIIII? Igngineerinc !IIIFlII.lI!llIlllHI'llIllIIIlIUIHI4WIllHHHIIHIIHU1HNHUI!ll!III!HNH1lk!NIHlilillHIHIWHHIHIINVHHHHbilHIUHll!NHNHNVHNllNEHNINIHWllNllNllNH1ll!NKHNHN'llIUNl!NHUIWNIlWVNllWIINUIIHNVIIVIINIllH1HIHHHiNIIHMIIINllHINLIIHHH4VII!LINHI!lilNIUI1NIHIlNH1NIUII1NI1NIHWHHVI!VIINLllU1NVIIHI4H1UHVHHUIINUI!IIWWll!FINVIIIVIIWVIINI1HHNIHIIIIIHIIUIIHIIW' E A , .rzmxi 2 5 E 5 E 5 E 2 2 ui .ii ii niiiiinumiimiiminiwi mn im ii ii imimimiiiiiiiiimmimimiim1limimwmiim-iimniiuiimi iniinimmininmimimiinniiniiiiimmimiiimummiiimmiiuiinlumlmininmimlm,iiiiummiuiiiiumummuiminimumumnmu-uiimuinwwiniimimuinuimuiwnimuiuuug , mnzamaazai,..,,..,..,,..,,.,,.., .. .il mama. i..i.Hini..i.H,.,i..H.,..,imamiaamzazasiammi-..,i ii..K..H.,ml,mmi..i..i.l..,...,.,,animrf.,..aaa5amamnemmm:.na.n....,..n..m.i....,l.a.,m..........,..i.rg2g sz- 31: 512 zi: si: .E if EE . .. ' :E Engzneerzng After the War if By Dean F. E. Turneaure :lg HE great warjust ended has obliged all fighting nations to utilize to the utmost their material resources, their transpor- tation facilities, and inni merable products of invention and 55 researchg and for the successful utilization of these resources the physicist, the chemist. and the engineer have been in great demand. ji Young engineers who have been trained in the schools of this country EE have most emphatically made good, and the training of such men both I' preceding and during the war i constitutes the chief contribu- tion of the engineering colleges of this country to the winning ofthewar. Theyounggraduates ' of these schools have shown 1 great capacity for special and l intensive military training, and E the broad, fundamental courses - which have been taught have been found to be satisfactory. , These same general courses, ' I condensed about one-third. were continued. on request of the war department, during the X operation of the S. A, T. C. Besides carrying on the regu- lar college work, the Engineer- ing college has had a large part H in the vocational training of 555 about two thousand mechanics m during the past year in fifteen different short courses. lX4any members of the faculty have as DEAN F' E' TURNEAURE contributed directly to war work by research and special investigation, and the College has furnished a strong quota of engi- 7,5 neers from its faculty for technical branches of the army. Problems of peace and reconstruction will call for an increasing number of engineers, and this university will doubtless do its full share in the 3 training of these men along very much the same lines as have proven successful in the past. ,- -'E LM,W..,W,H,i!..,..,i.,,.....,l..,,ii.i,.l.,,..,..,l.. ,.i..i.l...i., W., ill, i..i.,i.l i,.,,.,,...,i.... ..,il......,,iH.,..,,..,.ii.i,Hii..,.,...,..,...,.i...il,i..,l.i,.i.W.i.,,,.....,,,..i...i..i.H.,.,,.,..u.l..,..m.l..l.l.W,l.w,..,.iiQ 1iniim......m.n-.iiiii-ii.iiwn..mmii.im in iiw.m.ii.miimmiwiimmiiimii.iiw.iinuii.1ilii,.ii.w.wii.mm.in inVmm,wwii.1iiiiiimmw.mli.ii.,minimm1liinlmiii.....i...,m..i,.i.4iim.m,m,mi...mmm.-..i.iimni...mmmi.iim.i.nm.m.i.Wmm...m"m'i.nmm ii Page 70 awww.,.n..wm..fW.mnmlmHvm1.mm..m..1my15.mlH....gf95mmm555MM15559mmmymlmmfM5MW!3wwufwwwMM,,mmgH.95.u..u.H.U..n....,m.i...u.v.,,...m...w.mmw..Nw..VW.W.,mm.,,.w.m.w,mmfmw..m.1fm.Ummmmmv.mm.m.vmumm.mmwmm..mnymmmmmumnmmmmmmnmmmmmmmmmnmm 'i,..A..,.,,...,,mimimnmm..,,..M..,,u.,...n."'.....,.,.K.f..,,,....m..m.....,..,..,....,.,.......,.,.W.,,...,.,,.,,.,...,,.,,.....,,,,,,,,.,,..,..m....,,,.U.,.....,.u.,..,..m.,,,...,,.,..,U.,..,,,.,,.,,..,,.,,.m......,,,.,,.,,......,..,..,.,.,.,,,..,..,,.,,,,,.n,.,,..,.,,,..,ms:sis:mx:zzmmm1:max:msLamaLzsmnzazaaszsszn51:5n:mmspzznnwxssnaazaznaxnaxs::r..7.4:..T4.T..""',u.....u.,..,a.,...,,""""..,.,,........m."' ....,..,., .mg e sig , I E15 EE ESE E :ge E Egg EEE E E :E 5 IE 555 E . E-E :E EEE S Eli 5 E EXE EEE Eli ESE :ga 525 E55 EE :va :XE 5:5 if E , :QE 25: E55 gg? E55 E E15 :SE - . Ei? I 525 : s I fri 45 Eng SEE E - Ei? EEE EEE EEE E25 as - 2 2 E32 !'-V -"v -V EE E' I . . N- "1 - J- ' El: Egg ' ' - , " 4 ' , , :fi 1 J - -- , ' E55 -f NGXNESRING ' ' 1- Egg 17,5 ' r .:, ' . - X -' J:,.., E 2 sis Y' J ' ' I ,. ' ' ' . V4 - N - 6 - EE Ei. ,, . . . , -- gn - I7 mn I, 5, SI N zv Q - g.-Q1 P iz: gg 1 , , ., Eze 515 'I 2 ' 5 Ei? as EEE . Ei? iii E22 sig 1, 53? N V xi- Q fb -iv? 5 Ei? EE EEE E52 2-D E25 555 -- ... M-- E25121252Ef!Tl1Il11"1lIi"'ll"""""""'""""""""""""""N"'"'"'"'"""'"'"''"'""""""""""""""'"'"""""""""""'"'"""""""""""I"f"ilIf1l!il!2TlIl21lf1fIfllffI1lfflffflllflffffll!iffIIfKill!!1lI'Clf1U1fffEfIl5fff!1If155llffflffff!!!Ylfllflfllfll!UEllflflfllf551151112KSU!!flffffUillffllfllfTIEEUTTHZEYIIIIUIIQUElfTTEH,'Z.'2TffMI."""""L'TT.'lf.""""""ffL'L """"""'4!" SmvunmmnmmuunmummmnmuuummnmmmmvumwundnmmunmmEimuwiiEIFuun?i1nmdluwniiviwummmvmmnummmuunummwmmuwuwuwul:mmnvummmmumnmmmmwu1numwuwnumummuuwmnmummmmumwnummnmmunnmuunumummmummuunummmummuummummnmm:mnmmmuummununu-mmumuulmummmmmlunumuwuumuml Page 71 WmW.1Wm,Hmu.,..mm.mlfm.Hlm.MX..Wmmu.,..,...Yy.W..U..W.muH.,K.,N.HK.,K..N.HN.,.Hmm,nu.HH..mm,,m..,...1.mm.m.m..w.,..w muwumI-1InwwwwImwwwI-HwwH1fuH-I1H1I-H'H1'HH'Y'HHHH1"1H'1H'H'1'H'"YH'"HH'f"'"1H'W"HH''"'H'"flE!!:lf2:2521r:!l!!:1:!l:!f5!!:!!l!!:5lu!!!!15!!!!!1:m!z:!u!l:!!!!!!H!!1fr!!!1!:l!!w!lE:1!!f!!!!1!!!.......,..,.....,...,,.,......,...,....u..W...,,..,....,,m...,...,..,..M...,..,..u....,..,,.....,...............W...,u...,......,.,..,......-:5 mm""m"""'"""'--''"'"'''9595955WWEf5wwfMMT5Em555335532595wM"""rr"1'r"r":"""7"M""':z"""z:7a:x::::asnzzzazzzzzanzzzzznaz::::n::::n:::azz::::::1:11:mm:as::::::::::::....,...,M.,,.,..,.....,,..,,..,.H,.........L.,...,,.....,,..,.,,..,K.......,.,.,,..,...,.,..,...,..,..........,,.,,W,,,..,..,...,,.,,.,,.........,....,.,.,....,.,,....,,,.,,..,..,,....M,.,.,..,...u....H........,..,...m,..,....m,.....,,m...,......,...,,....,...,,.m.,...,...,..gEE gg w.m..........,..,........,,.,.,,.,.........,,...H.,,.,.......,...um.,,..,M...,..,...,..........,,..,...,.....,... . .,,... . ...H ..,.,, ....,... ...K.....,...,. ....,,. . -.- :E EE ESE EE E25 El: : Ea? EES sig EE 115 ESE : : Ea E32 . - . E :,- - 5 5 .., ,.... ,W....,...,....,.,m.,.u...,... ..,. ..,,........., ,.,... ,vm,.,.W......yH..uv,m..,,...m,w1.,.,. ., .,,,,..1.,..,..,. ,L.,,.,,.m....., . 5,Hmm--.MW-mum..'mmmmmMMWWU mmW.w.w,.H . ,HH .11.mu.lmnu-mmmvmwInfumy1.HWm1numfmw.Hynnnm1ynnum1H1InlmIn1.1vmfukmrmIn1InH4numnlwIn.H1In.HH..H.Kmmrumm.1m,H1myHyunuI.1myrmHwmmnumfmm1--um.mw.,ml.H..m.wn..1mmm,V.....fm...mmmMmm..uw.um..mmm.m.m.mmm-mm 235 smmmmmmnmmmummmmmummumnmmmunnwInummnmnuInumm1mwmwInunwInummmummmm:HvuwunIninumummInununInnuummmmmmmmummmInumI ' ' H H1ulNIllNInlllullill1InnuInullluull1H1rlmunum1InlunumnnInluulwnlumnnlwlmInvunumsuNllvllxrllrlmuullIllwH4lununlunulul1ll1llmlvu1umumNllmymul!mmullInluulunlmlmlxvIuunmxllnlmmllmluumlnummllHlxmlllulxluwllnnunmlnululmmnmlllmli P a g e 7 Z gmmllmunluunmsmmmmlmllmllummumm:mlrmvmmrnnunwmnumlluurzlmnnrmllummmnummunummmwlwxslxnwHvnmmmmmununmmunrrmmuummwmluummmuvmlmvnmulvlummmmlmnmwuuzwmuunumwllummmunnmmmmmums:mlmmnmluwnulmnuluumz 5 E gg 2 E gllillUHIIIllllllIIIVIIIllHINIlllllllllllllllUIllllllHIUllIII!IHIIIIHIllIIIUINIHIllNIHIlllllIIINIUHHHVIINIHHHHHINIlNIHIllIllUHIIIUHIIHHHINIIIIIHIIVIINIHIIHIIHHlllll!NIINIllIllVIINIUIliIIINllNIllIIHHHIIHINIINIIIIIIHHIllNIHllillllllWIllllNHHIllillWIINIllHllllllllNllNll!HHHVIHIllNIIIIIUllllllHHIliIIUIllUUIUIllHHIllIIHIIHIIHINIllVII!IIHIHlI4IIHIIHIlf La E E: 5 5 E 5 E ,n,,,. i ..... , ...M l....m.i ......,...,,,,. ,Lu,. im... ,..,. ,W ,...,. W .K,..,..,,.,. l n,.. W ,,..,,..,, N ..,,.,...,,......,.,.,..,L...l.,.,.,.,,,,.,,..,.. H .,.,..,,.u, .i .,.,, W .,,.., . ,.n..., 5 .,n,.. .H ..,. n.........,,...,..,.,,..,n,nnu,,. 1, HM. ,..,.,., ,..,.u..,......,.. i.m.,...,i..i,i,.,...A 555 Law After the War By Dean H. S. Richards NLESS the forces of disorder loosened by the war destroy our civilization, we may reasonably look forward, as a result of it, to an accelerated emphasis on state control and state super- vision over the activities of its citizens, a tendency already well marked. This will in turn mean extensive and complex legisla- tion, and the multiplication of governmental agencies. If this govern- mental control is to even approximate the hope of its sponsors we will require intelligent and trained leadership. In short, the need of trained men on the bench, at the bar, on the administrative board, and in the legislative hall will be greater than ever. 1 The just and wise administra- tion ofa modern state requires something more than good in- tentions and a ivillingness to hold ofhce. Knowledge comes through study and training wisdom through knowledge and experience. The law schools can best serve the coming era by in- sisting upon a thorough train- ing in the principles of law, superimposed upon a broad College training, The greater importance of international law, as the result of the peace conference, the need of some knowledge of other systems of law, as the importance of our foreign trade increases, will require attention to these subjects in the law school curriculum. DEAN H. S. Ricumzos The great war was a battle for our Anglo-Saxon ideals ofliberty and law,-won for us slowly and painfully by the blood of our forbears, and now preserved for us by the bloody sacrifice of our sons and brothers. The path of duty is plain.-to raise up a body of enlightened and trained men to defend our heritage, and lead the way to better things. miiniuiiiniiiiiiiiininiinmiiniiiiiuiiiiiiIiiiiiininiiiiiuiiiiiiiiiiiiniininiiiiiiiiininiiiiiniiiiininiinniiiiiininiiiiminimininmiininiiiiiiiininiiiiniinuiiniinininiiiiinmiiiiniwiiiiniiiiiiiiiimminiummiiiiiiiniiimiimimimmiiinummmiiiiiwmuimmi-limiininininmymiiwunmiummmaF E iiiniininiiminiiniininiiniiiiwiininiiiiiiniminiiniiiiininiininiiiiiiiiiniiimimiiimimiiiimmimiiiiininimininiiiiiiiiiimiiiiimliiiiiii?iiiiiiilimimminiiiiumiiiiiiimmi iiwiiiimii mil in iiiuimmiiiimm imiuinimmimmmi iiiiiiimim fum mm miiiiiiiiiimmniuniwmuinimnunmnini. Page 74 M H .1 mn munmmnuml u ummm.mmmmmMIWInmm1rm.-ummvmmmmm1nfInwnmywwwmInWmmyV.1-.1in1.Iwwu1.11ynm1InW.1wulmwmw1Hfnwlnlmmmn-WmH+mmwmmwmmw1.1wnnm1Inunyu1InXuX.IXW1Inul1yurmWm1muunuunmuuunummlmmfl1Innf1m1IHrfuvuH1uInwInvuumwHwufuuuwX1rvnuIn1ImInnumwnumunuwunnvmuvunuulmum- HnmnnmunmummmrmmfummmmumInmmy1ynvmmummmnm-mfumwmll -K ui In 1 4 I r I EM" . ,.,.....,..,....,..........,,..,.,.,.,......,.....,..........-.,.,...... ,..,.-......,....,,....,......,.....,...... Timm.1rmmm-..m.4,..muL.,XW1inV.......W..,W..,m,..-1H..m.m.1.HV.,XH1V..W,-.WH-nw....H.U1.111.1vw.-n.mm..v.HH,.1H..NWW1.1H.WW1H.HH.,..,H..WH1X..N1.mm.W.U.H.H..y..WW11.1X1.NV.NH.Hw...m,mm..1..H.m.Uw..m.W..1..w. 'N w F """"""""""'"W"'T""""'""i"""'"""""""W"""""''Q""""""""""''"'""'""""'"""""'T""""""" EE EE EE sue EE g , E 2 EE E E. E El? EE as if Eff EQ! 1.1 r f w ,, f EE X ' EEE WHPa. e Q, ? Q. , M. ' X dex iii QW of O ' SEE E22 :f5.1.1m11.1V..H.1k..m...1V.,km.....MH.I.....Q.Hkm..1.HL..H.1...W,....HK..W--IH.1..1..1...,m....m..1fnV.,V..H.mf1.H...WK..V..H.L1X..,H.,y.,.UW,.....,..,..,,..W..1.....1.H...K..1-.1...WV.1V.,L.,...WH1.N..11.H1.1..1.-..-.1.11my1-1.H.H1..1H1.11N.1NU.,InL..H.1K..H.N.H...H.,..,,.,.....NWW..N,HU.,..NynV..XHX.HN.y,K.,L..N....N.H...1...V..,..,..,,yHy.,y..N..,...V..,,..,..N..,y..,..,...HNN.....AN.....,V..H.,W,.NV..V.,W..,N..,V,N.UV..,V.W.,V.,...NV.,H...-...,,H,..,...WWN.U...W..H,..,.mm..,.m.,...,m 5 5HmmuiHIREEiBMW?iiEhmmEiiEii?iiRii1iCGii1EiGEMINI?iiilii5135556IIIEHFIGIGIMIMIEEIGHG?iiiliiQi!iiGiiEiGiRiIGGiEiiREEiGQRILZIGIQEUIQRIQRIQQEFGSEIEIGRiilRiiRERQISEIIHIREIGIGIGH?EIGIIEEZGIKEGQRIDIIGiRIREIGRIREEIIGEEWRIQIIIQFIGEiEIUIGEIEEEZQEISEFKIQIESIQSIHill?RIRIIRXIEEZZEIQIESEIQEIIFEZHIRGIIIERZGEEEIIEEIEIGREQEIQIISTIMEERIIQEIEEZRIGEQEIIQIGEEIIYIEliliiiGilE?G21ii3QilGi?RIRIIQGRZZREEEREYQIRIRIIREIIRIIRZRZGEIIGIHumwmlmmmf Page 75 in III I I Ii I I I I I iniiii iii iiiuiiiriumiiiiinni in I I in in ii I I ii I I I ii iuiiuunumuum ian: II I University of Wisconsin School of Music Faculty MILLS, CHARLES I-I., Mus.D., F. R. C. O., Director and Professor of Music PARKER, FLETCHER A., Emeritus Professor of Music TDYKEMA, PETER W., M.L.. Professor of Music, Chairman, Department of Public School Music JONES, IRVINC W., Asst. Prof., Chairman of Public School Music Department TOWNSEND, LOWELL L., M.A., Assistant Pro- fessor of Music GELTCH, VON, WVALIIEMAR, Mus.l3., Assistant Professor of Music JONES, JOSEPHINE, B.M., Instructor in Voice Culture " On leave of absence l9l8-IQ. In XV. B. C. S. CAMPBELL, LLICILLE, Mus.B., Instructor in Pianoforte CRANE, ALICE, BA., Instructor in Public School Music EASTMAN, IRENE B., MusB.. Instructor in Organ and Theory GUNDERSON, HELEN, BM., Instructor in Pianoforte SVVINNEY, EARLE E., AB., Mus.B., Instructor in Voice Culture YATES WMT E., Instructor in Band Playing and Orchestral Instruments CWood-windl, Director of Regimental Band BEANIE, ALICE, Secretary to the Director The University School of Music has made very rapid growth in all its departments, at the same time maintaining very high standards. The faculty includes men and women whose training and experience is of the broadest kind from a literary as well as a musical standpoint. During the past year many changes have taken place in the personnel of the faculty. In the piano department Miss I-Ielen Gunderson of the University of South Dakota succeeds Mrs. Doris Carter Peterson. In the voice department Mr. E. Earle Swinney of the University of Illinois succeeds Mr. Ernest Chamberlain, and Miss josephine jones of Emporia State Normal School, Kansas, succeeds Mrs. Minnie Eergman Lupfer. Miss Lucille Campbell, a graduate of the Uni- versity School of Music under Mr. L. L. Townsend, is succeeding Leon L. Iltis in the piano de- partment. Mr. Wm. E. Yates of Western Military Academy, Alton, Illinois, is Director of the Regimental Band and instructor of orchestral instruments, Succeedingj. E. Saugstad. Mwrgwm IIIIIII IIIIUIIIIIIIII I I I II I II IIIIIII I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I ii I II III I ' IIIIIIIIIIIII ww II Page 76 EUII4VIIHIllllIHIIIIIUIHllWWIlIllWVIHIUllUHllWIHUILUUHIIIHIWVHNlWIHHHIllIllVHKIWllWKHHHIIHIHIIIHHHWHWVHWHHHVINU1NYIUI1IllUIHIWHUllNlllNIIHI4VI!HUNIHH7IllVIIIIINIllVIIVIINVUVIINIHIHNIIUHVIINIHVIHIINH1NIlNllNIllUIHINVIIIII!VIHIIVIHIINIIHIIUIN IHII H IHIHIH N II II WIlNIINVIIVIHVHHIWVHVIIIVIINIHVIIWIllH1NHHIlHHVIINVIHIIIVIHIIHIMIIHIIHIHQ E 5 E 1 :P 3 gliIIIIllNIIUINVHVIIIllNIHIIIHIVIIUHVIIVHNlilIUIllVIIVHWIHIHIllWIHllNIllVIIUINVINVIIWIINllNH4IIIH1NVINVUNIINIHIHHHHNVINNIlNIHllNVIIHIUIWIIUIlNllNIIUIIHUIHNIlNIUIllHIUHVIWVIINIllIllVIIWVHVHNIHVIIVIHIIUHIIINIHIIIVIIHINIIUIINVHFIIVIHVIHllHHIIIUIVIIWFUHUIUlllHHVIIHUIllVIINIHIUIHIllVIIHllIIHIIHVIHIIIIIVIIIIIINIHVIINIlNIliVIIUI!UIHIILIINKIHIHIII-E Medicine Jiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiwmniiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiiiuiiiiiiniiiiiiiniiiiiiiiiniiiiiiiniiiiiiiiiiiiiiiiiiniiiiiinniiiiiniiiiniiiiiiniiiiiiiiniiiiiiiiiiniiiiiinininiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiiiiiiiininiiiiiiiiiiniiiiiiiiinniiiiiiiiiniiiiiiiiiiiiiiiiiiiiininiiiiiniiiiniiiiiinuiiniiiiiiiiiiiiiiiiniiiiniiiiiiiiiiiiiiiiiiuiinun JiiiiniininininiiiiiiiiiininiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiinininiiniiiiiiiiiiiiiiniiiiiniiiiininiiiiiiiiIiiiiiiiiiiiiiiiiiiiiiiuii miiiiiiiiiiiiiiiiii will mini iiiiiiiiiiiiiiiiii uiimiiiiiiiiiv iiuiuiiiilimiiiiiiniininiiiiniinliiininiminiiniiiiiiiniiiiiiiiiiiniiiiiiiiiniiiiniiiiiiiifiiiiiiiiiiiiiiiiiiii Cflfedicine After the War By Dean C. R. Burdeen HE importance of medicine for successful Warfare induced the government during the war to take special steps to keep medical students in school and medical teachers at instruc- tion and research. Medicine is no less important in time of peace than in time of war, The war indeed has served to emphasize the need of more efficient application of medical science to the preventive cure of disease. ln the movement to bring this about the medical school should play an active part. As soon as facilities can be provided the work of the medical school should be extended so as to in- clude instruction in the clinical branches, It will take a con- siderable number of years to develop adequate facilities for giving the complete medical course under the auspices of the University. It is hoped, how- ever, that when instruction in the last half of the medical course is undertaken it may lte undertaken in such a way as to 3 be a distinctly helpful factor in the movement now under way la -A- toward the higher standards of health and bodily vigor in E13 Wisconsin. Meanwhile the new infirmary at the University will enable us to care more adequately for the health of the students and the Bradley Memorial Hospital will enable us to study problems DEAN C- RA BARDEEN of importance in the control of disease. We have been fortu- nate enough to receive 315,000 -is from private gifts for the erection and equipment of these buildings. 1 The constantly increasing number of medical students is taxing our Ji resources to maintain our standards. The capacity of our students wg for work is shown by the fact that they even did good work during the recent S, A, T. C. regime at the University, 355 Qll E Q 5 1inmlmiWi.wwwwgwiwEWMMwww..iiniwiii55,fiiiiwiWilinifimiimlmiin.iimi..iiimimiiiim1.i...mmi.winimiiii.iiinimiii.iiiiimiiiininiiniii.mm.miinmiinimiii.iiim..miimmimimiiiiiiiiiimmiimimm.,mi...uimiiiimmimiiimiiie45 .imlminimininimm.ininimii.iui...iiiiuiii.mi.-iii.i.iiiiimimmmii.HFii..iii.ii.HTiiimi..miiniinim...Tiniiiiuiini.....imi..i..ii.iii.,. mmiw-iii .iimiiiiiii.inm.i.iimi..in...ww,w..i...i.m.i..W..i.iimy1...iim.,im.ii...mW.n,mmi.i.miimwimwi iiwimiiil ii.i,..i..m..i..,.m.s Page 78 2-Qm1nuvmmmInnwnumwIwumm-mmnwmmmwmmumwnfnmm.IHwnwInulWInuv1.11mmwunuwu1Inmwuv1nnummWI.1mm1nfnu1unn1H1Inmwmm1n1luwuwnwuwnwwInuwrnnnw.4vmulwI.wrnw11wInInin111wwulmuH-Iwmwnwruwufru1uwm1-1wmmumm'-mmmuuuvuuu-141I-1N11Hvu1I-11uuInwnunyuI-1m1uwyn1u1nl1InNuNIninVuwInmmwuumm-mmummmnmwmH1VH.fnuul1unwyunlwIn1nwInm1uluwmmmmmmfuulwm1mmXnwvu1InwulwInnlmnummmvmm'mg 3 5 :la 35 Ei - Menntmi sig Z EE EE A , Dv. Lararzkl and 1515-slshxuxiis Y ' Dag-,xW"l'n1Qn'i' 01' Hx:E::r:-57 1 QW f . I bhruc gui . s ,MEM Qfwfmj Ska ' W 5 a iii si? 3 5 gs Sl? 313 gg? E, ai? 3 ! 1 25 1 s E 2 sea is 2 5 Sh 333 15 555 3 5 235, LM...mnuwwummm--mmm-ummn-mmInumm-umuummmumm.nm.w..Hwww-.1-4-..uIn1.4-.1um..mmm-1.mmvm1.Mwma1vumWim-nwH.mM.wwI..ul'mm.mmwww-Anmww.Mmmmmmmm...1.11.Hnumwwwummmulummm.mm-.ulmwmmullnumuww-ummI..-...mlmmWmmmvmIn,.Nul..wmu.mmmmm,.Hmmnummu.,un..mm.4nu..nuXInmm,m..vmmmmfu5 gg S.n"""',...m.,.......W.n."""........u....mF"'M........W,mmmG..'-"M,..J"......mm:fv:n""'....M...H.,.nium1i1n:nm.amm.m.""""'..,.Wmm......4..'..v..mmmmmm57m,mm4...,.H...m..WH,.......WH,.,......,....,......W.H.HH..WH....WM.IWm..W..Ww............,..,...1..,H,,..,......,,.,..........l..W..............n...,......W.....W...un,.....1..W...........U..K..........u..1......,..W..,....m.,,,..,..,,....m..,.......u Page 79 9- nu r V W..W,HY..H...WV.,,..WV.W.UH.W..YY.1,.1WV..,.1Y..N.,YV.,V..H...HY..,K..H.H.....,.MK.,.HH..H.H.,H,X..,H.N.HN..,.HN.HV.,L..,K.,N.N1.1N.mnH,.......Af..,...f.m..,.....,.. .L I wmmYWYHYH-W-H-HwmmnwH1H-1H1Y'HH1HHH1H-1H+H-1I'Y1HW"HHH'W1"HH'HH"H'H"H1'"'"1"H'H"H"'''H'H"H"'''f''flH'"''x''iff'"im5221551529:ffEffuffrzfblflfsf1:51:lleffMilf!!lui5:11221ff!E1lffrlfflw5:4S!!!ff......,..,..,.,.....,..,..,,..N,,..4...,..,.........,.........,..,......,...W.M...,..,..4N.........,..,..,..........,....,,...,..,...,..,,.,...,..,.,...,.......,...,...m.., WTw5T!WfT95EWWMWwwwmifW'"T""""'""'::a':1:::1:::::zzz:azzzzzxzzaznzz:::::::zz:zzzxazzaqzzzzzzm1::z:::::::n::::s::n:::z::::::z:n::z:::515111111as5:1:::::.n:,..::zzz,nmm,za:,..,,.,,..,..,.,,,,H,.,,..,..,,..,,.,,.,,..,..,...,..,.,,,..,..,,,,,..,...,.....,,..,..,..,,.,,..,......,..,,..,..,,.....,..,...,...,N...,..,..,,..,,..,.........,..,K..H........,..,...,.....,,.,,.,.,,.,n.,l.....,..,...,,.,,..,W,.........,l.....,H.,U.....m....,........,..L - 55, ..,,... U, .nu,,,..,..,,. ..... M nn,n.........u,..,.,..,.,,,. ,,..,, H ,..,,....,.,,. u,..... ,,.,,...,,.,,...,.....,...,,,.,.,,..,,,...,., . , KJ Ei .. .3 ijyggggggggqgggggfggggglgfgflggygwgm3:31551532353551,..1...w..1,..1...mm.,H.W..wy.m.wm..m.1..mHmm.,1.1H-1..mm.H.w.,mv-HWmu1wm.mmumm.,.Huw.m.m.mm.mminu.u..lw..1...,..,...umm..mmm.n.1N..W,H,wm..m.u.mm-1W.mm-w--uminumm.u..mmm.,V-u.mm.mmmumXV..1.Hm,.Hm.W..w.w.,X..mm.,m.m-m..w,.lfNTun..,M9mLq5w1.111-Q::y5 g E -umm-umummmummmnmmmumnmmvmmumInml1.IwwIHWmmmmmnmlmuummWWHmmmmmmm-IumminnlwnnmmmmuummummmmmmmmmmmwmmmwwmilmumrnwwummmmuWumInmuwmnmwwuyummwummmifnlumInuuwmmmmmiumwlm.m4mmm-wummm'mmmmmummulummmmnmmlmmmlmlmmnulWmnInlm.41In1Hmlummm.mmfummuummumuumn:m1nmnnuun1nuwm- Page 80 :E 'E S :E El 1 X. -is El: -s -ig are 5: a i 55: is ,ig tai ??? 1111111 ,.......,..,.,...,...... ..,. ..,......-..s....,.. ...,. :111 Ee! is 55. ig. .S 215 ,Z -a 1i1 1111111111111 11 1 1111 1 1 1' 11'111111111111 1 1 1 111111 1 11 1111-11 11 1 1 11 1 1 11 111111 11 111im1i 1i1i111 1 1i1111111i1i1i1111i111111 ii 1411111 I Cphysical Education if PHYSICRLA ' uutcmero - ""' E55 ii ara :ss gi? 1 .., egg 1 I Al 1 I5 l E .Ii . Q TQE. JONES, Chairman of Department . . Track Coach and Baseball QQ GUY S. LOXVMAN, Director of Gymnasium . . Basketball Coach EE Joi-ns: R. RICHARDS . . . Football Coach HARRY E. Vail. . . Rowing Coach GEORGE BRESNAI-IAN . Cross-Country Coach H. H. HINDMAN . ' . Swimming Coach F. E. SCHLATTER . Gymnastics Coach J. C. STEINAUER . Wrestling Coach R. I.. DOUGHERTY Boxing Coach M. A. KENT . . Assistant Coach in Basketball and Baseball GEORGE I-l. HAGEN . . Assistant to Chairman , The work of the Department of Physical Education this year suffered, of course, from obstacles developing out of the war, but the aim ofthe department, to enable the greatest number of students to participate in athletics, has never been lost sight of for a moment and, on the whole, the efforts in that direction have been productive of much benefit. Considerable energy was spent unavailingly when the school was virtually an S. A. T. C. camp, as elaborate plans for inter-company and interlbarracks athletic contests had to be abandoned with the breaking-up of the camp just before Christmas, before the schedules could be commenced. In that it spurred the S. A. T. C. men on to greater par- ticipation in healthy sports, in anticipation of the organized competition soon to commence, the departments labors however, were well rewarded. The transition from planning S. A. T. C. athletics to the work attending athletics uninfluenced by the war was not an easy one, but the department feels that it has made the change as quickly as was possible and that the "athletics for all" idea at Wisconsin will again be in full swing before the school year ends. The physical educational staff gave of its best men to the country's war cause. Coaches Richards, football, Stein- auer, gymnastics, Hindman, swimming, Benish, cross-country, and Dr. j. C. Elsom, medical examiner and director of corrective gymnastics, all went into service during the year. 251-1 1 11 -1-- 111 -i1--1i11 1 " . ...........,...................,..... l "" .Lu .... ..... LJ 'f.J1....- ' " "" 'l' ' "" ""' L2 .I...1,.,.....,..,,,,, ,,,,,,jl '1ms1'i11. .,., 1111111.11 .,.. 111111.11 ....l.. 1.nm:ua1sm1m ,i.i...ll.il.,l..i..l, 1. ..i..l,..lil,.,,.,..l,,.l llii ..ii.l.li. 1 -1-li1iii 1 1 1 11111111 1 111111 1111 111f1-11 1 1 1 1111 1"'111'1'I11'111'11'11'111"1"11'11'11"11'111'1'11' 1 11111 "11 11'1 "'11'1"' '1"11""11' 1 1 1 111 1 11 "1' 1' 1111 11 1 11111 1111 1 11 11111111 111 1 11 11111111111111111111111 Page 81 11 1 11111 11111111111111 1 111 11 11111111111111 1 11111 11111 111 111 1 1 111111111111111111111111111111 11 111 11111 11111111111111111 1111111111111 11111111111 111111 1111 11111111111111111111 11111111111111111111111111111111111111 111111111 1111111111111 111111111 1 11111111111111111111111111111111 111 1 1 1111111 111 111111111111111 11111111111111111111111111111111111111111111 University Extension CDivision Stal? Personnel Louis E. REBER . ...... . W. H. LIGHTY . ......... . Dean tOn leavej Acting Dean W. H. LIGHTY, Secretary ..... . Department of Correspondence Study PAUL F. VOELKER, Secretary Cresignedj . . . Department of Instruction by Lectures R. B. DUNCAN, Assistant Secretary Cin chargei . Department of Instruction by Lectures ALMERE L. SCOTT, Secretary ...... . Department of Debating and Public Discussion J. L. GILLIN, -Secretary Cresignedb . . Department of General Information and Welfare E. B. CORDAN, Acting Secretary . . Department of General Information and XVelfare W. H. DUDLEY, Chief .... . Bureau of Visual Instruction H. F. RINKER, Chief of Instruction . . Bureau of Post-Graduate Medical Instruction Rock SLEYSTER, Chief of Organization . . Bureau of Post-Graduate Medical Instruction State District Organization W. H. HENDERSON, District Representative Conileavel ...... W. Hf BENNETT, Organizer tin charge? .... A. S. LANGMAS, District Representative . . A. R. MAcK1NNoN, District Representative . J. P. O'CONNOR, District Representative . - . L, E, BLACKMER, District Representative . . GEO. E. HOBBS, District Representative tonleaveb . First District-Milxvaukee First District-lviilxvaukee Second Distric t-Oshkosh Third District-La Crosse Fourth Distric t-Superior Fifth District-Wausau Sixth District-Eau Claire J. B. Gmswoto, Organizer Cin chargej ............... Sixth District-Eau Claire The University Extension Division in Wisconsin is one of the co-ordinate colleges of the University-the extra' mural college. It constitutes the instrument of teaching and of authentic information for the adult democracy through- out the state. It serves not only those who are disadvantaged by taking educational opportunities to them, but it affords all people a means of keeping abreast. Thus the practicing engineer, architect or doctor, on the one hand, or the artisan, clerk or laborer, on the other, quite as well as the student who contemplates a university degree course, may study and learn at home and without interference with their daily vocations, This is done through consecutive teaching courses by mail or local class, by forulinc-instruction and package library service, by lyceum courses, and by bureau, information and visual instruction met o s. e In this way the University committed to the unbiased search for the truth, may serve continuously an entire State 5 " """' 11 111111111111111111111111111 11 1 11111111111111111111 111 111111111 1111111111111111 111 1.111111111111111 11111114 ......!fE.!.'.!L..,Ei!!E....... l 'l it l ' 1 1 '41 H H ,Il , ...,........... . ....,..,... i.,.... ......-.,... ...,.. ...--,,.... ....... .,.. -,....T...mr............... I X 1111111111 1 1111111111111 1 111 1 1 11111111 111111111 1 1 11111111111111111111111111111111111111111111111111111 1 111.1 11 11 1 1 1111.1111111111111111111111111111 1111111111111111111111111111111111111 11111 1 1111111111 Page 82 wide democracy. 2... .,,.. ....................... ............. ... ............ ... . ...............W.....M,....W... ..... ... ..... . . . . .. ..... ..... . .. . ................... ............. ..... ..... ..... ........ ..... ........ .......... ....... ..... .......... swliiliililiii . . ...P 5 i E23 E2 as 352 Els 522 ali Ei? E12 Eli Eli sig s si is 52 s......... . n.. ...... ...... ...... The Library School 1 is - vi 71.225 -:i..zLfE!:,L- 222550: LIKRHR 'ice-we-L .lv wi ' . si.ii"1i1 Library Staj MATHEW SIMPSON DUDGEON, IvI.A., L,L.B., Director. On leave ofabsence, second semester, for American Library Association War Service in France MARY EMOGENE HAZELTINE, BS., Preceplar. Bibliography and Book Selection HELEN TURVILL, B.A., Instructor in Cataloguing and Classification CLARENCE BROWN LESTER, MA., Instructor in Reference Work, 'Public Docu- ments, Legislative Reference JESSIE WELLES, Instructor in Library Administration and Equipment JULIA WRIGHT MERRXLL, B.L.S., Instructor in Trade Bibliography and Library Economy ' ANNA GRANT BIRGE, B.A., Acting-instructor in Book Selection ' 67142 Library School After the War The war proved that librarians had a special preparation which fitted them for reliable positions in federal depart- ments, business houses, and emergency work war of an advanced order. This demand, which could in itself be only partially supplied, left public libraries with diminished staffs. The recognition of library training and the demand for it has brought a consequent increase in salaries. It is evident that more trained librarians are needed. During the last fourteen months the Library School re- ceived 339 requests for workers to fill vacancies in the following positions: librarians of public libraries, of branch, county, college, normal school, and high school libraries, librarians for childrerfs departments, for reference, cataloguing, and lending departments, librarians for business, municipal, newspaper, hospital, agricultural, and other special libra- riesg for assistants in these same libraries, and for workers in various lines of war service. The Wisconsin Library School must do its share in training more librarians to meet these demands. iiiiiiim iiiiiiiiiiiiiiliniiiiii iiniiiifiii 1ini.iiiiiiiiiiiiimimiiiiiiiiiiiiiiiwiiimmiiiiiiiiiiiimilim I. i mum imiimiiiiiiiinmiiiimmiiiinmiumim i. .vmi1iiiiiiiiwmmiiiiiiu ui.niiiiiiiiiimiiiiiiiiiiiiiiiiiniiiiimiiimiiiiiimiin iniuiiimmimiiiiiiiiii .ii .ui i uni I i mii i i i 1 i ii lim I ii ni i my ii wiiiiiiiiii in ii Page 83 ummm.,.HnmH.my.mmm.mmmH.mm.,.HmmnInWWvmInwIn1mmrmWInInnninwInul1fnnuulumInInmy1mfm1ufm1-IW1.11MW11H1yuWI-wmWynfm1.1W-.1inWHw1I-1U.1.IWwV.1mW-I1WW.HVH1InW1Hmw.Umwyu1-IXX-11-IwH.1-IwU1WmH.WmXHX,HW1.WW..W..XI1.XL.XW1.WI..1..X1.XXInH4H.X,HXHW1.4,HXmWHwmynN-XmW55.....Wy353135555355M!in11515555555553tuum!1554553153155IEWmvlylgInW5WinH.Wml..X.NXHXmXHXInWHWm1in1.Iwm1.IX.HwInWWmvmmnuWwnu.umm-1...w.u...f 5igm...nu...1..,....my.WV..1K.,mH.HK..M,X.H...NWWm...1..nnWH+W.fWKm.HnnH.WW...1my.HV..1V..1.H1..H..1..HH1.H1.H...AWnm.Hm1.mmV..1H.1..,,H1.H1..X1.11...N.1,H,.HV..W.A,m.HW..,H.1N.1..,W,...H.W.H,..,...N..H,W.HV..,K.WW..,H.V..1.H1..wm1.1XN,X1.,I..NUXI..,..,...,K..,1.,.HK.,,..,W,-H.HNWL.WW..vmV..,1.1.H1Hw...X.11mHW.X.HmX..XH1WX..11.1WWH-H.,1-1K..V...H,,..W--4H-N..K..W..X.HXHH.XV..X.H...mlL..,y.1.HX..11..X.HH.W1.1,.H1.1WX.HX.IXmm,1mm1.min...mm.m.i.51Eii:fg5 5 5 3 ,,,, .,,, A I I .... .V.... ..,.. ...... ,,---.-,,.,,,..,..-.,....-.--...M.....-....---.-.....,.-..E ,. ,.,,.., . ,,.,,.. n,... ,. .,K..,A. ...,.. ,.,,., .. .., ,.,,.., .. ... ,. A ,. .. u.,K., ..,... ,.,,.. ... .., ., ,.. .. .,,..,,., ,.,,.1 .,,,..k.. ,,, .,, ..,K. ,. ,,, .,... ,., .. .., ,.,...,.. .,. .., ,. .. ,.,.., ...,,.,.. ,., ,.,..,... ..,...,k., ...,.,... ., ,. ,.......,,,,. ,.,,., ..,,.. ...... .. ..,,..... ,.,,.. .., ..,...,., .,,..,,,.,n ,.....,...,.. .. ,.,,..,,.........,.,.,., ,. .., ... ,,,,., .. ..,K.. .., ..,......,,.,.,.,,..,....u...., H ,,...... M U, . I Page 84 053565 Address of Welcome . Class History . . Class Day Oration . . . Farewell to Underelassmen junior Response . . . 1918 and the NVar , . . Presentation of lvlemorial . Acceptance by Faculty Ivy Oration .... Ivy Ode .... Planter ofthe Ivy . . Class Day Exercises Tuesday, june 18th-3:00 P. M. Upper Campus Pipe of Peace Ceremony Nfonday, june 17th-11 P. XVI. Lower Cam pus LEROY J. BURLINCAME C. LEONARD GROSSER SARAH SPENSLEY RAY S. ERLANDSON . EBER E. SIMPSON CHARLES CARPENTER . . RUTH L. STOLTE . Ovio V. Bux . PRoE. A. B. I-IAL1. . ROBERT lvl. BREWER . MARJORIE KINNAN . DEMMER GOLDEN Pipe of Peace Oration . ..... VERNE V. VARNEY junior Acceptance . ............ HAROLD lvl. GROVES Senior Mass Tvleeting and Bonfire Commencement Exercises Wednesday, jane 19th-9:30 A. M. Agriculture Pavilion Prexy's Last Commencement Address .I.1I1.4I.1I...H.inI1.Ii..i..i..ii..,..,,.,,..i IiuiiinGiGiiiiliiiiiiiiiiiiiiliiiiiiiiiiiiiiiilimimi Page 85 QBaccalaureate Exercises Sunday, J une I 6th Address-ROBERT MARK WENLEY, Presbyterian Church Class Day Monday, Tuesday, june 17th, 18th 3 :OO P. M. -lvy and Class Day Exercises . . . 8:15 P. M.-"A Thousand Years Ago"-Senior Class Play . , . 11 :O0 P. M.-Pipe of Peace Ceremony. ll :30 P. M.-Senior Mass Meeting and Bonfire . . 5 :OO P. M.-Patriotic Band Concert and Song Fest . O4lumni way V Tuesday, june 18th 8:30-l0:30 A. M.-Alumni Registration .... 10:30-11:30 A. M.-Annual Business Meeting . . l1:30-1 130 P. M.-Luncheon . . 1:40 P. M.-Dedication of john Muir Kno ll . 6:00 P. M.-Annual Alumni Dinner 8:30 P. M.-Alumni Reception and Ba ll. Commencement CDay - Wednesday, j' une 19th 8:45 A. M.-University Procession . 9:30 A. M.-Commencement Exercises 4:00-6:00 P. M.-Presidents Reception . Open Air Theatre Open Air Theatre . Lower Campus . Lower Campus Open Air Theatre . Music I-Iall . Music I-lall . Upper Campus . Upper Campus . Lathrop . Lathrop . Upper Campus Agricultural Pavilion Presidents House Alumni Zig-Zag Procession Hrmr..,,.w,Wr.r..m ,w.rr..m.r..w. r1.141.11ininwr.Hmim...1..1m1Wui1urinr-mmrrrmliwlui Page 86 E2 :sz E., SEE 52 muun.. mrnmnmuxnumummmmm.mm I m .mn uv 1. .uv mnv ummumunu nm .mmmmmuummum 1. mnuunum w mmumuwunumunwwmm .Immun um num..11suwu.ummnwuummummm..nun.vu.umnuuuunnunmmnmu mu rvvun.uvunnmuumnmnmwuu numuruwnl1vuvuwnnrnruwrnnuvuwmmvmuxumlumnmmmmllummvllwl PE E'?2H3Eg5gwjgmemm:s2ww::gwLT .... N T -.-1- R -,-.-A'-- ---. , W -.F--. ------11. EE Ei.. :ii E S QSwxxxxwxxxxxxxxxxxxmxwxxxmwNXMmxwwwwmxwXXmmwwxwwwxwwxxXwwwmxxxxwxXXxwxNxxwwxxxmxmXwwXNMRwwmxwwxxxxxxwxx NXSQ N 512 -5 Nm . Nm E E X y 5:2 EE M 9 SS ESE 19 87110 VS 19 525 ..., Il N s ER ......,. -- Sw N - Ns 2225211-ESS ::..:-:..w,...,.,jr'- ----- -r .. .... - XxxR-NwxN-X-XXxxNNxxMww-Rim-NGi11iR1Q...-R-silx-ixg1,RmRN Sw:qQ: Q.Awww....maxRXWQRxXNWRWwxNMNXRXRRRRXRRSXQ lmm . .,...... AN EXE . EE? QE QQ 322 if Senior Class Ojicers E A I'lAROLD M. GROVES . . Pr6Sid6rli E LUCY WALLRICH . . Vice-President . VELMA A. REID . Secretary I HERBERT M. BAKER . Treasurer . Groves I Waflrich Reid ' B21-fer E Q . 5........IfQ...........f..l....C...............I.....................................................................................................................L.................................................................................................iff5Hif.iiif....................Ififi5ffii2EilifH................... ..... .................................. ...... ............... ............................. .T'.'a.":a""a'...... .............mx.:.'n1.m'm.."ns:.':.. ' Page 87 QQ V..-mmn.Hmummmummmmmmmmnn1mummmun,mmm..1mInXm1mmXWmymy-.1H.mw.ww.m.w.wXHXmXmHXunm1.IwmX1.11Hwmw1.1m11.Wm1.1XInW.11.IXXHWu1mfInWx-.1WWH1inXHmymyHXX.1XH1rm....UXU,..W..H.w.,..1,.U V.W1W1HWX.HK.my,.HmmW.Ummwm1mm1.UmmWwH1nu-mmwllnmfmHXIn1mmWmxmmW.mmmmnum1fmfum-mm.m.fm.v ....mmmn.,...NmW.mmmmm..XIn1HW..,N.1,1.,X..,H,..,H,XH4X1.Xwmm.m.H..u.u 1mm.W.u..1...um.,W...,..,f..m.m..u1m1m.NWm.,...mm.mm--1.22 I iii 225 55 Ei? E Ei? 5 Ei? ,,,.,,,,,,,,,,,mg555E5mgmmmimmmgmmm-RW ---,- 'HN .,---- .... ...... ,,.4,,,,,,A,,,,,,,,,,,,,1ilfjgggjfgg13515511315331ggggggjggg3ggg5gg1ggg3gggggggggggj33333gmif355553555:335M353mmm,Inuf.553:,3.,...,..5,5.,,..,..,......,..,....,.,...WW1V.,H.,.H,,.,.,1..,m.....,..!,MV-,.H...,L.,v..,,.,..,..,...,,.,,..,......,..,K.,,.1W.m.H.,,..n.,...W...,,.,H.V...nm.,..,,....H,......,W,H.K......,.,..m.,,...1.,.mn.L..m.v..n.,..,4m.,,.mf.sgg Hmmm ummummm11XW1w.11mW-.11H41HwXHwruW1.1ulwinw.IwwHwin1m1.11+I-wWwInin1InWWWw.I1W1.XInm1uf1InX.11mX.H11-1W1HNny1.111.11H1H-XHWmmfnmfmwmuv1H1Hmmmmwumm ' " " " " ' Page 88 HXnw.I111.wmruwn1vum1.Iwm1I-1m1uwInmwuvw-111.1W1Infuw-4wUw1Hm11HwHvu1m1Wm1.11muwwn1inwH1WH1w.UIn1mm1H1vu1JE-1Muiim1Inmb..1UWHEHMEElimnumHifi,mminumEMEFKZEEEFCilmE mmwunuma:winwumnwmwnumwnnnununninwwnwuwwuwinwu1wnwnwwuwmwuwuw1nwuwwninwnwmwuwnwwuwuwwnruw1IwwnwNwm1n1fninmwin1nw1n1flwinwmwImf1inrnm1W1muvwmmwn1n1wuww.1wuwnwwIwwuw,IwwHww1wwuwwnumwmmumwuwruuuuwnuuwnuvuwuwwuwrwwruwuwnmmmmmuurvwmwHwwunwI1wuww1wuuwmwanuuwluwuwwu1u11ruin1fuul1un1u1inumummmmvluvwuIw1uwwnwrHwuwXnuuwrn1vuwnwmwuwwuwmwvuwuwruwinunwvumwruwvunvwuwwInvmvuwvumwmnmmmm m ww 1 mmm v rgaaazzmmanmnmaznzuznmazansnzni::nm:m::m:u:::::1:::aaaaamagszzzazmzzzzanzxamzzzzzzqnn::::::::::::,:::q:n::::::q:::qz::::q::::::1:::asm:Quran:man:nm::::::::sam:z:n::::::q:q::::a::::::z:qqzzzazmza:::::z:::q:::q::q::1wasa::a::qz::1:zsunsmana:masszz::z:a::q::::::a:::::::::span::::z:anzqzzsazzsnqsnaqznanxaazzzaa:::::::man:sam:ana:scam:rw:su"'"H"':"""""'"""''W'"":""""q"""H"'"w""""'""'"rr"""'"""""""z"":z':-'n"s'z:::':s:.,. E - .,,.. .,,..,,.,... ,..,..,,..,,..,,......,...,., ,.,,.,.,. ,..,..,,.,,..,..,,,.,,.,,..,,..,,.,.,,,.,..,,,,..,,.,,,... . . , . . ,. E E E 5 E E E s Q E E . - M ,E . Ei 1 2' ,, ., ,, H, -a 5 fn 4 .- -ff ,,. ,,,, E 4.1, - E ,aff 412 555 M: E S f' frfffwdf-r -- f'--Y ' :,- W ,x ,..f...W-,,.,,.!w. ,MW W,.,....,, ,,, ,, Eli L:".'5!2'Y: X4-.+'1,:.'1-vwv'-:"'c- 141.1 1542 21 . 4 , 4 if WW? ' : E F',fri.1 2:5 V ,.1m.u, yi "' ' 5 as V ,1 ' 1','4z"f " .aim Eii EEE 3 Emnyy,nuvm11-11Infmnnmnu1Winnunv1u1H-W1H11.I1InH11.-1.H1H1V.1Inin1..W1.wmN.1.H.Hm11.,.H.W1.,.HK..1..1..1H1.H11.1..1L.,L..1..1.11W1..XmL..11.1.HV...HK.X..1K..1.-1-mm..1..nw.vH1in1.11H1.I1wH11.1InwI-1.I1inXHXU,ulXK-X1.11I.1..,N.11.,-.1m,..1.H1..,,Hy.,,,.,H.1..1L.1m11.11.,U.1m.H1..XL.1N..N.H,..1..1L.,...1MyH.1.1,..,WX1.1X..N..X1..,V.1V.,,..11...H,ynmy.UNHN..minl1.H1uvV.,imWWWHMUNWW1nv11.1n111.1u,1u1-I1X-IXHXin11.1H1nlmmm.mm.nm1 1 w m nf 'EWRHTHii?ii?iiiiii?GifiiEi?iiiiiHiiIFilUiUiiinwfuRhvmuvmlmEuwvufn1HwI-wwnwHW1u1Hwmm1.InuwnwInw-11H1mnnmwnX1uuHXH1myH1H.XH1m1U1Inmym1Inmin1mmm1NH1H1NH1fumuHXm1H1XHwHwin1HM1.I11H1ininummmmlmm fn ummm in K..... mn..K..nm...WI..Um..,..,.,..,......,,.M,., .,l. u..u.1..,...,,.,.,, w..., mm, ..... H., ..,K.,..,,.. 1...X.,,.....,,.,......,..1...,l.u.,.: ..., ,..,..u.,,..,..1 K..,.. ,..,..u.,,..,,.,,.,, ..Y.., ......,,.v., K.., ,.,,..K..W.u.., ..... ,..,,..,.,..,.m.. ,. .. , P a g e 8 9 immm:mnum:mmwmummumm1Innuvu1mm1m1ulvu1wn1u1nu1u1m1rn1u11Inmym1.I1vu1mrn1nummym1H1m1mmvm1.I11n1vu1u1nlm1In1u1vu1vmumwmumml1n1u1nl1H11n1InIn1u1rnXnXIn1nwin1H1Inm1uwwuwInmmu1nul1nl1u1w1u1InmyuuuuuInmmwnmwu1vunluInfnwInnlwufummnmmmwmmmunmlmnnnmmwnm H. 4 I v u vw In nn uumm1uvInwuwfuwuwInwuwmwnwinvu1mwmnlmwuwwnwInwuwnvyuufuuInvuuuw1uuunInanwuwnu1unn1mmmvmmmwlmmu. ggQuInHnunm-mmrwmumI-I1umHnf1nuinwH11In1mmf1-11.H1H1nu1H1In1.I1.H1HX1..1,H1M1..1Imu1V..1m,1.,m1.HW1InV..w1.4W1W1I.11.1N11in11.1nl1I.11I1w-.1-111K..m1U4W1H11Hdl1H.W1m11.1..11H1.HV..1I.,,H11.1m1..1,HV..1V..1HX.11H.1..1m1il?551NIRH1115HQIliiIiiiiil1hill?iiiIli?iii?EEFilIIIIPIRIEGi1.iiiiiHiGiliii'IEiiiFillIiiIEIIFQIFEEli?H25521PEIIZIRil?iiiiii!Iilii?1EliIii?FEW1IEEEIDEICIIIEIGI?JilLIEHEIRIllQllliiliiiiiii52111155iii1IIIGIIFIGIGIEIIIIEIIFEZREEIIEIYFJIIQIIIIIZIIIIIRIIIEIEIKIISE5 .. 2 gs 55 EEZ EE W E EEE ' ' EEE : 1 EE 3 2 EEE HWWM-Wmm--IWWWWWW ,H11.f1.H1..,m..m.,...,..H..,UWV.,,..,X1.1,..1V..XV.,W..1,.1,1.,W1,N1..,,..,,H,V.,11.,H.X..Nm,K.,,UXV.1XH1...1,.,X1.,.N1..11..XL.,V.,W..W.w..,..,.H N- um wmmmln if I .,.. ,. .. ,. .,,. ,, ,, ,, V- H H My K. wm.H.w.M. ,..mw..um I L.HmmW1.111-11.I11H1I.1V..H.mmm..H.1Win,-11.H.H1H1,H1..1InH.X1.Nmmum-.1mWXL.1H.u.m...m.mww.Q..1. Km 1 .H nw. . . .U.,v..H..1.m.. my mn., H in K .V al: ..w.m..v..,,..m..1num,.,..w..,..m.. ,K.,,Y.H...,W,H,.WX..,,UW,H,,.y,,..,,.H,HY,,HH.,,..Y,..W,,.,H.Y,.1,H,,.,,Y.,,,..,,.,,..,,.1,,..,,H,..W..m.,,..,,,,,H,,..,K..,U,,..,,.,,,.,y..,I..,..,,..,..,,.,,,.,,H,,.4,..,,.1,,H,..,,.,,..,,..,X.,5.5,li..iz,,JRanniliiiliixliiiiiziziwiiiii 53-5955-"' '5-I 2 Page 90 vm1u1wnwfuwHwnwwHwIn1If1m1H1.IwIn1mInwHwInwHwH1rwmW1H11.11n1n1m1mwnwUwmw.I1WwuwK-1mm1LHwu1ruwuumnlum1uin1VHm1m1mmImmmuH.mwm1.Inl1ulumWmmmmmulummmm.mmunmnmlmmmmf 1111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 1111 15515111IEE1511i1111111111111111111111.111111.IRM111i1111111111111111.11111111111111.11111111111111111111111.11.1111111.1111111111.11111.111111111111il115.1.111i1.I11IZ11EI11I11.11121li,Ill11I11il1Ill11I11I11I.11I11I21LZ11IJL1III1Zi11I11111Ii?1,I11L11.511.II1I11.115211521Ill1.11FilII!1E111Il1L111liJill1iiHi1ill1Ci1Ii11.21LII1Ili1111ii11Z11EIR11111E1L5111211111ll1L511H13111ii1Pi11L211El1Ll1L521il11L111ii1U11111Lil1LI1L311Jil1.111111A11.11L21111111111l11LELl11Li11.i11ll1I2l 1 1 1 111 15 1 -1 . 9 B' ' 1 .f.5'fN.1"R7 1 1 ' '+-' 1 - ,V 11 .. ,.., -LJ,Wk 'gil'-1- .-..5,i9'i..,,,'-. V . 1 ' ' L' if ' 1 . , I x 1 fy 9 N1515111M13111111111111111111111111111111111111.111111-11.11.111.111111111.111.1111111111111.11111.111.11111.111111.11.111.11.111111111.111111111.11.111.1.11.111111.111.1111111111111.11.11111111111111111111111111111111111.11.111.111111111111111-1111111111111.11.11111111111111111111111111111111111111111111111.11.111111111111111111111111111111.1.1111111111.11.111111111.11111111111111.111111111.11.111.11.1151111.1111111.11.1111111111.11111.111.111111111.11111111111111111111111111111111111111111111111111 11111 111 1 1 1 1 1 1 1 111 1111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111El11i1111IE111i11il1il1FIR1I1111111111111111111111111111L11E111i111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111 111111111111 11111111111111111111111111111111111 1111 1 Page 91 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 11ru1mlmHlmlwIIfHlv1'H"1l"l"''"H"''W"W"V"'"''"''"'"'"W"''"'"'""'"""""lWff5Yflf!f55fll55951555ffL--l--1--1---1--1------1--1---1---1--'1-n--1------"- "" """"""""'"'"""""""""""""'"'"""'"""'"'1il1Zi'Zl3i311111111ISV?11211111111Ill1'l'1i1i1i1iii1121121112151111Iii?ill3111112111121iii11121111111Ii?1221111P121ill'Zi'ii"i1"i1iil1"Z11111111111121H1iii?1153115511515111316111Eli?ii!ii11iliiii1lliIii?5111122117111iii5i1E1i1ii1Iil11i1552 "' J---11 ----- ---- 11111111111111111111111111111 111111111111111 1111111111111111111111111111111111111111111111111111111111111111111111 mmL"""""'u"""' ' 111 1 111 11 111111111 11111111111111111111111111111111111111111111111111111111111111111111111111 1 1 111111 11 1111 111111 1 1 11 1 1 111 11 1 1 11 H11 1' H :zz -11111111111111111111111111111111111111111111111111 1111111111 1.111111111111111111111111111111 11111111 I ESE 1111111111111111111111 1111111 1111111111-'J11111M 51353111111111.11119111111111111121111111111111111111111.111.11.1111111.111.1111111.11.1111.111.11..11.11111111.11.111.11.111.111.111.11.111.11111111.1.111.111.11.11.1111.11.111.111.11.111.11.111.11.1111.111111.11.11.11.111.111111.1111.111111111.111.11111.1.1.111111111.111.11.111.111111.111111.11.111.111111.11.111.11.11.1111.111111111111.111.11111111111111111111111.111111.1111111111111111.11.11.111.11.1111111111111.11.111.11.111111.11.111111111.111.11.11.111111.11111111111111111111111111111111115LJ-1u1m1U11111 111. 111111 111121 ,11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111L111E11iii11i1Lil11111111ii1lil11111111111L111H1L11111111111i11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111u1u11u111111x111111u1m1111111111111 Page 92 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111s 3 E -I I I Ir I I ui II I l ll A I Illrlll R I I II mu Irnimiilgimvg IE is ii I a GORDON DALE ADAMS . . . Evansville ' L 1 V 'M ' A "Gardy" K "4-VW " A " "' I ti COMMERCE ,f U , ' J V , Sigma Alpha Epsilon: Beta Gamma Sigma: Commerce I ' It 77 I - - ' - A All f ' Club, Monastery, Tennis Team, Manager l, Football I 4,2 ,,lIgzuLfTN,N Q Team, Manager 25 Union Board. T' X . Thesis-The Application of Budget Plan of Accounting to 3 lr . ' I Modern Business, 1 I ' I I V . I , 'li ' , ., 5 . BERNICE ALBRICHT . . ..., Normal, Ill. 5 . u v , LETTERS AND SCIENCE X 3 ' , , V. IAL, , if I Achothg lllinO's State Notmal University l, 23 Y. W. C. A. 1 A gg , ' - ' : I Cabinet Counrlilg Vice-President junior Mathematics Club. Z 1 ' f y" gl T TRENT ALEXANDER . . ,... Madison 9 f X, , LETTERS AND SCIENCE 7! ' E A y f I Delta Zeta: Y. W. C. A. 1, 2, 35 Hoosier Club l, 23 French Q G' L , W- 179' Club 4, Choral Union l, Z1 Women Students' War Work l 4, ' ' 4 1 , Council 33 Basketball Squad 23 junior Play: Geneva Club, X 'T , " Suffrage League 2, 4, Classes Section Badger 3. 2 , -' ' 4 Hg., ,. , . . I , ELIZABETH ALLING . . . . Tallmadge, O. ' H V I . -. - "Belly" J h ,i - ,. V LETTERS AND SCIENCE ' ' "V 5 Oberlin University l, 21 Pythia 4. . it . 1 fl" f , Thesis-University Extension from State Universities. :Q 33 i' l SARAH E. ASHBY .... Indianapolis, Ind. A "Sally" - I LETTERS AND SCIENCE - A Kappa Alpha Thetag W. A. A.p Y. W. C. A. Cabinet Coun- cil 35 Congregational Students' Association Cabinet 3, 4, Hockey Team 4, Assistant Editor Satire Section Badger 3. Thesis--The New Psychic Element in the Short Story. IRMA ATKINS ....... Elkhart, Ind. "Tammy" LETTERS AND SCIENCE Alph? Chi Omegag Ferry Hall lg Northwestern Univer- sity . Thesis-A Study in the Sources of Shakespeares Plays. FREDERICA ATWOOD ...... Madison "Freddy" ' LETTERS AND SCIENCE Delta Gammag Vassar College 1, 2. Thesis-The Extreme Romanticism of Maeterlinck, LUCILE KATHERINE AUCUTT . . . Aurora, Ill. "Ceil" LETTERS AND SCIENCE I Northwestern University 1, 2. DOROTHY HELEN AYERS . . . Dickinson, N. D. "A. Z." HOME ECONOMICS Achothg North Dakota Agricultural College l, 2, 3, Eu- thenics 45 Outing Club 45 W. A, A. 4. Thesis-The Teaching of Cooking in Foreign Countries. FLORENCE ELIZABETH BABCOCK . . . M adison NORMAL COURSE! PI-I.B. 2 Superior State Normal 1, 2. 5 . Thesis-Social Evils and Follies in the Time of Addison and Steele. 5 l ...... .. gJ,,,,wmgg II.T..m..I..IIm... ...II I.I..I.I...I.II......I..I.mm min II I. I.IIIIIIIIII..I.I.I.I.I.II..II In I . iiiFiiiiiiiiiiiiiiiliiiiimiiiiiiiiiaiiiiiRiiiinni . ,I I. I I.I.I...,.,..,a Page 93 7 I ,.V,k ily' If ' . , ,... 51657, . , -rV' L, VL i, , ' I H l"saN'fL 1:7 , Hf1':i5,1, ,, A Q :lift 'Z -.iZ'EI. , 44. , vfi1,g,ilf'- A ,.,i.' i Q f T' L D f:grr:.,,.. .. . - ' ' " X, - , N Q., :ff , 5 I r I XJ 5 S R: , ,ff - 33"-- M. "use 1 A A A C , .,,k IA. ..kV K 1 I - r " if- ' -214 4,1 ff! ggi? ' I Y ,C if-ii .fy ea Q X F xv, S? ' jf J ,gi X Q K I f ik k 0' '55 4 f I. ,A , .. El . A . 5 ",',' if , .xii ' L 1 , " .. . I fif iizii, '1"': l K 5: ' f Y Ti- ' I il 4 T AA A R 2 I ' A 5 'I "'::" k A ll 5 4,1 X b li ,d M Y C NV 5 Y T fy 2' at . f L ii ' " -' , T M , I, fe, T I I ? I - :,f 'l" A . , N a ' , 2 , f -, V I rvl, I, , .,, ., g .L . . A.. A ,,.. D fit I Qoslj - v I if r I L T - 1 Q A Rli.Ti . '.,, 115' if I7 V '- , Ak 2 f f if ' " S Z ,.,'r A " I fv,:,1-- ,ga ,qi 1,-., ,,.,f,., .,.- Navi-1 if ,,. r XVALTER MICHAEL BAGEMII-lL . , . Milwaukee "Mike" MECHANICAL ENGINEERING THOMAS MASON BAINBRIDGE . . Platteville COMMERCE Sigma Alpha Epsilon, Platteville Normal l, 2. HERBERT M. BAKER . . . . janesville "Bake" COMMERCE Chi Phi, White Spadesg Commerce Club, Secretary, Union Board 3, 45 Production Manager junior Play 3, Production Manager Union Vodvil 4g Student Financial Advisory Committee, Business Staff Daily Cardinal l, 2, 35 Business Manager 4, Class Secretary 4. Thesis-Constructive Accounting. C. l'lAMMETT BALDWIN . . Tulsa, Okla. .Hamm ACRICULTURE gFnga Alpha Epsilon, University of Missourig Monastery U . RUTH LUCILE BALL . . . . Muncie, Ind. "Billie" LETTERS AND SCIENCE I Chi Omegag Maryland College I, Hoosier Club l, 'lg Suf- rage League 3, 43 University Press Club 33 Y. W, C. A.g Woman's Page of Cardinal l, Z, Advertising Staff Daily Cardinal l, 21 Sorority Section of Badger 3. , .- Thesis-Health Insurance as Recognized by the Medical Profession in the United States, Great Britain and Ger- many. . ANNA-ROY BARDON ...... Superior LETTERS AND SCIENCE Superior Normal l, 23 French Club. Thesis-Papers on Corneille, Racine and Moliere. GRACE M. BARRY ..... Richland Center "Tuclie" I-IOME ECONOMICS Thesis-Relative Proportion of Rent, Food, Clothing, and Other ltems in a Budget. MARCERY j. BARRY ..... Oconomowoc LETTERS AND SCIENCE Milwaukee Normal l, 2. Thesis-English Novelists and America: A Study in lm- pressions, W'lNIFRED BARTHOLE ..... Glencoe, Ill. UWM.. LETTERS AND SCIENCE Alpha Phi, W. A. A. l, 2, 3, Board 43 Student Council of Defense 43 Basketball l, 3, 4, Class Vice-President 33 Union Vodvil Z, 3. Thesis-The Utilization of Rivalry. ZITA BATZ . . . . Sun Prairie AZN.. LETTERS AND SCIENCE St. Mary's College l, 2. IIIIII..II.,.III.IiK..I..mr......II..I.w.m. HI. H. .-iw., Inv... U.-Ii. Iirnm ..i.iI.m...I,..II..I U. Iirrmmiimmm IiInInIIIIInIIImIIIIImrrrumrrirrmrur I " """ ""' "' "' ' Iirrimiimummu Page 94 FRANCIS L. BAYLE .... Glens Falls, N. Y. "Pele" MECHANICAL ENGINEERING Cornell University l, 2, 3. Thesis-The Gas Turbine. OLIVE BEARDSLEY ...... Chicago, Ill, HOME ECONOMICS- Pi Beta Phi, Lewis Institute I, 2. MARGUERITE BEATTY . . . Des Moines, Ia. HOME ECONOMICS Omicron Nug Euthenics 4. D Thesis-The Vitamine Content of Some Poodstufis as De- termined by Fermentation with Yeast. FLORENCE ESTHER BEATTY . . . A Davenporl, la. HOME ECONOMICS Kappa Kappa Gammag Omicron Nu, French Club l, 2g Euthenics, Treasurer 3, President 45 Keystone -lg Bowl- ing 2. Thesis-The Effect of Mineral Salts on the Physical Char- acteristics of Gluten. 'T ' LOUISE I-IARRIET BEAUCAGE . . . Fonclrdu Lac LETTERS AND SCIENCE Oshkosh Normal I, 2g Pythia 3, 4g Orchestra 3 3 Outing Club 3, 43 Suffrage League 45 W. A. A. 43 1920 Badger Staff. Thesis-The Background of Some of I-Iardy's Wessex Nov- els. ' FRED LOUIS BEHLING . . . . johnson Creek AGRICULTURE 'Agric Literary. Thesis-A Study of Certain Plants Selected for Economic Value in a Cross Between Marquis Spring Wheat and Black-Bearded Spelt. RAY E. BEHRENS . ..... West Allis CIVIL ENGINEERING Triangleg Tau Beta Pig Civil Engineering Society, Vice- President 3, President 43 Wisconsin Engineer, Advertising Manager 3 3 Captain Cadet Corps 3. MARGARET BELKNAP . . . . . Waukesha PUBLIC SPEAKING Oberlin College l, 2, 3g Y. W. C. A. Cabinet: Clef Club. Thesis-Theater Architecture in America and Its Influ- ence on Dramatic Production. WILLARD BERNHARD BELLACK . . . Columbus "Bill" MECHANICAL ENGINEERING Theta Xig Armour Institute of Technology lg A. S. M. -E. 3, 45 Wisconsin Engineer, Business Staff 35 Assistant Editor 4. Thesis-Mathematical Analysis of a Tesla Turbine and Centrifugal Pump. HELEN A. BENISEK . . . . Anligo "Benny" LETTERS AND SCIENCE Thesis-The History and Development of the Modern Cem- etery and its Relation to Civic Art. ' 9 ' I I .I I Iiiiimimmii--I.. I Ii "'l""G"""""' 'T"""""'i l mmIIImiIuiiiiiiiiiimiiiiii Page 95 "1l I ' 1A , Q, I if , Q Lf? ' af 5 R Ie 5 .R 1 ' ,fA' A .A4A, . g I - 11. J lf , f ' l 'V I' f 1 '+--Q : .r . - Q V ... " . I I T WM -.++A f ' i . I .,... l 'FM if ':" N"" '11- I li AA'-w2 'fi .A' f 'f Y S lg? Z E .. A ':'A " ' J 1. I Z , .lI i I in If - if ? "q I I I A . .,A-: I ' I ni ' ' A Q, V V: .,:, In z L ! ll v Al l b " ' ,. U All - ' A , g , '-, n g-A'l'Efgf42Q' If b. A L I A .V, ,E ., I ,q A gf. ' IIIIIIIII II II H I il 1 I ELIZABETH RHEA BENNETT . . Aberdeen, -S. D. "Betty" LETTERS AND SCIENCE Kappa Alpha Theta, Oberlin College I 3 Press Club 45 Bas- ketball 2, W. A. A.: Outing Club 4. Thesis-Analysis of Most Popular Women'S Magazine. LEONARD BERCSTEIN .... Duluth, Minn. PHARMACY American Chemical Society, Menorahg Hesperia. Thesis-The Effect ofthe War on Drugs and Pharmaceu- tical Chemicals as Revealed in the Chemist and Druggist of London. OLIVE MACDALENEBERRY . . . Dakota, Minn. LETTERS AND SCIENCE, PI-LB. Winona State Normal, Winona, Minn.: Pythia 3, 41 S. G. A., Representative 3, 4, Council 4. Thesis-A Test in Arithmetic. CILADYS BEVERIDCE . . . . Lake Mills "Glad" LETTERS AND SCIENCE Alpha Omicron Pi, Milwaukee-Downer l, Z. LUCILE W. BIEBERMAN . . . . Duluth, Minn. LETTERS AND SCIENCE Kappa Kappa Cammag Mystic Circle. Thesis-The Treatment ofOur Soldiers alter the Civil XVar. VERA LOUISE BIERBAUER . . . Mankato, Minn. LETTERS AND SCIENCE Milwaukee-Downer College lg French Club. VIEVA MARIANE BIGELOXV . . Madison . "Ve" HOME ECONOMICS Euthenics 3. Thesis-Clothing Budget for College NVomen. MARVEL MILNE BJORNSON . . La Moure, S. D. ..Vee.. LETTERS AND SCIENCE Tgamestown College l, 25 Dakota Club 35 Taychopera Camp TlIZSiS-Victor I-lugo. MARJORIE HELEN BLACK . . . Flint, Mich. "Marge" HOME ECONOMICS Michigan Agricultural College l, 2. LoIS V. BLACKBURN ...... Palmyra LETTERS AND SCIENCE Achothg Carroll College l, Z. Thesis-Aptomism of Browning'S Dramas. IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III I I I IIIIII III IIIIII III IIIIIIIII IIIIIIIII IIIIIIIIIIIIIIIIIIIIII II IIIIIII IIIIIIIII III IIIIIIII IIIII I """""" """""""" """u"""""i III II II I II III II IIII I I I Page 96 I DAVID JONES BLATTNER . . . -Sulpl1ur,Okla. "Dave" ELECTRICAL ENGINEERING Kappa Epsilon3 Tau Beta Pi3 Eta Kappa Nug Varsity Track Squad 2, 3. Thesis-The Economy of Hydroelectric Power Develop- l'TlCI'lt, MARY ZILPHA BOI-IAN . . . Avoca "Za" LETTERS AND SCIENCE Alpha Xi Deltag VV. A. A.3 Bowling 3. Thesis-A Proposed Plan of Welfare for Working Girls in a Department Store. KATHRYN M. BOLL . . . . . . Rice Lake ..KiHie.. LETTERS AND SCIENCE Chi Omega, Castalia 2, 33 S, G. A. Council 33 Y. W. C. A., Cabinet-Council 3, Cabinet 43 W. A. A.3 "W"3 Basket- ball 1, 2, 33 Baseball l, Z, 3, 4. Captain 2, Varisty Baseball 2, 33 Vocational Conference Committee 3. Thesis-I-Iistory ofthe Wisconsin Industrial Commission. IDA KATHRYN BOLLENBECK . . Madison Hide.. ' I-IOME ECONOMICS Euthenics 2, 3, 43 Ski Club I, 23 Germanistische Gesell- schaft I, 2. Rgieiis-Detail Study of Liquifying Micro-organisms in I . HELEN AUGUSTA BORCHERS . . . Whiieuialer LETTERS AND SCIENCE Pythia, Vice-President 43 Y. W. C. A. Thesis-Geographical Influence in Cities of Wisconsin. GRACE XVEYMOUTH BORDELON . . Bunkie, La. "Grace Deahu LETTERS AND SCIENCE Louisiana State University 1, 23 Suffrage League: Y. W. C. A.3 Archery, Thesis-The Influence of the Works of james Fennimore Cooper upon Certain French Writers. AAGOT M. K. BORGE . ' . . . . Madison ' C MUSIC SUPERVISOR Clef Club I, 23 Glee Club 23 Choral Union I, 2. LUCILE DOROTHY BORNE .... Toledo, O. "Cid" LETTERS AND SCIENCE Germanistische Gesellschaft 3. Thesis-The Personal Element in the Works of Theodore Storm. MARION FERN BOYCE .... . Milwaukee HOME ECONOMICS Gamma Phi Beta3 Milwaukee Normal I 3 Mystic Circle. Thesis-Study of Food Rations. GAIL VANDEN BRAAK . . . Green Bay ..Van., COMMERCE - Delta UpSiIon3 Leland Stanford junior University 1. 2 lam' Q.,- III.IIInmi-will--IIIIIIIIIIIIIWIIIII-Iim. ...III 1.1. I I n I ininIinillIlilluinimiiIIIIIinliminiiiiliiiimiiimm II Page 97 Imiiiwt Eli E25 Elf E55 55? SIE EIS iii ESE EEE ,ii il? EE EE E els EIS gig EEE i E s e 1 i 1 mum ii ni mmmim mum in in EE ,, , ,III I lim: I Inu I u Inu Iii I-IELEN MAE BRADLEY ...... Hudson LETTERS AND SCIENCE ' Hamline University l, 2. Thesis-The Evolution of Opinion as to the Cause of De- pendence. GRACE CATHERINE BRAY . . Elkhorn "Torcl-ty" , LETTERS AND SCIENCE Alpha Gamma Delta. Thesis-Theory of Representative Government in Ameri- can Politics. ERWIN C. BRENNER . ..... Milwaukee 'AEIIIH CHEMICAL ENGINEERING' ' Alpha Chi Sigma, Phi Lambda Psi: Tau Beta Pig Chemical Engineers' Societyg Engineering Society, Track l, Z, 3. Thesis Course. ANN BRIGGS . . . East Grand Forks, Minn. MUSIC Delta Gamma: Glee Club, President 43 Keystoneg Mystic Circleg Clef Club. Thesis--The Standardization ofthe Measurement of Pub- lic School Music. , CHARLES JAMES BRINKERHOFF . . Neenah I-Bffflkn PHARMACY Thesis-The History and Revision of the Pharmacopeias ofthe United.States of America. ERNEST JAMES BROWN . . . Madison ..E.-1... Ajim.. MEDICINE Student Senate 23 Secretary-Treasurer 1919 Class 2: Man- ager Outdoor Players Z1 Student Financial Adviser 2, 3, 45 Publications Committee 2. Elections Committee Z. Thesis-Topographical Anatomy. HELEN CONVERSE BROXVNE . Waupaca "Brownie" LETTERS AND SCIENCE Kappa Alpha Thetag XV. A. A.g Varisty Bowling 2, Vice- President Green Button. Thesis-The Wisconsin Primary Election Law: Its Rise and Development. KATHRYN K. BROWN ..... Rhinelander LETTERS AND SCIENCE Thesis-Class Barriers in Galsxvorthy. PORTER I-I. BROXVN ..... St. Louis, Mo. COMMERCE Kappa Sigma, Mandolin Club l, 2, 33 1919 Badger Staff. RUBEN S. T. BROXVN ...... Madison "Rube" - LETTERS AND SCIENCE Plfilomathia lg Haresfoot 25 Glee Club 3, 43 Union Vod- VI . Thesis-The Hague Peace Conference and its Relation with the Present Problem of Internationalism. IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I I I I II I IIIIII II IIIIIII IIIIIIIIIIIIIIII IIII III III IIIIII II III I IIIII III III IIII ,I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I P a g e 9 8 QIIIIIIIIIIIIIIIIIIIIIIII E l'Q?liIJiiKIIIIII.II ag: se Sis ,E- :QE sis I A I Im mu IIII Im ' ' ' l..,-..,....,..,...,,.,.. .....a,...,............- -. l",...L, . ' ll ANTON WILLIAM BRUNNER . . Durand ..TUny,. PHARMACY II Delta Phi Epsilon. ghisis-Pharmaceutical History of the Chippewa River a ey. RUDOLPH H. BUCHHOLZ . . . Sl. Maries, Idaho "Buck" CIVIL ENGINEERING Civil Engineering Society 3. Thesis-The Design Of a Rc-enforced Concrete Arch. CARLYLE WILLIAM BURGESS . . Duluth, Minn. "JimnIy" MECHANICAL ENGINEERING Phi Kappa Psi: Case School oi' Applied Science l, 25 A. S. M. Eg Engineers' Crew. Thesis-Investigation ofthe Increase in Horse-Power Ca- pacity ol' a Gas Engine by Supplying the Air Under Pres- sure. EDITH ELEANOR BURKE . . . . Madison HOME ECONOMICS KATHERINE E. BURTNESS . . . Sioux Ciiy, Ia. "Kay Bee" LETTERS AND SCIENCE Lake Forest College lg Morningside College 2g W. A. A.g Hockey 45 Dancing 4. Thesis-Strength Tests of Group Muscles of Children. ETHEL BYRNE ....... Milwaukee LETTERS AND SCIENCE Milwaukee Normal 1, 2. Thesis-Dorothy Wordsworth. HELEN CAMPBELL ...... Milwaukee LETTERS AND SCIENCE Milwaukee Normal School 1, 2. A LEOTA MAE CAMPBELL . . . , Toledo, O. 'ALoLsie" LETTERS AND SCIENCE National Park Seminary I 3 Western Reserve University 2. Thesis-Professional Aspects of Nursing in Wisconsin. JOHN WEBB CANCE . . . . Galesville V Ajawn.. COMMERCE Phi Kappa Psig Beloit College 1, 2. Thesis-Marketing the Securities of the Chicago and Northwestern Railroad. THOMAS WILSON CAPE ..... Doclgeville LETTERS AND SCIENCE - Thesis-System of Promotions in the Public Service. I I IIIIIII IIIIIIIIIIIIII I I IIII III I II I I I I I I IIIIIIIIIIIIIIIIIIIIIIImIIIIInIIIIIIIIIIIIIIIIIIIIIIII I Page 99 X 51 3 , R 'gi Z- , , in In In ir II ii Iiiii min III un RACHEL j. CARPENTER . . . Iron River, Mich. HOME ECONOMICS Thesis-The Clothing Industry in japan. RACHEL BEAL CHADWICK . . Detroit, Mich. ..Ray.. LETTERS AND SCIENCE Delta Delta Deltag Michigan University l, 2, W. A. A. Board, Wearerg Varsity Basketball 2, 4, Hockey 33 Varsitiq Baseball 3, 4g Archery 45 Y, W. C. A.,Cabinet unci 4. Co Thesis-The Statical Work Done by Human Muscles in Continued Contraction. HAROLD COWAN CHEETI-IAM . . Milwaukee . "Cohen" CHEMISTRY Kappa Sigmag Phi Lambda Upsilon, Phi Beta Kappa, Alpha Chi Sigma, Union Board 3, 4. Thesis-Preparation of Phloroglucinol from Diethymal- OYIZLC. WVILLARD A. CHIPMAN . . . Stoughton E H Hemp.. MEDICINE Phi Beta Pig Sigma Sigma. Thesis-The Nerve Endings ol' the Suprarenal Gland of Mammals. . MINC-HINC CHOU ..... Shanghai, China CHEMISTRY Phi Lambda Upsilonp Tsing I-Iua College lg International Club, Vice-President, Wisconsin Chinese Students' Club, President, Editor Chinese Students' Monthly. IQEATS S. CHU ...... Uingpo, China LETTERS AND SCIENCE Tsing Hua College lp Artus, Hesperia, President 4, Vice- President 3, Treasurer 41 Chinese Students' Clubg Interna- tional Club, Secretary 45 Accountant 1920 Badger. Qaesis-The Operation ofthe Bank of England During the ar. MAvIs CHUBB ...... St. Louis, Mo. LETTERS AND SCIENCE W. A. A. 3, 43 Red Domino I, 2, 3, 4, President 41 Key- stone 3, 43 Basketball 1, 23 Dancing Honors Bgjunior Play 35 Cardinal Board 35 S. G. A. Cabinet 3, 4. MILDRED CLARK . . . . jcmesville "ANI" COMMERCE Beloit College l, 2: Y. W. C. A.g Cardinal 4, Badger Staff 4. Thesis-Analysis of Control as Affected by the Organiza- tion ofa Mail Order House. LILLIAN CLARK . . . . Oshkosh MLM" LETTERS AND SCIENCE Delta Gamma, Smith College 25 My stic Circle, Hockey I. Thesis-The G. A. R. and the G. A. D. ERNEST CLARKE .... . Madison PI-I,B. Superior Normal l, 2. Thesis-Methodism's Early Interest in American Educa- tion, iiI.mminii..iiIimuiI.iImi.iII.I...iiiIiiI limimmmiInIIiIInIiiIIiiIiiiiiiuiuimiiuiiii Page 100 ELMER RUSSELL CLARK ....... Lodi ' AGRICULTURE Alpha Zetai Ag Literary Society, President 35 Country Magazine, Editor 3. 'gnesits-Frost Resisting Qualities ol' Various Strains ol' a a, VIDA A. COAPMAN . ...... Kilbourn LETTERS AND SCIENCE Alpha Xi Delta. Thesis-A Message from William Morris structionists of Today. RUTH EUCENEZCOFFMAN . . . "Rufus" HOME ECONOMICS University ol' Illinois l, 2, 3. to thc Recon- . Pana, Ill. V. IRIS COLDWELL .,.... Mazomonie HOME ECONOMICS Alpha Camma Delta. ARTHUR VINCENT COLE . . . . Mauslon MEDICINE Gamma Tau Betag Ripon College l, 2. Thesis-Topographical Anatomy. FLORENCE E. COLLINS . . . JOURNALISM . Tipton, Ia. Chi Omegag Theta Sigma Phi5 Coe College 1 5 1919 Badger Staff 35 Daily Cardinal Staff 3, 45 Consumers' League Board 45 Press Club 45 1918 Home Coming Committee 4. Thesis-XVhat One Hundred Farm Women Wish to Have Printed in Their Section Of a Farm journal. MARY BELLE CONINE .... Nowala, Okla. HM. B... LETTERS AND SCIENCE Randolph-Macon Woman's College 1, 25 W. A. A,5 Outing Club5 Y. W. C. A. Cabinet Council 3. 45 Varsity Tennis 35 Womens War Work Council 3. Thesis-Operation Characteristics of Audions. LAURETTA B. CONKLIN .... Chicago, Ill. "Laurie" LETTERS AND SCIENCE Kappa Kappa Gamma5 Mystic Circle5 Spanish Club 1, Z, 3, President45 W. A. A.5 Y. W. C. A.5 Tennis Team, Captain 1, 2, 35 Basketball Team 25 Spanish Play 3. Thesis-Translation of a Spanish Classical Drama, "El Desden Con el Desdenf' RUTI-I MARGARET CONLIN .... Madison "Connie" LETTERS AND SCIENCE Mathematics Club 3, Secretary-Treasurer 45 Outing Cl b 3. Thllasis-Algebra and Calculus in the Finite Complex Plane. BEULAI-I M. CONNELL . . . Menomonee Falls "Bee" LETTERS AND SCIENCE Achothg Milwaukee Normal 1, Z5 Spanish Cl'ub5 Y. W. C, A. Thesis-The Back to the Land Movement. is .wII..IIIIi.II..IwI.w.II.m..i..i..v.l IIiiIuiinIinuiIIiIniinimiiimmmimiiii Page 10 ..,, I A K X 2 ADI 4 J 4565 3 Z5 ,,.. W-.. I I n III III mu I II Imru II mimi I IIIIIIIIIIIIIII I III I I I I I mini I RAY COOLEY ....... Chicago, Ill. HOME ECONOMICS Achothg Omicron Nu, W, A. A., Euthenics, Wahzeda Camp Fire, Baseball 1, 3, 4, Wearer, Indoor Baseball l, 3, - 4, Varsity. Thesis-A New Stain for the Bacterial Colonies in the Lit- tle Plates. i GLORIA O. COOPER ....... Baraboo LETTERS AND SCIENCE Alpha Gamma Delta, Red Gauntlet, Secretary 2. Thesis-The Isolation of Cholesterol and Phytosterol by the Digetonin Method. MARIONJULIA COREY . .... De Kalb, Ill. LETTERS AND SCIENCE Northern Illinois State Normal School 1, 2, W. A. A., Outing Club, Board 4, Wearer-, Varsity Basketball 4, Varsity Track 4. Thesis-Strength of Normal School Children as Tested by the Method O E. G. Martin. ARTMAN I-IOVEY DAI-ILE . . . Madison . AAN.. MEDICINE Gamma Tau Beta, Lawrence College 1. Thesis-Topographical Anatomy. ELEANORFAIRCHILDDANA . . . . Eau Claire LETTERS AND SCIENCE Gamma Phi Beta, Milwaukee-Downer lg W. A. A. 3, 43 Tennis Z. Thesis-Seneca and Marlowe. MARY FLORENCE DANFORTH . . Washington, Ill. HOME ECONOMICS Illinois Wesleyan University lg Euthenics Club 3, 4. Thesis-Co-operative Kitchens: Past, Present, and Future. FLORENCE DEAKIN . . . Waukesha "Teddy" LETTERS AND SCIENCE Gamma Phi Beta, Milwaukee-Downer College l, 2, French Club 3, 4, Cardinal 3, Coed Cardinal 3, Badger 3. Thesis-A Study of I-Iardy's Women. WILLARD O. DEI-INE . . Waupun Ajoe.. MEDICINE Alpha Kappa Kappa, Marquette University l, Z, Biologi- cal Seminar l, Z. Thesis-Etiology of Epidemic lnfiuenza. EDWARD Louis DEUSS ..... Sheboygan ..Ed.. LETTERS AND SCIENCE Chi Phi, Iron Cross, Sigma Delta Chi, White Spades, Stu- dent Council 3, President 4, Hesperia l, 2, 3, 4, Forensic Board 4, Press Club 4, Daily Cardinal Z, University Editor 3, Managing Editor -ipjoint Debate 3, Semi-Public Debate 3, Publicity junior Play Committee 3, Forensic Editor 1919 Badger. ROY MARTIN DEWITT . , . Montfort LA NV Phi Alpha Delta, Platteville Normal School l, 2, Black- SLOYIIGTI. IIIWIIInIIIIInII-IIIIIIIIIIIIIIIIIIIIIIII .I IIIIIIIIII InIIIIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIII Page102 "" . I I I I i 'I I i I I a I STEPHEN T. DEXTER . , , Elroy "Sieve" AGRICULTURE Northland College I. 2, 3: Y. IX4. C. A. Thesis-Feeding Dairy Calves. DOROTHY DIMOND .... . Albany, Ill. MEDICINE Thesis-Topographical Anatomy. ANNETTA DONKLE . . . . For! Ailzirison "Neal" LETTERS AND SCIENCE Kappa Alpha Thetag Northwestern University I 5 W. A. A.1 Dancing 13 Baseball 3. Thesis-'I he Development of the XVht:at and lvlilling In- dustry in Xvisconsin. DOROTHY R. DOPP ..... Davenport, I a. ECONOMICS lgpha Gamma Deltag Iowa State University I, 2, 35 Py- t 'a 4. Tlliesis-The Replacement Of Men by Women in lndustry. GRETCHEN DUNAWAY . . . . Sikesion, Mo. LETTERS AND SCIENCE Kappa Kappa Gammag University of Missouri: Glee Cluh. Thesis-Development of Soldiers' Homes in the United States Since the Civil War. GEORGE E. DUNN . . . . Milwaukee "Bunk" CHEMISTRY Ivlilwaukee Normal School I, Z. Thesis-The Development of New Coal Tar Bases for Dyc- stuff Manufacture. MJENNETTE DUNWIDDIE . . . Delavan ujimmien ' HOME ECONOMICS Thesis-Study of Dietaries in Army Camps and Base Hos- pitals. I-IENRYJ. DUWE .... . Middleton "Do we" COMMERCE Commerce Club. Thesis-An Outline for a Course in Cash Accounting. HOWARD O. EATON . ..,.. Madison LETTERS AND SCIENCE Hesperia I. RICHARD HOIT EDE . . . Madison "Dick" CHEMISTRY Sigma Nu. l Page103 iiiimiiiiii iiimiiiiiiiiiiiiim I I I HiiiIIiIIiiIIIIIiiIiiIIIIInIIIIIiiInIiiIiiimiiiiiiiiiiiiiiiiiii I 4 W 1 A IW ? ' T 4 ' f.., K I I Q: iiii! 3 f CHARLES ARTHUR EDWARDS . . Lewistown, Mont. COMMERCE Dakota Wesleyan University I, 2, 33 Football, Assistant Coach 4. BERNADO W. ELSOM ., . . Madison "Doc" LETTERS AND SCIENCE Star and Arrow 3, 45 Artus 4g Cross Country 43 Track 33 Athletic Board 4. Thesis-Public and Private Schools in Wisconsin. LOUISE L. EMERSON ,... Ekalalza, Mont. "Louie" LETTERS AND SCIENCE Pythia 2, 3, 4, Rocky Mountain Club I, 23 Y, W. C. A. Cabinet Council 3, 4, Blue Dragon, Secretary 4. Thesis-The Woman Suffrage Movement in Montana. MARTHA ENGEL . . ..... Sun Prairie LETTERS AND SCIENCE Milwaukee-Downer College 1, 23 Y. W. C. A. 3, 45 Suffrage League 43 S. G. A. Board 3. Thesis-Shrubs ol' Madison and Vicinity. SAMUEL NOAH EPSTEIN . . . Madison ..Eppie.. CHEMISTRY Thesis-The Manufacture of Resorcinol. QIOSE ESCABI ..... Mayagiiez, Porto Rico MEDICAL SCIENCE Thesis-The Relative Size and Position ofCertain Abdomi- nal and Pelvic Viscera in the Foetus Child and Adult. IVIARIE M. ESCH ....... La Crosse "lWari" LETTERS AND SCIENCE Pi Beta Phi: La Crosse Normal School I, Z1 Suffrage Lea- gueg Consumers' League. Thesis-The Development Ol' Harpers Magazine from l85O to 1900. I-IARRISONEVANS . . . . . Shuquaiak,Miss. LETTERS AND SCIENCE Phi Delta Phig University of Mississippi I, 2. IVIILDRED CAMPBELL EVANS . Grand Rapids, Mich. LETTERS AND SCIENCE Editor-in-Chief NVisconsin Literary Magazine 4. Thesis-Alfred De Vigny: The Philosophy Of His Poetry. LUCILE EVERETT . . . . Denver, Colo. "Evie" LETTERS AND SCIENCE Delta Delta Deltag W. A. A., UW" Wearerg Hockey Team 2, 4, Varsity 4, Bowling Team 33 Dancing Team 43 Honors 4, Assistant Business Manager 1918 Badger. Thesis-The Statical Work Done by Human Muscles in Continued Contraction. .www-I liiilwiimiiiiiiiimliii .I .I I II mi iliiiliiililiiiiiiiiiliiiGliiiiiiiiiiiiiiiliiiiiiliiiml 'mmm' mn I Page 104 JOEINA M. EWE .... . Lo Crosse "jean" LETTERS AND SCIENCE Germanistische Gesellschaft 2, 35 Cercle Francais 4. Thesis-l'Iorace's Philosophy ol' Life, ISAREN FREDRIKKA FALK . . Sloughlon "Colonel" LETTERS AND SCIENCE Alpha Omicron Pig University ol Chicago I5 Pyihia 2, 3: Consumcrs' League 3, 45 S. G, A., Executive Council 4: Y. NV. C. A.: Cardinal Advertising Stall' 4. Thesis-Rise of Industrial NVorkcrs ol the XVorlcl. JOHN MERRILL FARGO . . . . Ml. Horeb "Eddie" AGRICULTURE Philomathia Literary Society: Agric Crew l, 25 Agric Bas- ketball 3. Thesis-Cotton Seed Meal and Silage vs. Corn, Cotton Seed Meal and Silage at a Ration for Fattening Steers, CLARA VIERLING FAUERBACI-I . . . Madison LETTERS AND SCIENCE Kappa Kappa Gammag University Orchestra 25 Union Vodvil 2. LAURA ELIZABETH FAVILLE .... Lake Mills HOME ECONOMICS Alpha Phi5 Omicron Nug Bowling l, Z, 35 Varsity Z5 Hockey l, 2, 35 W. A. Board 3, -L MARION E. PAY ....... Madison LETTERS AND SCIENCE Kappa Kappa Gammag Class Bowling Team l 5 Class Bowl- ing Squad 2. KATHERINE FEDDE ..... Peilone, Ill. In ..K.. LETTERS AND SCIENCE Delta Delta Delta5 Clef Club 3, 4, Treasurer 45 Castalia 35 Musical Director 3 5 Scoops Club 25 Suffrage League 35 Class Bowling Squad 35 Sophomore Dance Committee5 Co-ed Cardinal 25 Advertising Manager Badger 45 Assistant Advertising Manager 3. Thesis-The Conflicting Natures in Grillparzer as Shown in I-Iis Life and Dramas. GLADYS FELLOWS . ...... Racine LETTERS AND SCIENCE Chi Omegag W, A. A.5 Y. W. C. A.5 Indoor Basehall l, Var- sity I, 35 Track I, 35 Hockey 2, Varsity 3, 45 Wearerg Blue Dragon, President 45 Union Vodvil 2. AUCUSTAR.FELSHER . . . . Madison "Srniles" LETTERS AND SCIENCE Menorah Society, Secretary 1, 2, 35 Executive Board 45 Banquet Committee 2, 35 Consumers' League 3, 45 Minne- toska Camp Fire Girls 45 Cercle Francais 45 University Zionist Society 3, 45 Germanistische Gesellschaft 2. 35 Women's Equal Suffrage League 2, 3. Thesis-Determination of the Solution of Boric Acid in Solution of Ammonium Dorate. WIRTI-I FITCHFERGER . . . Chattanooga, Tenn. ECONOMICS University of Chattanooga 15 Artusg Ski Club 45 R. O. T. C., Captain 35 Y. M. C, A. Cabinet 3. A Thesis-Peace Time Extension of War-Risk Insurance. 'Q v 2. A - X, 5 f 5 I f I i-i I - A f I W - 'f,. , , I af f' " 'ivr " "' ' ' I I fr " W 3 rj , 2 X .V I V , , Alf 4 as in A 'fi .ee " . ,,.... .55 1.. Z! V yll. .Q ,. Q. V: . .. ' "?' " 1 2" "lA"' 1 li . fv-. - J li" lilsizif f .ff ill 'I 5'5" i ,Z-, ,V ,.. .,,, , A .,,.. " ,.'. fi X v..' -iii Q . m .,.- -.'. .IIIIII-IIIiIii.I.IIIiI.iiiiiiiw.iI.ii.IIIIII..iI., IiiIiiIElililliiiiiiiiiiiiiiliiiiiiII.IIIiIIiiiiiiiiiiiiiiiiiiiiiii Page105 MABLE GRACE FERNALD . . . . Madison HOME ECONOMICS Swimming lg Tennis I, 2. BLANCHE FERREY ..... St. Paul, Minn- LETTERS AND SCIENCE Delta Gammag Winona Normal l, 2. ghesis-A Study of Some of the Children in Dickens' ove s. MARGARET FRASER FERRIS . . Osage, Ia. ..Peg.. HOME ECONOMICS Alpha Xi Deltag Milwaukee-Downer College lg Consum- ers' League 2, 3, 45 Euthenics Club 3, 4g Suffrage League 45 Congregational Students' Association Cabinet 4. Thesis-Some Conditions Affecting the Health and Morals of Women Employed in Mercantile Establishments, Hotels, Laundries, and Garment Factories. HAROLDM. FIELD . . . . Oelwein,Ia. ..Hal.. LETTERS AND SCIENCE Lambda Chi Alphag Edwin Booth I, 2, 3, Treasurer 4, Union Vodvil 23 French Play 35 Iowa Club, Red Domino- Edwin Booth 2, 3, junior Play 3, Senior Play 35 Junior Open 33 Assistant Chairman Camp Entertainment Com- mittee. Thesis-The Origin of Speech: Some Studies in Emotional Reactions. LUCY LOUISE-GARBE FINNER . . Dodge "Loose" CHEMISTRY Thesis-Monarda. GRACER.FINUCANE . , . . Amiga "Figgie" HOME ECONOINHCS Euthenics. FINLEY LELAND F 1sEEck . . Terre Haute, I nd. "Fizz" civit ENGINEERING Triangle, Hoosier Club lg Gym Team lg Wisconsin Engi- neer, Business Manager 4. IVIARY T. FITZMAURICE . . . Beaver Dam "Fitz" HOME ECONOMICS Thesis-The Study of Milk Agae as a IX-4edian for Various Bacteria. CATHERINE LORETTA FLEMING . West Allis "john" LETTERS AND SCIENCE Alpha Omicron Pig Milwaukee Normal l, 25 Red Domino 3, 4, junior Class Play 3. Thf3ifgThe Word of William Jennings Bryan from 1913 EO . Wl1.1,1AMj.FocRE . , . . . Chicagalll. MEDICINE University of Chicago I, HThesis-Congenital Anomalies and Malformation of the CSIT. . .-iHiiniI.iiim.ii.ii..i..iii.i,.ii. iniiiiiniiiiuiiniinuimiiiiiiiinwiii-iii i Page 106 awww"IW"-'I""' L.,,............ -.t....-..,. ,.L...,-.:...: '-.:....:t.....L. .,. sig EI I IRENE FOLCKEMER ..,.. Camp Point, Ill. LETTERS AND SCIENCE Alpha Omicron Pig Rockford College I, 23 Glee Club 3, 43 1920 Badger Staff 4. Thesis-The Education ol' an Enlisted Man in Peacc Time. MILDRED LUCILE FRAZIER . . . Madison "FrazlIe" LETTERS AND SCIENCE Phi Beta Kappag Y. W. C. A., Cabinet Council: W. A. A. 2, 3, 43 Castalia Z, 35 Bowling Z, 3. Thesis--Motional Impedance of Marine Receivers. ERNEST FREYMILLER . . . Wooclman DFW.. MEDICINE H Hesperia 2. 3. 4. Thesis-The Action of Dyes on Experimental Animals. EVELYN A. FRISH ..,.... Madison NEW.. LETTERS AND SCIENCE Thesis-Soil Fungi, MIRIAM FRYE ........ Madison LETTERS AND SCIENCE Phi Beta Kappa. Thesis-The Paper Money Literation During the War. IRENE E. GALVIN . . . . Benton, Ill. "Rene" LETTERS AND SCIENCE Northern Normal and Industrial Schools l, 2. Thesis-The Effect of Solvents on the Decomposition of Methyliodide. RACI-IAEL MARIE GAUSMAN , . Madison MUSIC Choral Union 3, 4. I-IULDAH GERDS' . , A . . . . Milwaukee LETTERS AND SCIENCE Thesis-Co-operation Between the Federal Employment Service and Corporation Employment Departments in the Reduction of Labor Turnover. MARTHA GIBBON ....... Madison LETTERS AND SCIENCE Thesis-The Relation of the Proposed System of Com- pulsory Health Insurance to the Insurance Companies Now Operating Within the State. J. CURRIE GIBSON ..,. . Oshkosh "Gibbie" COMMERCE Glee Club. Tlhiesis-Business Budgets and Capital Stock at no Par a ue. 'Q ,f 91 .Qu jf .iii..I..I..IiiIii.I..I.iiiiiiiiiiiiimiiiiiiii-iii .. I i I I i iiimiiiiiiininIimiiIiiiiiiiiii-iiiiiiiiiiiiii Page 107 iii.iiiiiiiiwiiiiiiiiiiii iimiiiii iii in ii iiiiiiiiiiiiiiiiiiiiiiii i . I ig- f . ,Lk, H i ,,., 1 X I . . " "'i1 ' f I I .L,L I .gi I 'ff'jE, 22 1 .I S1 i- A QI-.g.1qIQf2:29Tir1 1:54 61-12 f'.-,. i fl-3"f2' :'. A A .y . . .. ' '-L. T .r. f A . ccls ,,V. . I Q ,V.. FV Q . .Ak.:,, . . ,4,,. ,AA X . , , 51. fr , 152' 'i fgf.. I f A I .,.. ' I: I .. . a..f.-W X' " - If. -i .. -fy -.-M ' f - we - . I 5 i l Q. I.. z r L. E1 W W. . I M . Ea? Z A 7 ' .X al I I tl . Ia i' I ' I A 'I V, 2 It '-" I 'El' - ,Q .4 - f-- , .. - .,g. 5 , 'f f '-' I , .,,.. f f i ii II v in II I I I I an I I viii nl nu I HERBERT GLAETTLI ...... Milwaukee "Hub" CIVIL ENGINEERING Triangle: Tau Beta Pig Civil Engineering Society, Gym- nasium Team 35 Band I, 2, 3, Orchestra Z, Engineers' Min- strels 1, Union Vodvil 3. GRACE C. GODDARD ...... Madison LETTERS AND SCIENCE Pi Beta Phi, Glee Club 3, 43 Choral Union 3, 4. Thesis-Some Studies in Bret I-Iarte's Development of Character. -BENJAMIN GOLDEERG . . . Antigo "Goldie" MEDICINE IVIADELINE HENRIETTE GOLDMANA . . Milwaukee Ullfladdyu LETTERS AND SCIENCE W. A, A., French Club, Dancing Honors, Dancing Team 3. Thesis-Papers on Corneille, Racine, and Moliere. HENRY LAWRENCE GOTFREDSON . . Green Bay DAHGRILII COMMERCE Sigma Alpha Epsilon, Tennis Club: Commerce Club: Var- Sity Team Z, 3, -lg Intramural and Interclass Baseball 3. GENEVIEVE GOUCH . .... Booneville, Incl. HOME ECONOMICS Alpha Gamma Delta: Euthenics 2, 3, 4, Consumers' League 2, 3, Treasurer 2: Tennis 25 Secretary Yellow Tassel 3. JAMES A. GOUGH . . . . . Sugar Bush MEDICINE Phi Beta Kappag Sigma Sigma: Gamma Tau Beta. Thesis-The Arterial System oflvlan as Seen by the X-Ray. VIOLET E. COULD .,..... Norwalk LETTERS AND SCIENCE La Crosse Normal I, 2. Thesis--Indian Relations in Virginia Between 1740-1760. ELSIE DOROTHY GRABER . . . Mineral Point MEM.. I-IOME ECONOMICS Thesis-Relative Proportion of Food, Clothing, Rent, and Other Items in the Budget. DOROTHY PATTERSON GRACE . . Oak Park, Ill. LETTERS AND SCIENCE Pi Beta Phig lviystic Circle. Thesis-The Women ofj. M. Barrie. .IInIinIIIIIIIinI.IIniIniI..I..Ii.Ii.II.-Milli.. , IIIiiIinImIm.mmIIIinnummu-Immiiliiiil I y I Page 108 LOTTIE C. GRAF .... ' .... Sparta LETTERS AND SCIENCE La Crosse Normal School I, 2g Pythia 45 Y. XV. C. A. 3, -lg SuHrage League 4. 'Ihesis-l'he Effect of Housing on the Assimilation of the Immigrant. FLORENCE MARIE GRAPER . . For! Atkinson "Bud'A HOME ECONOMICS Omicron Nug Euthenics 2, 3, -lg Vice-President -lg Outing Club 43 W. A. A. Thesis-The Effects Oflvlineral Salts on the Physical Char- acteristics of Gluten. IXflARION C. GRATZ .... Pemberton. .N. j. .-Gflllilldu LETTERS AND SCIENCE Swarthmore College l, 2. JAMES E. GREENBERC . . . New York, N. Y. LETTERS AND SCIENCE Iowa State College I: Athenae Z, 3. 43 Censor 43 Sociedad Hispanica 2, 3, 4, Vice-President 41 Menorah Society 2, 3, 4, Treasurer 43 Ski Club 25 Swimming Squad 23 Spanish Play 3: Circulation lvlanager Daily Cardinal 2: Circulation Manager Badger 4. Thesis-Export and Import Railroad Rates and Factors in Foreign Trade, DOROTHY N. GREENE ..... Milwaukee LETTERS AND SCIENCE Milwaukee Normal I, 23 Pythia 3, 4. Thesis-The Spirit Of Personal Liberty in Wordsworth and His Immediate Predecessors. MILTON E. GRIEM . .... New Holstein "Bill" AGRICULTURE Alpha Chi Sigmag First Regimental Band l, Z, 3, Freshmen Baseball. MAE GRONDYKE .... Crawfordville, Ind. HOME ECONOMICS Kappa Alpha Thetag Western College lg Indiana Univer- sity 25 Omicron Nug Euthenics Club 4. Thesis-Home Work in the Clothing Industries. ALMA ELEANOR GROSS . . . . Duluth, Minn. LIBRARY COURSE Thesis-Arthurian Romances as Classics for Children. HAROLD MARTIN GROVES . . . . Lodi "Harry" "AHeclc" LETTERS AND SCIENCE Phi Beta Kappag Delta Sigma Rhog White Spadesp Iron Crossg Hesperia, President 4g Sophomore Semi-Public Debate 23 Student Council Of Defense 3, 43 Forensic Board 43 Intercollegiate Debate 2, 3g joint Debate Closer 35 Winner junior Openg Winner Senior Open Oratorical Con- test, Class President 43 President Student Senate 4. Thesis-Intercollegiate Debating. ' MADELEINECUILLEMIN , . . Norzhllflilwaulzee LETTERS AND SCIENCE ' Thesis-The Sulphur Content ofthe Keratins. '-s I.mi..i..w.i..i..iii.I... ...Ii iI.Ii.I.. I. ii EiiiiiiiRiRiiiiiiiiiiiiiIiiiiiiiiiiiiiiiiiiw Page 109 A 'lil T7 X X. ' V .2 an l W ."' f yf i : 'Cf I' af 7 l A is ' K I .. 5 .fl if 735' . ' . g f A ,. f g, f j ' X ,.. 5,:at,,., I f r I f a I I Q , -'-sf ' . .7 -, , .E.. . - .- fr 1'- 1 f f -' i"l ' 12- ' ""' , ik ? I" l""' s'f' I ' , Z 4 Z ii I I I iiniii iii iii I I ii E. JOSEPHINE HADLEY . . . Stoughton ..Jo.. LETTERS AND SCIENCE Castalia 3, 43 Y, W. C. A. 3, 4, Ehesis-Wagon Trails and Trades of Wisconsin in Pioneer ays. MILTON A. HAKER ....... Portage LETTERS AND SCIENCE Ripon College lg German Club Z, 35 Luther Student Cabi- net 4. Thesis-An Historical and Comparative Study Of the Pro- posals for the Establishment of a League of Nations, from the Time of Dante to the Present. LAVONNE HANNA . .... Clay Center, Kan. "Vonnie" LETTERS AND SCIENCE Lindenxvood College l, 23 Suffrage League 3, S. G. A. Board 31Y. W. C. A. Cabinet Council 4. Thesis-The Neutrality of Belgium. MAURICE MILLER HANSON . Madison "Moose" CIVIL ENGINEERING ' Theta Xi: Philomathiag Track I, 2, 3, 43 Athletic Board 4, Student Senate 4, Fraternity and S. A. T. C. Editor, Liberty Badger: Class Executive Advisory Com- mittee 4g Chairman "NV" Dance 4. RAYMOND OSCAR HARDINC . . Madison .Raye COMMERCE Phi Kappa Psi, Beloit College 1, 2. Thesis-Intelligent Labor Legislation a Benefit to Produc- tion. MYRA SUSAN I'IARKER .... "NH" LETTERS AND SCIENCE Alpha Chi Omega, Clee Club 21 Choral Union I, 23 Inter- Sorority Bowling 25 Twelfth Night 2, 3, 4, Vice-President 33 Union Vodvil 33 Twelfth Night Play 3. Thesis-The Free Theater in France and its Effect on the Little Theater Movement. DOROTI-IY B. HARRISON . . Madison E MDM.. LETTERS AND SCIENCE Chi Omegag Whitewater Normal l, 23 Castalia. Thesis-Dickens as an Historical Novelist. , ALFRED F. HAUBRICI-I . . . Kenosha NAU.. MECHANICAL ENGINEERING Baldwin Wallace College 1, 25 Wisconsin Engineers Clubg A. S. lvl. E. ThesiSRAnnealing of Steel. RUBY LOUISE HAWN ..... . Ruby MIDDLE AGRICULTURE Alpha Gamma Delta. FRANCES HAY ......... Beloit LETTERS AND SCIENCE Beloit College l,l 23 Spanish Club 3, 41 Orchestra 3, 43 Wah- zeda Campfire Group 4. Thesis-Color and Sound in the De Rerum Natura of Lu- cretius. iiwiiiim-.ii.ii..i..imi..ii. mm.. ii. ... .iiiiimi gi. .iiwiiiu Lmmfgi ll I lil l ill I illl l A li I IliIniiliiniilliiiiilliiliillivlivlliil ll I l N P a g e I I 0 JAMES M. I-IAYDEN . . . . Madison COMMERCE Commerce Clubg Philomathia Literary Societyp joint De- nate 4. Thesis-The Problem ol' Government Ownership of Rail- roads. ' IRMA CHARLOTTE I-IAYSSEN . .... Anligo LETTERS AND SCIENCE XV. A, A. 2, 3, 4, Board 43 Outing Club 3, -I, President 4, Suffrage League Cabinet 4. Thesis-The Reorganization of juvenile Court NNork in XVisconSin. ELIZABETH R. HEAD ...... Madison LETTERS AND SCIENCE Delta Gamma: W. A. A, 2, 3, -Ig Y. W. C. Ag Black Bat: Hockey l, 2, 3, 4, Varsity -lg Basketball I, 2, 3, -I, Varsity 3. Thesis-Tibullus: Character and Personality as Shown in His Works. RENA HEDDLE5 . . ...... Madison I, LETTERS AND SCIENCE Gamma PhitBeta: Blaclg Bat 2. Thesis-Bibliography ol' Design Principles. FLORA WILI-IELMINA HEISE . . Green Bay i'FIo" MUSIC SUPERVISOR Theta Sigma Phig Pythia Z, 3, Censor 3, Program Commit- tee 35 Choral Union 2, 3 3 junior Orchestra I, 25 Basketball Tournament I, 23 Cardinal Stan 2, Associate Woman's Editor 1920 Badger 3. ALFRED N. I-IEUSTON .... Tacoma, Wash. AAI.. LETTERS AND SCIENCE Chi Phi, University of Washington l, 2. MORRIS LEROY HICHCOCK . . Edgerton "Hitch," "Pele" CHEMISTRY Lambda Chi Alpha. Thesis-Determination of Boron in Commercial Potash. FRANCES LEANORA HIGLEY . . Waukegan, III. "Fran" MUSIC Sigma Alpha Iota: Northwestern University lg Clef Club 4, Suffrage League 23 Castalia 4. PEARL CORINNE I-IILL ..... Spring Green "Tum", "PIO" PUBLIC SCHOOL MUSIC Choral Union I, 2. MARIE EMILY I-IJERMSTAD . . Red Wing, Minn. "German LETTERS AND SCIENCE Alpha Phi, Mortar Board, Treasurerg Y. W. C. A., Treas- urer 45 W. A. A., Treasurer 3, Board 43 Union Vodvil 2, 33 Badger Staff 3. Thesis-The Relation of the Shoe to the Strength and In.II.IIinIui.IIIIIIInInI.III-III-III.Im..wiI IIIIIIIIIInIIIIIIIIIninInmuIiiimiiiiiiiiiii-I Page Ill I Flexibility of the Foot and to Posture. I , I I I I I n I in III II Ii I I TEH KUEI Ho . . Kinghwa, Chekiang, China "Doctor Ho" COMMERCE Peking Government University I, 23 Chinese Students' Al- liance in the United States, Wisconsin Chinese Students' Club, Secretary 3, Treasurer, President 45 International Club, Treasurer 4. Thesis-The Operation of the New York Money Market in War Time. ALICE E. HOFFMAN .... . Madison CHEMISTRY Wahzeda Camp Fire 1. Thesis-The Analysis of Certain Plants Found in Lake Mendota. BEATRICE MURIEL HOGAN .... Madison LETTERS AND SCIENCE FRANCES E. HOLFORD . . Cassville "Fran" MEDICINE La Crosse State Normal l, 25 Y. W. C. A. 3, 43 Suffrage League 3, 45 S. C. A. Board 43 Pythia 4. VIOLA HOLLENSTEINER . .... . Milwaukee LETTERS AND SCIENCE ' Milwaukee Normal l, 23 Pythia 3, 45 Barnard Counselor. Thesis-Shelley'S Democracy. l:RANCESE.l'lOLMBURC . . Grand junction, Colo. "Fran" JOURNALISM University of Colorado I Q Colorado State Teachers' College Z5 Press Club 3, 4, Thesis-A Comparison of the War Policy of the New York World and the Chicago Tribune. PRESLEY DIXON HOLMES . Southwest Harbor, Me. "Pres" CHEMICAL ENGINEERING Phi Kappa Sigmag Alpha Chi Sigma, Phi Lambda Upsilong Chemical Engineers' Club, Secretary-Treasurer 3, Presi- dwtillg Engineers' Club: Football l, 23 Swimming l, Z, 35 ETHEL M. HOLT ....... Cambridge LETTERS AND SCIENCE Y. W. C. Ag Suffrage League. ELIZABETH-l.l'lOOPER . . . Elkhorn "Betty" . CHEMISTRY Cardinal Staff 3, Advertising Ivlanager 45 Organization Editor Badger 4. Thesis-Nitrogen and Fat Determination in Caseins. PERLE MARY HOPSON . ..... Madison I , , H-.. ....V......,,,....,,,,,..,,.., .. .....,,. ......,,, ...... . ............,.--.----M my W W 5 nwee.. ? LETTERS AND SCIENCE Pythiag W. A. A.3 Y. W. C. A.g German Christmas Playg 5 Daily Cardinal 23 Badger Board 3. 'E Thesis-The Development of the English Drama in the Early Nineties, Page 112 I I I II I II I II II IIIIIIIIII II II IIII II III I I I II II II I MAE I-IORTON ..,.... Pardeeville HOME ECONOMICS Euthenics. Thesis-A Portion and Cost Study of Fresh, Dried, and Canned Fruits. LAzARus I-IERMAN I-loRwITz . , Sheboygan "Luz" MEDICINE Thesis-Topographical Anatomy. I-ISUEI-I HAI I-ISIEH ..... IVusil1, China msec.. LETTERS AND SCIENCE Theta Delta Gamma, Chinese Students' Associationg Inter- national Club, French Play 2, Athletic Board. RUTH ANNE HUGHES . . . Downers Grove, Ill. LETTERS AND SCIENCE Delta Delta Deltag Consumers' League: Y. W. C. A. Thesis-Study of the Indians in Coopers Stories. MARIETTA LUCILE I-IULEERT . . . Burlington LETTERS AND SCIENCE Ripon College I 2. Thesis-History of Racine, Wisconsin. from 183-I to 1800. PAUL I-IUNTZICKER ...... Greenwood CIVIL ENGINEERING RUTH BING1-IAM HURLBUT ,... . Omro LETTERS AND SCIENCE Oshkosh Normal l, 2. Thesis-Virgil in the Magazines. GRACE I-IUTCHINSON . . . . Grand Rapids, Ia. LETTERS AND SCIENCE Coe College I, 2, French Club. Thesis--Papers on Cornielle, Racine, and Moliere. MARGARET I. I-IUTTON . . . . Madison HOME ECONOMICS Omicron Nu, Bowling 1, Z, 3, 4, Captain 2, Varsity l, 2, 3. Thesis-Feeding Experiments with Isolated Fractions of Brain Lepoids and Brain Protein. FREDERICK WALKER IRISI-I , Washington, D. C. LETTERS AND SCIENCE-PHARMACY II Y I. fl I H N T l I I I ? ' " ,A .i2:i. I' f - I j l 3 , 5 ' . ' - S .7 Qi ' Ie X , . 3 I . jf . ,fi 1.:'f' ' fif- ' It V. 2112 A' M ., I I I. I MBU , I :I 'Neg X 0 5 , ,W ,D ,. , I I se' E1 If - S I, 1 f e . I' ., . V I ' E X' 1 if ., c I In zl A f .e 2 , X I E SS vi If-"mx OX NN , fa ,ZW csv? ff swf., ggi? f Q! X rw? mi I Q' -4 I 1 W I , .I I . R , . 4 N A E ll 'dll Q 7 'Nz f ' jf I ! ,Y I f f f . Q, 3,,..,' fx ... 'gm 3? V 3 , Q if :rp . I, . -'1:ia.if I p .I,. f . . ,., fi. -If 4' , 1:-we--1 I. Q Q ' I , .ZQi,mW .-9.4. ! ., ." '-,, , ' .- "X 4 y Q A --. fa... f 4 e In -I -'z +I, . I . own., my-I -UWM Q 524-A' .Z 1' fe' "-I-' TC ma.: L" 71' .' Lv f -L 'V.- - ' IIIIIIIIIIIIIIIIII.II.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII s I II II I I IIIIIII I IIIIIII II IIII II I I II I I IIIIII I III I I Im IIIIIIIIIIIIIIIII I II I I I IIIIIIIIIIIIII IIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIII II Page 113 gmnmmmimmummrmnmmmnmmmnmmmm I ' 1 : 1-ummm..mmm..mmmmiIu.Ii..Iim.Il E , myinII.-II..m..f,m..i..If. L ,.............-.-...-... CLIFFORD E. IVES ..... . . . Sharon MECHANICAL ENGINEERING Ohio State University 15 American Society of Mechanical Engineers. HELEN KATHARINE JACKSON . Sistersville, W. Va. ..Kay.. LETTERS AND SCIENCE Alpha Omicron Pip Wells College I, 23 1920 Badger Staff. I'hesis-The Development ofService in the Public Library. GERTRUDE MARGARETTA JACOBS . Detroit, M ich. "Trudie", "jakie" LETTERS AND SCIENCE , Phi Beta Kappag Castalia, Vice-President 3, President 45 Chairman Senior Cirls Swingout 35 Y. W. C. A., Cabinet Council 2, 3, S. G. A. Board 4, Keystone 4. Thesis-Philanthropic Initiative. ANNA JAMESON ....... Fulton, Mo. ..Jimml.g.. LETTERS AND SCIENCE Alpha Chi Omzgag William Woods College I, 2, Suffrage League, Y. W. . A., Consumers' League. Thesis-French War Finance. DACMAR JENSEN . . . . Racine ..Dag.. LETTERS AND SCIENCE Y. W. C. A. 2. Thesis-Comparison of King Lear and Oedipus the King. GLADYS JOHNSON .... . Waterloo, Ia. 'ijohnnieu LETTERS AND SCIENCE Gamma Phi Beta, University of Idaho l, 2. Thesis-The Women of George Moore. luLIA JOHNSON . ....... Portage ' LETTERS AND SCIENCE Alpha Omicron Pig Glee Club Ig W. A. A. l, 2, 3, -lg W 5 Swimming, Track: Baseball. Thesis-'I he Skirt as a Factor in Fatigue. IVIARCARETJOHNSON . . . . . Portage ..MllgS" LETTERS AND SCIENCE Alpha Omicron Pig Pythia I, 2, 3, 43 Glee Club 45 W, A, A. 2, 3, 43 Y. W. C. A,g Indoor Baseball 3:OutdoOr Baseball 3. Thesis-The Entrance of Women in lndustry in America. NICHOLAS S. JOHNSON . . . Ohio, Ill. ujalinnieu MEDICINE Gamma Tau Beta, Notre Dame I, 2. Thesis-The Colorometric Determination of the Haema- Eliobiln gontent of Blood, and a New Standard for SohIe's et O . KATHERINE JONES .... . Milwaukee HOME ECONOMICS Delta Gammag Milxvaukee Normal I 3 Y. W. C. A., Cabinet Council, Consumers' League. Y -........-..-.... ..... W... II1.IinI.III..H.IinI.II.Hm..l..I.m.ll...l I .Imi..ll..m..m.w-lu., ml. - Sawmi- """""""' .II.IITEliiililiiilLEIBElillilliiiiliiiliEiimiiliilliill 'A""3""""N""""""' Page 114 IVIARGUERITEEDXVARDSJONES . . ForLAlkinson LETTERS AND SCIENCE Chi Omegag Oberlin College lg Glee Club 3, 43 Cardinal, Business Stan' 2, Assistant Business Manager 33 Advertis- ing Manager Badger 33 Social Settlement 3. Thesis-Development of the Dramatic lnst inet Through the Medium of Rythmical Bodily Movement. THELMA PAY JONES ...,. LETTERS AND SCIENCE Delta Zeta. Thesis-Behavior ol Bunodera Lucipercae. FREDERIC T. j UNO ..... 3 CHEMISTRY Thesis-Electrolytic Deposition ol' Alloys aqueous Solutions. RALPH KARCER ......, LETTERS AND SCIENCE Artus3 Varsity Track. 1Rv1NW.KEEBLER . . . . "Keelvs" CHEMISTRY Alpha Chi Slgmaj Marquette University 1. Thesis-The Effect of the Addition of Sucro in Condensed Milk. DOROTHY ELIZABETH KENNEDY . . LETTERS AND SCIENCE . Madiso11 . Sheboygan from Non- Milwaukee Milwaukee se on Lactose . Ashland Castalia 3, 4, Treasurer 33 French Club 43 W. A, A. 3. 43 Vocational Conference Committee 33 Badge Thesis-The Attitude of the State Toward America. MARY KEYES ....... LETTERS AND SCIENCE r Staff 4. the Child in . Madison Thesis-Book Reviewing in American Magazines, 1810- 1800. HILDA LKIECKHEFER f . . Milwaukee im.. LETTERS AND SCIENCE Alpha Chi Omega3 Red Dominog Union Vodvil 33 Edwin Booth-Red Domino 23 Chairman Alumni Committee 3g Mathematics Clubg Suffrage League. Thesis-First Part: 1-Iyper-Complex Number, FLORENCEI-1. KING . . . . Milwaukee ..Kink.. LETTERS AND SCIENCE Delta Gammag W. A. A. l., 2, 3, 43 Y. W. C. A. 1, 2, Cabinet 3, 43 WCSFCFQ Badger Board 23 Women's Editor 1919 Badger3 Student Council 43 Cardinal Staff Z, 33 Co-Ed Cardinal 33 Sophomore Dance Chairman 2. Thesis-Ergographic Experiments on Right and Left Hand- edness. GERTRUDE P1-IYLLIS KING . . . . LETTERS AND SCIENCE Peoria, Ill. Alpha Phi3 Bradley Polytechnic Institute 1, 23 Y. W. C. A. 3, Cabinet 4. Thesis-The Placing Out System for the Care of Depend- ent Children. in ii ii .1 ii ii. . . . . . ii i min... 1 . mimi.1iinin1ii1iiiiininniiiiiiiiiiiiiiwwiim Page Ili' e iff! .edeff D li i ,E 1 i 1 Ev: E., 512 1 1 1 2 5 I al, LE EE ai B., EE 512 EE SEE 215 EE 522 I 3 .2 as s ii :ii iiiiiiiiiiimwii-iii T I I i I 1 n I in I i i i ii i in I in xiii i r iuuuiiniunmniivnuiuuvni ini mu ui inuin4nuuiiuinumminnuun im i im n uri mu TOWER W. KING .... . Madison "Kink" ELECTRICAL ENGINEERING Beta Theta Pig Eta Kappa Nug Colgate University l. Thesis-Calibration of Pitot Tubes for Air Measurements. WALTER A. KOEHLER ...... M ishicot CHEMICAL ENGINEERING Tau Beta Pi. DOROTHY KYLE ...... . ,Tomah LETTERS AND SCIENCE Milwaukee-Downer College 1, 2g Congregational Students' Cabinet 4. Thesis-Vector Analysis. ELEANOR C. KRAEMER . . . Milwaukee AEI.. MUSIC IV ' W. A, A.: Clef Clubg Y. W. C. A., Cabinet 33 Swimming l, Z5 Union Vodvil 3. Thesis-Piano Programme. PAUL STEVENS KRAMER . . Faribault, Minn. "Pablo" LETTERS AND SCIENCE Psi Upsilong Trinity College lg French Play. Thesis-A Translation of Three Essays by Georges Pelissier on the Modern French Novel. MARGUERITE KRAUTH . . Phillips Mpeg.. LETTERS AND SCIENCE Chi Omegag Nlilxvaukee-Downer College I, Z. Thesis-A Study of the Mueorales. GRETCHEN KUEPPER ...... , Milwaukee LETTERS AND SCIENCE Delta Gamma. Thesis-Casein Analysis, HARRIET E. KUPFER ...,.. Kenosha LETTERS AND SCIENCE Alpha Phi. Thesis-Wisconsin State Council of Defense. I-IENRY W. KURTZ ...... Sheboygan CIVIL ENGINEERING Triangle: Wisconsin Engineer, Business Staff 3. MARTHA KURZ ........ Madison LETTERS AND SCIENCE Delta Gammag University of Missouri lg University ol' Colorado 2. Thesis-Literary Editors of the Atlantic Monthly. i-iiinii.iiniiiiiiiiiii.ii.iiimi.iii.ii.i..ii ,,,,,,,,,,, ,,,,,.,, ,,.,,,,,,,, Iiiiiiiimiiiiiiiiiniiiiiiiminiiiiiiiiiuimmiiii """""'A""""""' Page 116 55 T .,K. E32 E! 5 335 EI 52 Q EXE E 5 2 E EE EE is I EE EE I I " ' """""""" """""""""""" ImimiIIIIIIinInIInImimiiiiimiimimiiiiiiimm .mil-miiuimiim Ii I I I I ,I , 'lW""'ll"lil,,,,.,,.,..,.,.....,..-......................WM-............,..........,................,.,......-..................,............,,.,..........,,,.,,.,. .,.,.,..,.... 'l I GLADYS KYTE . . . . Grass Range, Mont. , "Glad" . HOME ECONOMICS I I elplga Gamma Deltag Ward-Belmont College l 5 Euthenics I U . i I . l JEANETTE JONES LAMB ...,. Erie, Pa. . .Ju .. 3' LETTERS AND SCIENCE Alpha Phig W. A. A.: Y. W. C. A., Cabinet Council 43 Swimming 2, 35 Track 2. Thesis-Effect of the World War on Woman's Field of I Activity. MARION E. LAMONT . . Madison "AIary" LETTERS AND SCIENCE Alpha Gamma Delta. MARGARET E. LANDWEI-IR .... Milwaukee LETTERS AND SCIENCE National Teachers' Seminary, Milwaukee 1, 21 German- istische. Thesis-Droste I-Iulshoff's Treatment of Nature. I-IAROLD MYRGN LANGER . . Waterloo "Illia" LAWV Phi Delta Phig B. A. Wisconsin 2. ARTHUR LANZ ..... . Monroe PHARMACY Alpha Chi Sigma. Thesis-Cultivation of Medicinal Plants. WVILLIAM JAMES LARKIN . . . Whitewater ADOC.. ..Dad,. MEDICINE Whitewater Normal l, 25 Sigma Sigma. Thesis-Topographical Anatomy. ESTHER A. LARSEN ...... Madison LETTERS AND SCIENCE Thesis-The Work of Herman Amberg Preus Among the Pioneer Norwegian Lutherans in America. MARGARET LATHROP . . . Madison Upeggy.. LETTERS AND SCIENCE Pi Beta Phig Twelfth Night 3, 45 Keystone 45 Class Secre- tary and Treasurer 33 Secretary, Green Buttong Union Vodvil 3g Red Cross Benelit 3. Thesis-Cheruloin. MARGARET D. LAUT ..... Wausau LETTERS AND SCIENCE Alpha Delta Pig Lawrence College l, 2. Thesis-Fencing in the Public Domain for the Cattle In- dustry. T t ...I I. .. .V I ii ,mi in iiiimiiii f.m.m.I..i. IIIn..II...IiimII-I.II..iIII...I.iiinII..ii.I.IIIIIIIIIIIIIWIIIIINI.I...I...,..,I..I. ...mm IIiimmmiiiii..I..Im,...I..... .H II. ii-.'..I. I. iimmml Page117 FRANCES ELEANOR LERRY . . La Crosse "Fran" LETTERS AND SCIENCE Carleton College l, Z, Thesis-I-Iospital Social Service. LILLIAN LEWIS ..... . McFarland "Lil", "Red" LETTERS AND SCIENCE Chi Omegag W. A. A. g Outing Club Board 3, 43 Y. W. C. A.g Indoor Baseball 2, 35 Manager 45 Yellow Tassel, Treasurer, Union Vodvil 2. Thesis-A Comparison of the Backgrounds in the Novels of Meredith and Hardy. MARION LUCILE LEWIS , . . . Milwaukee HOME ECONOMICS Milwaukee Normal l, 2. - Thesis-A Minute Study of Certain Bacteria Contaminat- ing Foods. LAWRENCE VICTOR LITTIG . . Davenport, Ill. "Larry" LETTERS AND SCIENCE-MEDICINE Delta Upsilong Inter-College Football 2. Thesis-Topographical Anatomy. K. T. LIU ....... Charigsha, China CIVIL ENGINEERING - Purdue University I, Z, 3, Chinese Students' Club 4. Thesis-Design of a Concrete Bridge, IVIARY ANN LOXVELL ...... Madison LETTERS AND SCIENCE University of Michigan l, 2. LILLIAN LUCILE LOVVRY . . North Fond du Lac ..1-il.. LETTERS AND SCIENCE Phi Mug Lawrence College I, 2. Thesis-Town and Country Life in the Aeneid Books l-6 and the Ceorgics. LOUISE LUDLUM ..... Sioux City, Ia. JOURNALISM Alpha Chi Omega: Theta Sigma Phi, Morningside College I 1 Publicity Manager Suffrage League 45 Keystone 43 Car- dinal 3g Advertising Staff Co-Ed Cardinal 33 News Editor Cardinal 43 Press Club 3, Vice-President 43 S. G. A. Board. Thesis-Newspapers Service to Advertisers. BRETAM. LUTHER . . . . . Madison 'ABu.sler" HOME ECONOMICS Achothg Euthenics Club 3, 45 Shakespearean Masque I, Congregational Students' Cabinet 2, 3. WANDA LUZENSKA ...... . Berlin LETTERS AND SCIENCE Oshkosh Normal l, 2: Le Cercle Francais, President 4. .ii.w.I..i,..Ii.IIm.m.,i.i II..MAI.,...r..I...m,i.iI.ir.. mi II-.w.Immi.. im..u.iI..1...II. I...m..II..I. iiiuiiuiiimiuiuiimimu I 7'h""' "4"" M "" "" """T"Tni I P a g e I I 8 ,I r I I 5 XVILLIAM .JOHN MCCOY . . . Lancaster ' 1 "Mac" f A WW '- A I ' COMMERCE ' ' f Beta Theta Pig Skull and Crescentg I-laresfoot Clubg First f I .f, . f ?' A"' , l A Regimental Band I, Z, 3, 45 I-Iaresfoot Production 2, 3, 4. ' f ,ggxkz alW'Ibp11Z7,EQ? fgawiil. 45 W' M1414 f r I A BLANCHE Lois MCDONALD . . . Beaver Darn , lg "f u 1. "Lois" "Cricket" l 5E LETTERS AND SCIENCE ii" ' Theta Sigma Phig Le Cercle Francais: Suffrage League, . W N Treasurer 45 W. A. A.g Archery Z, 3, Bowling Z1 Cardinal 3. ' , Thesis-The Question of Motion-Picture Censorship. J ' ' il HELEN ELIZABETH MCDOUCALL Pocatello, Idaho LETTERS AND SCIENCE Alpha Chi Omega, Rockford College Ig French Clulo 2, 3, 4, Sulafrage League 2, 3, 4. Thesis-A Comparison of La Debacle by Zola and Le Fen by Barbusse, MARY SEARS MCI-IENRY .... Denison, Ia. LETTERS AND SCIENCE Kappa Kappa Gamma: Y, W, C. A , Cabinet Council 4. Thesis-The Retirement ofthe Farmer to Town, ROSCOE LYLE MCINTDSH . . . Edgerzon "Niue" MEDICINE Sigma Alpha Epsilong Gamma Tau Beta, Beloit College l, 2. Thesis-Topographical Anatomy. GEORGE B. MCKINLEY . . . Milwaukee "Mac" . LETTERS AND SCIENCE Beta Theta Pig Freshman Basketball 2, Varsity Squad 4. Thesis-The Valuation of Railways-Purposes, Theories and Methods. EVANCELINE MAI-IER . . , Devils Lake, N. D. "Vange" LETTERS AND SCIENCE Gamma Phi Betag Black Bat, President Inter-Sorority Bowling 4, Sophomore Dance Committeeg Badger 3. Thesis-Influence of Tools and Processes Upon Ornament. WALTER E. MALZAHN . . .I West Bend "Wall" COMMERCE Theta Chig Beta Gamma Sigmag Commerce Club 3, 43 Ad- vertising Club 3, 45 Commerce Advertising Manager 3, Business Manager 45 Cardinal Assistant Manager. Thesis-The Installation of Adequate Accounting Systems for the A-Company. NINA MANN . . . . . Lake Denton, Minn. "Fussie" x LETTERS AND SCIENCE Delta Zetag Pomona College 1, 2. Thesis-Delinquency. WVILLIAM GEORGEMANTONYA . . . Chicago,Ill. MECHANICAL ENGINEERING Theta Xig Mandolin Club 35 A. S. M. E., Secretary 3. nm... I . I I liIIilIniinInI-Iimiiiiuiiiimiiwii IinIiiIuiinIiiiniiiimiuiiiiliiiiii Page 119 ff-S -5 i . ...W . Imimm. . I In innmiim.-mummm unmv n I I I HAROLD E. MARKS . . ..... Madison LETTERS AND SCIENCE Alpha Sigma Phi. Thesis-Federal and State Regulation of Railroads. IRMA E. MAROHN ....... Milwaukee LETTERS AND SCIENCE Milwaukee State Normal 1, Z3 French Clubg W. A, A.g Out- ing Clubg Wearerg Varsity Basketball 33 Thesis-The Enter of Gravity of the Human Body in the Horizontal Plane. A GLADYS E. MARQUARDT ..,,. Wausau LETTERS AND SCIENCE Delta Zeta, Consumers' League. JANE R. G. MARSHALL . . . Lake Forest, Ill. LETTERS AND SCIENCE Girls' Glee Club 3, 41 Castalia 3, 43 Lake Forest College 3, 4. Thesis-A Study of Family Relationships in Shakespeare's Plays. OREN H. MARSHALL . . . . East Troy "Shorty" MECHANICAL ENGINEERING Theta Xi: A. S. M. E. HERBERT JAMES MATZEN . . Milwaukee 'iPinky" COMMERCE Chi Phig Commerce Club, President and Vice-President. Thesis-A 'Study of Credit and Collection Methods of Madison Retailers. CORA AMALIE MAUTZ ...... Madison LETTERS AND SCIENCE Kappa Alpha Theta, XV. A. A.: Hockey 13 Class Bowling 2, 35 Varsity 2, 33 Badger Staff 1, Z, 3, 41 Pan-Hellenic, President 4. Thesis-The Development of Perspective from 1250 to 1600. DORA E. MAW . .,... . Madison . COMMERCE MARGARET ISABELLE MELAAS . . Stoughton ..Peg.. CHEMISTRY Alpha Omicron Pig Pythiag W. A. A. 2, 3, 43 S. G. A. Board 43 Bowling 1, 33 Indoor Baseball 2, Outdoor Baseball 23 Barnard Secretary Z, Classes Editor 1919 Badger, Editor War Section 1920 Badger. Thesis-Analysis of Egg Substitute. INEZ CHAPMAN MERRILL .... Pardeeville NORMAL COURSE Whitewater Normal 1, 2. A Thesis-Early Explorations, Indian Relations, and Trans- portation Systems of Portage, Wisconsin. ii......i,..II.I,..I.. .ii-i.ii.wii..i..-H., ..I..i...,, Im. .I .imI..II..i..i,.,I.i.i.w. .W.im.,I..i..ii..,..i..i...ii..i.i.,.iI..i..ii.5.I I-mmm., ii I IIimmiiimminiiiimiummmwiinmiiiiimi I ""' ' n Page I20 -Im 5 WWII.. ,Li lnlllll M I II --W ,l,,l...l..AlNl4ul WMM Si3:::m..I.I. 5 EIS EE Ia E52 E55 E15 JOHN P. Memes ....,. Fond du Lac "jack" CHEMICAL ENGINEERING Chemical Engineers' Society 2, 33 Vice-President 3. EI, MARY ELEANOR METCALF . . . . Berlin LETTERS AND SCIENCE Spanish Clubg Suffrage League. Thesis-Caesar in Magayuies. Si BARBARA JESSIE MILLER . . . . . Ripon if LETTERS AND SCIENCE :ig Ripon College I, Z. ' h Ti Thesis-Mathew Arnold s Treatment of English Literature, GEORGE E. MILLER . . . Charlestown, W. Va. "Sleepy" LETTERS AND SCIENCE I Sigma Nu. MARIE MITCHELL ....,. M ilwaukee LETTERS AND SCIENCE Alpha Omicron Pig Red Domino 3, 4, Treasurer 3g W. A. A. 45 Y. W. C. A. 43 Track Team 43 Basketball 4, Manager 43 junior Class Play, WOmen's War Work Council -L, Chair- man, Student Council. ' Thesis-American Ideals in Recent Verse. LILLY E. MOE , ..... Duluth, Minn. LETTERS AND SCIENCE Basketball 1, 2, 3. Thesis-Nigelungenlied. SIGRID WINIFRED MOE . . . Chetek ..Sig.. LETTERS AND SCIENCE OutingClub3, 4gSki Club3gW. A. A. l, 2, 3, 43 Y. W. C. A, l, 21 Castalia I, 2, 3, 4g O. C. Board 43 Indoor Baseball Team 2. Thesis-joel Chandler I-Iarris and the Uncle Remus Stories, ERWIN T. MOIIME ...,.. Kewaskum LETTERS AND SCIENCE Germanistische Gesellschaft 2, 33 Hesperia Literary Society 2, 3, 43 Semi-Public Debate 21 Badger Business Staff. Thesis-Ethical Problems in Modern German Novels. ROBERT B. MONTGOMERY . . . Madison H ..M0my.. , MEDICINE Gamma Tau Betag Scabbard and Blade. Thesis-The Hip-joint as Seen by the X-Ray. ALICE LOUISE MOORE ..... Milwaukee 1 LETTERS AND SCIENCE Milwaukee State Normal I, Z. i I Thesis-The Foundation of Browning s Optimism. III I II III I I I I I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 121 1 1 1 1 11 MORRIS F 1Ns1cY ....... Lake Geneva LETTERS AND SCIENCEQMEDICINE Thesis-Chemistry. JULIA ANN MOYER ..... . Monroe hjudy.. LETTERS AND SCIENCE Lawrence College 1, Z3 Castalia 4. Thesis-Word-pairs in English. ARDIS MOZINOO .... Wyoming, Ill. "Monte" LETTERS AND SCIENCE Alpha Chi Omegag Northwestern 1, Z3 Twelfth Night. Thesis Course. CLARA E. MUELLER ...... M ilwauhee LETTERS AND SCIENCE Clef Clubg W. A, A,g Swimming I, 2, 33 Swimming Honors: Union Vodvil 3. Thesis-Replacement of Men by Women in the Industries of England. EMMETJOHN MUELLER . .... Milwaukee MECHANICAL ENGINEERING Alpha Tau Omegag Pi Tau Sigmag A. S. lvl, Eg Freshman Footballg Varsity Football and Trackg "W". CATHERINE OLIVER MUNSON .... Viroqua ..Kaly.. LETTERS AND SCIENCE Kappa Kappa Gammag Milwaukee-Downer Ig Mystic Circle. Thesis-Ruskirfs Social Ideals in St. Georges Guild. BRYNHILDEJOSEPHINE MURPHY . . Madison "Bunny" LETTERS AND SCIENCE Kappa Kappa Gamma. E Thesis-Thomas Heywood's Treatment of His Women Characters. JAMES H. MURPHY . . . Chilton "Murph" LETTERS AND SCIENCE MEDICINE Gamma Tau Beta. Thesis-Etiology of Epidemic lnfiuenza. ALICE C. NAFFZ . . . . Madison LAI.. PHYSICAL EDUCATION La Crosse Normal 1, 23 W. A. A.g Blue Dragong Outing Clubg Hockey Squad 33 Dancing Team 3. HAROLD NEBEL . . . . Milwaukee "Nebs" MEDICINE Gamma Tau Beta. Fl hesis-Topographical Anatomy. 11111111111111111111111111111111111111111111111..111111 1111111111111 15 1 ME1115u1u111111125221111.1111111111111111 11111111111111111111111111111111111111111111111111111111111111 1 11111 1 111111111111111111111 Page 122 CLARA A. NEHRLICH ,.,. . Sheboygan CHEMISTRY Alpha Omicron Pi, Thesis-Studies on the Determination ofthe Ash of Com- mercial Caseins. NELS THEODORE NELSON . . . Cambridge "T, N. T." "Nellie" AGRICULTURE Alpha Gamma Rhog Agriculture Literary Society. Thesis-Germination of Corn at Low Temperatures. ESTHER NEPRUD . . . . . Weslby 'ANe,bpie.' LETTERS AND SCIENCE Chi gmegag Milwaukee-Downer 1, 2, Glee Club 1, Libra- ran . Thesis-Music in Shakespeare. ROSE IRATHERINE INEXVMAN , . . . Madison LETTERS AND SCIENCE Pythia-, Secretary 4. Thesis-Experiments on Rabbits to Show the Action ol' Certain Aniline Dyes in the Disinfection of War Wounds. KATHERONE MABLE NIENABER . . Madison "Kath" HOME ECONOMICS Euthenics Club. Thesis-The American Dye Situation. 1-IAROLD ROLE NOER . . . Wabeno "Harry" COMMERCE Chi Phi, Phi Alpha Deltag Commerce Club 3, 45 Spanish Club 3, 4, Glee Club 3, Y. 1Vl. C. A. Cabinet 3, 41 Athenae 1, 2, 3, 45 Forensic Board 3, 4, Joint Debate 43 Band I, 2, 3gChoral Union 1, Z, 3, Commerce Magazine Staff 3, 43 Stu- dent Senate 4. Thesis-Requirements Satisfied by joint Debate. EDITH DOROTHY NOLL ..... Marshfield LETTERS AND SCIENCE Oshkosh Normal 1, 2. Thesis-The American Federation of Labor in the Presi- dential Campaigns of 1908, 1912, and 1916. WILLIAM ALVA NUZUM . "Bill" . Madison COMMERCE Phi Sigma Kappa. Thesis-Manufacturers' Cut-Service and Retail Advertis- Ing, ELIZABETH RUTH NYSTROM . "Belly" LETTERS AND SCIENCE Y. W. C. A. Cabinet Council 35 Pythia 1, 2, 3, Treasurer 33 Geneva Club, Track 2, Thesis-The Geographic, Economic and Historical Aspects ofthe Development of Trade on the Great Lakes, . Chicago, Ill. BERTHA OCHSNER ..... , Chicago, Ill. "jerry" LETTERS AND SCIENCE XV. A. A. Board 3, 4, Red Domino 1, Z, 3, 4, Vice-President 45 Theta Sigma Phig Literary Staff 3, 4, Swimming Team Ig Tennis Team 2, Dancing Honors 3: Junior Class Play, French Play 1, 2, Union Vodvil 2, 3, Edwin Booth-Red Domino, Play 2. WIIHIIVIIII IIIIIIIIIIIIIIIIIIIIII -I I I I I iiiiiiiiiiiiiiiiiiiiiiiFiiiiiiiiiuiiiiIIIIIIIIIIIIIIIIIIIIIIIIIIIIIm Page 123 I if w iv pix f4nmeZ', Ne, . "I. 4"' 5 I ' Y a . i , I I , , f g Irl, if - ' ,. v. 1 M. 4, .MQ L X 3 V, X T in W' 7 , I 1 '1 .'-" 521' A' 1 1 I 7 'ii ' 41 ,, ff , ..:l I , Sik h j , 4 Q V y e Wai K, f . ,4 , . ? Q J auf .4 f f 1 'P x 4 'ak W ,I tx I t f ' .355 5 ,f f A I . . 4 M f V "I fa 1 I 4 S ,g - U ',4k .ki 4 ,. fr , , V 1,V' I My . 11' ' 12 'f 'P J ' f L Ei - " pllf- Y f I fx, f :"'- 1 . 'ix' i f ' .7 f "" ' 'I -I'I :vi "'I' I if i .7 5 ' Alif -..If A, T ,... ., 2 'Z - . ' .Q ., .,:.V Q if .0 , 9,1 'X .. ,, 0. f . I -.A A , I ""4 'M VM ,X , , ,.,, . f Z 3 wi I 1 5 QW 1 I .I1,. :few -V , inf We .,, ,.,..,. . 2 f 4 2 ,.., , Z7 ?4 X If ig , 1 ,W ,wow a,..fA1..., I 1 f ETI-IEL J. GDEGARD ....,.. Merrill LETTERS AND SCIENCE Castalia. I ' Thesis-Studies on a Vaccine for Tuberculosis. ELEANOR O'LAUCI-ILIN . . . Madison AEI.. LETTERS AND SCIENCE W. A. A. 4, Pythia 3, 4, Outing Club 3, 4, Suffrage League 4. Thesis-Synge's Interpretation of the Celtic Spirit. MARION G. OLBRICH . .... Harvard, Ill. "Bricky", "Belly" HOME ECONOMICS Achothg Castalia, Wahzeda Camp Fire 1, 2, 3, 4, Secretary Z, Social Chairman 3, W. A. A. 4, Baseball 2, 3, Outing Club 4, Euthenics Club 3, 4. Thesis-Influence of the European Social Movements on Costume During the Middle Ages. MARTHA HELENA OLESEN . . . Humboldt, Ia. LETTERS AND SCIENCE Alpha Gamma Delta, W, A. A., Outing Club, Ivlinnetoska gfargp Fire, Secretary 1 , Cardinal Business Staff 4, Badger ta 4. Thesis-Strength of Normal School Children as Tested by the Method of E. G. Martin. DORIS LOUISE OLIN ...... Florence LETTERS AND SCIENCE Minnetoska Camp Fire. Thesis-Peace Conference to 1914. MAMIE OLSON ....,. . , La Crosse LETTERS AND SCIENCE Thesis-Shakespeares Women Studied in the Light of Their Originals. MIRIAM CATHERINE O'NEILL . Chippewa Falls HOME ECONOMICS Euthenics Club 1, 2, 3, 4, Treasurer 4, Consumers' League Z, 3, 4, Vice-President 3, President 4, Suffrage League 2, 4, W. A. A. 1, 2, 3, 4, Bowling 1, Barnard Treasurer 3, Agri- cultural Association, Vice-President 3. Thesis-A Minute Study of Certain Bacteria Contaminat- ing Foods. IRENE l4ATHRYN GPCENORTH . . Kewaskum Hobby" LETTERS AND SCIENCE W. A. A., Hockey 3, Track 3, Thesis-The Development ofthe Paper and Pulp Indus- - try in Wisconsin. - JULIA OUTHOUSE ..... . Madison ujudy.. ' HOME ECONOMICS W. A. A. 2, 3, 4, Indoor Baseball 1, 2, Outdoor Baseball 1. ThIeZiSFMicroScopical Study of Bacterial Colonies Found IU I . GRACE PADLEY . . . . . Lodi "Gracious" LETTERS AND SCIENCE Thesis-Development of Children's Literature Since 1850. ImInmiIIIImInInIinIIIIIIIIIIIIIIIIIIIIIII in nm, ri. I I.. I. II I. 1 I.. I ...I .Ii I ...II H.. .m...m....I.. I, I... , i , WXInmWInmmlmWImmwlmmumn ...... ...1 ..u,......,... ...W ...... I.. .a.....,..........,,-,..--.... ,...,..,. . Page 124 EI if :I EIS gg..-.....t..-..,.,....L-..L... -.......--.-.,-..,.-.. ........ ......-.-.,,.. ..,. -.,...T.:.,.I.,.5m E I Ee ADELAIDE PAINE . . . . . Milwaukee gli "Achey" HOME ECONOMICS Kappa Alpha Theta, Track Z, Baseball 35 Tennis 35 Treas- Elg urer Green Button, President Red Gauntlet, Mortar Board, W. A. A. LOUISA PARKER ...... Clinton LETTERS AND SCIENCE sg Castalia 2, 3, 4. Ei- Thesis-The Stage History of Macbeth. GLADYS PASENVALK . . . . Norfolk, Neb. "Pony" , COMMERCE Women's Commerce Club. f VIRGINIA CLEVELAND PASLEY . . . Fulton, Mo. I LETTERS AND SCIENCE Chi Omega, Glee Club. Thesis-Industrial Home Work in Milwaukee. GEORGE HILL PATTERSON . . . Chicago, Ill. "Pal" MEDICINE l Beta Theta Pig Nu Sigma Nu, University of Illinois I, 2, 3. Thesis-Topographical Anatomy. JEAN PATTERSON .....,. Appleton LETTERS AND SCIENCE Kappa Kappa Gammag Mortar Boardg Keystoneg Yellow Tassel, President, W, A, A., President 43 "IVY WOmen'S Athletic Editor 1919 Badger, Student Council. Thesis-The Effect of Exercise on Blood Pressure and Pulse Rate. BARBARA E. PEARSALL ..... Evansville LETTERS AND SCIENCE Beloit College l. Thesis-The Geometry of the Triangle in I-lomogeneous Co-ordinates. 2 MILDRED PEDERSON I . - . . . Sirum "Mil" "Bill" LETTERS AND SCIENCE Keystone 4, Secretary, Pythia, President 45 Y. W. C. A. Cabinet Councilg Suffrage League, W. A. A. S. G. A.g Chairman Vocational Conference 4. Cl-IAUNCEY J. PELLOW . . . Dodgeville "Chuunce" . LETTERS AND SCIENCE Tau Kappa Epsilong Athenae, Vice-President 33 Sopho- more Semi-Public Debate 2, Daily Cardinal, Editorial Staff 43 Class Traditions Committee. Thesis-American War Finance 1917-1918. 1 HELEN I-IOPE PERKINS .... Princeton, Ill. HOME ECONOMICS james Milliken University l, 2. I ,..,.., ::1:::1:uII:: .............. l I II IIIIII III III I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIII I I IIIII III II II I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII I I I P a g e I 2 5 JACOB PERLMAN ....... Madison LETTERS AND SCIENCE Artus, Thesis-The Labor Situation in Railroads During War ime. LEOJ. PETERS . ...., Edgemonl, S. D. ELECTRICAL ENGINEERING Tau Beta Pig Eta Kappa Nu. I Thesis--Theory of Operation of Tri-Electrode Oscillators and Amplifiers. MARGARET I. PETERSON . . Delavan "Pete" LETTERS AND SCIENCE Kappa Kappa Cammag W. A. A.g Hockey l, 2, 3, 43 Bas- ketball 2, 35 Varsity Baseball 2, 35 Wearer. 'lxgfhesis-WOman's Place in lndustry During the Great ar. l-IARRIET NIXON PETTIEONE . . Burlington, Ia. Spd.. JOURNALISM Chi Omega, University of Colorado 23 Theta Sigma Phig Press Club 3, 45 Cardinal 3, 4. Thesis-A Study of Personality Sketches in American Popular Magazines. EVELYNA. PHILLIPS . . .... Milwaukee LETTERS AND SCIENCE Milwaukee Normal l, 2: Pythiag Y. W. C. A. Thesis-Sources of Parleyings with Certain People of Im- portance in Their Day. ADDIE E. PIEI-I . . . . Madison ..Ad.. LETTERS AND SCIENCE Cabinet of Coxrigregational Students' Association Z, 3, 4: ClefClubp Y. , C. A. Thesis-Cultural Studies on Penicillium and Aspergillus. MARGARET ELIZABETH PIEH . . Madison "Marge" HOME ECONOMICS Thesis-Some Problems which I-lave Confronted the Cloth- ing Industry in America During the Great War. EMILY MARION PILPEL ..... New York LETTERS AND SCIENCE ClefClub 2, 3, 43 Choral Union l, 2, 3, 4, French Club 1, 2: junior Play Committee 33 S. G. A. 2. Thesis-The Psychology of Stupidity. 'JANE PINE . . . . ForeszRiver,Ill. JOURNALISM Lake Forest College lg Theta Sigma Phi: Scoops Club 23 Press Club 3, 43 Suffrage League Z, 33 Badger 3, 4. Thesis-Criticism of American Newspapers by English Travelers. AMELIA PIRIE . . Q . Milwaukee "Ameal" LETTERS AND SCIENCE Principia School 1, 23 French Club 3, 43 Spanish Club 3. Thesis-Translation of "Sa Soi De L'I-Iommen by Paul Herview. I .III-IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII .I I I I I I I. I. I I .I .I .II IIIIIIIIIIIIII I .I .II I I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ' I I mi III I Page 126 I I I I III I II I II II I I IIII I I IIII IIII IIII II NELL PLACE . ....... Marinelle HOME ECONOMICS Alpha Phi, Milwaukee-Downer l, 23 S. G. A. 3, Thesis-The Growth and Development of the Dye Indus- try in the United States as a Result of the War. VIOLA E. PLELISS ..... . Madison "Ole" LETTERS AND SCIENCE Kappa Alpha Thetag Mortar Board: Y. W. C. A. Cabinet 3, 4, Vice-President 45 W. A. A.g NVearer1 ViCe-Presi- dent 23 Treasurer Red Gauntlet. ghhesis-I-lealth Survey of the Children in the Madison c Oo s. JEAN L. POLACHECK .... Milwaukee "Polly" COMMERCE University of Pennsylvania 2, ALICE VIOLA PORTERFIELD . . Omaha, Neb. "Paz" LETTERS AND SCIENCE Alpha Phig Pythia l, 23 Student Council 45 Theta Sigma Phi 3, Secretary 45 S. G. A. Executive Council 4, W. A, A. 43 Outdoor Baseball l, 23 Mortar Board 33 Cardinal Board ofControl, President 43 Assistant Editor XVoman's Page 3. Thesis-The Men in George EIiot's Novels. MILDRED HELEN PORTZ . . . . Hartford "Mil" HOME ECONOMICS Chi Omega. Thesis-The Wool Used by the United States Army Dur- ing the War. JULIA I-l. POST ...... . Madison II I I IIIII I L I I 42 I l - ' 'fl- I O.. X V rlyy , VX I I ,hI f,, , gf, 3 V A I' Z .' V "" '12 .. V ll , ,l,. QV I ' I VV QI V 5 K. . xvfv V KV!! I V V . A X VVVVV f I II: ' - .1 7, .,.,' , 551 I . I l , ' I IH ' . , g'i I 1 V, I 4 V V Wg ,. f I ' ' I R., ..., ' I of '--'-A2- I - , 2 Q V , V11 ,. ,VVV .I In V VV X aw. -QM .A . V X x .f Ai X ' I. .. 'ff 2112? sf I ' A -Q S' A I 'S af, VV N. ff Q S ef X ' K. V XX to aff PM Af . I XX R at X A X E -'Judy' l A I I LETTERS AND SCIENCE j j' I I- Mortar Boardg W. A. A. l, 2, 3, 45 Y. W. C. A. 2, 3, Cabinet I V, 5 ' 1 157 'Q -,f- fff 45 Geneva Club 3, 4, Hockey I, 2, 43 Outdoor Base- I - V .I ' " , 5 ' ball lg Indoor Baseball 35 Dancing 3g Union Vodvil 2, 3. V "' 2 1" - " ' ':'P 4 ' - Thesis-A Comparison of the Various Tests of Cardiac Function. . LEONA LENORE PRASSER .... . Milwaukee I S Q, :Q A "Lonie" F fx V LETTERS AND SCIENCE 5. -I .V Y. W. C. Ag Social Science Clubp Spanish Club. I 5, IV Thesis-Results of Probation of Adult First Offenders. ,V jf ,,,, 5 ' fl . . --s' DELIA PROUDFIT .... Constantine, Mich. V -IA' "Dee" LETTERS AND SCIENCE I Milxvaukee-Downer l, 25 Business Assistant Daily Gardi- I , 525. 2 nal 3, Associate Advertising Manager 43 Badger Staff 43 ff Q, Vi' ' X Y. W. C. A 2. Thesis-Folk Lore of America. RUSSELL EDWARD PUERNER .... JEHBFSOH .jf .-Squeaky 1 - -I - , gf- I - :R H MECHANICAL ENGINEERING 39,0 V Theta Xig A. S. M. E.g Cadet Lieutenant 2, Captain 3. ?f'T":'ijHY-. ,EEZ 25.6 - ' ' 'I' 'Q A I , e f I-IW A KARVER L. PUESTOW . . . . Oshkosh "f""',5g,eVZ Z MEDICINE ,g Ai, WV Q i Gamma Tau Betag Athenae I. -' Q .F . Thesis-Topogfaphical Anatomy- IIIIIIIIII I IIII I I I IIIIIIII IIIIIIIIIIIIIIIIIIIIIIII III I I I II II I I I I IIIIIIIIIIIIzaazaaaasxaazIIIIIIIIIIIIIIIII I 'lLl"':"rfl3lll5 Page 127 I I I mi I ii mini ini i KATHLEEN M. ROBINSON .... Green Bay "R0bbie,l' "Kale" LETTERS AND SCIENCE Kappa Kappa Gamma. Thesis-Humorous Characters in the Comedies of Terence. RUTHM.RADFoRD . . .,... Madison - LETTERS AND SCIENCE Delta Gammag Oshkosh Normal 1, 25 Twelfth Night. Thesis-George Meredith and His Circle. DUNCAN I-I. REID .... . Montello - "Dune" AGRICULTURE Stevens Point Normal School l, 25 Agricultural Literary Society, President 31 Agricultural Association, Treasurer 33 Assistant Business Manager Country Magazine 3. Thesis-Methods of Selecting Profitable Poultry. VELMA AGNES REID . . . . Hurley "VeIlie" LETTERS AND SCIENCE Mortar Boardg Red Gauntlet, Vice-President 25 Outing Club, President 33 Baseball 2, 35 W. A. A,g Barnard, Presi- dent 4g Keystone 43 S. G. A., Vice-President 4. Thesis-Reconstruction in the United States for the Crip- pled and Vilounded Soldiers and Sailors. XMILLIAM I-I. E. REID . . . La Crosse "Bill" AGRICULTURE Delta Phi Epsilong Alpha Zeta: State Normal School: Fra- ternity Track Team 3g Fraternity Baseball Team 3g Y. M. C. A. Secretary l, Z, Cabinet 4. Thesis-Determination of Specific Gravity Ol' Cream at Various Temperatures and Percentages of Fat Content. OSCAR ZACHARIAH RENISBERG . . erlerick, Md. Fr ..0:.. AGRICULTURE Agricultural Literary Societyg Football Z. CATI-IARINE J. RITCPIIE . . jefferson "Bill" LETTERS AND SCIENCE XV. A. A.: Archery l, 2, 3. Thesis-Ruskin as a Critic of lndustrialism. EDWARD H. ROBERTS ...... M adison Glaz LETTERS AND SCIENCE Ripon College I, 25 Satire Staff Badger 45 Glee Club -lg Cardinal Day Committee 4. Thesis-Explorations and Excavations in Palestine. I'IESTER DOUGLAS ROBINSON . . Santa Ana, Cal. "Sunny Cal" JOURNALISM Delta Delta Deltag Leland Stanford University l, 25 Cas- talia 31 Press Club, Executive Committee 41 Theta Sigma Phi, Vice-President 4: S. G. A. Board 33 Basketball 33 Serv- ice Flag Committee 3. Cardinal Day Publicity Committee 4g Daily Cardinal Staff 3, Desk Editor 45 Badger Stah' 4. Thesis-The Effect of the Telegraph and Cable on the Newspaper from 1843 to 1900. l RUTH MADELYN ROEI-IM . . . . Ashland I HOME ECONOMICS I Northland College l. iiiiiilliiliiiiiliiiiiiiiiiiiliIililiiiiilliilliiliii-wi Page 128 s i n ini EZRA I-I. ROGERS .... . Hartford MEDICINE Phi Beta Pi. Thesis-A Study of the Blood-Vascular Supply Ol the Lower Extremity by Means Ol the X-Ray. MARY TAYLOR ROGERS . . . jonesboro, Ark. HOME ECONOMICS State Agricultural College, Jonesboro, Ark., l, 2, 3. I-IAZEL ALICE ROSE . .... . Prenzice NORMAL COURSE Oshkosh Normal School l, 2. Thesis-Cantor's and Dedekinds Theories ol the Irrational Number. FRANK ALSWORTH Ross .... . Madison LETTERS AND SCIENCE Phi Gamma Delta: Philomathia 3, 43 Lieutenant R. O. T. C. 3g Student Senate 4. Thesis-Abortive Reforms. RADA R. ROTI-I .,..... Fowler, Ind. LETTERS AND SCIENCE St. Mary's College I. Thesis-Pioneer History ol' Northern Indiana. CLARA LOUISE RUDER ..... Wausau LETTERS AND SCIENCE Milxvaukee-Downer College I. Thesis-The Aspects of Education for American Women in the Early Decade. MILDRED PRISCILLA RUFSVOLD . . Marinetle LETTERS AND SCIENCE Y. W. C. A.g Geneva Club: Pythia Z, 31 S. G. A. Board 43 Executive Committee Consumers' League 4. Thesis-Re-eduction and Rehabilitation of Wounded SOI- Cliers and Sailors in Canada. LOUISE ANNETTE RUSCH . . South Fargo, N. D. "Louie" HOME ECONOMICS ' North Dakota Agricultural College 1, 2, 3. - Thesis-Decorative Stitches. ' 4 7 Z., I . A . 31 . X U 3 mx'Q,Nf,-. ,H ' -jf. y V5 U fl swf?- I ,V X . fe - ,Q gf . ' A . Ti- in 4 t1'1f" " I Z ...r I ' , 1 5 1-It . V .V Jll .-tie. , f. i'l.i A 4 ..... E i"" I . f A f t'Ie -A I'f't ' K. 4 I, ., ,W .. 2 f,.. -1 ,,., I f I 'H ' .,.g f' I... -C 4 QQ I 4 y if Z ' f f N af jf X C? i I' 6' 'P I X' 1 'ff " 4 fl lc gf '51 ' iq., , Q ,sf , f V , f f N e, , f-'sas-E- --NX. v if .5151 fw ...L , , Cs f h a ws-:.2-ra .1 .. . Wi. . l.'I' .I GEORGIA E. SALTER . . . . . Waupaca 'j S ...I I Il i' ,.. LETTERS AND SCIENCE 9 :5 Xu ,755 I 1 X Oshkosh Normal School If 2. Z X A WWC' A Thesis-The Council of IXat1onal Defense. , Q , I :,22g5f!:3q,- 945 V- " "Qi-ft .. .,... .- .. ""' ' ' I NIARGUERITE SAMMIS ...... M adisan ' ' 4"'Af"g . Z- f " "Marge" "Margie" I "" 3 ' PUBLIC SCHOOL MUSIC . . M V.,, C Alpha Gamma Delta 3 Glee Club 23 Choral Union I, 21 Out- 'ij E- .V ' I. " c ing Club 1, 2, Head 0fBi0vCHf1g 2- 2 I iili ffl -.-. if-1 Thesis-A Graded Course in Public School Music. IimiII.Iininmimmiiwiiiiiiiiiiiiiimiii I I iiIiiiiiiliiiliiliiiiiliiIIIRIESMiiiiiiililiiiiiiiiiii Page 129 II Ii I If I. LAURA MAE SANDROCK ..... Madison "Dolly" I LETTERS AND SCIENCE V Thesis-Frontier Aspects of Early Madison. LULU SAUL ....... Douglas, Wyo. "-Sokien LETTERS AND SCIENCE Kappa Kappa Cvammag Mortar Boardg Keystone 45 Y, W. C. A., Cabinet 2, 3, 4, President 4-g W. A. A.g UW." Thesis-Statistical Report of the Course of Employment Ln tlgi Sfgtg Of Wisconsin for Three Years Ending Decem- er , . . EVA SOPHIA SCHAIRER .... Saline, Mich. HOME ECONOMICS Michigan State Normal College l, 2, Thesis-The Quantitative Estimation of the Anti-Neuritic and Anti-Scorbutic Properties ofthe Raw Potato. MARGARET A. SCHATZ , . . Randolph "Schalzie" LETTERS AND SCIENCE Lawrence College I, 23 German Clubg Biology Clubg Inter- Class Oratorical Contests. Thesis-The Development of the Archegom of Sphaero- carpas. MARIE CATHERINE SCHILL . . Milwaukee - "Reef" MUSIC SUPERVISOR glee Club lg Choral Union l, Z5 S. G. A. Board l, 25 W. A. . l. ETHAN W. SCHMIDT ..... Chicago, Ill. MECHANICAL ENGINEERING Theat Xi: Tau Beta Pig Pi Tau Sigmag Carnegie Institute of Technology Zg Wisconsin Engineer Staffg American So- ciety Of Mechanical En ineers. Thesis-The EFfect of Suction Lift on Capacity and Effi- ciency ofa Centrifugal Pump. I HERBERT GLUECK SCHMIDT . . Milwaukee "Herb" MEDICINE Kappa Sigma. Q l Thesis-Topographical Anatomy. EDWIN F. SCHNEIDERS ..... Marathon MEDICAL COURSE Phi Beta Pig Sigma Sigmag Baseball: Varsity Base- ball 2, 33 Freshman Baseball. Thesis-The Pathological Effect Upon the Lungs Of Re- spiring Phosgene and Chlorpicrin Cases. ' VERONICA SCHNEIDER . . . . Madison "Vera" HOME ECONOMICS Thesis-The Study of the Resistance of Antitrypsin in Egg-White. l EI.INORM.SCHROEDER. . . . . Cle11eland,0. "Ellie" - LETTERS AND SCIENCE ' Y. W. C. A,g W, A. A.g "W"gOuting Clubg S. C. A. Board 4. ' Thesis-The Relation of Shoes to the Strength and Flex- ibility of the Foot, and to the Posture. IIIIIIIII IIIIIII I I I IIII II II IIIIIIII I IIII II III Page 130 t I will I IIIIIII Royj. SCHUKNECHT .... Port Washington "WI1itey" COMMERCE Thesis-Card Record System for Control ol an Omce. CATHARINE SCHULER . . . Milwaukee "Katie" CHEMISTRY S. C-. A. Board 3, 4. Thesis-Solubility of Boric Acid in Solutions of Borax, MARGARET SCHULTE ..... Freeport, III. "Peg", "Schulte" LETTERS AND SCIENCE Alpha Phi: Mortar Boardg Wearer: W. A. A., Secre- tary 4, Board 25 Blue Dragon, Treasurer 4. MARGARET CHARLOTTE ScHuLTz . . Milwaukee "Greta" LETTERS AND SCIENCE Mortar Board, Vice-Presidentp Ke-ystone, President: W. A. A.g Indoor Baseball lg rack 23 Dancing 35 Hockey 3, 43 Union Vodvil 2. 3: Vice-President Chadbourne 3, President 43 Service Flag Committee, Junior Play Com- mittee. Thesis-Skirts as a Factor in Fatigue. CATHERINE ELIZABETH SCHUSTER . . Lancaster LETTERS AND SCIENCE St. Clara College I, 2. Thesis-The Relation ofthe Iroquois Indians to the Early New York Settlers. LORENA ELIZABETH SCHWEBS . . . . Madison LETTERS AND SCIENCE Sophomore Basketball Team 2. Thesis-Morphology of Mollisia Dehnii. IVIARIANA T. SELL ..... . Madison HOME ECONOMICS Wahzedah Camp Fire, Vice-President 3, Treasurer 4, W. A. A.g Euthenicsg Basketball 2. ' Thesis-The Value of Various Sugar Solutions for Fer- mentation by Yeast. GLADYS MARIE SEVERIN . . Cedar Falls, Ia. "Glad" HOME ECONOMICS Chi Ome ag Iowa State Teachers' College lg Euthenics. Thesis-Slomens Welfare Work in Department Stores and Factories in the United States. Lois K.SEvRINoHAUs . . . New Albany, Ind. LETTERS AND SCIENCE 4 Choral Union I, 2, Y. W. C. A. 2, 4. Thesis-The Short Story. MARJORIE JEAN SEXTON . . . Marshfield "Marj" LETTERS AND SCIENCE Milwaukee-Downer College lg C-lee Club 3, 4, Daily Car- dinal 3. II I I iliiiiiIIiiiiiiliiliiiiiliiiiliiiiiiliiiiiiliir Page 131 K '-.eg .,.. .ft I I I., V' -I fri 5 I In I .X A of H A I 1 - ' ,. .MLIMJ " 1 ' - gg: 5 . I 1 C Ml' y 'I I ,f . ' V. ., , 1 . .f .Q W gf h fi ri 1 " ffjf jlrgfg 3 T., " 5 ' F' I I.-N I Q 1 f 14'-li f ' 'I ': . 'I ..l' 1 Q ,- 455, ,ta ,Z R.: f ' f if ' 4 :-A , . , A f " 'ff fl I ' Y -. ..-. 'Q t ' , y . ' ' gm . ii. 2 -fee "" 15 ' 5 I I I I .,., f I., f 1-qs... .,.. J-. .. Q mws.-1. , . f .. ....... , Ns. ,. ,. . , .,a .f ' -Q-is-'4f41lfY':15w2 S48 M1621-2' ff r -:tz2'g',fff1"'55 W- . ,.,.. WW, 8. ow., I-X a W.,,.i,.,,-,,A,..t,., , V-ff , , xi .5221 Q I. . .1 .ga 551.5 5"?f'7f3Z1f,6?'ff. ,.,. ., Z Qt - ., e-e- ff' ,f , X 4. . . . ff f' ,f vs svfxf P ' Ag 'atv' 'rw '." QU 151.-.1 E42 if 1- x I mfr, :qi 1541. aff 1 f.'fxf -f-. - uf' 4' .T i slf' -I A -ff' 1 51.1 I f if M f eww-Mama-msTe'f . g a 5 I 2 ' 'Tift-W "asf-sf' -if 3 466. f f! 11,44 Z e g: - . 1 eff- I as ...... 0..-5 1, . ' 1 4 rf A " .. . X . - - Mr' 1 . . avril: 'I 2' r ' 11146 "fi I ' ' . V , W- .,,,.,f.,.e f . A-:,.1,en . I I I I I I I iiiii II Iunii I I In wi: I l MARLYS DAVE SHAW .... Parksion, S. D. Q LETTERS AND SCIENCE ' Dakota Wesleyan University 1. , Thesis-A Scale for Measuring Handwriting. GORDON H. SHEPHARD . . . Mineral Point nsheb.. AGRICULTURE Alpha Gamma Rhog Glee Club 3, 4, Secretary 4. Thesis-The Cost of Making Butter. ' RUTH A. SHEPHERD . . . g . . Platleville LETTERS AND SCIENCE Alpha Gamma Deltag Glee Club 4g Choral Union 3 g Basket- ball 3g Bowling 3, Badger Staff 3, Y. W. C. A. 4, Consum- ers' League 3, 4. Thesis-Wordsworth and Anti-Militarism. -JOSEPH FRANK SHIMPA . . . . . Boscobel Use.. LETTERS AND SCIENCE Gamma Tau Beta. Thesis-Colorometric Methods of Hemoglobin Determina- tion and a New Standard in Sohli's Method. V SOHNIA SINAIKO . . . . Madison "Sunny" LETTERS AND SCIENCE W. A, A. I, 2, 3, 45 Menorah I, 2, 3, 4, Red Domino 45 In- door Baseball l, 2, 33 Outdoor Baseball 1, 2, Dancing 3. Thesis-Life History of Bruchus Obtectus. HELENHARRIETSKINNER . . . . . Madison CHEMISTRY Kappa Alpha Theta: Vassar College I3 W. A. A.: Hockey 2. 3, 45 Basketball 23 Bowling 3, 4, Varsity 3, Baseball, Varsity 2, 3, Y. W. C, A., Cabinet Council. BESSIE JENKINS SMITH ..... Milwaukee ' "Berry" LETTERS AND SCIENCE Milwaukee Normal School I, 2. Y Thesis-William Morris and His Influence Upon the Arts and Crafts of Modern Times. CAROL ,IOSEPHINE SMITH . . Grennell, Ia. UO.. LETTERS AND SCIENCE Grinnell College l. Thesis-William Dean Howells: His Change from Realism to Romanticism as Illustrated by His Novels. DOROTHY PAUL. SMITH . . .... Madison . NDN.. LETTERS AND SCIENCE Delta Delta Delta, Red Dominog Union Vodvil 2, Sopho- more Mixer Comrnitteeg junior Dance Committee. Thesis-A Study of the Physical Disqualifications of Men Rejected Under the Selective Service Law. HARRIETT MCCUNE SMITH . . Superior ..Hat.. LETTERS AND SCIENCE Superior State Normal l, 2, Thesis-History of the American Socialist Party After the Entrance ofthe United States in the World War. mmmIIIIInIIII..I...I..m..II.I..II..i , . I II. .Ir-f.II...II..III inIIIIIIIIIIIIIIHIIIIIIIIIIIII..I.IIIIIIIWIIIIIIWIIIIII I I ""w"""M" "l"N"""'N'iiiTiiEEIi-in un iz Page 132 w II II I I I I-IELEN BELLE SMITH . . . . Madison "Helen B." Alpha Xi Delta, Phi Beta Kappag S. G. A, President 4, Sec- retary 35 Y. W. C. A., Cabinet, Mortar Board: W. A. A., Keystone, Castalia, Treasurer Z, Twelfth Night, Treas- urer Z, 31 Bowling 2: Winner junior "Ex"g NVOmen Stu- dents' War Work Council: Student Council of Defense. ghesis-The Moral Philosophy of Montaigne and Its ource. MARY RUTH SMITH . . ..... Madison LETTERS AND SCIENCE Alpha Xi Delta, XV. A. A. 2, 3, French Club 3, Castalia l, 2, 3, 4, Treasurer 4. Thesis-A Comparative Study of the Eclogues ol' Virgil and the ldyls of Theocritus. GLADYS SNYDER ...... . Clinton LETTERS AND SCIENCE I Beloit College l, 2. Thesis-lnfluence of Brook Farm Community on the Writers Who Were There. WILLIAD M. SONNENBERG . Sheboygan 'NSIORRIEN MEDICINE Phi Beta Pig Sigma Sigma, Thesis-Study ol' the Blood-Vascular Supply ofthe Lower Extremity by Means ofthe X-Ray. SPIROS SOTIRAKOS ,... . Chicago, Ill. MEDICINE University of Chicago l, 2, 3. S. LLEWELLYN SPENGLER . Menasha uchum.. LETTERS AND SCIENCE Alpha Sigma Phi, Basketball, Varsity 3, 43 Athletic Board 3, 43 Chairman Mixer Committee 1, 2. Thesis-A Moral Mutual Benefit System of Factory In- surance. MARGARET SPERRY .... New York, N. Y. LETTERS AND SCIENCE Kappa Alpha Theta, Phi Beta Kappa, French Club l, 2, 3, 43 S. G. A. Board 43 Cardinal Reporter l. Thesis-The Influence of the French Parnasse on English Poetry. NILS EIVIND STABO . . . . Decorah, Ia. l'Henry" LETTERS AND SCIENCE Alpha Tau Omega, Luther College l. ELEANOR JEAN STANCHFIELD . . Fond du Lac A'Naane" , HOME ECONOMICS Euthenics 4, Cardinal Board of Control 4, Cardinal Staff 2,5 Wisconsin Agricultural Association, Vice-President 4. Thesis-Relation of Diet to the Resistance of Infectious Diseases. RACHEL STEARNS . . . . Madison URW.. LETTERS AND SCIENCE French Clulo 3, 45 Taychopera Camp Fire Z, 3, 4, Secretary 3, 45 Gym Team lg Crew lg Badger Staff 4. Thesis-The Factors of Form Perception. ' , Z ? 5 . 9 f f if f 1 1 E A, IIIIInIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIII In I III I II I II I I II InIInIIimiIiiIiiIInIIIIIIInninInIInIIiIIIIIIIIIIIIIIIIIIIIIIIII 5 Page 133 I III I I mi II I I II II II I IIIIII I 1 I - '- n f " I A . . 5 f , 5 Q W 12 fy ,X 41 2 P A a I I 4 SQ? . I Jaw f cp , , I X? Saw Jig up ,. 31... :,aaK"sf.:ai::,:ig,.- , rf' 9,335 4 Q 4 1 Q 'Aw Q, 6 19f X J N I K ff- 5 K i gas A X , A .fr . ...N,,, .if . m f. . .ras-af.z:2' -'LQ iIi:. i.:i .1:.1::f-A if we A A 4' xx w ab J 2 X' X we Q' i Q X f 4.1 Q' Sri, HR .I i X 'A fx Nh 3 M . h .,g Q .1 -.-1 ,.,...., ., ,.1,., , . ,,.. .-Q..-.Y ,,., ,M 1 sijllf' 1 ..lQ4 ' ii . I .. , - K' I ,,,,.....,.M,., ' .ff Aff A . -.,. fi ff- 1' 1,.,...:.S,, ai., ,. f A.. I A f :ff-.iw-'fg.-,.w 1.1-f ,, A I .y .,:g-gm i 1 .' S-fri -:2"Y.:??f AY' , fi 1"A',S.?i-:--'fiil--3.-215.:Qi--'Vi'-I:-5'-l:1:'EffT'E'fHig -..7. l fig: 3745 . .f'if?.fi 1 X i A ' egg, Y Q, . I V S . i Q. S3 1 S 1 l , ' i. ' 1 f A ' X . f 'K :W if X effvlfl ' cu I xt ' e I A f R x I . X ix ,- f M X, 'i V I xx 4 1 ,yy E Nfl f a jf ,ai f fif' N X f is I N I ff 7' I iis A eelsl iira . i I e Q l f ff , I 'wgiaaix ZQ- G Q-M.-!:.,..,.A W W 'WWI-grail? Y ff- - , , - ,2 , .., EMIL FRED STERN ...... West Allis MECHANICAL ENGINEERING Tau Beta Pig Menorah Society 1, 2, 3, 43 Engineers' Club 2, 3, 43 Pi Tau Sigmag A. S. M. E. 4. ESTHERIVLSTEUDEL . . . . . . Chilton LETTERS AND SCIENCE Thesis-History and Future of Railway Administration. SARA FAY STEVENS . . . . Chicago, Ill' 'osazzy' LETTERS AND SCIENCE Alpha Xi Deltag W. A. A.g Bowling 3, Thesis-Methods of Hiring and Firing in American lndus- trial Establishments. - N. HURLBUT STEVENSON . . . Burlington, Pa. "Steve" LETTERS AND SCIENCE Chi Omegag University of Colorado l, 2. WILLIAM H. STEVENSON . . . Onalaska LA XV Phi Alpha Delta: La Crosse State Normal School l, 23 Clee Clubg Holder of Exchequer, Blackstonian Court. MARY KATHERINE STOFFLET . . . Bishop, Cal. LETTERS AND SCIENCE Alpha Xi Delta: University of Southern California l, Z3 Choral Union 35 Suffrage League 43 Y. W. C. A. Thesis-Chinese Immigration to California. HUGO A. STOLTENBERG . . . . Manitowoc AGRICULTURE Alpha Zeta: Agricultural Literary Society. Thesis-Raising Dairy Calves. J. ARIEL STOLZE .... Wausau MEDICINE Phi Beta Pi, Thesis-Topographical Anatomy. LEILA E. STORMZAND ...... Madison LETTERS AND SCIENCE Platteville State Normal School l, 2. I-jfhesis-Private Employment Ofhces as a Factor in ln- ustry. AGNES L. STURCES ..... St. Louis, Mo. HOME ECONOMICS Pratt Institute l, 2g French Club 35 Euthenics Club 3, 4: Y. W. C. A. 3. iiiiiIiiiiiiEiiiiiiiiiFliiiiiliiiiiiliiliiiliiiiiiliiiii P a g e I 3 4 55 I5 EE Eli as E12 if i. 5.25EEEmm5m,.nwljiinzaiz VIV V I I V V I V IV VV I I .V I V. V I V . I ., , , , , , , Els if I RAYMOND J. SUCHY ..... M ilwaukee " LETTERS AND SCIENCE Milwaukee Normal School I, 23 Hesperia Literary Society, El Vice-President. :ig Thesis-Construction and Operation of an Ionization Manometer, CATHERINE C. SUMNER . . Madison 2 "Kazy" LETTERS AND SCIENCE gg: Delta Gamma. EE' Thesis-Experiments on Rabbits to ,Show the Action of Certain Aquiline Dyes in the Disinfection of War Wounds, RUTI-I D. SLJNDELL ..,.. Mason City, Ia. "Sunny LETTERS AND SCIENCE i Pi Beta Phig Rockford College lg Business Staff Wisconsin ' Literary Magazine 3. 'l hesis-Stevenson, the Man, as Seen Through His Letters. ELISABETI-I SUT!-IERLAND . . . Hudson "Beth" I-IOME ECONOMICS Omicrori Nug River Falls Normal lg Euthenics Club 2, 3, Q. 4: Castalia 2, 3, 4. Thesis-Relative Proportion of Rent, Food, Clothing, and Other Items in Budget. ROBERT M. SUTTON . . . . Peoria, Ill. ..Sut,. ' MEDICINE Beta Theta Pig White Spades, Star and Arrow: Basketball 33 Baseball Z, 3, 4, Athletic Boardg Sigma Sigma. Thesis-The Adult Arterial System Shown by the X-Ray. CLEARY NEIL SWANSON . . . Marinette "Swan" MEDICINE Phi Beta Pig University Band 2, 3. Thesis-Topographical Anatomy. BESSIE LILLIS TAYLOR ..... Glen Haven LETTERS AND SCIENCE Pythiag Wahzedah Camp Fire 1, 2, 3, 4, Secretary 4. Thesis-The Emotional Impedance of Marine Receivers. SARAH M. TAYLOR ...... Ottawa, Ill. "Sally" LETTERS AND SCIENCE Kappa Alpha Theta, Lady ,lane Grey School I. Tlrbesis-Impression of Early Western Travelers from 1750- 18 0. VIRGINIA SIMPSON TENER . Wheeling., W. Va. "Gin" LETTERS AND SCIENCE Qlphg Xi Delta, Theta Sigma Phig French Club 2, Bad er oar . Thesis-Keats as the Poetic Expression ofthe Celtic Tem- perament. , M. l-IELENE STRATMAN THOMAS . . Dodgeville COMMERCE Platteville Normal 1, 25 Glee Club 2, 33 Womarfs Com- merce Club, President 4. Page 135 n ini I is ui I ii Ii in uruu I u I iuniuiimn nu n mini iii min imimn I im iiiiimiii 1 EVA M. THORNTON . . ..... La Valle LETTERS AND SCIENCE , Mathematics Club 3, 4, President 45 Suffrage League 4. Thesis-The Group Concept Algebra Of Combination Of Operations in a Group. KATHARINE TIERNEY . . . 'Niagara Falls, N. Y. H UK. TA.. LETTERS AND SCIENCE Alpha Xi Deltag Buffalo Normal l, 2. Thesis-Ability to Distinguish Sex Differences in Hand- writing. -JOHN FRANCIS TILLEMAN . , Green Bay 'iTillie" LETTERS AND SCIENCE Phi Kappa Psig Gamma Tau Betag Beloit College 1, 2. Thesis-Physiological Effect of Poisonous Gases. HAROLD W. TILSON . . . Terre Haute, Ind. "Tilly" COMMERCE Phi Delta Theta: Franklin College l, Z. THOMAS E. TORPHY . . . . Milwaukee LAW Milxx-'aukee Normal l. DOROTHY MAY TRICKEY . . . Berlin ADM.. ' HOME ECONOMICS Choral Union 3. Thesis-A Study of the Bacterial Flora in the Normal Throat. ALICETURNER . . .... PortW'asl1ing1on LETTERS AND SCIENCE Kappa Alpha Thetag lvlilwaukee-Downer l. Thesis-English Seamen During the Sixteenth Century. HELEN LOUISE TURNER . . . Toledo "Pele" LETTERS AND SCIENCE Alpha Omicron Pig Wells College 1, 2, Y, W. C. A., Con- sumers' Leagueg Assistant Classes Editor Badger 33 Adver- tising Staff Cardinal 4. Thesis-The Recent Emigration of the Negro to the North. THOMAS XVESLEY TUTTLE . . Madison AGRICULTURE Psi Upsilong Alpha Zeta: Associate Editor, Country Maga- zine l: Haresfoot Play 2, Haresfoot Follies 3, I-Iaresfoot Club 3, Glee Club 3, Swimming Captain 35 Scabbard and Blade 23 Junior Dance Committee 33 lX4ilitary Ball Com- mittee . PAUL FARRELL TYE .... West Chicago, Ill. COMMERCE Alpha Sigma Phig Commerce Club. Thesis-Railroad Problems. iiIiiiiiii-iiiiiiiiiiiiiiiiii im ii. I i mi.. ii Ii I iumi L EE I I I IliIillullllirlinliVIIIHIiliiluiIiiilillllllivllulvlliv I Hlmmwm D-mmm-N 'WMMNM-Mn - Page 136 uniii vuiiii ii I im I I ii Iiniii xiii iiiii I ii ii I iiiImlmmiiiiiiiiiiiimii MAURINE VAUCI-IN ..... Des Moines, la. LETTERS AND SCIENCE Delta Gamma, Drake University 1. MARION E. TYLER ..,.. . Glidden HOME ECONOMICS Alpha Chi Omegay Notre Dame l, 2. Thesis-Psychology of l extile Advertising. EUNICE R. UEBELE ....... Tornah LETTERS AND SCIENCE Northwestern College 1, 23 Choral Union 3, 4. Thesis-History of l'On'Iah, Wisconsin. I iiiiii I ,, '-ii' 3 f ,I UIJ. Vii. , .jf , Q HELEN LlZZEL ....... Denver, Colo. HOME ECONOMICS ' 4 Thesis-A Brief History ol' Batik: Primitivefand lvlodern I " Adaptations. i . ,ml fl, 4 i '. V ."" 2.31. RUTH VAN DEURSEN ..... Dalton, Ill. . ' 'IM LETTERS AND SCIENCE fT'V':"a., .3 University of Chicago I. I f ' ' ' Thesis-The Function of Aphra Behn. . -..5 S , K f .A i f tix.-1' --iv , -. ALICE VAN I-lIsE ....,.. Madison ' I - I 2 LETTERS AND SCIENCE I gif--4-A-. French Club 3, 45 Student Council 3, 43 Vv'Omen'S Vwlar , uf, V I ' , Work Council 3, 4, Editor Wisconsin Litcrary Magazine 45 S f' if :L I Erenchglay 3. , yi' '- , .-7? ' I , hesis ourse. f -1- I rzraiaw 7' 7 ' ' 1 If ' ADA VAN STEENBERG ..... Lansing, Ill. I f I HOME ECONOMICS . XX , T I ' Z -Omicronglua LewisllnsgitutglA2LFELghIerI1ics 3, 4. ' A if A ' ' hesis- tu ies on ee ing . . . . en. .- gf-y . ,If ETHEL L. VASEY . . ..... Menomonie . . f, - is . 1. Qld, Z, 4 . : ,iff " LETTERS AND SCIENCE , .,,. 11 Central Holiness College l 1 Mathematics Club. fil l I ' V ' ' jj ' ' ,f awe., Z, ,. ,,f Thesis-The Discussion of Certain Loci in Plane Analytic ii , . f "d X ' g,,:,l,f we , K , gf, -21. 151' I -4 Q, HAROLD F. VAUCHN LP. . . . M ilwauhee V V L, me V ' Q452v., "Tf's 4'NQ' E3. ' LETTERS AND SCIENCE . Esta klssiggiaselliall 1 3 Football l, 2, 3, "W" Mang Assistant .:,.6 , K il oo: all oae 4. or L ,f ee gm. -IW ' 5 I MARION ELIZABETH VESEY .... La Crosse oi, -e.,,, g 4 Q 4 7,3 ir,-3? -'-ffI Ras "'9"f-,SKI fa Z Q, LETTERS AND SCIENCE . j , , ' La Crosse Normal l. 2. -'tif Thesis-The Discussion of Fictions in the Atlantic Month- '," W,,IQ.j',.Qj,Q.,"1'l 'fi' , . .,',' Q ,V ': , ,.,,,, , A ' rig ly, Harpers Monthly and Scribners for 1917. "" 4 f 'cf-W ' -to ' 4 Q1 Page 137 I.III..Ii.IuiI-IIuiii.IiImwiiimiiiiiiiiwi iiiiiiiiiiiiiiiiiiiiiimii mlm II I I iiiui I I I I ROBERT STANSMORE VIVIAN . . Madison MEDICINE Gamma Tau Beta. Thesis-Topographical Anatomy. MARCARETMOOREWADE . . . . . Muscoda LETTERS AND SCIENCE Theta Sigma Phig Cardinal Reporter Z, 3. Thesis-The Development of Women in the Works of Hawthorne. FRANCES N. WALKER .... I. Algeria, Ia. ' LETTERS AND SCIENCE Grinnell College l, 2. Thesis-The Influence of Samuel Butler Upon George Bernard Shaw. FRANKLIN XVI-IITTELSEY WVALLIN, Grand Rapids, M ich "Guernsey" AGRICULTURE Phi Gamma Deltag Alpha Zetag Congregational Students' Association l, 2, Social Chairman 3, Agric Crew 2. Thesis-Arrangement, Construction and Equipment of Buildings on a Farm Producing Certined Milk. LUCY WALLRICH . ...... Shawano LETTERS AND SCIENCE Gamma Phi Betag Mortar Boardg Keystone 43 Council of Defense 35 Vice-President 43 W. A. A., S. G. A. Council 33 Elections Committee, Chairman 33 Y. W. C. A.g Basket- ball l. 2. 3, Varsity 2, 35 Hockey 2, 33 Track 2, Varsit 35 i'W"g Union Vodvil 2, Assistant Chairman Vocational Clon- Ierence 3: Chairman junior Advisory 35 Organizations Editor Badger 3. Thesis-The Effect of Exercise on Blood Pressure and Pulse Rate. RUBY WALTON ..... Scales Mound, Ill. LETTERS AND SCIENCE Gamma Phi Beta: Northwestern University l, 2. Thesis-The History of Galena, Illinois. EDNA MARGARET XVARD . . . Sioux City, Ia. "Eddie" LETTERS AND SCIENCE Alpha Xi Deltag Y. W. C. A. 2, 3, 45 Suffrage League 2, 35 Consumers' League Z, 3. -lg Social Service, Y. W. C. A. 4. Thesis-The Treatment of the Family Deserter. GLENN B. WARREN . . . . Girard,Kans. "Bart" MECHANICAL ENGINEERING Theta Xig Tau Beta Pig Pi Tau Sigma, Philomathiag A. S. M. E., Varsity G m Team 33 Forensic Board Z3 Student Senate 3, 41 Semi-Igublic Debate Zgjoint Debate 4, Vlfiscon- sin Engineer StaH 3, Editor 4. Thesis-The Gas Turbine. ALLEN SMITH XVATSON . . . Madison "Walls" MEDICINE Gamma Tau Betag Lawrence College 1, 2. Thesis-Atypical Epitheliomata of Skin. CARL bl. XVEBER .... . Hartland MEDICINE Phi Beta Pi. Thesis-'I opographic al Anatomy. miIiiinimiiiiiiimiiiiiiiimimmiiiwiii In im, .ru -nm.. i...Ii.....n I II.,I.,i....Ii.i..i.....i..II.W,..i.i..,.,i....i , -R--"W-H+--'mr Page 138 IRMA WVEISER .... , . . . Waunakee LETTERS AND SCIENCE Thesis-The Non-Partisan League. - 1 NORMAJ. WVEISKOPF . . . . Sheboygan I ' MUSIC Glee Club 23 Choral Union l, 2. DAVID XVEISS ...., . flfaclison I JOURNALISM Intercollegiate Socialist Society l, 2, 3, -lg Cardinal 1, 2, 3, l Press Club 3, -l. Thesis-Essential and Non-Essential Elements in Repre- sentative American Daily Newspapers. CHARLES W. T. WVELDON .... Milwaukee LETTERS AND SCIENCE Paul Morphy Club 33 Lasker Club. Thesis Course. EDWARD O. WVERBA . . , . Milwaukee "Eddie" MINING ENGINEERING Tau Beta Pig Mining Club, President 4g American Insti- tute of Mining Engineers, 'ghesis-A Report of the Carltota Mine in Santa Clara, al. VIRGIL ROE WERTZ .... . Madison AGRICULTURE Thesis-A Study ol' the World Wheat Market from I909- I9l8 Inclusive. ANNA WHELAN . . . . . Mondovi "Ann" MEDICINE ,JULIA P. WHELAN ..... . Mondovi elude.. ' PHILOSOPHY COURSE IVahzedal'I Camp Fire I, Z, 3, 4, Treasurer I, 2, Vice-Presi- dent 4, Y, W. C. A., Poster Committee l 5 Hockey Team lg Baseball 3. , Thesis-Glycero-Phosphates. FLORENCE WHITBECK ...... Madison LETTERS AND SCIENCE Pythia I, 2, 3, 4, Secretary 33 Y. W. C. A., Cabinet Council 3, Geneva Club, Thesis-The Evolution ofthe Tanning Industry in Wis- consin. DORA N. WI-IITE ...... Mineral Point LETTERS AND SCIENCE Thesis-Poetic justice in Shakespeare. I WA it EN... we fxeww IIIIII.II.III..I..II.II.,II.II.IIIIII I.IIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIMIII II I I I II II I I I I I II I I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I Page 139 .I I I I I I I nun min I IIIII IIIIII In I I :nun KATHARINE PAGE WHITESIDE . , Louisville, Ky. UK' Pi.. LETTERS AND SCIENCE Pi Beta Phig Smith College I3 Theta Sigma Phig Twelfth Night 3, 4g W. A. A. 43 Castalia 23 Keystone 43 Union Vod- vil 35 War Orphan Dance Pageant 33 Swimming Team 23 Dancing Team 33 Wisconsin Delegate to National Con- vention 33 Re rter Woman's Page Cardinal 23 junior- Senior Swing get Committee 3. Thesis-Contemporary Poetical Drama in America. I-IILDA F. WIESE .... . Madison CHEMISTRY Thesis-Preparation of Phlocoglucinol. ARTHUR N. WILCOX . . . . Madison "An" AGRICULTURE Alpha Zetag Edwin Booth 2, 3, 4, President 35 Agric Lit- erary Society 3, 43 Agric Association, President 43 junior Play 35 S. A. T. C,, Vodvil Manager 4. Thesis-"Running-out" in Vegetatively Reproduced Hor- ticultural Varieties. CLARA BASSETT WILLIAMS .... Whitewater LETTERS AND SCIENCE Gamma Phi Bcta3 Whitewater Normal School3 Mortar Board, W. A. A. Board 3, Vice-President 43 Ski Club, Treasurer 33 Y. W. C. A.3 Hockey 2, 3, 4, Varsity 3, 41BaS- ketball 2, 3, Varsity 33 Baseball 23 Track 35 S. G. A., Ex- ecutive Council 33 Wisconsin Delegate to National W. A. A. EDWARD BARNES WVILLIAMS . . . Milwaukee ..Ed.. MECHANICAL ENGINEERING Psi Upsilong Pi Tau Sigmag Star and Arrowg A, S. M. E,3 Track I, Varsity Track 2, 3, 43 JUDSON SPARKS WILLIAMS . . . Bristol ..Jud,. AGRICULTURE Delta Phi Epsilon: Varsity Wrestling Team 43 Class Foot- ball 23 Chairman Sophomore Smoker 23 Inter-college Basketball 33 Interclass and Intercollege NVrestling 35 Intra Mural Sports Committee 43 Class Basketball 4. MADELGN C. XVILLMAN . . Madison "Willa" Music Clel Club 3, 4, President 43 Choral Union I, 2, 33 Twelfth Night 3, 45 Keystone 4. Lhesis-An Introductory Study of Some Correlations in usic. I-IARRIETTE XVILSON ...... Milwaukee HOME ECONOMICS Milxvaukee Normal School l. Thesis-The Microscopic Structure of the Colonies of Cer- tain Ivlilk Bacteria. JOSEPH ORIN XVILSON . . . Oshkosh aloe.. AGRICULTURE Acaciag Philomathla. Thesis-Corn Against Barley in a Gram Nlixture for Milk Production. EDMUND MERRIMAN WISE . . Fond du Lac "Ned" ENGINEERING Tau Beta PI: Eta Kappa Nug St. Patrick 35 Wisconsin En- gineer 2: Associate Editor 3. Thesis-A Study of the Application of Frequency Filters to Phonographic Recording Instruments. W Iiuiimiii .IIInmmiiiiiiiiimwii I I ImiInInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIImmiiiuiiiiiui I I I I I I I I """""' Page 140 GLADYS M. XVISE ' ..... . Madison "Clad" LETTERS AND SCIENCE Y. W. C. A., Cabinet Council 45 S. G. A., Council 45 W. A. A., Board 3, 45 "W" Wearer. Thesis-Ergographic Experiments in Right and Left Handed Men. BEN XVISHNEFSKY ...... Milwaukee LETTERS AND SCIENCE Athenae l, 2. 3, 4, Censor 3 5 Semi-Public Debate Z5 Sopho- more Financial Committee 23 Joint Dehate -I5 Council ol' Defense 45 Badger, Assistant Advertising Manager 35 Business Manager 45 Menorah Society, President 45 Chair- man Class Finance Committee. Thesis-Satisfied by joint Debate. I-IAZEI. GERTRUDE WOLCOTT . . . Milwaukee HOME ECONOMICS Normal and Industrial School l, 25 Euthenics 3, -l. Thesis-Methods of Institutional Accounting. RUTH M. XVOLFE . . ..... Suri Prairie LETTERS AND SCIENCE Pythia 2, 3, 45 Taychopera Camp Fire, Recorder 25 Outing Club5 Suhfrage Leagueg Y. W. C. A.5 W. A. A.5 Methodist Student Choir. Thesis-The Novels of Anne RadclilTe. KING GRIES WOODWARD . . . Peoria, Ill. "Woodie" MEDICINE Beta Theta Pig Bradley Pol technic Institute 15 Star and Arrowg Skull and Crescent5 gym Team 2, Captain 45 Union Vodvil 35 Student Senate 35 Y. M. C. A., Cabinet 35 Ath- letic Board, President 45 Athletic Council 45 Dance Chairman 35 Student Council of Defense, President 45 Junior Dance Committee 3. Thesis-Topographical Anatomy. LAWRENCE PERRY WORKS . . Madison "Larry" ELECTRICAL ENGINEERING Theta XI5 Eta Kappa Nug Engineers' Club 45 Tau Beta Pi 4. Thesis-Advantages of Central-Station Electric Service. LUCILE RUTH WORKS .... . Augusta "Louie" LETTERS AND SCIENCE Gamma Phi Betag Geneva Club 2, 35 Y. W. C. A., Secre- tary Z5 Cabinet 35 S. G. A., Judiciary Board 3, 4. Thesis-Some Factors Producing the Evagination Cysteri- cus. CORNELIA WRIGHT ..... Winona, M inn. "Carney" LETTERS AND SCIENCE Delta Gamma. ANNA YABROFF . . ..... Fond du Lac LETTERS AND SCIENCE Thesis-Religious Ideas of Shakespeare. BERTHA D. YABROFF ...... I-Ioricon "Burt" LETTERS AND SCIENCE Blue Dragon Inn5 W. A. A. 35 Pythia 3, 45 Menorah 1, 2, 3, 45 Secretary 4. Q Thesis-Shelley's Friends in Shelley s Poetry. .L X -iei 51 ii A A 7. Ie.. . Y QQ, . rf K 'f K 4151" l p 2- - I 2 1 I 3- 5215.4 '5'5' If I - imqlf ffifggg A an . fi Q .5 e fffhg, itaeaggg Q 4 - J- .3 "' ' Q' A '4t,, ITEEET' 3 ' 5 if . . I ada ',..f 5 ' , I fcfgfzif f . .... . ff' yr- IV" Eej algae.. 5 .t . ff' aj,!ff -' N A! fg 1 , .. - .Wm : I. .- .Zu . . I f eeea?f5t4aa .I?"3 . aaa" I. "'E"..W W s 29 ' I ' i P" If Z 5 , I . 3? Z I , e X' il 3 'i as ke 7 f X :..v5.,,QE.g, .' 1 'l y ,I , . - Is' 1, f .I-I , 5 . lVgQn.A n4E g .. V ...V, J 3 V V. 3 I fl I- fi- fem: f , .. .. fe I -ag -f.e ff , I X, . I ,.f- ,Q ,,,.. 6225. -.. .,, - ., .gil 5:31 51- .VJ I9 . 22.1. ff'2r eeffee.. f 'n-Qf:.fpeee febeea ve? i ,-fmfZefw ii ' . U 'V . " 5 I ,kv Z wi ' ' 1.1 , " ' 'L ,ZIV Q ff f , tw' , een X g X xi V .5 gf ab' 'wig i ,.,, sr .i" I f' 'A 33 .5 V. .... .12 V . . Q ' ij., I. 1 . Iv,I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II I II II II I II I I I II I I I I I II I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I Page 141 an i 1 T M ltllxv WL! .vl. F lllrhl mimiiuili u A. HERBERT KOSCHMANN . , Wausau "Chula" LETTERS AND SCIENCE University of Chicago l, 2. Thesis-The Origin of Certain Metamorphic Rocks. IRENE OLIN . . . . Florence ..Pax,. LETTERS AND SCIENCE Minnetoska Camp Fire. Thesis-Fur Trading in Southern Colonies. XVALTER Ti-TAUER . . . . Watertown LAW E Phi Delta Phig Philomathia. LILLIE TREDVVELL ....... Chicago LETTERS AND SCIENCE Pi Beta Phig Black Bat. Thesis-The Women in Galswothy's Plays and Novels. MARTHA YOUNG ..... M emph is, Tenn. LETTERS AND SCIENCE Agnes Scott College l, 23 Basketball 3. Thesis-Americanization ofthe Immigrant. ARUTH ZILLMANN ...... . Thorpe LETTERS AND SCIENCE Alpha Chi Omegag lvlilwaukee-Downer lg W. A. A. l, 2, 3, 43 Y. W. C. A. l, 43 Suffrage League 43 Basketball lg Hockey I, Thesis-A Study of Tests of English Vocabularies. W l 1iniuiiiiiiiinii-1T.IiTviTlwiiiimimiilw-ii mmmmnmmi ii mimi El ' ' 1iniuiiniuiuiiiiiuiiniiiTTiiTmnimmmiiimm ""'M""""" """" Page 142 mnmumuwm umm umm num vw nmumum v ml In mu um mn u N my vu vm I I N mum mum T u mvummw u mm ru nw mm mum mn T1 1 H T I I nm mmmu uw 1 T u fummml u ww T v 14 wmuwmnw: : ..5X...m....Xm,.X...XXX. X X X X 23-.numum ,T . -XL nmmum uw u wnmmnumnwn 1 Tn X: arg Si: x E .X. . jg QE .fi il? .L Z! 21' E.: m X : 1 2 aww xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxvNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxgm 2:5 xxx . QS ' s XQ ,Q 5. XX NX -1. 1 N N 15 19 UTI 10148 20 E 'Ni A f M :N N5 EN 1' V NN S 3 5 S SN QW, ,.,, ,nzqw-wmg 'ffffffffff : sgggggggigvgxvg' SN bb.. -'Z-,,,,..-+ is -,.. QS Efffliffli .::::1':E' Pt..-:N NT- ---- N-N 0 ----, gg. X XY , SQSYWN,NNMTW,wwmwXRQQWQQQQQQ .... . M::x.i.g,SNgmQmQQw,Namw...mzaaawwlxNAKWWWWNWNWNNNNNQQS , ,,,,,,, ,X,, xxx . 2 Eg ' s -S 1 :E 1 2:3 i , jumor Class Officers 1 . . ALLEN SPAFFORD . . Pre-Yideflf E DORCAS J. HALL . . Vice-President HELEN M. SNYDER Secretary X HERBERT B. WRIGHT . . 7'rff1SUfGf ANTHONY G. ZULFER . Sergeant-at-Arms -- -X- - T Q T - . 1 f V 1" 3 .. A 1- T - T ' X Q. V ' 4 VTLT . . ' T .,,,, - , X. Q ' . : fP-' -' 5 ' " -' ..V' ' .. - Spaffgrd Hall Snyder Wright Zulfer X. Ee :LQ E jg- :L T1...TN.,mmm,,..,....H.....,... 4 ., . fu -H-I-L, XXXX ,,M, -0 gm ,.,. H :zusafe!ur:221222:lufwlufweuuwzitllrf ' J!--I-1-5 4,., 2 -2.2.22-Jllhlfh .--4-. --.f N- H.,Ty.mi:mi5niazna:nn:u:nammaana'a "" ..,, H . ...W T....,. f.T..,T......,. ....,..T.....,.,,.....T.n..,,..,., u...T...,...m.,..T..T.n.,,..,...Tu.mn.,.........,.,.,..,,.....,..,..........,,...,.,.....,.,.H.,.......T.,......,T...T...um .,..,. ml .T.mT.,., nm ..T.u.,..H. .m,.,..1T.,..,.... W U W.,H.,,,.,T...m..,.,m.. . .. ... ..u..... Page 143 55 E wvmnnn1nwwnwwuvmymm1uv1n1unmmumuwmin1uwrmInm1ynwmmmwwInanwuw1nwInInwuwwnwanuv1In1munwanwuwnuwuw1uwun1uwunwmnnwnwwmInwuvwnwunwuwn1wuwuw1nwuvwn1snwuwwuwanwu1nu1uwwn1nwwnwrnnuwnuwnwnuinwmwmunwnuanwn11nXuwnnwmmuuwulunwunwnwwnun1nnwnwnwrnwnwnwinwn1munnnwnwruwuwnuanfuwuxxuuninugW53E1Wwfuuvxanannyxp155infH5mfE!!mf3:5mgQ!35555551ifiwH33M53551E!!3535555153mfIEuf1innwgfwfqm1555lmmf1inW3wffflwllniwg 1-nmzzznnzmmzmazzmnmznz:za:zzman:Q,:::::::zzz,zzzzzzzza,1:1ans:51:1nz,an:zzzan,az51:15:1azz.zz:azz:sn:sam:zz,LQ:2:11z::.::,zzz1:11Lsrzzzzanzz:,zz5:1.zz:xx:zz1..zzz,La:zzz:LanazzanLs:1zz:9:1151zz:,m.zzusaann:,:A,Nsz...H,..,..,...,,..,..,..,,.,...,,..,..,,..,,.,,H,,.,.,,,,.,.,....,,.,N.,,.,.,,.,.,..,,.,,..,,,.,..,..,.,.,..,,,.,..,,.,..,,.,,..,,..,..,,..,..,,..,..,,.,,..,..,...,...,..,....,.,..,,..,,..,..,..,,..,..,,..,..,,.1,...,..,,.,,...,,.,,.,,...,,.,,..M.,..,,..,,..,..,,..,,.,,..,,..,,..,..,,...,...,..,,..,,,..,.EEE 2 E E 2 EE .11 E55 Ez: as age J: Ei: :KE ii: 553 E25 5 .w,. HWWW.HY,.....,W.mml...myW...,.HH.,,..m.,..1....i.m.,, ,..,. m..1,..V.., ...,......, k.,...H ..,. ...H,Hn.,,..H...,..,..m.,L..H.,,,.H ,.,.. H ,,,.. N., ..,,..,..,,, . ,K..,... mu., ,.,,,., k..,..1, ,,,,. ,H,W..W,..WK.YX..Y...N.YX.WW.,W..WH.Y..Y.HX..,,.,...,..,H.,...H,.,.,,,,.,.,,.M.,.m..,, ,w.. .k.mm..,H.N.WW.HW.1W.N..,K.W.W...,,.H..N..M.M...H,..,H,M.,..,,..w,.m..,. .4,. .1Y.H..,,..,..,..,,,.,,.H..,, ...K , ,..,, k..m...M..,, .,,.. ,..,.K..WW.1.. .w.. u..,..m..,.,.. ...K .,.r"..,..,..m.....r".,,K..,........,.,u....1......m....m. Page 144 as ... :Ez 222 mmmmnumuvuvmnnwmunmnrnw1111H11nwwwinM11H1w-IWmumIn1H1.I11-11rl11nwH4mHInH4wH11111.11wVwwn1HwUwwgHEuggw51W5.4in1V51w51w551WHfy53155133451.1mw551W155M3Wym153,E3155153wV5in3ynWumH3wn11IfwH3uww11wnw311in1wHuuuulUInm1I11uwwU1wI+uHumMHmmwH11-4wH1wmmmNIn1-11V-uuluH1wI--rluN-HInuw1In1Hum1I.uwmumuf1HuunwHuunu+NHwuw1Hwm.u..ww.mmHwH11.111.1X.1X1-1MHWW1fn1uww-INuNWHNInmw1H1XIfXmmHmummmumw isU.....-M..mmW...WW.....U.,.nm..,...W,..,,,.,X.1,,.,,,.,,...,..,,..,..,,,.,,..,..,,..,,..,,.,...,..,,.....,,,.,,..,W,..,..,,H,.1,..,,..,..,v.,,,H,..,,.,...,,.,,..,..,,H,,.,,.,,..,,.,,.y,,.,,.,,..,..,,,.1,..M..,..,,..,,..,,,,..,,.,,..,,.,,,.,,,.,,.,,..,,Um.U.....,,...,.,,.,,,.,,..,...,,H,,..,.,,,..,..,,.,H.,..,,,.,,.,.,..,,,,.,,,.H...,,H..,,...,..,N,,..,,,.,..,...,,..,H....,W.,,.,.,.,H,,..,,.,,..,,..,,.,,,.,,..,.,,,.,4,...,,.,,...,.,,..,.........4,,........,,....,,.,.,,...,.....,,..,,W,.,,,..N.,......4,..,.,.,H,,,.,...u..,...,..w.,..- E Ei- ,., -- 552 EEE ii: EE E,-.smmm.,H.,H....l,H.H.11..-mnA..num1.HH.V..11.Umm,in11.1.H1..,V.,,.H...H.,,.1,.,,1.1V.....,,.4myK.,H.U.,H,,H,..,,H1..X,.N,.,1.4X.-X...WXV.XX.NN..,..4V..W.H.m..m,,.,, .,..,, , ,,.,,, .1Mmm..H.m.Wm.m.W..H.1H.H..H.1,.1X..1,UW.W.mm.n..1..N.N..N..,H.XK.NW,in.H,.H,.H.4,..,..wm.W..H..U.W,.W.mm.m.m- ,.., X.,1.11H..,.W..wWm.Hf11K.1V.,11.,1.,,..,H,,..X,1X,-1,VH,..1V.11.11..,1H1.11H,,.1,V.,,H,1.1N.1,K.,N..,L..,.1,,HV..,I..1.NL..,,....m.m,...w.Wmegg unmmmnunmmwInnnmywummummumnumnmmm..wunvulilwmm1Innnvuummm-mxmmmmmunm1iiRii1IE1uwimumummlmwumwWwuwyuw'mmmnmmnuu.mmm'winw-1wm1Mmmmnmmmmlmnnlu1mvHwwnwuwmunfmmmmmm-uvnnummuninwuwwnwunuwnumummmlmmmmuwwmlI.1munwNH1mmmmmmlmw'mm-mlmvumXmXHwmXInmXmXwlm.mmmwmumWmulXmlmwmulXmXHulmlmmmmw-mm..mmmnlmmmlmi Page 145 wmmnmmmmru1fnnmmm:uwuvmnmvmnnuwmmm:fnmumWIfWWnWn1nv1mmmummwH1mmwwI1wuwnuvmvmn1wnwuwmwu1mmommmwrmfnnnwummInanWHwInwrninwmmvmuwlmnnwuwLHwvuinummummuumnuwuulHInH1wn11:wwE1waywyffmmnggf3gmggmg!35355255555555gfml55135511513551531355gg!!15315555gg!gm555ggmfgg!535lgggggggjgggggmg33515551551ggffgguggmglfg5555521553M5355335351EmMfglmmufgwgmgmwilll5553555335915 52,.mmmm1nulmH11Hrm1mlmInmyinumm-m.um..,.nfnWHw1..1in1HWInw.H1.ml,K..H.1mlK..vmruW.HW1kmU.mfmWWummmWWmmWufW-1W1-1x.Ninw11-1-11AuH-WW1.HmnuI-mm.w.mm.wHH.1mH.1.Hwmmmy1....U11.,,H1.HK.,H.Nlm.IlmH.Nin1.11.HmNvm.Hun..X.H1.....,VHV..NWm,..1my.....1N.HV.,1.HmXI.1.H11.H.NnvmH.N1.1N.Hm,.H...1HNmmN1.NK..U.,W...H..H..V..N.MnlN1.11..1..1V..mlInU..H..H.ml1.mnV..1H..1...mN.HH.myH.lmummmu.m.nu.,m..m-,wwe 3 55: E E EEE E E 2 E E E E 5 :E E ijgygggggglgggggfgg55511555555155353153553355553555mf1553553555535uw3555:MEMM.,tl.,H5Wmum...ynWV.3wg.1K..ny...nm..,K..,..XW1-.1H.X.HW,mX..,L..WHWU.,K.,,.,,......1L.,V..1...,H1,HX.1X.HX..XH,H.W.H,..,K.,...H.,K.,,..m.,..mm..1HX..X.H,V.,..,,....H.H,.,H..I...W...1..w..,...w.H..1H..lu...,..XV.,X.....,N..1...1.11.U.H,.HH.H.,...,.,.....,.,..,.,.......m.,K..,.....m...,.....ml...um.,um..W..nm..,....m...m.....um..mmm.XH.1m1.mm,....,...m.u.m.,....5- 3 5 numvwwummwvuwnnnmwnu1Iuzuummwunnuwnuunm1mrm1Innuwmwuwulnur1-Iwwvufu11uwmnu1mmnnwmnnanmywnuruxnumwu1mwmnuunnmunmmuwzu1Inmnurnwnununzwrnmununlxru1nwmnurnnumwmnumwuwnnnn-umunumuuwwuwuhlniillmilIIIIIIXIIIHTFIIHIYIHFIIHHiiiMKIIIiililFIIYIHTIEiilliiHHEWIHFIGHIHIIESIEHIIIRFUHRKIIEHEIDIHIEHElRh'iilfIIH1u:nuuummCifIiKinnl:ulIZHIIIIQEIIIEHIHIEHIHQYEIRWuinuxu1xuuummnnmnumumnummui P cz g e I 4 6 K 1H+mwmmuwvuvmmlwmHumu1In1mvmmuW1AmH41mumin1In1InwV-wUM.U1m1N11HmfU.Wmwnww.Iw1HwuvMHmXHXHX1H1rnW1-1mmwwin1I-1m1V..w.1WnfA..HynInWWIN-wwmwmInin1W1u1in1H1inmHnwIn1.I1114U111-11V-1Wuv1w.IXuXulHmIn1n1nymmm-wmwwmwmwnfnWHinwK4wW1H11HXmmHInmXu1u11H11U1WHIH1H1.I11.11H11I1XWWHm1-11uf11.41.1uH,Hwynu.mmmum-mmH1nwwn1NuXmmufu1I.1inuInuuummHInuv1m1u1nninumunffnuulwwwyg S fiiiiiiiilliil3155131515EQIIJIE55535225Qi?Gi?HJZIQIHinIl..1.H,Q.,ww1HU..,11111.1H.H.H.H,W,1.1.HWH.W.U.f.11H1m1H1mW.Hin1H11.11..XL..w..vm.m.mmmH.1.111.WW..vm.U...1.H1.1,.H,..,,.1mmm.,,m..,..1,..W,H,U.W.,,.4,V.,,.1,.L,,..,PII1L.I..l,I.QE11,il17111511,I.,1Qi1Fil,,QiQ52521Gillill22.1lil1iiiQ51,ElidillH311151413,Fil,iiiIl.JIMillGil,illQ11XQi?lilGil,il.1.11.J1HXZi?,L..xi.6121JilI..Rhi1QLA1.16111In1ll1L,X,1.,'.41,HUm.H1..,,..XInNK.NH.uwInm1W1H1NV.1K..vw.H1H1mmm-fwmmg 5 E !E E 5 EQ: 555 Egg 225 Ei M'"''"'"""''"""''"""'""'"'"""''"'"'"U'"'"'"''"'""""""""""1"""'"'''''"1"'"''"'"U"'"'""'"'"''"'H'"''"'"'"""""'"'"''"'"'"""'"'"""''"'"'"''"''H'"'"''""l2!H!!'l!!H!'!!!lI!!ll!!!E!!!!!lE!!!!f!!I'fEEETEEUEEYIK!HZ!E52E!!ll!EEIIZEIEEZIEEIEEEIEflfll'525221525E!!EE!!!iI!!2!flEffl2211555232251IEEIEEIEEEEIUlfZ!fH!i2!lE!1l!!!E!!!UEfI152551IlfilllIII''flEEZ!!!E!f'f!IfEI2!!lEf''!f1I!'IHHH!!!''!I3!!!Z3ZII!UEflZ2I!1221EZIZEEYEZYIHEHEEHEIH''...."""""'EEIE2fETH"'ff 5 imulwinwuhhwmEIMEEEIHMMFFIZIIIRIEEEIISIIEIUISRiiliiiliiwliliilili?GEii?Gill?HEiliilIilliiwillmiiiwuwwnduwmunw:ivuvulmummwInwInmmumn1mnwuwmInnful1.mu1InmvmunmummunmmmmmnwinIn1InXInnlulummm1.11in1InmmymummmnuInwnmnInmmmummmym1Hw1-1XmmmmmvmmmnunuInummmmmmvmnmm w.HH.wummnumlinHH1mHwinummmm1.I1wI-lmw-1un1ulinNinuwmummunInm1wmlmummmmmnmma Page 147 mylmummmrmwInm1mummm1n1nvummmnmm1HwHwwI11Hw1H1muwmvuwmvuwpnwInmmumwuw1Iw1u1fuw1Hmumm1-IwInwn11HwI-4mmNIn1n1uw1HwH41H1mWu1.11n11u1N1w-Iwmmvmmpu1H11.11m1H1mulHmfn1.41Wm11I11mm1XI1Xmnluw-+1mm1+I11.11vuXHM1mmHIn1I41H1inu+I11Hwuufuunu.ummm1n11uuHunmnufumumuHuH1wu1uwN-11uXWHmuwnl1nu1Iuun1uHuHwufunmvmnwww1u.uInm1141mwHwXuuuwWmu1.4wvu1n1uwwmulHmInrmuwuumummun :mmumum....1Inmy1.1.H.11.11.11..1HWH1V..11IHInV..11I-1Inm1,Hm1m,K.11U1In1m,..1WN11Mm1H1m1HXin1,iw1.il1.-1H1vmm11I,1m1.I1U11.w11H1L.11H1U11.11H11K.1.W.I1,1.1In1i.1dl1in5.11Il1G11IIE1riJill1hi1.111.11H1M1K.1,.4,1.,,K.1L.,,V.1V..1.IXX.11V.11H11U11.1V..11-1U11H11-111-11.11.I11I-1H111-H.11.4w1H1.mw.m.wm.mufl11.1,WW1K.,,.1N1.Nmm1mX.11.1XX..1U11.4,1.1N.11.111-1yn1.I1L.11I.1H4V..1X..w..N1HW11.M1N1X-IXI.1NHX1..1.HW11IQ1il1Qi!1Il1QIllEid1lil1Ii11ii1lil1512PQI1151IIIUIIRKIZRKIRGQUISLH ,WIMIIIIIIIIIII IIII If r w n1wwvuuvwmnwwnuwnwwuwn1mruwnuwLuwuwnvvwnwwu1nuwuwwuwnnwnuwnwLumuwwnwnwwvu11u1u1wuwmwuwvuwunnuwuwmwruunmummm-numn 1 5' IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIII'III.Im:.II.II.IIIIIIIIII,.. ,,,, ,I ,,,,,, I I WILEIIM WI1.41.H1V.,..X,.111-1L-X,..,L.,...,V.,11.1K.1L..1L.,M,..,X1,,1.,1.11..XV.1W.1,..W,1.V..X..,,..1V.,X.1,L..,..1V.,,..m.mww.m..,..,..,V..1,U.H,..1,.4,U,.4,,.,NV...N1.1W1V.,1..1...,H.1.1,H,K.,MX..X,U,H11.,1..1X..,.-.,..N,..,..,,1.,V.,.m..vwwm...., mm 1 . H :E ., , ,, ,I I I IIIIIIIIIIIIIIIIIIIIII I I I I I .. ..... .... ,,,,....,., , . . 'W' ""H'"'"'"""""""'4"""'- . .N.,,...w.,..,,.H..m ,,., ,..,.H,,.,,.H..,,..I...I.,I1..,..,V.,,,.,H.,K.,.H,y.,H.,..,H.,1.1Y..,K.,..H,.,N...W,..,,...y..,..,,..,,WM.,,..,U.,.H,...,..,,..,,,m,.,,.,1 . P a g e I 4 8 w w v r 4 XY Y ' x xx x M mx X X 19 op OHZOPQS 21 S2 SR S S gg W ,.-fflswfi: fffff?.':Pf-:1ffsi5s?f-'SKSXY vs ---- -A "'- RN w .. 45 z2E222.fffsE 2:11 ----'- r ..... X SXXsRRx.N.W.XMm.XwxwQww.:::xRS......R:Ni.Q.5NgSNQmiQqiSxRmw....xssaaxxwslswEMMRmRNWRRxsRRsRg SwXx wxsxmm1NxN , N,,,,x , ,,,. 3 Sophomore Class Oflcers ADOLPH O. TECKEMEYER I-I11.DA B. MAE-LEY , DOROTHY FRITSCH . FREDERICK R. I-IANSQN . HENRY B. ROYCE . . President . Vice-President Secretary . . Treasurer . Sergeant-at-Arms Teckemeyer Mabley F ritsch Hanson Royce .1 In M II I A HI .. .,..,.. ..,..., mmmmmmmmmmiii .,..... .M ...,... .... ..... ,.,, -..,-.....-.. .. Page 149 55 EE ga 5 5qm..,,.,,.... ,,.... . .,K,,,..,,...,.n.., nm., ...,,...,... .mm l.,,.,, m, ..,, ,.,...,,.m,,...,.... .,,,. m.,.L.,...... .,w,,,. mm ,.,,. M. .,.. ,,..,..m.., .,...,,.,,l... W.. ,.,,K .,,..m n,.,l..,.. ,..,......... .,,.,. , .,... WW. ,,.. w..H.,H.,,..v .,,.. 1Km...W.U,HH.,..WI..W,.WH,W.HK.,...,,.....,,...,.,,.,,.,,.w ..w,., , .,,K.,..,, .M ,... H.H.m..,, ,,,. mm .,..,,., 1.HH,,,.W..,,..,.,.,.,,.. ,,., U.K..YH.,..,.HH,H.Yum.,,..,.m.m.,,..u..,. ,,.., . ..,. HHH.HK.,WH,H.,,,.,,..,,.u...,.,,.. ,..,.,.,. .....,W..HH...H,H.u..um.,,H..,...,l 2 is s is Q i E- , 1. , E. . 5. . 5, : is 5 W :E 'Y 1 5..,,..,,,H,..,....W,Y.,.,,..Y...,rmX..,...y,..,W,.W,...,.W,..W,,..,..,. , .WI . H W., H I vu mu 1 xuvul1In1Inrnul11u1llHlAm4muvml1uINruxnlNlurl!HINrlvNmmllmmmllxHmm vl HAH u l vu vu n un nu w ur L E1 ,,,,,,,,,,,,,,,,,,,,,,H,,,,,,,M,W,H,H,M,,KmmYImW,mymXmyinXiHXInYInYInInmlXinMMMiminM.T....,...,..,...,,,.,..,...,...,,,,,.,....,..,,..,.. .... ..,..........,..,..1..f....Lin..l.1.,f.511.I..ruffle,Ji....5....:.:...!ff.11ttf11:5I!!5:2221211121E1525112:52:5::1:::J:!l51:12:25:25122152211f1t!:5!:1:::r::1Elin!!:Biff'121tl:112115:1:21!:!k!:2::52112::ef:::Jtill!!!:ri:relief52:ui:!!l1:!if:1l:f1:z2irfxerfrzirrfuffmwi2!1:u!1l!!M!utw:1!'.''."'."!::w!!k:22ME2tfwm..""".":f:'...H""'ms,,. ' uIwmlnvmumInfnwvuwInmwIuummmInnmmmmmumHXInmmnInufmwm1H1muuumunmnfumumnumummml n I w 11IwmmmmmnmumnfmInwInIn1uwInmumnwmmw1.1mwu1m1uummlmmfuummInnluuuwmmmmfmmmvmwInInmm11mmXunnmumlmmmmmyInulXmummmnuInLIInmmnmmmlmmmmnuwmmmmmunnmmm Page 150 EEE Z f 2 1 5 1 E ss if -2 mmmwmnmmmnmInmnnumymfwmmmmwfmInnnwulmmmuwlwmmmuwynfmWu1mmymummwInfuwInwIninuguw1m'ff1mlminwmfg1E5Q5wE1w55MW555Eff1555535555W53554wg!W3ul3143.H35.3ml5113.5yuun55inxyumm1n1mXmN.I1wHmuw1H1In1H1XInmU.Huwmwm1H1w-1wulWuvuwuwmrmXuXnuumuwwnw1Hwuwwuwmuummmmfnwmummwnuwu1InuuuruwwuwwuuIn1nmwummmmmuwmummumun:mmwnwwvuummmumlmmmmmg 535 EEE 15 E E Ei? gli EEE EE EEE QE V H: EEE 552 Ei? Ei? is as sez E55 :LE ::: if EEZ EEE :s nmmnummm npr nw Ei "' -s EQjmlynmfwmyH..1nf11m1mm1mm.w..u-mmfnfn1.-1VfnH-11-1W11.,H.1.umm1V.,L.....4inX.11N,1..1.HX..1V.X1.11.H.H,..1..1.H1..wV...11,1.X,H1.11.H1.11H,m1.1H.X..1W1H1V.1,..1.H.H,1.,1..1H1W1.11.H1.1XH1H.X..1.H1.11..,inH.1L.,H:,H.13.193,TIn15mmm351555my3511355ffm-I,E33:mm!InEminum5:53:,InlmmmmmfT155215315135HI!552wwmm,HmyIf,H:E1ifWZ:,inmflm123:mumwww.X...Ty,.XX.w.,,1.,v...E9u.-Ti anwvmwuvvmunwnnmu1vmnnwulwimnGli11i.i?5iwl-IIEWHi?lilEHRiii1iiiHIGHiiiiiLliiiiiiiiliiiiliiiliiliiifillliiiiliiiiiiiQEIRIEIHIRii?FiwiimMIwFiUl1umunmwm-.nnmmuuwumnuninummmumummInmnmlmmmmulummfmmwmmmummumwuuwmm1-Iummummm.,WNInmmmmmm.wnwmmm-mmmummmmmmmwmmmuwmmu-www-m-1yumum.wm-mm.-nmMwmmmm.Wmmumm-.mmmnulmmllummmmmm Page151 iii EEE mm gmmmmummummvuHInmuvfmm1mmMXmummW1fuummm-mmm 5 51mmulmlm..m.mnnmmmm umlwmmml H p .1 I w w M wmwmu wwHwmwHWW.4WN1ul1H1wH1n11H111.1H1W1ulyu1Win11Iw1.41L.111-11.41WN.X1I1wM1LHwH1XI1XHXm1H1H11.1wVHm11WmNV-11I11-wmm1w.mwn .1w.111.11.11H11.11U1U.1H1ru1111inmm1N11u111-1H1V.wwu1mru1in1w-1wHwin11-1uXmwmvu1m1u1vu1u1w.11N1mmmlu.-ummmmuummwwv lmmH.1mimmm11H1W1111W11.1in.H1H41K.1m,..,1HN1,1.,.N1..w,..,1.,m1,.1,.11I-1H.Xm,L..1.11,.111.,,H1H41H1H.1..1V.11L.1in11.1X..1L.11mW1K.11.11.H1..11.4,1.1X.11H1.Hw--Iin,H11.11In1m1..in1m1L.X1-11.I1mX1.X1H1L.,V..1..,X1,1W1N1in1K.NIn1..1..11.U1.,1..,H111.,inV..11.1H.1..11.14..1,HH.,H41.11H1nv1H1V..1L.11.11.111HH.1H,1..1..1WN.11.H1.111H11.,,1.X.H,1.1.HN..,I..V..11.11..1.H1..iniHi1,ii'iQHQllil"""" U mnfu1.11V..1.H,..mmw......mm.mm H4 H .mm My .1V..11.1wummV..wwmfww-ww ... ww. N lxlllthhl NHU5L531:54,.111.11.HMww1H1K.111.,11.1H1myL..N1..W..H..,..u..m.,.v.mm.W..,.. M . lmm1rmm1nuwuwfmwunm1mummmmmvmmm ' ' sag XHN-IWmXXHXinXLf5,14HXWNMXNtu3531lf.inIml1W,..1In1UWW..w..Xw..XV..,.1www-m.u.mw1.rm1..,W1..1WV..NH.1..1,Hin1mXNumm-mlwww 11uWulwfu1su1vuwmwu11uwvu1InXvu1mru1Inmm.mmmnmn "" "' :1 W ,Vlrvllvvlxrllrllbhrlrlhlv rhhl 0 n..,..' A .-1.11W1inIn1H1mmmm.mwmumXWin1m1.Hinumm-,..m-v...u .mlm um . u11uwWummm1Innv1W1InWInXuXmmmmmlmmuvuw H 1 My H1L.111.XH1.Hmf1.Imlm1H,,H1mu.myX.HK.11I.1.1111.1H.nuH.1muwWww,yymm,mm.H,2.n.f,.A-2...u..mm1mum.n-m-QQ .11.I1Inm1In1HWfuwuwminwInw-IwInwI1wnl1mfuwuffmm.mmnl1uwwumy1u1mmWvuwuwlmniii'm1mri,mi.1InIunl1EEhmhvmm1H1ulin1inm1IninwinuinumXInuumXin1HXummnlwInnuInnuIn1mm1mmnuXInInin1.muuin1K.1Nm.Hwnumnummlummmuuummmmmmmul Page 152 u.mu-lwlmmnmm-mmm .3 EE 252 55 :E xs E 4 S 1 i -1 1 555 .an 252 E55 Wmuflm1gmnvygffjmmggfgffM55335535:55H5Um,..u..,55mMmf1W.-,...mmm...n1WU.1InrnAIn1fu1.I1In1mH.,.HMWV..,mA..AV..,533553ufM551I..133W5553551355!5:1535MinAV..H.1A.41WH-AH.mymH.Aum.:155A55lm55553555.5151A.M1.1wHWV..WH.MH.AHAnnnn,HAmmyH.1WV..1V..1I.,111Auf1.HW1H,1Wny1H..1.1nunyA.HupH.AU.AynAyn,mAI.1W1H1WHAmmm1rmInAH.IH1A.HV..11I.AInlmWin1H41yu1H1H.1mWV.-1H-AH.1mWAny1H.mfmlmmmm..mmmmff ggiyi.11PERUiiliih.Im,1Imummum..m..mm..w.w mmlw-.mlm fl .1 mmmmmmmn U 4 .. m u-vm..mmu mmm. mmwwmlml1.wmmm.m.m.1fmmulmlumlummm In mum In wm.mm.mmmmm w Wllvmmunlml .Au vmwuwmmu mm'WIlii?7i??ii?ii'5'.ihummmm 1mvi'1E1i1lllI?ilililii'l"Kmum U fl. H umm I HHH4mm.H un?'ITEMEii?5i??ii1iiiRiIIZiiI3i'253 'f 25? . - 35: is: A: E1- Prfeshmen ' 35, Eg! il' if :ii - EEE 2 ,, .,. Mi ' ' ' Webster Sumner jorgescn Thompson Ryan fi? iii jj Class Oficers CHARLES L. NVEESTER . President EY DOROTHY SUMNER . Vice-President 222 -JCSEPHINE L. JORCESEN . Secretary JOHN W, THOMPSON . . Treasurer iii ??? RAYMOND J. RYAN Sergeant-at-Arms 223 55 Z.: , V. O f A 1'-f WV- vfn,J'4'fhwvffvM..f' AW- v ww-Hv4z:4','mcQ, 'hw ,..,:,' -U,wrz,f4AMm:aw w.wfA.',-.,,,m,,vH.,,,-A-1Am,LJAW- .f ,Nw-nf M1 7fm.,,wfff,v,,W-,f.f,,f.ffM wffp .,,1fQ,44+f4m-4, ,v,.,,.,m..,.,Www AM 4,A4,,,. .MA-1.,w..,,y.,.,,,,.W1W.M.A,+,,4M,Q.+ W, M. ,,,y,,,A,yA,, ,,,,L,,,, , f ,4,f,.,g,,?,,.,,LW., M ,zw w,-1ffaf,+' ,, WW .f -, ,Q--yy: fe". pw ' 1 f . A'- A M 3-f --- iz: f -A A mf f W isa " ' , -V L: EEE 5, 2515 4 " L-.'w..w , A , Q , ':'r.: .v1"oW1w"v"wwf, W"'z""4f??.-ofH,-Q f ' . ' -V1 -'-' wfrza-',-yz,-gvzf f- wffqw zz: 4'fff13w:fZ'f.fzi.4,4a:,a,f?y:f',-116-,,f.':p1,w,VME..apf"1e:..:+,.,, ., "N: 1,15'q.rfY?J,w A'4g4g:,Ad ',-f,s.,, , L-W ' M 4' .. vf., fm-,..,:,.,v,,-z --- ,. X wiv -f:,.2f' viz- - -'L 's g ' Wymgw, rfz' WI 2 15- Q -'f A iff W- iff-egfg--11---Q mf,-4' rw"rv4wm:1gf1.,v. ps-151, ww, +:zPQ,n,.w-4.f EE ff! ,mf :ww A Y f-.. fw ff ' f '-A . ' 555, 1 - as f , L A. V- . fx ,.. 1 Ng , 'm '- 2.- gfz yy ,agffghd-515 5, 4 bQ'1f.ip',-Q.y' ff -A ,, 1,,,,w3p-w,?y? J , 1, f-'nf-, Fm:-5 :ff '. . ' ' ' 1' :w "f:-- ' :V fwffw 1 A f ' f "T.'2H'i' ..4 - 'I . .,- Af A + 5 1 9 f ' A A 5 - -. 'ff' ' fb ' fn 2-- . Q ,,,,.,4m- .,, .A , -:ng 1--1' f' ' A '-'f 5i,g,., - .,., -'45',gy,1.f , ff M 1 a ' , ' A, ,A 1 , " YH. , . 14 l y- is . 5, NN. Q .J A V , 3.4, A , fm? Nm EEE gk ?.,,.vi4 J E V If 'Z .. , .gpg ,,f,.I, im: H .,., - . J , ., ' j,J ff'l27i?5 A 'F .ge,.,,, "ff3Zil"h ' "' gif? ' ' 1.. ,Ju-L1 ' :I 3 . 'W ' ' 5' - . 'A . '-7' ' " -Wf..W,,2'swf'f"'w- Af "' ,. 1 , 11 522 -, A , 2 " ' ., A. .. f , Ei' 51.1 , " -'ff7"l1.": "" "!w.11wff-2fi21ff"l,'f'f if 'V ,C29i??"ZQ"7 IG? V" ' Z ,V '11' .. Q:'.,., ,- ,,-wwf 'T . ESE gig A N ,,V,5k U54 V- RIAA ,, 'gf ,v.kj,VZh,!:,, 31,,lVi,,lf, IV I J X' I I V,,!l,,:j Z, , , ..,, , , KVM: , A f., R ..,...,, ,. , ,, . A ,.-. 555 ESE Cap Night, April 25, 1918 533 .. E12 2:2 535 ggi -3. E52 :5Evmummxumummmmnuwummpunmuvmumnuwvuwnvannuannuzunnwuwuuuumnuunnnwnumnummumnumm:nunnnmnnmmm wn mum:uwanrnwanmummmmunurnrnuwuwunzunlunwlusurum:numvuuvuummnuunmuurmmnunwuummyununmmnxmmnuumm4 xnmunu nmwmmmmwunnnmnmnnuurumunmm:unnmnnuununuummuuunuumumumnmnumnunnnnumumnnmnunummmunum fm:nmmmuumnmuvvwInnmmiiiiiiiifllmiihiillliiiFiliiilimiiliiflillllnunummmannuwnuunanummmvu:mmInWilFi?EIHEIIIIFFHInnummrnummmwH5115HiHIIIIKHGIIIHIliiiiiliifiiifliiiiiliiliiHIIFIHIHIIIEIEFIHIIUIIIIIlililimiiiFIIFHUIFIIQEIIIHUIFHIIEEIIZIIHIIIEEIIEEHGIGIIIHYHQIIIHIIHITHIGIummmunufmMIIFEIEIiiEIEHIIHIiliiiliiiinxMKIIGiEHilIHGli2iiKiififFuiQMHiKIIIIIIFIREEYIIEEYEIIEEIHFEIRIIIHRIIFGHii55ii5iHiiunuxHIIM' P a g e I 5 3 1 f I If -111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111151111111111111115151111111111112111E11111111111191111151111111111111211111111111111111111112111111111111111515121T1111111111111111111111112111511111111111111111111111111111111111111215111111111111113111111111111111111111111111111111111111111111111 11111111111111111111111111111111 1111 1 1111111111111111 111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111111111111111111111.11111111111111111111111111 1 111 11 1111 POINT BROSH GLASS IMMITTEES U. lu Webster, New Piml- lut. ou!l1nbSvnw7 Pmgnl. cum.. 1. w.11.1.r. 11.1.11 11111111.11 . , .111 .1 111. 11... 11 lm. 1... 11.1 .pp.11111..1 .111.1111111... 1.. 1.1.1. 1..n1.1... .1....., Th... 1.1.11.11. . . 'au 11.1111 11.1-11 .1 11111. 111. . -1. ...vm 11111.11 1... 11... 111. -111.11 by mu... 'nu .1111.11.m.1. ...1 mm c..1..111... Am.. u.yr1.w. ...am-n. 011.1 an 111111, ...x .r1.111.1.11. 131.11 owfnf 'r1.11.1.. c1.....n1.1i.1. 11.11.11-J 1115, nu...z..u1 sm... rm... c.--111... rm... mm. .n.x1-11.111.11.111 L+ vnll, ...'1. c11.11..1.11. A1-111111 nu., 11.1. mx.. c11.,.n1.111, c11.111. mu.- 1..y,m11.1. x.n1111..1.1. Annu. c111.1.1n11., w..1.y 111.11111 111.11-1.1.1., mmm Bm... mx. 61.111111-11.11. ul-dv: s.r11.11a1, n...1.u swan. ony sun. n1..1... c..111111m... - 11.1.1 w1i hc. e1..111.-1.11. Hurri- , 11,.,,.,.:, 11.1m.1. .1.. .1-1.1. 1u.y.1,'n..1.1.. s1..m11.., cu- 1111. sa.-.111... 1111.1 c.1.1-sn... rna G, s1.111.11, 1r1.11111.11. B111-11 0.111.111 1.1.1 111.11111-11., oem. s1..n1y, 1:11111 x.y..1, w.n1.111 P111- sux... cu-lun 1.1.1.1 c..u1..1x. .1..111...1., x-11.1 moody, ...x 111.11-1111111, mu up nm.. B111-1.1. whim A101111 An. 11.111, rumen co..-mn. - J..1.111. sim., .11.sm.111 Mm... 1 b 1. .11.111.1.1.: neu. 1... 111111. ... 01.1111 1-. eww. LH. n.111..11.1. 1.1.1 1-11...-.1 11.11 11.11111 c., mm c...-1114... w1ua.1..,-r. u1111.,.11.1..11.11: R111- ..1 u1n111..u, mm 11.1111111114 11.1. no.-u.11 :mph 11.1111-11111, 51.1121- .1. mari if 11? wf1 Y QQ .A 1. ,DS Q19 Q 1-it'-' .199-095, -1- -rsh' ' x XV. . ,Ny fy 011119 .1 , ip, ,vwpvx w xg? 1 1 ,1- ,111e-N0 , 01.1 .31 ,9p,51. W ov. ,ov 1- 4,1 xv .sq V, ,,-1 , .v"a"' 0' '..- 12' "K-,As ' 11- Sv' ts-N19 N111 .1 WN' ,, . , 63,1 11,11 :S,J'.v,.',99V Ns 1,441 vga.. 9 Re. ,xv va . 11, 1 1. 11+.1.v'1r' ' V"".-9 X 1 fav 1-.1 111.4 B 4 S, 91,-FxyX.1:X1 1' 4xv 1 vw, , 4 6 9 fx 1 3 .1 ' . - Q 2- 102: 9 ' 1 1-1 4 .16 'x '11 0 v Y' 1-1 1 1. ,eff dl 1 X X f' ' . 1 wg'v1 ,Dv -X 1 an ,if 1. x J v211f,1-11- V11 vfiglvffi ajbi. U 1 1 . ,O 1,1-2'-x--1 . 1 11 1-5,:jf.Q.go.+ ,vi 1311- .wwf 093,11 t, - u v 9 Q.. .J 1 W "1 1 1 . 1 6 v 6 ". -gy TRY msn WHO LBRBAK "U" mms Smdmmcomwm sw.. B. r 0rlln1udloGovnrn Underdamnu. mga.-nLmi..1:y .Lmww?l L. 111r..1. Haig. ...11111111z 10 11.1.1111 sw., 11111111.11 11.1. 1.11. 111 111. md... lllllh. 1111.1 zz.. 1.1-111.11111 11 as My gK111...b.1-. .iwmn 111. ,.v...1.1, ma.-11.1. 1. 1. 1. 11.11.111 1... as 1.1. .u..1...1. 111. 1.11.11 n.. 1111.11.11 .111 .u 11.111111 .a.1.... V 1 1 If I I x11u.... .1 1.1.111.1.ny 11-1.5312 1:15. Wbes GHCTWOFFIQS o Thefrosh OPHS' T0 111113011011 Faosu TRADITIOHSA ig 1111.11 is scpumea bi Senate Committee for I Middld al April I . 1 rassmun 1-mmmoru . 1. Nu 111.11-1... .ma -... . agrgi .Hmm 11.1 .mm 1.1. Pm, 1111 . ,mu-.bee 111.11 1. 1.11.11 11. u.. fun:-.22 Rflllrilioh Ag: NOVlmbCl' I. LM Ku '34 lDfihl lltm Lhl HN! If 1.11. 1111.1 ww. .114 1.11. .1111-as lxlhllliiunl. 2. I-'f..n111.1. .114 .13ph..11m ...n 11.1 .11 11.11.11 .11 111. U- Q... - an N. num... .um 1.1-11 . 1111.11.11 1. .11 11n....1...11..1. 4. mv... ...mba ma 51.13 .vm t1-1111... .ml -1... 111. 111.1 1. . .un nu bun-1. 1-sm .111 msn sm. 11.4111-... xhuN11l11?::...1 um: mn. 011 111111. r .xwl zA1111wx...1.11r.. 5111... 5.1.1.1 1 z. N11 n1..r.111.1.1.1 mpxmm 111.11 -Q.. ...amy 1111.11.1- a, No 1m11..11 mn nm . en. 1114... m'.1..lb 11L..1.1-L 5 N. r...1...1.11 .un .11 .11 ..1.u .11 1z...1.p. .11 .111 11.11.1- .ny b1.1u11...- s.1111 .14 11... p1..1.nm.111 11.1. . m.d'2.1.1g1 .1 .111 .1 nu .1 1 1111. f...11..,. 1.11.1151 fr.. ...11T3'.1 ua wah.: 1.1.1. u.4111111.. ..1..1..m... Th .111.1111x1111. 1.1.1 1.11. 11011. ...a ai.- f E1 aglhwmdmzs lm. 21.1.11 . ' nl! Ylfl I-I so '31 011132. .nm u.. u . nn 11.11. an mu.: 11131. 11.1..1. . M 1 e- 11 Swv- Q.-11. 11. 1...1.s.1.11111 -Lu 5. .nm .1 me -mn many of nh uma, -1.1111 1. 1111111.11111 1.1 w.11.1...1.q fail. .na 111. 1.11.1 1.111 1..1111.1m. Prwln In dilrnu iupum n. ...my 11.1.1.1 1-1...1...1. vb. 11... 11... 1. m1m1..n.. 11. mm: m:4...11....ny men-11111. - .1.. .1 111. .1...1... vx1.l.1s111.. 11.1.1114 11. pu.-!db'Y1.:f mx. 11.11111 .1 41.1. 1.1 n. .ma 1. uh. 11.41.1..y 11.11, .M ..,'Z:. no .xuaenu .lun .rumpz rn pun. hh 11111111111-1 -11.11.111 p..1.11..1..1 1.1 111. mm I11. 11.1-1.1.1 n. 1.11111 Q. ...fm 1. ..11..1.11.n.. nl u.. ma... ..1.. 11. 111.-1 u, . 11.1 .1 11.-111.11 -.11 mn 111. 1.1.1.1 .na ...uf .11-.pu .1.u1.11. 1.11. 11.1 11. u.. E HT.. u11.ux..1 un -.13 .1... ..1..p.... 1 14.11.111 111111. - nm 11. 1111.1m1.1s.... -11.1. 11. 1.11111-Ke.. 11.1.11 ..1..1, 11.1 ... ma. .1:L1.a.. g-.v.11111111 11. un... um-1 1111-111111.11111 1. 1:11 11..- .. 11. um 111. 11. 111111. 11... 11.11. 11. I.. .amz ...Q .111 11. 11-1. 11.1111 s. 1.1-1.11.1 .u... ...mm .. 111.1 ld141:1..1.u..1..1...y....,,, SH 4LL 32054 B r'741, S a 4-11 WMS111 0 1wUnr e S 1720 T Drlvoqmu RADITION ak rfamnf hw! s z.. - . . . 1.1.1 1:1 bl 1 mu 555 ' Wie' af?" 'Qi 3' Q, .DX 5:.1u11n1.P::.x':1:fn.1. vm.: gig -fr-0, D, 41,14 1 2,4 ,v 9- rn. e11.11.111. .1 m. 11.1v11.ny. A I of 1.9, 9,4 Aviv r1..!. v1.1.1. -n..uu.-1... A A 55 4,vvf,1. A.1.11111111.h.111.u-b1..1111111a..m. . 1 355 .sob may ...uhm .yn .1 zz.. r..4m1.1.. 11.111, E55 1 1. ,qw 1 511114. 111. E4 muy .11 P. n..11.u, I :ss 0.-" fm- umm -. L:-311. A111111-..-1., L' .yn c.....y. E. 11.1, na hh L 51. . 1 QA 511111. 1.,, X . P - ' Dafflber SENATE URDERS mg? 1v11..1...,.',Q"s,,'f'f' we X. 111 2' 'ff z 1, WW' m.u11n11., 1,,,,uT gig X515 gxrfx REACH URS To :zz pa -we HEMOU1-A NEXT QUAR ,1 S1 1111111 B' :S I . . - rr. .mn ' I EE - qu ea X 'n.1 1. 1 2 6.95 QS "" :"l': f:f.f:: 'mfg 'A-'U'-. VX 1X ..1.. 1 .,, 111. .. 65,11 212381, uw A . 11.1. 11111. lo co.. gg:-,11.:-:,'11,X,gLL.5.1::f,5 -wir: E25 A 1-1. , YNW W 11.9 mfg: . nrm Du.npsn's i15"3,5:5:'D:'i,,'T"?3m' 1."',' 'QE . Jag, ,411v,,w EMU ...., ,,'j- 1111.111.."" -1131. ,P-111.1 EE ,1. ,Q 11 Mp- nn. rm... .1 ,,, . -11.1, W, 1:2913 325. 'yy 1-ff. F71 T.'L'Q,'fu1v'i.1k:',','Q'1A3r':-':7f".,,"f:j ",2.1?g5Q .5g,"1w9',n1',. WA- W 125513. .,111l."' 1......1"717,." f-1. '21 1'-3,11 ,1 ,JW 1f:,f 'ffn3"'J1'- 5.11 1...u111.1-11 wiu 11.1. 1. -.H fn.. 'i -wu11..1?7X.' 'M 1.1 I: 1,1- 222 K 135, 111133, ,'1-SQ, 111. gm... un 111. m. nm an d u.. o'2,P:-L1.1,,, lb. B Lu-:I-11... 11. .J .11 ov .1 , , .sv -". uu111,.1..11.1. -rm. 1. 111. ax... -fm.. u. N 1 ff 'ws'-1.:5:e::'1:.'-.r.1:m 1: Ni.-51'-1312-'fi15'w3.,..,,.,1-'f'12f lll 'ffm' ga 1,-1 "L 'WS' 'iv' 1.1.1.1 .. 111. 111.1 11.11.11-1111111111 111 , S,",,17- -1-.1131 :W-m1.I'.2 3' f-11.2 ,. 0,1 px... 40111. Q Q , D . ..,, ,L -11. ,M 11. 1.. :E .1 ,,,. X, 3,4 1.5, up -.,.1..- -. 1 -- -- ....-1. f11..11. .1..' . ...Wh 1111, ,g ,N 111 .1 . .S . '11-1 1. nw... ww- , EEE m",11Ww -41.49 'U hx. ,."" M 1... 0 'W -1- .1-A 11" ., wo' 0. "M 'UNA- :1- agile v",3111g,. v- 111.,",'gg-fg1..'I."L", 53.1-1-1 ' V' 'Q' Q' 1-W'-me ,sg H I 1 1 1 41 14 wlhvlwtmluvm 1 1 nluuwxlmlulvx 1 I1 111 4111 Hlmlwmm uwllwmwll IA A H 1 .F111111111.1111111.11.11.1111.11.1111.1111111.1111111111.11111111 111.1111 11. 11 1 111 1 11.11 11.1 1 1 11 1111 1111111111 1111 11 1 1.1 111111111111111.11.1..1111111111111..11111111:11m:i11i11111L:11.111.111.11.11.1115511:11:11111:il11111.11.11..1...1.111.111.11 1 11 1 111111111 11.1111115111111511I:11.111:12za1:11i11.111.11.11.11.111111..1 111 .11 1' '1111.1111111.111111111.11.111111.111111.11111111111111.11.111111.111.1111111.11.111111.11111.11.11111111 11111.1111111..111.1111111111 Page 154 iimmiiniininiiniinimiiiimimiiiiiiiiniimniiiiiiiiiiiniiiiimniiiiiiiiiinminiiiniiiimiimniiiiniiniininiininiiiiiiiiiiiiiiiimiiiiwiiiinmimiiiiimiiiiiiiniwiiiinininiinmiinininiimuiiniiiiiiimiinininiiiiimniniiiiimmiiiiiniininiliminuminiininimiiiiinininiuimiumimiimminiiiiiiiimmiiiimmii miuiiininiiniiniiniiiiininimiiniiiiiiiiiniiniininniiiininiinimniimiiiiiniiiiiiiiniininiuiiiiimmiinimmiuiimiiiinininiimiiiniiuiiiiimniiiiiiiiiiiiiiiuiiniiiiiniiiiiiiiiiiuiiiiiniiniuiniinimuiiniiiiiniiiiiiimiminiiiiininiiniiiiiiiinmiiiiimininiinimmiiiiininiiiiiniininiiiiiiiiimiiiimiiiiiii A .minimmiiiiiuiiniiiiiiiiiiiiimuiiniiii .iiuiiiiiiiiiniiiiiiiimminmiiiiiiiiiiiiiiiiif A Word for the Students Army Training Corps By Major joseph D. Holloway, Commandant HEN the Students Army Training Corps was planned and the matter put before the various educational institutions throughout the country, the War Department, through the Committee on Education and Special Training of the General Staff, was attempting something in the nature of an entirely new departure from the usual army method of obtaining suitable officer material. Such a step had of necessity to be taken to keep pace with the rapid expansion of the army to meet the then existing emergency. The S. A, T. C. was instituted to form practically a depot from which material could be drawn that would after training fur- nish the bulk of the commis- sioned personnel of the various branches of the army, chiefiy Infantry and Artillery, Heavy and Field. Unfortunately, with the signin of the armistice, the need for ogflcer material became of no importance for the fur- therance of the War Depart- ments plans, and orders were received not to send any more candidates to Officers' Training Camps. Nothing could have proved more detrimental to the morale and good discipline of the unit than to have the hopes of hundreds of young men shat- tered and quite naturally inter- est in academic and military work lagged. Those men who earnestly desired a university education at government ex- pense continued their work diligently, although their chances becoming commissioned officers were goneg they deserve great credit. Others, whose interests were not along educa- tional lines, deserve credit for the time they have given to both the educational and military work with the one purpose of securing a commission in the military forces. Undoubtedly, had the war continued, the future ofthe S. A. T. C. was assured and it would have been only a matter of time until condi- tions would have so adjusted themselves that all confiicts would have been removed and better men would have been graduated from the University and frcm Cfhcers' Training Camps than ever before. MAJOR Josepi-i D. I-lottowmr iwigiiimiiiiiniiiiuiiininiuiimiggywmuiiiummmiuiiniiiimmimmnumininiimiimiuilimiiimmininmininummiiiiiiiiwniiiiiiiiiiiuimiinimuiimmmm:mmumuiiniigigwiwiimiiigiiiiiiimniw :mmiiiininiinmiimlimiiiiiiiiiiumiwmininiiiiiiimiinmiinmiininimumiiuiimmmmiiuiniminiiniiiiiiiiimiiuiniiimnmiiiiiniiimmiininiiiiiniiiiimniiiiniiminilimiimininmiini.mniitmmiininiiiiiiiiiiuiiiiiiimi Page 156 wminiinimiiinimiiiiiimiiiu!L iiiiiimmiimmmmmniummini Elie Officers TOP ROW-Heep, XVaItOn, Einbecker, Warr, Walker, J. P., Ivliddlebrook. Naramore, Wells, Irion, Ferguson, Webster, Kenney, Epstein, Sommer, Brown, Wallace, IVlCCaSkey, Hanaford, Webb, Weiskopf, Wellltxorn, Watkins, Bentley. SECOND ROW-Benscoter, Washburn, W. O., Ticknor. Lilaera, Multer, Kara, Mowry, Parmenter, Dunne, Sheppard, Joslin, Babcock, Holloway, Weiss, Sloan, McCurdy, Waller, Niederer, Kennedy, Rewey, Kurtz, Jones, I-lerwig, Field and Stay? Weitman, Walker, W, G. MAJOR JOSEPH D. I'IOLLOXVAY, Inf., U. S. A. Com- mandant IST LIEUT. GEORGE A. SLOAN, Inf., U. S, A. Adjutant ZND LIEUT. RUSSELL G. KUR'FZ, Inf., U. S. A. Person- nel Adjutant ZND LIEUT. QRMOND E. REWEY, Q. M. C., U. S. A. IST LIEUT. JOSEPH D. WALLER, M.C., U. S. A. Surgeon IST LIEUT. RAY W. NEIDERER, D. .C., U. S. A. Dental Surgeon IST LIEUT. MORTIMER M. BARTLEY, D. C., U. S. A. Dental Surgeon First Battalion CAPTAIN LOUIS LAEOER, Inf., U. S. A, Commanding Quartermaster Company A ZND LIELIT. MILTON F. XVEISKOPF, Inf., U. S. A. Com- manding ZND LIEUT. WILLARD O. WVASHBURN, Inf., U. S. A. ZND LIEUT. HOWARD KARC, Inf., U, S. A., S. D. Radio Instructor Company B ZND LIEUT. WALLACE W. BROWN, U. S. A. Commanding ZND LIEUT. WILLIAM G. WALKER, Inf., U. S. A. ZND LIEUT. THOMAS E. JONES, Inf., U. S. A., S. D. Athletic Director O. T. C. Candidate Examiner. Company C ZND I.IEUT. I-IERMAN F. HEEP, Inf., U, S. A. Com- mending ZND LIEUT. BETI-IUEL M. WEBSTER, Inf., U. S. A. ZND LIEUT, WILLIAM T. WAl.TON, Inf., U, S. A. Company D ZND LIEUT. WILLIAM F. EINBECKER, Inf., U. S. A. Commanding ZND LIEUT. MERLIN C. WARR, Inf., U, S. A. Second Battalion CAPTAIN CHARLES G. BABCOCK, Company E CAPTAIN CHARLES G. BABCOCK, Inf., U. S. A. Com- manding ZND LIELIT. GRVAN W. WVEBB, Inf., U. S. A. ZND LIEUT. DANIEL B. BENSCOTER, Inf., U. S. A. Company F IST LIEUT. RALPH B. MCCURDY, Inf., U. S. A. Com- manding ZND LIEUT, JESSE P. WALKER, Inf., U. S. A. ZND LIEUT. FRANK MCI-I, FERGUSON, Inf., U. S. A. Inf., U. S. A. Commanding Company G ZND LIEUT. LUTHER M. WELLS, Inf., U. S. A, Com- manding ZND LIELIT. OKLIE D. WASHBURN, Inf., U. S. A. ZND LIEUT. ALFRED K, IRION, A. S. S. C., U, S. A., S. D. Post Exchange Officer A Company H ZND LIEUT. WILLIAM C. KENNEY, Inf., U. S. A. Com- mandirig ZND LIEUT. MILTON O. NARAMORE. Inf., U. S. A. ZND I..IEUT. WVREN MIDDLEBROOK, Inf., U, S. A. Third Battalion CAPTAIN WALTER C. WEISS. Inf., U. S. A. Commanding Company I IST I.IEUT. HOWARD R. JOSLIN, Inf., U. S. A. Com- manding ZND LIEUT. EDWARD D. LIBERA, Inf., U. S. A. Company K ZND LIEUT. CI-IARLES W. SI-IEPPARD, A. S. S. C., U. S. A. Commanding ZND LIEUT. HOWARD H. BENTLEY, Inf., U. S. A. ZND LIEUT. JAMES E. KENNEDY, Inf., U. S. A., S. D. Ass't. Personnel Adjutant Company L ZND LIEUT. VINCENT L. DUNNE, A. S. S. C., U, S. A. Commanding ZND LIEUT. WALDEMAR F. WEITMAN, Inf., U. S. A. ZND LIEUT, GEORGE SOMMER, Inf., U. S. A. ' Company M ZND LIEUT. LEWIS E, PARMENTER, A. S. S. C., U. S. A. Commanding ' ZND LIELIT. RAYMOND WALLACE, Inf., U. S. A, ZND LIEUT. JOI-IN D. WATICINS, Inf., U. S. A., S. D. Mess Oficer Radio Company ZND LIEUT. LEWIS DE R, MOWRY, Inf., U. S. A. Com- manding Headquarters Company ZND LIEUT. LEE C. I-IERWIO, Inf., U. S. A. Commanding ZND LIEUT. EARLJ. I-IANAFORD, Inf., U, S. A. ZND LIEUT. DONALD D. MCCASKEY, Inf., U. S. A., S. D. Ass't. Personnel Adjutant Military Police Company .IND LIEUT. EZEKIEL S. EPSTEIN, Inf., U. S. A. Com- manding K ZND LIEUT. ROBERT E. WELLBORN, Inf., U. S. A., S. D. ASs't. to Q. M. ZND LIEUT. FREDERICK L. TICKNOR, Inf., U. S. A., S. D. Ass't. to Adj. Marine Company IST LIEUT. WALTER W. MULTER, M. C., U. S. A. Com- manding Navy Detachment ENSIGN IvAN C. Mix, U. S, N. R, F. Commanding milII...IIninmy,III.-III.I-..I.III.i...II-IW .WIII.IIInii.I.IIIIIIIIII-III-v.iI..III I-II .mu I .I-I-II ...WIN-In ...nm-,IIII.III.mII..II.IIII. ImiIniiilEIGIGIIEEIIQIIIIIEIIEEiilii Page mmmmnnm L....... .... L. ....... .. .... .... . ....... .-....- ...... ,..,..... 157 ,mmmmmm.mimnmmmmimmiimmmummmummmuw.ummv--nnimmmmmmmmimmmmmmm.immmmmimlmimi.mmiinmlmimummmin:mmmiummiii.mminimminimminimimm1uimlmininim1niHmy1inmm1inimminimuminimminimm1inmlmin1mmmiminimmmmimmlminmlminimmmmmninimmimummminimlminnumimnmmmium.in1Iniummmmimmiwimnmmummmnmmnmmmmug Taking the Oath ofAl1egiar1ce, Got. 1, 1918 Ex-President: Taft Reviews the S. A. T. C. Troops at Vilas Park, Nov. 10, 1918 : - : E IE 3 MMMMm35.,mi..2..,:.,H.5...,H.,i.,,...,..m.,..H,..,,..m,,.......,..,H.,H....,...,...,..........,...,...i..,,..i..,,..i.,,K.....1,.,,,.,,..,.,..,.u..,.,.,.,..,,,..,..,...im.,,.....,....,,.,..,......,,..,..,,...i.,,.,,..,i.....,..,iH.i.,,...,..,..,..,,.,H.,...WH.,..4,..,......,...,.i.....m..,..,,..,...,.,...,..,...,..,...,..,...,,.,..,,................,i.,..,i..,..,im..,,......,..,..,.,....,i..,...,,.......,..,...m..,UH...1.....,,......,.....HH1.....f...H.U..,..,H,..,1.,.,......m......u...,......,...,..ii...,..,.1..1E mimmvnnumaniiniiiniimummlimwmmunminummminnmmmmimnmmininumluummnumimiminiumummfnumiinmiiminmiiminmyinimmyinmyinin1invmhimiiminiidviiiii:EiliiiiiiiiiiiiiiiiiiiiiiiEiiiiUiiiiiiiiimiiiiiliiiiimiiliiGMMiliiiiiiiiiiiiiiiiiiiiiliimliiiliiM555FEEFEEIEIEIEIIIIYEIEiiiEiiiiERHRiEiiiiIEiiiiiiiEEii1iEimmmimmim'iHimiminmininunnummmnmuEuinimmiumuimnwummuwuiumnumnnmuunnuus Page 158 - 1353535555willM5giuiiiwgwmwww.,,..,...i..iK.ii.H....niI,MU.,........i..,.i...,.,,..i..,...mm.,......i,.,i..imn.U.imi.HM...MV.i..,...i..i,.ii..,..,,..iW.i.H...H.....i.ii.......i.,i.,...i...i..i,.,i..,..,,.,i..i,..iK.,H.,.H,..iinV..i...WH.iH.U.,..ii..V......i...i..,inH.ii.i,W,V.....iiHiniK..H..iniwi..U.,i..iH,H.i,Hinii.mn.,im..ii..iin...ii.,,uiM.,i.Hif.im.H.,.......,......,...,.....n.....,n.....,......i..,...in......miiU.,.mm,.....n.,,..i.....m..,...,..,...s z 5 gm ,, ,.,..,...,,....... ,..,.......-e-.. ...,,.,,.......,,.., ,...,.. ..,.........,...,.. ,.., n.,,..,..,.. ,..,,. , .,..,..,...,......,..,..,,,.,..,,.....,..,,.,..,.,., - . , ...n,,..,, . ,.....,..,,.,.,.,,.., ..,.,...,,.. ,,.,...,.... .... ,,..,.,...,, M ..,...,,,..,.,..,,...,. V ..,,...,,,,,.,,.,...,,..,, . , . . ..,,.,,.... , . , M-. .,,...,,. W. ...... ,.-.N.h,-..- ..,. -s-.-.......,M-..,.....n...,,.,.u...,,.. ..: gnu.,.i.ii.m.mm..iimmmmiimimiimimmi.mimimi.m..ii..mn.ui.Wiii..iimmmmmiiimiimmwmmimi..inmm.ii.Wmmimmm..ii.ii.iimiummimumimmmiiiim.Winimmimi.mmmmimmmymimimimiimlwmmmimimi..miiimiimmmiiiim.-immii.ii.m..m.i,.ii1-mimiimmm..invmlmmiiiiiiiiiiiii,mminim,mi..i.m.m..ii.ii.miimm...miniimmwimmiiniimiI-mm..ii..umWimiiii-iiiiiiimiiiiiwg 5Igm,iiiiiniminimymm.iuiiiiii-.wimiwiiimi.ii1fii.Hmm.iiI-iinmuniiniuimm.iiiiiimmiliiinimimiii.iiiiinir-.iinuiiuimm,iiniuiviii.iiV..ii-1ii-ii-Iiim.iirimi1.4iiiiminiiuii-4iim.,iuiniiiiii--iI-iiiiri-.uminiiiiuii.-ii-.iiniinimmiiimiiiiii-.iwiiiiiiiiwmiiiii..imi.-i...ii.miii..i...mvmWiiiiin,Aliiii.ZiiIiiiiiiiiiiuiiid'MilliiIii1?iI,?iiilIi.ililiiI.IiLiIll?IliIllliili1llllilGillIiiFilIiiIIIQIQEIITIEEiliEiiiiiiiiil1EEEliliiiliilliiiiliIHQIZGZEXiliiiii5iiiiiiiEIFIZPIIETEEE5 sis :is 'ga Z 5 E i' 5: 5 . The Gymnasium is Used for Barracks SES EEE Mess in the Annex on Thanksgiving Day if s f..if..m.,,.,,i.,i...iini.iiH.,imH.....iim.,,,.....iim,mm..ii..H.,....inH.,i..H.,Wi.....,.....,.i..u.ii.i..,..m.,...mii.Mmi..im..miim..i..i..ii.,um.,miW..i...my......i..H.,uiK.,mi...Mi.1H.,i..i.Him..i...,Himmi.W..ii...W.......mi.....i...V.,...i.ii..,,.i..i.,....K.,...i..W.,...iK..i..,..H.....,...,i.,imH.,.,....i...,...i.ii.U.....imm,H.,Uim...i..inii,W.i..,.......i..i..i...,...,.,i.m.,u..i.m..u..m..,ii..mm..,,....m..1..,......,...ii..,m.,.,.,.,.m..i,ms,:.,.a - P a g e I 5 9 1mm..umH..Mu....m.,..H,,.......,..,,....K ...K H. n,.. U..,,,.m.,. .,,.,,,..,.. .H .,.. u..1...,..,,..,, ..,K, , ,..,,,.,,. . ,..,,.,,K..,,. ,HH,..w.m..,,.,,..,,.,,., .,K..,..,,..,..,,.. ,H,W..W,..,... ..., ..,..m.,, ,.,..,,..Y,...,.,l.,...,, W .w.,,,.. H.. w..,.., ,..Y,..,,HY..,..,,..,K.,YHWV..,K.,Y..YWW..WK.,H.YInW..W,.,,,,M.W,,W...W..,5,5W3,Mfm,HE5135,,inM,35,15H,5,55,15,5355555,1,55,U,3,3,ff3,5355,mfM31,3fm,M53,15,3,UH,35,4,T53,.5,3,HE..1,E55,52,WW,,.WNml,H3,H,,.1K..NHw.m..N.m......u...f5 225'-'.m,n,....F.mmman:::zmz:a::zznn.'r,.,,n:nx::n::1:::1zz:rummanaxzzz:::zna::::n:::::nma1mana:namza::::::::1:zz1rm:zzz:12:1an1:::::::za:zzazaazzz11:3:msnxzzzagqQ:1mas:1:snzz:1:11:11:aaazz:11:1zz:zz::zzz5:11xxx:xxx.:,.:,qs.,.zz,......,,.,,..,:.,,.,,..,,,.,..,,......,,..,.,,..,,.....,..,,..,,..,..,...,..,,..,,.,,.,,,.,,..,..,,H,..,..,N.,,..,,.,,,.,...,..,,....,,.....,,.,,N.,...,..,,.,,..,W,...,..,,.,,,.,,.,,..,,.,,..,,..,,.,,..,K..W..,.H,,,,.,,......,.,,,....,.,...,...,..,...,..,.,.,,,..,..1...,.m.......g22 EEE if 1 W EE I I 2 as .ggxnnum:ul1unnmH1rmnwnu1ulNInuvlrllvulmlmuvmrumuuvvrlwrmwvuvuml1vu1:mlnnnwunruwruwvuxvu1luxuxyuwu1xanxuruwwuvvuxnwvuwulxanxuwnv1:lvvuwvnxll1nuwInzuxvlnu1mulwuwvmmllmlmvmlu vmmvuxmn lu E? E ,HH,HWHInWmWmWInXMHHWHWWInXmWWWInWWNMHXmWinMimmmMmGimimmmMMIV1.,ZW1,..H.,...,,,.,,....,,..,,..,..,.,,.,,.,,.,,..,.,......,.,.,.,,....,.....,............,,,.,,.,,... ..... ..,..,,..,...!l.Ziff!lillEEZHIITEZ'EliKCI!EIIIEEIElf'IIIZ!!YZ!IEEIIYCEEDIIIIII21125EEEHEEISZEEII!!IEDillEEl'HEY!!!YUE!BIZEfflflII!!!llfl2311121251E!!"H"'"'"'''"'"''"''"'"''"''"'""""'""""''""""""""""""'2 55 u u nu ru nwInwHwvu1vufuwmruwfu1lmnwruwulw1Hfuwmsu1m1nwmwuwmwuw1uwnvwnwrnwuwmwmwI4wu1fuwmrunuWnwn1numwnumwnwmwuwvumwW1uwufwuw1Iw1n1w-1wu1wmruin1nw1nuuwmwu1w.1uHw1uwmuI1wWwH1mumfmmwmml H Page 160 . .-...,...,-...................-,...v: mu I wwH1uwWHwUwruwm1H1H41HwyuWmwuvmwmmww-11Hwulnuwmmfuwmwn1nu1mmum1munnumvumumnHunInmmuuunmuuum.1 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11 1111 11 11 1111 11 111111 1 11 1 11 11111 1111111 1111111 111 111 1 11111 1 111111111111111111111 11 1 1111 1 1111111111111 11111 11 1 111111 Company' A Offcers LIEUT. MILTON L. WEISKOPF, Commanding LIEUT. WILLARD O. WASPIBURN LIEUT. HOWARD KARC Cadet Non-Commissioned Qhficers GEORGE B. MCCORMICK . . First Sergeant BUMP, FRANKLIN E. FLOOD, GEORGE H. HENDEE, JOHN H. KAUMHEINIER, LEON E. KINNAN, ARTHUR H. MAIER, VICTOR l. BAUER, ALFRED J. DONALDSON, CLIFFORD S. FISCHER, HARVEY C. HOLM, GERALD W. HOLTZ, WILBUR E. ABRAHAMSON, ABE BAINBRIDC-E, THOMAS M, BARTELS, RAYMOND O. BLACKNEY, CLARENCE XV. BLADON, CUTHBERT W. BLASING, ERNY E. BEAUGRAND, MARSHALLE BENTZEN, ROBERT W. BOWERS, NEWTON L. BURNS, JUDD A. BUCKMASTER, BRUCE M, CAIRNS, GEORGE W. CAPEK, CHARLES A. CHADBOURN, REUBEN C. CHAPMAN, JAY W. CHARMLEY, CHARLES C. CONLEY, CLAUDE S, DARRENOUGUE, R. S. DAVIS, JAMES B. DAWSON, FREDERICK J. DICKENS, PERRY A. DREKMEIER, ALBERT C. DROTT, ARNOLD M. ELMER, WILBERT D. EVANS, JOHN H. FIELD, MAURICE E. FORMAN, ABRAHAM W. FOSTER, JOSEPH O. GATES, HAROLD C. GILBERT, ALEX C, GLYNN, NEAL A. GOETTSCHE, FRED F. Sergeants MCDONALD, JOHN F. IN'1EDER, JOHN O. MOONEY, WILLIAM P. NEPRUD, LINCOLN NOLTE, CLIFFORD S. PENFIELD, AINSWORTH Corporals MANN, GUSTAVE B. POND, THOMAS H. ROSE, RUPERT E. ROYCE, HENRY B. SELL, VERNON W. Privates GRAY, WENDELL A. HARMAN, JOHN C. HARRINGTON, EARL T. HAWKOS, JULIAN H. HAUBRICH, EDMUND HOLM, TRACY C. INGRAM, WALTER J. JAMISON, ELCIE B. JENKINS, GLENN L. JORDAN, CECIL F. KLUETZ, EDWARD K. KNAUSS, BENJAMIN, E. KRAEMER, ELMER A. LARSON, MILO R. LEPKOVSKY, SAMUEL LORIG, ARTHUR N. LYNCH, DAVID C, MAXWELL, DONALD R. A. MCCALLEN, CLAYTON B. MILLER, ALLAN H. MUSKAT, HARRY NEHRBASS, HARRY L. NELSON, KARL O. NEWBURG, MELVIN R. NEWMAN, ROBERT T. OLSON, CARL M, O'MALLEY, WILLIAM P. PAUL, HAROLD H. PROKOP, JOSEPH J. PUGH, CHRISTOPHER E PURNELL, WILLIAM H. RALPH, EDWIN D. RESH, WARREN H. SCI-IRAMM, FRANK H. SMITH, LEWIS P. STEVENS, GEORGE O. THOMPSON, JOHN N. THOMPSON, LYALL E. ZUBROD, WILLIAM B, SMITH, RALPH R. WELCH, THOMAS D. WICKS, WILBUR J. TUFTS, HENRY F. REUTER, FLORIAN J. RINGDAHL, HARRY J. ROUNDS, HAROLD B. SCOTT, CLIFFORD O. SEIBOLD, RAYMOND W. SMITH, SANFORD F. SNYDER, ALBERT G. SORENSON, ROY STANTON, CLIFFORD M STEVENS, RALPH W. STRAND, JAMES L. TAYLOR, FRANCIS TETZLAFF, KARL E. THIELMAN, EDWARD J. THOMAS, THOMAS B. THOMPSON, ALVIN J. THORP, LELAND A. TIBBETT, WILLIAM R. TIERNAN, GEORGE H. TREAT, RAYMOND C. TUTTLE, KARL R. UHL, WILFORD H. VAN UXEM, ELMER W. VOLL, OBERT F. WEEKS, RALPH E. WEGNER, ARTHUR E. WELLS, RALPH A. WESTCOTT, RAY D. WHITE, PAUL B. WICKS, ORRIN D. WILLEY, HOWARD E. WOJAHN, CHARLES K, 11 11111 1111111111 111111111111111111111111111111111111 11111 1111 11 111111111111111111111111111111111111111111111111 111111 111111 1111111 11111 11111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 111111111 1 111111111 Page 161 111111111 1111111111 1 1 1111 11111111111 1 1111111111111111111111 111111 1111111111111 11 grulmmIIIIMIIIIIIIIIIIIIIIIIIIIIIIIIIIIImmIInIIIITIIIIIIInImImImInIIIImIIIImIIIIIIIIIIIIIIImInImIInInIInImInImIIIIIIIInmyIIIIInIInImInnuImInIIIIInImInImInImIIIIIIIIInImInIIIIInImInnuInImIumIummIIIInIInInImIuunmnnmnnmmuIInImImIIIIIIImInInImnumIIIIInInnuImInnmnnumInInIIIIInIIIIIIIImImIIIInIInInImIIIInIInIIIIIIIInImInInIIIIImInIIIIInInImInInIIInIIIIInInIInImInnnInImmm:IIIIInImImnnIIIImIIIIIIIInumIIIIIIIIIIIIIIIIIIIIIIIII-1 5 5 QIIIIIIIWWIIIIIIIIIIIMIII.-I..II.-mf, II MIIIIIIIIIIIIIIII. I.II.III.w.m I HY' Y A -:SJ ' 52: .- I WN 'mf f .fa-'5 1 " S if - " Af Q , gi? ff Qi n: ' '- galil'Ei.-is-::,:effg-RTM PM " '- ' -- ..,. n Hia .' "5 I . V ' I 5?,'::E,eg.5s5zipgATTEQRPA Q ' ' T p ,. Q: ao- ' LA .-T5f:Fv.':-.- ff' T331 W3 A A 5 20 5' A E5 fi' - T: 'gy - , PM X:5:,.,,....A,.:'.fI ,: , -alma, WA J ,L , bf, M. 1 K ' Wim' .IIIIIIm,III.III.II.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I I I A ,A -AMPS? v A 4. y Company B Officers LIEUT. WALLACE W. BROWN, Commimding I LIEUT. WILLIAM G. WALKER LIEUT. Tl-IOMAS E. JONES Cadet Non-Commissioned Officers DONALD C. BAUDER . . First Sergeant ALFORD, F. E. BRODT, C. D. CALDWELL, J. R. CULP, R. F. DANIELSON, A. C. DENISON, H. C. ANDERSON, D. BABCOCK, J. D. BELVACE, H, T. BROWNE, W. G. CHRISTIANSON, A. W. CLEAR, E. K. DATES, G. L. ABRANIOFSKY, EDXVARD A. ANDERSON, CLARENCE W. Sergeanls DOEOE, PAUL F. DORNBUSCH, A. J. FELDMAN, JOSEPH G. FERGER, W. F. GATES. G. B. HEUSTON, A. N. Corporals ENCLER, M. B. FORTNEY, R. L. HAHN, A. J. HALBMAN, H. HOLSCHER, H. HOPP, A. J. LOOK, W. O. Qprivates GOLDEN, REGINALD C. GRIBBLE, SAMUEL W. KELLET, W. R. ROSS, FRANK A, STOLLEY, G. B. STUEBINO, A. C. THOMPSON, S. E. TOWER, E. J. LUNDGREN, C. L. MOREY, D. J. PETERMAN, W. F. ROHDE, A. A. STABO, N. R. VOGE, C. D. PETERMAN, WILLIAM F. PETERSON, RALPH W. . A-I .,5::,.,2.fQ, . , .,.. ,.., x 6. I , 21' "" . . ATWOOD, JOHN T. GRIFFIN, THOMAS W. PIERICK, URBAN J. '-" Q BAUCH, CLEMENT F. GRUHLE, ARTHUR H. PIETZNER, VERNER W. BECKMAN, FREDERICK W. GRUPE, ROBERT H. PRATT, LEROY J. BERG, CASPER R. GUNDERSON, EARLE L. QUINN, EDWARD W. A, BERNARD, JOHN R. HALL, HERBERT P. RALPH, JAMES S. :S " BJERKE, JEROME O. HALSOR, IVIARTIN E. RAWSON, CHARLES A. EE BOGAN, NVOLDON HANIILTON, JOHN S. REINHOLD, FRED E. if BOTHWELL, JOHN S. HANSON, ROY B. RICHARDS, GLEN E. 55 BRINKERHOFF, JOHN S. HOCKINC, JOSEPH P.. RIEDER, OSCAR W. gg BROWN, ANDREW B. IRISH, FREDERICK W. RILEY, PETER E. 232 BURNS, JAMES P. JOHNSTON, JOSEPH H. RISBERG, HAROLD N. gi CAMERON, THOMAS L. JONES, MARION W. ROBERTS, ARTHUR O. Q22 CANNON, DALLAS E. KESSER, EDWARD F. ROSE, HERBERT A. if 2152 CASSERLY, RAYNIOND J. KIRCHER, JOHN E. ROSENBLUM, HARRY M. EE ,V ,V CHARNEY, SIDNEY C. KIRKHUFF, JOHN D. SHILDO, RAYMOND A. CHASE, DUDLEY KNEEVERS, EARL E. SHOWALTER, INORMAN 55 CLAGUE, COLEMAN KNUTSON, ROY J. SCHUKNECHT, ROY J. EE rg CLAPP, SPENCER KQENIC, LOUIS A. SHATTUCK, LYLE D. 52 SSE? IfffS??fER C 1IfSEUfC3e?S'jIS J A 215.335 ' 1522? 555 ,Arg 'A . . , . . Egg CONRAD, CLIFFORD D. LANCILL, ADDISON NV. SMITH, JAMES W. Q22 BANIELSOXIXII, JOHN JA EEACH, HIAIROLD C. 2MITHiJWVAL'lgER H. E55 ENzER, ILLIAM A . ESSLER, ONTAGUE TAM, OHN . 25 DESMOND, HUMPHREY E. LIBBY, GEORGE A. STEHN, RANDOLPH F. gg SOE!-ILEQ ARNOIPP W. LINDOUISIT, LOUIS ETONDALL, RALPH M. 5,5 V 5 Q A. OYLE, RTI-IUR . UOOPF, EONARD . TONEMAN, ICHOLAS DRAJESKE, WILLIAM H. MACCRADKEN, JAMES C. STRAND, HARRY E. gg EUNN, DfiRREL DL IIQAAAIEZTPREPSS, SEYMEUR ETRAND, ,ILOSEPH URKES, UTHER . C UE, RANCIS . TRONC, ABIAN . QQ Q11-'g?J'Q DUVAL, ALBION MCMURTRIE, ROBERT H. SXVEET, DONALDJ. DYSART, RAYMOND ' MEYER, FRANK P. SNVENSON, SEVERN H. if ESCH, HUGO E. MONTGOMERY, LEO C. TAMMS, HENRY N. 555 FANSLAU, AUGUST H. MORRIS, CHESTER TANNEHILL, HARRY S. EEE FELLONVS, KENNETH S. MORS, MELVIN A. THAUER, RICHARD C. if Qill , FENNER, EDWIN MULLEN, ROBERT A. THOMPSON, JOHN W. gg Q 4.1 F ISCHER, JOHN F. NELSON, CHESTER W. THORSEN, MARTIN EEE fix FRANZ, WALTER B. NEXVMAN, EMANUEL D. TOMCZYK, LUDWIC Ei? FRAWLEY, J. RUSSELL NOREN, HERBERT L. UHL, ARTHUR H. gg- IERENCI-gi PHILIE A. 8 ERIEN, QFSICHARI3 D. ww BERCEN, EDSON :iz 3 RITz, ALPH . ' EARY, OSTER . ALKER, AY . if . - CANNON, ROY A. PASCH, LESTER A. WALL, WILLIAM L. :A ,.',,,,,,.,g:,..:,.AQf' GERICKE, WESLEY O. PEACH, LLOYD WHITE, BURTON H. ii SIESE, QEROME EELLOXV, C5HAUNCEY ENHITE, WCITLLIAM SD if "W" 'A" IESE, ALTER . ERLMAN, ACOB IECLER, EOROE i5f"""""' " '""""""'H"""W" U "IH" I-I - II-1 I U1-'www-A -I In-I-II--II-I-I-:II III I -IIAM-I..II..I ..... . I... I.,I.w..,..I..,,.,...IMMI, ,.,.,,,,,,..,,,.,,.,,,..,,., .. ., ........ ...,..... ,..,... ....,...,..,..,,...,. ..., ....,..,..........,..,,....,,...,..,,.I,. ,..,... ,., .,..,...,.... I., .,,. .., ,.,.,. ...,.,,.,., ..,... gmgggg- ,,,,,,,,,,,, , ,..,..........,.- -.--,.... II. .. ..IIII...Im.I.II..I.I..I..II..I .I I.II..I..I..I. .III III..I..II..I,..I..,I..I..... II..I..I...I...I...I..,,......I.. .I II..III...II...I.,I..I.,I.I..II..I...I.,II..I..I....I..II.MI.I. II...III...I...II......,..,I..II..I..I...IIIII.I.III.,IIII..I.II..I.........I..I. ,III .IIII..I..II..I..I.,I..I..,..I..II.,..I..II.I..I..,...I..I .I..II.,II..I..I..II.,I.,II..I.I,...I..I...II.II.,II.I.I.III.,III.,IM..H...II.,...IIm.mm...TII.,I.IIII...I.I.II......I.IIIIIII.I..I..I.I.I..I.,..............,..,,..,.,, P a g e I 6 Z EE ,,...,.,,m...,m,T..I...II...I.,..I...,....I...,...,.,.,. ,,.,,,. ,...,..T..,... ,,.. TwI.,I...TIT..I.II.T,,.,......,.,...,..,..I l.,. T., ,..,,.,.. .T ,.,,.,. , .,.,. ITI,IITW..,.,,..T......I.Twi,mf..,IIwuwmw...I..II.,,...,,,.,...T,T..,.,.,Twmwwwww,...I.,I..T.,Iwww....w.2wMTI.TI..I..,.,.,...wUIWMW.T..,,..w,W.IJ.,..TT.,I...A.I...Tw,..E,,,..I.,,,.........T,IAII..II...TT,.,T.,,..,....,......, --T """" I I. I "T I :ga 1 3 , . E52 SES il: SIE 235 2 S 5,5 . . , ..,, 1.5 , ,, Com an C I "" ' . . -'T Wznners of "Com,bet ' gig I - 3 T 5,2 EEE ' ,sw 1---me M- - E E EI: SY", ,Ya 3 Tis ofifims TE I " N ,Rifir Q 5-E C- 'R - I- f 51- I " 5-" fp ' .1 ,gd 5 ' LIEUT. HERMAN F. HEEP, Commandmg gig ,wx '-.'-""GhTf , ,... 9, LIEUT. WILLIAM T. WALTON 55 A - TQ- -wj',c,,..', A -5 lj ' W.-1 ' 5,9 f I LIEUT. BETHUEL M. WEBSTER if his ,:.,5af1ys'3fA" ,..: ,,. W '-' e fi. fi" ' -' 3 w '. A--hA'.14' 2:2 f A' cz cl N C ' ' Oz O 'P'-5,-'.. .Z ,P-. I 1 , .- A a et: on ommzsslone fficers f f ' ADOLPH 0.1-ECKMEYER . . First Sergeant .-fir f' , , if: , S f-L- 'Ri ffm - f 'wtf Q. 3 nw' ergean S Y N -Rig 1' H ',':f-- "R?Pf -.: I ' Q ft ' - 5 pggfifiifxf , BARNEY, TYLER D. FRULAND, CHESTER E. LUETsCHER,FREDERICKJ. jgji , SRi'..-Aqjg gig BROXVN, PORTER H. GEORGE, LLOYD MALzAI-IN, WALTER E. ' , BURNS, WILLIAM W. GRACE, HOWARD R. MILLER, GEORGE P. . -' 51' ,A -' CONLEY, PAUL C. KAYSER, PAUL A. WOLFE, JOHN C. 9,4-, E-a'2r:-T.,.m.T1,--A - - 1, , .., A FLOCAUS, WILLIAM A. KNORR, LINCOLN D. WRIGHT, SAMUEL C. A 5- am- -' I-' ' I-' ,- , .,.f Rv 1 - C afffiv- .E - or ora S . 2 1' I.. p 4'-' ' . Af ' sg- . BENNETT, LOREN HOYER, FRANK C. NOREM, LAXVRENCE E. , '- V, 4' H ' CANCE, JOHN W. LILLICH, JOHN E. REILLY, CLEMENT H. -V , DRIVES, ROY B. LINDA!-lL, GEORGE E. ROBERTS, GAIGE S. I., EDNVARDS, HENRY L. MARTINEAU, THOMAS B. SMITH, GILES V. 1 'LI HALLINE, EDWARD P. MCCRAY, JOSEPH W. THOMPSON, EDWARD G. , . HARDY, HORACE F. MCIVER, FRAZIER D. f.xf:T-,- ..,--'e'sf'e' -- "'- ' 'rt ' , A - ' ""' : 5-Sie f I -Km -f.. .,-.:::',::f:'-'ga-2.5: 'y L , y Q f ' prfzvates ::: ,HN 1 :8 1. Bias ' ' ALLEN, DANIEL L. FUCILLA, JOSEPH G. MOREHOUSE, LINDEN H. ALLEN, HARRIS G. GAFFRON, EDGAR B. MUELLER, ALPHONS R. 'Q - A ANDERSON, IRVIN R. GAI-IAGAN, PATRICK M. MUNSON, NORMAN B. ANDERSON, ORRIN A. GARLAND, GEORGE W. NEWCOMB, ALVAH L. ARCHIE, KENNETH H. GOESSLING, WILBUR W. O BRIEN, JAMES A. T AUGUSTINE, W, H. GREENBERG, JAMES E. OLM, HENRY W. -L J BARTH, ARTHUR E. GUNNISON, JOHN P. PIERCE, FREDERICK O. BAYER HORACE M HANSEN OSCAR P FRANCE HENRY C - B ' R ' H ' ' R ' V ' :A sm" -2124 I A-Af-1 fx , - . - T - 1 J 323252 A353335 J HEIBEERJ ZKENIVC RQEEETDS A12i'SI'EE L .. A A ' A - - - BITTERS, WALLACE W. HOLSTEIN, BENJAMIN M. RICHARDSON, C. D. -f 2-,, BLUM, BRUCE M. HULL, PERRY M. RUKA, OI-IN P. jg. BORDEN, RUTHVIN B. JACOBSON, HUGO J. SALE, RVIN A. ,J BRONSON, CARL E. JOHNSON, NEILL P. SCHIMIDT, JAC A. ' ,fri BROWN, DARRELL T. KALVELAGE, GEORGE A. SCHOMISCH, NORMAN N. .. Q Q 5' BURT, ROLAND W. KARLEN, ROYAL W, SERSTAD, MILLARDJ. L BUSH, HENRY KIMBALL, DEAN P. SMITH, CLYDE W, A BUTTS, LEO V. KIRKWOOD, CHARLES A. SMITH, SHELDON J. ,xg C D E K C E S M H . , A M HAPMAN, ONALD . LUMB, ARL . PRAGUE, URRAY . A "ff .3 CHARLSON, ROY M. LARSON, ARVID O. STARK, THEODORE E. fr 25, CLAFLIN, PAUL C. LEISER, FRED E. STAVRUM, THOMAS L. V, CONKLIN, ROBERT L. LEONARD, WILLARD L. STEEL, HOMER J. , ' COXON, ROBERT G. LEWIS, ROBERT C. TAYLOR, EARL A. V . ' 2 , CROCKFORD, WELBY H. LIBBY, ELZIE B. THOMPSON, ARTHUR H. Om.. 4:-'....,, ef, .Y U Xa A. CURTIS, FRANK C. LICHTENBERGER, A. C. TOGSTAD, KARL R. T DANA, WALTER D. LYON, CHARLES H. Topp, JOHN G. A, DAVISON, EDCAR C. MACKMILLER, GEORGE G. TORPHY, MICHAEL B, ff - , V ,fi DESMOND, ROBERT W. MADDEN, JOHN D. UGLOW, WILLARD L. A DODD, JOHN M, MARCKS, ELGIE C, VALIQUETTE, C. H. L,g,QQ,,1 "Os DONNELLAN, ARTHUR N. MAXWELL, JACK D, WAITE, PHILIP C. DOOLY, JAMES F. MAYHEW, LESTER O. WEBSTER, CHARLES L. ,- ,, EOUGHERSY, LVM MCERIDE, PETER D. WEEMANHKINGHH. .- , 'Wg' , RESEN SXVALD . MC LAY EDWARD A. EISEL, ANS , ,. Q ' EASTMAN, KENNETH S. MCDONALD, ROBERT E, WHEELER, LYMAN E. - ' . ,,, lc., ,. ....,. .... , , ,, ,- ECKERT, JOSEPH F. MCFARLAND, ROBERTJ. WIDMAN, JOHN "" j fg EGAN, JOHN M. MCNUTT, REGINALD R. WIDGAND. HENRY B- . , . ELLS, ROBERT B. MCVEY, VANE H. WINNER. HARRY U. 5, " FALSTAIEJ, GILROY O. MEYER, BARON D. ENOLF, WWTER EC 'vu'-A' A FRYE. MMETT R. MIEDKE, RALPH A. ISCHKE, ALTER . T. MILLER, HARRY I. . I I I 1 SIII.I.mmI.,..I...I.I.ImI..II..T.T.,I.II..I...T.,...I....TI..II.,I..IT.,,.,I,...I........,.T.I..,T,.T,..I..I......,..I.,.,,.,...,,,.,..,IIT...I,.,I..T.I.........TI.TTm.I..,I,.,,..,..T.T..,..T...IT.,T..I.TII.,I.I...T..II...TT.,...II...T..I.T.,I.,mm:ammiimzsxmsmznaszzzzmasaa..I...TTnnmssammnTanzaniaT...I.....I.....TI,....T.,...,T,.......I..T..T.,.......I.II.IT...I..Tm....T.,...WaI..TanT,mmzaas:nnn n':sa:m::::m,..m.I..T.I....,....,.,,..,,.,,..,., . Page 163 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I III III II I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII """" I I I III I II I II I IIII I I III II IIIIII Company D Officers LIEUT, WILLIAM F. EINBECKER. Commanding LIEUT. MERLIN G. WARR Cadet Non-Commissioned Offcers LINCOLN A. SOLLITT . . First Sergeant BEECHING, CHARLES G. GROTH, HAROLD H. HERBERT, OSCAR A. HILLER, RAYMOND P. ARONSON, HARRY J. BARTEL, AUGUST J . BECKNVITH, WAYNE I. CARVER, HORACE J. FISHER, MYRON M. ADAMS, HAROLD E, ALLEN, THOMAS C. AUCUSTINE, HARRY F. AYEN, GILFORD A. BADE, CARL A. BAGGOT, GERALD P. BARACER, MILES E. BORGHARDT, C. E. BATES, WILFERD B. BEHLING, ARTHUR W. BOHL, WARREN A. BOROWICK, JACOB S. BRANN, AUGUST F. BRENZEL, CERARD S. BULLARD, CHARLES E. CALLANVAY, C. W. CARROLL, CYRUS K. CRAIG, JAMES M. CUMMING, HAROLD W. DICK, ADOLPH A, DICK, WALDO C. DORNBROOK, PERCY F. DREWRY, BEMROSE W. DRUNIMEY, FRANK E. DUWE, HENRY J. EAMES, CLAUDE F. EDXVARDS, M. J. ERSPAMER, OTTO J. EVANS, BURTON W. FREIBERG, WALTER E. FROST, SIDNEY E, GARLID, ANTHON P. GASPER, WALTEIl B. GASUL, BENJAMIN A. Sergeants HOPKINS, JOSEPH J. JOHNSON, CLARENCE L. JOHNSON, WINFRED E. KUEHN, WALTER L. MERRXCK, DALE M, Corporals GORDON, WILLIAM K. HUNTER, JAMES P. JACOBSON, HERMAN L. LOEWENTHAL, R. J. LYMAN, CARSON F. Trivates GAULT, HARRY C. GAUSEWITZ, WALTER H. GILBERTSON, EDGAR M. CIROUARD, ARTHUR G. CLEESON, ALBERT F. GOLDSTEIN, LEONARD G. GRAPE, LEON A. GROVES, ALBA J. HAIGHT, ROY J, HALLING, ERICH M. HARGAN, JAMES HUEMMER, FRANK R. JOHNSON, HARRY K. JUNG, WESLEY W. KETTERER, ARMAND F. KIEL, WILLIAM KOENIG, RALPH K. IQOEPKE, HERBERT A. KOSS, JOHN E. KOUTNIK, EDNVARD J. KRUEGER, BENJAMIN R. KREUTZER, GEORGE E. KROPP, CARL F. KUEBLER, WALTER L. LANGDELL, HAROLD A. LYONS, EDWARD E. MGMASTER, ROBERT F MANSON, CHARLES L. MATTOX, RONALD C. MILLIGAN, ROBERT W. MORTENSEN, EINER NICHOLS, LEE B, NOLTE, PHILLIP P. O'LAUCHLlN, F. D. MGCUIRE, HARRY J. RUFFOLO, FRED WALLS, MILTON G. WARD, ALONZO L. MAEGHTLE, DEWEY L. MAYER, CHESTER J. SAMPSON, GEORGE N. WEISSE, LESTER C. OLSON, HAROLD D. OLSON, HERBERT E. OTT, HANS W. POLLACK, SAMUEL S. POWERS, GEORGE E. RAMSEY, YUILLE W. REGEZ, WALTER A, RENNICKE, KARL H. REYNOLDS, THOMAS A RIEHLE, FELIX A. ROBERTS, DAVID T. ROWELL, LEXVIS J. ROWLAND, DAVID H. SCHAEKEL, GEORGE B. SCHICKEL, EDXVARD J. SCHOELLIC, JOHN G. SCHULMAN, GEORGE J, SCHULTZ, GEORGE J. SHERRY, RUBEN H. SIMON, MIKE T. STEVENS, LINTON C. VANDER KODDE, W. F. VAN HOUTEN, R. W. VAN VUREN, FLOYD S. VOIGHT, ARNOLD R. NVILLIAMS, DAVID C, XVILLIAMS, FRANK M. WITTENBERG. CARL T. WOLBERC, HARVEY T. ZIELSKY, FREDERICK A ZILMER, BERTRAM G. ZIMMERMAN, HARRY F. IIII IIIIIII I IIIIIII I I I II III IIII IIIIIIIII IIII I IIIIIII IIIIIIIIIIIIII II I II I IIIIIIIIIIIIIIIIIIII II II I II IIIII IIIIIIIII IIIIIIIIII III IIII IIIII II IIII IIIIIIII IIIII II II I II II III I I IIII I II IIII I I II IIIIIII II II IIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIII IIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIII IIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 164 IIII IIIIIIIIIIIIIIIIIIII IIIIIIII II IIIIII II II II 1 1 1111 111 111 1 11 1 1111111111 111111 11 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11 1111111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111111111111 111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11 11 1 1 1 1 1 11111111 1 1 111111 11111111 11111111111111111111111111111111111111111111111111 1 1111 Company E Officers CAPTAIN CPIARLES G, BABCOCK, Commanding LIEUT. GllWAN W. WEBB LIEUT. DANIEL B. BENSCOTER Cadet Non-Commissioned OHYICCPS BAXTER SAYRE ..... . First Sergeant BIGLER, JOHN BREUER, HERNIAN CLARK, BURTON? DROBKA, FRANK BERNHARDT, E. L. BULL, WARREN CARSXVELL, BEN CARTTER, BRUCE CRAIK, EDWARD CULVER, GLENN DOERFLER, FREDERIC DREWRY, CHARLES ARIENS, MANDO BANCROFT, GEORGE BARCLAY, SAMUEL BARLAND, GEORGE BARTH, CHESTER BEACH, MAURICE BEAN, WALTER BERARD, OVID BETHKE, RAIMUND P. BILLINGS, LEONARD BLAHNIK, VANCE BOEBEL, PAUL P. BOWLES, Jomv BRENAMAN, ERROL BROUGHTON, CLYDE BRUNNER, ANTON BUDDE, MCKINLEY BUCKMAN, GEORGE CAMPBELL, EVERETTE CARLSON, VAN S. CARPENTER, EARL CARPENTER, JOHN F. CARPENTER, OTTO CASPERSON, HELMER CHASE, LEON CUFF, ROBERT J. DAHL, LAWRENCE G. DAVIDOFF, ISIDORE Z, DAWSON, THOMAS DEWEY, BARTLETT DIDIER, ANDREW DRAIZE, JOHN DUFF, JAMES E. DUFFY, WALTER EBERT, REINHOLD O. EGAN, LAWRENCE ELSEA, STANLEY M. EISENBERG, LOUIS EMERSON, HUGH ERICKSON, ROBERT FALETTI, STEPHEN FIELD, REMEY A. FORD, STANLEY E. FOREN, FRANCIS J. FORSBECK, FILIP FORTNEY, NORDHAL FREDERICK, HARRY GATES, LLOYD E. GEURKINK, WALTER GOVIN, FRANKLIN M. GRIEM, WALTER GRUETT, ERWIN W. HABERLAND, WILLIAM Sergeants EVANS, RICHARD FACAN, ROBERT HUSTING, NATHANIEL LAGANKE, NELSON LAUCHLIN, EDNVARD Corporals HEWETT, WALTER HOLCOMBE, ROBERT L, KLEINHEINZ, FRANK LUTHER, MELVIN MCLANDRESS, SMITH MERENESS, LAWRENCE MILLER, HENRY B. PARKER, FRANK W. Privates HANSON, ROY E. HASXVELL, C. B. HAYNER, LEWIS HEILEMANN, LEWIS HEMBRE, HELMER HINKLEY, GEORGE C. HLAVACPIEK, JOSEPH A. l-IOLTAN, HERBERT HOLZBOG, WALTER C. HOMMERSAND, EDNVIN HORNE, DANIEL O, HOTTON, ALFRED D. HRUBESKY, C. E. I-IURLEY, JOHN IRXVIN, JOHN W. JANECEK, WILLIAM JENVETF, CARLYLE A. JOHNSON, ALLEN A. JOHNSON, NORMAN L. JOLLY, CARL JONES, ARTHUR N. KATZ, HENRY J. KELLER, ERWIN G. KEPPLER, FRANK KESSLER, LOUIS G. KNAPP, WALTER A. KNOBLAUCI-I, CARL G. KNOBLAUCH, GEORGE F. KOLB, EDWIN S. KORTEBEIN, ARTHUR J. KRAUSE, GEORGE KRUMHEUER, SIDNEY F, KUHLMAN, MILTON H. KULL, ADELBERT LAST, JOHN A. LEONARD, AUBREY LEVERENS, HOWARD LONG, WALLACE LORD, HAROLD LOVEN, LEO LUDDEN, ALFRED LUEDTKE, ARTHUR MAGISTAD, OSCAR MAHONEY, DAVID MASON, RALPH MASSEY, EARL MCADAMS, FRANK MCNOWN, GEORGE MEHRE, FREDERIC METCALF, HAROLD MILLER, VANSON V. MOON, JOHN MURPHY, WILLIAM NELSON, NELS T. PAULY, JOHN STAMBAUGH, PHILIP STRANAHAN, BEN WITTE, JOHN PFEIFER, OLIVER RAUTlO, EDWIN REWEY, OLIVER SPANGENBERG, GEORGE STEHN, RICHARD SUTLIFF, WHEELAN TOEPFER, GEORGE WEISMAN, JACOB NEUPERT, PAUL B. NORRIS, RUSSELL NORTHEY, WALTER NYHUS, WALTER PALMER, OTIS W. PARTRIDGE, WILBUR PETERS, RAYMOND D. PETERSON, HALMER A. PERSCHKE, CHESTER PFRANG, LLOYD PIERRE, WILLIAM PINEHART, PETER J. POSS, HOWARD N, POSTEL, CARL POTTS, TRUMAN REICK, CHESTER ROTH, PAULUS SALMON, LYSLE SCHNEIDER, CHARLES SCHLOMOVITZ, ELIAS SCHUELER, MILFORD SEARS, VORLYN SHREVE, RAYMOND SMEDAL, ERLING A, SMITH, ALBERT F. SOSALLA, JOSEPH STAUSS, WALTER C. STEIN, HOXVARD A. STOCK, DONALD A. SULLIVAN, LLOYD SYGMAN, SAMUEL TAYLOR, HERBERT C. THAL, ALFRED A. THOMPSON, JOHN E. THOMPSON, MYLES T. THOMPSON, WILLIAM TOEPFER, RAYMOND A. TOOMEY, FRANCIS E. TORKE, RALPH L. TURNER, CHARLES W. VANDERHOOF, CLARENCE VANDERVEST, WALTER VETTEN, CORNELIUS WALLACE, JOHN WASMUTH, WILLIAM WEHLE, ALEX F. WEHLE, EDWARD WHITSON, ARTHUR WILCOX, ARTHUR WILLIAMS, ALWIN WOLVERTON, ROBERT F. ZELLMER, ,ROBERT G. ZIMANI, NOCHOLAS 1111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111111111111111111111 11 1111 1 1111 11111111 11111111111111111111111111111111111111111111111111111111111111111111111111 11111111 1 11111111111111 11 1 11111 1 111 11 1 1111 11 1111 11 111111111111 1111 1 11 111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 Page 165 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II H""' . ""' ' "" I. I I. A - ..w:,-,ieiL:.:- V ,- 37 Om an D- A, .-I, f-,A .E O C 8708 - I gg., LIEUT. RALPH B. MCCURDY, Commanding ' LIEUT. JESSE P. WALKER 2 'IRNA -2 LIEUT. FRANK MCH. FERGUSON ' ' -2. R .vm fl I f Cl et 071- O77'Z7Tl1SSZO7'l6 CCPS : ISA :VI LOXVELL W. HIMMLER ....... First Sergeant ,- Q I Sergeant-5' A f 5 , BACHMAN, C. A. MITCHELL, WILLIAM K. TASCHE, LESLIE W. HELFAER, EVAN P. MORICE, ELTON K. TUCKER, CHARLES E. . HORTON, FREDRIC A. PHILLIPS, GEORGE D. WALL, FLOYD R. ,Q FJ KNOLL, ROY P. SCHLICHER, RUDOLPH WOODWARD, KING G. 3 WP SCHULZ, ERWIN P. - I :If UIQ,-ff.I.,..57a-, ' C -. ' I - . or orals L BERGSTEIN, LEONARD MARSDEN, WENDELL H. SHERBURNE, LOUIS R. A BAUER, CARL P. MASSEY, EUGENE A. TAYLOR, FRANCIS N. ik COE, ARTHUR W. MCGARTY, MITCHELL E. TIERNEY, EDWARD F . , 0' 1 GROESSELL, F. E. MERTES, JOHN P. TROWBRIDGE, FREDRIC , .. f 1 I HENTZEN, ERXVIN A. MILLER, RUSSELL H. TUTTLE, CLIFTON M. '-I - IIZIIPKE, GIIiBERT JW ISIOTT, WILLIAM A. VIVIAN, ROBERT S. '-iws, -v with-:L A EEBLER RWIN OSTERHUIS LESTER J W SON: E M . .L Au, A AQ, , , . , . IL I , DWARD . KOCK, WILLIAM F. PETERSON, MARVIN G. Cpriv a tes ABELL, GEORGE W. HARKER, CHARLES A. PENNEFEATHER, E. J. ACCOLA, VICTOR H. HARRINGTON, DELOS J. PETERSON, E. M. F ALLISON, ANDREW B. HARRIS, FORREST D. PHILIPS, CYRIL A. 1 ,- I ALTSCHNVAGER, EDWIN H. HARVILLE, CLIFFORD PIPER, PURCELL W. --f 2. ,IU -. .. 'R A If ANDERSON, LEONARD S. HARTWELL, DONALDJ. POTTER, RAYMONDJ. . BACKHAUS, HENRY HATLEBERG, C. N. PUESTOXV, KARVER L. I BAESCHLIN, NEAL HITTNER, VERNON J. PULLEN, RICHARD W. ,aiqfgfg BACLEY, EARL C. HOLBROOK, XVILLIAM F. QUISLING, SVERRE jj-Fi' BAKER, BURTON C. HORWITZ, LAZARUS RALPH, JAMES S. ' BAYLE, F. L. HOUGEN, HORACE P. RAUBE, HERBERT A. BEIER, EDWIN A. HOVDE, PAUL V. REPPEN, ARTHUR C. BEMIS, GEORGE G. HOYER, GEORGE C. ROLLEFSON, RICHARD .. gISCHOEF,cl5RITzK HUPF, WHITFORD L. ROGERS, EZRA - ' - - ' ORSACKI ARL . HUSTON JOHN ROEGNER H E .. C... ...R I ' I I - - -. " I -sane-3 I EORST, JIXOIHN W. IRVINE, ROBERT K. ROLLEFSON, GERHARD L . LA- RAUN ERVIN JOHNSON NICHOLAS S RUBENSTYNE JACK IA. Mg , R., A .55 Q I I A I 5 j Q Ai BRENNER, ERNX'IN C. JORDAN, CLARENCE A. RYAN, PATRICK H. ' ' ' N "x3f51- I BRICKBAUER, BENJAMIN JUNG, FREDRIC T. SCHAEFFER, MICHAEL E BRIDENHAGEN, CLENIENT KAISER, HARVEY M. SCHILDHAUSER, F. J. -Ziff '1'. A .- K - .II r I 1 BROWN, THOMAS K. BURDICK, ALLISON L. BURDON, HAROLD B. BUROKER, DONALD J. CALDWELL, HUGH IVI. KIDDER, EARLE E. IQITONVSKI, JOHN E. KLETZIEN, SEYMOUR W. KLUSSENDORF, RAYMOND KNAPP, MINER M. SCHNEIDER, EARL E. SCHULTZ, ERNEST C. SCUTTE, ALBERT G. SCHWARTZ, FRANK S. SEIDEMANN, ENGLEBER - ,M , 5 ,I l CHAPMAN, ARTHUR H. KNOXVLES, DAVID R. SEVRINGHAUS, ELMER gf, qi ' : CHEETHAM, HAROLD C. KORRISON, CLARENCE L. SEYBOLD, ERXVIN G. 2 gwE'CJf..Ay.5L Q! CHIPNIAN, WILLARD A. KROHN, IRWIN K. SI-IIMPA, JOSEPH F. f-gjfg. , COCHEMS, KENNETH KRUM, JOHN F. SLY, KIETH C. ' M -fig..- I K ' COLE, ARTHUR V. LAMBEAU, OREN A. SMUCKLER, ROBERT H. , Q COOK, BENJAMIN F. LAMM, VINCENT P. SNEIDER, ELMER F. S '!i'l!'1SlII,IqjSgf ,, DAHLE, ARTMAN H. LIEBERTHAL E. P. SUITS, FREDRICK XV. -f' "' aj DAKE, CLAUDE A. LIEBERTHALI PAUL R. SUTHERLAND, ELIAS J Q, A gvf' DEHNE, WILLARD O. LOCKXVOOD, WILLIS SUTTON, ROBERT N. 5 DREDCE, THOMAS J. LITTIG, LAWRENCE V. TEBO, ARTIE H. vi . 6- DUECKER, HUBERT C. LORFELD, GERHARD W. TIBBETTS, JOHN W. Q ,jbf'.e-,qQyf.-5- QQIQ-,4 DUNN. JOHN J. LUBAN, SIMON TILLEMAN, JOHN F. 'ir-5 ELLOS, SIMON F. LYDEN, PAUL F. ' TIMM, HAROLD D. ww Inf-5 Qing. fi -.QQ -V EMANUEL, XVALTER A. MADISON, FREDRICK W. TOOLAGIIXN, JOSEPH - L- - ENDE, ARTHUR TVIALLOXV, LOUIS C. TRIER, FRANCIS M. px. ERICKSON, MILO MARTEL, CLYDE W. URBERG, SOFUS 4 EVANS, JOHN R. MARTINI, JOHN W. VELGUTH. WALDEATAR yi,-T' yi, L G FALSTAD, CLARENCE H. MATTHES, CHARLES D. WADE, G. C. -S ,I 1 FARRELL, EDXVIN J. MCCONNELL, CLARK WALTERS, WARREN W. fm. 1,17 ,ig ,S IIEAIVKESTSHARLES E. MCDERMOTT, F. E. NVATSON, AILILEN S. 'viix 'Ti-'H-.' ' y . INSKY, ORRIS MCINTOSH, ROSCOE L. WEAYERS ARVEY H My FRANK, HOBARTJ. MILLARD, ROBERT D. WEOENER, ARNOLD A. In I "1 Q FREYMILLER, ERNEST F. MILLS, WILLIAM K. NVEDDIG, HARVEY W. Q55 - ,Hg ' ' wb 5 ' FUNK, ARTHUR C. MONTGOMERY, R. B. . WERBA, DANIEL R. ,P .main 15:5 GAARDEN, CLARENCE A. MURPHY, JAMES H. WIEDRICH, FLOYD G. - ' -- vi"V"f' -Wil' G A W N H W L L C ggi? N H 31. vi' GAUBATZ,A RTHER . NEBEL, gOLD C WHITE, . C. . E .Vi , by GORDER, RNEA, EITMAN, ERBERT . WILLTANIS, ?:RL . K - Iqfwgf OUGH,JAMES A. NELSON, ALVIE G. ILLMARTH, RANK J. ' N GRAF, FREDRICK R. NELSON, NVAYNE E. WISEMAN, JOHN W. up Mff""1"!S'. GRANT, HERBERT E. NETZOW, EDGAR O. XVOLTERS, HERBERT H. Afiygu .- ' 3, GREEN, WALTER E. OVERTON, ORRIN V. WRIGHT, HERBERT B. N' in 1 , Jn V, GROFFMAN, HARLAN G. PALMER, HERBERT P. WRIGHT, LA VERNE ,I'.. " ... I A .QSM-:J HABERLAND, ERWIN J. PASHKA, EDWARDJ. ZUEGE, DAVID C. HAMMOND, R. W. PATTERSON, GEORGE H. ' A IIIIII I IIIIIIIIIIIIIIIII I IIIIIIIIIIIIII IIIIIIIIIII IIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIII .I "'-- ' -'-T'-"--'----- " 4-1--ilu-I-ii-L ----- - -A---A----V " ' ' " I II I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIII I II I III IIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIII III III I IIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIII I III IIIIIIIIIII IIIIIII IIIIII I III IIIIIIIIIIIIIIIIII If Page166 vIIIIIIwIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII A IIIII II III IIIII I I IIIIII II II IIIIIIIIIIIIIIII IIII III IIIIIIIII IIIII II I IIII IIIIIIIII II II I IIII IIIIIIIIIIIIIIIIIIAIIIIIIIIIIIIIAIII IIIIIIIIIIII IIIIIIIIIIIIIIII II II IIIIII I IIIIIIIIIIIII II III III III IIIII II II II III III IIIIIIIIIIIIIIIIIIIIIIIII IIIIII II 1 I E Company G Officers , LIEUT. LUTHER M. WELI.S, Commanding i LIELIT. OKLIE D. WASITBURN LIEUT. ALFRED K. IRION Cadet Non-Commissioned Officers DONALD A. STOCK ........ First Sergeant ANTHES, CLARENCE A. CRAXVFORD, GEORGE G. DONOHUE, JAMES A. KASTl.IN, GEORGE J. KUEBLER, GEORGE B. COOPER, l'IUMPl-IREY J. DONOXVAN, EDWARD T. EDGERTON, EMERSON W. FELTMAN, CARL H, FORD, HENRY M. ALLEN, HARRY D. AMADON, HENRY C. AMIDON, GEORGE W. BARTLETT, HAROLD C. BASS, FLOYD K. BAUER, JOHN H. BECKER, ROLLAND H. BECLINGER, RICHARD T. BENBOXV, ROBERT L. BETZER, CECIL E. BIENSTADT, BEN BITTNER, T. V. BROWN, CLARENCE B. CODDO, WILLVIAM E. CARSON, WILLIAM K. CLARK, MANLEY H. COLE, JOHN W. COOKS, HARRY B. CONNELL, WALTER J. COX, EDWARD L. DAVIS, GEORGE P. DOWLING, XVILLIAM J. DREW, EVERETT G. DREWRY, MONTROSE K. EBBERT, EZRA E. EHLE, GEORGE H. EVENSON, CHARLES R. FELLOWS, CHARLES L. FITZMAURICE, JAMES M. FLECK, WILLIAM C. FRICKE, WILLIAM H. FRITSCHE, OSCAR O. GATES, CLAUDE A. GEUSSENHAINER, F. GILES, CLAUDE R. GOODRICH, CHARLES V. GREGG, JOHN W. GREILING, WINFORD W. GRIMSTAD, REUBEN C. GROTKIN, MELVIN S. Sergeants TVIUELLER, EMIL A. OUWENEEI., WILLIAM A. PARSONS, CECIL P. PETERSON, XVILLARD O. RALI, IRVINGJ. Corporals FREESE, FREDJ. HAIDLE, ARTHUR J. JACOBUS, DELWIN C. ICLEMENT, IELMORE F. LENVIS, HELMAR A. LINDCREN, ELMER L. Privates GLVENTFIER, FELIX G. HAPIN, LEONARD W, HANSON, PETER HANSON, MAURICE NI. HARMAN, FRANR S. HASSET, JAMES C. HEBERLEIN, CLYDE E. HENKEL, LEO L. HERRICK, ROSWELL H. HOFFNTAN, FRANK A. HOFFMAN, WALTER A. HORNIBROOK, F. C. HORTON, HORACE B. HUBBARD, FRANK C. HUBBARD, HENRY S. HUEBNER, BERNARD W. INGEBRITSEN, HENRY D. JENSEN, HAROLD W. KLEEBERGER, GEORGE S. KNOTT, WILLIAM M. KRAEGE, FREDERICK H. KRAUS, HAROLD L. KURTZ, CHESTER M. LANGAN, EDNVARD P. LALLIER, WESLEY C. LARSON, OSCAR W. LATHROP, WALLACE H. LONG, DAVID E. MAGANN, JOSEPH W. MASO, CLARENCE E. MCGRAW, ERNEST A. MCMURRAN, M. J. METCALP, CLIFFORD W. MILLS, HARRY E. MOSS, HARRY E. MCLAUGHLIN, JOHN L. MOOTz, RAYMOND P. MEVERDEN, LEON L. NAPPE, EDGAR H. OLSON, GOLDIE R. RICE, ALEX TERRY, ELTON H. WALST-I, JAMES E. XVALTON, JOSEPH L. TVIANTHEY, ROLLIN H. PAULUS, RAYMOND L. PRIDEAUX, GWILYM F. SERY, RALPH J. SMONGESKI, 4PAUL P. PEACOCK, HAROLD I. PEARSON, CARL E. PETERSON, STERLING D. PHELPS, IVAN POPE, ROBERT L. PORTMAN, RAYMOND J. POTTER, JAMES L. POULL, LEROY M. RAGATZ, ROLAND J. READ, PHILIP C. REZEK, ROY H. RIETZ, HERMAN E. ROVE, OLAP N. ROI-ILPINO, ANTHONY F. ROLLESTON, LEONARD P RUNKEL, HERBERT F. RYNDERS, FRANCIS A. SCHUBRING, GEORGE F. SCHULTZ, RAYMOND C. SCOTT, EDXVIN I. SHARP, HONVARD M. SMITH, CLARENCE C. STEINMETZ, GEORGE M. STENEHJEM, LYLE C. STICKLE, THEODORE E. SWITZER, RAYMOND A. TIMMINS, BASIL J. TAYLOR, KENNETH G. TREBUS, ERWIN H. TURNER, ROY W. VIIADE, IRVING L. WVEBSTER, LYLE W. WECNER, GILBERT W. XVILKE, MARCUS F. WVHITHALL, EDWARD F. WOELFFER, ELMER A. WRIGHT, HAROLD E. ZAMZOW, WILLIAM H. wIIIInIII IIIInIIuIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III III I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I III I III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III I II II III IIIIIIIIIIIIIIIIIIIIIII IIII I II I I III IIIIIII II IIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIEQZ IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII-IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIII IIIIII III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIG Page 167 IIIIIIIIIIII .,l. IIII l..,K .III ..,.. IIIIIIIIIIIIIIIIIIIIIIIIIIIII ..,K.,,..,K .IIIIIIIIIIIIIIIII..IIIII..IIIIIIIIII.IIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIII .,w.. IIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII .,... IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ..,l IIIIIIIIIIIIIIIIIIIIIIIIIIIII w..,,..,..,K IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ,.., .IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII .wh .I : .,, '- ffififx . "2 'N 19" RJR II:-I-IIA. I. . A N- '- :III-Sq.: - 1.-A 'N ,I-WI. JI N' . 1 5255 bf .MV-" "" R! ... - ' .,-'2f'N"' ik I. ,If Af I -- f"5':.-,I Iv 5-55"-A. ,IA I . II. .-iI1F:174CQ:g5x7'2-H? 'I F .. .,,, I .I 5- W- RV.. A Q! .. -..I,- . . 5' -,D , :D I 'G 1' x1:3,,.III . ' -' 2' ' I . 4 X. .. '- 'X fi V' ' EZ .jJ.?3f1- - ' ,, 'V '- Comp any H Officers LIEUT. WILLIAM C. KENNEY, Commanding LIEUT, MILTON O. NARAMORE LIEUT. WREN MIDDLEBROOK Cadet Non-Commissioned Officers MAURICE M. HANSON . First Sergeant BLYSTONE, JASPER K. Cox, IRVING K. CURTIS, HAROLD C. DOUGHERTY, JAMES K. EMMERLINC, HANS F. BORGMAN, GEORGE J. BORLAND, OLIVER W. BRADY, HARRY W. CHANDLER, SHELDON S. ELLESTAD, GILES J. GILBERT, HARRY S. ABRAMS, RALPH B. ALVIS, HENRY C. ANDERSON, CARL R. ANDERSON, HARRY A. ANDERSON, RANDOLPH G. ANDREE, CLARENCE A. BAILEY, ROBERT D. BARTLETT, GLENN A. BEALE, GEORGE E. BLAIN, WILLIAM C. BLAKE, HAROLD L. BLIZARD, LESLIE BORK, RUDOLPH A. BROITZMAN, T. A. BUTTERMAN, ERNEST CALLAWAY, LESTER R. CAMPBELL, LESTER C. CARNACHAN, ROBERT W. CI-IUDACOFF, HENRY CLAWSON, DONALD G. CUNNINGHAM, M. H. DODGE, EDWARD S. DOLLIvER', ARDIN J, DONALDSON, C. W. DUBOIS, HORACE A. ELSTAD, EDWARD M. EMMONS, LANVRENCE E. ENGEL, STANLEY D. ENGLISH, DONALD J. EVANSON, JOSEPH F. FIEDLER, ELMORE W. FIEDLER, STUART O. FRANK, CHARLES W, FRIEDMAN, ABE FRITZ, VIRGIL F. GESELL, HAROLD L. GILLMAN, HERMAN J. GILLUM, JOHN E. GORSUCH, STUART F. GRAVES, SPENCER F. GRAY, PAUL L. GREILING, REUBEN H. GROKOSKY, LEONARD H. ' A 9f"'f-P frm ' ' vi ' pf 9 52 .352 'V' . -'- I - g -I sg? . I ,. . .,,, , I K. .qi-ov was.. I -any ,. b ---.JD " I .. v, .k F'-211: if . ' D. 'J iII,jUfx"' Y 'l.:.. gli. , GSX... U ff: if!-'wrif' I 'lf' NI' I, ' T ' Liiilf- -I5 I- T535 - -.I 1,4 .ij-.I,. If Rf I A A ' -1' :f .g.:.I.2f . -,- I II I I. I A ., . ...iw ,.... , ,W ,R ...fm , ..,:5:7eE,-v,,.',.4,-gggxha .. 2'5" . ' IN .. .. , - 2 '9'..f'1WgI.. ,. 1 -X R-LII.,-A Ifiw A' FI. LT' ' -fa' 'I " 'I 'R W' f 'Q n I M," ' ., -f w,,4n4IWwI .. ' kg.-' .- ag '.- I: -'f..f155NZYnLCV.l " I I...., II.. ...I.......... I I I,...... I.I,. I I II IIIIIIIIII IIII I IIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIII III I IIII IIII IIIIIIIIIIIIIIIIIII I IIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIEIISII Sergeants FLOM, MERVIN O. HALL, STANLEY O. HARRIS, LAWRENCE E. HILL, GEORGE A. HOFFMAN, HARRY W. MARVIN, ARTHUR D. Corporals GOLLEY, FRANK B. JAQUISH, ROBERT I. KEWIN, EDWIN A. KUEHLTHAU, EARL R. LARSON, RALPH E. MALLERY, JOSEPH B. MARTIN, HORACE P. Privates CROSSKOPF, MILTON W. HAGEN, ARTHUR E. HALL, EDWARD D. HA LVERSON. LEONARD S. HANSON, ROY F. HARRISON. CHESTER T. HENSEY, EARL E. HOFFMAN, GILBERT B. HOCLUE, BERNARD E. HOMSTAD, ERWIN E. JELLEMA, CHARLES JOHNSON, HALVOR JOHNSON, TVIILES P. JONES. CHARLES E. IQALK, BERNARD R. KELLER, OSXVALD L. KING, DONOX"AN S. IQNAPP, EDWIN J. KOENIG, HERBERT C. KRfXUSE, ELMER G. KRELIL, HARRY L. KRUSE, ELMER R. KURTZ, MAYNARD L. LANNING, BRONVN C. LINDONY, CARL W. LXPPERT, ERICK W, LIIIINGSTON, PENN P. MATTS, LESLIE H. MCCABE, EUGENE H, MCCOMB, DONALD W. MCCONAGHY, DANA W. MGKONE, EARLJ. MEARS, CLAUDE A. MEEK, LOUIS F. MELVIN, JAMES D. MILLER, DONALD W. MILLS, DUDLEY J. MOODY, FREDERIC A. MORAN, HARRY E. MORTER, EMIL W. NEEL, MELLVILLE C. NELSON, GEORGE W. NEUMAN, OSCAR W. NEUMANN, HERBERT P. MURDOCH, HARELL A. ROGERS, ROSS W. SCI-ILUETER, T. L. STOCKER, ALFRED E. STRONG, THOMAS F. MITCHELL, MALCOLM RANDALL, EARL A. REEVES, HARRY M. RICHARDSON, NELS C. SCOTT, GEORGE W. WARREN, CARL A. NIEMER, ARTHUR W. O'BRlEN, HENRYJ. OICONNOR, WILLIAM B. ODEKIRK, WALLACE E. OLSON, OSCAR M, OPITZ, HAROLD F. PARADXS, WILLIAM G. PARKE, KENNETH N. PEHRSON, ALVIN O. PETERSON, LARS P. PFEFFER, OSCAR POPE, FREDERICK G. PRITCHARD, FRANK C. ROBINSON, WARREN J. ROSCHI, LESTER E. ROSENAU, IVIERVILLE J. ROWBOTI-IAM, NORRIS SCHREINER, FRED J. SCHMIDT, ARNOLD W. SCI-IRYYER, GEORGE L. SEDER, XVILLARD-J. SEITZ, OLE H. SLEZAK, GUSTINE SOLL, ROLLAND H. SPRESTER, CLAXRENCE F STAEHLE, KARL A. STALLMAN, CARL A. STANLEY, FREDERICK J. STEVENSON, JOHN H. STRANG, GEORGE H. STUMPF, VHIALTER P. THORPE, NOEL C. TRESNER, LLOYD F. VANCE, EARL R. WARREN, HONVARD V. XIVHITNALL, GEORGE R. WILL, CHARLES F. XVXLLIAMS, LEROY WILLIAMS, HARVEY H. WILLINK, GEORGE J. WITXVEN, NEWTON C. ZADECK, SAM ZERVAS, WALTER O. IIII IIIII III I III II III IIII III IIIIIIII IIIIIIIIIIIIIII IIII III IIIII IIIII IIIIIII IIIIIIII IIII III IIIIII IIII II III IIIIIIII IIIIIIIIII III IIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIEEIGIZIEHIYIEIIIEEEIIRGZHITEIIEIIGFIUKEIEIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIAIIIIIIIIIIIIIIII P a g e I 6 8 I IIIIII IIIIIIIIIIIIIIIIIIIIIIIII III II I IIIIIIIIIIIIIIIIIII IIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III IIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIII IIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIIIIIIIIIII II IIII I IIII IIIII IIIIIII IIIIIIIIIIII IIIIIIIIII III IIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIII III III IIIIII IIII III IIIIII IIIIIII IIIIII II II III IIIII IIIIIIIIIII IIIIII IIII I II IIIIIIIIIIIIIIIIIIIIIYIIIIIII IIII I I II IIII II IIIIIII IIIIIIIIIIIIIIII II IIIIII I IIIII IIII II III II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII i Company I Qfficers LIEUT. PIOWARD R. JOSLIN, Commanding LIEUT. EDNVARD D. LIBERA Cadet Non-Commissioned Qfficers HARRY PEI-IRSON BEROFORD, ROLF E.. HANSON, LEWIS S. JENNERJAI-IN, CARL A. ALBY, EVERETT J. BARRINGTON, CURTIS E. BRECKE, ROY L. BYER, WILLIAM A. CHRISTIANSEN, HARRY ALLEMAN, LEWIS C. ANDERSON, ROY E. ASSMAN, ABE BALABAN, EMANUEL BARDOUCHE, WALTER J. BAUER, HENRY F. BAUMAN, LEWIS L. BENEDICT, IRVIN A. BERG, GUST A. BIRRELO, ROBERT BOECKH, HUGO E. BOORMAN, STANLEY H. BORNITZI-QE, HENRY BOSSENBROCK, W. J. BRIESMEISTER, RAY C. BRILL, HERMAN BROWN, WALTER N. BRUCE, JOHN N. BRYNHILDSEN, H. A. BURAN, TRYGVE O. CAIN, DEWEY J. CALLAHAN, WILLIAM B. CHAPMAN, GLEN R. COSGROVE, LEE P. CROSS, PAUL E. CUTA, ALBERT G. DALLMANN, H. F. DANIELS, CLARE R. DAVIS, LAWRENCE K. ELLIOTT, EARL W. ERICKSON, W. M. ERICKSON, HAROLD E. FALK, CLARENCE A. FARR, CHARLES L. FELD, HARRY B. FINN, LEONARD R. Sergeants IQOLLOCE, PIERMAN F. LACEY, JAMESJ. MAINLAND, KENNETH E. MILLARD, KENNETI-I C. Corporals GEWALD, HAXROLD T. HASTINGS, HARRY B, JONES, DELBERT T. KNIGHT, WILLSON H. LEWIS, WARREN H. OLDENBURG, F. W. Privates FORD, THOMAS FRANEY, HAROLD F. GILBERT, HAVILAND GULLICRSON, HILMER HALES, HARRO O. HANSON. ALFRED HANSEN, NORMAN HANSON, EVERETT H. HAUGEN, CHESTER A. HAYDEN, ARTHUR E. HOLMES, SETH E. HOWE, HARRY HUBBARD, RALPH C. HUGHES, RUEBEN M. JANSEN, PETER H. JASPER, HERMAN J. J ENSEN, J ENSEN, KELLER, ALVIN E. JENS C. ERWIN F. KETTNER, JOSEPH E. KLARER, SYLVESTER J KNUTH, RUEBEN C. KOEI-ILER, HENRY G. KEMPFERT, AUGUST T. KROHN, ERWIN A. KRUTH, ROY A. KUPCZYK, JOSEPH P. LANG, EDGAR F. LARSON, LEON E. LIEBRECHT, S. F. MCINTYRE, VICTOR T. MADDEN, JAMES J. MARSHALL, HUGH B. MESSNER, ARTHUR G. MOLZAHN, GEORGE F. MOUNGEY, L. D. . First Sergeant IREID, JOHN H. SERZOXV, WALTER H. SORENSON, FORREST L. PANKRATZ, LEWIS L. PETERSON, ETHAN A. PRIDDIS, CHESTER A. SCHMIDT, HERBERT W. WENNERBLOM, H. W. MULVANEY, ARTHUR R O'BRIEN, JAY OTIER, WALTER L. OTTENSTEIN, JOSEPH PARADISE, WILLIAM H. PARRETT, CHARLES H. PATZWALD, ELMER M. POPE, ALFRED B. QUINN, ROBERT N. REICH, GEORGE E. REICK, LEWIS J. RIEDERER, LEE A. RODEN, SAMUEL H. RUNGE, LEO F. SEDMIRADSKY, JOHN SEELEY, LEONARD H. SERIO, SALVATORE SULLIVAN, WILLIAM J. TAIT, ROBIN C. TERRY, FRANK J. THORESON, ANTON O. THORSTENSON, W. T. TOFT, RAYMOND G. TURR, RALPH W, UEBELE, ROY J. VITNEHAUS, FRANK WAGNER, LEO V. WARREN, THEASLE S. WAWRZYNIAKOWSKI, L. WESKE, JAMES J. WESTENBERCER, R. H. WILLIAMS, GEORGE B. WOLGEZOGEN, H. C. WOLINE, ERNEST W. WOLF, JAMES IIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIII II IIIIIIIIII II IIIIII IIII IIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II I IIIIIIIIIIIIIIIIIIIIIIII I II IIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIII IIIIIIIIIIIIII I TIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III IIIIIII IIIIIIIIII IIIIIIIIIIIIIII III IIIIIII1 Page 169 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I IIIIEZIFIEIIIIIIIITTIIIIIIIIIIIIIIIII II II III IIIIIIIIEIIIIIIIIIIIIIIIIII II II IIII III III IIIIIIIIIIIIIII IIII IIII III III IIIIIIIIIII IIIII II III I II IIII I IIII I III II II I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIII IIIIIIIIIIIIIIIIIIIIIIII I II IIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIII III I Company K Oyiqcers LIEUT. CHARLES W. SHEPPARD, Commanding LIEUT. HOWARD H. BENTLEY LIEUT. JAMES E. KENNEDY I I Cadet Non-Commlssloned Ojfcers ALFRED VAN DE ZANDE . . Y First Sergeant Sergeants FREEBORN, VICTOR D. PETERSON, HOWARD STOLL, PAUL R. HENDRICKS, RAY A. POLLARD, FLOYD A. THON, LOUIS E. IQAPHINGST, LOUIS ROBERS, FERDINAND WELCH, LEE L. LOOMIS, 'IPI-IOMAS F. COFFIN, HARRY F. DAVIES, IRVIN HURLEY, CLYDE J. JOHNSON, LEROY J. KLEIN, JOSEPH L. LANCSETH, INCVALD ADAMS, CECIL P. ADAMS, CHARLES P. ALEXANDER, CHARLES L. ANDERSON, GOTFRED R. ARENT, IRWIN J. ARNOLD, ALFRED W. BABB, CLINTON L. BARTLET, ROBERT F. BARTO, WILLIAM M. BIRKHOLZ, CHARLES A. BISHOP, DOUGLAS I. BLOOR, HARRY BROST, ALEX J. BUNKELMAN, JOHN W. BUNKER, FRANK J, CAVANAUOI-I, H, W. CHELMINIAK, EDXVARD F. ' D CHRISTENSEN, HAROL CLACK, TXAARVIN M. COURCHANE, FRANK A. CRABB, DANIEL H. CULLEN, ELNIER J. CURRY, BERNARD H. DETMAR, WILLIAM DIETRICH, WILLIANI A, DOHENY, JOHN D. EDDY, HAROLD S. EIMON, PERRY A. ERDMAN, MARTIN A. FISHER, PERL FLETCHER, WILLIAM B. FRYSETH, SELMER O. GABBERT, ERVIN F. CIARBISCH, ARNOLD D. GROH, LEO P. HAMMERSBURC, R. H. HANSON, MELVIN E. HARRIS, MERLE E. HEDERER, WENZEL HEID, EDWIN P. HESS, EDNVARD E, SPARKS, RALPH E. Corporals LORD, FRANK H. MORAN, THOMAS W. NICKODEN1, EDWARD N. O'CONNELL, ALFRED P PRUEHER,WALTER J. REINKE, HERBERT W. fprivates HILAND, JOHN J. HOFFMAN, EDXVARD V. HOLDEN, MARK S, HOLSBACH, J. E. HOOPS, PIERBERT C. HORSWILL, EDXVIN E. JANKE, ROBERT F. JOHNSON, CARL O. JURANEK, ARTHUR W. KIKNIISH, FRANK J. IQENNDEY, XVALLACE O. KETCHUM, EDWARD L. KETTERHAXGEN, W. J. IQIMMES, JOSEPH P. IRING, M. IVI. KLAW'ESTAD, JENS PQLAXVITTER, OTTO A. KLOVSTAD, ELMER KNAPP, XVAYNE A. KNUTSON, ALBERT M. KOCZOROXVSKI, A. W. KUNZ, JAMES W. LAEMMRICH, P. J. LARSON, HERBERT T. LAVINE, ROBERT W. LEE, OSCAR LEXVANDONVSKI, W. LUND, ADOLPH LUNDE, HARRY O. MCELROY, M. C. MCINNIS, M. H. IMCKENZIE, ROY MCWEY, CHARLES J. IVIANZ, LOUIS R. MILES, STARRE A. MOARN, PATRICK F. MOHOLT, ONCLE E. MOUNT, CHARLES H. MUELLER, JOHN E. OLSON, PETER C. PAYANT, VITAL A. ROESKE, EDWIN D. ROMAN, ELMER M. SANDERS, JOSEPH W. SHARP, KARL L. XVEIX, LEO J. PETERSON, XVILLIAM F. PIETREK, PAUL P. POLUS, EDNVARD J PRINZ, HUGO W. RABACH, CARL W. RIKEAIISCH, FRANK H. REITEN, CARL ROEHRDANZ, R, A. SAIBERLICH, R. A. SCHEIDE, VERNON H. SCHNIDLER, FRANK J. SCHNEIDER, LESTER G. SELL, RALPH H. SHAUGHNESSY, JOHN E. SIMPSON, GEORGE W. SINKULA, ADOLPH J. SPEILVOCEL, FRANK G. SPREDA, JEROME L. STEVENS, IRVING SULLIVAN, DANIEL L. SXVANSON, ALBERT C. SNVANSON, FRITHJOF TAYLOR, OSCAR C. TAYLOR, HARVEY R. TENDRUP, HANS E. TOPEL, HARRY O. TOPP, HARRY C. TRUESDILL, LESTER H. USAREK, WALTER WVAGNER, HENRY H, XVARNER, LESTER E. XVEBER, JOSEPH F. WEISBROD, W. A. NVHITNEY, MAYNARD R. XVOIDA, FRANK XIAEGER, ALBERT F. YOST, IVTARC YOUNG, RAY M. ZENNER, EDXVARD ZIELSDORF, REINHARD II II III I IIII , IIIIIIII II IIIIIIIIII IIIII III I IIIIIIII IIIIIIIIIIIIIIIII IIIII IIIIIIIIIIIIIIIIIII IIIIIIIIIIIII I II II IIIIIIIIIIIIIIIIIIIIIIII III IIII IIIIII II II IIIIIIIII III III I II IIIIIIIIIIIIIIIIIIIIIIIII IIIIIII II III IIIIIIIIIIIIIIII II II II IIIIIII III II IIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIE Y IIIIII s I I Eli EI nun IIIIIIIIIIIIIII.II,.I,,,II,,,, .....I.,.II.II..I,.,,, . ,.,,. ........... I .I...,,.,. .. . .,.... ...,. .. ..... , .... ...-A..... ... ..I. ,...-........-,.... 1 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIII IIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIII III II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIII II III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIII IIIIIIIIIIIIIIIIIIII -IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 170 .g, mmmmmInmununmnnuInwImImInnmInIImInIInIInInqInIIIIInIIIIIInInInwyInIIIIMMMIITERM!!IInInImIuunInImInInnmnuvwggzfgfyiylnvllwIIHIIMEInIInmmIInIInInInIInInIImmInMIIInIWInIIIIInImIIIIIIIIIIIIIIIIIIIIIII vm IIInIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIImmInInIInIInImInIInImnumInImImInIIIIIIIIIIIIIIIIIIIIIIIII IIIIImIIIIIIIInIInIInInIInInIImvmInInImIIIIIInnunumIIIIIIIIIIIIIIIIIIIIIIIvmmmIIImIIIInIImIIunumuumm -I EEE EEE vi .1 1 .51 " 'f C Ompany L ,wif 9-' Ei? 7' I:"'f'. gig 1-'.'5fj'.tw" - q ,T ,I . C9763 . LIEUT. VINCENT L. DUNNE, Commanding f ' V-'if -'35 LIEUT. WALDEMAR F. WEITMAN Y 'IJ LIEUT. GEORGE SOMMER Vi F' 7 S1 '-fi l,1gB.s5i,F Q -1 C cl N C ' ' d O AMY' 1:-Tai .3 Cl et On' O7Tl771lSSlOTI.2 C6718 553 . f ,A :Tv-1""' N 5 ,HARP 1 "AEC ' 1' I Ei: ' . :iff .7 ARTHUR R. UPOREN . First Sergeant , Q. ' Ni' QT.-Lf,'I' 'Q , WIN.. ...J ,H ,A 7 wg Sergeants Rf, . F' :F -..- 'I-N E EEE f""!.-fr' 2 E55 1, 1 52: ' 1:5 EE " ' . QI- 3, 552 Q -A sh' " II1-,J T filifzxf-lxfiff "gif, I...',g3-iw. 1, -.. Q if? 51 5 ' L' '-'I 'airs 'A f .4 ' Q- Q ' '34 .ye . . '1 5257.1 S'g',if'. -WL -A ' :I -,,-:g.:sf"f .elim ,. .. I -.A f 1 7'b i:gF ' IA.-?5' f" ' I ga 3 A Is: 225439 gf- - .. .E ..... I-I I - --R-'g.,::1-a:'-.nw P? H -:f' -":' Q' ' W'1g.5Q .EE A .. . . A T" li - 'Qlygg ..5-M. ...7 :-Nga,-4' 4- . . , 4' QI -sl: EU ' " it r Qxbfgi fa I I ALCOTT, EARL L. BEHLING, EDXVARD A. BRITTENHAM, F. A. DECKER, GEORGE H. GROVER, H. J. HAIDLINGER, FRANK HOPKINS, H. D. ASKAY, JOHN F. BALTES, W. M. BROST, WVILBERT J. DAYTON, JAMES A. DORY, JOSEPH E. BARLOW, EMMETT A. BAUM, HARRY H. BAYER, EDWARD BENDER, CURTIS G. BERNINC, JOSEPH A. BERTRAND, LEE N. BLAGER, A. BONESHO, FRANK M. BONNES, BENJAMIN H. BROD, LEO J. ' CALLAGHAM, WILLIAM P. COTTS, PAUL W. HOWARD, ERNEST C. HOWARD, VERNON J. lqO'lT, W. J. LAVALLE, M. J. LOOMIS, L. E. INACCLOUCH, JOHN TVICCONAOHY, A. H. RJEYER, RAYMOND C. Corporals GROSCHMIDT, KARL W. OHNSON, WILLARD M KNAPP, IQARL F. NOOP, PAUL C. LEXVIN, OSCAR A. Qprivates JANKE, ALBERT C. JENSEN, EDMUND C. JENSEN, LEROY C. JOHNSON, BERT J. JOHNSON, CYRAL E. JOHNSON, THOMAS H. JORGENSON, ALFRED M KAMINSKI, B. A. KARL, VINCENT J. KAZMIERCZAK, P. S. KERWIN, HENRY R. KLAMICER, CHARLES MILLER, JOHN A. NELSON, C. E. NELSON, F, J. PETERSON, P. A. SCI-IERHART, WILBERT L. SCHROEDER, C, W. TIMM, H. M. IVIILLER, MERTON M. PARMENTER, MAJOR E. SCHROEDER, LEO L. SHALLMAN, ERVING T. THOMPSON, SIDNEY M. PARADOXVSKI, STEVE G. PAULEY, GLEN V. PECK, ELMER L. PEDERSON, OSCAR H. PETERSON, CLARENCE W PETERSON, R. G. PINEGARD, EDNVARD A. PORTER, E. H. QUALY, P. B. REKLAU, ARTHUR H. RATHSACK, BEN RAY, ROLAND T' CYRAN, AMBROSE L. IQLUG, GERHARD E. REUTELER, FELIZ H. DAMPIER, THOMAS J. KOEHL, JOHN E. RIPP, JOHN M. DICKINSON, HAROLDJ. KOSCIELNAK, ANDRENV S. RUDE, MORRIS DIETRICK, JOSEPH A. KOSHOLLEK, B. E. RUNGE, WALTER H. I, DIETZEN. MICHAEL M. KOSMATKA, G. F. SALTNESS, HJALMER M. DUNREL, ELMER C. KRAUSE, ARTHUR SCHEIDERER, IRVIN ,gg i- T, ERDMAN, E. D. KRAUSE, A. C. SCHMIDT, ENO A. V-E? f ERDMAN MARTIN F KUMMER WALTER N SCHUSTER HENRY , ERICKSON GEORGE A. KURTZNVEIL LOUIS P. SEBO, EDGAR N. ERICKSON: LAWRENCE R. KUSCHEL, ERTMAN M. SHERIDAN, WILLIAM D. ' V A3 FINGEL, FREEMAN L. LAATSCH, ALFRED G. SIMMELINK, EDWARD ff FLEINER, WILLIAM H. LABARRE, EMERY E. SMITH, EDWARD V , T3 FOGELBERG, WALTER L. LANG, OTTO SOHOLT OLE S. . ,g.. . . A C I FORSYTH, ROBERT . LANOENDORF, . H. SOWIN, LEO 'fin FRAKER, CHARLES P. LANZ, OTTO A. STAUDE, FREDERICK FRITSCHE, RAY LARSON, CARLJ. STEININCER, CARL D. I A A ERONK, EXLQVARD JH LEDIN, THEODORE A. STERNKE, ROBERT R. -1 AULKE. ALTER - LEMKE, JOSEPH J . STLUKA, FRANK J. 4 z, SILBERTSFN, VICTOR A. LEWINHHARRYEE. STUDT, KAI H. L .451 'Vi' Filif-' '31 'cn' :gi -' I O-M OPLEN VAR LODL, ENRY . TAITT JOHN " GORMAN, LYLE C. MARKCREN, CCG. A TI-IEOEALD, RAY GRAMS STEVE J. MACMILLER, ARL . TOMCZAK VINCENT W. GREENWOOD, LOUIS J. MCINTYRE, RUSSELJ. UHL MELVIN C. .f '.f',,' GN Sz' , ' TAX, GUERIN, BERNARDJ. MILLER, FRED WARD, OSCAR HARBART FREDRICK MILOSKI, JOHN , WEAKLER GILBERT A, : HARTMANN, ARTHUR H. NEUSER, ARTHUR J. WEBB EQLE Tv Ng HEDDINC, LEWIS T. NOWAK, CASIMIR M. WELLQNSTEIN OTTO J g XXI! W, LII-2252.1 HEDIN, DAVIDJ. ODELL, GILES F. W W ' ER A ' I HENDRICKSON, JOHN E. OLSON, OLE M. ENZEL' ALT ' 53 - HOFFMAN, A. N. OSTWALD, WILLIAM H WERDER, .JOHN O ' HUEBNER, WILLIAM D. PACZESNY, FREDJ. WIRKUS. JOSEPH M' I I H .I,.I.,.......,..,..........., , ....,....,.......... I...,,...... .,,,..... I ,. . I ,, .. .I ...... . I... . ,. II.. . ,.,.......,...,...,,..., I ..,..,,......,...,..n., . . .... , ,,.. , ,,.I..,.............,,........,..,..,.......,...., .....,,.,,,,..,.,. . , . .,...,.....,,,..,.,..,.,...,......,I..... ..... ,.,,,,,...... . . .umm mum mmm IanIImInIInxmliiiKH?ii5UIilYFF1IIIuIIIInInIuIIuvInIuIImummmInnvIInInInIIInIInInIInIInInIInInInmm:IInInmmIInInnuInInIIIIInIIIIInInnumInIuIInInIInImmmruIIIIIIIIInuvIInmimiiliiffiinImIIIInInInKHIHEHIEEIYIHPIHIIIImzuImmunImInImInInIEEEHMIGIFEFIIIIIIIIIIERIGEIInummmmnnlniiIivInInIIIIIIIIIIIIIIIIIIIIIIIIII mm. IIIIIIIIIIIIIII Im mm mm mm: ImmIIIIIIIIIIIIIIIIIIIIIIII nmmmlmw num mm. IIIIIIIIIIG P cz g e I 7 I 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111I11111111111111111111111111111111111111u1111111111111111111111111111In1111111111111111111111111111111111111111111111111111111111111111111111In1111111111111111111111111un111111111111111111In11111111111111111111111111In11111111111111111n11111111111111 . 1 1 1 1111 1111111111 1 11 1 1 1 11 11 1 11 1 11 111 11111 1 111111111111111111111 1 11 1.1.5 Company M Qfficers LIEUT. LENVIS E. PARMENTER, Commanding LIEUT. RAYMOND WALLACE LIEUT. JOHN D. WATKINS 111 1111111111111111111111111111111111111111111 1 1 1 A Cadet Non-Commlsszoned Offizers KAI H. STUDT .... First Sergeant Sergeants BOETTNER, F. W. HENSEL, PAUL J. PETERSON, HENRY L. BRYANT, ALVIN W. HJORT, THORWALD O. PLATTETER, CHARLES F. CONWAY, HUGH LEONARD, URBAN C. SCHNEIDER, F ERDINAND DEUTSCH, I-IERMAN J. NELSON, GORDON E. ZEMAN, BERNARD J. Corporals AVERY, CLIFFORD W. HAERTEL, ELMER R. MORROW, SAMUEL E. BEHREND, FRANK C. HALVERSON, EDWIN M. PRESTON, DANIEL L. COMP, SYLVESTER J. JACOBOSKI, ALOIS L. RYBELD, RICIJARDJ. EDNVARDS, JACK C. JANKA, ALFRED A. STOWE, GARELD D. FITZGERALD, GEORGE C. JARSHAW, HOLIVER G. VAN LONE, ORLO W. GORSBUCH, MARTIN L. KINGSLAND, ROBERT D. WOLF, FRANK G. 1 Privates ANDERSON, ADOLPH H. HARDER, FRED D. OKERN, MEARL G. ANDRAE, ROBERT C. HARELSON, RUFUS H. PASSON, PETER P. ALCUMBRAC, WALTER S. HARTY, RALPH M. PAUL, ALBERT F.. BAILIE, RALPH J. HEYMAN, ALPHONSE PAULSON, RUSSELL BALSLEY, RALPH W. HINTZ, EMIL O. PELLOQUIN, HOMERJ. BEAVER, BERNARDJ. HIRSCKERN, OTTO PHILLIPS, LEE I. BLOOM, GEORGEJ. HOFSCHULZ, HARRYJ. PIKE, FLOYD R. BODE, ALVIN E. HOOFT, THEODORE A. POMIAAER, ARTHUR BOFINCER, WILLIANI A. HOLSTEIN, RAY E. PORTER, ALMON R. BORCHERT, ARTHUR E. JAERUCK, ALLEN PRAIN, WILLIS A. BRANDENBURG, R. G. JACOBSON, A. L. PRASSER, ERNVIN J. BROXVN, GEORGE W. JOHNSON, ELMER O. PRI-I-GHARD, JOHN M. BUDDEN, ORVILLE L. JOHNSON, FRANK O. PURPERO, CHARLES W. CALKINS, GEORGE D. JOHNSON, HARRY E. REGELE, JOHN H. CASE, HONVARD I. JONEN, HENRY G. RILEY, HONVARD V. CLARK, ADMIRAL D. KIXCPlADORIAN, PAUL ROHRICHT, HUGO A. CLARK, HARLEN G. KAPKE, XVILLIAM F. ROSERA, RYNOLD S. CLARK, HONVARD G. KAPPUS, CASPER E. ROYCRAFF, EDWIN CLARK, SHERMAN S. KEMl'FERT, AUGUST T. SCHACHT, FREDERICK H. CLAY, ERNEST G. KERSHAW, HERBERT A. SCHARDIN, RAY W. DAMASK, KURT A. TQILPATRICK, FRANK B. SCHMIDT, HERMAN R. DAY, CHARLES M. KINDT, MARK SCHUH, CLARENCE B. DEVINE, PAUL W. IQISSEL, HOWARD C. SCHXVARTZ, CHARLES F. DIONNE, JULE D. KLINIENT, HENRX' SHERWOOD, NVALTER F. DUPUIS, EARNEST KOELTING, NVILLIAM SIDLE, MARTIN M. DONOVAN, JCE E. KOHN, WALTER L. SIDLER, RAYMOND C. ENGLAND, ADOLPH P. KRAUSE, ALVIN H. SIKERRA, ANTHONY S. ERDMAN, ELMER W. KRISTZUMAS, JOE G. SIMON, XVALTER W. ERDMAN, PAUL O. ICURTZ, STEPHEN H. STICHERT, ERVIN H. FANKHAUSER, FRED C. LABEGKI, FRANK K. SUTCLIFFE, CHARLIE V. FEHRENDORFF, H. H. LAMBIE, OSEORNE T. TOZEK, PAUL G. FENELON, JAMES J LANGELY. ARDINAL J. TOMASHEK, FRANK GARDINIER, E. J. LIERMANN, F. M. TREDUPP, XVALTER O. GAULKE, WALTER A. LINDQUIST, CLARENCE W. UBER, ROY L. GORHAN, ARNOLD B. LUDWIG, ANDREW J. VAN ANTNVERPEN, ALVIN GOTTER, EARL LUTz, ELMER O. VOEP, ROMAN B. GOURDOUX, C. F. MAEGLI, ROBERT H. Voss, FRANCIS W. GRENWIS, GEORGE E. MARSGHKE, W. A. WESTPHAL, GEORGE P. HAACK, WALTER C. MARTIN, LOVELL J. WEX, EDWARD A. HAAS, SAMSON H. MORAN, ELROY J. WICZYNSKI, ALOXS S. HASS, ERWIN R. NEEB, SAMUEL G. WILEY, DANIEL D. HANRES, ALBERT E. NELSON, FRED N. WILSON, LEONARD HANSON, JOSEPH NELSON, ROY B. WISEMAN, HARRY A iiifffffffffffff' "" ' "" ' " """" " 'I "" ' """"""' I """ I II 1::II::I::1:II I s:::::I::::::I::e K'II' I 'I II I I'-1 1'1' IIIIII I I IIII I H IIIIIII III- IITHI II IIIII IIII IIII I II 11111111111111111111111111111111111111111111111111111.111111111111111111.111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.1.1111111111111111111111111111111111111111111111111111111111111111111111.1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.111111111111111111111111111.1111.111.111.11111111111111111111,1111111111111111111I111111111.111111111111111111111111111111111111111111111111111111111111111111 P cr g e I 7 2 I 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111113111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111I1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 F11 11111 11111 1 1111 1 1 1 11 1 1111 11 11 1 1 1 1 1 , , ,, ,, H, ,,,,,,,,,,,,,,, 55 IE 1 11 1 111 1111 11 1 111 1111111111 1 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 Radio Company LIEUT. LEXVIS DE R. IVIONVRY, Commanding Cadet Non-Commissioned Officers FIARRY M. ASC!-HNGER . First Sergeant ACZNEW, FRANK W. ANDERSLHN, IRUDOLPH E, BELLMER, ALVIN M. DAVIES, CLINTON W. EI.LER, LINN R. HAHN, LAXVRENCE I-I. HANLON, RAYMOND J. IQREMER, DONALD G. LANNOYE, LORRAINE M. AHERN,'THOMAS L. BAKER, HARLAND R. BARTLETT, GEORGE W. BAST, MICHAEL O. BERC, CI.lFFORDJ. BEUST, CARL BEYER, HERBERT A. BIRKREM, OITTO A. BLANCHET, IQENNETH C. BRADLEY, GLENN P. BROEZEL, VERNE L. BROXVN, LYLEJ. BUCKBEE, MILTON V. CAREW, JOHN R. CLAFLIN, FOSTER C. CLEARY, LOUIS F. CLIFT, DELBERT L.. COOPER, MELVIN W. COOPER, LEONARD G. DAHL, WVALTER E. DELANEY, DENIS J. DILLON, FRED G. DORWIN, MILAN M. DUNIN, STANISLAW M. ECKE, REUBEN I-I. ELLIOTT, HARRY T. ENDERS, LEROY L. FADNESS, NELS L. FELLOWS, FRANK S. FERRIS, PAUL E. FIEDLER, RALPH O. FREEMAN, PHILLIP D. GANGSTAD, ROY A. GRAF, ELMER A. GREVE, ELMER J. GUESS, PEARL G. GUSTMANN, E. A. HARRINGTON, C. O. HAZEN, WILLIAM M. HELD, RUTHERFORD R. HENDRICKSON, LEWIS P. HESER, FREDERIC D. HETTGAR, EARL G. HILL, EVAN V. 11 11 1 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 Sergeants I'lEIN, MARTIN N. HUBER, LAWRENCE J. KRANZUSCH, RAY F. Corporals LEUEENBERO, VERON H NELSON. RUSSELL H. NORBY, PERRY A. OLMSTED, LLOYD O'Rl7URKE, BERNARD T. PEKOFSKY, PHILIP Privates HILL, MILO L. HOESLY, HOWARD S. HOFF, GUY I. HOLLOWAY, JCI-IN M. HOLT, CLARENCE U. l'IUMPl-IREY, GLEN M. HUNT, HERBERT A. HYATT, FRANK B. IBENTHAL, JOHN C. JILEK, JAMES B. JONES, RUSSELL W. JONES, CLAUDE B. JOHNSON, CLARENCE JOHNSON, HAROLD E. JOHNSON, ROBERT H. KAASA, ORIN G. KELLOGG, HORACE E. KIDD, CLARE W. KIENOW, ERWIN C. KIRXVIN, PHILIP F. KRAUSE, CLARENCE C. KRUEGER, RAYMOND A. KRUSE, ORWIN H. LAMI, HERBERT J. LARSON, JOHN R. LECLAIR, CLARENCE J. LESTER, GEORGE E. LINDBLOOM, ALBIN J. LIVINGSTON, LOREN C. LOTWIN, HARRY H. MCDERMOTT, DANIEL J. MCDONALD, ARCHIE W. MACBRIDE, DOUGLAS D MACMILLER, CARL A. MAHAN, FRANK E. MATTESON, CYRUS P. MORATTI, LOUIS F. MOREY, DONALD J. MULLEN, GLEN E. NELSEN, HAROLD N. NELSON, CHARLES R. N. NEUENDORF, EDWARD C. NOHL, RAYMOND F. NOLAN, GRANT J. 1 1 11 1 i111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 Page 173 1 1 111111111111111111 NOLTE, FREDERICK W. PEACOCK, CARSON E. WILEY, EARL J. PETTEOREW, PERCY D. PIERSON, ELMER ROEXVEKAMP, F. W. SUDA, GEORGE M. TENNEY, PAUL H. WOOD, HAROLD C. NORNESS, RECTOR L. NORRIS, ALBONJ. E OLSON, CHARLES W. OLSON, HAROLD E. O'MALLEY, FRANCIS J. OXVENS, LEO F. PAULL, HARRY J. PAULSON, CLIFTON A. PAYNTER, SAMPSON J. PEARSALL, MERTON C. PETERS, CHESTER L. PETSCH, HERBERT A. PICKER, PAUL F, . PRAY, CLARENCE E. PROULX, EUGENEJ. REED, CLARENCE REMOL, WILLIAM B. REYNOLDS, ROY T. REYNOLDS, JAMES A. RICHARDS, LLOYD B. RICHARDSON, JESSE L. RICHARDSON, ELMER E. RICGERT, ERWIN W. ROHERTY, LEWIS F. RUSKAUFF. BERTRAM A. SANDRY, JAMES G. SCHAEPER, JOSEPH L. SCHMIDT, ALFRED SEIPP, ERNEST W. SHEPARD, FLOYD P. SIKER, WILLIAM F. STEPHENS, LEON B. TAYLOR, DAVID TILLER, PALMER O. TRANTIN, RUDOLPH WALSER. RICHARD G. WVEGNER, KARL H. WENZ, CARL WERNER, GEORGE E. WINTER, WAYLAND V. WIRTH, HONIER S. XVRIGHT, WARREN F. 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111 1 1 11 1 nmIIIIIInmIIIanImIIIIIIIIIIIInnnIIIImummIIIImIIIIIIIImIIIIIIIIIIIIIIImIIIIIIIIIIIIIIInnmInmmuIIIImIInImIIIIIIIInImIInInnnIInInImInImTuIInIIIIIIIIInIIIIIIIInIInImImInImInImInIInInIImIIIInIIIIIIImIIIIImuInumInIummmmIImInmmIInIInInInIInInIInInIIITmmumnumImnunumumnImuImInnuIIIInInIInImInInIIIIIIIImInInInIInInIInInIIIIInIInInIInInIIIIInIInInIIIImInIImIIIInIummIIIIInnuummnuIIIIIIIIIIIIIIIIIIImIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII f""T-ITIHH?TMRiTi1T'7F"'"""'?',......,.m.5..U. """""' "Q"T""5'T"',.. ,,. ,, , . . , ,I , II, . .UI In. .T"""7"'T" I IIITMI'ii'iHTiiiiIIIIIII II II III III In I I HW... .III.Im...,...I..,I.. ..,.In.,,.,H.,,....,,,..,.,.,..,,.,,,,.,,,,.,,,,,,,,,,,,,,,,,, 4.1 n :sp x L : 'I153Z 'fZX'9- -'TNQ - A - 1186161 UCl7'fQ7'S C0771 C171 had s -K ,335 ...S,. m. WA- ..' VI: f Q . .. 9' .-:wg ..,, . A Im mm In IIIIIII " Rszfibiw. f' I-Hi ,IHA -- 'A 1-fa-v'w-As-riff-R:.:'T . A ' 5 pm..--1. 'ill-E: - .ar-133' . A, earl? mei"-.'1':1f.:-f - A . ,:,, . , A -JW .-gg. R'-.:::"fif,'.'4"" ...bf 5 , 5 'gi-,5i2::.. RQ A5 "'f"'f" :f.cEE:tS'Z'5:E-'fha ': V -A 1' 'f .45 ' ' 2. 'QL 'Vs' TX' . ' Zvffii f f If .1f.,-KE" -F: ' - . f . :...:f,:f 1: Q ' ' ' -'4YI'.'A:1f ::Af:r1.a-S:A,.:e51n.R -Ogg. -. Ap. .X AA: .Z , ,K ziz- f A I. I- -,-. . :-f , f.4A,:a.P:..T... ,:,,. A .Y kg. T' gf 1, I 4 59,1 ' ,:S5:31w.,,,,. -iff:-va 1 ff -I '.':.IfJ. 5 '4,4-ny.. . 'gg 4 , ,. .-.542 ings! 1 '. "KH .Q,f'5," - ' me zu 1, .. - VJ .,.,. . . 1' ,A '34 "E"1a. A .. 3 A-A:-kilw.:.....1-1 6 ' fx-I.J.-Q 2:51 ' SMF- FIT'-.' 'TIC ' f- 1 . A R' ' . 0 N.. ,.,..5 A' I -A P Q. R'-,Q .- 1 Niffwe e,,I.q,:,..,.m-..,, , 7 5 --'v-- QI- X 11 .-A 1- A' ' if X . 5? .A-va ,AQ ,g ,wg:.-.YET . 4-R-1 .ZA N1w:m.?f'E' W ' :si -. ' . . " .,f" wwf P131 'ww ,. ,, A ., .X-,i,Mrn,. ,, . gang I. lf?-rx " FTf"f'.f75. ' 'x' " N5 angzw. ,IA ,X lf -. v. .1....-1: 1 I ," -Q '-TM. 145- ,. gala., ,,, ,K JI' ff " :1"i5::..F. Ii-f" - ' .. ...Z .... ..:Lzw,. EI ' ' V 2lr"1,.. ., vi 'F ' A.q,.3,3, . K :I Gifj F' R .- 1 -11-- A RI -'H Q .,., .1 .ARA-A ' " ' Q QL? ....w,., .. ' .My-A 'fi Omcers LIEUT. LEE C. HERWIG, Commanding LIEUT. EARL J. HANAFORD LIEUT DONALD D. MGCASREY Cadet Non-Commissioned Officers EUGENE F. BESPALOW . . FIRST SERCEANT BENTON, DWIGHT F. BOWMAN, HAROLD F. CROLI., MELVIN W. DODGE, LEONARD GILL, HAROLD A. GRISWOLD, FRANK L. BAGON, IVIERRIT M. BALCH, HAROLD M. BAUMAN, OTTO W. CLARENBACI-I, RALPH E COLLINS DAVID H. AINSNVORTH, PERCY F. ALBRECHT, GERALD R. ALLIN, BUSHROD W. ANDERSON, OSCAR W. ARVIDSON, REUBEN D. ASCHENBRENER, E. L. AXELBERG, GEORGE W. BANDONV, CHARLES R. BEARDSLEY, GEORGE L. BEGLINGER, FRED F. BENSON, IRVING M. BIANCE, TONY J. BLOECHER, WILLIAM BRANDAU, EARL R. BROSOWSKY, ERNEST BUNDE, LEO F. CAPEN, HENRY W. CAPRON, CARCIL.L, COLLINS, COOPER, COTTON, COVELL, CRONIN, CHESTER A. WILLIAM A. SIDNEY R. CHARLES T. ALFRED R. ARNOLD B. PAUL T. DAVIDSON, JAY H. DIEHL, VAL C. DOCKA, TI-IORALF C. DONOVAN, CARROLL T. DUIPOIS, LEONARD EBENTIER, ALBERT F. EXVING, WILLIAM C. FEDDERSON, ALFRED L. FEIRN, WILLIAM I-I. FORD, RAYMOND FRAZIER, ARTHUR H. FRENCH, NEXVELL E. Sergeants KELSEY, CARL H. KNOERR, RIJDOLPH R. MEYER, ROYAL L. MONTGOMERY, W. H PETERSON, RALPH E. PIDCOE, WILLIAM W, Corporals FULTON, FRANKLIN D. HILLIKER, BELDIN I.. JAEGER, WALTER C. KING, WESLEY B. MGDOUGALL, R. K. MONTGOM ERY, ALVIN E. Privates FUCHS, THOMAS GARRITY, LEO V. COELLNER, XV.-XLTER H. GORE, XVARD A. GOTHAM, DONALD E. CIRANDY, WILLIIXNI N. GRIFFETH, STEWART D. HANSON, PAUL E. I-IEDDLES, DONALD F. HOLCOMB, CHARLES E. HUMLEKER, LARS HUNZIKER, CTI-IESTER E. JEANNERET, TOM E. JOHNSON, DAVID A. JOHNSON, IVIILLARD W. JONES, ARTHUR L. KEMLER, HERBERT J. IQESSLER, ALFRED F. KING, GEORGE R. KOEHLER, WALTER A. KOENECKE, PAUL M. KOHASKY, ARTHUR B. IQRENZ, ALFRED S. LANGE, KARL F. LESLIE, CHARLES E. LIEBERT, ARTHUR E. LINDQUIST, CHARLES R. LONG, JOHN R. LYMAN, ALFRED T. MAGFADDEN, ROBYN K. MCCONNELL, PHILLIP S. MCDONALD, FORREST R. MGKNIGHT, CLAIR MOULDING, J. W. MUELLER, LOUIS C. NEMETZ, VICTOR W. IIIIWIII.-IIIIIIWIII I .III III II I I .. . .. ...mn . .... .. .... . ,.... PESCH, ANTHONY W. RADKE, ORVILLE E. RAY, OTTO A. STILES, HUGH R. SLAKER, DONALD V. THIEL, WALTER C. NOTT, WALLACE C. RISTEEN, HERBERT L. SCI-IROEDER, GILBERT W. STEGEMAN, HENRY R. VITS, ALBERT L. NOLEN, VERL V. OLDS, XVALTER M. OLSON, CHARLES D. OLSON, SIGURD F. PENBERTHY, FRANCISCO PETERSON, ROBERT G. PETERSON, GEORGE C. PFA!-ILER, JOSEPH A. POKORNY, EARL J. PORTERFIELD, JOHN A. PRAY, CLARENCE R. PRESCOTT, CLAUDE E. REED, ROLAND V. RENARD, EARL J. RICKNIEIER, CARL H. RODGERS, PIOXVARD J. ROSS, GEORGE A. RUHSAM, MILTON W. SGI-IMIDT, RAY C. SPILMAN, CARL J. STEELE, LLOYD M. STILES, DNVIGHT H. STRONG, WALTER E. SUHR, ALFRED L. SUNDBY, CLIFFORD A. TESCH, ROLAND G. UBBELCHDE, PAUL R. VALENTINE, JOSEPH F. VENNES, LEON A. WVADSXVORTH, HAROLD V NVILSON, JAMES W. WOOD, WILLIAM M. WORKS, LAWRENCE P. ZELONKY, BEN ZEMBROSKY, AEE L. ZIMMERMAN, FRED E. I I I I ...II.III..I.mIII.Im.I I IIIII .I IIIiIIilEIIIII1IiiIiiKiiIiInIInInImInIIIIImIIIIIIIIIITIIIIITIIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIImmmIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIII-IIIIIIIIIIIIIIIIIIIIEIIIIIYIQRIIGEEIIIIIIIIITIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIII Page 174 sr ' ' I I IIII I Che Regimental Band LIEUT. LEE C. HERWIG, Commanding HERBERT A. STOLTE, First Sergeant Sergeants NVILHELM, NVARD H. WOODHOUSE, IRVING Drum Major BONVMAN, HAROLD F. Comets BERCEN, JAMES M. MORLAN, LENVIS M. BERGMAN, ALFRED E. NANRIVIL, RICHARD M. BOWMAN, HAROLD F. RIEIQ, FOREST O. DEWIRE, DONALD S. SOLBERC, CLARENCE M. FOOTE, PERRY A. SPEAR, MARVIN S. HENDRA, CHRISTOPHER STOLTE, HERBERT A. JOHNSTON, XVILLARD A. THOMPSON, GEORGE T. IQERXVIN, JOSEPH j. 'IP-IOFLAT, GERALD B. LAMONT, DALLAS A. VAN SANT, FRANKLIN A Clarinets BERO, PAUL I. BURDICK, SYLVESTER O. DREWS, HAROLD M. JACKSON, MORRIS D. MELHAM, ARNOLD G. SUMNER, XVILLARD G. HOXVLAND, GERALD B. Trornbones BOLLINCER, PAUL E. SANDERS, PAUL P, HIRSIO, HERRON A. SIDIE, STANLEY R. RUKA, j. P. XVEGNER, .JAMES H. French Horns BENNETT, DONALD M. WARNER, W. E. CONGDON, C. C. WOODHOUSE, IRVING Mellophones WILHELM, WARD H. Baritones ERICKSON, CYRIL L. IIIIIIIIIIIIII II-IIIIIIIIIIIIIIIIIIIIIIIIII W I I I ummImmInInImInInIInInIInIIIIIIIIIIIIIII-IIIIIIIIIIII Tubas PAYNTER, S. j. VAN DE REPE, ABRAHAM C Saxaphones ALLDS, HALLIE L. LAYCOCK, RUSSELL D. Snare Drum CLARK, LLOYD S. FROST, RUSSELL E. CHAPMAN, HOMER D. KREPS, JAMES T. Bass Drum HINTZ, ELMER M. Kettle Drum VANDERBIE, ROBERT Page 175 II I I I III II IIII III IIIIIII III I III I III II II II II Cpersonnel Detachment LIEUT. RUSSELL C. KURTZ, Commanding Cadet Non-Commissioned Officers HARLOW H. PHASE, . . First Sergeant BALDWIN, WILLIAM S. BOGCESS, RALPH V. BONDI, EDWIN W. BURGY, JACOB H. CASEY, JAMES M. CHAFFEE, PERCIVAL V. CRAINE, EARL E. EDWARDS, LEROY E. EDWARDS, RAYMOND D. ELLINGSON, ARVIN B. FROHBACH, HAROLD O, GIERACH, RAY J. GOTTSCHALK, JOHN B. HARDINC, RAYMOND O. JACKSON, AMOS H. KATTE, MARTIN KATZENSTEIN, HENRY B. KLOTSCH, HARVEY W. KREMERS, GERHARD R. II.II..IIIIIIII..II.II.III.IIIIIIIIIIIIIIIIIIIIM II IIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III Page 176 Privates MABIE, EDMUND MAUTZ, BERNHARD M. MORGAN, CHARLES J. NEUMAN, ROBERT NODURFT, JOSEPH R. NUEBERGER, CHARLES READ, HARRY S. REIDER, GLENN L. SCI-IULTZ, ERIC J. SCHWENKER, HARRY E SCHENCK, EDWIN W. SINEGUB, JACOB J. STILES, RALPH D. STRATHEARN, FREDERICK D STEINSBERCER, FREDERICK WERNIG, CHARLES XVERRBACH, ARCHIE J. WITTENBERG, HAROLD W ZELLER, DELVIGNE R. I I Cfxfilitary Police Company Officers LIEUT. EZEKIEL S. EPSTEIN, Commanding LIEUT. FREDERICK L. TICKNOR LIEUT. ROBERT E. XVELLBORN Cadet Non-Commissioned Officers IRVING GOLDBERC . BUNGE, GEORGE C. HAMMOND, LORING T. LENZ, HERBERT S. IVIANN, BERTHOLD C. BROTHERS, XVELLINGTON EKLUND, OSCAR A. LANKA, LEO A. ANDERSON, BRADY M. BARR, WALLACE A. BLATTER, ERWIN W. BOERNER, ROBERT L. BRADER, JAMES L. BRANDT, GEORGE S. BRUMM, ROMAN H. BYBUTH, ENGVALD O. COMEY, FRANK A. DESWARTE, LAWRENCE C. EDWARDS, CHARLES A. FRANKLIN, NATHAN GOSPIAW, HAROLD D. GRAY, FRANK W. HAASCH, CLARENCE HALL, LAURENCE W. HANSON, FREDERICK R. HIECKE, WILLIAM A. HOGSETH, HELMER JACK, JAMES A. JANKOVIAH, ANTON J. JILBERT, EDWIN H. JUNG, CLARENCE S. KLENERT, WILLIAM W. KOLLATH, ALVIN KURANZ, ALFRED L. LIUM, JOHN L. ' MARGOLES, HARRY IIIIIIIIIITIIIITIII .II I .. . IIIIIIIIIIIIIIIII.IWMI...I...I.,II.II..I.. P a g e 1 7 7 . First Sergean! Sergeanls SWEENEY, HARRY L. CITIPPLE, ERXVIN R. WPIITE, CECIL E. NVILLETT, ALFRED E. Corporals MCDONALD, EDWARD M. MEYERS, BERNARD E. USHER, EDISON H. Privates MARSHALL, SAMUEL H. MARTENS, ARMIN G. MAYHEW, ANSON B. MOSS, WALTER K. MUEGGE, WALTER H. MUELLER, GUSTAVE G. NORMAN, BYRON E. PETERMAN, IVAN H, POLZIN, ALBERT L. Y POWELL, ROBERT B. RANKIN, EUGENE J. REICHENBAUM, DORE ROSENOW, HENRY J. SECEL, JOE SHAUCHNESSY, RODNEH' J SOLBRAA, BURNEY A. SPETZ, RALPH F. STERNLIEB, HYMAN A. STROHECKER, WARREN D SUNDT, GUISERD M. TERRY, EUGENE J. VALKER, CLARENCE A. VIERGUTZ, FREDERICK H. WEST, JOHN C. WILKE, MARVIN F. WILLOGROD, GEORGE E. WOLTER, ELMER A. XVREND, BEN I I Wisconsin Section Chemical Warfare Service TOP ROW-Eyster, Meek, Jacobson, Schneiders, Malone, Nesbit, Johnson, Coleman, Eldridge, lnnis, Coodrich, Leake Khorozian, Haas, Bauer, Hedgespcth, Axlcy, W. O. Davis, Whitmer. SECOND Row-Burton, Richdorf, Schlornovitz, Paltz, Hippie, Clarke, McConl-tey, Maver, Hoffman, Otis, Young, Ambcrg, Marsh, Littel, Grady, Bunting, A. G. Davis. THIRD Row-Bentine, Dennis, Cole, Citelson, Hilbert, Trachman, Green, Watson, Tilleman, Pleasants, Serles, Knight Bender, Heakin, Hart. The University of Wisconsin Section ofthe Chemical Warfare Service is a branch of the Medical Division, and has been concerned with a study of the effects produced by poison gases used in warfare, methods Of protection against them and treatment of conditions arising from exposure to them. The Section consisted during the height of its activity of eight commissioned officers, thirty-two non-commissioned olicicers and enlisted men, and twenty civilians. A total Of about seventy reports dealing with various phases ofthe work have been submitted to the Director of the Chemical Warfare Service since the establishment of the Section in July 1918. Most ofthe military and civilian personnel were discharged following the orders for demobilization during the morth Of December. MAJORJ. A. E. EYSTER, M. C., U. S. A. Officers MAJOR J. A. E. EYSTER, M. C., U. S. A., Officer in Charge MAJOR W. J. MEEK, C. W. S., U. S. A. ZND LIEUT. J. Y. MALONE, C. W. S., U. S. A. lsr LIEUT. V. C. JACOBSON, M. C., U. S. A. ZND LIEUT. E. F. SCHNEIDERS, C. W. S., U. S. A. ZND LIEUT. L. E. BURTON, C. W. S., U. S. A. ZND LIEUT. L. F. RICHDORF, C. W. S., U. S. A. Enlisted Personnel HEAKIN, N. W. . ........... Sgt. lst Class, M. C. LEAKE, C. D. .......... Sgt. lst Class, C. W. S. BENTINE, E. J. .... . Sgt. C. W. S. BENDER, F G ........ Corp. C. XV. S. DENNIS, J. L. .... . Sgt. C. W. S. COLEMAN, J. J ........ Corp. M. C. HAAS, A. C. . . Sgt. C. W. S. HART, M. E. . . . Corp. C. W. S INNIS, A. H. . . Sgt. C. W. S. NESBIT, R. O. . . Corp. C. W. S WI-IITMER, R. G. . . Sgt. C. W. S. WOOLLEY, J. R. . . Corp. C. W. S Privates, Ist Class, C. W. S. ELDRIDGE, J. M. CITELSON, M. L. HEDGESPETH, R. H. JOHNSON, B. L. PLEASANTS, W. H. SERLES, E. R. AXLEY, HAROLD DAVIS, A. G. DAVIS, W. O. BAUER, R. O. COODRICII, G. W. Privates, C. W. S. HILEERT, P. E. KNIGHT, D. K. Private, M. C. COLE, A. E. Civilian Personnel KHOROZIAN, C. G. TRACHMAN, H. I. DR. S. AMBERC FRANK GRADY EDWARD T. OTIS DR. C. H. BUNTING WALTER E. GREEN WILLIAM PALTZ DR. P. F. CLARKE J. S. HIPPLE J. F. TILLEMAN DR. B. H. SCHLOMOVITZ HUBERT LITTEL ALLAN S. WATSON Miss CLARE B. HOFFMAN HARRY G. MARSH C. J. WEBER Miss MARY E. MAVER Miss DOROTHY E. REID Miss ANNA Wi-IELAN FRED W. MCCONI-:EY mill.. ii.i ii....iw.i..i..w.i..i...i, IIiiIiiiinI.iiinIiiIiiiiiEimniviiiiiMEMililiiiiiliiiiiiillii Page178 WILLIAM YOUNG : :as if - 12 .5 . 5' m..ww..m.w .,,.. ,,H,...,...U.,,.H,..,,H,.M.HL..X.N..H..,,,.,m..,,.... ..,. ,-X.H,.HH.,W.WX..,..,,..,myV..umU4,...X...V..X,H,.UWL..W.UrmWX..XmlH.K..,V..nnN.1N..,myX.HH.,W,...,H,X......WH,,.U...M,,V..,..,H.N.NX..,,..,mlH.N.U1f.,V..,...,.H,..X.HV,HV..w.H.H..m.mw..fm,..XW,...,N,y.XW.y..,1.4H.H..W,,...Hmm,m...,.W.Wfm..mm..v..w4yHW,HW.N.W,Hy11.N.,XH.XK..,y.,V..,1.1,1.1X..,H.,.HH.X,..XV.,XmmumV..W,....Hmmm.w,..m.H..,1.,,.HL.,Xvw..m.,,.,,.m..!..W5 55 E 2 S 5 E35 512 EE 555 RE? W...mmm ummuum E35 E25 E25 gag Sze E 2,1 el: 11: aaa 312 Q......,,...,..,,.U...,.M,..H.,,,.,H.,..,,..,.U,H,,..,......nm..,,..K..,,..H.,...,.H,.H...,..,..,,..rf...,....XV..,...U....4,.,,.,,..,.W,..,.Hy..,...,N,..,,.,f..W,,H..,...H.,,.,,..,...V..,,.,,..,H.U.H.....,...K..H.,,.,,.H.,.,V.,,H,.....,W.W,.1,..m.H.u..,....,....W..,K.,N,.,m,...y..,K.,,MH.,.W,..,,..,,.,...,,,.H.,,.,,W,..,,.W,,......,,.,...,WQ..,.,...,,..U.,,..,...,..,WM...,,H,H....W1NU.,..,KH,.mu...M.,..,mu..N..H.,,..H.,H,,..,U.,...H,,H.H.,.,.,..,,....,,...,..,,.,.WH.......m..,,,,,,,,..,.,ma 5 2 ... u.,,..m.,,,.,,,..,....,.,,..,....W..w,H.A...,..H.....,,..m..,..,...W...1,..H.1...1..n..,,m.,u.,...w...,.n...k.mm.,n.1H.mm,.,am.H.n..,,.......m..H.,,..w...m..,....H.,,W.,..,..1..m..,,,,..,,..,..,,..,..,,.,,...,,.,..,,.w.,..,.,.u.,,,.,..,.,.,,.U,.,...K..,,.,,W...,.,,m.,...,.,..,,,..,,.,.....,.....,.M.,.,.W..,,.,...u.,,..,.K.,.,,.,.H..,K.,U.M.,,..,....,.....1...H.,......,......n..,K..,H,.NM.,.,,.....,,....W,m.....u...,.,m...u......n.,,,.m.,..,..,W...,m..M.,.H.m....,,.,,,,,,.W...na..uE I Page 179 m ...rK..mr.W.1rrn1HH.rH.1Y.,rV.,V..rU.1ur1V.1.m..1urH.rInmrV..r.U.Ur.Nmr.Hr.1rHrr..rV.,rHrWV..rrnmrH,um.mm..mm.H.Im1ru1.H.m.mm.m..w.,r.mm.mmWmW...wrK.-rmwwmm,Wmn,mm,mmmmfnm..um..Wm.um..mm.m...m..r..W.w..mW..mm.mm.Wrw..wmmw...mr..Wmrm...rmm,mmWWmrpmWmmm,.mm,mmvm..um..mm..,.m.mm.1mrV..rWrWrHH..r.HrHrV..r..mm.ww..r..m..rmm.mww..mmW 55-........,.mK.,V..rmr.frm11.1WU.1r..m.U.,V.,r......rH1V.,r..rH.H.H.Yr..,U.r,Hr.HK..rHrmv..r,..1.HWU.,V..1.NN..rK..W1mr.HrV.r,Hr..r..rmmrrV.rWV..rr.HurMr,HrHr...r..rrnr..rH.,..rnrrV..nrr.Nr..rnrr..rWrr.rWr..rWr.HN.rW...rr.,r..1r..r.HW.H1,HH.1.H11.r.Hr..,...rV.rrUrr..r.1rH.r..WWWrHr,N1..1V.,r..1mr...r..r.HN,rV.rV.,r..r..rK..rHr..r,..rurV..rrnr..r.MV..rV..H.r,.r,..V..r.Ur..rr..r..rr..rWV..r...H.rry.1y.1,..r,.1rm.Mr..rH.r.HN.HH.r.Hrr.rH.rK.,rW.r.UrV.N.HrV..r.MrN.UW-.r..r,..m,5' Government Inspection Cadet Corps, 1918 Prexy Awards Commxsslons IMII55M332mg,3355Im31333335312r135,mmfM3if3M3.3,,W3353M52I.EmI553mr35:3M,55M1.5315.325I35Tx..,..,...,,.,,..,W......r..,,..,..,..,,..,N.,..,,..,,.,r...,..r..r,,.,..,.,.,W.,V,,,wr,..,W..r...W..rK..rV.,,..,..rr..,..r...r..rum.,,.,,,.,...,...M.,,..,.W,,,.,mf..,..,,.W,,..,.W.r..,.nwrr.,W.,rL..,nm.,r..W...,.,W.,,,H,..r...,,.,mm.,mmr.,..,...Mrnr.ur...r..,rur...r1.1rmr..rr..r...,..rH.,,.,,..,,,.,W...H.,,M..H.,...,..,r,.r...u..w.,,E55 I L,,,L,,,k,,,,,,i,, II I II I II I I I . . .,,..,..,.,,,.,,...,..,..,.....,. ...,,.,,,.,.,.,,.....,,.,,..,..... ..,..,,..,...,,..,..,,........,....,.,,..,. . ,.... ......,,.....,,,..., , .,...,...,..,..,,.,,..,,,,.4,,....,..,r,..,.,...,,.....,...,.,,,..,.,...,.......,..,....,.,...,.. . .,,.,,..,..,... . ....,..,,,,...,,... . . ....- ......... ..,... ,... , ...,..,.,,,. , U.- ..,. ,,,-,-M,.,,,....-..-.e.....: , , .,,, .,,,,,,...,..,,..,,,..,,.,.,.,.. . , ,...,,..,,.,,...,..,,.,,.,, .,..,,..,,..,,.,,...,.,,..,,,.,,.,,..,...,..,.,,,.,,.,,,.,,..,...,.,...,..,r,,.,,,.,..,,..,,, , ...,..,,..,.,,,,.,,..r..r,..,,..,,.,,..,..,,.,,..,.,.,..,,..,..,..,,..,,.,,..,,,.,..,,.,,..,,,.,..,..,,..,,.,,..,...,..,...,..,,.,,..,,.,,..,K..,.,,..,,.,,,.,,..,..,,,,,,.,,.,,...,...,.,......,.,.,,.,U....H.,,...,.....,...,,.,,..,.....,,.....,....,.,,..,,..,,.,..,...M..,.....,.,.,,,,,,.,,..,,.,,,.,,..,.,,,,.,..,r.,,,..,,,.,,,,,,. n,.,..,.,.. ,,.,,,,.,.,.,..,,,,,,..,.,,,,,,,r.,,,.,,,......,. . , , F Page 180 1-.. 222 gg: QW555535355353335my55:3551mf5.5w1511mnn1.1wmw1HwIn1fu1mnl1in1InwHUInX.4lm1pnfnwfmnl1HwunInwWwmwL.w1vumwmwmfuHHww.11fnwInmwwHwInwm1mmwmwIn1InWnWInWuWWvuW1mlIn1vu1n1m1m1mMwIn1ulwvu1.11vuwwmummw.11uv1u1u11-IwrHwruwu1w1rmm11-um1In1uv1111In11.w1mN1.winwlm-I1X-11m11.1Xmm1In111wIn1ny1mulwX1.1m11.1,H4mmmfmmmmuwfuwyuXIn1u1w1.11.11Inmmwmm-mmH-1InN11XinwmwInH11fmu,1nu1Huuv1ynuH1uf1In1umm-mmwuwmm 552.11.11.111M1.H,..,,..11..11.11My1L.11.Nmy1.11V..1H11..11H11..11H,..W.HK..1..1,nm..W1.H1NV.44V..1W1.H1..1m1V..11.11.HU.WH1.H11.11.f11..1N,,.H1L.11.HU.1H.1W1..1w.HV..1V.,,1.1H.1X-11-1.1L.11.H.-My-.H.u..w.HH11.,,V..1.Hvm1U11.11H1N111.41H41in,V.1In,H11..11.11m,.H11.11.41.MN1.N1..XV.,X1.,H11W1H1NU,1..,.MX.H,H11..1X..XW1.U1.M1.XX...,H,NHNIy.1H41.MV..11.11WN.HH.w.um..,,..mwwH11H1.U1.HV.,1WN..N1W,H1H11WW11.4N.U1.111..1W1WX..1MN,H1.M1H1V.11H1H.1mN.H,m.m..W.....w.E 55 af..,,..,.N...,,..,.N.H,..,,..,,..,,..,,...,.,.H,V..,.H,..,.H..,X,HW..W..,,y.X.HX..,V.XK..,..H..W...,..,..,,H,H....,...H.,.,,.H,...K..U.,V.,,......,..1...H.,H,..,,.,,,..WK.WLH,..mn.1,..,,.W,.,,.HH,,..WH.,,.,L.,W..H.,H.,.HX..,K..,.H...,.HH...H...,...mu.,,..,W,K.,K.,X...,U,...Km,WX,WH.unK.,,H,,.y,,mm.HW.,,..N,.,,y.,,..,.HNH,K.,..,..HV.,WX,.H..,.1X...H.,U.,mu.N.,...m.,...,,.M,.,.H.,,..,,.....,K.,,..,...M.,.1...1...,,....H,.,,,..,.,,,.....,...y..,..,,..,H,..,,XH,...M.....,..H,H,m...,,.,,.,.,.w,i if 1nu-n1wInmlmy1ummwnwnumvmmmmmulmmmm.:ummmwI.1wn11.w1nin1IndUEnml.lMuEEmHAIEL4EmQlIElIiiiIEulummmmummmmmmmihnmumuunnwwI1wmfninwmmmmnmnummummmummmummmnnnnmummmmummmummmummmummmummmmumuwmmmHummmummmummmmummlmuumummmummmmmmmwunmummmInummm-X51GiQIFGIREMZTEEEIIFWEGQIGEYFIMIEIRIEIIEIEEH. Page 181 .., -I: 1- i.,.,.,.,,., ,.n. un.. ..., K.. ..., nm .,,...,.,.. HW.H.H.,.H,,.u.m.4...,,Hnu..m..,.,,..,,..,.m.....,.,..K., ,,., ..,, K.., ..H..,..,..n,..,,,,..,,.., ,..... H., ,l..,. M.....,...u..,..,..m.,,. .,...ll., ,. .,... .. .,l.... . ,l..,. ..,.,m,,m l.., . .,1, .,..1,..,..,l ..,. .1H.,...,I.,H.,W...,..,,.,H....,,...,.,mm.....,..,,......,...f....,. ...,. ,nn..,...,H.,..,.......,HQ.,ywg.w5,5,.5.w.,,:,w5,,wgE,,.555w,W..,,,.,.....nWH.,,H...mm...K..,..n..,.. ,..., W... ....... m.,.....,,HM...H.,,.W.,l..m....w..,,.,.,,..,.5 E, ,,.,,, N ,,.4,, -,,,,,,,v,,.M,,,,,.4, gughgnfhm -,,,!,,,,,,. ,,,4.v..,v,,V,44,,,,,,44 R A V,vnnlnunVnnn,A,,V.,,,IA,-,4,-'!..-...! nlbn ,QInVI,V3MW,,mmI,ffI:I:H1,55Eg5,5,EE,,,HE,ww1,mm,,,, .,,.,...,.., E.. ,..,,.,,,.,,.,...,.. , ,..,...,......,..,,........,... , ,.,,,,,,.1,..,l.,...,... n,......1,.,,..,, . ,....,..... , ..,,. . ,., .,.. ,. ..K...,.4.,. ...,,.....,... ,,,.,,,,.., W. ..,,, W. ,,..,,,...,..,.,,,,.,,,...,.,.,.,. .. l,,... W. .n,,, .W .....,. M .,..,,.u.n , ,... m.W.u. ,u1... ,m,..W.,u,..,......n....s,g nnmwmnnnummnwnumwnwmmmnumnwummmummuummm1mmm:wnmummwuumwumxummmwnumwmmm:ummmummm:umuwummmmznnummvnumuummmxnummummmwuiulwilxrixvinhlwiilwlulwiivInHzivElMInQI:i1Ini1Mini?inuiw:HMIIYIFMUIIIIHIIYIIISimiUIQIIEIITIIIEIQQIPIHIHYHQIHIIImillHHEWHGIFEEIIX5HEFifMCIIHIIEGIEIEIIIIIYQIEEEILHKQEEH5iGFilliiEiEEE:TfziEEEHnnuu1fHFlGhllIilmunmru1fIfEmYvE P Cl g e I S Z gm.mmU.....,H.M.,WWW,yn1...Y.HYWK.f1V.,um.1,K..,...V.H,..,,.HH.,.UW...,H.,1.1H.,,W.NY,..WN.1.HmlMmH...H,...,.H,.U,.H,.H,..1H.W1H,,..,H,XV.W,V.,,f.W.mV.,Wvm...mmv..1,H1H.1V..H.,1.1XXH,.U,mV..XWX..XX.MW,W,..,V..N.,NHH,,H1,..1...4H.,.MH.,H,1..1X..1W,1.,H.,HHH,VH,,H,.HH.M.,1.4,..,,H,..,,HH.,,..,,y.,H.,.HV..,,Hmm,HH.,M1.,m,WV..,,.,.mmH,WmyH.,V.WMVW.,nnW...nm...U.H.W,H.,.vmH.mm.mmIum.1.1,,.Hm1mml..4,...1.w.m.mmg 5gm.,W.,.,H.y...M..,y.,,.H,..,,..,..,Y..,y..,...rm,,..,..,....,..,H.,..,,...,.,,.M.N..,,,.,........,.,,......V,..Y,.....VY,.,um.,...vu,,..,,..,,..,,..,..,,..,,.,,..,,...,..,,.,...Y,,,Y...Y..,,,..,,.H...,,,,,....,,,.....H.,,,,.,,.1,.H,.H,..1,..,..,N.,,..,..1H.,..,...,...,..,y.,N.,,..,.,.,W..,,..,.,,,..,..,W..H.,..,..,,,.,...,.m..,,.,,..,,H,,..,...,..,,.,W..H.H..,..,,,H,..,N.U.,H.,,.,N.,W,.W.,...my,..,W,,..,W,..,,..,H.,,..W.,...,..,..,H.,.H,..,,..,...H.N..,....,.N.,,..M.,U.N.,,...u.,...,..,.....w.,...,......5g5 5 : s g E si 1 : 5 E 5 E 5 S 5 2 s 2 2 f E ss? E gg Ei 5 E 1 5 5 5 E si E E E E E E 5 E E 1 2 E as 5 g 5 5 s E EE S25 E52 E55 51- 552 Ei- zis as E22 I 2 Ii, SE E55 EEE 522 as Sai iii :fr :as gig Ex: :za l- E wwwwwwmy1:1fuW.1Wmf-.1XinmumInInH-1..1in11.4rnnn1-11H1Infm1.11.HWN.unL..1H,K..H.,V...mL..fm1.H.HU.1In1mWU.Xyn1-11.HU.1.Hml1-4InVH1.11InH1umm.HH.1fuV..wmL..nmH1H-1.Hm11.1W1-111H1H11H11.,XHX1-N1.11m1mmK..1m1mH4V..1.HrmulWlmvmH.1WV.,N.HmXH1u11HvmH.,1.1fm,HN1.umHmlnm....1V-.11fm1,WWm.mmu..muK..mm..m.,mmvu-..,..n..m.w..4v.m......mm....m.,....mu....m....,m...m-. I E ' : "'-"'- -'-- 'E .4 ...4..1...H.,YN...N...D...........,.,......u......K...........l.n.m...K..,.,....mm.m.....,V....n.,,.m..1m.m,...mfm..w.....,..i P a g e I 8 3 1 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 L 111111 1111111111111111111111111 1 1111111111111111111 11111111111111111111 11111 1 111 11 .11111111111111111111111111111111111111111111111111111 1 111 1 1111 111111111111111111111111111111111111111111111EZ- 573115112GIGill251511115E1315515GLIEQTIIGIEIELIIJ115111IIS1111111Gi11111111155121121515E11FEGZQIEFIIEQIEIGiiIIIIIIEIIREIEIEIEIHQQI15111111112211211QiiiillIIIGLEGEZIEZIRISJillEi!Killiii?lil1111212111iii1215111iiiPIZRIRIIIHIIEISILE111111111111111111111111111111111111111111111111111111111111 11 1 1 1 11111 1 1 1111111111 1 11 11 111111 1111111 1 1 1 1 1 1 1 1 1111 11111111 1 11111 1 ,: ii 51.111111111111111111111111111.11111111.11.111.1111111111.111.111.11111111111111111111111111.111.11.11.111111.11111111111111111111111111111.111.111111111.1111111.11.11.1111.11.111111.111111.111.111111.11.111111111111111111111111.111111.11111111111111111.11.1111111.11.1111111.11.1111111.111111.1.1111.11.111111.111111111111.1111111111.11.1111111.11111.111.11.111111111.1111111.11.111.111111111.11111111111111111111.1111111111111111111.111.111111111111111111111111.11111111111111111111.1111111111111111111111111111111 1111111 11111 1 111111111111 1111111111111111111111111111111111111111111111111111111 11111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 1111111111111111111111111111 111111111111111111111111 11111111 11111111111111111111111 1 1111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111 11111111111111111 1 Page 184 .. ,...,:....m X.. ,.....,,..,,:A,mmm I b wid r r r i - ...,. ...-... I ......... ..... -. ..... N. ,..,. .,....... The Marines By Ll. Waller W. Muller, U. S. Nl. C. HE Marine Section of the University of Wisconsin was at nrst termed an experiment, but as the weeks went by, the men began to show real signs of that spirit and snappiness which makes for a successful military unit, The spirit of the Marines at the University was the same as would be found aboard ships, or in France. They were f always there to do the job, with the material at hand, and never coming back until it was Finished. In athletics the Marines came out with seven "W's". This in itself proves a theory that a Marine never comes back until he has accomplished his mission. The lvlarine Corps says to its men very much the same as the ancient Spartan mothers said to their sons: "lf you go into battle and lose, never come home, for there will be no home." , Translating this literally we get exactly what is told us in an "Unwritten General Order." This indescribable something called lvfarine Spirit is no other than that which won Belleau Wood and caused its name to be changed and go down in history as Bois de la Marine. lt is the same that won Chateau Thierry in the fifty-ninth minute of the last hour. This same "esprit de corps" was in the heart of every man in the Marine Section, and if he had been given a chance in France or Siberia, he would have made the Badger University proud of his name. LT. WALTER W. fNflUl,TER IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIII IIIII II II II IIIIII III IIIIIIIIIIIIIIIIIIII IIIII III II II IIII II II II IIIII IIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII II IIIIII I II IIIII IIIIIII II II IIIII IIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIII iw N..,,vv,, - l-,l! N -l.,.l , ,,4A,4 ,,4,, I II IIIIIII III II IIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIII IIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II III II IIIIII II IIIIII IIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIL El? 'Ei QI? EI El I , 55 EEE as iii SE Eli E ii: I l E Qle The Marines :fs sie ,V - LI, . ,I- . I .V Ei -- El: if I I :IE I sl: :,: I -., , I TOP Row-Kiel, Becker, Klug, Maack, Nelson Coleman, Pabst, Harley, LOOmis, Claxvson, Mayhew, Koehler. SECOND Row-Johnson, A. D., DeYoung, Morrissey, Evenson, Jellerna, Whicnall, Sabin, Leaper, Donaghey, Bieloxv. ' Rove, Moody, Zander. THIRD ROW-Baker, Christianson, Granberg, Krez, Mathison, Kesten, Cook, Groves, Greenberg, Lyons, Kucheman, Noble, Gotfredson. FOURTH Row-Spafford, Sheldon, Mansfield, Hirsheimer, Widmer, Blum, Margoles, Johnson, A. L., Trier, Keeley, Quarberg, Powers, Thibert. Ramsay, Dexter. The Marines LIEUT. WALTER W. MULTER, Commanding Non-Commissioned Officers SGT. WILLIAM M. YOUNG, U, S. M. C. , SCT. FRANK HOPKINS, U, S, M, C. fprivates I BIELOW, MARTIN P. BLUM, GEORGE L. BROGAN, JOHN J. CHRISTIANSON, CARL B. COLEMAN, PAUL J. DEXTER, STEPHEN T. DONAGHEY, JAMES B. ELLIOTT, JAMES R. GOTFREDSON, ROY C. BAKER, BURTON C. BECKER, ROLAND H. CLAWSON, DONALD G. COOK, BENJAMIN F. DEYOUNG, AUDLEY M. DREW, EVERETT G. GRANBERG, HENRY S. GROvEs, HAROLD M. HARLEY, HERMAN K, HIRSHEIMER, EARL S. JOHNSON, ALFRED L. KESTEN, PAUL W, KREZ, FREDERICK W. KUCHEMAN, NORMAN A, LEAPER, WESLEY S. LOOMIS, PORTER L. LYONS, GEORGE B. MAACK, ALFRED H, MANSFIELD, HERBERT S. MATHISON, LEON J. NELSON, GEORGE F. NOBLE, HENRY H. PABST, FREDERICK A. PADDOCK, JOHN M. Privates on Special Duty with Marines EvENsON, CHARLES R. GREENBERG, JAMES E. HODSON, ELLIOTT W. JELLEMA, CHARLES JOHNSON, ALBERT D. KEELEY, LAWRENCE C. KIEL, WILLIAM KLUG, LYLAS P. KOEHLER, WALTER B. MAROOLES, HARRY MARKLEY, PAUL L. MAYHEW, LESTER O, PONVERS, PATRICK G. A QUARBERG, LINCOLN RAMSAY, WAYNE. SABIN, DEWEY J, SHELDON, JACK G. THIBERT, FRANCIS V. TRIER, CELESTIN J, WI DMER, ROBERT J, MCINTOSH, C. W. MOODY, 'FREDERICK A MORRISSEY, JOHN F. ROVE, OLAF N. SPAFEORD, ALLEN WHITNALL, GEORGE D- ZANDER, KARL L. I JIQIIIQIIIIIIQII III II IIII II IIIIIIII IIII II IIIIIIIIIIIIIIIII IIIII II III IIIIIII I III III I IIIIIII III IIII I IIIIIIIIIIIIIIIIIIIIIIIII IIIII III II III IIII II III III III III IIII IIIIIIIIIIIII II IIIIIIIIIIIIIIII III IIIIIIIIIII IIIIIIIIIII II II III IIIII I I II I III IIIIIIIIIIIIIIIII II III III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIQ IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIII III III IIII III IIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII' Page 187 ' ' I , Domgs of fhe Devil Dogs For three months the embryo "Teufel I-lunden" lived a checkered non-combatant. if 4' Career. Expecting eventual action overseas, they were as "hard-boiled" as a Marine , is expected to be, but the ups and downs ol S. A. T. C. kept tht Marine Camp in con- ' stant turmoil. - -is- Y N 55 X I. , I , ,y 3 -1 jf:-3, vi .11 Q I , 4 1 7 ,, .. ' l Peet , rv H-1:4 5 I ,.. 153' gf . gist ,. I, rs: as e ' . , -H NW :"x N. " -fi ' ' sf- "ef:-"W , if -1- 4 . M it, -:af CQ - It A ,f ll! A . . ,V . . ' 'sf I xx ,wi 1 - ,:w ':L - ! X s q 'WEVX H In "CARRY ON, MENP' -,149 REVEILLE-10 A. M. W. h h. k ,f ' , f .a.4..4.4-I unifqlfm gli Iffiogrfip f' 4 ' 5 - f l There was no bugler in the Marine Camp, felt himsclfgqual 9' ,A and the sleepy birds were awakened in this to any shavetail Y ' n 'W m21DUCI'- . lieutenant and f P -1 F F Q s he always rated X my i X 0 ff A-. a salute, which 1 N 5 Q0 A -i ,ff he promptly ', f' 795944 :iff receipted. 4 if X 'X N , fqtfx . . .4 S4 1 Nl , X 'gy W fi ' AN- in I X 1, K W5 N. f wi T ' f -' M 'I ' l F N -5 Q pt if X ,Y X X 5.1 K M A .Q SL x l ' I, U W Q 0 ' W " fi . 'Fw fr , . A 3- 14' 4 li T P at -- 'nf I . v . v I.. SHIFT QUARTERS! Ali! I , ' XJ' A . . ' N , Orders to move barrix were issued and carried ' , I 1 :3 X v out no less than I7 times A Marine did not rate A ,Ll .-ws' - o trciclc service 7555" Q CHECKING IN W, 4 .iff Given Z4 hours to 35 ' 4: hand in clothing on the is ' eve oidischarge. Every N ' barrel in kgadisor was A "X, - u' tone 4- t'1 many V J glqtli? iiounds jvere con- " - s , ' W fined to quartqers pendi 5 NS., if. 4 ing arrivalo t e"civies 5 I i O NA ff, from home. - up 3 Fi i fe .M 2-.L-.z 'ii f ' , , . . . . Q 1 , 1 'S , , .QX I . A f vpgaq I.. 5 N - 'ffm ' 'Q ! 5 if ' x -ew:--Q -- Zkom 4 l,, . Q K. f - '- 2 I. ' see ,gs--e , ffvflflarky 20 A TYPICAL SESSION Between drill hours and when the call oi classes was buried in an atmosphere of smoke and bunk i Hiiiiiniiuimi.iimi..i..ii.ii..ii.immm iiii.iiiiiiiniiiiiIiiIiiiiiiiiiiiiiiiiiiiiiiiiiiiiii Page 188 Uoblilidmef U.5.VI. . X C Apprentice Seamen Company I TOP Row-Klann, Bertelson, Hedstrom, Grimshaw, Friday, Ourada, Engler, Evans, Lamb, Fuchs. SECOND Row-Borgers, Christcnson, Kaufman, Colony, Warnecke, Hanson, L. F., Gerhardt, Black, Coomber, Barry Lee, Koebl-ce, McDonell, Beck. THIRD Row-Daniels, Kerler, Bowman, Jourdan, Amundson, B. C., Dale, Johnson, E. D., Glaettli, Johnson, O. E. Brand, Langer, Hanson, C. F., Ives, Johnson,J. B., Bellack. FOURTH Row-Terry, Dorsey, Luce, Dawley, Evans, Clarl-c, Gibson, Horne, Ede, K. L., Cruger, Hanson, E. P. Kidder, Johnson, A. W., Cunningham, Lamboley. FIFTH Row-Gladden, Cooper. Larsen, B. M., Donnelley, Kirst, Brown, H. H., Hartzell, Edwards, Bartholomew Goddard, Grota, Anderson, Mantonya, Amundson, E. W., Sickert. Ojicers Navy Detachment IVAN C. MIX, Ensign, U. S. N. R. F., Commanding CHARLES H. WEAVER, Chief Yeoman U. S. N. HENRY ALBRECHT, Chief Master at Arms U. S. N. WILLIAM E. STRASBURG, Boatswain's Mate U. S. N. ADRIAN L. IDANITWERS, Cadet Commander of Navy Section Company I Cadet Ojllcers Company Commander . . . . . . . . ALVIN R. KLAXN Section Chief . . . . OTTO L. SICKERT . HENRY F. GRISNVOLD Company Clerk . ........ . AMUNDSON, B. C. AMUNDSON, E. W. ANDERSON, P. M. BARRY, L. G. EARTH, K. P. BARTHOLOMEW, J. F BECK, H. H. BELLACK, W. B. BERGMAN, M. J. BERTELSON, B. J. BLACK, R. R. BRAND, R. B. BROWN, F. H. BROWN, H. H. BoRcERs, N. D. BOWMAN, P. G. BOYNTON, N. R. BRYAN, R. BRITZMAN, H. C. CAHILL, E. G. CHRISTENSON, A. CLARK, R. C. COLONY, M. P. COOMBER, H. M. COOPER, A. W. CRUCER, H. J. CUNNINGHAM, E. S. DALE, N. C. DANIELS, W. E. DAWLEY, D. E. DONNELLY, D. W. DORSEY, G. A. Dosci-I, E. L. EDE, K. L. EDWARDS, A. W. ENGLER, H. F. EVANS, G. D. FRIDAY, F. J. FUCHS, W. T. GEHLER, H. F. GERHARDT, A. P. GLAETTLI, HERBERT GLADDEN, A. H. GIBSON, E. H. GODDARD, M. B. GRIMSHAW, R. B. CJROT.-X, B. S. HANsoN, C. F. HANSON, E. P. HANSON L F. HARTZELL, L. S. HEDSTROM, L. H. HEIN, G. L. HERI-IEIM, M. A. HEYER, H. A. HORNE, A. D. IvEs, C. E. JOERG, H. P. JoHNsoN, A. W. JOHNSON, E. D. JOHNSON, J. B. JOHNSON, O. E. JOURDAN, R. L. KAUFMAN, F. G. KERLER, E. A. KEYES, E. A. KIDDER, C. P. KIRK, C. H. KIRST, L. A. JUN I .mi mimlmmimyinmil-N-A-liimwlilmnwm uummmmInIininummIninwmmimiImummwiiiim Page 190 IQOEBKE, E. J. LAING, S. G. LAFLIN, J. M. LAXMB, S. J. LAMBOLEY, J. J. LANGER, J. E. LARSEN, B. M. LARSON, K. N. LECLAIRE, A. C. LEE, O. C. LINDEMAN, H. E. LINDNER, H. G. LUCE, F. A. LUND, A. B. LYONS. F. W. MANTONYA, W. G MCDONELL. J. F. OURADA, J. C. TERRY, O. R. WARNECKE, E. G. WARREN, G. B Company K TOP Row-Snider, E.. N., Young, V. D., Johnson, Weiss, R. C., Viech, McLane, Megorden, Stewart, R. D. Walraven, Olson, Vitcenda, Scewart,J. D., Rundorf, Nelson, Scadden, Schiller. SECOND Row-Will,J. C., Miller,J. I., Miller, K. C., Powell, Dean, Schulz, Sinex, Shock, Pitzner, Sabin, Putnam, Powers, Richardson, Peterson, Osmundsen, Mackensen, Talbot. THIRD Row-Gerhardt, Timm, Roetzer, Robar, Schoheld, Soref, Samelius, Weiss, RC, Turneaure, Maurer, Rittenberg, McLenegan, Schirmer, Slichter, Multer. FOURTH Row-Rosenberg, Smith, Van Roo, Nicolay, Snider, W. H., Oycn, Teske, Merriam, Shapiro, McKinley, Purinton, Thompson, L. N., McKaig, Paulsen. FIFTH ROW-Lammers, Morris, Karas, Thomson, Wilcox, Pastoret, Wilson, Fabian, Nickodem, Taynton, Reichert, Portman, Myers, Watson, McConnell. Company K Cadet Officers Company Commander . C. W. MORRIS Section Chief . . . . J. D. MCCONNELL Company Clerk . . G. B. WATSON Apprentice Seamen DAUCHERTY, R. L. MCLENECAN, D. W. ROSENBERG, B. W. STEWART, R. D. DEAN, H. K. EARLE, K. S. FISBECK, F. L. FABIAN, P. J. GERHARDT, O. A. HOWLAND, D. H. JOHNSON, KARL KARAS, L. L. KURTZ, H. W. MACKENSEN, E. H. MAXSON, R. H. MALIRER, E. D. MECORDEN, G. C. MENICK, H. S. MERRIAM, J. R. MILLER,J. I. MILLER, K. C. MULTER, L. M. MYERS, CHARLES MCKAIG, W. H. MCKINLEY, M. J. MCLANE, F. L NELSON, M. H. NICKODEM, J. V. NICOLAY, J. L. OLSON, J. H. OSMUNDSEN, O. S. OYEN, H. S. PASTORET, L. H. PAULSEN, C. W. PEACOCK, B. N. PETERSON, H. B. PITZNER, A. F. PORTMAN, L. J. POWELL, H. M. POXVERS, M. A. PRICE, L. J. PURINTON, S. M. PUTMAN, R. J. REICHERT, G. J. RICHARDSON, C. I. RITTENBERG, G. F. ROBAR, G. D. ROETZER, A. G. RUNDORF, R. L. SABIN, A. B. SAMELIUS, W. R. SCADDEN, F. H. C. SCHILLER, R. F. SCI-IIRMER, J. R. SCHOFIELD, I. P. SCHRAGE, C. T. SCHLIETTE, D. H. SCHULZ, H. H. SCHNVARTZ, R. J. SHAPIRO, L. H. SHOCK, M. R. SI-IOEMAKER, M. J. SINEX, G. N. SLICHTER, D. C. SMITH, F. E. SNIDER, E. N. SNIDER, W. H. SOREF, S. M. SPIELMAN, H. J. STEWART, J. D. Wim.-i...ii.i... I-.Iwi-wiiiiiiiiiii ininlimmmininiiIIIininmiinIiniiiiiiimiiiiiiiiiiiiii age 191 STONEMAN, W. F. TALBOT, H. A. TAYNTON, MARK TEHENNEPE, C. A. TESKE, H. O. THOMPSON, L. N. THOMSON, M. S. TIMM, C. H. TURNEALIRE, F. S. VAN Roo, J. A, VIETH, F. L. VITCENDA, T. J. WALKER, S. A. WALRAVEN, PETER WARREN, WILLOT WEISS, R. C. WEISS, R. G. WILCOX, RAYMOND WILL, JOHN C. WILSON, L. J. YOUNG, V. D. 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111ui1111111111111111111111111111in111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111n111111111111I111111111111111111111111111n111111111L 11 11111111111111 111 11 11 111 1 1 1 1111111 111111 111 1 1 11111111 11111 1 1 11111111111111 1111111 1 1 1111111111111 1 1 1 1 1 11 1 1 111 11 1 1111 1111111111111111111111171111111111111 11 111111 L Company L TOP Row-Porter, Sanders, Bach, M., Friday, Bakken, Schubert, Tiedeman, Hipke, Josephson, Marks, Bach, E., Andersen. SECOND ROW-Bluhm, Heilemann, VanVleclc, McGrath, Browne, Lewis, Schiffman, Hughes, Brady, Driver, Meyer, Thiede, Hotton. THIRD Row-Thompson, Archie, Schultz, Parkin, Robb, Fuhrmann, Assovsky, Ashton, Hubert, Lindahl, Sontag, Stolzc. FOURTH ROW-Stern, Hankin, Faber, Taylor, H., Neisser, Krivonos, Heseman. Bussey, Grady, Orvis, Marshall, Machlis. FIFTH Row-Docter, Ramsey, Ballantine, Caspersen, Beste, Seeber, Taylor, W., Schwentker, Hill, Hance, Skelley, Heller, Routt, Scott, Travers. Company L Cadet ODITCGFS Company Commander . . . DONALDJ. SCOTT Secnion Chief . . . RONALD W. RANISEY Company Clerk . . MYRON C. DOCTER Apprentice Seamen ALBRECHT, HAROLD T. ANDERSEN, VICTOR S. ARCHIE, ARTHUR J. ASHTON, SIDNEY C. ASSOVSKY, CHARLES BAC!-l, C, EDWIN BACH, MARIQ J, BAKREN, TESTER H. BALLANTINE, G. NEAL BESTE, CURTIS F. BLUHM, HERBERT W. BRADY, JOHN D. BRONVNE, EDWARD I... BUSSEY, FREDERICK N. CANDEE, KENNETH CASPERSEN, VICTOR H DAHLE, CRRIS B. DRIVER, CAMILLES O, EISELE, EDWARDJ. FABER, ARTHUR C. FREDERICKSON, J. FYFE FRIDAY, A, CARLETON FUHRMANN, CARL G. COFF, SIDNEY B. GRADY, CYRIL J, HANCE, LYLE S. HANKIN, HARRY PIEILEMANN, MERLIN F, HELLER, HERMAN G. HESEMAN, EARL J. HILL, CLARANCE D. l'IIPKE, ELMER N. HOTTON, HOXVARD S. PIUBERT, ELMER G. l'IUGl-IES, CHARLES L. JOSEPHSON, SELMER B, TQRIVONOS, FRED G. LEWIS, CLARENCE E. LINDAI-IL, JOHN W. MCCRATI-I, JOHN E. MACHLIS, SAMUEL A. MARRS, HAROLD E, MARSHALL, DAVID L, MEYER, CHARLES A. NEISSER, WALTER R. ORVIS, GEORGE C. PARKIN, CJ-IARLES A. PORTER, COLBY A. ROEE, EDNVARDJ. ROBERTS, GAYLORD B. ROBERTS, ROE ROY ROUTT, MYRON M. SANDERS, HARRY W. SCHIEFMAN, ALVIN J. SCHUBERT, C. C. F. SCI-IULTZ, EMIL O. SCHXVENTKER, JAMES M. SEEBER, TAYLOR H, SIQELLEY, XVILLIAM D. SONTAO, XVESLEY G, STERN, XVILLIAM STOLZE, JOSEPH A. TAYLOR, HAROLD P. TAYLOR, XVARREN A. THIEDE, JOSEPH A. THOMPSON, TRUMAN TIEDEMAN, LEONARD P. TRAVERS, CHARLES W. VAN VLECK, JOHN H. WHITE, CLEVELAND J. 1 11 1 1 11 1 1 1 11 1 1 1 11 1111 1 111111 1 1 1 11 1111111111111111111111 1111 1 1 1111 111111111 11111111111111111111 11111 11 1111 111111111111111111111 11111111111 11111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111li1i1ii1i1l111li1ll111111111l11l11111111i1iil11111ii1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 Page192 , ,,,, 1111 111111111111111111 I 111111111111111111111111111111111111111111111111111111I11111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111 1111 1 111 11111111 11111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111 1111111 1 11 11111 1 111111 1 11 1 1 11 1111111111 111 11111111111111111111111111111111111111111111111 11111 1 1 1 1 1 11 1 11111 11 11111111111111 11 11 1 1 11 1 1 1111 1111 1 111 11 1 1111111111111 1 111111 1 1111111 111111111111111111111111111 s E 1 Company M I f I , l TOP Row-Lund, Keller, Johnson, Moody, Kiland, Niederauer, Milks, Birkctt, Orsburn, Chapman, Cumming. SEEOND ROW-Joerndt, McKinley, Lewis, Gehler, Wolfram, Pieh, Fox, Seids, Wegemann, Evison, Smith, Janisch, CVCFSOU. THIRD Row-Schneider, Wigder, Wemple, Schlotthauer, Meier, Ede, R., Blomstrom, Blowney, Stemmler, I-leyman, Newman, Slama, Schujahn. - FOKRTH Row-Wilder, Uhl, Stearns, Zlpperlen, Webb, Dudgeon, Spettel, Williams, Scott, Rodems, Rusterholz, Oman. gg FIFTH Row-Brown, Loftus, Weber, MeNaI.Ighton, Oehrlein, Sinaiko, Adler, Fancher, Nyman, Mero, Kautz, , Anderson. Company M Cadet Ojfcers Company Commander . . CLARENCE V. JOERNDT Section Chief . . . . SILAS L. SPENGLER Company Clerk . . SIDNEY F. MOODY Apprentice Seczmen 11 11111 111111111111111111111 11 1111 ADLER, OSCAR L. ANDERSON, STEVE W. BENNETT, WILLIAM J, BIRKETT, PAUL J. BLOMSTROM, CARL A. BLOWNEY, RUSSELL P BROWN, EARL D. BURR, ALLAN R. CHAPMAN, LAWRENCE B. CUMMING, ROY G. DUDGEON, SIDNEY B. EDE, RICHARD H. EVISON, WILLARD A. FANCHER, CLAIR A. Fox, PHILIP C1. GEHLER, ERWIN J. HEISIG, WALLACE D. HERZFELD, RICHARD P. 11 1111.11.111.11.1111..1.1..1.11.1.11..1.11.1..1...1.1.....1.1111.1....11.1.11.1...11..1...11..1.. 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111I111111111111111111111111111111111111111111111111111111111 HEYMAN, MORRIS A. HOLMAN, SOLOMON B. HOFFMAN, ARTHUR L. JANISCH, WILLIAM J. JOHNSON, MARVIN L. KAUTZ, LEO C. IKELLER, DANIEL l-l, KILAND, KARL G. KOLMAN, MYRON J. IQURTZ, LESTER W. LENVIS, JOHN W, LOFTUS, GERALD W. LUND, MYRON P. MCKINLEY, EDWIN D. MCNAUCI-ITON, LESLIE MEIER, EMIL J. MERO, SANFORD G. MILKS, MERRILL T. NEWMAN, GEORGE l. NIEDERAUER, FRANK L. NYMAN, GEORGE F. OEHRLEIN, GEORGE L. ORSBURN, OSCAR D. PIEH, ROY J, PUCKETT, WALTER C. RODEMS, LEO S. RUSTERHOLZ, CARL I-I. SCHNEIDER, HOWARD S. SCI-IWARTZ, CHARLES F . SCHLOTTHAUER, D. E. SCOTT, OWEN L, SEIDS, JOHN W. Sci-IUJAI-IN, ALVIN D. SEVERSON, CONRAD E. SINIARO, JAKE SLAMA, ELMER SMITH, ROY N. SPETTEL, MARCUS J. SPIES, GERALD A. STEARNS, RUSSELL B. STEMMLER, WILLIAM UHL, ALLAN P. WEMPLE, LEONARD C. WEBB, DOUGLAS J. WECEMANN, ALVIN A. WEBER, CARL J. WHITE, RICHARD J. WIGDER, BENJAMIN WILLIAMS, JUDSON S. WILDER, FRANK E. WOLFRAM, HERBERT E. ZIPPERLEN, WILLIAM DT .E K I I .a :IE E 11111 1 111111111111111111 11 11 1111111111111111111 1 111111111111111111111111111111111111111111111111111111111111111111111111111 111 111 111 11111 111111111111111111111111111111 11 11111111111111111111111111111111111111111111111111111111111111111111111.111111111111111111111111.1.1.11111.11111111111111111.111.2 .111.1.111111.11.11.111.11.11.11.1111111.11.11.11.11.111.11.11.11.11.11.111111.111.11.1I:Iaz11:I.11.1.11.111.11.1111:aanameInIIIII.11.11.111..1111.11.11.11111111.11.1111111.11.11.11.11.11.111.111.11.111111..111.11m.mIIma:1.111.11.1.1.11.11.11.1.masmIamnimsiaizmamr"'11111:ImzmaIm...11.1111.11.1111.11.11..11.11..IIImaI:zm 2 P C1 g 6 1 9 3 Is In.- HmmmnInmuluummnmummmmli 3123555355ggMy55M353mygfgfMyWwwmulnumwupnvmmumuwulvuulumnwulsunnmwuvmwuunwInmmwmnnInru1InmvnmummmmmwmmwnumwuwluvInmluunwInmln1lulmvunuruwmmwuwlnwuwnnmmfwmInnumunmwnumwuwuvwnwulmwyufmmmwInwnwnnwuwuwluwInwuwmmwInnnwInInwnwwnwmmwmlnwn1ul1uwunmwIn1nwKumwnvmwmmwmmmwmwnwmnulnmwummunwuwInunwmmunmwnwluwmumuummmnunumummummnmnmnf 3 alum..M4mwmInnwW-.1ullu1-.1my-I1ulmlmm1InIn1Hmm.1.HI..V..l.HHl1.Hmm1HUMulmmm,1InmyulmmlInlnm1In1InInm1H11H1mul1.Umymlnm1Inl.1lullmnll.11InH-rmmlulml.I1ln.Uw.Hm1lmInIn1In1I.1-.1mullmnnmlH1myInH.1H11.111.1lu1.I1H111.l.Unl1mm1...l.mm.mm111ll1l..1H1m1mH.u.1m1.H.iniiiliilinI-I1QuVdll.1mlii1InH1175li.1lilMdnInInInnh1.1ml-L1illi..m1-IlnuullmK11m-in1Qulm.il1Edidiiiliml517151516562EEIZLIIQIEIREIITIIIEE Useless Steamship Cardinal SE The Navy Prom-Kehls l-lall, Dec. 6, l918 if 235 H: sig 5 immm.fnnmvmmum.mm..mm : i : :y-..,...,..- .... .. .... .......... Wim.,,..,...U.,...,..wL..l5.....,......,.L.EEW...ml,.m..,.2..H..,.......:.l,..,,MM3..,..,,.m..um..,ul...nn...,..,..,...,.m.....,...,..,,....,,m...,...,..,...,..,m...v.........,..m.,..,...,..,..m.,ml.....,......,.m..,,.,...nu...H....y..,I..,...f.m.....H.,,.l............,H....f.....m..,mm..1......,.....m........,m..m..,,.m....,...mn..,1M.,..W...lV.f..,I.mn...,.......H......,.m.,..,..,.....,.,....,m...,,......1...,...w....u....ms55 1nmunuumulumunmumnmmmmuuuulluummmmmmummmumumumlmmnnmlnwmummmwnllnwmmm1mnrnmmummmmnummummmmmmwummmummufImmunInmnuulInunlnrinmlmnumInnmEIunumdumummlunnmiimnilmEE"rnwnu:Emumnumummmmlmm1II11unmummwuumummmulnumunmuuummnunmnnmummnunummvumummuummmnumnmu-muni Page 194 Thlehcs F5 Pd' iiiiiiiimiiiiiiiiiii iiiiiiiiii iiiiiiii ii i i ii i i iiii ii i i i i iiiiiii i in ii i ii ii ii i iiiiiiiiiiiiii i i we iiiiiimiiiiiii iiiiuiiiiiii iiiiiiiiiuiiii iiiiiii i i i i iiii iii iii iii iii iiiiii i iii i ii i ii i iiii iiiiiiii i i i ii iii ii ii iiiiini ini i i iiiiiii i ii 5iiiiniiiiiiiiiiiiiiiiiiimwii Eliiiiiliiliiiiiiiiliiiii i College Athletics After the War By Tom E. jones HE past year and a half has been a great laboratory experiment in the develop- ment of human material. We should profit by the results of this experiment. lt has brought out strikingly the defects in the preparation of our man power. The nations hrst and most important concern during the period just past has been to develop and condition those recruited for military service. lvfodern warfare has demonstrated that thc carefully trained and conditioned man is still the most important factor in victory. lvfilitary authorities say that the condition of the American soldier was one of the decisive factors in the war. lt was because they pos- sessed the ability to think quickly and act independently in emergencies. These qualities they acquired largely through athletics. NVe have learned much about playing as well as fighting in this war. Cnc of the bright sides of the great struggle is that the interest of the general public has been nce of physical education. lt has emphasized the great opportunity and responsibility of schools with reference to physical training and I am conhdent that the future will see more athletics, rather than less, in the schools. Physical htness is just as important as mental fitness in making useful citizens, and a dehnite period should be arranged for it on the program of every stu- dent. One hour a day is not too much to give to this very important part of the students education. The new impetus will be along the line of intramural sports. Ath- letics for all and everybody in athletics. The normal and best way to develop intercollegiate athletics is by backing them up with hundreds in a good program of in- tramural athletics. Intercollegiate athletics will al- ways have their place in developing institutional loyalty and inspiring the non-athletic to better efforts. The competitive spirit is funda- mentally a good thing and needs to be developed in the entire student body. The strenuous, competitive nghting type of game instills in the men the spirit of determination. One of the definite lessons taught by the war was that athletics are of real military value. It was what supplied our men with the spirit that enabled them to do things which caused the German to gasp in amazement from his first encounter with them. Whenever it was necessary to put in just a little more "punch" in order to attain a result, our men went after it, as they did back on the old gridiron with the ball on the two-yard line, fourth down and the goal to make. This is the spirit that athletics put into every man-the "Never Quit" spirit, and the knowledge of this did more to beat the Kaiser than our bullets. It is common knowledge that the Army and Navy authorities were inclined to place college athletes in a preferred class as officer material. We have every reason to be proud of the war records of our athletes. Wisconsin has given freely of her best men in every sport and during this period we have carried on the athletic program and have tried to uphold the honor,of thc school in these sports. College athletics have passed successfully through this critical period and now is the opportune time to make improvements. We should not quietly drift back into the old channels but should take the new impetus given to sport to "carry on" on a broader basis than in the past. We should realize that this whole question is simply one phase of education and that a definite place should be arranged for it in the program of every student, Athletics are an essential part oi the education of every college man and the right sort of athletic training will go a long way toward building up a rugged and endur- ing citizenship, aroused to a proper appreciation of the imporla Tom E. jones iiiiiiiiniiiiiiiiniiiiiiuiiiiiiuiiiiiiiiiiiiiiiiiuiiiiiiiiiiiiiiiiiiiiiiiiii i mm iiiiiiiiiiiiiuiimiiiiiiiiiiiiiiiiiuiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiwi iuiii i ii ii iii iuiiiiiiii i in i ii iiiini i i i i ii i i iiniiiii ii i ii ii ii i imiii iiiiii iiiiiiiiiiiiiimiiitmiiiiiiimi miuiimiiiiiiiiiiii iii t ii i i ii ii in ii ii ii ii in I l r Page195 iiiiimiiii iiiiiiiiii gw.mm.nmmuwm gg 2............,... nwmummmnuummmunumm HERERIILI1.ummmuff?HIWRIIRZ-ZRZNREZHim.131iR1.n..u.n..... W. if. 9 L E6 59 il 2 , !'1 w 1 N ummmuvnmummmmmuummnmnuwnmnmunmmnunnmmmnmmunvmyummmunnummmummummmmmunumuInInnmummmmmvnmlinmyuvummmmmm-mnumnmummummmmmnmmmmmmummunnunuununmmvuwunummmnumummmmmmmuvummwummwnummmmmmunnmmnmmmnumuvxAuun11Au1u1n111Inx1mvnuvu1mumnumnmmmmmng lm.mmwwinmvummmm.w.wummmmmm1..m.mm-1..mum..W..ummm..ml...m.m.m....-.mm,.m..,..m.m.m...y..v...w.uw..m.1..,...mv.1.mm..v...m,......,..m.,..m.mm-1.W-m..mm.,I-m.m..m.my-1..,...H.H..-mH....,....m1.m.m.vWU.imW1.MLMnhinV..Q11i5'II511I11ELRJ1I5'li511I1111iiiRIHQQHIRZHQHEHEGIRSHWGLW.IIQZESZZZIRIITQEE .M,, U.,,7,v.nQ7Z 5 1ILumnnwmnmnmnunnmum Euinmhl.11..I11IIvR11?iR1??11?I1E111?R1iv , ,,,.. , .- 12111Slit21:L511111215:2L151t2:I111211:22it5n1:tt:2tt25Lt121211511L212511:5it21:2211tut5511251Eit512212::11L!1t:!1:'1Lt'11t'L2":"'"v'11"'""'"""'"""'H'H""'H"H'"H'-""1""-"W-1"1----M-'l--1'--W---v ununmvummnuwlvwnunumvnumummmyuvmymvmynummyNnu1uv1an1Inannn1InmmmuuunmmmmumummnuuvulwummmummmmvnvmvnumulMillillMN?lli13il1il?li?11li P a g e I 9 6 .mm1.mmminlmmmmu.m..1..v I. 1 K. 1.. .H mmymymmmy.mmnmmummu if 332 gf: H..,..,, 1 ,.Hm...,..,...,...,..,..,mm.,.HH.,um.,,.mmW...,.H,.mm............,, K..,. ..,.H,..X..w..1..,,.Hi..x..u.,,..v...,..,,.,,..,. ..1.K .W....,.N-M..m.,mwww55ww.m.1..15 .w..,......,H.,my.HW.H...1W.mm...ml.mm1m...umH.-...my...mum...mmw.,....,...,.4"....-..1..-.1...1II.1.I...1.......m.,.m.,r""...x.m......1 m1lv?1ih1Z11nXIQ?11511Qlli?513HERB?RRM1QR1l3113?1iih.mvummmmmm 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111g ETE11111111111111111 111111 1111111111111111111111111 111 1 1 1 1 11111 1 1 111111 1 11111111111111111111111111111111111111111111111111111111111111 111111111 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111 111111111 111 111111111 1111111111111111 111 111111111111111111 11 1111111111111111111111111111111111111111111111111111111111111111 z The Athletic Board Q2 Hanson Mann Pease Spangler Elsom Nuzum Bauer XVoodward ' Ramsey Duncan Officers E: KING G. WooDwARD .... , Presidenz jj: ANTHONY G. ZULFER . Vice-President 212 CARL P. BAUER . . Vice-Presidenz S. LLEWELLYN SPENCLER . . Secretary Personnel "XV" Men Nan Men BERTHOLD C. MANN , . Football . . . WILLARD R. DUNCAN CARL P. BAUER , , . Basketball . . HARLOW H. PEASE ROBERT M, SUTTON . . . Baseball . . . S. LLEWELLYN SPENGLER ' MAURICE M. HANSON . . Track . . . . HSEUH H. HSIEH . . Cross-Country . . RONALD W.RAMSEY . . lVlinorSDOrtS BERNARDO W. ELSOM KING C1. WOODWARD 557142 Athletic Council JAMES FRANCIS PYRE . . . Presidenz THOMAS EDWARD JONES . . . Chairman SCOTT HOLLAND GOODNIGHT OTTO I.. KOWALKE CHARLES HENRY BUNTINC HALSTEN JOSEPH THORKELSON EDXVARD J. MCEACHRON IQING GRIER XNOODNVARD , "tb . I - .1 - - js ,.1vv,j,: 5 -, 1 1. Q1 . . 123' . QD, I "..: Q' . r' S.-fs? in I 'V I A V , , X xx 1 ": ' 'ALa11y" Hall P 111111155 a EEE SSE if si: EEE :ig EE :ls E35 Eli iii is 1 4 if: 11 1 11111 111 1 1 1 111 11 1 111 11111111111111111 111 11111 111 1 1 111111111 111111111111111111111111111 11 1 11111 1 1 11 1r - 11111111 11111 1111 111 1111 111111111 11111111 1111 1111111 ,S111111111111 111111111 11111 1 1 1111 1 1 111111111 -1,., ,,.., ,..,..,,. 1 ,, ..,......., S .......,.....,,,.....,......,.... - ..,.,...,... u11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111111111111111111111111111 1111111111111111111 11111111111111111 1 11111111 111111111111111 111f Page 197 Elie Intercollegiate Conference Medal The lntercollegiate Conference Medal is awarded annually at each of the ten schools composing the Western Intercollegiate Athletic Association to the graduating student who has shown himself to be the best scholar-athlete of his class. The selection is made by the faculty and athletic council. The medal, of gold, was designed by Dr. Tait MacKenzie, of the University of Pennsyl- vania. lt was innovated in 1915. ' 1, 'fy .s:-.S 1 li - Tse ig: N , .. M... 1, -' -Q-iw . . 'i . 1, V ,l:,,f,,. , .AW- " f6sa 1f5-W . H 5 V bf flffia ' . vi- -.X 1 Q ,. . I I . , 1 0 4 V -N S' z a . , Q, J Kennedy . f 1g,33"', . -S as-1. .. wr f 1 M ,,,,, Mi... ,, V 'fl ' 'V 'f lv? .i i iff' V, if Burke 4 Martin "Tom" Kennedy was the first Wisconsin man to receive the medal. lt was presented to him the year of his grad- uation, in 1915, in recognition of his ser- vice on three 'varsity crews and on two 'varsity football squads, in conjunction with the scholastic average of 85.4 that he maintained for four years. Dow l-larvey, holder of the Wisconsin record for the hall-mile run, was pre- sented with the emblem in 1916, 1-le won three NV's in track, captaining the team his senior year, and one W in cross country. 1-lis average for four years of scholastic work was 91.1. Mead Burke, who won three NV's as a hurdler on the 'varsity track team, re- ceived the award in 1917, 1-lis scholastic average was 87.6. Burke holds the 'var- sity indoor record for the 40 yard high hurdles. Eber Simpson, Wisconsin's greatest all- round athlete, was the last recipient of the medal, being awarded it in 1918. 1-lis record of winning seven W's in three sports, added to an average of 84, gained him the honor. Eber played quarter and half on three 'varsity football teams, guard and forward on two 'varsity basketball tives, and filled in at nearly every position on the'varsity baseball team for two seasons. Wi. H-i..ii..,..i..,i.-1. .Hi..ii..ini.,i...i.ii.il.iimi.Hinim..,i..i..i..i.i..i.. P a g e I 9 8 ig . tt., fi .- fm 5 ::- - 'i 211 S- i 3237 W 1 l XE? tg 511 1 '2- 1 ll S' Q Harvey 1 f lesxmpscfu . W:-:-., an of wisaeffwx V 1, 4 agent, Q mms 15 f ,vm f f Q, 4:- ' 1 Simpson .iinim V ..,i.ii.1,w..i... .11-ui. 1 nmmmum in u u in n mmm P OOTBALL EAM Ojicers BERTHOLD C. MANN . . Captain CLARENCE F. HANSON . Manager GUY S. LOWMAN . . . . Coach THOMAS E. JONES . Assistant Coach HAROLD P. VALICHN . Assistant Coach MAURICE A. IQENT . Assistant Coach Personnel BERTI-IOLD C.MANN, W-Left Tackle WALLACE A. BARR, W-Quarter Back JAMES P. DONACHEY, W-Right Tackle WESLEY S. LEAPER, W-Right End JAMES L. BRADER, W-Left End MARTIN P. BELOW, W-Left Guard ROMAN I-I. BRUMM, W-Center WILLIAM K. COLLINS, W-Right Half Back GUISERD M. SUNDT, W-Full Back FRED K. SMITH, W-Left Half Back EDISON I-I. USHER, W-Left Half Back HARRY A. MARCOLES, W-Right Guard WALTER KUEHN, aWa-Right Half Back LYLAS P. KLUG, aWa-Full Back ELDRED J. ELLINCSON, aWa-Left Guard ROLAND C. SPRINKMAN, aWa-Right I-lalf Back OSCAR A. EKLUND, aWa-Right Tackle RICI-IARDJ. XVHITE, aWa-Left Half Back Season in Scores Wisconsin . Q 0 Camp Grant . 7 Wisconsin . . 21 Beloit . . 0 Wisconsin . . O Illinois . . 23 NVisconSin . . O Minnesota O Wisconsin . 14 Ohio State . . 3 Wisconsin . . 7 Michigan Aggies . O Total Points Wisconsin . . 42 Opponents . . 45 u.w.I..WtI..mII. I..I.IWIw.Ii--i..ii.wI IIIIIIIIIIIIItII-IIIIIIIIVIIIIIIIIIIIIIitIIIIIIIIuiIvimiiimmmiiiii Page 200 1 u i i The 1918 Varsity Team Carter Vaughn Klug Eklund White Ellingson Kent Hanson Jones Kuehri Barr Sundt Collins Smith Usher Lowman Leaper Donaghey Below Mann Margoles Brumm Brader The Coaching Stay? Wisconsins coaching staff, disrupted at the very outset of the season by a war demand which took Head Coach -john Richards to Washington and out of football for 1918, at times assumed the proportions of that record staff of 1916, when Dr. Withington, introducing the Harvard sys- tem here, had as assistants King, Soucy and Dougherty, who came with him from the East, and Buck, Mucks, and Driver, Wisconsin men. Vxfhen Coach Richards left for war work, the responsibility for the team's showing fell upon Guy Lowman, basketball coach and aide to Richards on the gridiron in 1917. Lowman was assisted during the season by "Peewee" Vaughn, a member of former 'varsity football squads, Tom jones, who had handled the freshman elevens for several years, and Maurice Kent, the latest acquisition to the Wisconsin physical education staff, who came from Iowa, where he had special- ized in coaching baseball. nvy rr af Arqm.,-'r 5 3 , I 'fa1?,g,:i5 A ' A 1 may I A .gy ga, f: ,V we-1 ,Qi 1 , 2 it P Ns ! f 7 4 1 '2 Q f "Peewee" Vaughn Assistant Coach Guy S. Loxvman 1-lead Coach i,.i..ii1.ii.1iini.1iK.ii.ii.iw.ii.ii.m.,iii mmiimiiiimiiimiiiiiiiiiiiiiiiiiiiiiiimiiiw ii Page 201 gg 0' 1 'Y' 1 NW J f ., ,, ff 91 4 ? Nl' X 4 ff 4 ' f g v , 4 1 14 tae' 'Y' 4 ew , f P? 141 I 'vc' Af X5 5 2 1,3 f 1 4 1 fa? I f ,f A an mx: ea, :X ,. ,. PM ?4'yf ' ,f"4 15,1 ,,., 3,5 , wage ' , M 1 4 0 rv ,W 6 K I 1 1 arf, ,K A 1 if 4' Q9 ' 4453, w -4 K 4916 4- I Z '5 Lieut. Tom Jones Assistant Coach J' ...,..,,. VF Smith Mann CCaptainJ Collins The 1918 Season - By Harold Gill '20 The 1918 football season at Wisconsin? Well, to begin with, let me paraphrase by saying "It was not a success-and it was a success." Under the microscope which reveals only cold, glaring figures, and which is applied by the uninitiated public, including, unfortunately, some of the students here, Wisconsin's conference record for the past season was certainly not what might be expected, in the usual order of things, of a school which has always maintained a ranking in football on a par with Chicago and Minnesota as makers of gridiron history in the middle west. Based upon unfeeling figures, it was a failure, for the 1918 Badger eleven Finished in fifth place in the Big Ten. Won only one of the three conference games played. Won only three of the six games played all season. Scored a total of only 42 points, as against 45 by opponents. To those who have followed conference athletics for any length of tirne, however, with an eye to more than the material things, the record spells success. For such persons know that, out of absolutely the worst football material in the history of the school and under conditions which had never been even approximated before, an eleven was pieced together that on the closing day of the season might have given any team in the conference a battle for top honors. Words are too inadequate to describe the mess which prevailed at Wisconsin when the First call was issued for football candidates. A man versed in all the tragic lore of history, equipped with eloquence that might rival the Blind Master, is needed to tell of the disastrous conditions which attained. There never was a time since the first Wisconsin team stepped onto a football field, back in 1883, when prospects were so hopeless. Consider! Barr Getting Away for an End Run 1iiiiiii.iiini.4i-iiiniiiiiiiiiii.iiii.ii.mw.ii.iiiii.. iiiiiiiiinimiiiiiniiiiiiiiniiniiiiiiiiiiiiniiiiiiiiiiiiiiiiiniiiiiii Page 202 Ali' t, 4 v -1 L' I Q2 . 1 fi hi hifi : ' T" J ' .9 1 41. 1 . ,PQ W1 , f 1 -f - v M2ifg0lCS Sundt Below There was not one football man in school, not one veteran, for the first time in history. There was one of the smallest squads of candidates ever known here, with freshmen, raw, unschooled frosh, outnumbering the others three to one. And from this squad was picked a team, composed almost entirely of first-year men, men new to conference football, a team which step by step, despite innumerable obstacles, was molded into a fighting, talented eleven that won its last two games in a decisive manner and finished the schedule with a burst of speed indicative of class, the culmination of two months of as rapid progress as was ever made by any team, I wonder if you fully realize just what it means not to have even one man back from the eleven of the year previous. Such a thing had never happened at Wisconsin until last fall. Such a thing will probably never happen again. Such a thing had never been even dreamed of. It meant. that the coaches were without a man who knew the Wisconsin style of play, without a man who had had undergone his baptism of fire in conference football. lt meant that there was not a veteran to build with. Carpenter, Scott, Weston, Gould, Davey, Kieckhefer, Sivyer, Bondi, jacobi, Keyes, Olson Mueller-all of whom had seen Big Ten service in 1917-LOST, not one back in school. And the coaches had been counting on having nearly every man of them back! Remained only Mann, substitute tackle on the l9l7 squad. As he was the only member of that aggregation back, he was chosen captain, and the coaches, regarding their pre-season plans sorrowfully, discarded them with a sigh and plunged whole-heartedly into the work of making an eleven out of the disheartening material afforded them. The material alone was enough to drive any coach crazy, but when obstacles began to pile up daily with the start of practice it is astonishing that the Mendota asylum did not claim a batch of recruits from Camp Randall. 1 Stopping an Illinois Drive Through Center 1.mirinrummnuInInummmn.rmwmm.u.r mmm. 'JLWMLEH .nu.i::!:w55l5:25:E-55 425553392 I 1minimummminrurummumwwmmumn Page 203 nu u r 4 in iiniuximiiiliviiiixiir urn ii v 1 im urn mum: is immuuni num ii n nun :ini ii nun n l in i i iv I ri I ni in , ui ,Sy i f em I 59? it fn Brumm Barr Usher ln the first place, the start of practice was delayed more than a week by the slowness with which candidates appeared. As stated before, they were, in the main freshmen and it was some time before they had adjusted themselves to university conditions, had arranged schedules, and had performed the many little duties incumbent upon entering college. In the meanwhile, a few candidates worked cut daily, waiting for more to show up. Then came delay while arrangements were made to permit candidates, all of whom were S. A. ' ' ' ' ' T. C. men, to practice, delay consequent with rearranging of drill hours, class periods, and the like. Sliding over these obstacles to practice, mountainous in themselves, we come to the season proper. The first games, with Ripon and Beloit, were postponed because of the "flu," Whatever advantage of more time for preparation was derived frcm these postponments however was ff b d 1 ' o -set y e ay in conditioning caused by slowing-up of the practice as a result of the effects of the epidemic here. Then another blow descended on the Cardinal camp. Coach john Richards was called to Washington on a war mission which kept him away from the game for the rest of the season. I-Iurried efforts to get another gridiron coach failed, and Coach Lowman, who had been rendering capable assistance to Richards, was given the job, Finally, a date was arranged for the Beloit game, but the contest with Ripon was definitely cancelled, leaving the Badger coaches with the ''between-the-devil-and-the-deep-sea'' choice of sending an inexperienced eleven into its initial conference game with only one practice game under its belt or of scheduling the strong Ca mp Grant team for the first game. Camp Grant Forced to Punt s .ii.iii.1i.Hi.ii,iii.1i..iini..i..ii.w.wm.w.ii s I 1 u ii i , , , , i mm iiiiiilillii1lHEI?lilliilFiiiiiiiiii!iiiiiiiiiiiiiiiiwwi Page 204 mwiummmuumum is uviminm ini mmnu nun I r , Ellingson Leaper Eklund Deciding that at least two practice games were necessary, Camp Grant was invited here for the opening encounter, and the husky soldier eleven was returned victor, on a lucky touchdown resulting from an intercepted pass, by the score of 7 to 0. Beloit came next and Wisconsin chalked up a win, 21 to O, showing considerable improvement over the work of the Saturday previous. To the initiated, the playing ofthe Badgers in these contests was worthy enough to exempt them from much criticism, l:ut to the fans, accustomed to seeing Cardinal elevens score 50 point victories in pre-conference games, the outlook for the season was certainly discouraging, Then followed the hrst conference game of the season, against Illinois, at Camp Randall. Illinois had veterans. Wisconsin had none. That tells the story. Illinois won, 23 to O, but two of its touchdowns were the result of lucky recoveries of fumbles. Wisconsin threatened to score several times, but the punch in the backline was lacking. The Badger showing, against a team which later was accorded premier honors in the Big Ten, was all that might have been expected. A second defeat, at the hands of Minnesota at Minneapolis, sent the Wisconsin hopes lower, but honors accrued to the Cardinal eleven because of its great stand against the Northmen. Stubborn resistance throughout the game, with a desperate defense checking the Gopher marches under the goal-posts on several occasions, confirmed the prowess of the Wisconsin line. The offense was still weak, however, and inexperience spoiled several chances which might have led to scores. A 40-yard forward pass in the last quarter gave Minnesota its only touchdown and earned a 6 to O victory. Vxfisconsin stopped the Gophers four times inside the IO yard line. S- Smith Gains on the Scrubs 2 i wmv imimiimmiiiiii Qiwgufgww 4 I iiifiinilimiiiininiiniiiiiniiiiininimmiimiwwm rr Page 201' 1 N' ,fx . - .s :L A f -2 N42 , 9 iff':1 -xiii, R . .41 ..,-. 1 Wt 9 1 1 Brader Donaghey Kuehn The first Wisconsin win came against Ohio State the following Saturday, at Columbus, a strengthened backfield ripping through the enemy forwards for long gains and turning in a 14 to 3 ' ' ' S me to scoring was in the victory. The line continued its stellar work and the closest tate ca ' ' d on a field goal from the 25-yard line when the second quarter, when three points were registere Badger wall stopped further advances. The final contest of the season, against the Mic igan gri Thanksgiving day, was a stubborn battle, which was won by Wisconsin in the last few minutes of play, 7 to 6. The Badgers fought an up-hill game all the way, on a field that was covered with several inches of soft snow. The ball was so wet that it was almost impossible to handle, and one of the Cardinal teams best stratagems, the forward pass, was useless. On its playing in the Hnal pair of games, Wisconsin was entitled to ranking among the leaders. lt is doubtful whether Illinois could have repeated its victory had another game been played fol- lowing the contest with the Aggies. The team had found itself, had acquired confidence in its ability, and, greatest of all factors, the offense had become formidable. With not a man of the team lost by graduation, and a dozen or more men of other seasons expected back from service, one of the greatest elevens in history seems assured. True, ' ' h 'f not more, than at Wis- all the other schools will have an unusual wealth of material, as muc , 1 ' ' ' ' ' it that never admits defeat will do the rest. consln, but, given the men, the old Wisconsin spir Coach john Richards, who was called away for special war work hardly before he had started work with the eleven, will probably be back on the job, ready to pick up the loose ends and start a winning regime which should extend far into the years and place Vxfisconsin again on top in western conference gridiron records. h A 'cultural College eleven here on Smith Makes First Down Over Center 1 11111111 11 11111111 1 11 1 1 111111111111111111111111 1111111111111111111111 1 1 1 1 1 1 1 11 11111111111 11 11 111 11 111111111111111111.1111111111 1 11 11111111111111111111111 1111111111111111111111111111111 111111 1111111111111111111111 Page 206 EE 5 555 3 gnffmummuvlmlmwmlu1nlrmnnInwmwuvwvuwInmwnwwnwlnwInwInuvwmyInwuwnnwanwm1uwunwInlInmlnuynmwInwuwmwmwulwuwm1fnfuwwInmwInwulmwIn1mwn1nnwmwInwnlmwmwInruwvulInwInwnnmwnnllnlnlvmruwInwullnllnwullInlmwIHfulanlvurulwuwruluwlInlulmwmlInwInwvuwInmywuwmlVuwruwluw11mlmmmmmmn1uwmlInwIn1Inm1luvu1vulnlw1nmmlmmlmmmfm1ullullulIn1Inml1IHmwinlulvu1vu1lmmmmmmnmmfmnmmmmmmmummmuwmmuuf 5 551fiwhmnlhlliil1myvumH.Hmm11.illu1ln1Inm1m1ynm1V..lIn1.M1.11.U1.11vi..Inlm?In11.1.H1-Hlu1mlInlu1yu1-if1.iv1Hlm1ll1ll.1vi.1iulmm1H4lnl1I.1In1J.1ll11H1vu1In1-1,1ii1V..1ul1.I1lHWInwm1.Hll.11In.U1,H1.Hl1.1N.1H.mmmlmmml.11.Myu1H4l.HlI-Nlu1ll.1In1I.11.IlN-Illn1-.11ului,W1ul1I.l1U11H11HlW1ulmlUi1Lil1m1lnI,LFi.lJn1imInV2.1di1hiQH1156lidhi1IZAlil1QLlll?Pill5211dl1MilliiilMillIll?F-11Pill511311F711QiiGil?Fiiiiiliii1iii1illFill1Q21EillFil1FilU511275227Eliililliiilliiiiiig :zz 1 5: ' S55 Illinois Fumbles Near Goal Line j355w.m-1,Inummn..lmmf..nmmmlW.W...W..H.Wmum.H.Wm.H...vm.....,......,,mm...lw...,.m...,..,.Wyn,...umM...K.,Wmmy...Ml.N.umf..1Wm...m,..,...,..m........,my..,T,1l..,.m2wwEmmmMTH...mm....15ww5.2Emwy2ET...m,lm.....mlwm...,2y.H,.,,...,.w.....1Wmm.,..ly.,.m...mm....,,,y..n.u.wwmm..mm,......M.m.m..mun-...n:.......f...1...a is :umlmwanwummmunnnnnwlnwmwluunvulInMHETHMEHIREEREIHIREEMIREYEFEGWuvMGEEESEIEMEERE-nnmwHFEGHEIMluuilmuimnnuluummmmmmulnunumnulmmmnnmlummmmmnllnuulmmlmwnwnnInunmumnmlmm.unmmm'lmmllmmmmmmmmmlvuumunuuummlummmunmnnmuumummmmumnumummm111nmunumnumfmnmummmunmwmuuumnummmnmummmumnuwmu . Page 207 QE gi 5 M u 1 Why We QDidn't Win the Championship Next Fall-Oh Boy! Often, in the intoxication of unrestrained imagining, we've wondered how it would seem to watch some of the gridiron immortals back at Camp Randall. ln wild day-dreams we've been thrilled time after time by conjuring visions of "Keckie" Moll booting one over from 40 yards out, of Vanderboom crashing over centerg of "Butts" Butler smearing a play, of "Coots" Cunningham barking his signalsg of "Biddy" Rogers weaving through the interference and bringing down the runner, of A1 Tandberg striving for six inches and a touchdown. Now those fond imaginings seem about to become actualities, for when the early rays of the next September sun slant down on the white-lined Field at Camp Randall theres going to be a bunch of wonder-workers of other days back, Oh, boy! what a team were going to have! Imagine four Wisconsin captains playing on the same team. They'1l be there-Paulie Meyers, leader ofthe 1916 squadg "Chuck" Carpenter, captain-elect for last fall, Mann, captain last season, and Sundt, captain-elect for 1919. And-sweet patootie!-with them will be Davey, backheld Hash, and Kieclchefer, Scott, and Sivyer, linemen, all of of the 1917 eleven, who chose to smash the l-lindenburg line in preference to disrupting those of Wilce, Stagg and Williams. And-Doc, the smelling salts !-we'1l have from that same 1917 aggregation of pig-skin artists Bondi, jacobi, Stark, and Could, all backline stars, and Weston and Olson, performers in the for- ward wall, all of whom have been in service and have just been discharged from camps in this country. And when they take the turf next fall- When four captains are battling on the same team- When men are sitting on the sidelines or composing the third team because there are better men on the squad- IVIAY WE BE THERE TO SEE! iiiiiiiiiimiiiiii1iiiiiiiiiiiiiiiiiiiiiliiiiiiiiiimiiiiiliiili H H -1 -ummm Page 208 IE LLTE6M I Dec. Dec. Dec. jan. jan. jan. -Ian. Feb. Feb. Feb. Feb. Feb. Mar Mar. Mar Mar. GUY S. LOWMAN ANTHONY G. ZULFER ANTHONY G. ZULFER . HAROLD G. KNAPP . . CARL P. BAUER . . . RoscoE L. McINTosH . WILLIS M. FANNING . I-IARLOW H. PEASE . MILLARD M. BARLONV . FRANK L. WESTON . . ROY J. SCHNEIDER . Ojicers Personnel . W . . W . . W . . W . . aNVa . . W . . W . . W . . aWa The Season in Scores 27-Wisconsin . 28-Great Lakes . 3 0-Wisconsin . . 4-Great Lakes . 1 I-Northwestern . 18-Minnesota . . 25-Illinois . . I-Chicago . I 0-Wisconsin . . 15-Illinois . . . 23-Northwestern . 24-Wisconsin . . 1-Minnesota . 8-Wisconsin . I0-Iowa . . I5-Indiana . I6 43 39 I4 20 38 25 . 24 . 28 . 16 . 32 . 29 . Z3 . 25 . 29 22 Camp Grant Wisconsin . Coach Captain Left Forward Left Forward Right Forward Right Forward . Center Left Guard Left Guard Right Guard Right Guard Milxvaukee Normal . Wisconsin Wisconsin Wisconsin Wisconsin Wisconsin Iowa . . NVisconsin Wisconsin Indiana . Wisconsin Chicago . NVisconsin Wisconsin Conference Standings Minnesota , Chicago . Northwestern . Michigan Illinois Purdue . Iowa . Indiana . Ohio . Wisconsin . III.IIIIIIIninIIIImiIIIIIIIIIIImliwimmmml IIInInInIInInIInIIIImmunmimInumIIIIIIIIIIIIIIIIIIIIIIII Page 210 Won 10 IO 6 5 5 4 4 3 2 3 Lost Pct. 0 1.000 Z .833 4 .600 4 .556 7 .417 7 .364 7 .364 6 .333 6 .250 9 .250 uinimnnniwinlinlnummlrmmmviniyuvmlinlinlnlinlinlulniwIif1ui1nlmyummnimiuvwrniinmimwmiinwui1inmyrn1uvwin1uirmmvuv1ui1vu1u1nllnilrulinininvnninllminwni1uiruwinwmluiwuwinww1in1inwulmiimnn1ui1inin11nimiinmym1vuwannnin1m11munnvllvummiuifmilullulinlinmmmvummmuummm n r . ., .,lK.,1l..lH1lllW1.HlH.1..lH.1ni1.HmilK..H.1H.lml.H1...1.HWmylW1H.l.Hmlmlmy.Win1K..1N.V..1V.,1llW1..1my1..1K..lK..1ml.,,..,l.,,..,,..l..m 1 5 2 The Cl eam 1 E 1 gee 'Se Higbie Schneider lviclntosh Fanning Barlow Lowman Pease Bauer Zulfer Knapp Weston 1 5 Team fRec0rds 1 Wan 3 Games, Lost 9 Total Points Scored . 230 Opponents' Points Scored . 279 Free Throws Made . 40 Free Throws Missed . . 43 Personal Fouls Made . 61 Technical Fouls Made Z2 Field Goals Scored . 95 ' if Indlvldual CRQCOMS 1 le fee Ota Player Award Goals Throws Points 'X ' ffl I f - Knapp W 18 0 36 Mc Intosh W 19 1 39 " 3 : Weston . W 12 0 24 Bauer . W 7 2 lo Pease . W 7 0 14 Farming . aWa 4 0 8 " Barlow W 3 0 6 Schneider aWa 1 0 2 13" f 1 Lowman Kent anmunmmmumminiunumminimm.numuninmuulininmumummmmmvinvminmuminmummmunumlininmmimiinlumimlminmlminimm1Himl'ENGINEluinlinlmlmmllvlinunmmlminmiMilli.iihill:himilliimiliihiiill1ininin.mlmuiin1il1inlminmimiinmluimlHIEEEIGIIEIEIMWW.mmlnilmmmmlliniminimlimliiil-IMEESSI5EiimTRmmmmiMiiiE.ummmmmmmuumlmlmlnnfmmnmm mum-mme Page Zll if K+ x - J ,,:,, ff ' ' 5 V 1 -1 ....f. f . ,.-l iw 121 -931 ' Bauer 1 f W2 fr 71, If 41 Wm? N, 5, f W X , ,, , iff f 'KX f 71 K 1 J ,X Ju iff ,f ,, 1 4 fi gf f ff' - I , f s F f iw" af f f , Q, 4 ff X ,fff f If Jw, f ,f ' 'A ua, , v , , lf , f 1 I L if H 1 f i Ni a 5,1 L if ,, as as I iimi1.Immmiimwiww miiwuwmmm fi x Gif! . x A SL. . , 1 Captain Zulfer Weston The 1 918-1 9 Season It was the most disastrous season in history for a NVisconsin basketball team-a season char- acterized by the most inconsistent performances in years, a season which ended with Vwfisconsin in last place, after a brilliant record extending over seven years, in which time five western cham- pionships had been attained and during which no Wisconsin team ever fell below third place. Much of the liability for failure may be accredited to lack of material. XVhen the season opened, there was not a regular back from the championship 1917-18 quintet. Chandler, Brock REUIIJQ, WA' 1 :sd Barlow M X 1 5-:' . is 1. , .7511 X X . , f z 1 J ' ' AI Y' -:Q . ,ft 1 ,i i E i l 1 if., ,5 -T ,.,, ,fav and Simpson had been lost by graduation,Captain-Elect Zulf- er was at Great Lakes, and Swinsen and Maisel were not in school. Knapp, with Bauer, the only substitute of last year's team to win his was in service. Of the four aWa men of the 1917-18 squad, Fladoes and Birch were in service. Thus Coach Lowman had only this scanty experienced material to start with: Bauer and Spengler, substitute forwards, and Pease, substitute guard. From the freshman team of the year previous he recruited Fanning, center, Mclntosh, forward, and Barlow and Schneider, guards. ' Captain Zulfer, Knapp, and Vxfeston bolstered the team when they were discharged from service and reentered school, but much of the value of their return was lost because of their coming back at different times. Until past the middle of the season, Wisconsin was unable to put upon the floor ateam which had played as a unit in any previous game. 'Injuries to Bauer and Barlow added to the spirit of .mminiuinrvuiminin1ininmwmmnmunm i i 1 ummmnuumnunummmnmwwu-mum' - ml viiniiiI5iMMGEFEGEIIIYIIMHIIIIEFEPEIEIEIIFYINIH """"""""""""' ' in i u v munummnwmmmimmiumn Page 212 ummimmm vim-mlm. , , ,, i v inimnummmmm-mnin ,, , y , Q ii yslllllfg r .Eel A Hg 3 Pease Captain-Elect Knapp le 5, 'Cf' "-. - .40 iv f 32,1 X ' ,N , , gl, V ,q Maclntosh uncertainty that was in the Badger camp at all times, and the chance that Zulfer would be called back to Great Lakes was always present. As to the season proper, the performances of the Wisconsin team would have forced the might iest intellect in the universe to admit his inability to explain them. The Badgers reversed the usual thing and played their best away from home, they defeated Chicago Cand the lvlaroons had a title-claiming fivej at Chicago, they lost to lndiana, the weak- est team in the race, here, suffering a most humiliating trimming in the final game of the season. Again, when the Wisconsin Squad was in probably the worst shape of the year, lowa was defeated easily, 28 to 19, and Illinois was outplayed, even though the Badgers lost, 14 to 16. This was at the period when a last-minute shift in the lineup was required because of an injury to Bauer. The team looked good. Then came the next to last game of the season, just after Wisconsin had played its best basketball of the ,year and had beaten Chicago-and lowa won, Z9 to 27. Perhaps it is best to forget the past season and look ahead. Of the l919 team, only one man, Bauer, will be lost. Captain Zulfer, lvlclntosh, Fanning, Knapp, Pease, NVeston, and Barlow will all be back. And with them, we hope, there will be this winter a host of former stars, among them George Carl- .if son, captain-elect for 1916-17, Paulie Meyers, Maisel, Swinsen, Fladoes, and l-lemming. my Fanning N ..,,.,.,.,,,,,..,... ,.,....i H .M ..,..,.. , ,...i,..,.. .. ..,.,,,..,,, . , W 1 in in i 1 "mi" "" T" A an mm unMiiiiii'5iiiZiiiiillm:nu uuuiiiHiiilliiiiiiililllllililiilliliillliiliiiiiliiliii in n I " Page 213 :mmmmmmumummnmmznmumiinimianinimvvuumimmmmnmmmw in wunmrm num umm nm ii ii u mmnnmmmnnmiimiuiruinisuiniiniuiuinmunmiuminiuiuiminiiuiimviuiminiimummimumumuuummmm nm nunmmnuimuixv1iniimvvviwmiiiiimmmmm mivmmwmmumuiininiinunnunmmmumnuirnnumiinmiumuummmnuimunmiummmumummmmnmmnmnnL THE WINNERS Fifteenth-Annual Turkey Race E November 27, 1918 I-IESTER WADE, first . FINN AANESEN, second IRVING K. KROHN, third . ALBERT J. KNOLLIN, fourth , RAYMOND A. SWITZER, last , Distance-1 M miles Live Turkey Live Goose Live Duck Live Chicken One Egg Time of Winner-6 minutes, IO seconds The Sta rt R The Finish mi i ii ii ii in ii mm mn mm i mlm i i ii i i iii nn im i mm in H iiiiiiiiiiiiiiiFiliiliHXiNiiliiiiiiiiliiiiiiiiiiiiiimmm nn: Page 214 i ii mi ui nmimmu ui iiiiiiiiuiv nun mmiiniuiimiimn u in in nu ii mm ............. .. . . .. ....... .... ......... . .... . . ... .. .. ..... .. . .. . . .. . . . .. . . .. .......... .....L...M.... ..... . .. .M ...................... Ti'T1rTWr"a"msr" .mmn.:na..r..1:naiz:................ ........... . .. . ............ ............... . .. ..................................................................................................................... ............... ........................ .. . . . ............................................... .. .... ..... ...................... T118 1 91 8 CPOSSTCEOUTZU' V Team Ramsay Loomis Brothers Manager Hammond Burr Captain Elsom Coach Bresnahan Oficers BERNARDO W. ELSOM . . , . Captain LORING T. HAMMOND . Manager GEORGE BRESNAHAN ..... . Coach Personnel BERNARDOCW. ELSOM, W PORTER L. LOOMIS, W WVAYNE RAMSAY, W ALLEN BURR, W WVELLINGTON BROTHERS, W Season in Scores Wisconsin-Chicago Dual ...... XViscOnsin, 235 Chicago, 32 Triangular Meet . . . . Wisconsin, 24g Minnesota, 353 Ames, 64 . . .sy f -w m eiw 4 Vfi.. 'vez-,J -.: .xr 3 .fi X. T i :Qt' T,J,.'c'V,. S ' ' ff, Wg.. ,y ,- , , 2 - ' ,. , 5-1 . N A, ,.4,. ,..,: M ff: fr- fc., R. ,. 1 ..- fi' ,, ,Ar' - .:,f.:.:fe 3 . .-Q.-. , T' sie 3 TQ. . ,.,,,,f .. ,U . km. . -4 -. R 3, " , . 5.3. ,. iw 'L . 2 R' " ' . 4 - ew . - g. .- - 'f xy ' H2 f , we , . R -- -.., .. , ., 1 1 ., ., 1 .f. 2 M , , ,. -, 22: ,-Ra g .. .Jim 1r,"4k.- kg' 1- , T 1 7 . Coach Bresnahan gfgyggvvggmilvingggigigw-M ........5Lg:,.!M.JWM ..... .............. . ...... . .... .. .... lm., .. .................. ................................................................... ...yi .WMLnlguimgmwww.Lv.................................................................................y..........5w..m.3........................ 1. um .. ...LH . ...... ........... ....... .M ............ . ..... ... .. .... .. .. . ..... .. .................. . ..... . ......... ......................... ...... ... .. ............ .. .................................................................W................................... ....... ........................... . Page 216 uimmimiiilmiimiuwi iii iii will in ii i ii iii i u ii iii i i i i in ii ii ii i i iwiii i iiii ii limi ii viii in i ii i i 'ini ii win gggzzanaxzzwmii iwW.,.ii..i.. i iiiinii iii., ii ii i. i. ii H.. i. i i. i EE Eli Ei EE 5: EE :lf ' l 'li f fav 'f - EEE V gf V x f P ., -- .N E L . ., 3131 .2 e 1 fi s ei, tmnj- V hwazwl' A' " Sf,-1 . ' ' . ' " ' if-T W ' 1 f , 52. ' 1, '7 l i. A -- . 1 L .V A l -3, all , .fi .,- 5 . 'f ,. . Q if ' f ' . fl l 4 assi, . :I Wm i 1 - Ramsay Captain Elsom Loomis Review of the Season Although no conference meet was held, whatever titular honors accrued to the cross-country season of 1918 undoubtedly belonged to the NVisconsin harriers, who proved their claim to being the best in the west by trouncing Minnesota, Chicago and Ames soundly and winning every meet entered. Chicago was defeated in a dual meet, and Minnesota and Ames were beaten in a tri- angular meet held at the close of the season. At that, the team was minus several men who had been counted upon to be back in school and to be members of the team, Captain-elect Dayton, Crump, O'Donnell, and Dennis entering service before the start of school. Meyers, another member of the 1917 squad, was in school I but not able to ccmpete, as were Ramsey and Nash, aWa men on the same squad. 1 3 . . , . . A . . ' Elsom Finisning First in Triangular Meet i 1 ,5- 255 E55 I 5xg.,W.,,...,,,m..i..,i..mi...,..,...i.ir.imiW.ii.mmii.i..i.mim.i.wiiiiiiiiiii i iiiiiiiiii-mm ii-ii ummm iiiviwi 1 iii i ii iv gymQmwlngmig,y,Ug1HL11QQ,,,,,,,,,,,,f i 1 'H Hi,gg,,,15J,5-W,-NM--,,,,,,,,H,5ggLLgL,-MLJ,-1 I if simsr"a'r"':'V"'r'w mi. iii mir., iiiiiii i.i.,.n. ri .i .i i ii i ii i .i..i...iim..N..H....,ii..i.....i,..i..i..i..i,,,,,.i,....iii , .i i i N' f Page 217 J-11111111111111111111111 1111 111111111111111111111111111111111111111111111111111111 11111111 11 111 1 1111111111111111111111111111 5-1111111111111111111111 1 1111 11 111111 111111111111111111111111111111111111111111111111111111 1111 111111111 1 1 1 1 1 1 11 11 5 9 N1 'fm ww w Z Pr W4 J ei ei 15:44 1 411 me 1 was 111- 44651. N 1: W' 1 4 , QQ.. P 'sv 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111 1111111111111111111 11111 1111 11 1 11 11 111111111111111111111111111111111111111111111111111111111111111111111111111E 11111 111111 1 1 1 11 111 1. . 11. f 'f 1 Jn . .1511 , . 12 Q:-. . , 11 1 , , 01 Q C Brothers Burr Manager Hammond The team had a good nucleus to start with, however, in- Captain Elsom and Burr, a former man in that sport. The new material showed capacity for rapid progress and interest in the sport was not affected to the extent that it suffered from lack of candidates as did football. With ten veterans, Loomis, Anderson, Ramsay, Nash, Ramsey, Crump, O'Donnell, Meyers, Dennis and Dayton, who was chosen captain for the 1918 team but who enlisted before school opened last fall, back next season, as they probably will be, the greatest team in the history of the sport should be assured. 11 11 11111 1111 Elsom Finishing at Chicago 11111 111 1 11111 1111111111111 1 1 1111 1 11 1111 111111 11111 1111111 1111111 11111111111111 1111111 1 1 1 1 1 11 1 111 11 11m 11m111MM11I-l 11111111-1M11115gg 111111111111111111111111111111111l11f1111111 1 1111111111111111 11 11 1 1 11 11 1111 111 11 1 11 11111 111111111111 11 11111111111111111111: P a g e 2 I 8 Wisconsin-Chicago 5Dual Cross Country Run CAMPI3EI.I,, Chi, First ELSOM, Wis,, Second BURR, Wis,, Third LooMIs, Wis., Fourth LONG, Chi., Fifth Chicago, Ill., November 9, 1918 The Result WVISCONSIN, 23, CI-Iicfioo, 32 The Summary WVILSON, Chi., Eleventh Course-Five Miles Time of Winner-27.'5l RAMSAY, Wis., Sixth HALL, Chi., Seventh ANDERSON, Wis., Eighth BROTHERS, Wis., Ninth LEXVIS, Chi., Tenth Triangular Cross-Country Run The Result XVISCONSIN, First . , . 24 points MINNESOTA, Second , 35 points AMES, Third . ELSOM, Wis., First WILDER, Minn, Second BURR, Wis., Third LOOMIS, Wis., Fourth MOON, Minn., Fifth RAMSAY, Wis., Sixth STONE, AMES, Seventh KINGMAN, Minn., Eighth The Summary PREITENOROSS, Ames, Seventeenth Course-Five Miles Time of Winner-27 13 315 . 64 points LYNCTFI, Minn., Ninth BROTHERS, Wis., Tenth SWANSON, Minn., Eleventh FREVERT, Ames, Twelfth SMITH, Ames, Thirteenth ANDERSON, WiS,, Fourteenth FREVERT, Ames, Fifteenth MARTIN, Minn,,'Sixteenth Ninth Annual 5Dralce Relay Carnival Des Moines, Ia., April 20, 1918 Wisconsin, unlike in other years, was entered in only one event, the two-mile relay, in which the Badger team com posed of Crump, Elsom, Ramsey, and Nash, took second place, forcing the winning Chicago team over the entire dis tance The points scored in this event gave Wisconsin a tie for sixth place in the final ranking. Chicago and Missouri divided honors at the meet, the Maroons scoring 10 points in the relays and Missouri 6 Scholz of Missouri won the special l00-yard dash. IiniiiiiiimimiiiiIiiIinmiiiiIiiiiiiiiiiiiimiiiiiiii lim IimiiiinminiiiiiiiIiiimiiiiiiiiiiiiiiiiiiiiiiiiwii Page 219 :SSE?F5iii?iiEliQIIQEZIXZQ1killHQFiiiliGi1?iiiiii?ii?iiiMilli?GIQIIRFIEIZZRiiiiiiliiilii?IillillliliiilIilliiiiiiliiiillliiliiliiiQiiKillilliillilYEIRIIIEZERillIIIRIIGIHii?iiiMIR?ill521HEREIN511iiiEiiiiillillii?EIIIIIRSIIQii?IiiliiiliilIIQYEREIQEIZ1InMill?EIIRQEIRFGQii?.ISRQIIYFIIEIJEliNEWERiiiiiiliiiliiliiiHEREINlil521H.umInmummInNHummWH-ummufX.1umm.m.wmm..1..m. mmnmmmummmmvu11Invumwmummmvu1InvuunmummummmmwI.nm1uvm1mnwummm1H.H1mpn1mm1InmmumInpnWnWvuwHwuwInwminululmnInwnvmwn1uwwu1u1un1nwuwwuwvuunuwuvuuuuum1vuunumulummmwI-wmummufmumInynIn1uluH1mwI.NInummvuinuInnluHuNnwulmumvumwuwruwI-1mwufmummfnwiflwrlvwflgg N 551M,,M.11,.,,5.,1.,3,....W.H,..,,K..Y....M...Y,M.,...U..,,,H..,,,.,WW.,,..,.,.W,W...,.,,,...,..,H.,.H...YK.,Y..Ynm.,,.,,......H.,,..H.,,X.,,...,.,,...L.,,.m.HW,,.N..,nm..H.,,..H.,W.....,,.HH.,...,.,,...,..,..,,..,,.,H.,,..H..,.,,.....,,.,.,.....,..H.,..,H.,W......H.,...H.,,.,,..,WW.UH.,.H,WK.......H,.HN..lmin,,HH.1my5,33,,,m5,15,3m S..Av..W...,H.,Y.N.WH.,K..Y...,,.HY....,.,.....n.Y..,mm.WH.,...,nm.,,.N..,Km..,Y,H..,Y...W,..,,H,..,,..Y,..Wvm..,H.,..,WK..,,.,...,..H..,,.,,y..Y...H,Yy.YH.YV.YH.may.w.:rn..m,...,..,.mmW.1.,L.....,H..L..,H....MW.H..,...,.mu,1.U.,,..,......,...,..,...W...H.,..,L..,...H.,...M.,.,.H.,...WU.,..,Um.,,...H.,WH.W1.1,.HU.,i.,,.....,,..,,..,.....H.....m. Page 220 1m1HWmm1IninwH1Inulmnmin1.1Wmm1m1.11InulumuvmyH1vmnwm1m1nmnulumInnlvmlmmm-mmmlmmnnmmu: 1H1511lilIIILQIRIIEl?ILIQIIIRIIZ1EIREIIIIZHi?lil?iiliil1iiR1EIRiiiiil?iiililliillimlilIQSIIGIISIEGIGIIQIEZEIGE?iEi?lEiPiiREimm-Q2 X V I 5 v 1 r A I f 'nl A i I 4 J E mmmfuvmmumInummminwnwunnlvmumnuwqEE!mn35555355353tI335gggggfggfggggnsggyggmvgyggggyilgg Sill?RERiiiiii?hhminmninnl1mwynmmlWInhmmwun-umunuw-1rmmmmmmuummmmmmmlmllmmmmmmnmm HL ' 'I - -LI EA C6718 1918 Varsity, Qutdoor Track Team Ojicers THOMAS E. JONES . . . . Coach HARRY R. HEINTZEN . . Captain IRVING A. ANDREWS . . Captain LORING T. HAMMOND .... . Manager Personnel HARRY R. HEINTZEN, W, 120 yard hurdles IRVINC. A. ANDREWS, W, 120 yard hurdles, 220 yard hurdles, broad jump, pole vault WILLIAM R, MALECKAR, W, 100 yard dash, 220 yard dash, 440 yard dash, relay GORDON W. CRUMP, W, 880 yard run, mile run, two mile run BERNARDO W. ELSOM, 880 yard run, mile run, two mile run DEMMER GOLDEN, W, mile run, two mile run EDWARD R. XVILLIAMS, W, high jump EMMET j. lVlUELLER, W, javelin throw HAROLD A. GILL, W, high jump ALLEN SPAFFORD, W, 120 yard hurdles, hand grenade, pole vault MAURICE lvl. HANSON, W, Shot put, javelin throw, broad jump LEROY E. EDWARDS, W, high jump, hand grenade CLYDE L. NASH, W, 880 yard run, relay OTTO j. URECI-I, NV, 220 yard dash, 440 yard dash, relay, 100 yard dash C. HAROLD RAY, W, 440 yard dash, relay BERNARD E. MEYERS, aWa, two mile run RICHARD P. HERZFELD, aWa, Shot put, javelin throw EDWIN A. GALLUN, aWa, Shot put, discus throw ' The Season in Scores April 27-Wisconsin, 965 Ripon, 52M May ll-Minnesota, 72, Wisconsin, 71 May 18-Illinois, 81 Mg Wisconsin, 62M june 1-Wisconsin, 100, Chicago, 44 june 8-Western Conference meet, fifth place, 13M points Q, I FS ' ' , -' .INA ' ' Illinois Meet-Andrexvs Wins in High Hurdles I..I.IIInI.IIImmInI..mm.IIIIIIIIIIIIIIIIIII Il I In gun l M InummuiInInIInIInIInIuImIniInIIIIIIIIIIIIIIIIIIIIIIII Page 222 'innmumiumnmmmmiimmmimuuuumuiininininimmuiiniiiiimimu num iiiinininiiiiinuniummmmimmmini numiiinimiiiiiiiuiuuiiimimiiiiiiiiuiiiniminiiiiiwmiuiiin Iiiinmiminimmiinimininiiiv1iiiiiiuuinimiuiinuiiuiuwimmm mv Ininmmiiiimnnuunimiummmuwmwmmmiu i im limi iiiiliiiiwivpi in i I mm iwu ir i iunmuw iiimmiiwiuiiiii imiimw i in imvi mmm wiimu ii i mi 1 i immii mumiii ww mum mimiuui iimimimu wimuwmiwiiinnuimiimumuwm ii in im iwimw inn 'wwwmmimiiviiiiviimiwiiii I ii nm iiivmumiuuiviuvmi The 1918 Gutdoor Track Team Manager Hammond Edwards Gill Urech Hanson Spafford Coach jones Elsom Maleckar Captain Andrews Nash Crump Golden War Takes Captains For the first time in history, Wisconsin last year had three captains for one season in track, jimmy Peterson, stellar dash man, had been chosen to lead the 1918 cinder and field performers, but enlisted just before the start ofthe indoor practice season, going to Great Lakes. At a special election called by Coach jones, in which all the track candidates participated because there were not enough men in school to give the balloting a semblance of dignity, Harry l-leintzen, veteran high hurdler, was chosen captain, adn acted as such all through the indoor schedule and well into the outdoor campaign. Then he was called to Pittsburg for special war work. The mantle of leadership then descended on the shoulders of Irving Andrews, also a high hurdler, and "Andy," although momentarily expecting his application for enlistment to be accepted, continued in that role throughout the remaining few weeks ofthe season, competing in the last meet, the conference classic at Chicago, just before enterin an ensigns' school. William Malecker, crack sprinter of the team, was chosen captain for l9l9, but enlisted in the navy and was sti at Great Lakes when the first track men donned suits this year, - Chicago Meet-Gill Wins With Bar at 6 Feet Page 223 """"""' "" ' uTETTTii"""" ii V im ii 1 i '1Ti"TlF" im T""i7'T'Ei"1Uiiv GEM?-4 v nu wmmnnmmmunnnmnummuiumnmiuii inininuniuiinimlmmiinumminumminmimm:uwimmminiinnmiiiwmilnuminmiinimnmwnnumumininumininiininiinlminuminnnuiinlmnummmiiinuiimiinwiviiimmimunininiiniiniiniininiiniuiininmuininunininuniniinummmmmilmmumummmuvmimumimmmnnmmnviniinnnimininnminnwuumnmiminmniminiimmmmiuulmlmmmmimnnuimummmunumnnuim 2SillIuiimRRmGiRiHiiiMiZi7?lirHEEimiEiiiiEEiEMFnTiFEi5EiiiEEiiiminnminmillninniniumminimiumiiiimininnniminninmuiinilmuiNiii15Wiiiiiiiiiiiiinininiiiiiiiiinininiiiimmiimmmiwmiimnum1inmimiinmyiniinmiii1iniminimmiinuiiiiiin1niinmiiininmiinmiIiiniiinniiininiinminiiimmimmmuiiinmiininiin116lliiililiilIIUIEliiiiiiiminiininimimiuiinmiinnumiuiimiinminvuimminuimimm s s s 55s..i...m..i..i....i.iimii..m.ii......,....... m""""'.m-mmmi...mnmiiiiiiimin.-ii-.1ii Iii Ray Hurling Grenade Hanson 1-leaving the Shot Review of the Season The 1918 outdoor track season was just what it was expected to be, a year which would have contented many schools minus the imposing record in that sport which Wisconsin has maintained in recent years. It was a season unmarked by record-breaking performances, but one full of development of young candidates. In the four dual meets of the year, with Ripon, Minnesota, Illinois and Chicago, the team showed its superiority in three, although Minnesota earned a technical victory after the Badgers had outclassed the Gophers over all the route. Illinois scored a clean-cut win over Wisconsin, its strength in the weights proving the undoing ofthe wearers of the Cardinal. Ripon was snowed-under, as was Chicago, while Minnesota's one-point victory was a result of a combination of "breaks" in the luck, all of which went against the Badgers. Fifth place in the conference meet at Chicago rounded out what was a successful season, a season which had been classed as one certain not to be a championship one from the middle of the indoor schedule, when lack of veterans precluded any possibility of a team of stars. The greatest strength of the team lay in its distance-runners, among the best in the west. lt was woefully weak in the weight events, as it has been since the days when Arlie Mucks, garnered his certain 15 points each meet. Most of the members of the squad were sophomores, so with the return of a majority of them and their consequent advances, a title-seeking team may be looked for in 1920. 1919 will probably be another season of development, as most of the members ofthe 1918 team are still in service or have been released too late to permit of their entering competition this year. - 3 , . ,. Illinois Meet-Crump First, Nash Second, in Half-mile 1nninmiiimmlimiimiiimi mimyiwiimiimiimmininmiin1in1niiniiniiiiiimmiiiiiimmii ii1uiuiiiiimmiiiimii iiiiimmimmiuniiiiinimininiiniin1ii1ininiiniminmiinlminlmuiimininimiinmyuimmmimnmu mlm mminimiimmimminimmmimiwiimwiniminmlmiiiiiiimwiiiiiiiniumiimimiminimnm..miwillMmiiigimiiiiiininiwiguiiniiIIIiuiimnmnmminimmim ummmimmnminimimimmiwmmmuiimlumnmininumimlnummminimimiiminmlm,mmnumminiimlmnumnummlmiiiinumiiiimniliiimiuimininiGiililiiiiliiminliiiumniiiiliiiiiliiimiiuimlmminimlmmlminlimmlm.mmumminnumimiuinmmminmlmlimmummnimimmmmmmmlmmlmummmmininnmmiiuimnmmminiinmnmmmiimmiiimmmiiiilmniumnmuui Page 224 ,ar--Q--Q .. - Eighteenth Outdoor Annual Con erence Tracie and Field Meet Stagg Field, Chicago, june 8, 1918 THE SCOREBOARD Q 3 L C I- .C 2 .LI 3 -, 3 Q Q E 5 E '91 L Q 9 5 0 Q E if IZ I E Q 1-' Q .C fl I o 5 E ii 3 3 E S ia 1- is 5 Q 1' 5 U 2 :Z m -O E P cu Q. cv Q gy: E cv .E '-s 'EQ bw 2 3 ?' Q o o T U ?' o T' E ?' 6 L C cu cv .- cu Q 3 3- o E o .Q Q N Q P gl 2 5 13 E 2 to 1- at 2 vi E21 C1 1 I S S, I O rr ia Michigan.. , .. 2 0 5 5 5 0 3 5 l 0 0 O 0 2M 4 DO 37M Illinois .... . 0 Z 4 O 2 0 0 O 3 l 4 l 6 To 4 To Z7 Missouri. .. . . 0 3 0 0 0 2 0 3 0 5 0 2 0 55 0 -3 24 Chicago ..... .. 5 o o 2 o T3 o 0 o 3 o 0 3 0 0 -2 18 wisconsin ..... . 2 0 o 1 o 1 0 o o o 0 0 o 0 in 'S 13 M Minnesota ...,. . . 0 O 0 O 0 5 Z 0 2 0 2 0 0 0 IM O IZM Drake .,.... . . 0 5 0 O 2 0 0 O 0 0 0 5 0 O O 0 12 Notre Dame ..... . . 0 0 0 0 O 0 5 1 5 O 0 0 0 0 0 O 11 Purdue ...... . . 0 0 0 3 2 0 0 0 0 0 5 O 0 0 0 O 10 De Pauw. . . . 0 0 0 0 0 0 0 2 0 0 0 0 0 O 0 0 5 Kansas. . . . . 0 O 2 0 O 0 0 0 0 0 0 0 O ZZ O 0 4M Indiana ....... . . 0 l 0 0 0 O O 0 0 O 0 3 O 0 0 0 4 Northwestern ....... 0 0 0 0 0 O 0 O O 2 O O 0 l 0 l 4 Ohio .......... . . 0 0 0 0 O 0 0 0 0 O 0 0 2 0 0 0 2 Ames ............... l O 0 O 0 0 O 0 O 0 0 0 0 O 0 O 1 School of Osteopathy O 0 0 0 0 O 1 0 0 0 O 0 0 0 0 0 1 The Summaries Event First Second Third Fourth Record 120-yard Hurdles . johnson CMichD jones wCDe PD Andrews CWD Osborn CMOD 315 315 Mile Run . . McCosh CCD Crump CWD Donnelly CMichD Stone CAD 4:29 315 100-yard Dash , Drew CDD Scholz CMOD Carroll C11l,D Collier C1nclD :IO Broad jump . . johnson CIV1icl'1D Lang CIllD Rice CKD Kreidler C1llD 23 ft., HX in' Two-mile Run . Sedgewick CMiehD Atkins CPD Moore CCD Crump CWD 9:51 Pole Vault . . Cross CMichD Kiefer CPD 1 Lang C11lD I tied 12 feet Ervin CDD - 880-yard Run . L. Hauser CMinnD McCosh CCD Roney CMOD Nash CWD 1:59 115 Shot Put ,... 220-yard Hurdles . Discus Throw . 440-yard Dash . Hammer Throw . 220-yard Dash . Javelin Throw . . High jump . . . Hand Grenade Hurl Relay Race . " New Record Gilfillan CNDD johnson CMicbD Cilnllan CNDD Barlow CMOD jordan CPD Drew CDD Wilson C111D Osborn CMoD Michigan tied Illinois Wisconsin Nash Ray Urech Maleckar Baker CMichD Sylvester CMOD Weiss ClllD Speer CCD Anderson C111D Collier C1ndD grossglnsn CCD ice . Later CMicl'1D med Missouri 1111111111111.111.111.11.111.11.1.11111111111.11.1111111111.i11 G. Hauser CMinnDBohn CS. O.D jones CDePD Gilfillan CNDD G. Hauser CMinnDBaker CMichD Carroll SIMD Pike C111 Weber CND Davis CMinnD Zilglfhllfuil XcDFelilsCs1l1c11DD Wisconsin 1 . Linn CND Minnesota jtled Chicago Northwestern 11iiiliiGil1111liiiiiiiii1iii11111135151iiliiiiiiliiliilii """M"" 'W Page 225 40 ft., 8718111 224 415 130 ft., 3 in. 152 215 134 feet 122 215 177 ft., ZZ in. 5 ft., HM in. 61 points out of possible 180 3:29315 if Wisconsin-Minnesota Dual Track Meet Minneapolis, Minn., May II, 1918 The Result MINNESOTA, 72 WISCONSIN, 71 The Summaries Event First V Second Third U h W D 100-YARD DASH Maleckar CWD will civil, D MILE RUN L. Hauser CMD Crump CWD Elsom CWD SHOT PUT G. Hauser CMD Schroeder CMD Herzfeld CWD 220-YARD DASH Maleckar CWD Mara CMD Urech CWD G11 W HIGH JUMP Egwirdl CWD ae E. Wi11iams qwp 120-YARD HURDLES Andrews CWD Heintzen CWD Spafford CWD DISCUS THROW G. Hauser CMD Platou CMD Gi11en CMD 440-YARD DASH McNally CMD Maleckar CWD Urech CWD BROAD JUMP Bierman CMD Andrews CWD Long CWD 220-YARD HURDLES Mara CMD Spafford CWD Andrews CWD .IAVELIN THROW Hanson CWD Mueller CWD Herzfeld CWD A Andrews CWD D . P . V" W M d OID AYULT ongC D Slwilliamscwiwrle TWO-MIDEVRUN Meyers CWD Crump CWD GO1den CWD PIAMMER THROW Davis CMD Carroll CMD Schroeder CMD 880-YARD RUN L. Hauser CMD McNally CMD Nash CWD HAND GRENADE HURL-Won by Minnesota, 32 points to 28. F . I 1+ ' il I I, . - I Record 110 1-5 4:36 3-5 41 ft., 7 in. 222 1-5 5'ft., 9 in. 215 4-5 122 ft., 11 in 152 20 ft. 11 in. 226 2-5 157 ft., 7 in., 10 ft., 9 in. 10:30 136 ft. 2:02 u Maleckar Wins the 100-yard Dash .mmmIIIInImmIuimrIIInrmmmmrmmr ummIInumIIIInInIumuuIInInIInInIInuiilummnnrumn Page 226 .I mn, Im I m nmmnnmmuvmummmmr unmu ui uuuunmmimmmumm Wisconsin-Chicago Dual Track Meet Camp Randall, june I, 1918 The Result WISCONSIN, 100 CHICAGO, 44 The Summaries Event F i rs! Second Third Record 100-YARD DASH Maleckar CWD Urech CWD Buchanan CCD 110 1-5 MILE RUN McCosl'1 CCD Crump CWD Elsom CWD 4:39 2-5 SHOTPUT Grossman CCD Herzfeld CWD Hanson CWD 36 ft., ll in. 220-YARD DASH Malecker CWD Ureeh CWD Karger W. :22 3-5 Williams CWD1 HIOHDUMP 'Gill CWD Edwards CWD Dried 6 fc. Wilson CWD J 120-YARD HURDLES Andrews CWD Spafford CWD Ames CCD 115 3-511 Discus THROW Mueller CWD Hanson CWD Williams CWD 110 ft., 8 in. 440-YARD DASH Speer CCD Maleckar CWD Ray CWD 151 4-5 BROAD JUMP Andrews CWD Hanson CWD Kennedy CCD 21 ft., 11 in. 220-YARD HURDLES Andrews CWD Spafford CWD Hall CWD 226 DAVELIN THROW Grossman CCD Hanson CWD Mueller CWD 167 ft., 8 in. POLE VAULT Andrews CWD AWD tied 10 ft. TWO-MILE RUN Golden CWD Moore CCD Meyers CWD 10:02 1-5 HAMMER THROW Reber CCD Hammen CWD Williams CWD 89 ft., 2 in. 880-YARD RUN Speer CCD ' Nash CWD Greene CCD 2:00 2-5 Edwards CWD 12 out of pos HAND GRENADE HURL Williams CCD Hanson CWD tied sible 30 Spafford CWD points A 'k Equals Wisconsin record. McCosh Beats Crump in Mile-run Iummmwi-wwmmmvwilll.mlnm.mm lvuiinmlumlllnummumlmimmlli1in1mmmlumnuwii Page 227 mmn in Ii I Wisconsin-1 llinois Dual Track Meet Camp Randall, May 18, 1918 The Result ILLINOIS, 81 1-3 WISCONSIN, 62 The Summaries Event First Second Th i rd 100-YARD DASH Carroll CID Maleckar CWD Lang CID MILE RUN Elsom CWD Crump CWD Lewis CID SHOT PUT Weiss CID I-Ierzfeld CWD Schuh CID 220-YARD DASH Carroll CID Maleckar CWD Emery CID Gill CWD I-IIGHDUMP Edwards CWD Williams CWD tied f IZO-YARD HURDLES DISCUS THROW 440-YARD DASH BROAD JUMP 220-YARD I-IURDLES DAVELIN THROW Andrews CWD Weiss CID Emery CID Lang CID Carroll CID Wilson CID POLE VAULT Lang CID TWO-MILE RUN Elsom CWD I-IAMMER THROW Pike CID 880-YARD RUN Crump CWD I-IAND GRENADE HURI. Anderson CID I Duechler CID I Kreidler CID Mueller CXVD Urech CWD Kreidler CID Andrews CWD Weiss CID Urn CID Meyers CWD Anderson CID Nash CWD Schuh CID Spafford CWD Anderson CID Maleclcar CWD Hanson CWD Kreidler CID Mueller CWD Andrews CWD Colden CWD NVeiss CID Ramsey CWD Spafford CWD x Record 1022-5 4:41 I-5 40 ff., 3 111 :ZZ 3-5 5 fr., 10Min. :lb IZO ft., 6 in. 252 22 ft., 6M in :Zo 175 ft., 6 in. 11 fc. IOZZ5 I-5 122 ft., 7 in. 2:06 I-5 I9 out of pos- sible 45 points 1 Carroll Breaks Tape in Quarter-mile mmuiinInimimuiIinnlIiniimuimimiiiinli IIniminnuminuniniinIinimmimmiimmiimiiuimiuiim Page 228 Twenty-Fourth Annual Interfscliolasftic Traclc and Field Meet Camp Randall, May 25, 1918 The Result MILWAUKEE NORTH, 27 points MILWAUKEE SOUTH, 12 points MILWAUKEE EAST, 25 points MILWAUKEE DNASHINGTON, 9 points MILWAUKEE WEST, 22 points MADISON, 7 points STOUGHTON, 18 points WISCONSIN 1-IIOH, 5 points MILWAUKEE BAY VIEW, 1 point The Summaries Event First Second Third Record 100-YARD DASH Shattuck CMWD john CMWD Birkenwalcl KMED 110 3-5 MILE RUN Loomis CWD Lewis CSD Schilling CMWD 4:48 1-5 Sl-IOT PUT Jacobsen CSD Weisel CMED Schwenker IMD 42 ft., M in, 220-YARD DASH Spetz CMND john CMWD Shattuck CMWD 123 2-5 1-IIOHJUMP Dietrich CMWgD Loeb CMED 1-lurley CMWgD 5 ft., 4M in, 120-YARD HURDLES Lewis CMWD Stolley CMED Gill KMD :lo 4-5 DISCUS THROW jacobsen CSD jacob-Sen CMWgD Bracler QMD 112 ft, 4 in. 440-YARD DASH Spetz QMND Thompson CMBD jesko CMSD 155 2-5 BROAD JUMP Spetz CMND Landowski KMED Stolley CMED 20 ft., ll in. 220-YARD 1-IURDLES Schneider CMND Lewis CMWD Stolley CMED 126 4-5 JAVELIN THROW Norem CMSD Potratz QMSD Miller CMBD 153 ft., 9 in POLE VAULT HAMMER THROW 880-YARD RUN 1-IALE-MILE RELAY Landowski QMBD Schwenker CMD E. Schmidt CMND t. d G. Schmidt CMND 'C Eiring CMED 1 Jacobsen CSD Potratz CMSD Brown CMWD Graf QMND Mathison CMD Woschitz CMED La Crosse Milwaukee East ,Milwaukee North 4' New W. I. A, A. record. 11ft.,oMin 135 ft., 2 in. 2:09 1:39 1-5 I.. . Lanrlowski Breaks Record in Pole-Vault ImI..IInmi,mmI..IInIIIIIIIIIIIMIIIIIIIII In my .Im II InmiInImiuImInImimminInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII """""""' "' Page 229 :gmmummmunvmruwvumnnmmmmmwmmmumInInmvmInnnunInfnmwmmmmwInInmInwwuwn1ummmnnmwInmnumumnumnumwanwnwmmHInInmwmm1n1in1mmmmmuwmfu1mm1lmnvmmm1nvm1uvfuW1myuwmXmmulummm1In1uwInXnmwnluluwmIn1nwuwunwInrnwInunmummm1uwmmwuwan1uwmuwmInm11-11nwmfuuuummmuInulwmwnw1uwuwnuummuwinununanuuuulvmminum1nwInXuwInummyn11.11nwmXmumnwmnunnmv 5 3-mnmK..fmHXXmmmummInunin1Mmmm'X..umlmml.1.Hui11fuMy1hillli?lilA2355ii?IGIGiGIIIEZIIIGIIHIZGiRINIIIISEQIQEIIIIEiii55?Giiliil55217211llIl?lIQlIIQi?QlIliiihlwliiillTiiiilil515115111555112111511IIEQIISIIIIQIEillIiiJillQi1311131151521Lil?IiiEEZlililIIEFilIll5.1,.UN1.N1.NL..WW-1-.1Wm,.11yuX.IX.H1I.,K..Wvm.Hm1..,H,yn1.1,H.1H,V.1mum.H.H,..,V..V..,.H,1.,V..V..H.H.H.HH.1.H1..1L..X.H1..umm1.1myW...XH411.4V..um.HN.X.Z1Li-1.L,25351mil,1-1mluiXyuNmui1dhE.iRiiiGiEREg dmfmXI-WwH.1yuX.H1H,WW1.Hmmm..mm..w, mm 4 . 5 5 EananmlUs1V.,,..,...,,..N.:In1,.,,V1P,E1,,.,,,,I,,,N1,5551:ffQ541513355151535.33551335gg3ggjgggggg3gg33gg355ynw551gmmmyrnwvuWvHInwuw+--4InW11wIn1InwI.1Uwyu1N1w11WXHX1.wVHnl1in1I.11.11V.11H1.I1WI.W.1w1.11.HW1.I1W1InH.1I.WH41H1InwI-fmruwuwmnuul1Hwm11.1H11H1m,H1I.1.I1W1.Hin1.I1HN1I.1W1N1m1m1.1Nm1H1m1.I1+IXXI.1In1H11.1NInV..1Inm1In1..H.1XInH.1H1uvX1.XIn1ynWNHuN1.umN.I1vu1W1H11-1yu11HN11I.N.I11HNIH1H1m1.11mNV.1lmmH.XvwmInN1.NNI.vmmfnumnmmnmnmmgg ,,,,,,,,,,,,,,,,, , ,W V ,Wmlmm 'ummm ,mm mmm W ml L ,,,,.,,.,..,.,,.,.,,.,,,.,,,.,,..,,.,,..,..,,,..,.,,..,,,.,...,,.,..,,..,,..,,,,,.,,,,,, .,.. ,.,,..,,..,,,.,,,.,,.,,.,,,.,,.,,...,....,,...,,,,,.,,,,,,.,..,,., . .,,,....,...,..,,,,...,..,,..,,.,,,.,,.,,.,,..,,..,..,,.,,,.,,.,,..,...,,.,,.,,,.,,,.,,.,...,,.,,,.,...,..,..,,...,..,,..,..,..,,.....,,...,.....,,.,...,.,...............,..,..,,..,,.,,..,,.,,,.,,.,,,.,,.,,,.,,..,,,,,,.,,.,,..,,..,,.,,...,..,..,......,.,. ......... .M .... . . . . ...,..4.. W mu my W WH, km.1VH1in1.41mW.HrmVHkmin1.I1yuWmW.1w1.11HW.HW.HH1X.HV..11.11.111.1V..11.1L..XL..W1.WInW..1InmwL-wnfWIHmw.IWWHw.HWmmm.1..mmmHfmV..W..X1.1W1.X.HWHXH,inN.M.H1H,m,..1.M1..1m1H,K..N.H1.I1I..X..,..1H.N.HK..1K..1I.11..U.Xm1L.11HNm1H1N.X.INnvNHNU.1V.11H1.11ny1m1.U1H1WH-N.HNH1in1..1m1H1I..1W1,w..,.wm.mm.., H.. Wm... .. 1 1 ms .. . ,. , . ., ....m., W.. 1....m...l.. P a g e Z 3 0 gnuimuiii Im IIIIII II I IIIIIIIIIIITIIIIIIIIIIIIIIIIIII E22 E55 EEE if as Ez: :fe EE ,ri I x E: Es Eli Ei? Z! EE r r EE EE SSE I E23 IIIII IIIII IIIIIIIIIIIIIII II uIImI mi IIIIIIIIIIIIIIIImIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I I I I I, I I, ,I In, ,II , I , , I, H, H , H HI, Um , I ''""""'"W"""""""M'ii'iTiiliH'IiRiiiiiiiii5iiSEiliiiiiJiliGi I5f'ii'ii'iii"'1iiiiJliiiliiiiiiiiiiii The Varsity Indoor Track Team I.,E.I-mv Y . .E . 17 -...V - - - Av- - Scheidenhelm Meyers L. Edwards Reed Hohlfeld Coach jones Herzfeld Blatter Mecartney Smith Hammond Hall Ramsey Fourness Hsieh Spafford Elsom R. Edwards Brothers Sternliels Shoemaker Pinkerton Pauly THOMAS E. JONES . . LORING T. HAMMOND . Ojlcers . Coach Manager Personnel ALLEN R. BURR, W, TWO-mile Run WELLINGTON BROTHERS, W, Mile Run RAYMOND D. EDWARDS, W, High jump, EDWARD B. WILLIAMS, W, Highjump RICHARD P. HERZFELD, aWa, Shot Pu: RONALD W. RAMSEY, aWa, 8804yard Run LEROY E. EDWARDS, High Hurdles EARL E. FOURNESS, 40-yard Dash, Relay LAURENCE W. HALL, LOW Hurdles, Relay HSUEH H. HSIEH, 40-yard Dash, Relay PAUL KAYSER, 440-yard Dash, Relay LESTER F. MOCABE, 880-yard Run PHILLIP D. REED, High Hurdles, High jump DON W. SMITI-I, Mile Run GORDON TAYLOR, TWO-mile Run Season in Scores A1 March 8-Notre Dame, 44 213, Wisconsin, 41 1 13 March 22-Flnished seventh in Conference meet I' I ' - A .. f 5 i -i"e 1.4.7 P iifv I Qi:-is : Anfaf V. -. A I.-1 sz ' Meyers Hsieh l-lerzfelcl I ,.,,.,.,..... ...,,..,,..,,., . ,... ...,,.,,...,.. nu III I I I I I I II I liiiiiiiiiiiiiiiiiiiiiiimiiiliiiiiiiliiii5iiIiiEiiIii1iiiiFiiEiI I I 4' "l'iFIiiEifH'iiIIiETiElf' Page 231 iii mmunwvuiummminniummmmmiinmiiimmmii .mmm .mmiii mm i iiimiiiimmimiiiirimiiiii Ninth Annual Conference Indoor Track Meet Evanston, Ill., March ZZ, 1919 TI-IE SCOREBOARD 3 L 'E 5 E C 3 L5 5 Q I! L, Q N Q C I .O E 3 E .D U L' -U 5 -Q i. 3 '-' G1 T. 5 U T. of I. cs -1 E 5 11 rl. cd gi 5 2 5- 5 in Q 3 a 2 Q 2 E 3 ZF I F cf 33 5 'Z 1- Michigan .... 7 I - 5 Z 5 3 3 I 65 3 36M Chicago .... 0 8 0 5 O 7 0 8 IZ 5 342 Illinois ,......... 4 I 2 l 3 IZ 0 3 2 2 ISM Northwestern ..... 0 0 3 I 3 O 5 0 I I3 Purdue ........ 0 0 O 0 I M 0 0 0 O 4K Minnesota ..... 0 0 Z 0 0 0 0 0 O Z Wisconsin ...,. 0 O 0 0 0 I 0 0 0 l The Summaries Event First Second 'Th ird Fourth Record 50-YARD DASH johnson CMD Carroll CID Cook CMD Miles CID :O5 2K5 MILE RUN McCosh CCD Long CCD Caskey CID Bouma CMD 4:40 60-YARD I-IURDLES johnson CMD Hamilton CND Jensen CMinnD Zimmerman CID :O8 440-YARD DASH Kennedy CCD Emery CID Butler CMD NVebster CND 153 4X5 Weghorsc CPD I HIGH JUMP Johnson CMD Linn CND D tied 5 feet, Il inches Brigham CID I TNVO-MILE RUN McCosh CCD Sedgwick CMD Moore CCD Burr CWD 9:48 Cross CMD I POLE VAULT Eilson CND Bucheit CID Y tied I2 feet, 4 inches Westbrook CMD 880-YARD RUN Speer CCD Lewis CCD Gardiner CID Birkholder CMD 2:04 Walla CMD SHOT PUT Smith CMD Moorish CPD tied 41 feet, ZX inches Corgas CCD MILE RELAY Chicago Michigan Illinois Northwestern 3:35 2,75 X Ties conference and worlcl's records. IiiIiiiIiiII-IiniiIIniinIiimwiiiiwiiiwii. IilIIiilllllillilIIlilillliliilliiiIlliiiIIIliiillililiiilliiliilli Page 232 Wisconsin-Notre Dame Dual lncloor Cfraelc Meet Gymnasium Annex, Marcl1 8, 1919 The Result NOTRE DALIE, 44 213 DVISCONSIN, The Summaries Event Firsl Second 'Third 40-YARD DAsI-I Mulligan CNDD Hsieh CWD Fourness CWD POLE VAULT 40-YARD HURDLES lVlILE RUN 440-YARD DASH HIGH JUMP rl-NVO-MILE RUN SHOT PUT 880-YARD RUN MILE RELAY Event 40-YARD DASH HIGI-I JUMP SI-IoT PUT BROAD J UMP POLE VAULT 40-YARD HURDLES 45-YARD HURDLES INTER-FRATERNITY RELAY INTER-SORORITY RELAY INTER-HIGH SCHCOL RELAY INTER-LITERARY SOCIETY RELAY Radamacher CNDD Reed CWD Brothers CWD Kayser CWD Edwards CWD Burr CWD Gilfillan CNDD Ramsey CWD Powers CNDD Cilhllan CNDI Meehan CNDD Barry CNDD Williams CWD C Gilfillan CNDD itied Douglass CNDD Sweeney CNDD Hoar CNDD Meredith CNDD XVon by Notre Dame CHoar, Colgen, Scallon, McCartney CNVD Edwards CWD Smith CW5 Scallon CNDD Taylor CWD Herzfeld CWD McCabe CWD BarryD Thirteenth Annual "W" Relay Carnival Gymnasium Annex, March 14, 1919 First Second Third Hsieh Stolleyl , Spctz I tied Edwards Reed l . Risteenl med Sundt Bach Herzield Marsh Gibson Sundt Merrick Pauly Lewis Reed Stolley Fourness Snolley Hsieh Sigma Phi Chi Psi Sigma Chi Hall Reed Scheidenholm Pickard Clague Muhlenberg Alpha Omicron Pi Chi Omega Delta Gamma Knollin Shapiro Spetz Burr YVisconsin High School Madison High School Stevens Paige McMurray Glasier Hesperia Philomathia Hsieh Meyers Pennefeather Anderson Iiiiwiiiiiiii IIIWIIIIIIIIIIIIIIIII 7illIiilillliiiiilliliiillliiiiiiiliiilillilliiiiii.IiIiI.II?limiIii Page 233 41113 Record 104 315 ll feet 105 415 4:51415 :55 315 5 feet, 8 inches 10:24 415 37 feet, 6 inches 2:09 415 2:50 215 Record 104 415 5 feet, 8 inches 36-feet, 8M inches 19 feet, I0 inches I0 feet, 9 inches :O5 315 :O5 415 1:44 115 8:43 l:l6215 l:l6 l15 mmimmmmim ."'Eimnmmnmmuw 1. H.. A EB- Cfhe 1918 Baseball Team Ojicers GUY S. LOWMAN . . . . Coach EBER EDWARD SIMPSON . Captain Personnel EBER E. SIMPSON, W, Catcher GEORGE K. MILLS, W, Second Base ROBERT M. SUTTON, W, Short Stop ELMER M. MCBRIDE, W, Third Base HOWARD J. HANCOCK, W, First Base ANTHONY G. ZULFER, W, Left F ield, Pitcher EDWIN F. SCHNEIDER, W, Pitcher ROB R. ROBERTS, W, Center Field WALTER A. EMANUEL, W, Right Field JOHN J. MCKEAOUE, W, First Base CLARENCE H. PHELPS, aWa, Pitcher ARMAND R. SCHILLER, aWa, Catcher HAROLD R. CHIPMAN, aWa, Right Field CYRIL J. BEAVER, aWa, Second Base -Season in Scores April 10-Milwaukee A. A., 12, Wisconsin, 4 April IZ-Northwestern College, 55 Vifisconsin, 4 April l4-Wisconsin, 5, Campion College, 4 April 17-Wisconsin, 55 Milton College, 2. April 22-Notre Dame, og Wisconsin, l April 27-Notre Dame, 15, Wisconsin, 2 May 4-Wisconsin, 9, Purdue, 8 May ll-Chicago, Og NVisconsin, 5 May l5-Illinois, 45 Wisconsin, 0 May 25-lllinois, 13, NVisconsin, 0 May 31-Chicago, 145 Wisconsinfo June l-Chicago, 55 Wisconsin, 2 Conference Standings Won Lost Pct. Michigan . . 9 l ,900 Illinois . . 7 3 .700 Ohio . . 4 2 .667 Chicago . 5 5 .500 Iowa . . 2 3 .400 Wisconsin . l 5 .167 Purdue . 1 5 . 167 lndiana . 0 5 .000 .1II.IT..I.HI.HinIII.T.II..I.HI..mii.mm.www.m IuwiIiiiEiilliiiiiEiiliiiEiiiiiiliiiiiiFiiiiiiiiiliiiliiiiiililiiiiumm Page 234 sg 52 232 21: EE if QE E15 il. si- 1 El 21 25 Ei E! 45 5? S E ,..., ,..,........... ,.., w.IL,..n. ....n ...,m,..,..,.,,,.,. ...u. M.,,.,..,.,,.,,,,.. ....,,,..,.......,..,...... .. .,n,, . ,..,..,,, . n,.,..,4,. ...,.,n.,,n,...,........,,..,..., . . .,,,.,. .n,, ,.,,......,..,i..,,., ,,,., . . . . .,,,,, .,,.,,..,.,.....u,..i,,,...4......,., . .. . .. . 5 gma::1nnnnmm"nm1............1.......................................................................1................................................... ............. ........................................................................ .. .. . ...................... ..... .......... .......... ...... ..... . .. ................. ..... ......1.1::1::m11a:sms11:::n::...........................E 5 QL S - E ' 5: 315 S EE E T: 51' 5 E Zi lla fi iii SE' :Q I 3 rl 515 ' -l fi. E55 E : :le A EE- 5 ' E25 :If E25 -i Els 15' 'V :1 T T fl if . 'EE- 2: .Q Q1 E15 if :Q E 1 . I . I Battmg Averages 2 E S Games A. B. I-I. Pct. Hancock Z 6 5 .833 . Mclieague 4 10 5 . 500 Schneider . 6 l7 6 .354 E5 Mills . 6 21 6 .286 Simpson 6 22 6 . 273 1 . . McBride 6 19 5 .263 Q . . Sutton 6 19 4 .210 Roberts 5 l 18 3 .l67 A , Schiller 3 7 l , 143 A. Ei: . Emanuel 5' l6 2 . l25 5 Zulfer , 5 16 1 .063 5? El Eli 552 ' fl El? 252 Egjlgmllmlmnuuwnlnuunlmummmmvumnu1111111111nnnuulnuum11mnuan ......................................................... . .................... .........J,,..M..I. nlvlllnl ...nluww.3..........l......... .. .. .............m..M..w..M.'.w1...M5..Mwww.iw...5.E.M3W.HE...wm.u..u..m.l.,.:.M....L..M.............f.E i................... .....zszan111::11.r.mm"'11'a:1......................... .................................rm1::a::1:n:1:nw "" ..mm:':r11........... ..1........... ............................................................. ... ..... .. ............................................... ........................................................ ................................................. m..........m......""'1...............5 Page 235 Inter Fraternity Bowling Sigma Alpha Epsilon---I9192Champi0nsA Alford Ohmsted Haley Donaghey Klapproth Gotfredsori Adams Standings ' Fraternity Won Lost Pet. Sigma Alpha Epsilon . . .... . 39 6 866 Alpha Sigma Phi . . . 38 7 844 Theta Delta Chi . . . 30 15 667 Gamma Tau Beta . 29 I6 644 Alpha Tau Omega , 28 17 622 Sigma Nu . . . ze ia 577 Phi Kappa Sigma . . . 23 22 511 Chi Psi . 1 .... . 22 23 489 IDdtaliappa Epsnon , . 21 23 477 Chi Phi . . . . 21 24 466 IDeka THLIIDCME . . . 21 24 466 Beta Theta Pi . , , 19 26 423 Psillpsnon . . . . 15 26 366 Tau Kappa Epsilon . . CJ 36 200 Philiappa Psi . 7 35 166 Zeta Psi . . . . . 8 37 156 Records High Team Average . ,... . . . Alpha Sigma Phi . High Team Total for Three Games- . Alpha Sigma Phi . High Team Single Game . . . Alpha Sigma Phi . High Average ...... Harold E. Marks . High Total for Three Games . R. R, Etter . . High Single Game . . . Gordon D. Adams . H1.11in1H1in1.41fuin1infH1.I11Humummwmlml -wwlmmminin11.11-41in1-I11-4imlwmimmmlu Page 236 827 2664 956 174 627 255 13145 225 I I I fi 577.8 1 91 9 Varfszty Swzmmmg Team Gutenkunst Rieck Holmes Bach Sollitt Stemmler Mackay Hindman Kidder Ojicers HARRY H. HINDMAN . Coach GEORGE E. LINDEN Coach f Personnel PRESLEY D. HOLMES, W, Plunge WILLIAM STEMMLER, W, Breast and Back Strokes CHARLES P. KIDDER, sWt, Diving CHESTER E. RIEOK, 40, 100 and 220-yard Swims, Relay LINCOLN A. SOLLITT, 40 and 100-yard Swims, Relay RALPH S. lVlACKAY, 40 and 100-yard Swims, Relay CHARLES A. GUTENKUNST, Breast and Back Strokes CLARENCE E. BACH, W, 40-yard Swim, Relay Record of Season i Wisconsin, 343 Milwaukee Y. M. C. A., 34 Third in Conference meet, 15 points. lil S- 1 .. .H i. i i ii ...H i. ii.. . ... .ii . H.,,aszazxiiflfliilllzzxzaaxzsszsmzxaaifillflflliffllifhanasa ., .. J'L:l'f"" lL'3"l'f'r"wL':f ""4" . 15I'L''2'52ilHlffllwmwklllflllffllllffilS Page 238 I E l Ninth Annual Conference Swimming Meet Evanston, Ill., March 21, 1919 THE SCOREBOARD U 'X U E 46 U I: 'Q an E gi fg T3 JE .E -- P P 5, QE CE fi? J, e5 TJ Q 'E Y 'E TZ C . - . . I U H 6 G1 S 3 3 3 3 O U fr LL. N CL. -- - wr l-' oi Chicago ........ 5 5 l 5 l 6 8 8 46 Northwestern .... 5 4 7 l 7 5 3 6 42 wisconsin ..... 0 2' 3 s 3 o 0' 2 15 Purdue .... 0 0 O O 0 0 0 4 4 lowa . . . l 0 O 0 0 0 0 0 1 The Summaries Event F i rs! Second T11 i rd F ourzh Record 40-YARD SWIM Ries CCD Branower CND Halley CND Hamilton CID 120 FANCY DIVING Beasely CCD Billows CND Kidder CWD Rossiter CND 220-YARD BREAST STROKE Daniels CND Stemmler CWD Lowry CND Strauss CCD 3:06 415 PLUNGE Holmes CWD Gordon CCD Grossman CCD Rossiter CND :34 415 lso-YARD BACK STROKE Daniels CND Stemmler CWD De Swarte CND Williston CCD 2:14 415 220-YARD SWIM Ries CCD Branower CND Alliston CCD Halley CND 2:48 315 100-YARD SWIM Ries CCD Branower CND Halley CND Piper CCD 1:Ol 415 440-YARD SWIM Allison CCD Whitney CCD Branower CND McMurdee CND 6:41 160 YARD RELAY Chicago Northwestern Purdue Wisconsin I 226 l 15 r mmm-mn i.m..immumm iiliEiiliiiii?KEIEFEZEISIIRiiiIiilimiiliiiiiiiiiiii?ilili?iii Page 239 Em.....IIwgIIIIIQIIw.iI.II.II...III..mI .n... III ..,n I I I II. III.I.IIIIIIIIIIIIIIII...I.I.II.II.IIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIII.II.I.IIII....IIIIIIIIIIIIIIIIIIII...IIII..I..II..IIIIIIIIIIIIIIIIIIII IIIII .I IIIIIIIIIIIIIIII...IIIII.,IW..IIII..III.II.MI.MINIIIIIMIIMIIIIMIIMEII.IIIIIIIIIIIIII.IIIIIIIIIIIIIII.II.II..III.,II.IIIIIIIIIII.IIIII.II...II.III.III..II.! 3"QWIIWIIIIIIIII.....IIII.III..,I.I.I.I..liIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIII., .II I IIIIIIIIIIIIIIIIIII I I IIIIIII I.. III.I..ImI I IMI ...I .II I...III.III...II..I..I..II..I.....II..I.II.II.IIII...I.I..II.II..I.I.I..I..IIIII.I..ITII. I.I I 'I II I.I...I..I..I.I..IIII IIII..Wml..I..I.l...I..II.Il..II....Innmnm"'vH2 I I , i gwwe I I I I Holcombe Warren Heseman Rohde Tasche Woodward Schlatter Ojfcers FREDERICK E. SCHLATTER . Coach IQING G. XVOODWARD . . . Captain LESLIE W, TASCI-IE . Captain-Elect Personnel KING G. XVOODWARD, W, Tumbling LESLIE W. TASCHE, Flying Rings ROBERT L. HOLCOMBE, I-Iorse GLENN B. XVARREN, Horizontal Bar EARL bl, HESEMAN, Parallel Bars ARTHUR A. ROHDE, Parallel Bars Record of Season Varsity, 54 2135 Freshmen, ll 113 Meet with Milwaulcee Y. IVI. C. A., cancelled Conference meet, cancelled I II ...MII II II. II IIIIIIII .mi IIIWIIIIIIIIIIIIIIII-:I ImmunIlnmiIIIImIIIInImnIIIIIInnIIImm 2 I mmm lwmmmmu I IIIIIIIIIIIIII I-IIIIIIIIIIIIIIIIIIIIIII M nm V I I I IIIIIIIIIII III IIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I IIII IIIII III IIIIIIII IIIII I I IIIIIIIIIIIIIIIIIIIIII II II IIII III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIxIIIIIIuuIIuIIIIIIIIIIIIIIIIIIIIIII IIIIIII w Page 240 ra- ui ii i I I :mm 1 1 nr ir r in 1 I 1 , ,, ' I s Freshman-Varsity Gym Meet February 22, 1919 The Result Varsity, 54 213g Freshmen, ll I X3 Parallel Bars WOODWARDCVD ROHDE CVD f tied HOLCOMBE CVDD The Summaries WARREN CVD, first GOLLEY CFD 1 GRIEM CFD D Horse Flying Rings Roi-IDE CVD Dtied for mst WOODWARD CVD, Hrst DEWIRE CFD I TASCHE CVD, second. OHLSON CFD KATES CVD GRIEM CFD tied for third OLSON CFD tied for CAMPBELL. CFD Roi-IDE CVD Tumbling WOODWARD CVD, First DEWIRE CFD I TASCHE CVD I tied for second Horizontal Bar tied for second third mu nu i uimvi umm mum: nn mmnn Varsity Boxers .....mmimm.u.n ..i.m.....mmm.. m.n..,w..,.- l..,LL'lu1i....n..uLMw iniiuinuu :uv :uni mini A 1 4 ii... ...i.,..w..i.,i .H ii.. .im.Hi...i.i..i......i.i. .1 P a g e 2 4 I wmmmnummmummmmmmnmummmlmmvmnmmumyllmmmInnmmmfnnu,mmvulummmmruvrnlu1myynummmanlnlmlmmlmmumInmmm:lInnumnnummmmy1nvInuvnufnmmmrmmlmurlInluumInunmmmlnlullmurmymummulananlmnnlnllmvumumulurnnnrlanmlnlnluvlnumulm1uwlnluwmmllnluummmlum1InwnvInlnlInlnmummmmvvuul1ulummmummanInnnlunnuplvwllgmwnlmmmnmnnummmn "'"""""""""""'i""-"""""""""""""" l l nnmmlmln n ul l rl. mmm Immun rmInlmInmlmnmmmlwmulmymlnl.mmmummmumummmmmmn mm lnnnmnmlmnl I ummmummmummmmlul1vumm.uwlmlmwwllwmlul.Mun nnuwmm .1ImlnllInnllulmmmmnnmm.mwmwm ln um 1 ,lu nn ln nlmwmmmmmnml mmm. ummmmmmmuwlIn ur mm-mmlmlmm w The 1919 ivarsity Wrestling Team , Lueck Dahl Steinauer W Weeks Frank'in Mercer ' Kirst Nienaber Bontley Royce Williams Albrecht l-lembre JOSEPH C. STEINHAUER . . ..,.. . Coach HENRY B. ROYCE, l2O pounds JUDSON S. XMILLIAMS, l-li pounds ARTHUR C, FABER, 165 pounds HAROLD T. ALBRECHT, 125 pounds LELAND A. KIRST, 150 pounds CARL V, PETERSON, 175 pounds l-IELMER J. HEMBRE, 135 pounds Louis FRANKLIN, 158 pounds HERBERTJ. WVEEKS, over 175 pounds Ames won only dual meet of the year, 42 to 7, Weeks taking the only bout that Vxfisconsin captured. 1 Opening Round of Boxing Bouts 2 I ' ..l.m,.l...,,l..WH.,,..,...,...,l..,..,,.,,,,.,...,.,.,... , ., H .l V. . W... nl.. nl... .,,..,..u.,l,..l...,,.,.,.n ll . n l. n ....n,,. .l,.,.n.,..,.,..,.. l...,..l.,,..W..,,.l..,,.l..,.ml.,ll..,U,l..,,..,..u...,.,,..,.,,. W.. . . ...1.....,.,....u..l..lm...H.mm..,..,l...,.,..,.....,,.,..,..,,..,m....,...m.,.WE5 nunmnnmlm1lummnulnmummuunununlulullvulnumlnlllululmmmumumumvm1lulunlulnnlullnllulullnlvrwlu1lmulrnlulmllnlnnnumlanlnlullulln1urnllullullmullulnllululullulanlmvulnunlnllilllilliiliumrnlunnliiiiillillliilllliiilliliiilulllnlun1lvuul1mllnlnllilliiillililiiillllnnlmlnunmmlnllIIHIIFIGIFEIITHIIIIIHIIFIHHM11ululluunnumlnmnannumruFlllfmliluxnuuHEEEEHHElinnmnIEiGnmmnlrnlniiiinnllnvulmillnlllznnxzxu P a g e Z 4 2 Inter-Fraternity Basketball Delta Upsilon-Champions, 1919 - --Jig? ,N A , A AS ."S"f7 5K tg n , X ftp 1 .1:::,:,f:.. N, 1 1' fix " 1 Q , M ,, - Nita ! -K K X f, . 4. -,,.?. L-. - l 1 ' 1 1 V, ,.- 'V 1 Q' 'ai ' 1 ' " J ,IQ ., ' ig h . J Q , 4 I -.,k ,-if--' If T' . . 1 -i . ,gi evfrjitrl- K - ' ' jfis-.w 'V - -Y 'A 5' f Q, ' i f i ' 1 .5 .,.. s ' S -h-' ,, 1 i ii k-l, . , lax .Ric I ,I fggigji if 1, f 3 ,1955 1 .. 'yin--1.L..Qf', f , ' , Q' Qff, Q. Littig Dougherty Evans Harris Ryan , Warren Balch Holtz Kellett Records of the Season Preliminaries I Group I W L P Group 11 xv P CC. ct 'Alpha Sigma Phi ..... 5 1 .833 Phi Beta Pi . . . . 5 833 "Phi Delta Theta . 5 l .833 Kappa Sigma . . . 5 833 'Beta Theta Pi . 5 1 .833 Sigma Chi . . . . 4 666 Triangle . . , . .3 3 .500 Phi Gamma Delta . , 3 500 Chi Phi . . . . 2 4 ,333 Gamma Tau Beta . . 3 500 Sigma Nu ..,. l 5 , 167 Theta'Xi . . . l 167 Delta Tau Delta . .,., 0 6 .000 Theta Delta Chi , O 000 " Tied for first place "' Alpha Sig won first place on a ross " On playoff Phi Delt won from Beta Group III I Group IV Chi Psi ...... E . . 5 l .000 Psi Upsilon. . ..,.. 6 OOO Delta Kappa Epsilon . . . 4 .800 Delta Upsilon . . . . 5 833 Phi Psi ..., . 2 .500 Sigma Phi .,.. . 4 666 Delta Phi Epsilon , . . 2 .500 Lambda Dhi Alpha . . 3 500 Sigma Alpha Epsilon . . 1 .200 Theta Kappa Epsilon , . Z 333 Theta Chi . . . . 0 .000 Zeta Psi .... . 1 167 Alpha Delta . . . . O 000 1 1 Semi-Finals Phi Beta Phi . , . . 24 Phi Delta Theta . . 2 Delta Kappa Epsilon . . 16 . Kappa Sigma , 12 Delta Upsilon . . . . 14 Chi Psi . . . . 9 Psi Upsilon . . , 12 Alpha Sigma Phi . 1 l Finals i Phi Beta Phi . . ll Psi Upsilon . . . ' 4 Delta Upsilon , . 16 Delta Kappa Epsilon . .15 Delta Upsilon . , 15 Phi Beta Pi . . . 14 Delta Upgilon , 22 Psi 1,lpSilOI'1 . . 1 l immummimmmmmiimlummmumimmnmmmmummi..1. H . 1 Iiminmwmumimumininimnmnnummiumnnmmum v i """"""""" Page 243 Iimmmiivimwii -'D E A I - s. -.J I v VN PII V V tx fglzircl Annual Ice Carnival JOHN W. BRINDLEY . . General Chairman GEORGE MARTIN . . Clerk of Course LATI-IROP FOLLETTE . . . Night Carnival WILLIAM B. FLOREA Prizes and Programs CLARA WILLIAMS ...... Booth Mile Open CMenJ Chester E. Rieck, first Irving Cox, second Lloyd L. Pfrang, third Quarter-Mile CMenJ Chester E. Rieck, first Lloyd L.- Pfrang, second Carl J. Seifert, third Lake Mendota, February 8, 1919 Committee Quarter-Mile Girls' Doubles Kemp and Wilcoxson, first Gaik and Ely, second One Mile CMen's DoublesJ Rieclc and Pfrang, First Cox and McAdams, second Dougherty and Swan, third Ice Boat Race, Three Miles Liberty, Hrst I-Iermes, second Yellow Kid, third Wisconsin Maedj e . Nott . . McCabe . Warner Ladvin . Teckemeyer Hoclcegf Game LUDLOW NORTI-I . l-IILDA lVlABLEY l ' ' Tickets JULIA I-IANKS . . . . . Prizes ELEANOR STANCHFIELD . . . Publicity PI-IYLLIS HAMILTON. , . Womens Entries Quarter-Mile CGirlsJ Marie Wilcoxson, first Elizabeth Moss, second Auto Lyman, third Broad jump QMenJ Lloyd L. Pfrang, first Irving Cox, second Frank C. McAdams, third Miss Wisconsin, fourth Milwaukee While Squadron, 105 Wisconsin, 1 , . Center . . Rover . . Vxling . . . Cover Point . Point . Goal . White Squadron . . .Robleski Carlson A. Stoltz Schinner Zottman . Varel InrmmimimiInnumIimnmimimuir ImmiiniuiInIInInmlImInInmiInIimiiininmium Page 244 9WI.WwI.1mww..mw..vm,mmummm-IWmumH1MW1MN1wm.H..mm..vm.mm-M-mfm.mmmm.nwm.w.WW.Hvmmv.w.wm-mlmnmwmm..m.umu.mm.XX.1XH.XX.1XmXmWw..4mmm.mm.mWW,mmmm.vmnmH.X1.11W,..XXHXmX1.mw.m.m.W.-H.wwWmmumu,.H.m.nm,mmmm.,V..WH.W.Hmm...,.mw.mfmmu-wwHmmm,mm,mmuw.,mmWV..WH.1InmyIHmXX.1wmwmw-mmU.H-m1mmm..n.umm.mm.mm,w.u.mm.mw2 gn.mmm..-mmmff.HM.U.H1.Hmmm..wnm.n.mm.mmH-myWWW.HW1.X.UXmXInum.m.mw.m.w.mm.mmmm.mn.mmmm.Wmmwlmlmmfumm.m.hw-mm.mmWm.mmmm.XH4X.HWwX.1wmu.m.mwm-mmH4u.mm.m-mmmM-1mm.X1.XvmH.X,HXI.XmwmwmX.IXHww1.4W11v.mm.m..m.w.mm..ww.mmfm..Wmlm-mlmmHmlmMumW11.X1-411Hw,HX.HWHXV..XWmunmwmmm'mm-'mmmmmmm.umH.wm.m.wm.....3 w- ifi -1 . 'Q-'Y 1 Ei: 1 kv VN? Yelmwm. u,,a gl 7 QVV! .fa W, ,..... ww. NPV 2 43, marie' Haw N102 EEE I ' 1 E25 g ,, 223 ! ! l :EE WY I hsrh isa Sets ix SEE he P UCI, J" 552 EEE in mmmnmmnmmmmmmnmnnmmnnnnmmmnmmmmmu 5 5 5 anY...M.,.N.Wm,.m...u.........u..,...,.m..,H.Y..,,..m.,...l......,.Hnm.,K.m.,..,.Hww.U.WH.umm...,..um..,..,...,.m..,.m..m..,.H..m.....,mW...nu...K..W,H.,,.....,...w....,.,....,,.,,..,mi...m.,.,.,,...,.H,..w..,K....m..mm.w...,,...,..,..,,.w....u...W,HW...W....,.W..,..,..,....W.....,um.,...,.,..,.m,,...,,.W,,,m....,.,W...K.,H.,f...,m..Kmvm...u........,,..mm.... E.m-:ummmnrumwvuummmumunxiniiiiiiiiiiiiiIIHEIIEEEiiliiunmmnnnmlvmnunuvnuuKMnnuunanmmmiiiEEEMEMEEIIEEEEIMEEGHEEEFEIWIEEE?MuiEP?M5riiu1?EYiiiPiEniEnuFHxvmmmumrmmmm:rmmm:runumrmvmunuunnumnu1ummmuwmwmmm1m1mmnumrmummmmInwrunuzuwmm:mvuwnzwmnnnumIninnunmuwmvnumu1nummmummmnunummm:ununnnuummummmmuvnmmnmnmnmnm P a g e 2 4 5' ,, E yumnnvmnummmmmuwInwmmnnmmwmmmrmwuwInmwanwmmmmnmmruvmwnwmmm:unfurnwsuwuwunummumwmmmIninwumm!un5:1wnunwuwunummuinwnuI4wnwInummmInmwwnwInmmmmmu1In1u1vumwinwmuwmmnlwInyuuH4ruulmnnwuunwunwWnnanummmumwrum1uuinnummm-mluIn1u1InnnwInmmmumwInmwInmuvunmmuunrmvuunvunummm:mwunwanwuumvwummmuwwnunuumunurwmumuuuuInrnuvuwuumumnmmmng QQfEMEGEiEl5RiiI..ImfluX.Hmil.1lm.Wi-nu1mV..1W1-1XmHmmmfuW1mullmmmmmlrunurnmwummm.XH4wH-inmwul1--mmmru1I-4fuwu1In1.mumWwuwmmwHWKmummmrmm1m.H1mummmulW,NH,nuimmmm1mlIn.in1.XyummmmmmmXm1uXm1.wmmmwuwwuwInInwruwmmmuInN.1H4uInmrm-mm...W.H1In1InmXummmwHwInmlInu-IXmy-mmmin1Wnlwmnlummm.1.iquiwmwmF?iIi.1iiiQLiiiiiiiiilliEil7ili1?iillElEi1IB'3 5 -1- 22 EN ,. if " 225 if ES A :S " :z 555 552 25: 555 ss: E if R: E if E5 555 E -- E Em :SE vm 2355255553213515553MMy55M3,5M3If3Q,,,H,:I53:53,5W,..1H.,.U,..1,...,..,,..y...,...,..,...,U.,WH.....,..,,,.,,..,.N...,...,....,.,W,..,.H,..,,M.H,..,y..,,U,..,WX...,..,...N.,1H...N.,,..,W,..,m,..4,..,H.,H,...H.,..,,..,.,,.,.H.,..,,..,,..,,..,.1,W,..,y..,...,.4M..XH.H..N.,...yW,..,..1H.XH.W,..,V.,,..,.HXmu.U..,WMK.,,..,,m.Hi..,......,...,,.,...,...,H,y.......,.....X.H...UH,m...mlH.,V..N.M...,.,.......1I.,X.mmH.K.,mn.MV..U.,,.....m........,...,m...m..m.....,as: . ,,.,,,..,..,,..,,...,, .H ..,..... . ....,..,.,.,,..,,.. ,, ...,.,,.... ...,,...... . . .. .... ......-.- ,..,,. ,.,.......,...,h.,....,.,,.,. ....... .. ..,..., ,....... ..... ..........M.W. ,...., .,........,. .. ........n...M....,.-.M,...,......,............,,.,.h.............15 .uwmmunnumnuummm'mwnmInnu,ummmmmwnumumInmumul1vuumwInummufwnumwmmumummmumm.H X '""""'"'"""""""""'""""""'"W"""""""""'M"" ' ' 4 I1W.U,.HWH.W1.11.11.HW.H,..Y.Hlm.H,.HY...K..,.UWK.,mm.,..W,H,..1.HX..Xmu..M...,..,1HWm...,..m,,.m.,...1H41...K.,X..Y.W.U...,..,,H,..,......X.N..Xmn.,.......1.M,.m..m...,,H.in...4nu.H...U......,..4...,......,.H...,,H,.........4X...XM..mu..N..m........NW.H.HM....m.u.....wW..,.mm..n..1.uK..,H...u..,m..m.....m.mmmm.ma P a g e 2 4 6 EEE fi Eh sae W.. ,...,K.n.,.....,,... H.. ,... ...NH,...,.......,......,..., .,,......,.........., , ..,..,... , ,..,,........1...... .U .,.. .., ..,.., H.,,..,..,um.,,..,......,..,...,,. ,,,.,,..,...,...,.,.. ,. ..,,.. ,..,,,,,..,,..,,.,.,.,,, .,,.,, H. ,..,...,... , .,,.,,,..,.., ,H ,.,, , .,,..,,..,..,,..,,..,..,,... ,.,,..,..,,.w.1...,, .,,,,, ,. ,,,.,, . .,,.,,..,,.....,... ,..,,..,,.,,.,,,..,,.4,...,,,.,.,,...,.,..,., .1,..,...., ,.. ..., mm.. .,,...,. , ...,,.. , ,..,.,,...,..,. ... ,.,n. ,,,.,,..,,...,.,, .,,. W., ,..,.,., ...... ,,,. nn.. ..,.. U... ...K.. ,.., ,... ,..,,..,,.,, .,,, W.,,..,..M..1...u.,.,.,,...,.m..,,.m 52W,..,.......,,..,...,...,..nK..,..........,,..,......,..,,..m.....,u....,,......,..,...,...u.,,...,.,,......,..,,.n...,.....1...H..,..,..,,......,..,...,,.,,,.,.,.,..,..n..,,W.,,....,.,..,...,..,,m,.:p:,.::,.::.z,:..:.:zaz:::n:mana:annaazzzzzzaauzanaman::a::s1:a:z::1:::n:zz::z::1:anna:z:n:m::aasx:::::n:::s:za:zzQ:asza:Q:sz:amzzzzzzznzzzxzzzaamnzzzq:annauma:sssnanzzsgzzzzzszn:z::1z:zzz::1:agaaszanzmzzzqazzannasense::m:a:x:z:a::a:xmaszanzzznznamzmznnznzsasm....,..,,:m:mrunzmmmasznnmmfs2 E 5 552 E 2 S35 E , E EE 7 f ESE , iii 5 1 EEE W 552 iss EE EE 252 ii? EES EE EEE Ei? 3: -1 E55 2.5 E25 egg EE K , - : n 2 5 gggygggggggggggggggggglfgggggggggggggm55555gmmffgfgmmglmgE5MmgmnuummmmmmlnlummInummmuwm.m.mmulwmlmnluH.y.mm.m.n..u.11mumm-ummm.mmummm.-mmmmm-I--mmm.-U-.umm--1umwmmumw..H-mmwmw...H.mumlmlmmuumm.NmmmW.m...mmumulmlmm-mm1mmmmu-nl-Wm.-..mmmnm.mnmXInmmmmnummm.nmx.mmmW,-m,.mm.m.,m...m5 5 annmummluunmuvunnummmwmnunmnvmvu1numu1nnnuuunwsnwanummmwnumuwmannuummmnnanmmmumunnummwnunnmm:uvumuummnumummunmummmnuunwunumummmmmwummnmmmmummInwu1mnumInmwInummn1m1mmmxInmuinmmulhimihhilinnilmllnEluvilfiiiiiiliiviif1u1mmilinFIREmin:1ii:nivimmInmummmruwnmnumnumwuvnum:mmmwnum1Iavu1AnumuuummmmmnuuummumuumummnE Page 247 Second Annual Inter-Fraternity Indoor Sigma Nu , Sigma Phi . Sigma Chi . . Chi Psi Phi Kappa Sigma . Kappa Sigma . First Pauly Sigma Chi Stolley Sigma Nu Sundt Kappa Sigma Brothers Sigma Nu Reed Sigma Phi Hall Sigma Phi Kayser Chi Psi Pauly Sigma Chi Ramsay Chi Psi Knollin Phi Kappa Si Sunclt Kappa Sigma Knollin Sigma Chi gma Track Meet Gymnasium Annex, February ZZ, 1919 The Results . 34 Beta Theta Pi . . . 33M Delta Kappa Epsilon . . 31 Gamma Tau Beta . . 28M Phi Alpha Psi . . . 21M Tau Kappa Epsilon . 19M Chi Phi ..... Psi Upsilon ...... . 1 The Summaries 40-YARD DASH Second Third Fourth Fifth Knollin Fourness Sundt Stolley Phi Kappa Sigma Sigma Chi Kappa Sigma Sigma Nu 45-YARD Low I-IURDLES Pauly Pourness Hall Field Sigma Chi Sigma Chi Sigma Phi Beta SHOT PUT Bach Bricklzauer Blatter Barr Camma Tau Beta D. K. E. Beta Sigma Chi E MILE RUN Ramsey Pinkerton Knappen Dorries Chi Psi D. K. E. ' Chi Phi Sigma Nu 40-YARD HIGH HURDLES Knollin Stolley Collins Pauly Phi Kappa Sigma Sigma Nu D. K. E. Sigma Chi ONE-LAP DASH Stolley Fourness Kayser Stickert Sigma Nu Sigma Chi Chi Psi Phi Kappa Sigma 440-YARD DASH Pickard Scheidenholm Ramsay Dorries Sigma Phi Sigma Phi Chi Psi Sigma Nu POLE VAULT Klague Stolley Wolf, Phi Kappa Sigma Sigma Phi Sigma Nu ' Blair, D. K. E. t- d Woodward, Beta le Kinnan, Chi Psi 883-YARD RUN Brothers Ramsey Pickard McCabe Sigma Nu Chi Psi Sigma Phi Phi Alpha Psi STANDING BROAD JUMP Metzger Risteen 1VIcCalJe Stolley Beta Kappa Sigma Phi Alpha Psi Sigma Nu ' RUNNING BROAD JUMP Stolley Kayser Pauly Knollin Sigma Nu Chi Psi Sigma Chi Phi Kappa Sigma I-IIGI-I ,JUMP Risteen, Kappa Sgmal . S ndt, Kappa Sigmai Reed, Sigma Phi 1 fnrlcd Plzdluly, Sigma Chi Itiecl Ewald, Psi Upsilon FOUR-LAP RELAY Chi Psi Sigma Chi Sigma Nu Phi Kappa Sigma .mmniuiIininInimiinIiiIinmiiiiiiimiiiimw IiiiI.III.,IiiiiiiiiimmiiiiiiiiiiiII..IinIiiiiniimimiiiiiiiiimii Page 248 7M SM 4 3 3 2 R ecor d :O4 3-5' 205 4X5 36 feet, 9 inches 5:03 ZXS 105415 :l73f5 158315 9 feet 2:16 IX5' 9 feet, 3 inches 19 feet, 9 inches 5 feet, 6 inches 1:11 ' W. A. A. Board Wallrich Faville Bartholf Schulte Wise Hayssen Craighill Chadwick Weld I-IJ ermstad Fellows Gaik Patterson Ochsner Hamilton Williams JEAN PATTERSON . CLARA WILLIAMS . MARGARET SCI-IULTE LOUISE WELD . . IRMA HAYSSEN . , PHYLLIS HAMILTON GLADYS FELLOWS . WINIFRED BARTHOLF LAURA FAVILLE . ELEANOR GAIK . MARIE I-IJERMSTAD MARGARET CRAIGHILL RACHEL CI-IADWICK LUCY WALLRICH BERTHA OCHSNER . RIAH FAGAN L . GLADYS WISE' . . President . Vice-President . Secretary , . . Treasurer Outing Club President . . . . Hockey . Indoor Baseball . Basketball Bowling . Swimming . Archery . . . Tennis Outdoor Baseball . . . Track . . . . Dancing Graduate Athletics War Work Chairman I-lyacintha Murray mmmInlnIInniI.Nmi.Nmmm.m.m,.m. IIuinvIntmulimIninIuiImInInIInmumnnmnmm Page 250 . Im.. . 1 . . vm mum ulmmmummmnmmml uuuzuuum ImmmummwuwumnnmmmvummminmummumvurmmummwmnwwnummmummmwnuminvmummwmvvuwuwruwInmrnvmInm1mfmrHw.IwmW1ynwmvuwHuw1uwuwinwInmmuummuwunwmnuwInwnwummmmwvuruwruuuwmmvmvuwuuulwuwwuwruummanunuwInulwuwanummunvuumwInmmnvmmunnmn u 1 I ..,. . 'H W "HW1"HH'''H'H'H'1H''H''H1"H"1H'1'H1'HHH'H"IH'I1'HH"1H1H'1H'H"H'1HI1H'1'H'I-1'IH'H1H1H11'HNH1H'1H'HH1H1HH1HW""11f-W"11fI11v'e i5.,......u..1...,...............,..,,,..,..,H.,U.,..,....M,..,.HN.Y...,..,Y.U,...,..,...,..,..,,.M,.,,...,..,..,,..,...,,,,,..,W,..1H,,.H,.1,..,,..,,.,...,..,,M.H,,.,...,,.,,..,...,,.,..,,.,,,.,,,.,,.,,,.,,..,...,..,...,..,,.,,,.,..,,...,..,,H,..,,N,..,H,,,.,..,,..,...,..u..,,.,,.,...,,..,...,..,,,.,..1....,..,...,,..,...,,.,...,..,...,..,......,,....U,,:,.,.,,.::a.,,.::z.:1:zzian:zz1:zz:zzz1:11511:az:azzza:1az:z::::::15:1:az:zzinn:::z::5::::::::z::::a::z::z:::::::1:::::azzn11z11::zzszaazzzszzzanazzznziszxa::::a:am:z::s:aL::n:x:a:zsaznzxzmzzzwuS a :gs ,4- 25 555 5 E52 E E EEE EE Final Emblem Weavers 'gs :E E E22 5 , E25 4. " ' ESE ' ,hifi ' E55 E25 L.'f'-..Jg. -- ' :sf HE GLADYS EVELYN PALMER MARGARET ALICEFFRASER LUTIE MARIE NELSON 3 3: EEE -is sas 961709705 515 EE 555 E.- Egg ' sa: 555 SIE 55: :li 525 Eli gs: ei: -m ,- if EF Emmmm5w!.5H5W...,W......,..,.......,..H..,,.....H.,M..,.HW,.....,,...,.....N..K..,..,K..y......M..,AK...M...H.U.,,.U.UU.U.,H.,..,.............vm...mH.muum.,..,,.,,..,,..,W.,y........,,..,ug......,y.,,..1,.,H.H.,,..,......N.,,............,.W...,.....,...,H..,.,..H.,,..,...nm.,,mm,.....I,.,,..,...H.,,.....,1..H.H..,,.,y..,nw..,..,,....,,......H.W.,.H...V..mm.H.mnK..n.,......,,,.mm..m.my......f................m..,.,mm.,..,..,....1.....m........,..,,..1...f..,.s1E m...,,...f...,,HH.umM...K..N,1...H.,I.,W...I..um..Y..,.HW.Hm....,.....,..n...K.....Y...I...mU.WHmm...W.,..,I.,K.....1...X......mW.,......1y..H.,.............X..W...H.H.,H.,..,I..u.....,...K.,u....4..,,.HK.,um..K.........WK..nuK.........,.....1.....HK..,.........M,.,H...,K...M..,,...........u.,.,..,..,..,...X...,..,..,...H.,H.,.HX..,...1.4H.,H..I.,........M.,H.,.U...,,.,.,.m.u.n.:1a:mmm1.-'.,...mn,.,.W.,,.1,...H.......H....mmmaz5.1.ear,.......um..,...W..m.w......LE Page 251 'HmyWIn1nvm1mHH,mmlmrmin1num1u1Inm1mInrm1HWIn1.HnufuW1mym1I.wInwInulWm1InmyIn11.1mvu1yu1InnlunwuwInWu1ul1n1fuwI.wmvuwIn1Uun1I.wIn1I.1mw.IwInwIninmyIn1InInwIn1H1n1Wm1InwnmlyuwIn1Wmnl11.1vmynm1fumfmmwI.wIn1Ininm1rnnl1yn1u1In1nwInru1H11u1Inm1In1.I1mvu1In1u1.I1fu1mXI.uvuH.1in1mIn1.I1H.1yuulNu11.1NIn1n1InulXIn1uuK..wInm1fu1u1in1In1.I1Innn1Inm1In1n1In1In1.I1m1In1.mnXm1uvIn1mmyyu1In1mnnlmmummmmw-ug 2S16FilQiiilillFIZYFIIUZQIIZ1iiiQliiiiiPFI?lliliilIllXFIQIIIIiii1511151iiiHi?lil?lilHI?lilHIElil1Iii1ii1iiiIiilPilliii1lilNl1illPIIIFQIimin1mmmynl1in1I.wIn1.InuwI.1.H1-IXInHHmfu1In1InInwInV..1.Iml1InIn1H1I..w1.1InmwmW1mw.111.1WX1.1ul111V-1w1-4H.XWm1u1m1n1Inw.I1mnl1mm1uf1u1n11.1nnrnm1mnnulnnmrminunmXu1ul1.I1m1u1Wwu1in1In11.uynnl1mInumnl1min1munu1.1ynmuU.1InNnuvuW1In1InnuInnl1nuInnurumwnnmnn1u1in1nummfmmwInmwnnmmm-mlmumnggE H, ES 5 555531MENHUHUHuumEHmeE5mf1.151myin1ugEW.1inwIn1in1ufmw,H1m1nv1Inw1.wW1yu1m1vuIn1Inwu1In1mWInfmin1In1.1wInWInL..wInm1u1wuwW1mwnwm1mm1u1ul1Wmwmwu1--4mwinm1ru1-Hfu1Inin1InmWWynWInmWuwfn1u.Innl1ulXnwwn1furuwu1Inm1In1W1uNmW11I.1mmum1I-4InmwIn1uml1In1I.1in11-wm1H1nlummfm1I.1fumm.vu1.I1nl1InXmm1muWU.1InV..1In1InmlnnWmm1H-rmnumunnwwru1mnummymrllullvumglfwt-3555535 :K..wunX11.1myrm1In1mynuunnmmmwnmInlmmlW.1uv11.11In11,vm1InwulnnwuvwnwmwInwrnwm1.HinwmwIn1I.w1I.1mlmH.11fl1.Hwmm1W1u1in1In1.IWInwuwnlwnlmwfnwInmwmwuwm1mH+wu1mmynlwyuWwInwvuW11.1In11.1Inm1ulnuin1u1WN.INm1InnlXHXynWuWm1H.1InH-1.mmIn1u1lmInnlufuw.I1m1u1wHmyfn1inXInmwinm1mrmm1u1munw1Hwm1H1mnn1H1inWyunumunuU.mm-1nmnrmum-I1fnnum1an1u1mmynuummmmummmmummnmmmmlmmmm Page 252 Outing Club X1 , f Snyder Swift johnson Moe, Sammis Weiss Marohn Corey Hendricks Wagner Hughes Lewis Hayssen Hacsslcr Hammond Wise Board Members IRMA I-IAYSSEN . . . President DOROTHY HAESSLER . Vice-President MARIAN j OHNSON . . Secretary HEI.EN WEISS . Treasurer CLARA WILLI.AMS . , W. A. A. LILLIAN LEWIS . . Hiking HELEN SNYDER , . Coasting " MARGARET SWIFT . . Skating SIGRID MOE . . . . Skiing MARION COREY , . Horseback Riding MARGUERITE SAMMIS . . . Bicycling MARGARET WAGNER . Picnicing EVELYN WISE , . , . Boating RUTH MGCLELLAND ELEANOR HUGHES HARRIET HAMMOND IRMA MAROHN . . Roller Skating LELA HENDRICKS AGNES SAMUELS Frosh-Soph Picnic 1 ii imiuinumInIminumminiiiiiuiuirmmimm I Ii Jiglilggwwiiimww- --4---l wg-MJSWH 5 'd"""""""" M"""' IinIinminiInIuimmmiIiniiiinnuimiiiiiiiiniiiiiiimiiii I Iiiiiimiiiiii iiiiiiiim I .II IIIIIIII. -Page 253 niInmummIImmnumIImImIIIummmInInInI1InImIIIImInImIInInInIInIIIIInnuIInInInIIIIIInImnnmnuIIIInIIIIuiInIInIIIIInInIInImInIIIIInIInIInInIInInnnInIuIInIInInInIInIuIInInIIIImIInIIIIInInIInIInIInIInnwInIInInIInInIIIIniIIIIInImIIIIInInInIImInInInImIInInInIImnIInInIInInIInInIInmImInImnnInInIInIIIIInInIIIIIInInInIIIIInIInInIniIInnnInInIInInIInunInImIInInIimmInIInIIwIIInuImmInIInIInInIIIIIIIIIIIIIIIAIIIIIIIIIIIIiummuniunniu WIIIIIIIIIII-mi. -IEEEESIMIEIRESFiM111l1?iiii"i'l IIIIIIIIIIII-ATIIumliiiiiliinliiiimiInI1 I 11111141.1111 III. I II IIIIIIII IIIIIIIIIII wmiiui mm. I In 1 IIIIIIIIIIIIIWIIIIIIIIIIIIVI1 ,III II II I I mu Ir IIIII II III MII. II WIIIII II Hockey CHAMPIONS-1919 Peterson Skinner Schroeder Saul Everett Ashby Post Schultz Pleuss Head Fellows Patterson Williams King Varsity Team FRANCES DUMMER, '21 ELIZABETH HEAD, '19 LULU SAUL, '19 LUCILLE EVERETT, '19 HELEN KING, '20 MARGARET SCHULTE, '19 GLADYS FELLOWS, '19 JEAN PATTERSON, '19 IVIARIE WILCOXSON, '19 PHYLLIS HAMILTON, '20 SARAH ASHBY LUCILLE EVERETT GLADYS FELLOWS ELIZABETH HEAD KATHERINE BUTLER HELEN CARLSON ELEANOR GAIK DOROTHY HAESSLER CCapt.j SELMA ALBRECHT MARGUERITE CROSKEY FRANCES DRAKE FRANCES DUMMER MARY BABCOCR MARJORIE BLAIR MARGARET BRETHAUER FLORENCE BROWN FLORENCE KING JEAN PATTERSON MARGARET PETERSON VIOLA PLEUSS fCapc.D PHYLLIS HAMILTON AMY JOBSE KMgI-.J HELEN KING MILDRED KING ESTHER GRAHAM MARCIA HINKINS GRETCI-IEN LOOMER NANCY LORENTZ ESTHER CRAMER EDYVINA DEXTER RUTH DICKOVER DORIS LOVELL CLARA WVILLIAMS, '10 1919 JULIA POST LULU SAUL MARGARET SCHULTE MARGARET SCHULTZ CMgr.j 1920 MARGARET MCMEANS GERTRUDE NOETZEL ISABELLE WATERMAN MARGARET WESLEY 1921 HILDA MABLEY CCap:.J ELIZABETH MARRHAM DOROTHY SHAPER MILDRED SCHWARTSBURG 1 922 MARGARET POPE CMgr.b BESSIE SICHLER ELIZABETH SNIDER CCapt.J NORMA STRASS ELINOR SCHROEDER HELEN SKINNER CLARA WILLIAMS MARIE WILCOXSON LOUISE WELD I'l.-KZEL WRIGHT MARGARET SNVIFT CMgr HELEN THOMPSON MILDREO WARSINSKI KATHERINE SWITALSI MARGARET THOMAS IMA VIIINCHELL fl Games fJuniors . 9 Seniors . . . 5 T - fFreshmen , NOV' Slgophomores . 12 NOV' 14 Sophomores . . 3 ISOV' lgriophomores eniors . . 1 Juniors . , 13 uniors . . NOV' 7 Freshmen . I NOV' Isl Freshmen , 0 NOV' 25lSeniOrS . TimmInIIIHIIIIIIIIIIIIIIIIIInIImImiimimiiiImIIIIIIIIIIIIIIIIIIIII .ImiImimimi..IIIIIIIIIIIIIII1 mini mm mmInIIIIIIIIIIIIIIIImIIIIIIIII-ImVIIIIIIIIIIIIIIIIIIIIWIIIIII IIIIIIIIIIIIIIIIIIIII mlmImIIIIIIIIIIImImmmimIniiliiiiiiiilliiiliiilliifliiImnllliliilEiliiiiiiiilihumiminiIIIIIIIIIHIIIIImIIIIIIIIIImiIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Iiiiiiumiiiiiiri mm.IIIIIIIIIIIIIIIImimmimIIIIIIIIIIIIIIAIIIIIII111111111111ImimuiimImmmimImIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIImmminIIIIIIIIII II: Page 254 In I I I In In WWWWI 1 I In I In II I Ir II IIIIII In I II IIII I IIIIII II Iwi I I I Indoor Baseball Hayssen johnson Lewis Reed Sinaiko Fellows KATHERINE BUTLER ELLEN CORRELL GLADYS FELLOWS ANNETTA DONKLE GLADYS FELLOWS IRMA I-IAYSSEN MARGARET -I OHNSON MARJORIE BARTHOLE KATHERINE BUTLER HELEN CARLSON LUCILE CHASE MARION GOSS MARCIA I-IINKINS RUTH MCCLELLAND PEARL MOSS ELIZABETH BENNETT AILEEN CASEY ELLEN CORRELL MILDRED CRETNEY Post Wise Varsity Team XVINIFRED MOSS VELMA REID MARGUERITE SHEPARD 1919 LILLIAN LEWIS ,JULIA POST 4 VELMA REID 1920 LOUISE INGALLS LAURA KREMERS IVA MCDONALD GRACE PATTERSON 1921 PAULINE PAEST DORIS PHILLIPS EVORA ROESSLER , 1922 AGNES GILBERTSON NORMA HOPSON AGNES IVERSON RUTH LINDSTROM Score of Games I Seniors . 28 Seniors , . . Mar. 3 Freshmen 14 Mar. 5 gunlilors V - juniors , 30 A Op Omores . Mar' 4I,SOpIfIOmOreS 18 Mar' 71Freshmen . . Page 255 Iviar. 1 1 1 Donkle LEILA SINAIKO ALICE TUCKER GLADYS WISE CLARA RUDER SOHNIA SINAIKO MARGARET SCHULTE GLADYS WISE MARGARET WAGONER HELEN WEISS EVELYN WISE HELEN WRIGHT MARGUERITE SHEPARD LEILA SINAIKO MARY SWAN ELIZABETH WATERMAN DORIS LOVELL KATIJERTNE ROWLAND MAE SMITH ALICE TUCKER Mar- 8juniOrS . . 32 Freshmen . . Seniors . . . 27 Sophomores, . 17 I I 4 I III I IIIII I I I II Im ini In IIIIII I :Im Bum T"""""' ' q3as7cet Ball King IVIAVIS CHUBB RACHEL CHADWICK WINIFRED BARTHOLF KATHRYN BOLL RACHEL CHADWICK KATHERINE FORWARD DOROTHY HAESSLER PHYLLIS HAMILTON MARGUERITE CROSKEY ALICE DAY , FRANCES DUMMER CONSUELO BURWELL VIRGINIA DORING LOUIsE FRITSCHE juniors . Feb' 27 Freshmen Seniors . . Feb' 27 Sophomores . juniors . . Mar' 5 Sophomores , Weld Chadwick Mar. Mar. Mar. Lyman Va rs ity Team FLORENCE KING AUTA LYMAN ' 1919 FLORENCE KING MARAGET PETERSON VIOLA PLEUSS I 920 AMY JOBSE MARION ,JOHNSON HELEN KING 1921 MARIE FEE MARGARET FISHER 1922 ELLEN COULD AUTA LYMAN MARGARET MCDOWELL Score of Games 5 Seniors . . . Freshmen . . 12 juniors . . Seniors . . . 12 Sophomores . . Freshmen . . IIIIIIIIIIWIIIIIIIIIIIIIIIInIImiiwwimuilim Mar Mar Mar. II .I my II. IIIIIIIII I Page 256 Chubb LOUISE WELD CLARA WILLIAMS LULA SAUL ELINOR SCHROEDER CLARA WILLIAMS MILDRED KING ISABELL WATERMAN LOUISE WELD AMANDA I-IANSON DOROTHY KROPF MARY ALICE NEWTON ELIZABETH SHOLES VESTA WOOD MABEL WINTER 13 fFreshmen . 31 juniors . . 30 15 Freshmen . 38 Seniors . . 39 17 juniors . . 26 Seniors . 25 :E EIIIIIIIIIIIIIIIIIIII...III ..., ...III ..,.. IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.II.IIIII.IIIIIIIIII.II.IIIIIIIIII..III..III.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIII.I.I.IIIIIIIIIII..I.IIII.IIIIIII.II..I..I.II....IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ,,.,. III. .,..., IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIII.IIIII..IIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIII 2: iii ig mg 5: ESE ' EE EIS :SE Outdoor BCZSGZDCZZZ 255 K I SZ: Egg S EI i i I I I ' X I CHAMPIONS-1921 Fitzgibbon Kropf Sell SE Falk Sichler Sutcliff Sinaiko Warsinski Hinkins Shepard 1 918 ,RUTH BOYNTON EMMA DAMKOELER JULIA JOHNSON LUTIE NELSON, Mgr. gg RACHEL CHADXVICK ETHEL DUMMER ELIZABETH KENIJALL MARY RONDEBUSH RAY COOLEY MARY GLOVER CLARA KEPKE HANNAI-I SMYLIE I 91 9 KATHERINE BOLL FLORENCE KING MILDRED PEDERSON ELINOR SCHROEDER 5 MARIE HJERMSTAD, Mgr. MARION OLERICH MARGARET PETERSON MARGARET SCHULTE MARGARET JOHNSON JEAN PATTERSON LULU SAUL HELEN SKINNER l 920 DOROTHY HAESSLER MARGARET QUINLAN ELLEN TENNEY MARIE WILCOXSON SIG!-IRID HANSEN META SCHROEDER MARGARET WAGNER VIRA WINCHELL LOUISE INCALLS KATHERINE STACKHOUSE HELEN WEIss 1921 ADELE FALK DOROTHY KROPF MARGARET SICHLER MILDRED SWEET ALICE FITZGIBBONS ELSIE SELL LEILA SINAXKO IRENE THOMPSON MARCIA I-IINKINS MARGUERITE SHEPARD LEAH SUTCLIFFE MILDRED WARSINSKI I I . A - , , A Champirmship Game I EI, I S52 'EE EEE IE IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIIII II I I I IMI I I I III IIIIIII II IIIIII IIIIIIIIIIIIIIIIIIIIIIII II II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II III - IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIulIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIII Page 257 III IIIIIIIIIIIII II IIII IIIIII IIIIIII IIIIIIII I II III III IIIIIIII I IIIII III I I III II II IIIIIIIIIIII. IIII 21111111111111111111111111111111111111In111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111I11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111II1111111111111111I111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111I11II1I11n111I111I EQ11111111111111111 111111111111111111111111111111 1 1 11111 11 11111111111111111111111111111111 11 1111111 1 1 1111111111 111 11111 1111 1 1 1 1 11 11 11111 1 1 1 1 111 111111511111111111111111111111111 233 Track SWIFT SCHWARTZBURG CROSKEY STORMS ' THOMPSON CHAMPIONS-l92l 4 Varsity Team V 1 MARION COREY PHYLLIS HAMILTON MILDRED SCHWARTSBURG VENICE DONKLE GLADYS PALMER MARGARET SXVIFT KATHERINE GOODHUE LUCY WALLRICH 1918 MARIAN CLANCEY EDITH MARTIN GLADYS PALMER :SE MARION COREY CLARA WILLIAMS Z 1919 Egg WINIFRED BARTHOLF MARY FREE VIOLA PLEUSS ,gg GLADYS FELLONVS MARIE MITCHELL LUCY WALLRICH if llELENA OLESEN 1920 E E LUCILE CHASE RUTH JOHNSON JESSIE MECEATH VENICE DONRLE ELIZABETH KUNDERT MABLE SMITH :QE PHYLLIS HAMILTON MARJORIE SCUDDER 1921 ELIZABETH CHANDLER MILDREO SCHNVARTSBURC- MARY SWAN MARGUERITE CROSKEY RUTH STORMS MARGARET SWIFT KATHERINE GOODHUE HELEN THOMPSON Track Records l-lurl Ball Record Hop, Step, jump Marion Corey, 19-63 fr. Z in, LUCY WALLRICH, '20-Z9 fc. HZ in. Basketball Throw V Running Broad jump KATHERINE GOODHUE, Z2-74 fc. 9 In. MILDRED SCHNVARTSBURG. '21-I4 fr. 10 in. Baseball Throw GL.ADYS PALMER, IQ-226 fc. 3 in. , Q javehn Event T1wmm1 ..1.. ..1..11., .Mm,1 N4I. .,1111111 .11 1.11..11 1111 ..11 11.111.1.11 111 1.111.1.1111..1.1 11 ..1,. 1.111 11.1111.11.1 11111 W1 11111.1111111 1.111111.1.1.1 111.1 1W11m1WwW111W ..11.1 .111 .1.1111 1111.111111.111111.1..111. 1.11.1 11mm 11.. 11111111..1..1111111.11.111.11111.11 1mWWmW111WWmmWMWWwWm1 111.. .111..1 1.1.1 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111Eililiimii111111111111NME111111111111111111111111111111111111111111111111111111 PageZf8 1 1 1 11 111111 1 1 1 1 1 111111111111111111111111111111111111111 11 111111 1 11111111111111 1111111111111111111111 11111 11111 1 111 1 1111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111 111111111 11111111111111111111 111 1 11 111111 11 1 1 1 111111 11111111 1 11111111111111111111111 11.111111111111111 C34T'c11er K Lak.-- .. - A , A , Johnstone Kundert Urban Brownell 1918 MARIAN COREY MARIE I-IJERMSTAD RACHEL CHADWICK IRMA IVIAROHN 1919 MARY JO!-INSTONE ELIZABETH KUNDERT RUTH MARIE URBAN 1920 SADA BUCKMASTER VERA jERc GRACE GLEERUP DOROTHY MCLAWRIN I q 6717118 1 l 19l9-CHAMPIONS Conine Paine Crass Conklin Goetzc 1 11 -1111111.11 .1 .1111 1 1 11 11 111. 1 1111111111 11.1. 1.11 .........1.. 1 11... 11111. 11.... 111111. .11.. 1 111.1.1..11.1..11...11111.11111111111 1 E .1...m1w1w.w1111.11. 1111111 11 1.1.111111rnvnrmnmrz''mmamnzmmam'"'T4r:"'11n"""'TT""1"11mmamF''r""VT1'-11111...mmmm.1"'1..1....:1111ammm1'T'.. 111. '11"rTT"""1""-'1 ..I'f 111.11111111111111111111.11111 1.......1"T""""-'-T"-T...1. 1 1 11. 1 Page 259 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIII IIIIII IIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I IWEEIIHIIITITIIIH I II II IIIIIIIIIIII I IIII I II IIII II I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIII II IIIII II I IIIIII IIIIIIII IIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIII IIIIIII IIIIIIIIII II IIIIIII IIIII IIIIIII II III II I II III III II IIII IIII I IIII I IIII IIII I II III II I IIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIII Dancing ADA BENSON 1 LUCILLE EVERETT IXAAVIS CHUEB ANITA DONKLE MADELAINE GOLDMANN LEONA HICKMAN ALICE NAFFZ DOROTHY BRIDGE ADELINE BRIGGS FRANCES DUMMER Class in Dancing Dancing Honors 1918 IRMA MARQHN DOROTHY REITBROCK ESTELLE SAWYER 1919 SOHNIA SINAIKO PAULINE SHORTESS J ULIA POST MARGARET SPERRY CLAIRE WHITE KATHARINE WHITESIDE CERTRUDE NOETZEL BERTHA GCHSNER MARGARET SCHULTZ 1920 MARY BUSHNELL DELMA DONALD DOROTHY EVANS ELEANOR GAII4 1921 JULIA HANKS ELEANOR RILEY I II II I III I I II II IIIIII I IIII IIIIII III I II III IIIIIII II IIIIIIIIIIIIIIIII IIII I IIII III III IIIIIIIIIIIIIIIIIIIIIIIII IIII II IIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII III IIII III IIII IIIIIIII III IIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIII III II III IIIIII IIIIIIIIII IIII IIIIIIIIIIIIIIIII II IIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III IJM .IIIIIIIITII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIHISIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIITIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIITIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 260 fi 15 If if l 2 Z s ! I E 2 555 -,- -,,. pi.,i..i.,.ii..i...iii...i...im.w.i.,i.l,.i ,.,, ..i..i..i..i,iiiii..iinH..i,.ii..i,Hii.iiHii.1iH.i,i.....i.i..i.N..i..ii.., ..Y,...... ii, ,.1,. . Y,,.,,. ii ..,,. .iiii..iH.V..imi..i.m..i.i..,i,.i,w..i..,.i.i.,i,.,,.,,..W..,.i.w..i..,,.i.i,., ,..,,. iir.ii..im,.iiiii..iiiii.ii..ii.ii..H..i.ii.ii.,..i.ii.ii,,.i..,,..,,.i..,r.,. l.YY...,.. W YY.. ii, ,.1,,. HW.. ,,l.,,.,,,. ii., Y.,,. .wi Y..,,. .i.l,.ii.l..i ..1,..,,,.,,..,,. i ,.,. N ,,,,,,.,,. .i ,,.,, i..i.i..i.1i,..i.......Hi.HiK.,H.i,...i..iii..ii.,,..,...,...i.m.,,.., il. -5' 5 -1: Z E57 :li f g 5 3 2 i 51 .in i i ,2- E, is ,Q 1 is gl Ig Ei il. -i E 2 L sit if' aii . -- 2 -l. -si ga if , . 1 if , 'L . Ii 5 ?'E - I ,. -5, -, I gi. 5 ag , -3 553 'Z 5" -3 EQ 1 ig is I i 5.2 5 1 i , Qj , iss 5: , 2 I i 3 , , 2 . 3 I 3 i 1 i I 5 ' LA DANSE DE LA FONTAINE I A student artist's interpretation of a women's dancing class at Wisconsin. "Even the most colorful dancers appear 'glum gouache' with an unaesthetic background, or in the colorless gymnasium," says the artist, 'But touch up the rhythm ofthe body with the rhythm of musiqvand flexible imagery, and there Hashes forth at once the charm ofa sum- - mer night dancing for joy ofthe high season. 12 ,, 1 E35 sig i ,la Elf Elf 21' wumninmnmimmuiiuiiimninnunmiiuniiiimiiiimianinnmrimnmirimimiimumnmimiimniiwnmiminmiiniiiniiiiiiiiiiiiiiiiiiiiiinwmmiiiniummmiimiimiiiiEliiMEiuiiiiiiiiiiiiimiiiiuiiiiiiiimiiimiiminmiiliiiiimiiiiiiiiimimmiimmimiiiiiliiiiiiiEiinmmiiiMEE.mmmiimnmiiEi5MMiiEiilEIiiiiliiiiiinrmmmiiiiEiEWGlMEnirwiEi1iiiiiiiuiirm5EiilEiiiiinEB.imrnmmiilnium-mlmiiulmmiiillimmi-in E Page 261 in -5 E H ,.., mm..K...K..,W.,l..,..m.....,..,...m .w..... .,.....m.,,.m..m.,.. w,..... M.,K..Y.H,..,H,W...uw.,nm.,,...H.,K..W,.,,..,,.,,,.,,mW. ,...1. .WW..Y..Y...Y..,K..N..m.N..,..1..., ..,,. .Y..w..,,m..W..,..N ..,,. ,...,,.,, .,,.. u..,,.H.m., w.., ..,W.,,.U.,,..4..,H.,,.,,..,H,H.,E.,in,K..n.u..,,.,,.w.,.,3, ..YK.., V.,H,H.,Y..Yy..Y..,H,,..,K.,U..K..W...H.,L..,..,In,..m.,...,..m.,..,,.. ,..1 ...W.HY..H..Y,.,.H,W,..,...,,.,H.Y..,K..Y,.,H,WY,.,V..WY..WK..W.H.vm..H.NK....HH..I..H.,um..,,..u.w.,,..mm,.,..m......1 .ggggwgggg5553:15555555mmE53555ufWvm.HkmW.H1.-4yu1m1nuV..W,..,..mm..mmwf..V..1V..1.HH..1.U.HWXnu.MmyV..1WyuXH.Wm1W11.4V..1.Iwm1In1.11.H1H1H.11.41.11.Urm,H1.H.HW..11HkmK..X..X,H1.HH.1.HN.WmW1.HV..1K..mw.M1..XI.,H.N.1XH4NI.1H.,ynnl11.4WmfWulNL-11HNmX..XWN.HmyIH,...mN.UN-N1.Nrm..W,1.1,.UNEuufmfH55M353353mlE555gmfmwmgm555ggi5533M53553E5me3355953323355gf553fj5wQ1n2EgEgy: gE 1wInwvumlmlmlumm1wmnnwm1uwwmunwInm1imIn1uwfmfnWW.1Wum-numlmlmmI1wH1mWInwInfu1pu1pn1nmmlmuumwuMundi.luiulwfuvuWRiiiLiu1Qi1ni?nuri:hi?liillilPMEli'ii1FII?ii?ii21iiR1Qi1iillii1iiiliQREIILIIREZILEMQIIIIIRlilrmH4rmdunuluinuInnmmlliumummmlmumunmXInnlNInmuInmunuInuwmwlmlnum1ww.1ummmmnmmmwnvmmm.mlumyunuummmfHXulNInwInInufmmmunuinwInnnummInfmlmummmlmmu11nvmmmmnmunmlnnmx Page 262 :gs . - ass - - '-E EEE EEZ gwwffmMQQMM,mfgffmwmfMw.3w...umy.HT!www.,myV.,H..,.m...,H.Km,..um...,..,11.1mWmm.umH.,Mmf...W..m.1W.N...1inmy,..,...um.HWV..V..W..V..Nm.m.HM...ufH..W..K.HmK..NK..,Wmmm.WImV..N..NWmm.mnKmmmu.,H.NV..mmm1.1KmWH.,mm.W.Wm.mmH.mmm.HrmH.W...,..,.M.HW.HW.mn.mm,H,W.HWX..H..H.H.mminX.Mmm.um.,H.H..,...m,m.H.M.mm.H.Um,..H..f...um.m-3 E gm,.....,H.,,...l..,.......Y..,..m..,..,,,.,.,.,....,..,.,........,.m...U..,n.r'f.K..,...,..........,...m.,.m..,,..,,.....4,..,,...,..,V.H.HH.,H.Nmn.,.M..,...W,.m,.,,.,,..,..,,K..mli..,..,,..m.,..Hy..H.,WH..,W......,..,,H,,..H..WW,...,.m..,W......1...,...,..W..,,,H,..,,..,..H..W.,.....,,..,...,..4H.,..,...,,,.,..,,..,..1,y..az,...H..,...,W,..,.a..,..,..,,..W.,,.u.n...:,......u.,,..,Wa..,..,.,.,.n....,......mm,,l....,,...,..,..1,.N,,mn...H.,.,.,.:,,,..,...,......1.:,..,,,.,,:..,...,:,..u...,l.,.a.,..:E3 5 gg 2 5 2 2 E i Si: EEE EES S52 E55 iii 555 ii? EEE 52 555 sf? si: sis :is E55 355 EEE 232 sis 225 EEE -.. .F gee - : E52 :z: :,. gif .V X -.- ,5, :.: :F E EE sgs Q- 525 333 EE ij SE EEE EEE :ss ,F SQE : . E-I Egg gg- EEE 2:5 E : Ei .Ez .- :F E42 EL .1, T EEE Ei? EXE E25 '25 if EEE :gi 555 sis EEE :iz -.- .V 3 zf- .52 EE Es: Eg :iz fi: :zz .i- EEE -K: -!- E35 555 ri: mn u K -I mum EGFIPET- EE mm 52, Eli EEE E 255 512 515 2 5 E35 ESE af: 2 im2WMm...r.m....,....,,m,..,...,,.m......,...,..,...H.U..4...M-MyvmK.,..w.....m.,y...,..,..,,......,,,,,.,..,,.........,..,,..,..,,.....,,..,...n..,.,,.,,..1.,,,..,..1..,H.,.N...m...1..m.U.,i.,,....,.H.,mmW,..,..w.H..,..,,..,,.,......,..,,,.,......,..W.,...,..,y.,,3,......,..,,.....,,..,...,..,...,..H..,..,,..,...,.H...,.....,,..,..,...,..,,..,....,.,,..,...,..,,.,,..,...,,.,...,..,.,.,,.,...,,.....,...,.,.,..,,..,..,...,,.3.u.w.n.,,K..WW.WW..n.......m.....,.K..,.,..m...,..,.,,...s, lg 51mnmnuunnmnunmmnmummummmnnmunnwanunhniihiniiiiiiiiii55151iiiiiEiilliiiiiliiiGRPIIIIFIEiliiillHHHiiiIilliiililEiEIUiiiliunl:iiMilli:nnMuumummmmumvm:wnnmnmmmmmruunvuwInLumummwuwwlunumnum1mmmmmuuninwvuwmmnu1HfnunnumwmnlunwmInwnwnummm:-mmyuyuumInulwwHnuummm1mInumInmamnummumlummwvunyrmnuInmmm11mmmmnummunfffnxzunnmnlmmlwlmmmmllnnmnmuuq Page 263 w n muunuu u1Ininmwm1mInwInn1wInmwuwmyInrnWn1min1invmIn1Inm1H1wInmfn1inin1mmwmwInnlwmwI4wIninwHWm1m1I-wInwInin1nwInruwInm1in1InvuwInmwInwnwH4wnXmwnml1u1m1m1mInmuIn1uumnl1In1Innl1u1ulXInInuInmwnfnnvmnlwmuuwmanwmmwanwnvnvwmmmwwnwanunInwanwmmruwnumrmunummummmumg gmvmInmnmmmwInwInmmumInmylmnwInmwLu1uwmm1mwInnlin1mul1inwuwInnumXnNIn1nwmm1In1mummwmmnml mmm u H V 5 gnmmfm1mfmmmvmmmlw1InmlH1unIninX1.11.Hm.H1mrmmH.W11.1.HH.U..w..1InmmUI.wInnlmf1InH.num1.1wInmwH4W1Inin1ulW1H4InnuWwmm11-1.H1In.HMwH4w.NmwH1WwuvinW.41Wmm11.4mwInni1ihm1Inin1HJRul1InH.1In-.I1HIIIIGIQili?IiIlilIi.ii.iiil1iiR51NIRGI1,IR.H1HQiii1il?iii?E11IHZIQRIIILIIUIREIILQIRlil1EIILIIIGIiii?FIQIEIGIIERIZSERIIIJGIIQLIIRH1151IEQRIEIHZ1lilNIEHSEliiiiiillIIRESREZIEIRiiilIIRIIIiiilliiiii1iiliEEREEEG!Ri?512153111QIZEMIZQIIITEGIIHTSEE Ei? EE EEE age EEE SE SES Zi-2 N- 253 :gi E35 222 5 gligggggggggiggg535gggggglggggjgjyggggjlggggg35111531355555535313gggggiggiggggggggflggglgglfgym353gf355-imwW1...u.W.Humm..W,.mm...1..,.Humm......,M..,..m.1.H...,.mu1..1...mmH...y.UKw..W.m-.Wu.1H..W.U...L..uw..Hm..,m,.m..,..,NWN..um.Hmum-mm-mm.m.n..1H11H.,.m.mmw.m.m.11-mnmu..1.m.y...,E.nw..nlu.mw.m....m..umm..1.1--mm-1.-.1..mm.,mmH..X.mm.m..,m.,m..mm.,..41.m.m.m.n-lm-w 2 5 mmmmummmmmmumwmmmInwmvmrnumlwnn-mmmmmmInW4WW...nw.mmmmmwmmmH4wInIummmlmmwnummummmlmlwmllmummmmmmmmmumInummm-mmlnmwIninmlmmmmmmInummmmnwmmluInmummmumm..ummmummmu-mm,mummnlmlmmmmllmnumm..nmmmlmwwvmvu:mmnmmmuuum.umvmlmnnmmmmulmmuummmlunIlmwmmunnumnmnmnmnns Page Z64 HCH-VH-E?S 1 Y . s i i 5 1 nmIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIII III IIIIII IIIIIIIIIIIIIIIIIIIII III IIII IIII IIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII. IIIIIII IIIIIIIIIIIIII IIII IIIIIII IIIIIIIIIIIIIIIII IIII IIIIII IIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Quarbere Wisl-Inefsky The Liberty Badger I LINCOLN A. QUARBERG . ..... . , . Editor-in-Chief BEN IVI. WISHNEFSKY . . . . . Business Manager Editorial Stab? Associate Editors WHITNEY N. SEYMOUR ALLEN SPAEFORD DORIS SIMONSON, Womens Editor FLORA HEISE, Assistant Editor FANNY MILLER HELEN RAMSEY ERNESTINE JENISON MARCIA HINKINS GOLDES KISCHEL JULIA HANKS ANNE HUMPHREY , Died for Democracy Section MARGARET LEWIS, Editor VESTA JONES, Assistant Editor P, LOXVELL J. RAGATZ, War Editor EEE War Correspondence MARGARET IVIELAAS, Editor FLORENCE GERKEN, Assistant Editor PAULINE POWELL DOROTHY POWELL RUTH JOHNSON E Fraternities HARRY W. BRADY MAURICE M. HANSON, Editor OWEN R. TERRY Q Sororities IRENE HALEY, Editor MARGARET POPE LOUISE INOALLS FRANCES RYAN ALETHA WHITE I 5 Athletics HAROLD A, GILL, Editor JOE R. SHERR 1 I Seniors MARION MCCABE, Editor MARCUERITE GOODING, Assistant Editor Organizations X ELIZABETH HOOPER, Editor MILDRED CLARK, Assistant Editor Activities ESTHER J. WANNER, Editor HELEN ARCHIBALD 1 Satire - KENNETH L SCOTT. Editor MARGARET KIRCH, Assistant Editor HAROLD O. PINTHER HESTER ROBINSON EDXVARD H, ROBERTS WALTER K. SCHNVINN ROBERT K. THOIIIAS Special Features ADELIN BRIGGS, Editor I DELIA PROUDFIT MARION KINiBALL ELLA SCHUI.z DOROTHY KENNEDY I Wfomen's Athletics I MARGARET MCMEANS MARY FOXVLER, Editor SADA BUCKMASTER Forensics JOSEPH B. BEACH BERNARD E. MEYERS, Editor SIDNEY F. MOODY Photography CHARLES E. FANVKES GEORGE B. IQUEBLER RAGNHILD SKAAR HAzEL COUNSELL Editorial Assistants HELEN SNYDER HAROLD O. FROHBACH HOWARD A. GLADDEN GERALD B. HODOINS RUTH IVIARTIN HAZEL WOLFE ELEANOR GAIK DORCAS HALL LUCILE NUTTER DOROTHY MEAD MARY WOODARD Art KENNETH H. HARLEY, Editor GUNNAR G. GUNDERSON, Assistant Editor g MARY BOYD DOROTHY SHURTLEFF ADRIAN DORNBUSH GRACE GLEERUP LAURA KREMERS WINIFRED MOSS RACPIEL STEARNS EDNA GAPEN GLADYS HAWTHORNE CORA MAUTZ LUCILE SELK FRANCES TUCKER I I I i III I I III II IIIIII I II IIIIIII II I I IIIII III I I III I IIIIIIII I I IIII III III IIIIIIIIIIIIIII II IIIII IIII IIII II IIIIIIIIIIIIIIII II I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIII II II I II IIII IIIII III I I I I IIII III III IIIIIIIIIIIIIIIIIIIIIIII I I IIIIIIII IIIIII IIIIIIII III IIIIIIIII IIII IIII IIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIISIIIIiiiHIIIIIIIIIIIIIIIIIIIFIIIIIIIIIIIIIIiiiiiiIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII P a g e 2 6 6 i.i..,.......,.ii.W....,.5,.,,!w.,iii,w,,w,.,w,,i.w.wiW..wi.,.M,f,..i.i,..M.,Wil..i...H.,...iii...i..iii..ii.i......iiiii......iiii.i..i,..ii..iii.iii..iii,..iim.,iimm.,i..,..i,..,...i,..,..i.......i..,..i,..N...,......ii...,...,,.i..i..iiii.,i...,..,,..,,.,.,.ii..ii.ii.,....,...,...ii.,...i..i.iii.,i...ii..i...,.i..iii...i.........i,iii....iii........ii,.i.....ii.,i..U...,..H..iii..i....i.,...iii.W.ii...i...i..,,..,,..,..,....i......i,ii..,...,..ii.i..i......i2 :5: 555 .,. zs: 35 EE gs: :gg .V ii: ,E aa 5E is E5 gmmiuinmuiiiiiimnmi-imiiiuiiiiiiiniiiiiiiiiiiiimimiiiiiim.mini:-iimymiIiiummuimiiimiinumm.mm-iii-inimii-immmi ii miniinimmi-iimlmiinmini'Em-1.min,IiiimillliliiilillililllliiillliiiiliilIIZQIZIITHIlliiliilEllllilllillllWiliiliiiliiiI5UPliHilIillliiililllliililii1iiiilliiiiiilliillliiilillll75211illliiilliiiiliilllliiIIIGHIIICEIIlliilliiiillllliFliliillEillliillllllllillillilillilllllPlliiiilllllliilliiIilliiiililFilllilllilillllllllillilllllillfllilllilililiilillilliiililillliliimllggE -fi si: gli 232 EEZ Ei? ': Hanson Gill Simonson SpaHord Seymour ' - i . 'Y ' lk-' " , ' 3 . 3 532 555 ,wg , .ggi gf, il' W 5' - I ,x -31 ses Sara 1 , ' f if , , will ' - J . - ' fsifgj E52 :-: A Vfi- , , -4 VV . wg wi Egg NSV-5.1 ' wg" . ' '- 1 . , iz- . , , 1: ,,. 'U 3 - i , i -5 K K --xii kg-gi .i --.1 wr VV V we EE ' -Eff, 13,113 l . . 3 li. 3 ' 5: 2:2 2. .QQ ,Vg s.:Vii 4 'f:g,:,,Lf:1.-'ff +V 'J f . i' ,VZ , ' '. ,bg --- iii 2 ' -- ,,,qv-e-eLf.Le,1QziQ.'.:wiff.,--:..,:,:.4.g,f,.fx 2: if Lewis Gunderson Scot: Ragatz McCabe EE Fowler Harley Warmer Hooper Haley iii V, 4.-. f ,.--..-, ,V.,V , .. - 7, 7 --, ,e , , ,,,, WW-.. ,,,,,,o,,,,,.-e 2,2 ,-Q., , J. VV Vf71i..,.,, Q i- V ? ,,m+.C , ,,, . K , ry , A k jsmjwhm ::: aff. 253 - -. ,-. .. ,A -wg.. ,V -:fry -. 224, -. ,. ' V453 f4,:..3V.:,f - - ,, V- . ggg -V -V 1 i -:.V- Vp - ,. , - iz? , , ..,, f- fa'-M --- - -' f ., 1 ijw V f :gg f- V, -x , 2 - '- ' 1 f '- VV 1 V EEE ,. ., i A V.. , W .,,, . . .. Y H WV-fV:.i1V:.f -Vww , -f L iw :zz EE ' - v-v- , , 2 12: ,ri - 4 V' . A. .. T' Q, 4 " V, img" .,.f ,gN'i-y -3:31,-vfg W 4 gggw- gag V V Briggs Chu Brown Kitchell Olesen --- ,W yf:yV-ffegyi. .. 29:5 WQV.-'xi-,J f-X" f 'V - "Q V -'- ffl -' - V 1 ' V. 'V , V V' L :zz ,Q QV- , ,, V - - -1 -. 1 , Vi, V ,.,.. .,,-,vig - ,,,. . V, , Q, --- E55 ' ' ,- V - , ' , - . 4 V, - K ' --- M L ' V ' , L if X' I.: 1+ X eifgiiiz ' efiizfi - 'f . 'fa , : v: -- MI.. ., .Vfx 5, 1- iii ' 'V ' -"' 1 . V. ' -,. fizwff ' f - iv ' V: 'V ' ifvfff . 'V f1::,f Vs.:-' ' mf". . ff? ' ' - I '. --- V - V ff??2 V ' i 1 " . ' 'V f- . Converse Ivlelaas Greenberg Hanna Fedde Eli ERIEEIGIEGiiiiiiiGiEEEiFi1EiEiiEHlEiEGiiiEIiiIEiiiiiiIiiEiiiimiiiiiiliiiiiiiiiiilGiiiiiliiiilliiiiiwiiiiIiEGiEiEFiiEiiEDiliiiiiliiiiiiimiiiiiiiiiliiililliiiiiiFIIEESHRERHEEIZEIEEEHEECIEiiiiiiiiiilliliiiiiiiGiiiiiiiilEiiiiiiiliiiiiiliivilliiiiliiGiiimiiiiiiiiiilEGiGiIiiiiiGiiGinmiiiiiiiiiEiiMEEiiEiHKiii5nIiiHIEIiEIIEiiIEiIIIIiIII11Iiiiimiiimmiinuiiiimiminiiniiiumimmnimimmm-mm-wiimmiiimmmimuuiiimiiiiiiiiiimiiiiiiiiiuiiiii Page 267 nn O o o 91 :S cm 12 I o c.. VB. 5 U7 EERIEIEIMIEIEEEIIEIIIEIIFIiiiE.liT'E..flT."F'I"T ...... . ... ........: ...................... ................ . ....... a......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................:....................................................................................., ........ . .... .. ..... ...... ...... ........................................................................................................................................ ............................... .............. . ....................................................... .. .... ............................................................................. .........................................2E -Q X ,V . , ff... .-f, . .- 4-.ft ...,--.1-M -..:-fm.,-Q.,.V:.f,'V...,,,, 2- V.3..W.-g.,.:Wf -,-. ..V..,y.V 0,1 - Veg.,yfgggg-Vfjf,::"5-..'f.3V2x2,Eb':1.'12Qf'.32V6:-ta.:jg1.fg,.i.:jjf1,j1.,,q-ifgf -f.V.:f'::E.'5j'.V'.-25-ff,if-w.:::?Li4?iL4a.4-xiii.: .- 1 ' -ESR X25-5.2 2 ,.. ' 5. .U g ' -f 72 . f"F'?. If 'sl '-:Sf HTH - 57221 : I f 2' 2 V 1 Ill V49 : . " 5:5 X 7 1, is A 'v -' 3.6 .J ig.-., J' .12 . .. . ..,. .ESM ,W . ' 4 Ramsey Meyers I-Ieise Counsell Clark Snyder Shurtleff 5 2"""":"":":""::"'::"::"'::2:2:22:22:2222222:22::":'2':2222"222'2:22:2222221:22222:::2::22:::2::22:22:222:2:2:22:22::2:::::::22:222::22:222:22::22:2:::2:2:2::22::22::222::2:::22:222222222222:2 2212: 2:2 ::2 22: 2:222:2: 22 2:2 :22:22u2:2:22:2:22 22::22:2 22 22: 2:2 22: 2: 2:22:2L::22 2:u::22 22 2::2::2::2:2:2::2: :: 2:2222 2::2::22222 2: :222::2:u22:22:22:222 22:2 22: 2' 22w:222:w2::2:2:::22:::2::2222L222 22 22 22225222 2:222:22w2:: :22:22:2::2 2: 22:22:2: 2::::::22::2 2222: :2 2222 ::: :22 22:22u2::: 2222222 22:22:22 222 2:2222: 2:2 :2:2:2 22:2:222 2:122::2::2: :2 :::: 2:22 5fg:::a:::2::::::::::z:::2::..:::n:::2:::::::::::::2:a:.::::.z.:.....:2...:................................................................................................................................ .. .......... ... .. ... ... .. .. ........ ........... ........................... .. .. ..................... ........... .............. .. .... ...... ............ . ,E - E22 E E Ez: 5.5 aes Egg 525 ,. . ...... . ... .. ..... ,, .. .....-, .. S22 -.41 .: --.- Q N. wwf. 2 f "Q .. - -. -1 9 5: 55-732 C' ' I ., L "W 1 'IVV '-,.w'.'1i ' W Uv . '2 U. A V. -3? 2 nw - x- X' 0 :V I 3 3 bv -. 2 '1 2 ' ' U' ' ., .T 2 ' is H 225 Sigffi 1 L4 TE' ' 91 1 V 'Mf1Gf'f9 v. . , ' :W -- '2"f ,. O. ' ' ' 13 2 " Q.. .. . '2 . " . .. Sz Z -.ESQ U1 : .. Q WS -':' 2525: O 3 .w . 2. 1 2 . 2 . rg.-1 .VV 4: 1 -- , N..-5:'.g1::2f'f.'g1s,.f 512, 4 . .,.:-.-'- " by i2 - 4 f' A 5 E2 o :QI ' 4.99 .QQ . if f Sw '1 2 29:2 f-.54 5- 2 2:5 O : 2 A . z - 2 X N xv N . hwy... .. 3 :gg Q .Q -V ,,i,k.,,-g,,4 ...gg 3 .,,.,. . N :IX 3 .0 , ,V,.....q:.:., V , . . T 2: S. E cr 7 Z3 2 If .. . Q 2 B ga' -- N 9, 5 C .52 3-3, 5 23 .2 .4 '-.g5" S' efg. 4 f ' ..,,Z:::pf..1'f? ""' 2 xg 5 2 nw 52' 2. ' ' f ' 1 r V5. .Elf 2 14' 2- V 2- D WZ. '2 2 f':V ' " 55 2 X X V f ' 'Q . A2 X: nfltfifsaf'25is-.-2mffiif.f232Qi1?fQ Q52.z-m.w,.w.k,,.?'4,sw1ff...fgfQg-,gil 2 3 2- ' ...W A ' 2- 5. X wi -'. E'f,"? 1 ' I-55:5 J M - ,. :WEN 211 2 . f, - r ., 5' 2.: . A .3222 C L, . rv .1 2 . -- .Wie - 2 U . 0 0 .. 'Q X X Q 2 --" 'E 15214. , Q f i 3 Z 12:2 f. i1 'V E :2 M: 1 ff: ,, S E ... .RQ . -XX. ,., .V.. - .- x., 3.1. I . ,1 ,. YK wh VA.: 3 I, V V Qllv A P. E : .- . - X - Q - V . - -: - , Qs... .2 V 3 2 Ni' 2 .' 'P - - . . - A - 33 :-La. 5' H . L :.,'..:: I? :L . .yxiigi E 3 1 N.,-Q . :ji Q: W '-'- 4 , . r ' .VE E 1 I: W... .. .... . ...,.VQ....x.W. 4: 4-fl M7741 'lgggg-E Q.a..n . - M555 I 2 ff Sf. 3 iii . :V lv ' - V U, 9 5 Z9 cn :gt . 5. 1... .. - ,. V.. .ff ,. -. C. : .V .. Y., - 1- I- x , V --::- Y . - 211.4 4 ', rags -.. .-,Q ,N M . .. ,- MX., -1 . X H. UM... 3' .2 ,V ,., . , I pr . .. I4 ,Az .., A.. . ,. .1 V. . 2 5' .. 9, 5 .gl 5 .. ' 212 cl 55: -1 :AQ ' . iw, f Za'-3. 7: wifi V -V 1 - 11 ,-2.9: 2 ,. ' - , -' Vs ' ' " . . 52 1922 -. -' .. ' -1 2 : ' : we - V . V --- me M 2 '2 EEE X' , f f " ' riff :EERE 2' ' i , " a.: 1, . 1.-Y.. 1 ' L E .- M 2 , ,A 21.3 .. +1 2' ' E215 22.4 V 2 . 22 4 V ' 22 E , 2 Z rn '. W A :nf Q ' P-2 - O Q Q r Q, 2 f o 1 .2: 5:2 -. sz-' 1:2 4 E: 2-5,2 -1 11.54512 ij. 4 Vf-"Lrg, 2. .. ' ,' , ' " ., . f A w 223125. " 2 q....., ' 9733 - 2 ' H? rn 264' ' E W5 if y,: ' Ez. 5552? 2 ' " N . . 1 iw.: '3 - T EE S..-,.3, . , V , WQ4.. G :gif Jn.. ., . 4 f 77 .- , . - :- 5 , 735. ::-- -y,,Q...,, n . - O -. O E ..-. 2525 ii? Q . f FF. il Q' K' ' , S E' . if-. Y- 5 4 . K 'Q - 21 ' "'- . 2 E .A Q 3 X - .... Y - 2, I - : ' . Q-VN.,5m..h.J.-., U 2 N 5555 f -. -L -..,. . .Q .fi 5-. :.,...-:V-V':"' Q.. :leaf '-2 -'P . .PQ - - Z. ' fwfr-w':'jf 'jahj an . ' .h v ff 'U ...S 4 H FY: 2 21-52-.2 -. F! if , . "W ' 2: ,wr Vi: Q . . . 4.2, 3 25.3. 12: ',-I.. "l- , " .f J'i2'E27 ,I "W ' 1 ' ' " .:., '-. 1 -5: 'j' 92 , i Q r Ag, f ' -'..'gg,I:.V4':Z K-421, Q... g W.: A 'ti Q' ' 5' 2 ' ' 2 5 ' 29.25 .V ' "" V' ' ' " " V f., V mf' :n V 2 .V V 55" ,, nga? 5352, h '- h W : , Jjitgf rv 1 , h .r . V t - 1. 55 , f. ' .1 ., gl 1 1522: ,QW X 2 ,Q . . 5 s ? ' . f-,Q V A 2 ' 5,22 M: Q 5 ,. , 2 . , 2 2 13 , .. .. ' Q : ' fav.. - . '2 52 .... 2 2 U' . fi f - X, 3 ru Q, " L 5 2 ". - 2 ' .0 2:-Se' - ' f .Leaf fm :vw -'2' 2 7' N 5252 ffm. .. . I . f E 5 - tw? ' . -f ' V H f 2, f f- ' H x me . ,iff .,.,L,V,44 I , ' W fy 2 3155 'Tl 5 ,, -- I Egg rf. iz, , .. 'Sag' U, .Wag VV.. U, g,ga,i .V, - Vj. A 3 3 - ix? 2 :f2:?2:: 7- 1:31 33 3:11352 45.29-f ' . .-f ' -fkifg -. -14.20 .-. eff 5- 2 . .. ' Riff! X W . 'j..., .: 5:2 Ly-535. ffpx .. 5.5.4 3 -,-Z.. my . V, - 4 Q ...N .,--.,..:..' ,. V . .. 1...-:Xl fn- ,., - ...W ,. 2 : -' an U- 2: ' ' ': 5 . Q 1' . H .f 2 -1 , 23.3" in X --2: EN: 0 - - . ' 1534-.2 2 - . . J .242 5' Mb! ' 1 :wif D 1 ff. S- 2 2 :T ' ' 2- . . 2 . , 1.1.2 M 1 'Q . - -if ' -. 5 : '-. 1z.1'?'1R. ,iff 'A 'ti Tflfff-5: .ff 112:24 'VV ' L 'J ' :Q 5.3 Y' 2 'V"?x- ,-QWQQQQQ -v,-QV.-...U '- : 522 as EE EE il: :III ll ull I2 ll ul: ll :lu 222: I .... "' fy. -,. .., .. Page 268 EIIEMIEWIIIIIIIIQIEIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIInIIIIInIIIIIIIIImIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I - ,gun EE :Ei Els EEE sie I IIIIIIIIIIIIIIIIIImIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Ez: iI....,.,. ,,.... I..I...., ,..,K...,..,..,., U... I ..,,..,..,...... ..1.. I . . w...,...,,,.,... I.. ,,., ,.,,. , ,,.. ,,..,. II .,,. ..,.., I .II ,,..,,.,. .....,........,.,,, I ,,.,,,... ,,.1,.,.. . I ,,,.,...... . ,..,,,,,,,...... ,....,.I ,,,,,.,,K,.,..,,.....,.. ,I .I I ..,,,. ,,.,.,,,.., ,.,1 . . . I . .. I EES EIS sg: gig ...A its A V A , ,y-3 - 1 . f , A. . .f-Q. . :fl '. ' A E E yn I, , W I.. ,kv .uf fy J- . I ' I kA-l -4 'QQ' QE 1 I, " KV f ' Q I " 5 "" ' 2724 If 41, :is W C X in - i' h A . 4 A h e gg K I, ' I - I . ff " -.1 'I E52 '71 SIE I P 1" z. 555 I ' ' hifi. - ' ' .. ' ' - fifv' SE L. . CA. ea: . .E-: , ., ,, ' .L A , ' Robinson Kremers Schwinn VVhite Ryan McMeans Hinkins Humphrey Miller gg: A s-,-f- eg E: +87 I ,Q ' I ' 7 . . In ' ee ' I . . 4 ,, I .. 3 . A .I 1 2 fy .Qs J 1 - 5 , I Z' 'ft , I I' 2. 4 V X. V J, ff, fr f' 'w t . f iw 2 . .cf ..YA., -.Y..-f -.f-....v ' - W- -wc A , ---N I 5 Buckmaster Beach Gaik L Hanks jcnison Schulz Mead Woodard Hawthorne TT:-R'-'--T .... E.. evee . Q ' .1 ' 'i3'f . - , 1 -I et- W:-... -4 if It I 1 I I .- A I, A, U I- wk Il . If ' f - , E2 , 2, Z., , gg: 23 mf, - 2 . ii I3 I Qi .ig M , . ggi , ,. e1E2f-.Qj:i 'let A - fi , J ' 3 it J" , Eli I M . If I t- , , ., ll - fi f ff- .- . - - I ,. 4 . -1 -:ae Y It , yi - f . sz - 1' ', ,. ' A ' A fg- 5,:- 3.5 3 f ,fi , . Ingalls Parsley Wittwer Sherr Tucker Pope Prentiss Martin Pabst 1 feet f .V fe f Y, r . 4:5 'vf-f , 72 J . .fv 4 . ' 4 2 ' A - -A " I A . I ' - -1-It -.-. . --Q f I '- . -It, 2 a. - ,. If' -:pt-IA. , V --,-' .. . , --'- . .rt-'t A -ze: .1-fe. 1.1 eff- : . , M. .I Its A 1 . . I gi .. " - f ,,', ' . - I . . . - - . , . ggi . -A . ,. f . . ,. ' ,, s.-,-ver' ,,.. I , ,. L-iw--efl'rwfe41--Ll-2--' -- - " 'f ew- ---- .at--is--2-E-f-fi -- 1 -fn ' ' 1 J 1 rw ' QQ Kowalke Glassner Olds Wilson johnson Martin Allen I IWolfe Kennedy ' I ,. Business Staff A A Executive ' ' MARGARET BROWN, Assistant Business Manager HELENA OLESEN, Office Manager JAMES E. GREENBERG, Circulation Manager MARY CONVERSE, Circularization Manager VIRGINIA KITCHELL, Administration Manager KATHERINE F EDDE, Advertising Manager -. KEATS S. CHU, Accountant cg Administrative ' HORTENSE BASSETT, Private Secretary DORIS BEARD, Assistant Purchasing Agent FLORENCE I-IANNA, Purchasing Agent MARIE WITTWER, Secretarial Assistant MAEEL SMITH, Collections BORGHILD I-IERREID, Secretarial Assistant Sophomore Assistants JULIA OLESEN GUINOR HELBERG TAYLOR l-I. SEEBER MAURICE E. FIELD LYDIA LACEY WINIFRED TITUS WILLIAM B. FLOREA Circulation LANVRENCE E. EMMONS MARY A. JOHNSON GERTRUDE OPPELT ERWIN T. MOHME THOMAS A. REYNOLDS RAYMOND J . RYAN g f ALBERT K. ORSCHEL OLE H. SEITZ EDWARD M. WILSON CHARLES S. SCHNEIDER OSCAR C. MAGISTAD 5 Assistant Advertising Managers BEATRICE BEAL SOPI-IIE BLAUL LELA HENDRICKS DOROTHY WARE Circularization , EQ f JULIA ALLEN ALFRED BAUER l"lELEN OLDS MARION PRENTISS ADA WILLIAMS Advertising if ROSE GLASSNER GRACE GLEERUP MANNIE PARSLEY 5 GERTRUDE KOWALKE PAULINE PABST RUTH RUGCLES - CBodger Staf Pictures Courtesy of Portrait Shopj ESE iuiwIIIIIIEEEEIGiiiiiIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIimiiiiiiiiEiiIIIIIIIMEIEITMEIIEEEliiiliIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIEGIGIEIRREESETIEIIIIITIEHIETIZESZEIEIEESEGIIITIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIFEEGGEEZGHEEEIIIIIIIIIIIIIHIEITEEMIBIIHMIIIIIREHIEEEIMHDEGHIGESGIIIKIIIINIIIIIIIIIIIIEEMIISZEMIIBIMEiElTiRiEiiiSEIIMEIEFIIIIIIIRIMIT Page Z69 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII1 mnuunmum wmmm In ' ' ' ' ' " ' " ' I ItwiInImunmttmmmmt D...-Rf--f""1 I --N-t- M...-----f. ' 2 , V. 5 .' -If"-ff . , ALT, vi , I ,, .1, .4 fy , R- V ., ---, , . . k,.. .R I . Y ,gi AmmI1t,mtfmk.c,,4 A ' ' ' .ug S ' f 41' " 2 .-.iff R. ' I .Mlmytmm-A 2, f V 2 QR I- .- ' I ..,i,.f 14. N if 2' -if :xv If .iif----Q-6223535 ff522:2ti'4:., A ' III. VV I 'W I z ., W: Q " .R . f?EiE3.jil'1' .5 A,sw,wggff Affiffggswygrfmt-1 1 ,Q -, . ., ' f- 1- -f..-itt:.i.g:,.:.i5f1Q.,.g- . .g..- "-ii f Eff,-fw.f4f,af-fs.-sES.imwrfxaf5,,," f' ,.,,, 451-Z. ggztw--1 f tim:-1, 5, EEE- E m- , ' fig P-2:54 L, .,.,, .- ' gg, wat-N-3531153 writing-k5g,2+-ggtgfzf ,. , ,. ifNZ4f-.- T"'1" ':fJ 531.1 'fl -' MQW' f'?31it-:Z'??Ef- I -were , ta, A-, +f.-aA?-w'f-f2:1:fm-,f,c+:wgs5g-,,- I ,, , Q, ,,Eta,,,4,,.. sw, , Eltxuqzf- -57':52Ti,'?'2 3-A-Z Qsfnff-f: i2fQ2f?51C1bmusriss2v ta. ' 'U:41'::'1" . . . . . .Q I, W- ..s,, gg., ifwm.. ,, s, ,.-. . ,,,, ' "" at 'A ' , A B Ifqsrmiai ., "1'atf- Spas, I 2: . 'fR:f:sf Mf'?l mm: . . -'::E1::.: f::':.-:Q-I f QS- "5 ,J " ,f ' ,g r 4 12: ijyff, -SE2f:A,..E4i1f, I wr:-f ' , I X , -,sfk-A 'R T--211: , fit gi , ,uf-Lvlkejfh .rf -11512 'dt-25 sf' Q-1-.pf-E ,f-i..qf52 -A..- , E ., . , Q5-5E5xb pe , W -vias V LL, Y., . ,,,1,, , I ,Hz-L-s,A,-a'fE. A ' "MTE 1 A " SRREHI1 . , I N I, ,.- N, - . A .,.. , ..,f - , Iv , A--i. Lk.-uno' I Y ,I I f . f, ,. i.,,,Il 2 LI.. Rf-, gs , " 5 The 5Daily Cardinal News Staff OWEN L. SCOTT, EDWARD L. DEUSS . . Managing Editors LOUISE LUDLUM ...... . LEONARD ERIKSON, MARIE WILCOXON . ' .,.. -E.,-E--. 5. ,.,-., - --r News Editor . Assistants BERTRAM Cv. ZILMER .......... Athletic Editor ELLA SOHULZ, MARGARET KIRCH, HOWARD JONES, HESTER ROBINSON LOWELL j. RAGATZ, ............ Desk Editors GERALD B. HODGINS, HAROLD M. GROVES, CHAUNCEYJ. PELLOW . . Eclitoral Writers j. LEROY HASENPFLUG, WALTER K, SCHWINN . . . . Skyrockets MARIE BODDEN, IRMA HAYSSEN, MARGARET WILSON, FREDERIC W. BECK- MAN, MARGUERITE SCHULZ, CHARLES L. MANSON, LEON KAUMHEIMER, MARION BERGESON, ESTHER BRUNKOW, KATHERINE HICKEY, CARSON F. LYMAN .............. Reporters Business Sta-H. HENRY SCHATZLE . . .... Business Manager WALTER E. MALZAHN . . Assistant Business Manager ELIZABETH HOOPER . . . . . Advertising Manager DELIA PROUDFIT, IRWIN MAIER .... . . RICHARD SCHOMBERG, CLARENCE V. JOERNDT Circulation Managers ESTHER ROBERTSON ....... Business Assistant . Associates ELLIS VANDERJAGT . . . .....,. Collection Manager HELENA OLESON, KAREN FALK, HELEN TURNER, MARGARET LEWIS, HENRIETTA SOHAFFNER .....,,. Advertis ing Assistants SCOEIZ Deuss Hooper Schatzle Hmmmma:Iilimisgmmmr.,.....,.,...,s......t.-..- .,., ...M .... ,.......,,.,,..,,..s.. ,s........-,....-.... . Page 270 sn E6 il Ei El: 'Q uw:ummnmuyugmununummnumnnmumInmummwmmmmvumwnunuuvwwrummuummwmmnmanwummummnnwanrmununWnlnmwrnwnumnun1+nnumvuwummruwmmyvmmrnnumwnuunmwvu1vuun1m1nwnwwInInmnInunvuwInwrnnnmwInwInnl1In1u1vunnluwmwnnInwv1wmwvuwanmamvmmwum.unumvmwuanuInwvunurmvmrunnmwruwvuummwwummuvumvunuInmrnurunuwmnnnuvuvumunumunnmmnmumumInnmummummmng -nsummfmnlnummmflmmmInvm.umr1.I1rmmrmrwWnumrmrmnlrmrmummmun1mlmunannnnurunummrlmrmru1Imummuummmm ww ry ummm 4.wmmmm1fum.mm.mwmmu 1 m H4 W 1.ufm.m.m.mnu In w I .www L.mVIIZPIGEWIZYIIQGIRIITEIEQEIIZIIIFFI mn HWRIQEIYIIIEEEIFIUIH H UEILQIIIEIEII NEW5611541IIIZXQGIIQILEIFIIEEILiillinru 5Z.W?iiGE7?IZiE7Hluwun'?lIILmum5Z 555 :EE EE sa 32 S2 Z-3 5-2 ,is 212 if V35 Q " 0 -M'-2 f 4 pf.rmefrm-faww:'ww--f-rv.-W7-W---.-.f Iii v-ff. iff- geR2wgf-j:s1E5grQq-g,gz,f 521. :,:1c-.gf-: Y,-' gf-,, s " ' ' ' ' ' .'.u-yfggeby ,J ggi Q A 21: J 2-fa-. '- h ' .-.. - sg wggf, ' 11,35 . ,...'-12" my f ,, E. 6. - , "W , ' ,XSS .' -4' "P, GW? 1. ' -Q? C 'J . H- 'vm fi.:-' if A 'oi f 1.1 . fi? E32 f ' ' fn ' r gas ' H -tg ' s Q I . , -5 ,ff '-cm: 21 EE -55 zz' - ' - - x -' 1 - -, , ' 5 2554 7 7 gas 5? -. .,.. ,:f, . V 1 Aw- , s ,.H..--1-- .A..-.QL L- - - - - -,,.,f --. -. --.-..- --..,..-. -. ..,. --..--.. .-. . . . , - ,haw ,. EEL , . . El: Ludlum Zrlmer Hodglns Groves Pcllow Wxlcox Ragatz Si- !! :iz -1- -' rr' A'--'F ' : ff' r- fr J f m Af , ' fl- or .g - V A -r 252 5" . gh I ' I f eg-1 f ,. I gg igi H - , Q., 19'f' -. - . ' ---if " sis -E v p',' .mf ' , I , '-' ,Z SSE - ' .- Q, , V' fn, E55 - S Q A -ff' fi' 1" 'dy . 2-5 X ' ' Sri" - . ..,,. . -,,.-,. .,,g..,.-:... .. ,. .1 . , L" - Egg 225 Erikson Schulz jones Kirch Robinson Hasenpfiug Maier E E SE - 2 gas 5 5 Q5 . . . - -f . 552 5,2 f I .- .fn . . - wa 55 -ff E: .+ . ,Q-.a: :':-.. gf'-2 -. - gg Axffg e' , 1 1 332 2 2 1 A41-.12-: ,iw - 3513-4 .gin H' 5 Q , - - ' , gig r , f . r ' 1 554 5 -V Q-: N.. Q53 1 .. . I fig, I H .ggi .W M I :.e::-H., -Q. U v 7, -vb rg 1 gm 52: "2 :1 f. ' iii?--3 M A T r. "'- 2223 f - pw 'A 's 1 1 .. - . , .yogi ' , 5-E ,,55,1f ,L .QQ-,t I , f- --L --W , - ,,-r -of '- - 1. Q . 5 gg " -AK' ' 555 -ZfFifi'1'-' F 1'7" " f - if mi ' f i? , ? , V 5:11 .-5 gg- X :5.. ,Q .. - " A V f. ,, H - , s- ,af " Mi :sg me-mf-.,:. Q.: j ,:- - 7 3-1.3.1, Q f 3.15 I A , 4 .I ,gf L 2 4 X. 54 5, v::-,-,-:.- V , -,M AY WW, , WM N .. - . . 1" - . . If N . 1. gig - V, Ggwffgg if wW75Z-'5i,Q1xQ:N5 P Y' QM! W 3 ' ' ' Lewis Proudfit Olesen Turner Schaffner Baker Robertson 1,5 32 Cardinal Board of Control GARNET KLEVEN WHWNEY N. SEYMOUR Q25 :xl 5 :gs 235 ALICE PORTERFIELD ELEANOR STANCHFIELD -A ETHEL VINJE Stanchfield Kleven Seymour Vinje Portcrfiefd nllnlmnlllvllxllllLllllllklllkllllllltlllllvVlllilmlkllllhlmllllmlmvlKIIVIIIIIHLIIUIANIllIHHIUVIHHVIIAIIIKIIInlMIIillHIAIIIIIIHIIVIIVIIIVIIAIHNINIIIlllllllrlllllllllmhlllIllIllHlnllkulullllnlllullllblllVlnlllIllklmllllllklllluhllilllKIIIIAMIIllllllnllulllIllkllvlllulllllxlullmmllUI!KIIAVIJKIIUIHIIIIIIIIIUIILIIIKIIHIMIIIVIAIHVIIIKIHIHllllllllllllllulllmllllllllumillNKlltllmulmlulunlullxllmlnnnmllllmlmllllullllurmlluVIInlNvllulluulllunlllnullulllvllullnunlmnllullunllulluullunnlullllllnlE Page 271 glmmmmummmmnumInmmH.mmmmulmlmHInmmvuH.mminfnulmunummfuum-mmynmummKmmH4rnulHummmmummmvuHInmrnmumumminmm-mnnwnvmuwuulmuInmm.mwwfumumummyninmm.ummululHuwfmmmmumnumInfuummunInmmu.mmInInulmumminmvmnnnummummuwnumunmumvmInrnmumm,mmmn-ulmmmnwmummmumummmwwvunlmumnunumuummmwmumvnnnnnmmug 5 5gm.-1mmmmm.m..,ulK..mm.mnmmWmmmmuvWummm...W..mmm.um.HV..um.mmmW..mm.mm.UmmU.mmm,Hmmm.HInIninmWmum-.4mWmH.ummH.H.mxmmH-1.inmlmumIn.Hum.,umm.HN.unWW.MH.um.mmminmmwmm.UV..um.mmulummmml.HInumm.mmmumm.mmInInmnm.mmInmum.mmmulumm.mmIn-mnmm.vmmH.mm.wwInH1mmmmH.umnhnhlQ..151163LIIZWIGIIEEZEJEZGHIHZ E --- --2 Q......,..,.H.,,..,...,..,,...,,..,..,,......,.,.H..,...,..,,.H...,,..,..,W.,,.,,..,X.,,...,,.,..,,...,,H,..,K..,..,H.,..,,H,,..,...,..,,.MK..,..,,..,...,..,,..,..,,uala.,..,nm.z11.11amasszauazzaaanasnamanan:zzsansmananuananaz1zu:aaaan,ann:ansimswas1:1aanamassanunsasxanazsxaamaans:az1:sqcan:azanasainma:zacanmainmms.mm,..,..,,..,...,,...WK......,H........,.HH,..UX...H,,..,,H....X..,...,..,..M...,.,,..,,..,..,...,,.....,.......,...mn..,..........,....,.,K..H..,......,......W,..,H...,.,m..,l..,..,..u...m..f Page 272 - ' ' I' I 'gyzmtu A . -f-W fr -- it., - -- ' - Pa' - ' , F 'ff-emu., E L , Zgfsvowg:--..,,.? 1-zfzzyizweonsfa V Wwismpyf... , I f? ', .. I '- " J alfa I we Q06 zlerafyf' I I . Pfazy I .fffaoazme I-...N 'Q 90,0 " .4110 I gm V ..I-,N ,, t lp ,fffaynfmo V Quant, AMPE X"-" . f ness., y,,..m. ""1"' fm .W.iL,...t , ..,.iL,ii.,,i X W , ,4., W , AA.. , - .WWMM ..,. 4 an ""-M. "' 5,5 A "' All ,, . Ia are 5 - an 1 IA.. I IA- .IU Lim I ,4, , we A NIA. I. Rm. ma T5-s.,,,,'L' It 5'-ffm-f A, wIIIf'm.,I...I 77' "' EH- if 'ik-1.,, 4 MN' MIA. Dllmn 1- Rui, .,I 1-,,, I1.mmIf ' M- 0-M V A.. Is.,,,,, " "r-f-limi. Mr --im. Q. nw, .AJ du Yes-war G-neu-mrwu fm- .. pm A -,-55, ' """w...,,M W, fs. , ' I -2-Q-up MIXNWKF' ' .,.,Mw v N , ..I..,.W,.. Wy, A W'f::z:m,.,. L nur:-Q.:-may .,.,....n.,.,,..t......f ...,,,gmL..,m "',,..,.,,...,.,, We-,Mu -M. A ,,K:::L:-W-N V Q-.zggm -w..,,.L,, .W t., ..., 5.1 ,M X , ml M ml W.. .M . ,,,, I o..,,..Iw 4 , x.X' J N.....I. uv F 1-N.-, up , N' - rw" A The Wisconsin Literary Mczgazine ' "An Exchange of lcleasi' -wb. mud Editorial Board IVIILDRED EVANS ....,., Editor-in-Chief Associate Editors .JANET DURRIE ELSIE GLUCK FRANCES DUMMER KARL HOHLFELD RAARIAN FELIX BERTHA GCHSNER ALICE VAN I-IISE Business Stay? KARL I-IOHLFELD ,.,..... Business Manager ADOLPH GEICER . . .... Circulation Manager FLORENCE FINNERUD . . . . Assistant Circulation Manager A Business Assistants RACHEL CVWMMONS FLORENCE I-IANNA KATHERINE FISHBURN ' RUTH SUNDELL GEORGINA SMITH Fishburn Durrie Geiger Hohlfeld Commons Gluck Felix Van Hisc Finnerud Evans Ochsner n ! N W laf1EI::Jgf1 "1"I"'""""'m12:22:2!15l2 X Hn H H X I "H"I"'I'I'I'122:miami2:erm1:11I"1"1I'I:IIiEEi5E2E552EEEH5:-I3:w,.H,"::m::2:222wmsff::2Mm::2f2:2r" ...... Page 273 ,..,,, ,,n, ,,,, - -I an ---M IIAI I-MM---mmm IIIIIIIIIIIIIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIII M N Imummmxnmmnx IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIlmmmm Im In I IIIIIIIIIII IIIIII my II I 'I IIII IIIIIII IIIIWIIIIIIIIIIIIIIII I "' InIIIIIIIGIEEIRiBiGEiiEIEIIIEGiEiiREGEIiKI1HiEiEIE""' "MT"'M""""'n""' """"""""" ' Im. II IIIIIIIIIIIIIIIII JmmumIuIInmmnInI1 mu II I IIIIIIIIIIIIIIIIIIIIIIII I I n 4 I I I II I I II I :Iv In II nLLIlImgggmILIIlvgp,g1Igg5gg 'I'l at mm! 'lll NIVIIIIIIQIIMLWIM 2 s . ' Y . V . 'XI UUH.ZE'l,e K . , mba Q. A 4 - ,Gm R, 39,X599,6qa'f g . 1Eh8907l8in 'GlI11SC9W5m , Rx X-, 1 W X I f : ASE 4., 1 X. 1 i f - .1 I 1 ' I " - . ' "'1 I K I 'Vx' I f Al A .Xl xt .,2,A I .. I . I , '4 I I I I 557142 Isconsm Engzneevm . Honor Roll CAPT. CHARLES I. CORP .,.... Chairman Board of Directors RAY E. BEHRENS . . ..... Manager W. EDWARD BLOWNEY . . ..,..,. Editor ROBERT B. BO!-IMANN WVILLIAM EERICKSON FRANK I-I. CIRVES I The .Smpf FINLEY L. FISBECK . . . Manager GLENN B. WARREN . ....... Editor HENRY W. KURTZ WVILLIAM B. BELLACK PHILIP j. FABIAN ETHAN W. SCHMIDT MERRILL B. GODDARD WVILLARD A. KATES Board of Directors PROP. L. F. VAN I-IAGAN . .......... Chairman PROP. j. G. CALLAN PROP. J. G. D. MACK PROP. F. E. VOLK ' PROP. E. BENNETT - Fabian Katcs Schmidt Warren 5 Kurtz Fisbeck Bellack I IIIIIIIIIIIIIIIIIIIIIIIIIIIIII II In IImnIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII: Page 274 Zi: gsi E :i E2 isa sgl sg: I iii :EZ E22 I iii .I- sas :Ia .5 .I- ass :MMI,I,I,,,,,MIII,IIm ..NLMM,mw,MI .,,,, ,,,.., . LLm,,..m.l,,, .,,. I.. . -My,MLMIWU Nvvi uMl,,.lII,,l,I,. .,..,,..,, .. ,,,,,, ,.,,.,..,,,.,,..,,.,,..,,,i..,,.,,..nn,..,.,. I . .,., . ., .. I. I. .I E ' at """""" "" "0' ! : Q. . r . .... , , , .W., . . . f f g ? I' . il ' N-m f - ref' f ' P . "- 'ws I ,S AW - . .. ,.: ,-., tgp. ifaif - ,fn ' ' 62153125 2 .N ' j f . - l I I fr , - I: T' " ' ,gf A 4 - ,gg My -I .m sgqqgzrv- g'.g I:f:..Ix.. -- . 0 i 1' .243 3 '?5'- '. ' -'ffkfafw ..7?f-"" 'Ii"" ".I- 43 C M ' 8 . A'Brains with Business"-Publislwcl by the Commerce Students ofthe University E Editorial Staf Ei? CLARENCE V. JOERNDT . Editor-in-Chief 232 XVALTER R, NEISSER FREDERICK S. STUHLER Assistants to the Editor EWART K. CLEAR 15 PROP. EDXVARD I-I. GARDNER . Faculty Editor-in-Chief 4- . Business Sfaf 3 WALTER E. MALZAHN . . . Business Manager WILLIAM METZKER I Z lst B . M iii RALPH STH-ES I . .aol-S' Clfl O LlSll"le-SS Uflflgel' HAROLD R. NOER . .I . . . Advertising Manager EF RICPIARDJ. LOEWENTHAL . . Assistant Advertising Manager SANFORD F. SMITH gg? ARCI-IIE UERRBACH Advertising Assistants : . CHARLES I.. HUGHES ig 5 RONALD C. IVIATTOX . . . Circulation Manager MARY C. FOWLER . Assistant Circulation Manager in Faculty Advisors 252 PROP. WILLIAM A. SCOTT PROP. EDWARD I-I. GARDNER ?f' PROP. STEPHEN W. CIILMAN PROP. FAYETTE I-I. ELXVELL 5 I , S CLEAR NOER FOWLEP LOENVENTHAL STUHLER 2 NEISSER ,IOERNDT GARDNER MALZAHN MATTOX a QE 2 a I ii: 5 a 155 E imInnIIIIGIIIIIIIIIIIIIIIIIIIummIEITrIIInmIIImnIInuIunmIImIIuIIIImImnnInmmnnnnmnIIImxmnuIIIIImnmnImmIIwIIIIImIIIIIIIIIIIIIIIIIIIIIIIIIII I III IIIiTME'PMiIIEiI:IIIIIIuIrIuIIIIIIIIIIIIIIIIIIIIIIIuIImIIInIII:mIIuIIIIIIIIIIIImEmIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIuIIIIIIIIIuIuIIImuIIInIuuIIuIIIInInIIInms Page 275 V 4 1 ,-ni-m...m mmm g3..,...mW.....i. . ,ff ,... . ' -f" ., 4 L i . , ,.,,, ff , W .y,,fn3?g' st . - 1 ..f3ifi?T.iQfi1l:Ri! g r ,M ip Z i i . ,,.,...--'Q'-',,f"".fjf' JIT, ' 4""""" ' .. ..,, i. - ft gs-A f f- ' Wlgajggfi-,121,!,.Wf f ..f:-egg!!-.4. ., ,.f., W -X . . .'-- : .,., .i ly jj- - L-L--f--' Q . kv kk ,, l . gfffg N , ,Ze 1 - nw.: -T V "V . '- F V ff -ar K -:ft MJ. "' fi fx .A-fwarewr ii.-fe l aww-J - a-if . , U. 1 Y- . 1 f-"tr-g. ' . -'S ,e 2 I. i, - . . RH'-, ,, ' is-:.:::fazw V-1 ,' Y YQ may ' R i r 1 .. N YEA..- ... . -.s..Ea..,.. i i A 'Nj--r-v-.1-A , for R e' t 1 E gt The Re imental Ea le was the onl S. A. T. C. re imental ma azine ublished in the United 3 States. Three days after deciding to have a company weekly, the First issue of the Eagle appeared on the campus. The first issue was a magazine of 16 pages. The second issue contained 20 pages, with an abundance of cartoons and reading matter. The third and Final issue appeared with a colored cover, and contained 32 pages. Two thousand copies of this issue were printed and sold. With the clemobilization of the S. A. T. C. the magazine automatically ceased publication. Editorial Staff E. K. CLEAR, C. j. FOSTER . . Managing Editors BERTRAM G. ZILMER . . Athletic Editor C. IVICDOUGAL . . News Editor GEORGE DECKER . . Humor Editor Administrative Staff JEROME O. BJERKE ....... . Business Manager GEORGE COHEN . . . Advertising Manager C. CASSERLY ...... Assistant Advertising Manager IVIILLARD SERSTAD, ARTHUR UHL . . . Circulation Managers M. LESSLER ...... . Sales Manager LIEUT. J. D. WATKINS . . Censor EE Decker Uhl Cohen Casserly Halling Lessler Serstad McDougal Bjerke Watkins Clear Foster f i l 1 i mmiiiiiiiiiiiiiiiiiiiiliil5iREiiiIiIIiiiiiiiiiiiiiiiiiiiiimim MT" """' " """ t'n"M"' ""' i""m' ""'W"""'1fin:?mImmi Page 276 4 w 1 5 E 05 e - . ' MM . . 1 6,15 55l9wfaumn ,gc 691950 in 55' f329wtozw1 33'0x9iW'll" llwuwffagagiue Etum1lSE91i0,99S Glumufcgaa fl Qmgnguw y : f 5'lf"'1P W t l 5s::51Sil?iEi'jZ:J11'.' il 0 A if ll t ' ' ,R ,:j" - - ,,,,, i H ": ' F 1' iv'?ff'e-'1 '::' ,V , 'fi-' ' E '. I ' i"ff"f'PH1.- L f ' ' D pi . f Q .:,, S :::.:.' mlm-hqswifl l l?"'A,f! 'S Y-4-L .Jl A l4!iZ...'aLC5Cl3l"" "',l .:.i.-.-'li p '-4-fm::: mga. ,H :Zinn ll Che Alumni Magazine Ojzicial Organ of the Alumni Association of lhe Universily of lWisconsin 3 The General Alumnz Association Membership: ls open to any student, graduate, or former student, or any person who has been or is affiliated with the University, Object: To promote the welfare of the University and to encourage the interest of the alumni in the University and in each other. Numbers: Membership is made up of more than 4,000 leading men and women graduates of 5 the University. b Fees: Two dollars a year, including subscription to the Alumni Magazine. When the Old Grads Return 5 , , -1"-f-'m---- , 4-41-ff-ff-f1'f'ffff- "" ' ""' -Lf1l'N-A """ .,,, "''W-"L"'2f'f"LlLi?H"f1 ' "" 'n's""1' ""t""": l '''w""ME5?EE??l5izig Page 277 mmmmnvmmmummnmnnumvumlmnuulun,mmnn.mmmmnn1mmlmummm.mmmWnummmmm,nuulmum..1mummm1InInmlm1mnlwInvu1Inummmul1.mmmrmmvmulunIn1InmvmkmmumummmmmmnnnlwInummmnlmlmwInyunl11HwInnum1InfuXInuninunH.1yu1HXInm1mmXinrmin1InrmnumnlulHI.1H4Inunmymnunlmlny1Inru1InvuX'mm.Hmvmm5-I1mLgNm1ulmyuuummmgmvmnn.mmunmumlmuunmunmqg E 55lmmum-1mmEMEKiFiiiii?iiRi1?iZiFiiiiiiiiiliiwililnhi!Ehwn1innuInfmwuvinmwnumm1uvmwnlmmmInmmummmmfm1ufmyI.wruwmulwnwnlwuv:mmunnnmummmrm:mmannmuwInmunvmm1mmnunl1m1mvu1InlmmmuInnnmimuvnunuInmymnnmfmmwm1ynunInInunin1m1uNmNm1nrmmm,1InvmInm1mmNmmuininNIn1Ininmyul1Wunumlmmmuwmnfuul1WInulwwuwnu1InrnwInnumnummm'wulnnnnnumnwuunmuumlmgg -5, -., 5:5 555 :gg 11: ESE 525 555 :is EEE :sz sas 555 sas EEE EE -sas 355 z 531-ggmwgfggywgggggigygymml3515!M13,X554X.51I.,W.U,1.1H.NK..1.HXV.,w..W,.m.,..m..,Wm.mm.mmmm.ww.mm,mm.WL..WL..XH4X.UN.Xy..L..H.mm..H-W.HH.XmX..X,HX.IXK..X..XWX..,,.1H.1V..1H,H..WU.X..XH.1..U.,,y.XH.,H.H.,.H.H.WH.,..XV.,XWIn1UXX.I,KuN.,W.HHXm1Nmw.Hw..wInU.wmw.Hyuum.-nm.m.n.m.mmmw...m..1mm.uw..inWuv.WH.X..XInunWUmlunmmWV..W.um..WL...H.WmmXrm..m.um.m.mmmmm-uni -4, mm,mm..K..YH.Y.mY..,,W,,.Y,,.H..,K..Y.NY,.,H.YV..,Y..YV..,,.,,.NH,...,.MY..,H.Y...Y..,W,.,,Ka.,.1an1anzz:,anin19:11:112:1an:as1inii:1:mixisa:ia5:91:mmmuman1:11:izza:15:11:51:ismanain151mm:1:si55:zzz:Imaz:5:51an5:1as1:511asfanian:iziii1inLi:faq:sinsinsin1:91asiii:an:inin:inimtiesi:zzz:1:21zisiiiiissisisziiiisiin:nazianmiGmini::GaiiiHmanmsic:iz52:1:5anisfilm:mmmmxziniiiainmismnimianaziwizniimnzzmzzniui.um......,un.,....1,.....m..m.,,u5z.1a, P a g zz Z 7 8 :sz I 4 I zu Harfesfoot Dramatic Club Incorporated Moore Hemsing Lindsay JOHN W. MCPHERRIN DAVID W. MOORE JAMES M. LINDSAY JAMES BRYDEN C. HAROL.D RAY . PROP. JAMES M. O.NEILL JAMES F. I-IEMSINO N. BRADLEY I-IIOEIE WM. K. I-IOWISON ALVIN R. KLANN JAMES M. LINDSAY CARL W. MAEDJE I I Sumner Klann Higbie Mcpherrin Ray Morice Brvden Ojfcers . President Vice-President Manager Secretary Treasurer Honorary Members Mem bers - .. x . Kline., 5:- R. 1 9 III..I..mlm.-I..-,IIII-.Iml-.I-HI-IIIIIII-...II IIInIIiIiiIIiIRISIIIIiiiiiiimiiiliiliiiiiiiii?iiSIiiIii1CmmI Page 280 PROP. JAMES F, PYRE WILLIAM MCCOY JOI-IN W. IVICPHERRIN DAVID W. IVIOORE ELTON K. IVIORICE C, HAROLD RAY WVILLARD C. SUMNER I., nm I I.m.m..mI II u In Edwin Booth Hodgins Crownhart Schramm First Term ARTHUR N. WVILCOX ELLIS A. STOCKDYKE . . RAYMOND E. HOLGOMEE . ROBERT M. BREXVER . . CLARENCE F. SCHUBERT . EUGENE HUGH BYRNE ERNEST ADAMS CHARLES EDWIN BACH ALFRED J. BAUER JOSEPH BRIDGE BOLENDER JAMES L. BRADER WILLIAM COLLINS JESSE GEORGE CROWNHART HORACE KLEFFLER DEAN ADRIAN DORNBUSI-I LEONARD FREDERICK ERIKSON HAROLD MANSEL FIELD HERMAN KENNETH HARLEY GERALD BURCH HODGINS Adams Harley Schubert Holcombe Holcombe Ojqcers Second Term . President . . J. GEORGE CROWNHART Vice-President . CLARENCE F. SCHUEERT . .Secretary . . RAYMOND E, HOLGOMEE . . Treasurer . . . FRANK H, SCHRAMM . Keeper ofthe Mask . . ARTHUR N. WICOX Members in Faculty SCOTT HOLLAND GOODNIGHT Members in University RAYMOND EDWARD HOLGOMEE ROBERT LYNDON HOLCOMBE MALCOLM MECARTNEY FREDERICK OLDENBURG ALFRED MOORE ROGERS FRANK HIGGASON SCHRAMM ALBERT SCHAAL THOMAS LEROY SHEPHERD CLARENCE FREDERICK SCHUBERT THOMAS FOSTER STRONG WILLIAM WAGNER RODNEY WELSH STANLEY WELSH ARTHUR NOBLE WILCOX A W, -, .I M3545-I.: .w.m..I..I mm.Im..IIIIIIIWIIIII I 5 yggglggggglvg ii?ii1iii1iiIiiiIi?iiiEIIEIIIIIIIIIIIIImImIIIIIIIIIIIIIIIIIWI Page 281 IIIIIIIIIIIIIIIIIIII I -.!IIIIIInIIIIIIIIIIIIg25935333 IIIIIII I Im I IIIIIIIIIIIIIIIIIIIIIIIII I II I I I I I I In II I II I Red Domino Samuels Little Hanks Dennett Ryan Fleming . D 'SmIth M. Smith Ochsner Chubb Durrie MItche1l Ojqcers MAVIS CHUBB . . , President BERTHA OCHSNER . . Vice-President JANET DURRIE . Secrezary MARIE MITCHELL . Treasurer MABEL SMITH Domino Honorary Members MISS GERTRUDE JOHNSON MISS MARGARET I-I'DOUBLER MARGARET BELKNAP MAVIS CHUBB RACHEL COMMONS DOROTHY DENNETT FRANCES DUMMER JANET DURRIE CATHERINE FLEMING DORCAS HALL JULIA HANKS HELEN HARPER I-IILDA KIECKHEFER MARY LITTLE I IGIIYIZTI Active M embers I . , -.eq Rf T 1- ,L Q Safe' :IN A Page 282 MARIE MITCHELL XVINIFRED MOSS BERTHA OCHSNER ELEANOR RILEY FRANCES RYAN AGNES SAMUELS LOUISE SAMMONS MRS. R. F. SEYBOLD DOROTHY SMITH MABEL SMITH SOHNIA SINAIRO MARGARET TITCHENER illliliii??iiEiiiimiliiiiEIEEIIIIEEIIEIIIEEIHZII I Twelfth Night l R , V , 1 9+ Parkmson Briggs Schultz Loughlin Donaldson Coburn Ramsey Harrington Haley Tucker Colby lvlozingo Willman Miller Serwatius Cumnock Harker Lathrop Strong Radford Smith Ojfcers MARGARET LATHROP . . President ADELIN BRIGGS . . Vice-Presidenf HELEN COLBY . Secretary MAUDE MILLER . . Treasurer HELEN RAMSEY GERTRUDE JOHNSON ADELIN BRIGGS ELIZABETH COBURN HELEN COLBY BEATRICE CUMNOCK MARGUERITE DANA MAR JORIE DONALDSON MYRA HARKER JULIA HARRINGTON IRENE HALEY CONSTANCE KINNE MARGARET LATHROP AGNES LOUGHLIN Honorary Members ARIEL MGNAUGHTON Active Members Wardrobe Mistress ELIZABETH HUNT MAUDE MILLER ARDIS M. MozINGo MARY PARKINSON HELEN RAMSEY RUTH RADFORD MARGARET SGHULTZ FLORENCE SERVATIUS HELEN SMITH MARGARET STRONG F RANGES TUCKER CHARLINE WACKMAN MADELON XVILLMAN KATHERINE PAGE WHITESIDE I ImmmInruImInImInImmnnnlummnnnn IIInInumInInInnmIIIInInrunfvmIIIIIIIIIIIIIIIIIWIIII Page 283 IIIIIII IIIIII I II In II I IIIIII II IIII I II IIIIII II I IIIIIIIIII I I III I I I IIII II I l l ' 'V oclvil Fuller Opera House, April 24, 1919 The Acts H: A. Contortionist-George W. Martin B. "Behind the Beyond"-Twelfth Night Dramatic Society 'g ig Characters: Madeline Willman, Charline Wackman, Ardis llgflozinglo, Fliances Ellen Tucker, Adelin Briggs, Margaret .' I ana ulia arrington V fJI:.- -.refer - ' 'r" ' -- - -- -A -- -- -I - f C. Melody Mixers - Kate Fedde and Peg Kirch IE' ,. D. W. A. A. in a series of interpretive dances ,I',ff3f3q35 The dancers: julia Hanks, Bertha Ochsner, Eleanor Riley, ,,,, Gertrude Gleerup, Dorothy Bridge, Gertrude Noetzel, Mary Parkinson, Agnes Samuels, Louise Samrnons, Louise Weld, Marie Hjermstad, Francis Tucker, Elizabeth Waterman. W Frances Dummer, Adelin Briggs, Lee Bacon, Margaret Schultz , E. "Comedy Prestidigitatorn-''Sparks' Dodge 13. 72, F. i'Signs and Wonders" by 'Field and Companvu l v-ji Charagers: Harold Field, Alfred Bauer, Charles Hughes, Fred- 'I I eric ldenberg , 'Aii 7 G. "The Golden Doom"-Edwin Booth Dramatic Society Costuanes and scenery designed and produced by Adrian Dorn- ' ' US ' E Characters: Clarence Shubert, Ray E. Holcombe, Frank Schram. Marjory Donaldson. Thomas Strong, Robert Holcombe, llzllagold Field, Alfred Bauer, Frederic Oldenberg, Gerald , :aff-xiii , . o gins A ' fl Production directed by Ray Holcombe and Adrian Dornbush i'Assassins of Sorrow-Charles Carpenter and Fred Bickel H. "Overtones"-Red Domino Dramatic Society Characters: Katherine Fleming, janet Durrie, Flora Filtzer, Hilda Kieckhefer I. "A Few Topically Typical Tunes"-Horace Carver and Philip Reed J. "The Minutes of the Last Meeting"-I-laresfoot Dramatic Society Characters: Willard Sumner, William McCoy, Leo Fee, Bradley I-ligbie, Wesley Tuttle, Floyd Hewitt, john McPherrin, Alvin Klann, james Lindsey, David Moore, Elton Morice, Harold Ray, James Hemsing. K. "Pi Phi Pholliesn by the Pi Beta Phi Sorority jazz Chorus: Aletha White, Helen Archibald. Catherine Bur, Thelma Johnson, Agatha Hahn, Dorothy Hollands, Marion Pierce, Autentia Porter, Hazel Wright A jazzmine Buds Chorus: Katherine Tenney, Helen Clayton, Grace Goddard, Mildred Kern, Lucille Kessenich, Helen Ramsey, Gretchen Schweizer Fascinating "W" Boy: 'iTommy" White, "Marge" Donaldson and Chorus HERBERT M. BAKER . RONALD C. RAMSEY DAVID C. MOORE . . ALVIN R. KLANN . GORDON E. ADAMS . . WILLARD C. SUMNER . , OWEN L. SCOTT, Chairman Production Sta-If Production Manager JAcK BIGLEI2, Chairman, FRED C. KELLOGG , . . i Asst. Production Manager Program and Floor . Stage Manager Joi-IN W. MCPHERRIN, Chairman, .JEROME BJERIQE . 1 t Asst Slave Manager Adverlisme' Union Busintfis Manager JAMES M. LINDSEY . ..... Property Master Musical Director MERRILL C. GODDARD ....., Electrician . . Puldicizy RALPH BLIRT, ROLAND HANX'K5, CI-IAIzLEs READING h Property Assistants Baker Ramsey dill III II I I I I I I II I iiiiiiiiiiiiiiiiiiiiliiiiiiiiEZREEFIIQIZIEZK I E"i"i'"'i""""""''W1"""""T"' TiFiii"'fT'TI ' ' "" " I II Page 284 gmmmunmumnuunnu1mwuf1InwfuuufuvwHwInnuinwmwfmvurm3Wwgmwnfrmin1In1Hw1uwInwuww.1wInwInwnwInwuwvumww51wnwunIn1HwrnwnvwInmmwInfu1fn1Inru1H+wHwIn1.I1vu1yuw.11mnvvmwWufwInm1fl11.ImmmmmmmInm11-wu1.1unmwHwrnXInfu1mwInruuIn1uwruXuu1n1muyuwInuIn1nwIHwuv1uwwnwW1uuuuurn1m1uw1uwruuInwInwuwfuwmwInrnwmwInwuwmwnl1mmwnnnuruwmwInruwmwnuwrnnnnuwInvuwInwInnnw+uwul1u1uwInuvufuwnmrnwmwnmnmnummmwU 5T...-gmmmmEmmi:mm:WX:Zan:ml5:M4WinW'iluhXmXvuMmWH5mlmn:RmlmKW:WM5:MIman5:1inanmmingm5:mx:an1Wmmmmm.- ..,...,...,..,..........,,..,...... . .,...,. .....M .....,.. W.,...,.,.. .....,... . .,... , . . ,.,... . ..,.., ,..,... .........,. . ,..,.. ......,.............. ,... . ..,..,........,., , .,...,,...,,,.....,.,.,,......,...... . ..,. ,. ,.... . ..,,..... , . . , ..., ...,......,...,..,,., ., .....,.,,..4,,. . ,.,,..,,.,.,..,..,,. E,, . ..1,..mu.HL..X..,H.....WV...H,.....U,U,..,,..,..,L.....l.......,...,1.,H.N.,1H,N.,..M.,V.,,..,,..,K..W...W,.U,..1W,..,.......H.H..,,..,.H,..,,..WH.W,..,N,W,.4,..,...W.W..,..,..mmv.ww..,H.,-H...1.HL...X1HummH.1...4...N.Hmm.,In11.,V..1In11.XN.W1.1,Hm.m.mmmm..555 E55 ii: gy ESE :ss ' sr S! EEE . wiq uwmvow'L ' .V'.' fyyfffzfr fi 5? Ei , 55 dw 5:5 E5- si EEE E Es: E E. if E2 ii EE- E 555 E55 ESQ ' ,.: nn nv 55 EE mn mm mn mu mm nm gg5.....,......,...,,..H..,...,.,.,,..,..,,......,...,,..4,......,.....u.N...,M...,..,..m...W.,..,,.,,..,,...,..Y..,..,,..,X.,H.,..,...,..,...n.,..n..,..,,mmmu.,..,,..H.,,..,..,,.,,..,..,WW.,..H.,.H...H.,...H.,..,......1Y..Y...um.,...W..,..,..,Y..H.,,..,..W.,...,..W.,..,....,n,.W..,...,,.,M.,...V..,,..,..,,..H.,,,.,..,,..H.,,..,......,,..,..W,...W,.....,H.,..,,...,.n.,H..,..,..,,...,,.,,........,,..,.WK...m,...,....,,m.m.,....n.,..n..,,.,.,.,....,.x...,,...M,..,...1..,,.,l.,,.,.,,.,,.....,m...,...,5E smnmnmmmmunnunnuumInwInin1znfinlmiiiniIii?iii?FEllllliiPUSH?HiEEEIiliiilQIEFIIIYIIEEIHEFHIiliiiiiiEHIEEIEEEEiFQIIEIIGFIEEEEIIEEIli1ii?EEiiiYi1UEiiEiiIiiIiiDiEii?PFIEIIIIIRQHQIIPISIEIEI1mvmlmEEG:umwInInmvInwmInwuwnuInfuwmmummInnuuumnunumInmumInunnvfmmmm.ummmInnunl1uuummmHmIn'mm1mInwInummmmnnmvmInmmmmuummumnmmmnnummumInummInummummunmmlmEi?EE5EiiIEmui1E mn mu Page 285 nmmmiumm I Inu n u I I n II um II ru II I mu I num uinusuIummmuirniumnnmiminiinvmimuuinmig mmm, . .IMI . ...nm .I H. I .I .I..I........m....... ..I,.II.I,-m.I.... mi.II,..,...i.-InM-mm-mmnmimi-mmImunmn.nm.m2 665718 S. A. T. C. Frfolic The Minstrel Show Production Staj LIEUT. RALPH I-I. MCCURDY ARTHUR N. WILCOX . . BRUCE CARTTER, MELVIN LUTHER . LYLE BROWN, ROBERT HOLCOMBE . HAROLD FIELD .,.. . Director . . . Manager Business Assistants . Property Men . M alze-u p Man Performances Fuller Opera House . . University Gymnasium . University Gymnasium . Program Thursday night, November 14 . Friday night, November 15 . Saturday night, November 16 'EE .E as :gs ES EEE 525 a 52 35 is E E53 1 Boxing and Wrestling Matches 5 Wisconsin Tumblers -Q: K, A ' WOODWARD TASCHE GOLLEY 2 ln Fair Hawaii ' Hula-Hula Dancer: DONALD MARVIN 6 SOPVUHU 3010, Female lmPGfS0"lf1fl0'1 E Soloistsz WALTER HEWETT, NELSON LA W- WARSINE HGANPE O h f 10 - 7 Minstrel Show 35 awauan rc astra? plqces Interlocutorz L. N. THOMPSON Chorus of 8 Hawaiian Maidens , 5 Endmen. 3 Exhibition, Double Manual of Arms IIQIAVE IVEAHONEY C1-ICURTI5 M ARRY WEENEY AY OLCOMBE ERVIN FLOM' CLARENCE DONALDSON WALTER HEWETT GEORGE BARTLETT C. O. DRIVER LEO RODEMS ig 4 M ' l A . MZ:SZEYwkwardgiuad jiggersz NVASMUTH, RODENTS TTON . . . . , BART!-ETT LOUGHLIN Eccentric Violirust. KREPS Q gg CARSWELL NUHU5 jazz Orchestra: HUB LENZ, Director CRAIK POSTEL Grand Chorus of Twenty-five Voices 5: gs 33 In Page 286 T mmmmniwunummimnmmmmn ,...m......?irn-n.mmaEmmiimm.. ..,.. ........ .... -. .,.. .....,.. 5G7ze University Band WIVLLIAM E. YATES ' Conductor Conditions were unusual this year with regard to the band and many Obstacles hindered its progress. The first quarter a band was organized in the S. A. T. C. Its progress was slow because of the limited number Of rehearsals. After the demobilization of the S. A. T. C. we were left without a band as only a few members returned. At the beginning of the second quarter a new band was organized. This band promises to be a first class organization in a short time. With the co-Operation of all band men here in the University every effort will be used that the standard of the University bands may not be lowered. Personnel Piccolo I-l. A. STOLEE HEAD W. B. K 4 F. A. AN ANT . ONESTEEL OEHLE1 D. S. DEWIRE J. S. I-lEss u es I-l. GLAETTLI C. A. HOPPERT Clarinets P. C. QUENTMEYER I.. W. MORRISSEY M. D. JACKSON A. G. MELHAM R. C. MATTOX M. B. GODDARD Saxophones D. B. TERKEL L. M. KELHOFER I-I. L. ALLDS Comets W. P. HANSON D. R. LAMONT mi u u I mmmwmmmu nm: mmuimmummmimummmmn mmmimnumun uumumummun:mmmm:imnmwmummnnu W. W. JUNG F. O. RIEK P. A. FOOTE I-I. P. BOWMAN Trumpets C. A. BRODT C. CAMPBELL Horns D. M. BENNETT G. B. WATSON I-I. M. HUCKUK B. MACQUEEN H. J. DUETSEH Trombones W. J. SEDER J. I-I. WEGENER W. J. KLOSSNER P. SANDERS P. E. BOLLINGER Baritones C. ERICKSON E. N. PETERSON Basses A. C. WILGUS L. E. JACKSON K. K. CHEN Drums T. M. THOMPSON R. E. FROST I-I. D. CHAPMAN E. M. HINTZ mu nm mminTmmlmuimumummmlummunmunmnmun I ui I ii nmimmu.mmmmmmnumuimmumiiuiimniluunmmmiunmuunmnunmuui Page 287 niuiimuummmmmmnrmmnummnnmmm m The University of Wisconsin Glee Club Fa k Gnagi Adams Slalcer Carroll Mackay 1-lasenpflug Wolfe Gregg Hexvecc Coon Moody Goddard Sharp l-lintz Schxvmn Smngh Driver Burdick Swinney, CDirectorJ McNamec Fenner Walker Roberts Officers RUSSELL M. FETTER CAMILLES O. DRIVER ERNEST ADAMS GORDON l-l. SHEPI-IA ID CLARK j. CARROLL MR. E. E. SWINNEY l'lARLAND B. WALKER ELMER M. l'lINTZ . ALI ISON L. BURDICK CAMILLES O. DRIVER RUSSELL M. FETTER JOHN W. GREGC WILL GNAGI ERNEST ADAMS GEORGE W. COON XVALTER K. SCHWINN CLARENCE A. FALK MERRILL GODDARD CLIFFORD E. lvES Personnel First Tenors SIDNEY MOODY Second 'Tenors First Basses Second Basses IIIIII.IIIIIIIIIIIIIIIIIIIII-IIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 288 . . President . Vice-President . Secretary . . Treasurer Business Manager . . Director Librarian Accompanist j. LEROY HASENPFLUG SHURLEY L. MCNRXNIEE WVALTER W. l'lEXVET'l' EDWARD l-l. ROBERTS ARTHUR W. XVOLFE GORDON l-I. SHEPHARD DON V. SLAKER HARLAND B. XVALKER RALPH W. lVlACKAY HOWARD M. SHARP OSCAR E. SMITH IIII II I The PI adform Beach Wishnefsky Groves Review of 1918-19 Forensics The opening of the university year in the fall of 1918 found practically every star NVisconsin debater of the past two seasons in the service of his country. Most of them were commissioned officers. Two of them, Guy Black, '17, and Harold E. Kinne, '18, were killed in action. Out of the chaos of the Hrst quarter-the Student Army Training Corps, the joyful celebration of the armistice, and the return of many students who had rallied to the colors at the country's call-after this rapid turn in the tide of affairs, the university entered on the "after the war" period, and forensics revived with the opening of the second quarter in january 1919. The First Annual All-Forensic mixer became a reality under the auspices of the Forensic Board at Lathrop 1-lall, Feb. 15. Members of the five literary societies, Athenae, Castalia, 1-lesperia, Philomathia, and Pythia, participated in the very successful event. One representative of each society made a short speech. I-larold M. Groves, president of the Forensic Board, was chairman of the evening. Fletcher C. Cohn, '20, of Athenae, won the final oratorical contest and the honor of representing Wisconsin in the Northern Oratorical League contest at Northwestern university in May. His oration was on "The Short Ballot." Keats S. Chu, '19, of I-lesperia, was awarded second placc with an oration on i'China and the NVor1d Peace." Chu, who was elected president of Hesperia during the second quarter, is a member of Artus, honorary economics fraternity, and is also president of the Mid-West Chinese Students' association. Marguerite L. Schulz, '21, of Pythia, and Charlotte J. Calvert, '21, of Castalia, were elected to represent their societies on the Forensic Board following long contemplated action by the board to provide for women representatives. Miss Schulz won first place in the sophomore oratorical contest, and Gladys E. Riggs, '20, of Castalia, was awarded Warren first place in the junior open oratorical contest. imiiiiiiii myI.i.iii-.ii-ii-iwiiiwii i-ww -ig iggiu iiifiiiiiiininmiluiiniiiiiiiiiiiuiiiiiMiiiniiwwnmwwm I Page 290 HW' Hayden Cohn Chu The Agricultural Literary Society reorganized and elected officers: Elmer R. Clark, 'l9 president-, l-lugo A. Stoltenberg, '19, vice-president, Nels T. Nelson, '19, secretary, l-larold I-I. Cole, '20, treasurer, Bruce L. Carter, '20, sergeant-at-arms, Charles King, '20, was elected to the Forensic Board. Athenae and Philomathia will meet this May in the annual joint debate which looms up as the biggest forensic event of the year. Government ownership of railroads is the question on which the Philcmathian team will uphold the ahcirmative against Athenaes debaters on the negative The scheduling of the intercollegiate debates, which had been cancelled because of the dreary outlook in the fall, met with so many obstacles that the attempt was given up. The freshman oratorical contest, the joint debate, the Northern Oratorical League contest at Northwestern, the sophomore semi-public debates between Athenae, Hesperia, and Philomathia, and the annual Castalia-l-lesperia and Pythia-Philomathia parties, in April and May, will mark the close of the l9l8-19 forensic year. The inter-literary society championship in debate and oratory will be decided by the outcome of thejoint debate and the semi-publics. The winner of the joint will receive four points, the loser two. Each victorious team in the sophomore semi-publics receives one and one-half points. Athenae won the championship last year, and already has six points towards this year's honors, Hesperia has four, Philomathia none. Prospects for next year are hopeful. The Forensic Board is co-operating with Prof. J. lvl. O' Neill, chairman of the public speaking department, in efforts to arrange for several intercollegiate debates in 1920. The Regents' appropriation does not cover necessary expenses. I-lesperia, this spring, will choose her joint debate team to meet the Athenae-Philomathia winner next fall. 'The oratorical contests will be held at the beginning of the second sem- ester as in previous years. All of the literary societies have been holding their regular weekly debating programs since the opening of the second quarter. An increased interest in forensics has swollen the membership of every society, the women have been granted representation on the Forensic Board, the -Agricultural Literary Society has been reorganized, the first annual All-Forensic mixer has been held-everywhere there is an atmosphere of progress which predicts a banner forensic year for 1919-20. Schulz l ......EEEEEIEIEIEi!............EIEEEYEIEEIIIHI!fl!!f!!!..,..... "HW"""'""U"'N'3""""""""" ! umuuiinimiuiiuimuiiniinimmumnnuiiiminmumiin iilfiljLilimiilim,iiiiiifiiimlul 1 Page 291 g1ggg1g111g3u111-1151511515111 1111131111g111g15!1199151151 1 1 1 111 111111 11111 1 1111111111111111111 111 111m3111n111m1w11111111111111111111 111111111 11111111 11111111111111111111111111111111111 11 11111111111111111 11111111111 11111111111111111111111111111 1111 111111111111111111.1513gE ...1..1..1..1....11 ...1......1... n........ 1 ......... . ..1...1..1...1....1.. , 552111 11111111.11.1111.1111 EE 3 1 ' ' ' Y Fr' . olnt Debate 1 JJ, 1 lx 5 - Y 5 4831 Annual Joznt Debate Mayf, 1919 ATI-IENAE vs. Pl-IILGIVIATI-HA Gov. EMANUEI. L. Pl-IILIPP, Chairman Question: Resolved, that the United States Government shall, within Eve years after Nov. ll, 1918, own and operate all steam and electrified-steam railroads doing an interstate business. PI-I I LOMATI-I I A ATI-IENAE Affirmative Negative JAMES M. I-IAYDEN, Closer BEN M. WISHNEFSKY, Closer E GLENN B. WARREN l'lAROI.D NOER WHITNEY N. SEYMOUR lOHN I-I. VAN VLECK EE E! e e s El VanVleck Wishnefsky Nocr L.,,,,,gg,ggwgjggllhlv1g3,wmg,M mmmmmm 111111111.1111111111111..11.11.1.1.11..1.111111,1....1,.1.1. 1 11. M. 1 MEL but1.111.1211.111.1111111111.1111111.1.1111..1..1..1.111...1..1.1..1......m.11..1.....11...111.m.11.1...1..:- 1111111111111u1111u1111111111111 1 1111 1 11 1 1 1 1 1 1 1111111111111111ii111111ii11111111i11ii111111i111111111E"' " 11 111 111 1 1 11 11111111111111n111111n1111111u11u11m1111111111uu11u111111i111111111u11u111111n11u111i1111111u1a1e Page 292 gn E E E 5 5 E E E E E E E E , .1 Ei gi ummmniiimimimuiii F umm..mm..i......ii 3 E S 2 2 ls E S 9 E 1 E 5 E 5 E 5 um mmm mmm if Ei ngimq E mmmmm uuummmm ummm .mmmimm Ei Ei at si Ei ,I 21 51 if Ei E! E E E Eff ae W 3 ' 1 i H' oznt Debate f v 3 Hzstory of the joznt Debate The '91 Badger printed in 1890 says of the joint debates: "These contests are the pride of the institution, their participants the heroes of the college, the realization of the grandest possibilities attainable through service in the Cliteraryj societies li 4' 3 each succeeding struggle confirms the truth that in the production of powerful debaters the University fof Wisconsinj stands foremost among the educational institutions of the country." The first joint debate was held at the Chapel in 1867 between Hesperia and Athenae on the question of the constitutionality of the reconstruction bill of the 39th Congress. Hesperia upheld the negative and won the decision. Burr W. jones, Madison, Wis., widely known at present in the field of law, was one of the three members of Hesperias winning team in the Hrst joint debate. He was also on the Hesperian joint debate team which lost to Athenae in 1869. President Charles R. Van Hise of the Univer- sity of Wisconsin, who died in the fall of 1918, was a member of the Athenaen joint debate team which defeated Hesperia in 1879. Francis E, McGovern, former Governor of Wisconsin, was on the Athenaen joint debate team which won from Hesperia in 1890. The late United States Senator William F. Vilas, ex-United States Senator john C. Spoonerg the late john A. Aylward, United States District Attorneyg judge Evan A. Evans of the United States circuit ccurtg Prof. Elmer Robinson of Leland-Stanford universityg Dr. H. L. Smith and Professors Chester Lloyd jones and julius E. Olson of the University of Wisconsin, and many other prominent men served on joint debate teams. Victory in the joint debate carries with it the debating championship of the university. Athenae, Hesperia, Calliope, Lionia, Adelphia, and Philomathia are literary societies which have figured in joint debates. There were nojoint debates in 1870-71-72. The debate this year between Athenae and Philc- mathia will be the forty-eighth annual joint debate. The joint debate has gained nation-wide prominence. Many of the debates have been printed and filed in the Historical Library. T Hayden Warren SeYm0Uf ..i..i..ii..i..w.ii.m 1i..i..m.,..ii.w-i.,i miiiiiiiiiiiiiiiiiiii imiuliiilmniiwui Page 293 mn I I I I III In I I I I I I Inu Im IIII In Inu IIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIII un: I In :ff Q A 1' Af A 1: f . I . N211 I W ,,,- 1 A"2 A.,.A . A 1 I .LC I I A - -iii ", tg '.-- :Iii ,.vA, AW ' J 'i'11 if ' CD4t11enae M embers 1919 MAHLON H. CARADINE PHILIP F. LAFOLLETTE PAUL H. CONWAY HAROLD R. NOER JAMES GREENBERG CHAUNCEY J. PELLOW BEN F. WVISHNEFSKY 1920 MAX ALBERTZ RUDOLPH R. KNOERR ALFRED J. BAUER SIDNEY F. MOODY JOSEPH B. BEACH LINCOLN QUARBERC FLETCHER G, COHN WVYMAN S. SMITH PERCY F. DORNBROOK RALPH D. STILES LAWRENCE HALL JOHN H. VAN VLECK KENNETH HARLEY GOODXVIN B. WVATSON GERALD HODGINS FRANK E. WILDER 1921 BRUCE M. BLUM CHUNG LUI SYDNEY C. CHARNEY 1SADORE A. PERSTEIN XVILLIAM D. CONNOR XVILLIAM H. PIERRE FREDERIC A. DOERELER FRED RUFFALO FRANK E. DRUMMEY TAYLOR H. SEEBER MAURICE E. FIELD ARTHUR C. TAYLOR CLARENCE E. FUGINA FENG TSAI SIDNEY B. GOEE JACOB M. WEISMAN FRED G. KRIVONIS ALFRED E. XVILLETT IOHN C. LOWE WVALTER E. WOLF SAM ZADECI4 1922 HARRIS ALLEN ARTHUR AYLWARD MELBOURNE BERGERMAN JEROME O. BJERKE PERRY A. FOOTE ALFRED KESSLER CARL W. LINDOW .III..m..II.II..II.III.IIIII..II.w.II..II.II.III.I IIII.IIIIIIIIIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIII Page Z94 GEORGE C. LORD DAVID J.. MAHONEY BIRNEY F. IVIILLER ALBERT K. ORSCHEL RALPH B. SPENCE SAMUEL SYGMAN ANTHONY C. TRAYCER uni 1 i in i i ni runner iii iii :min ir rniirmiiiriiiiin i i ui iv i I I Cbithenae Moody Bauer Smith Drummey Spence Hodgins Wolf Lowe Dornltarook Perstein Miller Docrflcr Lord Pierre Fugina Greenberg Hall Willett Quarberg Kessler Van Vleck Goff Pellow Harris Stiles Aylxvard Albertz Wishnefsky Noer Beach Taylor Cohn Foote Cha rney Weisman Sygman Orsrhel Field Bj erke Ojicers HAROLD R. NOER, JAMES GREENBERG . . Presidents RLIDOLPH R. IQNOERR ...,. Vice-Presidenz KENNETH HARLEY, RALPH D. STILES . Secretaries SIDNEY F. Moom' . . . . . Treasurer Athenaas History At the very beginning ofthe university, the need of a good literary society was felt, and, largely through the efforts of Prof. J. W. Sterling, Athenae was organized in 1850. Two years later it was incorporated under the laws of Wisconsin with Levi Booth, Charles T. Wakeley, George W, Stoner, 'D. K. Tenney, Francis A. Ogden, and George Woodward as charter members. Meetings were first held in North hall. Athenae won every home, two state, and one inter-state contest during the time that the uni- versity was a member of the Inter-State Oratorical Association. The I-lon. Robert M. La Follette, present senior United States Senator from Wisconsin, won the inter-state contest in 1879. Since the nrst joint debate in l8o7 between Anthenae and Hesperia, Athenae has won a good majority of the debating championships, which have been a source of friendly rivalry and the means of stimulating forensic activity. Athenae is proud of her history in both war and peace. Her members came willingly to the nation's support in the Civil War and in the great World War just ended. Former president Charles R. Van I-lise of the university, former Governor Francis E. McGovern of Wisconsin, Paul S. Reinsch, United States Minister to China, and a host of other prominent men were Athenaens. 1 ii . .1 uiimiiuiiiiiiiiiiiiiiiuimmimmimmiiuiii 1 """""""'M" """" ' " iminiiimiiniiniiiiinmimmiiniiiimiwmimmiiiiiii Page 295 IIIIIII II I I I nI I I II Is ..A, . , ' EEE. A. -Mgsyf 1'c:::Z9' ' ' .24 "S . .. .,I .... A S, .,,, . . - 'N-.Al-,..q,.-I. M- . - 1 ' 12121-' - 1 - ,. 1 . ' JOHN A. ANDERSON KEATS S. CHU EDWARD L. DEUSS ERNEST F. FREYMILLER LEONARD BERCSTEIN HERBERT BEYER JOHN W. COWAN JAMES R. ELLIOT ERWIN A. HENTZEN STEPHEN ASCHENERENNER KO KUEI CHEN EWART K. CLEAR HAROLD O. FROHBACH JOSEPH G. FUCILLA EARL H. HESEMAN PAUL P. BOEEEL WENDELL BONESTEEL HOMER B. DENNISON Hesperia Members 1919 HAROLD M. GROVES ROBIN HOOD IRWIN T. MOHME OSCAR A. OLSON RAYMOND J. SUCHY 1920 WVILLIAM STERN 1921 1922 OLAF N. ROVE .IIIIIIII-Im IIIIIIIIIIIIIYI InIIIII-IIIIIIIIIIIIIIIIIIIIIII,IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 296 FREDERIC A. HORTON ROBERT K. IRVINE HOBART H. KLETZIEN BARON DEHIRSH MEYER BERNARD E. MEYERS WVILLIAM F. KOCH CLARENCE C. IQRAUSE LESTER LAUN HARRY IVIUSKAT EARLE J. TOWER JAMES H. XVEGENER EDMUND J. PENNFEATHER HENRY B. PERLMAN JERRY H. QUAM H esperia Hood Laun Hesseman Rove Freymiller Boebel Chu Krause Hentzen Koch Cowan Kletzien Suchy Groves Meyer Fucilla Mohme Perlman Deuss Muskat Metzker Chen Pennefeather Frobach Meyers Aschenbrenner Ojfcers - HAROLD M. GROVES, KEATS S. Cl-IU . . Presidents ' ROBERT K. lRv1NE, JAMES H. WEGENER . Secretaries KEATS S. CHU, BERNARD E. MEYERS . . 'Treasurers Hesperiefs History Hesperia was organized in 1853, three years after Athenae. A charter under the Wisconsin laws was secured the next year with R. W. Hanson, G. W. Perry, A. W. Lathrop, R. W. Hubbell, W. F. Vilas, T. D. Coryell, and S. W. Botkin as charter members. The first meeting was held in South Chapel, which was lighted by tallow candles. "Magna Parens Virumn is the Hesperian motto which the members strive to verify in war and peace. I-lesperian debaters won the Judges' decision over Athenae in the first two joint debates held in 1867 and 1868. l. S. Leavitt, F. S. Stein, and B. W. Jones were the members of Hesperia's first joint team, which successfully upheld the negative on the question of the constitutionality of the reconstruction bill of the 39th Congress. Hesperians are rightly proud of the excellent record of the society in war and peace-the Civil War and the World War, and the days of peace that intervened. Col. William F. Vilas, charter member of Hesperia, was a member of President Clevelands cabinet. Former United States Senator J. C. Spooner was an Hesperian. Congressman E. E, Browne of Wisconsin, Prof. J. F. A. Pyre of the university, and prominent men in all walks of life are numbered among the alumni of Hesperia. Cvuy Black, '17, closer of the Hesperian joint debate team which won the decision over Philo- mathia in 1917, was reported "killed in action" in France during the summer of 1918. Keats S, Chu, '19, at present president of Hesperia, is one of the most brilliant Chinese stu- dents in America. He is a member of Artus, honorary economics fraternity, and is president of the Mid-West Chinese Students' association. .mmm-i.. i.lv.mw..iiw.w. iiiiiiiiiiiiliii?iiiiiiimlmwlmHumif1in1ml-miwiiliiiimm Page 297 . Y, I ' AWE , .K,., 'gps' , f If ,:.,:.4AV:,Iy ,3 ,A Q 7 if .ui J ,V .V .5 .?.g,.,6E , .5 if ' , " "'x ' . ' , .. , A jg V,,V . ' Ph '1 1511 ' 1919 THOMAS W. CAPE NILS E. STABO JAMES M. I-IAYDEN GLENN B. WARREN FRANK A. Ross JOSEPH O. WILSON 1920 HENRY W. FRICKER RUDOLPH J. SCHLICHER EDWARD P. IQEARNS XVHITNEY N. SEYMOUR FREDERICK W. OLDENBERG SANFORD S. SMITH GEORGE D. SPOHN 1921 CHARLES ASSOVSKY GLENN J. FACBAULLEN WARREN A. BOHL I-IERMAN B. HALPERIN THOMAS J. DREDGE ANTHONY W, PESCH JOHN M. EGAN T. FOSTER STRONG JOHN V. GILBERT GEORGE I-I. WVATTERS LEON E. IQAUMHEIMER LESTER C. XVEISSE DAVID W. MCLENEGAN LORELLE A, XVOLF 1 922 ROEERTJ. CROWLEY CLAUDE A. GATES MAURICE A. HIRSPIBERG JOSEPH H. JOHNSTON A EUGENE J. TERRY InIInIInIInIInII.I.III-III.4I.-I.m-Wm. InIInInInIIIIIIIIIINIIIIIIIIIIInII.IInImmmwum-ww.. Page 298 DEAN P. TQIMBALL DAVID M. KUPPERMAN VICTOR W. NEMETZ FRANCIS D. OJLAUCHLIN i i Pltilomatltia Weisse Kimball Cape O'Laughlin Crowley johnson Terry Bohl Egan Assovsky Oldenberg Seymour Hayden Warren Kearns Strong Fricker Stabo Smith Watters Wolf McMullen Schlicher McLenegan 017i cers JAMES M. l'lAYDEN, GLENN B. XVARREN . Presidenls WHITNEY N. SEYMOUR, SANFORD F. SMITH . . Vice-Presidents CHARLES Assovsxv Secrelary GEORGE D. SPOHN , Treasurer Philomatliiafs History Young, self-reliant, persevering, and successful are epithets that Philomathians are proud to use in describing the merits of their society, which was founded in 1886 to meet the need of another active literary society which could provide more frequent opportunities for exercise in rhetorical work than could be obtained in the older and more crowded societies. That they succeeded without any "banner high advanced" betolcening them either great or the sons of greatg without any catalogue of precedents or names of mighty alumni to stir them to exertiong with nothing to rely on for success but their own industry and perseverance, is the boast of every Philomathian. Since being admitted to participation in forensic rivalry with Athenae and Hesperia-the youngest literary society, Philomathia, has proven her ability by winning many joint debates and several university championships in debate and oratory. 1-ler young alumni are beginning to take their places in responsible positions. Among these are Julius T. Dithmar, Assistant Attorney-General of Wisconsing Ernest N. Warner, prominent Madison lawyer, and a host of others who cannot all be mentioned. Gustavej. Wright, '15, Madison, Wis., who was a member ofjoint and inter-collegiate debat- ing teams and Northern Oratorical League representative in 1915, is typical of the calibre of men that Philomathia is turning out for her country's service in war and peace. - Wright gave up his life on a French battlefield during the summer of 1918. inimmiiimmiimiiiiiimwiiiiww-my 1iiiiiini1iiiin1niinmiiiiii-iiiiimmuiiii Page 299 1 1 ri Pythia f,2dmf?wRQX A p . M 9E?g?':fs5s5 52 Oficers . President . Vice-President MILDRED PEDERSON . HELEN BORCHERS . LOTTIE GRAF . EVELYN PHILLIPS . . . . - Secretary . Corresponding Secretary In I I uv: VIRA WINCHELL FLORA I-IEISE . JANET LINDSAY . MISS ABBIE MAYHEW . . Treasurer . . . censor . Keeper of the Archives Honorary Members MISS ARIEL MCNAUOHTON MISS F. LOUISE NARDIN ELIZABETH ALLING LOUISE BEAUCAGE OLIVE BERRY I-IELEN BORCHERS LOUISE EMERSON LOTTIE CRAP DOROTHY GREENE V IOLA I-IOLLENSTEINER DOROTHY DOPP FLORA I-IEISE HILDA GERDS FLORENCE GERKIN LILLIAN HANSON FERN BUSBY GUSSIE GREEHECK MARIE I-IAAS ESTHER GUERINI ESTHER I-IEISE Active Members 1919 BERTHA YABROFF 1920 VIRA WINCHELL 1921 1922 IWI.IIInIInInI.HInIIn.HI.II..II.IImmIIIm II.IIInInuwInInIInInIIIIInInIInIInIIIIIIIIIIIIIIIIIIIIIIII Page 300 MISS A. M. PITMAN MISS BLANOHE TRILLING MRS. CARL YOUNG MARGARET J OHNSON ROSE NEWMAN ELEANOR 0'L,AUC-HLIN EVELYN PHILLIPS MILDRED PEDERSON MILDREO RUFSVOLD BESSIE TAYLOR FLORENCE WHITBECIC LOUISE INGALLS ,JANET LINDSAY MARGARET MCMEANS ISAEELLE QUARBERO IVA RANKIN RUTH LANZ DOROTHEA LEVI MARGUERITE SCI-IULZ DOROTHY SHANER ELEANOR SHEARER -4 L i 1. .In I.. Ii mi. ii... mi.. I. II . Hi Tythia .YT I 7 . 3 cfs, . I' Newman O'Laughlin Emerson Alling Hasa Gerken Gruenbeck Shaner Taylor Berry Lind Phillips Gerds Borschers Rankin F. Heise Halford Beaucage McMeans Hollensteiner Yabroff Levi Lindsay Winchell Pederson Quarberg Guerini Dopp E. Heise Review Of the Year Americanization was the theme about which the work of Pythia centered this year. A certain portion of the time was set aside for the Studies of the countries which have been sending immi- grants to American shores in recent years. The home environment of Russian, Polish, Aremen- ian, Greek, Italian, and other incoming folk has been investigated in an attempt to arrive at a more complete understanding of the contribution they make to western civilization and Of our problem in making them American citizens. Speeches were prepared from time to time which were adapted to various types of unassimilated Americans. The psychology of the immigrant was studied and practical methods of dealing with him as an individual were worked out. Original programs and debates dealing with problems arising within our national boundaries provided variegiya Special features such as a pageant and the celebration of National Night have been provi e . . While Pythia exists as a literary Society, like every Other organization, she has felt that her problems must deal with questions arising out of war and the period of reconstruction. Thus, while the program of Americanization appeared one of vital interest for the college woman to consider these days, yet the training in speaking and writing and thinking that should be devel- oped by a literary Society, has been obtained by the methods used in approaching these contem- porary problems. Pythia, this year, also originated a plan for a national federation of women'S literary societies. The plan received enthusiastic endorsement by all the leading Societies of the colleges of the coun- try who find it desirable to affiliate for the discussion of problems and policies vital to their several Interests. Women 'S Annual fDebate May 2, 1919 Castalia vs. Pythia Question: Resolved, that all conscientious objectors now held in military prisons should serve their full terms. PYTI-IIA CASTALIA Ajirmative Negative MAROUERITE L. ScHULz, Closer CHARLOTTE J. CALVERT, Closer ELEANORE C. SI-IEARER JOSEPHINE I-IINTOEN ESTELLE R. STONE ELIZABETH KUNDERT First Annual All-Forensic Mixer Lathrop Hall, February 15, 1919 General Chairman-HAROLD M, GROVES, President of the Forensic Board Arrangements Committee-JOSEPH B. BEACH, chairmang music, WHITNEY N. SEYMOUR, publicity and tickets, HAROLD M. GROVESQ hall and re- freshments, FLORENCE WHITBECKQ program, VIRA WINCHELL AND JANE MARSHALL Speakers , HAROLD NOER, Athena HOBART H. KLETZIEN, Hesperia CHARLOTTE CALVERT, Castalia FREDERICK W. OLDENEURG. Philomathia MARGUERITE L. ScHULz, Pythia Chaperones Assistant PROP. LUCY -GRAY Assistant PROF. AND MRS. I. W. JONES mi..I..m. I iuiiiiiimmi .awwwummm-im imimi. mmm., -L-LLLMMLQILM ' mmmanInIiIImyuiiimiiInummmmiiiimiimmimiiim Page 301 u nu 1 I I I I I ui I I IIIIIII II is I IIIIIIII IIIIII Ii. I um Ccdialia Calvert Oestreich Sutherland Kennedy Parker Loomer Hendricks Kundert Odegard Sawyer Pointer Higley Gregg Cook Olbrich Ayers Lee Weld Noetzel Hintgen Durch Oestreich Sinclair Markham Riggs Cleveland Jacobs Moe Marshall Kiekhofer Hadley Smith Gaik Coe Jones Ostlund Dawson Winter Hammond BradFIeld Robertson Weber Stofflet Ojicers GERTRUDE M. JACOBS . . . . . President MILDRED I. SINCLAIRE . Vice President CHARLOTTEJ. CALVERT . . Secretary RUTH M. SMITH . . . . . Treasurer HARRIET E. HAMMOND . . . Music Direclor M embers Graduate MIRIAM B. HUBBARD 1919 LOIS A. DAVIS JANE R. MARSHALL KATHARINE A. FEDDE SICRID W. lVlOE JOSEPHINE HADLEY ETHEL J. ODEGARD DOROTHY HARRISON MARION G. OLBRICH FRANCES L. HICLEY LOUISA PARKER MARIE E. HJERMSTAD HELEN B. SMITH DOROTHY E. KENNEDY RUTH M. SMITH ELIZABETH SUTHERLAND - 1920 H, ALMA BRADFIELD lX4ARGARET l. LEE CATHERINE E. CLEVELAND ZELLA G. LOOMER ORPHA M. COE MARGARET C. MARRHAM MARY CONVERSE GERTRUDE M. NOETZEL ROSE M. DURCH ELVIRA W. OSTLUND ELEANOR A. GAII4 GLADYS E. RICCS LELA HENDRICIQS lVlILDRED I. SINCLAIR JOSEPHINE HINTCEN ANNA B. STOFFLET ERNA L. KIEKHOFER ESTHER E. VAN XVAGONER ELIZABETH KUNDERT LOUISE B. XVEID 19.21 CHARLOTTE J. CALVERT HARRIET HAMMOND MABEL L. COOK DOROTHY JONES HARRIET l. DAWSON ESTHER M. ROBERTSON lVlABEL J. GRECC VIOLET TIMLIN LEONORE WEBER 192.2 ESTHER M. AYERS CAROLINE M. OESTREICH LORENA E. OESTREICH I 'M' iiiiiiii5iiiiiiiiiiiiEiIrinuIiiiGiHiiIiiiEiiIiII Page 302 RUTH POINTER FRANCES M. SAXVYER MABEL XVINTER Ei E E5:.,..I.....I.,...I..I,..Ii.I . I I . an I II 1 I nu II II I Agricultural Literary Society? Sly Ports Massey Kolb Sears Price Didier Klussendorl J, Wilson Stoltenberg Scauss Metcalf Remsburg Wilcox Clark Kuckuk R. Bocrner Schueler Kuel-In Grant Koehler Taylor Kull Blomquist Woelffer King Carter Harris Behling Presidents . . Vice-Presidents . . S ecrel ar i es . . 'Treasurers . . . Sergeanls-at-Arms FRED L. BEHLING ELMER R. CLARK NELS T. NELSON BRUCE L. CARTER HAROLD H. COLE WALTER H. EBLING BUSHROD W. ALLEN ANDREW B. ALLISON JOHN J. BLOMQUIST ROBERT L, BOERNER HELMER C. CASPERSON ANDREW P. DIDIER HERBERT E. GRANT FOREST D. HARRIS Second Quarter ELMER R. CLARK HUGO A.,STOLTENBERG NELS T. NELSON HAROLD H. COLE BRUCE L. CARTER 1919 IOSEPH O. WILSON 1920 AUGUST NELSON 1921 NVALTER C. STAUSS 1922 RAYMOND KLUSSENDORF EDWIN S. KOLB EDWIN F. KUEHN ADELBERT C. KULL GEORGE F. MASSEY JR. ELMER A. WOELFFER Third Quarter C. HOWARD KING JOSEPH O. WILSON BRUCE L. CARTER WALTER B. KOEHLER HAROLD M. KUCKUK OSCAR Z. REMSBERG HUGO A. STOLTENBERG ARTHUR N. WILCOX C. HOWARD KING WALTER B. KOEHLER HAROLD M. KUCKUK CLARK MCCONNELL HAROLD H. METCALE RAYMOND J. PORTMAN TRUMAN R. POTTS EDWIN E. PRICE OTIS W. PALMER EARL E. SCHNEIDER M. W. SCHUELER VERLYN F. SEARS IKEITI-I C. SLY DELORIS A. STROMMER LEWIS W. TAYLOR ' EDWIN M. WILSON I,....,......h......,......-....,..,...........,,....,. ....,.......... --.-....-.... -............- ,.....,-2L2L.....L..,'L'2.......,.........., """ 1222222222222 2'""""""'""""""""""'"'2"'"'"""""""""""""" nIImIIIIIIIIIuIIIIII II III Il In uml I III I I I II urn II I II I II Il IIIIIIIIIImImIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I """"T"""""""""' Page 303 wInnnulrwuvwlmkkkmdvnmuumwmw w in1I.1Phsm,Rumi-wimmmu 6719 Forensic Board Seymour Deuss Meyers Groves 0jQcers HAROLD M. GROVES . JOSEPH B. BEACH . Athenae JOSEPH B. BEACH Seniors HAROLD M. GROVES Hesperia EDWARD L. DEUSS HAROLD NOER GKWKQB'-Dk nr 'X QW' NX sf' vi WEA 'f or if 1 if fi? S A AV K Nwkfi YQ? N 2 WMQEW ' Ffh' ft., " K.. ff Q ,fwge .A , , -sv X Hey . 5.1.1 +125 - '- W ? f gifs" i A . ' '-'o .J- umm.H.HH.Lvm.HmL.m.m.mm.mwm unmsumumuwwuwwInnuIuwuwwuw1mummmlwmm Page 304 Noer Beach . President . Secretary Philornathia XVHITNEY N. SEYMOUR junior BERNARD E. MEYERS 5TudQrxT5elf Govermueni' mmurm n I I I r I I vw num In :ummm I 5 Clie Student Senate Readlng left to right-Ross, Duncan, Hall, Seymour, Warren, Noer, Smith, Birge, Beach, Brown, McPherrIn Mann, Hanson, Bunge, Travers, Quarberg Ojlcers PRESIDENT E. A. BIRGE . President Ex-Ojicio HAROLD GROVES President Pro-Tem WYMAN S. SMITH Secretary Members W...-.viz ef-g.. f - ff. Wx.- PORTER H. BROWN GEORGE C. BUNGE FRANCES W. DUNCAN HAROLD GROVES LAURENCE W. HALL MAURICE M. HANSON BERTHOLD C. MANN JOHN W. IVICPHERRIN IvmI-ImyInII.nmInInIInumwnmmwwl IummulInIulImInInIInumumumlmml Page 306 l'IAROLD R, NOER LINCOLN A. QUARBERG FRANK A. ROSS XVI-IITNEY N. SEYMOUR WYMAN S. SMITH C. WESLEY TRAVERS GLENN B. WAl?REN CHARLES L. WEBSTER ,,.. ......... ,.,.....I.......... gummumunuunIvuummIInvmIInummummnummmuummInnInmnummvmInInnInIInIummmnuunnumumummmInImIInHmmmumInImIInImInummIInInumInnmInImInIInrmumInIInmvmIInumInInEnIInInmlummInImlnIInInuwInummImmnlmmumvl mm II mmumnmImIIIInInIInrmmIIuIunnnnurmInIInvmvmnuInIInIInvmInummInIInIInvmIInnuvuIInummvmnunuImmInImnnInIInImImunIInIunmnmmImunv I ,ImnummmImmnumuImunmmmumunmInInInIumnwnmmuImImmmnInmlIInmunmnunnnImummunmImmummmmnIImInIInmnInrmnnInIInummmmmnvmumInImmIInunmmInmmmnmInumIIIummInImInImummunInImIuIInIInumInImInIInIInInIIwInIInIuIInIInumInInIInIInunInIIInInIInInIInumwIuImImumInuvInInInnuIInInIImunvmmInIInIInmumnnvmImInInummnnmmmumumummmmmn g The Student Court E SIDNEYF MOODY . . . . Cluef juszzce ALFRED N HEUSTON Secretary Seniors JOSEPH R. FARRINGTON ROBERT D. FITZGERALD -JAMES M. PIAYDEN EDWARD B. WILLIAMS KING G. WOODWARD juniors HENRY F. GRISWOLD GEORGE D. SPOHN 3 EI E is l-mnum-.mmlummmIummmnummm.mmmmummmummmInwmvImmmInmnmmmIm.mmInmmInInI..I.mmInnumImIm-mmmmH-.Im-M-mn InInInImInvmInImImIlnygnlInI111.55311IIIWIBMIIEI1335513533335wwwg555wII.w.ImI.mmmnumIm-UI-u..mummmu..m-IImInnummm,ImummHIummmImmmmlmmmumm.IIII1.IIIIIIIW-mImI1nmm-In,ImIm-mmmmulmnuw-IIIIII Ir mmmnummnmmunummummmmInmmmmmnInnnInmmmmI.mmmmImmmImm.mmmmImmmm,numImInnumnummImmIImnImImmmInmnIuummuIunmnuu1InummInummInIunmmInmum-IIIIIIIIIIIIIIummIIIII--IIIIIIIII-IummInIIuunmI-nIm.mmummIm.mImmmmmm.IIm.mmmmmIInImm.mm..InImmunummmmIIImnI.nuIn.-IIIHIIIIIWIInIummmImImmImnummm.mmuIn Page 307 uumnunmmummimmunmmimmnmmm I ummmimnmiummuui I II I 4 ivnmuinmunmmnumuniIinunumuummmumnm mmnmm mImm.ImmImnmImimmmimim muy muuium I I I 1 I . .I I .II I. I I I..m.m,...I..Ir...n.Imi..i...v .1 uni mnvmmriimnmuI--Immmmnmmiiiiu .mini ummminiunimuumnunmzmunnnunnuimng C5718 Student Council Bartholf Seymour Wallrich Haskins Kates Faville Qua rberg Groves Parkinson Reinking Mabley Klann Hamilton Spa fford King Deuss Smith joerndt Beal Beach The Student Council, originally organized in 1917 as a Council of Defense, is a joint committee Of men and women which is elected Once a year. The Council manages various affairs dealing with both men and Women, such as the war drives, service flag, and "Bill" Purdy fund. lt has been placed in charge of the Memorial Union fund by the memorial Committee. Ojicers PRESIDENT E. A. BIRGE . Honorary President DEAN LOUISE NARDIN PROFESSOR W. A. SCOTT . Honorary Vice-President.: PROFESSOR W. T. ROOT . EDWARD DEUSS . . . President LUCY WALLRICH . Vice-President FLORENCE KING Secretary ALLAN SPAFFORD . . Treasurer WINIFRED BARTHOLF BEATRICE BEAL MARGARET CRAIGHILL EDWARD DEUSS JANET DURRIE LAURA FAVILLE HAROLD CROVES PHYLLIS HAMILTON CvLADYs I--IASKINS MARCIA l-IINKINS I I Members KARL I-IOHLFELD CLARENCE JOERNDT NVILLARD KATES FLORENCE KING ALFRED KL.ANN I-IILDA MABLEY MARIE MITCHELL MARY PARKINSON JEAN PATTERSON I..I..I..m.I I...I..II..I-.H.w.I inGiliLiliiiiiiiLiliiiWiliiiliEliiiiiiiiiiiriiiiiliiliiliiii Page 308 iiil ALICE PORTERFIELD LINCOLN QUARBERG JOHN REINKING WHITNEY N. SEYMOUR HELEN B. SMITH ALLAN SPAFFORD LUCY WALLRICH BEN WISHNEFSICY DOROETEN B. WOOD ALICE VAN I-lIsE .. ............ ,.T......,-......- m nmmnmmmmummn nmmn-if -E EEE FE :EE E35 EEE iss EEE Egg E E E EE EEE EEE Sig K. :F E2 EEE E55 SEE EEE sig .f- 25: EE E25 E22 5 E Qi? .Z .E ESE :EE E E E .E E E E E EEE iii qs E E EE E-5 EE Ef- E 55 gi 55 si: I e l- EEE E E is s SIE .gg :Ia EYE sig Er: sie I....u ...W mi ...mega mm gas E55 :rg Egg 5 :gg YE 'E .E fe Eg- .F mimiIimIIIIIIIIIIIIIiiIIIIiiiiiiriiiiiiiiiiiiiiiiiiiiiiwiiirinimIiiIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIriimiiiiiiriiIiiiiriiiiriiIIIIIIIIIIIIIIiiiiiiiIiiiiiiiIiiiiiiiiiiIiiiIiiiIiiiiiiiiiiriiiIiiiiiiiiiiiiiiriiiiiiirriiiiiiiiiiiiiIIIIIIIIinIiiiiiiIiiiiiiIriniiiiriniiiIiiiriimiiiiiriiiiiiiiiiIiiiiwIiiIIIIIIIiimIiiiiiiiniIIIIIiiIiiiIiiirmmiiiiimIiiiImriiiiiiiiiiiiiIiiiIIIIIIIiniIIIIiiiIIIIiiiiiIIIIiiiiiiiriiiiiiIIIIIIIIIIIIiiiiniiimiiIiiiIriinmiiiIIIriiiiiiiiiiiiITIIIIiiiiiiiIIIiriiimirmIIIIIIIIIIIIIIIiiiiiivviiiiiiininiiiiiiriiIiiiiiiiiiiiiiiimiinrii , Jn,.,.,... ....,.. ,,. , un,,,Kun.,u.,,,.. ,. , I ..,,.,, ..., . I I In ,..,n..,...,. I n...n..,,n .,,n.m.u,.,n,,... ,.,,..,,.,,.,, .. .u...,,., ..,,. ,,, .,u., ,.,,, I .., ,, ,,.,..,,,,... ,.,,., .. .. .,u , , ,.,,,., .., .......,., ,,.,. , . .K I . I ....,. ....,. ,. ,.,..,,,. ,,.,, I , ., ,. ,.u..,.., L.. ,,,,,.,,. .. Q F44 T 9' s 9 2 kauri r TPITHF 2 K Q .. - - . n C 0 C DL Executive Council HELEN B. SMITH . . . Presidenz VELMA REID . . . Vice-Presidenz MARGARET CRAICHILL . Secrezary PHYLLIS HAMILTON . , . Treasurer AMY JOBSE . . . . Censar Chairman DOROTHY HAESSLER . , . Azhlezics LOUISE WELD . . Religious LUCILE NUTTER . Musical MAVIS CHUBB Dramalic OLIVE BERRY . . . Literary ALICE PORTERFIELD . . journulislic KERAN FALK . . . Civic GLADYS YVISE . . . Senior MARGARET NUZUM . . junior VIRGINIA CONKLIN . Sophomore IMA WINCHELL . Freshman Legislative Board :Ee ELIZABETH ALKING LAURA FAVILLE MILDRED MARCH ELEANOR SCHROEDER ADDELLA BOIES OLIVE BERRY MARJORIE BARRIE GRACE BORDELON FLORENCE CULVER RUTH COFFMAN FLORENCE COLLINS CARYL COATES REITA CLAPSADDLE ESTHER COHEN DOROTHY CARLOCK RACHEL CARPENTER VERNA CARLEY JEANETTE DUNWIDDIE FLORENCE DUMMER MARY DAVIS EDITH EWALD MARY EDELMAN ANITA EVANS FLORENCE GRAPER EDITH GRISWOLD FRANCES I-IOLEORD VIOLA HOLLENSTEINER ETHEI. HOLT PAULINE I-IOETZEL RUBY I-IAWN MILDRED JACOBS MARION JOHNSON RUBY JACOBSEN GERTRUDE JACOBS MILDRED KING ESTHER KREBS MARGARET KRAUTH MARGARET KIRCH WANDA LUZINSKI LOUISE LUDLUM TILLIE LEVINE MARGARET MELAAS MARY MARTINEAU GLADYS MARQUARDT FRANCES MALN HAZEL MURPHY RUTH MARTIN GERTRUDE NOETZEL MILDRED RUFSVOLD VELMA REID ZELPHA REID KATHLEEN ROBINSON KATHERINE STOCKHOUSE MILDRED SINCLAIR MARGARET SCHULTZ MARTHA SCHOCKE EDITH SHEA VIVIAN SEEBERS CATHERINE SCHULER ESTHER STACY MARGARET SPERRY JULIA TURNBULL VERA TEMPLIN KATHERINE TIERNEY ELSIE TYSTON MIGNON WYMAN CORNELIA WRIGHT KATHERINE WHITESIDE MARGARET WOODRUFF ELIZABETH WEIMER MARGARET WADE DOROTHY B. WOOD DORA WHITE CLARA WIGDER LOLA WHITE CORDELIA YACI-:EY ANNE YABROFF LEONA YERLY I I i EE i 'EE I I z Winchell NVcld Haessler Berry Chubb Porterfield Falk Hamilton Coiikiiii Nutter Niizum Smith Reid Ciaigiiiii wise EEE E35 if 3' : Eiiii-iiiigiiwimgmgiiiiiiiriiiiiiiiriiiiiiiririiiiiiiiiiiiiiiiiiiiifiiiiiiiiiiiiiiiiiiiiiIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiriiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiIiiIiimiiiiiiiiiiiiiiiiiiiiiiiimiiiiiiiiiiiiiiiiiriiIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii iii I III ii iiiiiiiiiiii iiiiiiiiriihiiiiiiiiiiiiiiiiiiiiiiiiiiI iiiiiiiiiiiiiiiiiiiiii riiiiiiiiiiiiiiimiigiiiiiiiiiiiii Iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii iiiIiiiiiiiiiiiiiiiiiiiiii.i..ifiiii!E smiiiiiiiiiIIIIIiiiiiiiiiiiiiiiiiiiiIIIIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiriiiiiiiiiiiiiiriiiiiiiiiiiiiiiiiiiiiiiIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiIIIiiiiiuriiiiiiiiiiiiiIIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiIiiiIiiIiiiimiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii Iiiiiiiiii iiiiiiiiii ii ii i ii iiiiiiiiiiii iiiiiiiiiiiIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiIiIIiiiiiruiiiiiiiiiriiiinii iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiz Page 309 1 11 E 311111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111 1 1 11 111 11111111111111 1111 11 1111 1 1 11111111 1111111111111111111 11111111 1 1111111111 1111111111111 1 11 1 111 1 1 1 11 1111 11 11 111 111 111 11111111 11111111111111111111111111111 111111111111111111111111111111111111111111m 5.......,...11.....,,.....1..11.W..1.1....11.1.11 ......1....11.,...... ......u.... ..,. ..1..1 ....1.......,..,. .......1......,..1..11.....,...........1..................1.1..,1......n.........11...1.1...1........1.....,..-......11.....,......1,5 EE111111111111111111 111111111111111111111111111111111 111 1111 11111111111 1111111111 1 11 1 11 111 1111111111111111 1111111 11 11 111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111 1 1 11 1 1 111 1 111 111111111111111111111111111n11111111111111 1111 11 111111111111111111111111111111111111111111111111111111gEE are iw . ,df E My 1 ,39 sf Vets' ff' s 51 Union Board Ojicers HAROLD C. CHEETHAM , President LAURENCE W. HALL . Vice-President RONALD W. RAMSEY , Secretary GORDON D. ADAMS Treasurer EE M embers GORDON D. ADAMS LAWRENCE W. HALL HERBERT M. BAKER LORING T. HAMMOND E JOHN A, BIGLER STANLEY D. O-SI-IEA HAROLD C. CHEETHAM RONALD W. RAMSEY ALFRED H. TAYLOR E 1 1 O'Shea Taylor Hammond Bigler Ramsey Adams Cheetham Hall Baker ' 111 1 1 1111111111111 1 11111111111111111111111111 11 111 111 1 1 1 11 1 11 111 111111111 1111111 ' 1 1 1 1 1 1 1iiEi!1221G31IHHiiiii?IIIEIIYEIKISTIIIQISIIIGYIIHIZPZIIEIIYFIRIIIZI 1 111 1111 111 1 111 1 111 1 11 111 11 111 111 11 Page 310 E E EEE EEE s s E12 aig EEE E15 SE 552 E, ,EE sg: SE E 525 si EEE Ei? 555 552 ESE EEE E55 SEE E12 EYE EEE EEE 552 :sg EEE SE e 255 EEE Ei? :EE 1 s 1 1 1 1 a 1 EE E35 EEE Eg 1 1 1 1111111111111111111111111111111f 2 1111 111111111l1111111m1E peciiayl CCCXSiOIXS gmmnnmmnnuimmuniinnmmnnunnmnnmuumnumn n u in i rn i I mmiuinmwiiumy i 1mmiinumuhuivvigiiviiviiimiiviiv u numiunmmmmnummnmg ' mnuummmnmn iummmuniummmnmummuu . limi... iiimiimiiimmiiiiii mmuiiu mimmmmnm nmummummumm-E -E E53 sig E35 EE E25 512 EE s al EE E52 Els ex i s 2 min -5 i :sg 5 2 5 ii ii 1 Th J ' Va CP Q UTIZOT' I 07037 T'O7Tl State Capilol, April 25, 1019 Ei 1 i 1 Harley Haley : KENNETH HARLEY . Prom Chairman lRENE HALEY . . . Partner ' The Committee Chairmen ' 1 LAURENCE HALL K . . LEONARD ERIKSGN Assistant Prom Chairmen ERNEST ADAMS . . . Music gg CHARLES D. CULEERTSON Prom Supper 1: ' F. QMAR GOERLITZ . Boxes lf LORING HAMMOND . Homecoming AMY JOESE . . . Programs i JAMES M. LINDSAY . Ways and Means JOHN W. MCPHERRIN . Publicity CYRUS PHILIPP . Reception HAROLD RAY . Special Features ROLAND RAMSEY . Floor ROEERT L. REWEY Finance ALVIN R. KLANN . , Decoration HENRY S. WELLAUER . Transportation The 1920 Junior Promenade was given in honor of Wisconsin's returning soldiers, and was known as the "Victory Prom and Homecoming." It was the first ofthe famous Wisconsin Proms held for two years,-the First post-war Prom -and with the beautiful state capitol building as the setting, was perhaps the greatest and gayest of social occasions Wisconsin has known. For the first time, Prom-time was at Spring-time, the event lzeing held during the latter part: of April, and not dur- ing the middle of winter, as in previous years, Thus the occasion lent itself to the charms of "soft spring nights" and the youthful dancers, including the returning warriors, impressed with the fascination of a Homecoming Spring Prom, found in the 1920 Prom, for a time at least, what they had been yearning for-a return to the joy and youth of old 35 Wisconsin. 5: ...i i V al:zz:allllllfllflllzaasaalane:1ffllllilllllllllllllllllflznaa1 i , i i 'T' Page 312 is i inn ii iii iii ii .mi i iiiiiinniiiniiiiinwiiii.iiiiii.iuiminiiiniininiimii.iininiiiiiinmiiiiiiiiiiniinmiiiiiiiiiiniinimni1inimmiinmiinimyiniinuimmmiiiiiiiiiimmiug g,mi.ii.,,...f..i..iumm ..,.. .. ..,,...,..n,.,,., i ,.,,... ...,...m ,,.,,...,.. , K.., ,ii ...,, .,...,...,.. n.,,... ii., ....., f. ..nn...,n,... mm., ,.,,,n.n.K.,,,.,,..,..,...,,.,, . .,,,.,...,.,,...,..,..,,,.,,,.,., ...ii ,....,,., i .,,..,,.n..,,,. ii. ,,.,,...,.., i..i,..i ..,.., . ..,.. i..i.,, ..,1. mm..W.,..,...i.Hiii,ii...i.H,..i..,i.i..,,.i..u.ww, mi.. .. L5 iii EEE EEE EEE iii egg sig 252 "E EES i EE ,EE EEE 525 fi EEE EEE S52 Erikson Hall Ad-3mQ Cullwertsfn Coerlitz e Han'mond jobse Lindsay Mcpherrin Philipp . , . M., . Ray Ramsey Rewey Smith Wellauer We Sen che Pace iii 233 :ss :ga .i..,... ., ..,i, , i.,,,.,...,......,,.,,.,.i.,,..,,..,,.,..,...,..,,..,,..,..,,.,...,..,.,..,..,..,..,,..,..i..,,..,,.H.i..,...in...,,...,...,.,..,,,.,.,..,. i .,...,,..,......,,.,.,,,.,...H.....,,,,...i.,,.,,..,,.,...,..,,..,.i,..,...,..,..,,..,,.i.,.,..,.,...,i.,..i......,...,.,...,,.....,..i,H,.,,,.,,,.,,.,,.,...,,.,.... i ,i.,..,..,,..,,.,,,.....,..,,..,,.,,..,,..,..,,..,..,..,....,.,,,.,..,.,.,,..,...,..,.. i .....,, m ,..,..,,..i.,,..,,.,,,.,...,,.,,..,,.,,.,,,....i.,,i.,,...,, M., ...,,,,.., i .,,.,,..,,.,,,,, ,,,..,., i .,,.,.i.,.,,.,,.,..,. .. .,,i ii. ..,...i...,........,.........,..,,.,...,......W....,..,... , ..,.. . ..,........ i.,..,,. - ....., - .,.,n. -- ,..,. - ............,....,..,.....,.,....,....,..,....,,..,..,..,..,.....,..,......,.,......... W, .......... . ,... . .... ..,.- ..,...............,.. , ..,,. . .....,,..,.. .,.., ...... ,. ....... , ....... , .i..i ,.........,....-,,--,..-.,-.--............ N H F.tmmuunuunnnnnninnimummmimuiuniuiiunwmuuuunmimnuinmmumimuulumluumllilulmuxumllnumilunumimnmiinummmmum:unimlmmmimniinmvimmunuimuinmmummumnumimlmmuumm:inumininlmunnmmimulumvmmuiruummummnunininiimminummminimimmnmniinuimiuuuuuinnniiunmininnnunmmiumuiimmmmunmiuumnumnu ininiiinnumnmmmnmmiumxuuninmmnmmm. Page 313 gmmmmummmnmmnmummuunmnmmmmnmnlnvnllrnmnlmlnnlwmgEmgwgfmgummlgluEmmynumlm1InmmvmwuwInnummmm:wlmInunmnumummmmmwInwuwfnnumwannuulnuum:munuwwinwIninumInnlwmmwmulnunnruummwmmnunummmInvmmuannuannnnnanwmanwvumnunumvumy:mmwu1vuruunmummynuuvnummwmmwul1Inmnuwnnumwummmanm1mnum1mm:uvunnumummnunnnmnwnurnmung Z 5gmmmmmummmmmnmmunmmmmmumInummmummummmu1'mmfu1m:mm1InInInvmwrnulmlinmm.wmmmru1mwInInwInnuwInInfmnuuwmmywnwmmwmvmInvuwInwummmmm1u1Inhum1mli-hiuiiviilwlimi?iiixiii1IREM!!EEIiiTEiiiii1EISJEI1hi1iivrinnXm1In1nvm1InfnunnnuvunlnunuInInulwmin1InmXH4myInm1mm1Invmmmm'nnnummumuumnnWuIninwInW1mmwinuufInwvuwu1InwInnumwynummnumunmmuummumnmg5 3 Es -E Si as E52 5 Egg 5 5,5 E SEE S Ei -2 SIS Z EE 3 iii 2 gg 3wM....,....,..,,..,...,.N...,.m..,,..,...m,,..,............,,...,...,,..,...,..,,mmU.,,.,,...,...,..,.,.,..,,..,......1...y..........,...,..,,..,..,,..W.,,..i..,...H.,M..H..,...,..1..,,...,..,vm..H..1..,H.,,..,..,,..,..,,..m,,...,..,...,..,,..,,.,..,,..,,,.,..4,,.,.,1,..m.H.,...,..,..,,..,,..,..H.,,..,..,,..U.,,..,...,..,......,,..,...,.,,i..,..W..!H.,,.,..,,..,H.,,..,.,,,,.,ny.,..2..,:wwTMgmfw1,5mfmf15532:3QMmmugwmfgw5E5.,...,..,...,,..,,.... m..,...m..wm.,....N,..,.m..,,..m.,H.,,,m.....,...vm...,.m.m.....Im,.,.H.,...,,..,...y,.....,..W,..,...H.,,.,W...,..mm.,H.,,.m..,..,..w.u..u ..,. ,1.H1.HL.,XV.XH.,m1..1H.XUXX.HV..X.HN1.NNV..L.,,w.HN.HN..,.HX..,...,..+...X,H...,.H...y,.,,...,..,..,...,..,...,y..,..,..,,..,,..,..,X..,..,K.,,.H...,,..,..,.HW,..,..,X..H.,...N.,U.,inim.H...,N.N.H...W.inX..,,W.HX.HX-IX--4,W...,...,..X...1.W.HnuL.,...,,...H.,H.,..f...1my.Hmm,,K..,..,H,,W,.HV.,X1.,H.WUmm...X......,,.....U.U.IVf.mm...m...m-I.. Page 314 E fi: 5,5 225 mmW1mInnInummyuH.1,mmmmumlfmlmm-um..wf.mlWm.NmXmWmH.wmlmwmwmw'mmummmwww-wwmmnmmnumnummm:uw-11-umnumIninnl1uvH11H1uvnlWumynmmy..myXyuV..H.1H,mwluummlnmmmmmmmuwwHumwmmmlmummmm'wmmmvmvmmulynwmyuWmmvmulmyHwWmmy.mmMummm.mmmww.-,mmA-mmm-mmmmmmfmwin1mmfmm'mmvmmvmwyumlm'mmmymnumwInfumrm1u1ruvu,mm1.-mmm.. . .... . .. .. ., , . .. ..- vllwlvfl'vwwH1vwnf-I-'wwwuvwmmmm-vmvwmm:mwwwuwwwmumm-w.wmmm.1m,,..,..,,,.,...m.,.,,..,,,,.,..,,,,,,,,,,,,,,,,,,m,,,,,,,,,,,,,,,, . ,.., - ,.-....,.-4...m...-... .,,,. .,.. .... -., ...., ......,.....,,..n...,....- ..., W.. .,..... .n...... ....... ..-,.-- ,,..,,. 1 - 11fn1mv...mm-1umw..w.vm E 5 , Umm.w.,.m...u,mm .U..,K..,.,,. . ...,,.,..m., ....L....,....,f.n.H-..w...,..L.,,...L.....m.m..,...,.,,....,...vm.m..,m.,,...NWmm.,..,,..,...m. . ""'1"s :IE .,.,,..,...,..,,,.,,.,,,.. W ,.., H: 525 E 5 ESQ 52 ESE ESE EE 215 sf 552 E :: iii Qi? 552 :F EEE iii 352 :z EEE .: 55 The Big Party-April 25-ze, 1919 EEE :F 5'511umwvwvmnnunummrmmvw 1:-umm ul 1 1 51WVIW-M-HXmgNU-mumgl-3mh5-W33515-:55mgwww1513tm559:95:Hgamay:mminIInTugMI!!in3QUin52mmf!EEE213:3M355umIww5:1M3552my1.55ufwulinwup:HwInmw3.ww.1wmV..wIn1.1w.Hfl.wnyw1.XInmymWIn1.11H1in1I.wm1.I1.I1m1.11in1u1W1.11In.HwInm1H11-1minwuwinwInIn1.I1uv1I-wWinmvmn1N.IXInm1u1inK..,inmlmuum1H1m11.WN.1InmyInIn1InN.1InmmnuIn1Inm1H1inI-I1.mm--1mX1.1mum-uwInM1m-.mnanuInmumummmInuvurm.I1fuvwInrm1mmmm.--mum-1fuumm1Inm1mXmyuv1InWM1m1m,mmum1.4H.HInmXmmy1In1.1nnvmmyummmmnmfvmmymyH.1M1InwI.mum,rmmnmmlwnaig , uwnvmymmuunummwmwuvwmuuwInunwmmwrnwuwwnunwuxmwnmmmwwuwruwmmwzuwuwmmwnzwrlwnumwnwuwwmuwwnwvummwuv:mumwrnw:mumrnwnunwuwruwumwwuwInrumwrnnuwumwwnwuvmulwruwuvnunwunwnvwmmwInwnwmmwrunummwnvwmmmwruwummuruwllullulwrumulwrnwuvmmwnumnummwuwuwmulwmxuwmmrumnu:mmuvnnnumuwuwumnrnwumxuvxnumm1myuwmm1uwvu1mmunwnmvunxuwnmmusuwuvmmunnuum:uuvumm:nnwmmmxmwimmuvnuummunwummmu1vuwnumxunuwummuvunnumumuumm:numummummnumunuvunumwufwmwmmumnummnuwynnumnuuInmummunwmmwuvnnmumnnxn11wmvununfHiFiiFl1rlMfUilwxl5 zmmmn Eamummmmnm mi vi nn I n mmm n miummnuv mm I ni 1 u mmmuuu FT"""""" "' I r A i n i ui 1 i r un: rm nnmmmmm I1 I """iummuf1i""' Dedication Qjp Muir Knoll Deciicatory Exercises j une 18, I 918 Program Introductory ...... .... Song, The Blue Bells of Scotland Dedication ....... john Muir in College Days .... john Muir's Relation to Modern Science . A Word from a Room-mate .... Presentation of the Muir Knoll Marker HON. THEODOREM. HAMMOND Assemblage DR. CHARLES I-l. VILAS, '63 . JUDGE MILTON S. GRISWOLD PROP. CHARLES E. ALLEN, '99 CHARLES E. VROMAN, '68 THOMAS MORRIS, '00 john Muir and Scotland ..... . PROP. ROBERT M. XVENLEY Song, Auld Lang Syne ....,....... Assemblage . "The Mound was named Muir Knoll in recognition ofjohn Muir, who here first received that instruction which opened an acquaintance with hidden problems of the Scientific world, the after pursuit of which brought such luster to his name. "The Muir marker is directly at the roadside, perhaps 200 feet from North hall toward the lake, the Muir locust between." nnummrg O3 -X ,yml .k., mn ,,.., 4 - ft ss? o-f -vi"-. V of ' . ' fivifff ' if -21 Nw, Q .' - .L get a, N- .4 32 ,se,1.-cqQ'g+iLsgsz.g,3bK5?S5es . '- 1 av, , ,-55, 1 , f f 1- ' PSFL .. ,, - , A ri A v ' . f . , " f '15-5152.1 p sf E I F K L 5 I L ' A , . Q! . ,,,,, -My-mmMMWM-WIMNDMJM,,........,..,...,..u...,... .,i.w.,..n..f..,.ii.if..r1..........i.,,...,...m..E Page 316 is E E 5 is E E IE s E E E I E .EE 5 EE EIS Ei? EI Es :T EE 52 il ES :E E EI EI El Z5 El -5 l 5HEwfl"n" ' ' ' TEEiWiii?fmGETiTZiiMWHWMG 5 :ig EE E 2 IE Eg TIE EI ETS 'Z EE I af gt iii Keystone E52 Keystone is a society composed of the presidents of women's recognized organizations. It E-- originated the method of regulating womens activities by inaugurating the point system to abolish a monopoly by a few girls upon these activities. This organization also affords its is members an opportunity to become more familiar with parliamentary procedure. EIS E E EEE Ojicers MARGARET SCHULTZ . , . President its EEE MILDRED PEDERSON . Secretary 'E Members f VELMA REID . . . Barnard MILDRED PEDERSON . Pythia S GLADYS FELLOWS . . Blue Dragon MAv1s CHUBE . . Red Domino 555 GERTRUDE JACOBS . Castalia SADA BUCKMASTER . Red Gauntlet Ei AMY JOBSE , . . Census HELEN SMITH . S. G. A. MARGARET SCI-IULTZ . Chadboume EI.sIE GLUCK . . Suffrage 'E . . MADELON WILLMAN . Clef Club KATHERINE WHITESIDE Theta Sigma Phi E FLORENCE BEATTY . Euthenics MARGARET LATHROP Twelfth Night EYE ANN BRIGGS . . . Glee Club JEAN PATTERSON . W. A. A. EDWINA DEXTER . . Green Button LOUISE LUDLUM . Womens Page LUCY WALLRICI-I . . . Mortar Board DAPI-INE CONOVER . Yellow Tassel LULU SAUL . . . . . Y. W. C. A. I 52 . :IE E Buckmaster -Iobse Willman Lathrop -Iacobs Wallrich Briggs Conover 3 Ei Pederson Saul Beatty Ludlum Schultz Fellows Smith Reid Patterson K i III I I I I I III I I.. II.I..I.I..I...I..I .I......II, ....I...I I., I .I...I.IiiiiiiiEiEiiiiiiliiiii..I..I.Hiiiiiiiiiiiii?I..I...""'M"'"""""mif'f"ifiifI I Page 317 E i 1 1111 111111111111111 1 1 1 11 1 1 1111111111111111111 111 1 1 11 11111111 1 11 1111111111 1 1 11 11111111111111 11111 1 1 11 111,111-A1-A1-in 1 11 1 11 1 --1--111-M11113351111115131 1u1M1E11111111u11 111111591515 TTEYEGHEZEEGEWEFEMYEETTT' 1 1"T'"""""""i""'i""""i1 1 11111111111111111111 1 11 1111111 11111 1 111111 111 111 111 11 1 1 1111 111 11 1 1111 111 1 1 1 111 1 1 1 1 1111111111111111111 11111111111111111111111155 -1.- -1. 5 5Blue qlragon l Blue Dragon is the senior won'1en's organization. lt maintains a co-operative house for uni- versity women which has lately been endowed with 55150 worth of Liberty Bonds-S100 by the class of 1918 and S50 by the class of 1919. Uficers , GLADYS FELLOWS . . President WINIFRED BART!-1oLF . Vice-President Louise EMERSON . Secretary MARGARET SCHULTE . Treasurer 1 :ii 1 1 Schulte Fellows Bartholf Emerson :F sig 252 515 EE '1"11""'"5g,gmgA1,w,31gg1, 111111111111111111111.1111111111111111.111.111.1111 111111111111111111111111111111111111 1 11111111111111111111111111111111 1 11 111. 11111111111 11 1111 1111111111111111111111111111111111111111111111x15 111 1 11111 111111111111111111111111 1111111 11111111111111111111111111111 11 111 1111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111115111111111111i1l11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111: Page 318 Eli li lg sg 4 EE 1 W ' ,E fl 2 f if ls X X I ' W ' f ' f f, X X Q f X ff X 'll my 5 X svx i , L ' .X X4 i e- N' ' X- ' " X ,, " D XXX R .. X K During the past year Yellow Tassel, the junior womens organization, has done its share of Red Cross work. Under the junior advisory system, Yellow Tassel has advised and entertained f lner Green Button sisters. Ofcers DAPHNE CONOVER . . President HELEN SNYDER , . Vice-President HELEN RAMSEY . Secrezarv MARJORIE BART!-1oLF . Treasurer Q2 S Snyder Conover Bartholf Ramsey 3ii::::::::W"' ::::2::1uu1:uu:uw::l:f:t:w:u: ' ' f 1 ' ' H " H' """' ' H:::1::f1::f:1!:::::::u11::1::ef::11:1:::u:1ssu::::: '.u.L::u, .,., :J Nm' ' LIU" " I '1' 1 Q5gygfiflliliilifkliflgqpggq la Page 319 gm111111m111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111 111111111111111111111111 11111 11 11111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111u11111.11111111111111111111111111111111111!5-111111.A1151141111111111r1111111111111111111111211111111111111111111nm1111111111111111111111111111111111111111111111111111111111111111111111111111111111r111111mm11g 55a1m1111111iEEF1ZiiME"iEE"i11HE"'H1iiiii?1iGii5ii13iElHil1 "'l"llTmi'T'ii 1"l'11111111" 1 111111111 11 1 11 1 1111111111111111111 1 1111 11 111 11 111111111111111111111 111111 1 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 111111111111111111lHT1i111111111 "- 11111111111111qg 525 Eli ,F - 1 1 1 E E Red Gauntlet ei- as .,- E E Red Gauntlet is the society for sophomore women, which was organized in 1913 for the pur- pose of bringing the women of the class into closer personal relationships. In the fall the 51? EE. .,: members of Red Gauntlet entertain the senior women and at intervals give social affairs for their Ei: E15 E . 'E own members. ff 1 2 E55 EE ggi E15 Ojicers SADA BUCKMASTER . President Ei E MARY PARKINSON , . Vice-President - i - AGNES SARLES , . Secretary :if 32 HELEN Cru. Treasurer E 5:5 1 Q55 Sli E35 :L ,E EYE ze- :E s I 1 Parkinson Sarles Buckmaster Gill QFEEEQIEEEELE 1 1 1 1 1 1 1 1 11 1 1 1 1 1 1 11111111 11 11 11111111111111111111111111111111111111111111Eii 1 11111 1111111111111 1 111111111111 11111111111111111111111 1 11 111111111111111111111111111 1 11 1111111111111 11111 1 1 11 1 1 1 1111111111111111111111111111111111111111111111111111111 111111111 11111111111 11 11111111111111111111111111111111111111111111111111111111111 11111 11 11 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111: Page 320 Ei 215 IEE 1 is gunum EE E Ei nu mu: :mv 1 1 inns: s In u wx r u vu umnnmmmm Wk ummm.. .um Ei u g, va 5 f N f Ei JJ A , x f QQ f S., I ' fa. Green Cgutton Since the founding of Green Button society in 1912, similar organizations for women have EE been a part of the life of the freshman women. Spreads and social gatherings tend to unite the members of Green Button. Oficers EDWINA DEXTER . . President MARGARET THOMAS Vice-President MARY WOODARD Secretary KATHERINE ELY Treasurer Thomas Woodard Ely Dexter Page 321 -III nu.,K IIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMIIIIIIII .,,..,,,.,. III.IIIIIII.IIII.IIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII .4,. IIIIIIIII ...xy III l.w,.,,.. IIIIIIIII .,N. IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIII.IIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII..IIIIIIII.IIIIIIIIIIIII.III..IIIIIIIII.IIIIIIIIIIIIIIII.IIIIII.IIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIL E Y. W. C. A. Weld King Rogers Johnson Boll Pleuss Humphrey Rogers Simonson Saul King Pos: LULA SAUL , VIOLA PLEUSS . MILDRED ROGERS MARIE HJERMSTAD . LUCILLE ROGERS LOUISE WELD . FLORENCE KING DORIS SIMONSON ANNE HUMPHREY MARION JOHNSON JULIA POST . . AMY JOBSE . . GERTRUDE KING KATHRYN BOLL . Of'-icers Cabinet Committee Members . President Vice-Presideni . Secretary . . Treasurer General Secretary Church Affiliations Conference' Meetings Membership Publicity Religious Education Social Social Service Ways and Means H j ermstacl Church Ajiliations DAPHNE CONOVER GRACE FINUCAN ELIZABETH KUNDERT DOROTHY MACLAURIN Conferences BERTHA BLAUL MARGARET BRONVN SADA BUCKMASTER KATHERINE JONES MABEL ROGERS GLADYS WISE Meet ings ANNE BRIGGS AGNES EWELL HELEN HARPER JULIA ALLEN MARY BAECOCK KATHERINE BARTHOLF MARY BRIDGMAN HELEN CHEETHAM HAZEI. COUNSELL ELIZABETH HOOPER CLARA HOOVER GRETCHEN KUEIIPER MANNIE PARSLEY KATHERINE ROSENEERRY Membership BERNICE ALBRIGHT EDWINA DEXTER JOSEPHINE HINTCEN GRACE HUBBARD CONSTANCE KINNE LOUISE MCLAY MARGARET THOMAS CORNELIA WRIGHT Publicity DEIRDRE Cox LAURU KREMERS MARION PRENTISS AGNES SAMUELS HELEN SNYDER Relig ious Educal ion BEATRICE BEAL RUTH LANZ ZELLA LOOMER MARGARET MARTINI MARGARET SCOTT ESTHER WANNER -Social MARY BELL CONINE HILDA MABLEY Pl-IYLLIS HANIILTON LAVONNE HANNA MARY PARKINSON HELEN SKINNER Freshman Commission AGNES EWELL ESTHER HAVEN JANET HOLZER GLADYS HOSKINS VIRGINIA JACKSON MATILDA KEENAN CATHERINE MEYERS CARYL PARKINSON RUTH REID ELIZABETH SEHON Social Service LOUISE EMERSON DOROTHY EVANS GLADYS HOSRINS KATHERINE JOHNSON J EANETTE LAMB MARY MCHENRY MILDRED PEDERSON XWczys and N160 ns lVlARGARET BELKNAP FLORENCE DAY RUTH DICKOVER ALICE NAFFZ LUCILLE NUTTER MARGUERITE NUZUM ALICE SPENSELEY ETHEL STOCKDALE MARGARET THOMAS HELEN WHITE IRMA WINCHELL MARY WOODARD III III I IIIIIIIIIIIII I IIIIIIIIIIIIIII II II IIIIIIII IIIII II IIIII I IIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIII II II IIIIII IIIIIII IIIIII IIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIII IIIIIII III IIII III III III IIII III II IIIIIIIII IIIIIIIIII III I I I IIIIIIIIIIIIHIIIIIIIIIIQI I III II IIIIII I IIIIIIIIIIIIIIILI IIIIII II II III III IIIIIIIIIIIIIIIIIIIIIIIIIIL IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIiIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIII IIIIIIIIII IIIII IIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIII IIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.. Page 322 mrnumuvwuwnnzufumnmwunrmnumwmunanwnvanwUwru1rn1mwnw1n1in1nw1vuwuwwnwinwinwuw1u1in1nmwI1wuvwfu1uwrnwmwfuwuwul1uwwuwfuwmwnwwruwnwmwIHwnwwuwruWmWwInwInwmwuwwuwInwuwwu1in1m1u1yu1u11n1ruwmwuwwH1fuwunwuwmwu11n1ruwIninwvuuH1unwwuwruwmwuwmuuwvu1muuuwnuruwruwI-4mwanwuwm1vuwuufuuIuwuuwuwmumwuwwuwm1anrmmuuuuvurnwH1wuwnlwmwmuuwwIX1yu1nw1n1m1uumwnwwuwwuwwuwmwmrnwnvunwvuwmvuumnwvuwmwanuvuwuunvwmuwnvnnmnk : m.m..Wmm-nn.furm11.1,V.H.1mn.Hmm.1..,M..NH143321521311,1il553525IiiYES5551ElIIIEEIIIIZPIS522512151NlIi5GilIR5211iiiH15511EYESJil1I.-Ui?1FIRFIRI5JillQi,in1..Ji5T??iF.57E?iiI..HH1yi,1E.11Z.1.f11..1XV.1...X1.2,.HW,.411.1,I.1m1L.,,..,X.1,..X,..,.A,W,.1,W1l.1IllG321lilGil5,,,I5.11J.1ii11Qi1,ll3215.11H271121Lil1iiFill5511E51,W1QM1Q211L11Iii1IliIll?5215111liSill1lilQiiNlil1FilIii,Iii1LEG1Lil55111571P511IllIii1illiii1IliQlil1Ili1Qi?15?1P211I?1I511Ill1lil1II11ll1lilGilH211ll1PQI1lil1Fi1PFiIiillii1Gi1Ll11i?lE'i3 F us I 1 '12 see ,V 'Is 5 , , ,, 5 Af.. Q5 5 E is ,I ! E E 1: EE 55 E: is 22 EEE E53 ees sms 255 gi .1 q.......,,....rr,......,.N.U.mK..,..m.Mmmmm.i...,...uN,.HH.Wfniii:aim..1anizA51zminmamamzniimznzninmiiminanansnxnimLiam.'F..uz1:m5411:anznziaznmiGuzman..U.Y,H...,.HWW.HH.,.Hl...k..k.m.,mn.WH,H.H..,W..,W,..,W.UmH.H.,,.nm,W.,,ml..,K.,,.,...,..1H.,..,W,..,..,,W.,,K.U.,,W..,..,..,,.,,K...H,,mmH.H..,.........W...KH,,.,..,H..K..H,..unK..W.HW,.,,.,....,H...,,....H,,..,...H..1H,.1,K..H.,,..,.,,H,M...,..mm.,,...........,.,,...,m.,s Page 323 mm iiiiiiwiuiniiimmii. I . mmm- in inmm,..mi..mmim.iimi M. .mi Consumer is League Officers M1R1AM O'NEIL . . . . President DOROTHY WOOD . Vice-President CONSTANCE KINNE . Secretary ADELAIDE PAINE . ....... Treasurer Executive Committee MARioN PRENTISS . ....,.. . Publicity MARCIA I-IINKINS . . Legislation FLORENCE COLLINS Extension MARIE ESCH , . . Social ADELE FALK . . . Program MANN1E PARSLEY . . War Work ADELAlDE PAINE . . Finance MARGARET DOERR . . . Exhibit MILDRED P. RUFSVOLD ........... Education The Consumers' League of the University of Wisconsin was organized as a branch league of the National Consumers' League in 1909. The aim of the National Consumers' League is to abolish child labor, unsafe and unsanitary work places, long hours for workers, and the sweat shop system. A series of lectures by prominent workers and promoters of the National League has brought the aim of the League to the students and awakened an interest in the vital problems of the work- ing world of today. I J Rufsvold Prentiss Parsley Collins . Esch O'Neil K, Falk A. Falk i i inmiiliilliiiiiiiiiiiiiiiililiiiiiiliiiiiiiiiiiiiiliiiiiiiiumi Page 324 seg I ,-5 235 5- .,,.,.,..,,K.,...,.., - . ..i. -- - .- - .- .-.- K.,K. ,.., - M-M,-IM ,- -- . -- - . -- iE'EEi-TEIEUEIIM' """""""" "" TT" T ""' T-"" """"n M"""" "" M'Tm""""' V 5 Ii? ?'f 1 Z9 OTTZQ77. S O771Tl'l8T'C8 U The Wcmerfs Ccnfmerce Club was Organized March 7, 1917. The purpose Of the association is to bring tlie wcnfen who enter the Ccrrmerce course in closer contact with each other and with the activities Of the Outside world. Q23 Ojficers if HELENE THOMAS . . . . . President 3 IRENE HENSEY . . . Vice-President ELIZABETH ANDERSEN . Secretary E52 223 MAROUERITE HEINS . Treasurer , Members 1919 GLADYS PASEWALK HELENE THOMAS 1 920 I ELIZABETH ANDERSEN MARY FOWLER ORPHA COE IRENE HENSEY GRACE MCRAE I 921 , SADA BUCKMASTER JENNIE HOFFMAN I 3 IRENE DAHM HELEN ROTH RUTH ESTVAD CAROLYN STATZ KATHLEEN HARRISON HELEN THOMPSON I MAROUERITE HEINS ANNA WILKINSON HILDEGARDE WIPPERMAN Thompson Anderson Thomas Whipperman ' Fowler Heins Buckmaster Roth Hensey Hoffmann McRae Paswaik Harrison Statz Estvad r'a'I"M':1-m'aif' "-" I '-" Tiki-f---1 . .. - .- - - - -- -- -- - -- -- Page 325 3 nn uminm. .im 1 . ... .. . . .. mnmmmmmunmummmummmnimmmi .. mmm -Wmiiiwuiuuiuuiniimmmi 1 Woman,s Equal Suffrage League A Aim To further suffrage propaganda. To aid in the spread of civic and political ideals among the women of the University. Ojicers and Cabinet ELSIE GLUCK . ....,.. . President HELEN RAMSEY Vice-President MARION GRATZ . . . , . .Secretary Lois MCDONALD ......, Treasurer LOUISE LUDLUM . Chairman Publicity Committee MARCUERITE NUZUM . . Chairman Program Committee IRMA l'lAYSSEN . . . Chairman Nlrmbership Commiltee Nuz ,im V Ludluni Ramsey Mc Donald Gluck Hayssen mm nmmmuimwminminuimiinmmuiuni Q iiumminiiiiniimiiiiin.wm..m1iwmim I . wwmllmvlwlm vvwlv-v'v'W""""""'W1 Page 326 E52 53 111111111111 11 111111111111 11111 1 1111 1 1 1 1111 1 11 11 111 1 1 1 1 11 111111111111 1 111 1 111 1111 1 1 111 11 1 1 1 1 1 1 1 1 11 1111 111111111111111 1111 V101 Wxv. 1'-1111! 11111132 QJIUEZIIY ' E li ii I5 12 1s 15 is gf 1 X-' fx 1 5 Z ii- 1 l 1 l 1 lp-Xgm ' vm., l Xl 13 I E 1 Eutlienics Club Euthenics was organized to study home economics problems and matters relating thereto, and 1 .E '- 1 . . to create a social life among the wom zn of the Home Economics course., For the last two years, Euthenics women have aided in lVIadison's charity activities and Bel- gian Relief work. This year they have assisted in social settlement and reconstruction work in Madison. 1 Ojfcers FLORENCE BEATTY . . President FLORENCE GRAPER Vice-President is JENNETT DUNWIDDIE . Secretary lVlIRIAM OlNEIL . Treasurer QE Ez 1 1 if I , Kirk Burnham Luther Tucker O'Niel Cooley Bollenbeck Graper Schmidt Dunwiddie Walker Sutherland Beatty Kyte Gough Firiucane Madison Qi Ei? 2:2 E' 1 1 11111111111111l'111111111l1111l1111111111 111111 11111111111111111111.11111111111111111.1111111111111 1 11 1 111 1111111 111111111111111 111 1 l11111111111111111.111111111111111111:11fillifllffa11111111111fflElifillflfflffllfn:1m1 1 1F5f'if"M'1 1 1 1il'f:l1r"1i1111111111111111 11h511nim1f"':1f11rm1m1 """" 1n111n"115'r"'Er1115'uhif5?l5ffff?ll'51 11:1'l5Hii?1 Page 327 in I I +I n ii I In I I I mmm :iff H TA Ojlicers MADELON WIVILLMAN . Presidenz AACOT BORCE . . Vice-President LUCILE NUTTER . . Recording Secretary MARIE MCKITRICK . Corresponding Secretary KATHERINE FEDDE AAGOT BOROE ANNE BRIGGS AGNES BURKE DOROTHY DENNETT RUTH DONALDSON GUDRUN ESTVAD KATHERINE FEDDE HELEN HARPER MARJORIE BARTHOLF WINIFRED BARTHOLF MARGARET BELKNAP DOROTHY CARLOCK Active Members FRANCE HIGLEY CLARA HOOVER ELEANOR KRAEMER MARIE MCKITRICK DOROTHY MARTIN CLARA MUELLER LUCILE NUTTER MARCUERITE NUZUM Associate Members FLORENCE FINNERUD KATHERINE FISHBURN MARJORIE LACY . Treasurer MARION PILPEL DORIS SIMONSON MARION SPRING VIOLET TIMLIN IRENE TOWNSEND ALETHEA WHITE MAEELON WVILLMAN MILDRED WVINNIE DOROTHY LEVI ADDIE PIEH ESTHER SAYLOR GRETCHEN SCHWEIZER Kremers Timlin Hickey Fedde Willman Winnie Hoover Miller Borge Estvad White McKitrick Martin Pilpel Spring Burke IniI.IiII.IinImininIiiiI.Iimiiw-Iiimiiium IniuiIInInIuiImInImII4IInInIuIminiiuimumimim Page 328 ...in Im H. in in I. Im. .II I. mi I. .I -,mlm-Munn """' " I I I mmiiiii mmm 5 I 5 I . ' '23 , 4 'J . if i . ,U 1,1 1 U1 A ., 1 6, , I 1? Girls ' Glee Club PROE. C. I-I. MILLS , . . . Director Ojicers . . . President . S ecrelary- Treasurer ESTHER NEPRUD . . . ANNE BRIGGS . FLORENCE NASH . . . Librarian First Sopranos AACOT BORGE DOROTHY CARLOCK ALICE CRORY JOSEPHINE DARRIN DOROTHY DENNETT ROSE DURCH RUTH DONALDSON MARION BENDEKE FRANCES BLISS ANNE BRIGGS GRETCHEN DUNAWAY MARGARET I-IAWLEY DOROTHY BASSETT GRACE BITTERMAN GRACE GLEERUP HELEN JAMIESON ANNA CRAUN DANA CARRELL MILDRED Cl-IICHESTER MARY FOWLER GRACE GODARD JOSEPHINE ,JORGESEN I-IAzEL KELLOGG EVELYN LEE ESTHER NEPRUD LAURETTA NICHOLS I-IILDECARDE WIPPERMANN Second Sopranos JANE MARSHALL RUTH PAYNTER RUTH POINTER MARY SAMMIS First Altos SALINE LARSON NANCY LORENTZ MARIE MCKITRICK MAUDE MILLER LUCILLE NUTTER Second Altos KATHARINE FORWARD AVEL GAUSMAN MARGARET j OHNSON VIRGINIA PASLEY MARIE SCHILL MARION SPRING KATHRYN TENNEY LUCILE PESKE DOROTHY MARTIN FLORENCE NASH FLORENCE SERVATIUS DORIS SIMONSON HELENE THOMAS VIOLET TIMLIN LOIS WUERTEL MAR JORIE SEXTON RUTH SHEPHERD LILLIAN SODEREERG NORMA WEISKOPF MARGARET JONES MILDRED WINNIE DELPHINE WOOD Pointer F Olckmeyer Bliss Gleerup Fowler Forward Nicholas Shepherd Sammis Whipperman MacKitrick Winnie Timlin Dennett Briggs Donaldson Kelloggf Godard Durch Paynterllh Nash jorgerxson Weiskopf Tenney Lorenz Borge Bassett Bitterman Nutter Simonson Spring Teske . IH. . ,.,, Q .....,..,,., ,..,, I,..,,., I . .I .....,I.,,,,,..,,.........,I, ,.,.,.,,.,.,,. , .,,..,..,..I,., ... i.I..n.i. I I,,..,I,. H. I,., ...IIm,.n.i.,i.Wn.,.,I,Tm 1 I .T"""'r"u" I ""F"'Iu'i'11"' ...I..mmmamIazzaaumzIammszasnzv' I.,.m-'-"-,,i,.I..m.Im.II...II.,IIr..I.-rm 1 Page 329 mmmummmmummmummmmnummmmmnwunuuuwanummufrurmnumru1mvmmmnumwnwpnwuvunummnnnumnwmmmmumuwmruwzuwminwnwmummmmwInmynwm1mvuummfu1mInwInruwmmummInwIn,H1Infmynm1Innl1mmumInfu1nvm1InmXI1XmummuumnmmwmfummumvuInwuumwIHmnlwvu11mmmlmInmymfuuuwmmumvuulum1InfummmnnnmnufuwmmlmumInmvmunmmwummmnnmununvuummumumuunk E EEE-151-Slimnli-MEIIHQHHImmy1vihhQi-milInmm,mlWnl1H-vminmm-1muh1-I1inWlm1mmWW1mmvmIn1mmm,vu1Invu1mmInlmmvminmymmyInK..wIn1flwInwHw-.11InIn1m1-I1HHU1m11.1m1ynul1Inin1.Hnl1mWInmnumumunmmlmmfn1mul11.4inwIn1.11IninvmW1U1Inm1In1.HmwI-wmX-IXW1-I1mW1In111XInnum1I.1mInmlm1InmXul,uvH.,.-Xvm.HK..1HAwillhhli.vmmvvmInI-.TmIIAEIIIIIHIEIIQIIZIFQMEIIHIIIIIZiiillil?iiiEli?il???iEii9Ui1ElliiiiIiii!'5 E E35 Ei? 1 1- ,...1L..1H....U...1.m...QN.,...1...1...,H.1.H1.M1H1H.X1H1.N.,.m.v...wm.,,..1fHX,mmW,...,.U,H.WV......V...,.mm.H,...W...1..,...,...,...1,.,...,.HH.1,..,...,..1...,..,...,.m..W., W.. 1. : Y 5 N . mm E., .,,,,,.,,.,,,,.,,,, ,,,.,,,,,,, 4,,.. ,.,,,,,,,,. 4..,, ,.,,,,. A.l, ,.N..'...,-..-,v- llnrllrl , l4.'l-v.-,.-vv--!v-4 v.-vV-,vlA!.-l H .-'..-v--A--.4.-4,,l!VVI4lll.llXl-lv---v----------'v-'--44ll4'..,..,.ll r I U A A . , . W WW1.1...X.HK..,..,K..1.H.H1H.,H1V..,..1m...,...,..1.H1..,......1K..U.1.H...,..,,W...1.11U.X.1WH41..11.1L..11H1W...V...-I.mf,H11.1H.1.H1.U.H,,I1my..,In1.H1.H.HXI.1H1myH.H..V..1.HN.U.H1.HmyK..V...KmIHN..NU.1.M1M.H.Hrm1ynmHmm..1...,.m..m....mu u...um.wm.52T-Twig f,nvrmwInnnwffywLu1InunnmInwfuwunmlmwInwnyVfnin1lmmnnvu1nn1nuInnnunfnwmwuw1nwfmInwInwmwmanwruwInnuInwmmwInwmwnwfuwfuwu1wuwrnwuwnlwmunfnwuwrnwuwwuwuvwuwwuwWwuwnnwuwruwnumwnwuwwmulmIn1u1mwInwnwInnlwnwm1nwmnl1InXuumnWul1mulru1nfwH1muHum1Ininunfuu1m1mmummwInunurnwuunnumyInwuwfunuulun1unvmmwmnnmmm:ufmvuwInInunnuwuwnumumvumymyInnuvumywnuuvunummumuunun'mmunmyummumnulum? Page 330 unummmnmmnmmfmmmwmmmmmmnnm.fmmm.mmmmummm mnnmumg P, ..... W,,..m ......, .. ..u.K... . .,.,.... U, .,... mu ...,..,..... ..,,. ...,,,..,..4...,... N .....,.nK M. .,,.., , ,,,. , .......,. . .,,..,,..,n. , .,,..,...,. ... ..,,..,....,. , .... ,.., .n.,. W. ,,....n .,. ,,l.,,.. U... .,,.n... , ,..,,,,,, .U ,.,..,,..,.. ,,,.....,. ..,,.,,.,,......,... , ,K..,.,,.. 4. ..,,.,.. . .,..,...,.., , ..,,,,,..,..., , ..,,.,, W., ..,.. ,..,. ..,,..,..,.. . .,,.,... , ..,,,.,,..,...,....., U.. ,,.. H., ,..,,,., , ..,..,.,.., ,.,,..n.,. ..,,,.. , ...,.., EW-...,.,.M.-.M.-.M...,,,, ,.............. ... ..,..,. W.. ,..,... .,,...,,,..., . ...,....,..,.....,,..,... ,..................,.,,....,..,,.. ,,.. ,,,....,......,..,,.,..,...,,.,..,..,.........,,.,.......,.,.. , . . ,.,,.. ...,,.4,......,,,,......,. n ,...,.,,...,...,.,,,..,..... . ...,..,...,..,,......... . ,.,...,. . ,...,......,,.,.,,.... W . . ,.... ,..,,.,...,.,...... , ....,,...... - , ............. , ..,........N. ....... . M., .,,,,.. - ...,,., . .... 5253. .u.u H ..,. M n.....,..,u.,....... ,......,...,.....1,,.,,..,,..,...,,,...., u....,,.. u. ..,.,,.u..., , H ,,,...,..,...,.,.,,.,,..,,.....,,..,...,...,.,,...,..,...,..,,..,,...,.....,......1,,.,...,..,...,,.,,,.,...,,..,..............,..,..,...,,,.,...,...,..,,.,...,...,,.,,,..,.....,,..,.,.......,,...,,.,...,,.....,....,.,..,.,....,.,.... 1 .,,..,...,.,.,..,,,.,,..,.,,,..,......,,..........,......,.,.,..,.,...,,,.......,,..,.......,,.....,K..,...,.,.,..,.....,....,..,,....,.. H .,,,.,,.,......,.,.,,..,...,.......,..,,.,,..,,..,...,,..,,.,,,,..,,,.......,..,.n....,.n,... M .......,, Q ,E EEE EEE Ei? 552 22 Q1 14: 545 v E55 E55 L E52 :iz S age 223 H EE- EEE 1 Ef' si! gig 522 X asf EEE ,,..,,V-,...,., 5 5 EQ, ......u. , ..n.,n.,..,...,...,. , ....,.uu..,..,..,...,......,u.u. n...u1.u...n.n. U U .,..,...,............,,..,....u...u...,.,....,..,,.,. , .,,,.. . ,,..,......,,..,.,,..,......,..,,..,..,.........,,.....,...,...,,....,..,......,.,,,..,.,........,. n ..,...,..,.. , ........ Eu .,,..,. ..,,, ..... ,mm!g,,,5n,,m..,M...m ..... ,M .... 5,H,,,,.,.,m ,.., M..22mf,.,m..1,235,,,w,mM55,Ht5255,,1Mw,W,mWwm,mwwMm ..,.,,.,,. E,,,m..,.,..,i ' ' inJiT1iiT1i1mmuRiFEE1?i1iiilR1ERiR1ii1liiIEIH3RR11..EGmmnlwummmummmulnnnummmmmmuulml1uvunmmMwin1mmulwululunvml V Page 331 ii: :X- in sis 1 35 gmmummmnmmumummmnuumuummmunu1numunnnInwuwmnInummmmummmmm:wInnmmmmnnummnmnmunummunanummInunmumnumnumruummnumnumummmummm:mmnl1ummm1.mmmwInmmm,ummmnunumnumnumnnnuuumymnnmummunnuvunuunnnnuunwmnumnumwanunvumymwmmuInmwInummummmfmnnuynwuwIn1mmnnmynuInummuannunumwInm1mnnnumumuuumunmnmmnnag E g 2.Hnn.m..m...mu...m.munu.um-llmmumm.mmmmmummmmm,.m.HH.,.mmN.11.1vm.m..m-.mmmmmmlmmm..1mmmnmum.-1mmm.-.ummfunummm....mm1.Hnumum.mmum....mlmm.,mV..um...mm.H....mu.H,mm1...nw.,ml,mm.mWK..,mmmyH.mfH.,Km.HmH..1.mnnuum.1.H.HM...-1m.H.rmV..,.HV...mm1mml.H1.E.m.wm.m..um.,uiIiiGiiC5ITiHIiiiEGiKHI5EREliiIIiI.'iiiii1EiZiiEii551Ti5EiZ.7H'fS7I?ummu.-2 55 gas 222 ESE - ,E ass 1 51: -1: l E55 :zz Eg: EE g ggggggggggggggwlgggggggumwfugm551555wwug...nmInummmummmlM1.mmm1In.mm1mm-.1mm,rmU.unvmmummulmmmunm.m..v..1 E E munmnwummnnunumvmvunununmmumvuxzunmmnnmuvmvmmnmnwnummwummmnunuummmvuiilvnliinnwunHIHHUIIPEGilHi1iiiiillmiii1iH"""""""""" mwanunununanunnnunummmnuummnunmunmunnuInunnuannnwuvnnnuruwuwnumunnnwnuunnu1uwnnnnw:mnmnmummmruwmummanunwnnanunummnuwmnunnummmmnnumnununuunmmnnnunmyunum:wvunuununmuuwnwumnumnurnnuuunxmwnmnnmmma 5 4 mmummInuvunwInulwmnufnununInwmnuulmm.numnufuunnnmnnmm.,nuInfmnwfuwInInw.ilm1In1I?winwulw.hInwmmwu1InwInmmmmlmmlmmInnnnu'mmmummInummmuuummmnummm.ummmulmmmmmnunum1InummInummmnu.mm1mm:umnmuumnuummuwmmmi Page 332 ii Er E :IE -V .vu..vu.n..........nnnm..m...m..u.nw...unm................................... ...ng if 1.1 .5 1, 1:"'.....""""""'E"'...."""'""'!w1!!!!!!!EHf!f!fElfvul!u!:!H!:!!l5::!!l!!1!:12:1251E!EEMIMHBEKIEEHEIllflrllllinwllfflfElfIE!!tflfflfiftillllfflzlfulilff!:MU!!15!!1!!l!!:55!2!!1Elf1!!!!l!!!!!!1!!:I!!l!f1!f!!!!!!!!M!HltlrlllllfllffSiu!!!!!!U!!1!!2!!!!:Hill!!!E!!!!l!!1r:!i!1fI!!112222251525"'1!'!1"'1"!"rf"""""""1"f1"'"""""""""""""""""""""""""""'"""1"""""""""'""""'1"""'1""' .M W-- . ..,...... E51................................................................................................................................................................................................................................................................................................................... ... ...... ...............:.:.....1::..:..:....:n:zzz:m:a:.ni:nizazmzazazis::.1::m:1.n:z:1z::.:mamz.:5i:.:z.:::.z:.:::.:::::::::z1:11z:i::::.::.1:::::z..:.zz:15:1n:11:m:1I9:amnzzisznznznznzzsmzzs.....:a.:...........:..............rg15 ,if is E15 2.2 E35 EEE EEE E22 2-2 553 EE EE 55 E35 Eg: EE E.. :EE .Eg TEE E55 if 5.5 ' 215 :ii ' EXE ff: . 1 U. of W. Girls Hold Smoking LS Their EEE .-f-f Rlgfl!,Bl1fRduselol,wcUptolt 4 51- Ei? ge. v......r..-. :.... ..!a........ rf... .1 ' ' 525 Es. . U.. .1 r..s..4.. E.. E: Broun n 1.luww... ilu.. a...a-'.:4' .. 'ls 5. N BMW Baum In an Jllw-. lr I. S: lm... wp- .r..... . ... ' .... ....."".2f..lI. "" 21,,,m",I' .ES ...- .......TT'.. 1.1.2 ...TZ 71. ...... ....L..3r1........T .5 ....... .. ....... .. W xrr:...:: .r viz 1"-H . gif ....... ....... ... .........., .... ....... .. ...,,, gmgn, gn-gg 5 g - ...... .... .. ............ .. ....... ... ....... .:..... .. ....... . ' 5 -, ....... ....... ....... .. -.... ... ....... .. ....... ....... ....... .F 'UJEIK STUNTS AND ACTIVITIES f.mf"ff-ww www- Egg ....-h.,...-......:l... .. ...m...., 'H 'M',,'jwu-- , 52. E, . .... w - .,- 5.5 .... ....-.... ....-... .... .... ....... ' Amu... . ....... W w-.... E55 AS I GLU PY 'DCIE V ' 2"2.i...'3.T.2',iZ'If"i'LL .-FW-Cf-""f"... :'a:::a:.-c'::' Egg ..v.....f.... .............4 N... ... .... I-ww -.H-pw...-., .M .... .. ... . Exe E 1 ,,,,,,,, ,,,,,,, ,,,,,,, ,M ,, ,,, , ..-. .... ....... .... ...... gig 5 , Vw. :.:x.ly.1..h.:..... .... ....... -.. lgmmdzlzz ...:.u....:. .. f., EF - Bwomigxgouw -....... .:'.r:'.-:..::..'w, .Q ....... .W M .c...'.'::z :is ....... ....... ...........- .... n... 5 Jw-' rm H v- ....-.... 5,5 2.5 905.1 GL ., .-mf r:'?.x...:f"".""". ::L'...?'n 432- 12 T-.3-"..:r:.1 :r':.t af: I A ...L ,qt ...Q .... .. ... ..'K'..... ..- ...M rv.. g:"::uAwum-1 or .r...b:...... .... 15 GI S S WA.: ,"",..'.5:' ,.q-'j2....-54 '.. :::::':::.::x:"n" M --'W 'f 2. 'zz E.. ,. - .... 0 v n...na..u........ 'YH .,. .. .. ..-. -.5 C0-ED C5-RDINAL Y.-A gh v"?1wf'f"".,..H-L ,.... -.-....... .... ... ....... NP.. ,.... . . Ss. aaa el 401, what 0... .... .... ...... ....... -..-....... ....... w...-....... ..l.1....1 " """""' "' 5:2 - N ,.-W.. N, E, J. ..-...,......., ....... .....-. .... ..:.:'5:r..,.1-m 5.5 bl .... M.. A .a .,. .Q 1... .. .. ... . ...........-, ........... ... ... . .... ....... ... .... .W ..- . Els ,W ,...., ,.... A... u ,.. ....... ....... ....... .. . . .... .M .. "' S.- EEE fm... N..-AIN, ... 'fun ffm. ....-...... ....... .... -....... .... ....... 31?-I..'.Y..'I" "M" "" ers :fg .M .,,. F... ,,, ......w..............4................. ... . ....... .... 'X""""""' 5.5 :gg :LM -va ,. 9-'QL ,....-K ,, -.... .... .... .-..... 1-... .... .... .... .. ..... ......'S7I. S"L'1'.I"f' :ra Ee? ' .1' xv- ...w ""...4 X... "W 'M do -ww ..- ....-.... 0. ....... . .... ... f-.... I.. :fs Sokon i.'5.'nkt...-g:,..- ff.. -f:,..... L'..':..'f.:.:z".'f.:.."":u':.:: M""...".",.':."-V N- 'M--1' 292 5.5 .... ... ....... mg-, . .............,.. E.. 552 SPQYES Pi- .T..-fi. 131253. 11 5' Lij.. ,'.L...3'!!."f. '1. .....'3..""2f'.. 'S'.3"-T.l'S'...'211 2.17. '3."""1' E., ,N Ag -, , .... .. .... .... .,. 'Z E 2 E.. sq G -.... .. .. ...,...... ... .. .... ....... .... .. ld" fx: E55 Nun B , ....... ....... ....... ....... ... -....... ' "" """ 2.3 sig :wx Aw... .... .... ....... .. ....... . ""1"""""- -'---W 5:. EEE G ...,............... A 5,5 ... 'up elm., f .,: . . 1 931. la L, PHE . ss: sr: M '4 T. lh. ' ' - , . Hs gs. XX K Jw... 'M BY BARN I E . sr. sie . M.1"'w-.. X ARD GIR N 00 225 EEE ' ffm. 'H mf B-1.1 r 5 Q 4' Egg .... " f'T.'2,'f--.."fn.Z" f-f. " """' 'M-vu......,., P100 E.. , ..., '1..,.,," . ,kg ..-.,7Hh... 70-... mm um., ,,, "fm-S .hobo 61707. 555 ff . -""'1' fff9:f:T."'lf""":'f. 154'-12' 'Wk . " f"3'f... 0000 ii? ,....fgi.---"E ,',5j.P', 5.3. .'f.'.'ggn.?.i7 .H-g,' ...."'.'g-fn... ....... 5. 'Q .43 ',4.,'Q"'z,A,04- jf .s ,.. . ,,, or n. f .1 ,,,, 'rn ....... ' - -- , 5 3 :SE ..2'f""'..1-""1-ft" . n " "5:""':I?.""4 U'bf".?" -4... Lim" 'I da--J "' 'Q Wt"'4." 3" '2"v'f 041- 252 :gg -.rf o' , b.,,'- r., mv iz, n., n.,.p ff. whim gnu. hm, Haunt.. owe. '.,,.1G4,.l,4'h,,':a,'n,oh E.. 255 .,.--"...-- "C 'u.,, Sum f "W 'fha ' , ' Md -1. L. '- - va f' '- 0. 0 ,fnprf ahh, 255 sf: ,. -- ,..-'.. f' M-.. , rn... -'f!""ff.,, "H -.... ' 'M-1-1.. .. .jun fb" If 'vw 'wwf 4 ". w 4 555 . " " ....-f' --M - '.... l'ln."'-'lv.:'N4l mf.. .... "" - 1- 1.. ,M 'i - . 4- '4- '4.' df. 4.. rg. "mf sis gg. .-- ,. -N n... 3 ,,,:-f .., m..,fN x, Dj... I wr.. ... ...,,., M fn... ., mg., -,ff ,-mls, .,,, 5.5 L- ' .... x.. Ms. " 1 "f a."-'...'I:A..,,'1- ...o.."'5'-- ....., Lb- '.... nj. 64.9. 'e."f"f Z.. .. , ,..- . Cn. hu... ' A La funn... 'ml u ' . 'W 1 qu -1. .55 M. - - --' ... w- JZ' '.... o.. - m.,'2"fn,NPu rs. r.u...,. ""'w...., 'v"fq,'v ' - S.- 55 b, -:K iw.. 5 .f a ,U ,H ., - 5w......-1......, -- . rv ,,-. 4, - g g 1 f- I, n...,fH'BZ'ff 14,134 '6fm1','j2y.N 1.E'l'l'tv....'1"'N?'m-. .. ' 0413 1 4 453' :ig ,....--, ,,.ffT.---S51 U, .., .fbi o.,,, 5....,,A:.. Dem. gf-I-Z. lm... Hanna... 4 4. ' 1 gig . - ,. -"gf ..fv1".. ., "mi P. , y..,Q7c.,,1 .n..,,g,,f"gEw... n...-Lf' hu.. E Q PQ 5,2 E.. ' ,. ':1...- g...... -v.. gp: mp., -. .. . H-u n....,""g-f ,,f'2,,'b 'fisbflbe sg- gag -- - .- -""' P- C '-1 M" ' L. 4, E,- sis "".l1"" v' . +"Z2--- 'Q wx lp E.- g ,,....Z. l Q N W 4 E5 E., N.. :,. - H 4. Q. 4. 72' 2.5 iff - ' - . W '1Zf3Z.:7"nQf'3"3 "+. ' , Ca-Ed Mermand Brealu Ice I-Tim With my QQQQ Qf? e '41 0: EEE E.. . , , . 5: EEE Foot to Take Furs! Plunge IH Mendota .!':ff'i' "M"".Qf":., EXE 5:2 "- '1. 41. W. 4-t.'1."'-HV Ulu . 512 mm-L... .-H.. ... ................ ... ... ........... .... .... ....... .... ,gli 4:3 'v.Q,"'ff'Q'N.,, b"0f.Z",of'?f CMJSSPN, Ii? :H ... . ... .. . ....... .. .. W. .. - . . . . 1.5 .......... .... ...I S-......i'Z.. ....... ... ,.... '5T.o4'v"'.f','qf:l' 120140. 'W' "L 4Pp ' ' Egg 9, .. ..... ,.... ,.... .... .... .... ... 51'-W-gk. wr.. .. ....... ...... .... ,,, Margin: shaywb' ,fy 54,1145 Somali dns FW EE S, 9 -.. .... ............... .... o,,,-'gmggdy -M -1-H 53. -f. . 'lv -4 41 4. 411. 'DAY E.: 5.5 969. 4, ... ........... ..., ,.... ... ... """"n""""'v fo. 0 'M' 'f 'Jw ' A+. or "Mo --- .ef . 0 xx .. ..,........ . .... ....... . . " 'hm Mm T...--....... ... . lv'-.."-., ..,'v,"'w -. - ha., 'Carr cont E55 E55 big' 5X Q. A ....... .. .. . .. ... V ' "- '- ....... .. ....... .... .... ... ....... 'mf lv . wo' 'L 1. my or-. ,, -im E52 ,A-2,?'px'Ygv0e,,ng.g1.:I,:q E K:.:'..J..S..I'.2. I. ....... .... ...... "rg3.33535147515-I-.3-53-5-umW ""' LQ' 42-1'E.'j,-.'f'g1"'-6"'..f sm, W MW, f"'fw E., Qov-gn.-N Q9 ..q,.i,.- ,..f,.. V .:........ ....... .......... gm "H" " -M "" .47"."W"f..1,"f"7'27"Q' AJR- .. " " Q ,,.-tg.::.,.:0, .:3,.x.:1,,.... N Q 5-........'...... ..... ... .... ...- ..f,Z',,'f1T-...7:-1Z1.T,1,- -51.553 bw o.,,,v0...ji malzbgf. l...1...-.ZZ'y,? 2:2 sig nw x r, .-' . , f'--.-M f. .. ....... ...... ...... . ... .... ... '- .. ff - .' fr-. w.L."' . if .-'1,Ig,.-"l.gS.1rT-f:..1,".1J m:r...r:r:..11:rz.::.:7":..::H:1 JH -F 133.3 T-2. W' 2571? 3972.9 ill ,.-, X .W ...,.- ....... ....................... ' 'D' "ffm" '-I M' RQ, - ffl' 'f W- 'ow' "wa "- EE E.: -v .-f c-'AM' 'HQ 59' .... .. .......... .......... ... ' "1""' " """ -v.."'Ym""' f "H .1 L' U." 1. ' :f: 5:5 ww-' ,w ..fA.w,sP" ....... .. .... .,r .... ... . "' "" B3 ""'u""' " "P'f' W H' -'H M' 'f' """f-."' H.. "'f . ' 'Q "' iii Eg. ,. .. .V .. . 1. M M xv... .........., ............... -.... ... . .. fi '-0. M ,f. -.... '-- .1 wiv.-gi-.gi-4' .z..:...1,' :.:.':'m:r,.m: .sr:w:::.::'.'-Qii1.f'4E'5:l' ....j2.Q..:-Tir' .E Egg ,,. 9.5. .M ,......a.... ....... ....... .... ...., ......,.......,.... . f. 'H' ..."f. -. ' '1-...JM .411 .. 5:2 .A W HHH... ......:........ ....... ....... .... .... ....... 90 ...""-.. "'-.."" ""'f.." 1: .A .-.mxPr:...sz..":..'::1:LLf :'.'12:?.."'U ' W" 'W M -me 0' 'n EE .nk-.-ma...::LzT2.Ln.:....... .......... .......... 15.3 257 2"f.:Rf.T'12f.T." 'A' he-T, :::l2""'ZfZ"4':f', '-3'7"-.T..'L' if m.......'..m'::3.L': ..32::r:.:':':1f'm' 1' 0 'fi M511 '-1? .Evra-' M- fm.'Jn'.2:2:.:U:a..':u.1":rz:5 vw:r1p'g"E,53TP.'5E1'l'2'Q' .,Qf'.gf-3"g.,o QQQ. ,:f27.:0'i12.:gH.::M-7:'.f'2m5?' if? ,. -w- -'nw' Q. . -. .., 4 ...Z fb-'Q-mx" H- Egg 6 . ....... ,N an so ... A, ...W ..,,,a'..,n, .., N.. 3,3 555 . 1 CX, 4 . 00.15, -.,, -11 .,,,, fm., I-af., M. W'-1 .. 5.5 gf 5,65 v 4 1. 4-u. QM - . ... rf-.. .. lf... lf- H- f . Wt. W.. W 1.-ff.. 'M .3 ff' v- .A 1- 'Q MQ . , -. 'f-1-..2"-1.. H... , fm.. ' Zi' ..3.G:i.v"Z.. :.. M Q... Q5 'ff.mf.. if o on ef . w"..v' .1 T., E " fm.: . 'lf -. L." 1. W.. "' .. 'ww ' 1'-.Z"' ' m gr- vw. .v J- ,pw .,, RE -. , '44, .. fa Q, 5 .... 3... hc, hz... . 3. ..: " Mwififf-:r?3f'?X" .2'F"'.5'9"22.zQ hw " 1:'f"4?'f5."' 'n5""1Yf'L'::l.-.2'EH-'J'z?f21. . '. -- 9' . K .M . no fa.. r. ""fv..,,, Q. M' "H .Y E25 :gg 4,.ff,,..:,. 6.4, ...sw . af... Wm. ....,,,nu.. BQ., M f'+..,q:'g3.,, 046 00 QQ H: iii P10 .4 .GQ-1',.""'Q'.-" ,vjy rv., 'e..,""l, ur 4 R15 ., ,, I ,F 0 49 SE iss ..1.Z4".1' .W .,.- ' 5.4.9 ' 'fr q"'-.."'-'f "hm 'lf 'l 4 '44 'ZW E.. .55 . ,A .f' .-A ,,,,...r,.w Q- ... Mg. gnu., -...,4'-...go '-1 , If 416. of1.:g,.'."' ,. f"..1f one -. .""hv. .W .. fn., I - ' ow, X Q . 6' I :ss - .4 -,fe ,,.. ww .e',,v,..x U-ww e..,, Gem., ACH., Q4 eq-'41, 6,4 7' .H - vm . .0 .v ..- .0 .. w...,'-nl , ff.. 0 ' .. Q. 1 .. ...........,.... .... . Mn. n..-fa. '-..- f 1 Q, 1.5 .19 BX ,.x- pf' .0 o' .. QW m Wa., IA. 41-rv, fu I., '-gf.-, Pm " fo 4, see -wr.-' . ' .1'.1w"..1' .v .G "' sr 'He 'Wm M- ' 0 fb, x Q., Eg. W' .4 xv v' .1 .X xv ,dv .A IA. in fha H . .- '44 'fr e 'Q I QQ ' If-E.3kil3:i'.'v3E'.?5E'55 'N ' -:fZf??.:,e2.,?-fyfovi. 4' . -.':.w..f3- gm-g'i-fi.-tr.-' 1 ' .ww .:f..'ggM'Zf..3'f'?f.. . .X wx- ef '.3"1tW ave. Qf.:.1NfaQ.fQ.. -- :EE W X eb' x .. B Q' me X 'I -E5 E.: v.......wL 14, 4. .......-. ,z 3vA5QI:1T3'.2m3'T"'Zf3'B3Yt 33. .VN ."3il2'4'l2"-'Z'Qf?.:f'i'05'.1'? sag -X .H M- A v- ...X .- .G Q., H. ff. 1-- .- -W.. K. .... Q. . ,fo ..,.,,f. fa.. , f. . . .+N,.Qx,.Xgv,.sw.-2. -'bw l J., 5 4,505 .www .1 Q., fg.,, ,,, ,of ,ig vw..-'A .f ,...l,..-1 .bf 0 J! . . V awgqbf, ,gems mag. 1-,1 J 2-: .... , . ' JVC, 21 ..,'f.'g- 'wa , ff., 4,,4.,4v Q.. .- +".-'..,w "f 'MM '04 mf 05 Q X 40 "'5...f'iZQ.0.Z'f"l'1'5' Qv - "..'aM'0 'W-ff' 5E g.. :.. EEE EE 5: 5 jg.........................................................................................................................................................................................................................E.........5.M...........!......................H...mm........mg......ZnM....w...mE2E:Hmmmu2.5.2Y..mm...M..DS....mxwwT2E.E.M5.5.3...3...mmm..25.2..E..!m..TTm.mw..g....................2 I " 'M'""W""'M"""""'""""""""W"'"""'"'"""''"""'"'"'""'""'"'"""'''"'""""'"""""".1'.."'az51.L..1im...m...........aammxiznana..1az....5..5............................................................................................................................................................................................................................................................................................................................................"'A..................... Emunl ........................................................................................................................................................ . .... P a g e 3 3 3 5 I mm' M--vjmw ,-M-Mmm., I 1 I I I In I IIIIIII II Chacibourne H4111 Ojicers GRETA SCHULTZ . . . . . President MILDRED SINCLAIR . . Vice-President ALICE EDISON . . . Secretary MARIE BODDEN . . . . . . Treasurer EVELYN LUDLOW . . . . Social Chairman MARION STRASSBURCER Keeper of the Archives Activities 1918-1919 Oct. 19-Matinee Dance for the News Girls Nov. 28-Thanksgiving Party Oct. 26wCorridor Spreads Dec. IO-Formal Dance Nov. 7-14-Initiation Week Dec. 15-Christmas Party Nov. 20-Peanut Bag Rush V jan. 16-"Silent Night" Feb. 8-Faculty Dinner Ludlow Harrington Schultz Bodd en Sinclair IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIII I I I I II I ImIInInIiwumuluullrlllumIIIIIInIIIuulnlllmulmlnm I 5 Page 334 gpm-1 E a 1 is na I IwmwuwwuwH4wlu1H1wn1fuwUw1.11H4wnwwI11mwu1wnwnufl1wmmw1HwIn1uwwn1w1H11141ynwwnwInwuwW.11H4wnw1.11Inwu11u11nwuwXI-X1uwinumwn11u1inum1n1WwwH1Inwnwwuwm11n1H41H1wu1ruwuwunwvuuuw1nvwu1wnwmwwnmwnmmmmnuvs ,,..,...,..,,..,,..,,..,H.N.,,H,H.,,,,,..,Y..,..,,..,,..,..,,.,,,H,..,,..,...,,.,,H,,.,,.,,,..,..,,..,,.,,X.,,.,,,.,,.N,,.,,.,,,.,,.,,X.,,..,,..,...,,..,..,.....,,H,.,.,,.,.N.....,.,.,.,,.....,........,.,.,..H,,....K.,..,.......,,......,...H,,.....,,.H.,....,.,.,.H,,..,..,...,...,...,,.,.. H. EE , ,.,. mv-- 535 , EE E52 SEE ag: 1 1 E52 EE if 25: E25 iii E35 25 EEE X EEE w 522 gig Q sga E iii 1 EEE fee w is: 255 I Egg E55 i 355 22: N :Ez 522 , ii? 21: X Egg :za X ess :E :ia E15 . ifBm..k.m..m1W.....Q,um.....,H.,..v.mmmm.,.HXnu..W1-1,mu.,K..1.N..H..W1mm1..,,..,..W1.U,ml..L..,,.muW..,1.V,......,..X,.WW..,.MH.1K.,,...W1..,Km..,,.X1.W1.H11.1..H..,.H.nw,1H1.muU.,.Nmm1H,...W1K.,1.w.1U.,1.U.mn,,UWmX.1,mmH.W.ImlN..,,mmmXWH.,www1,.11nu.,N,1.M,H,.H...MX1.1,uv.,,.1,mm,Iy,,.U,.,,.,4.u,Km.,,N.,,.W.H,V..,W.,N1.,,.NH,W,H,.W,..,xNW..m.,.mnNV.,muWmy,mm,.1Xmmn.:vT,,..mmiTTZEE .....,,. ..,. .... ..,. ..... ,. ..., ..-N Mi I 1 I1XU1,Humwm.wm.mH1.H1.1XnfL..WH,1.W1HXK.,H,1HW,.11in1..1,.,X.1XX.1XL.111WXmW..WH,,A,W1.1,UXWyX,..XWUW1.WX.N,1.WW.XWNW.1Wy.1,UWW.HXWH11.UHWW.HmH..W.H.flH.H.mmH1,N.m..m.m.um.........m w lmwwInin1nvwHwIninwnwwnwnnvuwHw1Iw1InmwnwinwnwnwmwuwmwUwmwH11n1nwin1uwwIwwn1nwmwm1.11InunmwwIwwnv1n1w1wuI4wn1wnvrnulvumvummmwww1 ffmunwIwwlummuwwmmnlww1wwInununnuwuummnnwwnwmnuwwIxxnxuwxnwwnnnuuuwnuuwuuuu1xmxmmxmmuluuumnunulmu I Page 335 mnmmu.u.mmum.mm....m......n 1 . mm..mmn.............mu mmmnmummmnmmumnfmmmmnm I minnnruuummmuwmmmns rmnn mm .muunu u .nm .I nuvvmuu nun uxnnnunumiiu mmmummununnumnvmxium.nmmninuimiuwuiwuvnumluummnnmmunu 1 in 1 v n umm. mn lr nr .... ... ............................. ..................... . ....................................... ................................. . ..................................................... ... .. .. . ............................ ...... .... . ....... .. ......... . .. Oct. NOV. Dec. jan. Feb. Feb. Feb. Feb. ...... .. . .... . ............ CBar'nard Hail Ogficers VELMA REID . . . . . I-IARPJETTE WILSON . . ELEANOR STANCHFIELD . HELEN SNYDER . . . CLARA MUELLER ADELE FALK . . . . GERTRUDE JACOBS . . DOROTHY BELLE WOOD ELSA BERGER . . . . 5-Party for Freshmen at A. T. O. I-louse Mar. 26-Freshman Initiation Mar. 18-Christmas Slam Party April 17-Tea for Chaperons April l-Mock Prom May ll-junior-Senior Cabaret Dinner Dance May li-Valentine Dance May 22-Washington Birthday Party june . President . . Secretary . . Treasurer Social Chairman . Music Chairman . . . Librarian S. G. A. Representative S. G. A. Representative . . Fire Chief 9-Reception for Old Barnard Girls 17-St. Patricks Party l-junior Aoril Fool Party 20-Easter Egg I-lunt 3-Mothers' Week End 4-Vaudeville 18-Informal Dance l-Senior Swing-Out Snyder Mueller Stanchfield Wood P .1 g e 3 3 6 Jacobs Falk Berger 11111 1111111 11 111111111111111111111111111111111111111111111111111111111111111111 1111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111 1L 1 11 111111111111111111111111111111 111111111111111111111111 11 111111111111111111111111111111 111111111111111111111111111111 1111111111111111111111 1 111111111111111111111111111111111111111111111111 1111 1111111111111 1 11111111111 ' ' 1i111i1'- il1E211iiGii?11111E11iiiHi?111H711ii11111121511G11H11111FII1E11311111121111112111111il11i111111111111H111111111111111111111111iiiEli11111E2111311211E11E211151113111111Fil1il11111121111111111111111Ei?1121III1Fil11111111111111111"l1"""""" " 'i1l1"i1'i"""'1'1"""'1' 11111 111111111111111111111111111111111111111111 11 11 .11 1 1 11 1 1 111 111 1 111 1 11111 11 111111 1111111 1 1111 1 1 1 1 1 1 1 5 1 1111 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111 111111111111111111111111 1111111111111111111111111111 11111111111111111111111 1 11111111111111111111111111 11111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111511311Q111111111111111111l111r 1 1 1 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.111111111111111111111111111111111111111111111111.111111111111111111111111111111111111111111111 1 11 11111111111111111111111111111111111111111111111111111111111111111111111111111111111E11III11E11Zi11i11Ii11ii1Fil?li11ii1iii11i11E11iiiI1i11ii1il1iii1ii11i111i111111111111ii1I1il1i11i11ii1iiii1i11i11i11iiiiii11E11H1111lil151111112111111311I1liiiiiiiii1ii11i11iillii1ii11i11ii1iiiiii11111IGIiliiiiliiE111111Ii?P1131111111111i1REi11i11111li'1111 1 Page 337 wmv I Inn QjNla11oney ,S 515 Lake Stree! RUBY JAGOBSON . House President Graduates ' ELIZABETH COBURN RUBY JACOBSON KATHERINE NEERMAN 1919 BARBARA I-IARKNESS MARJORIE LACEY 1920 ESTHER BERRY AGNES LYNCH MARGUERITE DANA MARGUERITE MOE MARIE GRAMS MARGARET MORAN KATHRYN KELLETT GERTRUDE OPPELT 1921 AGNES O'I-IARA IDA SWANCUTT MARY ANN ORSCHEL RUTH SWANCUTT BEATRICE S1-IERBURNE I-IAZEL TOMPKINS 1922' ANNE ALEXANDER ELIZABETH LOCKWOOD ESTHER FERTIG MARGARET MCDERMOTT MILDRED HOCH GLADYS SCHILDHAUER EVELYN I-IUNT MARION RINGER FRANCES JACKMAN RUTH ROMSON CLARA JOHNSON MARIE TIGI-IE MARGARET WILLIAMS I I I I. I I :InIIIHfiiiiifii?5iII:nI:1InI:afiii5555ifilfiifiiiffiffinsazzz I I I I. IIII. I I Page 338 .mmmnm.,vm.mmmxH-U.,mw.w.mU.W,mmnw,mmWH.ml,HM.,...1...W...W.,.WWnu...mmm,HYmy..H..um...vmkm.mmH.v.,,...k..,rm.HWW..U.,um.mmK..Wnw.WW.HH.,H.Y...,..m.,.m,HWH.W,.m..w.,.NH.,,HWmm.W.,.WK..U.,H.V..uw.H.HH.,H.H.WW.,W..,H.,H,WV..WW.,N.,.HH..W.umW.HH.,.H,..H..,..H..H..,.N.H.......uw..WKm,HN.,H.W,...,m.......H.,U.H..U.W.umW.,....W...vmlm,H,,.m..,..,..W..,, 3gn..u.4...,...,um.,nm..WK..1...,..4,.HH.,nm..U.H.mmH.,......w....HH.,H.N.,Y......,.......,H,KmK..Wm.,IHWK.,H..mm.W.m...Ww..1,..,H.,,HH..Y.,W..,,..1H.,.HH.,,.m.,1.,.,.m.H...1.Mum..H.U.mV.,W,WY..YK...,.....H.HH.,K.w..m..u.....,,fH.HN...V..N....W.mm1HN...H.W,W..W.,lminH.,V..,..wm.Hm..H,W,.w..1.m..,m,mH.,K.,W,H.WmH.,..v.W.,,,,.,..,,H.,.U.m.HN.,W.,...,W.mw..1.,.,..,...,,mu...myHH.,H.H...,..,..,...,...,...K......u.E55 E : 5 5 E g: 53 E 5 Q 5 5,gyggww325151135155315.1mWH4nmInvuwfmnlwmummpwInvu11I.1nuruummInwn1mwInWwuXmmmmrmyuInwHWIn1.IwmmWHInH1fn1-I11.11InmwnwummmuwnwmmmwinfuwlummuwInrn11-MmmnwwmmumuwInWuvmmyrwWul11.1ynXInmMHynm1uwm1InmXummmInI-1ulm1H1XuuunmHInmm11nw.11IninNmmvmW1HX1-11mm1u1,HH.un.yn1m1.11WNInyuN1HInH.1H1in1inV..mfTWww.1m1mmXW1W.Uuwmgyxfugfgugufgmylwf QmwmwInwu1yn1InnumlwmwnuInmywmwnwmwru1mnuunwanummwmMvii?iii1ii?LMii?iiiI1N151iii1Milli?iii??iGEQ51ii?iiiGiiiilliiiiiiMGE1ii1G11iiIEEEiii1iiilidRE1liwiiiIIEGEEEZIiiiwilGi?hhInlmmwnw:mmunInmmymwInm.mmwlnulwH.XInIn1HXHHInWm1lmmmuluwInmmunmwrnwuwmmnlmmmmwXn1mmmmwwuunmwmwmmw1HinXmXnXWWnumuv11wmwH1mfInmm11.mmn1mfInmmm.mmmwn.1fmuu.mmmmy,mmwmmmnmmmummmvm Page 339 I I I I I n I In u I II IIIIIIIIIIIIIIIIIIIIII Ye Garth Inn 606 North Frances Street ADELLA BOIES MARTHA ALWAY LUCILLE AUGUTT ELIZABETH BENNET ENID BROWN KATHERINE BURTNERS ELSIE GRABER MARGARET CRAICPIILL FLORENCE DAY PAULINE GERLING ADELLA BOIES DOROTHY EVANS DOROTHY POWELL ADELAIDE ADAMS KATHERINE BARTHOLF RUBY BRITTS AGNES EWELL DOROTHY I-IOHN EVELYN I-IOUGHTON 1919 1920 1921 1922 House President LOUISE INGALLS MARION KIMBALL GARNET KLEVEN MARY ANN LOXVELL GRETCHEN MUELLER LUCY WOOLERY DOROTHY GLIERNSEY KATHERINE STAUFFER GRETCHEN ScHwEITzER PAULINE POWELL MARGARET NEAL CLARICE WINCHESTER SUSAN LEARY DOROTHY TERANT CAROLINE SCHWEITZER JULIA WATSON VIRGINIA WOOLERY LEONA WRIGHT PM mm nm mm mmmImI IIIIIIIII I .II Im. I I I In In ...WI...IIIIIIIIIIIIIIIIIIIIIIIII I .mmmuu A I iiiiilEiiliilEiiZEi?iiiGilIIIIEHFIESIIEYERIIEIEIHII' I I I I I IH I HH''HW'"""W"""l"""""" "'f""1"'X' Page 340 Red Qhlill 257 Langdon Street LEONA PRASSER ELIZABETH EHR MIGNON WYMAN . House President 1 91 9 IRENE QPGENORTH MIGNON WYMAN 1 920 ALMA BRADFIELD . CLARA HOOVER HERMANCE TESCHNER 1 921 MARJORIE I-IALL 1922 ELIZABETH BABCOCK MARION Goss I-IORTENSE BASSETT DORIS LOVELL MARGARET CONLEY I-IARRIET MANSFIELD JOSEPHINE DORING FLORENCE MILLER ELIZABETH VERNON ELIZABETH WAGENBRETH 49---"Mz"w ,Page 341 I In I I Qradford 'S 613 N. Frances Street A ANNA G. BRAUN MARJORIE BLACK MILDRED CLARK FRANCES HIGLEY ELIZABETH I-IOOPER GLADYS JOHNSON EDITH NOLL ANN BRAUN FRANCES MALM LAREINE MCKINNEY MARGUERITE DOUCHERTY GLADYS I-IADLEY MADELINE HANCOCK MARION AYERS FRANCES COCK-IRANE Adult Special MARGARET ERBE 1919 1920 1921 1922 IIIIIIIIIIInII.IImmIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 342 House President GLADYS PASEWALK JANE PINE DELIA PROUDFIT MARGARET SCHATZ MARJORIE SEXTON MARLYS SHAW GRACE PATTERSON MARGUERITE PATTERSON FLORENCE WRIGHT ALBERTA I-IELLER DOROTHY MEAD EDITH PINE ALICE LINCOLN ALICE WILKINS White's 517 N. Lake' Slreet MILDRED RUFSVOLD . House President 1919 LUCILE BORN BETTY NYSTROM LEOTA CAMPBELL IVIILDRED RUFSVOLD FRANCES WALKER 1920 DOROTHY LEVY 1921 SOPHIE DEHLER ESTHER ROBERTSON ISABEL FARRAND JUNIET SPAULDING ETHEL GILDEHAUS BERTHA TIGAY MARGARET KIRCH CLARA TIGAY 1922 LOUISE FRITSCHE GERTRUDE GILLETT HELEN HAFFENBERC GRACE I-IEMINGWAY KATHERINE MEYER LUCILLE WEST IIIIIIIIII-III IIIIIIIIIIIIIIIIIIIII 11NIMHIIIII-IIInInI.IIInII.II.II..4IIIII.m.III.IIIIIIIIIIII Page 343 OLIVE PETERSON RUTH POTTER IVIABELLE ROGERS ARLINE SANDER ALMA STRAIGHT T m v r 1 1 T H n T 1 4 ur Tm x nm 1 mmmuummuuum:Tuuumummuuumuunrlnvmnu num u Dewarlc 's 230 N. Brooks Street mm mm umm nu un rum HAZEL MURPHY House President I 91 9 MILDRED PEDERSON BESSIE SMITH I 920 FRANCES KLASS HAZEL MURPHY JENNIE MARTIN CLARISSA PATTERSON 1921 IRENE GARDNER - MARY ALICE NEWTON MARY VOORHEES I 922 A ESTHER GUERINI MAUDE MOORE E BEULAH MCCOMB DOROTHY SHANER LYDIA SCHULZ . .... ' 'l"'f"T'1. . .. . T1'mmf":L "" ii.H1?'G'i"': ""' ' . .. :mzanzasaaiwiaffiizzznazaannzsanznnma .. . . ... ...... .... Page 344 Sig Els ESE EEE is :ii E32 ef E S Sig E55 E55 EEE Eg: S-E 522 5,5 E35 I 5. E32 :Ig EES E22 E25 555 EE 525 :if E 2 555 555 EE E32 255 E45 sig EI: E55 E55 sag Ei: -E 555 sig I s s a a s 1 I S55 EPS EE E!! Q 5 2: ,..........,...... H H. .m.,...I..... - Illllllllrlllll I II II Illllllll Q'!"E1!!1ELf!1L.,J'Uf'!lJW1!"' .m.mm.m Mun kumm I N M nan nm n nn I unnuuuux I wx n I n I :I rm: num n :Inn un nu nr uv Imuum yy n my In I Inf un: n uunuuu Siggezkob 311 N, Brooks Street LILLIAN I-IANSON ELIZABETH ALLING FLORENCE BABCOCK HELEN BABCOCK HELEN DODD LILLIAN HANSON EDNA J ONES MILDRED BROOKS CAMILDA COUTURE nu ummmmInfumuInInummmummInInummmu.ummmIm.. nu u u :mum nmunummnm I Iuunmnunuuu uuumunnumn n mx In 1919 1920 1922 um ml If -mmmmmmm mm. In mm. u IImmumummumunmnnumuummmum Page 345 House President INEZ MERRILL HAZEL ROSE CAROL SMITH NORMA PELUNCK GERTRUDE IVIARGRAFF RUBY ROTTIGER CECELIA HAVE F RANKIE NELSON ..... I m'.....,.i.5.,,... ..,...,,.im,,........ ,.. ...... ......... NAWWWWWWWWMWHWMNWWWWWHmmmmmmmmmmmmmmmmWMWWWMMWWWWmmmwmmmwmmmwmmWMWMMWWWWWWMMWWWWWMWWWW NHMUA, rTmTnW,. , nmAT.,m T N A.HuAn.m munmHTmm.Hnm.H , . , , ,,mH. .H. .W A T MW., MHAWWMAAWMT HWnmAWAmMAwW.mHHHwmwmmmmmwmwwmmmm l Owen S 271 Langdon -Street RUTH COFFMAN House President RUTH COEFMAN 1919 ,,. Q. LL. IVIARTHA YOUNG 1 920 JOSEPI-IINE PEARSON PAULA RUDER S 1 921 HELEN CONWAY 1922 MARGARET BUTLER VERA HERMANN JULIA COLEMAN JOCELYN KNIGHT IVIARJORIE BLAIR ELMA STAAB ELLEN CORRELL V IOLA THOMAS ANN VAN ARSDALE ..... .. ,,., . ,,..,,,,..,,..,,.,,. . ,, , ,, .,,, , .,T.,T, .,1., , , ,,,,,., ,, ,,,,,, ,, ,,,,,, H ,,,, , ,...,..,,.,...,..,,.,,,.,.. , T .,u, ,..,,..,..,.,.,,.,, ,,,. ,,.,,. ,,,.,,,.,,. , , . 1ITIfmm:wmmumnmulnnumumnmy nlunuumumnlnnmmnummmnn uvuTmmmmmummmnuum uanvmnmnmmmmnnmmmmmuuuman munuummvTmTInmTmTuTmniliiiiii?EWiiiNillii?iii?ilIii5iiKiiYiilEii1iiTnmmuunnumummymmmmnmnu I uummuummmnn:mmfmrunununmmummmunImmuummnuuummm nmnmmmumunuummnmnummmummmnnumnmmu Page 346 gugIIIWIIumu1mumInumInInIInunnnm1ummInIInInIInnnImInIInIInIwm1InIInIruIImInIInIInInrmnnnuInIInIInIuInuvmInImIInInIInIuIInIrmInIInIInInIInIInIvuIuIInIInInIInIruIInvuIInIInInIIuIInIInIIuIInIInIInIInIInInIInInuInIInIInInIInIInIInIInIuIInIImInIIIIInIInIInInIInIIIIInIInIInImInIInIInnuIInInIIIIIInInrmIInmIImInIInIInInIInI11IInIInIInInIInnuInIInIInImmIInnnmmIIInInnnnnruInumnnummummmummwummnmnx -I sis E's 2ig.....w.,11....I.11.11.1111 IM,.1,...wIm.11.1.11.,1..1,......,mm..,..,..,,...I..mm..1........,.m...II...I..I....I......I.,I.,,..I..,I...WI,.....,I..1..v..1....M1.11.111.I.1.1...I.1.1,1 I 1 I I . . I I . .,..,..,.,,1,Inw.1.1.,.,w.1I.1w,,I.ImI.ww..,,.1I..m.I.u.,.I., I.1I.1I.w.1,,Wm1.1.I..1.wm.m.,1.1.w..,HW.,..,,..,.,.I.,...I..,..I..,I..w..11...,..I.......,.........,. 1. :ss if 5 E I W ar s 212 708 State Street ESE E52 QE EI: :ss E15 -if - gg FLORENCE COLLINS Q . . House President W I 920 FLORENCE COLLINS 1921 FERN BUSBY 1922 EE FLORENCE BROWN PEARL LITCHFELD JESSIE RUSSETT JOSEPHINE JORCESEN IENYD 3 LUCILE MURTA MILDRED STIC Cach ' 602 North Francis Street S , KATHERINE STACK!-IOUSE . . .. I-louse Presidenz I 91 9 FLORENCE DONACELSKI KATHERINE STACKHOUSE I 920 5 FAITH ARMSTRONG MILDRED LAWSON IVA RANKIN MABLE I-IEDDERICH E MARION ROTH l 921 ' LORRAINE IVIATI-IEws ' I 922 MARY ADAMS BOYD WINIFRED Moss ALICE TUCKER AMY COYLE IRENE WELSI-I I I 2: III I I II I I .Juana .... I:u:::::ILw:2u ,... I II I mxummummmImnummmmnnmmmummInInmumInInInumInIInnuInInIumumnnInnmnummInInImImInInIImmmIuImImInnuIuuuInInmuInInm1nI1InInIInImInInImImmImmunInIuIInIInInImnuInInImImInmnIInummmInummInInvmInIInmIInnum1111InnnInImmIummmIInummmImInIInmlInImIInIn1111mIImm.mmum11m1mnmn1ummmIIIIIIIIIIIIIIIIIIIIIIIIImmmmuII1ImImmmummunmnnnunnuu111.11111111111111 Page 347 EIIInIInInvmIInInvmIInIuInIuIInummInInInImImInIInIInInIunmInIumtImInInIInIuImnuImInInIInImmmImInIInInIInIutInInIInIuIInIInInIuunIuIInIuInIInIInInIInIuIInIutInInIInInImunmtInInIIIIIIIummumwnmumInInnuInIInInInunIInInIInIInInmtImInnuutInIInInIInInInlImInIInInIInInImInIInnnInInIInIInImInInumuIInInImInIInvmInIInInIInImIIIInIInIuIInIInImInIInInIIIIInmnInIInIInIInIInIunnuIInmwumuunmlm In Immmmn umm nImmIIInmumIIuI.Im.IIIwmwI.4Im ummm IIntIInInIInImmInIIIW4InImInIInIIIInIImInInIInInIInInIInImInInInIImmInInlInIIIIInInIInIInmIInInIntIuIntInIInInIImInInI.IIInrmInIInIItIInInIInIIIIInInIInIuIInIInInIInInII-4InIutInIInInIInmIInImInmtInIInInIInIInInInIInIInInImInIInInIInIInInIInIInIIIIInImInI.IIInInIInImInmtInIuIInIInInIInInIInIntIInIIfImyInnnInIntIInInIInIInIInIInnnIImImmmIIIIwv-1 Frawley 'S 620 Langdon Street RACHAEL CARPENTER ,.,.. . . House President LILLIAN BIERBAUER VERA BIERBAUER FRANCES FINLEY CECIL ARPIN ROSE BEITLER Adult Special LILLIAN FRIED Graduate LYDIA ANDRAE l 91 9 BARBARA PEARSALL 1920 ELSIE HARTMAN 1921 1 922 HILDEGARDE MAEDJE HELEN WOODRUFF Ellsworth ,S 248 Langdon Street RADA ROTH RACHAEL CARPENTER IMOGENE JOHNSON ETHEL BASTEDE ESTHER NORTHRUP DOROTHY CARLOCK I'IARRIET KUPFER MARION BROWN MARTHA BURGESS HELEN J OHNSON I 1919 1 920 DOROTHY CARLOCK 1 921 GLADYS HADLEY 1 922 EVELYN LEE House President HELEN UZZELL ESLIE SCHMIDT CATHERINE SCHULTZ ALFRIEDA SCHMIDT .I I. I, ..,. ...,,..,,.,,., . MI. Im, ., .I.I...I,.,I...I.,....,..,..,. . ...,... W., I I,..IIII.,I..II..I,.II..I..,I..I...I......I.,H.I..,I.I,..H.,,..I...I..,,..IW.I..I.,I.,I.Imu.III..,..,I..,..,,.w.m,I .II..,...I,HI..,...I,I,..,,..I...,..m.....IW.,...II...I...,...I.m.:5E ImumnumInIInIImInIInummm:ummInIInIInInIInInInIInmmmmmImInInIImInmtInIutImInIlmnwlmnmmmImmIIIIInIInInEERiiI'ii1QiiiiiimInmm-mmInnummrmInInIInIuIInI-IIInImtnwmmIInmm'm4iwImiiiimiIhnIhiwiilviihivInIInInIInImutInImIIfIInIuIInInIutInmlmm.mm-mmImIIum-IInImImmInInIIIIIInImiii?EQIIQJEDEIUZHEFQIIIUIMQLFIEIEEmumInIImIIIIIIIIINIIIIIIIIIIIInnuInImInIIInIIumuIIIIIIMIEIIIIEQIIHIEEIIIm' Page 348 gIIummnmmIIInI I I I I I I I I I I - llllyl 'WM I nun In I Im: I I Ium III EI Es I 2 Elgum-uIw lxrvu II I :III lu- I nxvunwnuw num lvnuv mum If :I I I I -I wwf- I I I I A. C. Ag Cottage 1311 Morris Street MARGARET WADE . . . . House President Graduate 1 MARY ROGERS BETSEY MADISON 1919 IRIS COLDWELL - I-IAZEL WOLCOTT MARGARET WADE HELEN PERKINS 1920 ANITA BURNAM ISABELLE JOHNSON ELIZABETH MILLER FLORENCE GERKEN LAEL METGALE HELEN PAULL RUTH WOLFE CB1ue Qragon Inn 435' North Warren Street JOSEPHINE I-IADLEY . . . House President 2 Graduate I NORMA DAVIS 1 1919 LOTTIE GRAF BERTHA YAEROFF ALMA LUESSEN 1920 ROSE DURCH .IOSEPI-IINE HADLEY GERTRUDE NOETZEL ELSIE GIBBON JOSEPI-IINE I-IINTGEN LOUISE WELD 1921 GRACE MGLAY IIIIINIIIIII IInIIINIIIIII-mm-III. I I InImInIIIIIInInIInIIIIInIInII.IImmIIIIIIIIIIIUIIIIIIIIIII Page 349 I M' "" """" I I 5 IIIIIIIIIIII IIIII Royce ,S 515 North Frances Street IVIARIE VAN ERMEN .... House President Graduate ANNE CLARKE 1919 1920 DOROTHY KYLE MARIE VAN ERMEN 1921 EDA CAPELLEN VIVIAN WILIQINSON JOSEPHINE I'IALSOR 1922 EVA ALFORD SARAH GALLACHER IVIARCELLA EGAN ELIZABETH KATZ OPAL GRIFFIN Qfxlortarf Board Cottage EDITH HADLEY . . . . Hoase President Graduate ELLA MARTIN 1919 1920 LOUISE BEAUCAGE EDITH HADLEY I-IAZEL HOAC- EVA TURNER I 1921 MABEL GREGG CHRISTINA WEEKS I P I ' IEliEl!1H1I!!1iff1551511lil?I!!lllfllliflffllfllflillll ' I I. I I I II.I.III..I......II..I..III.II..I..I...II..I.II... Page 350 I 3 Grady S 708 Langclon Street FRANCES DUMMER . V' 'H V' . 1-louse President 1919 MARGARET FRITSCHEI. HESTER WADE 1920 GERTRUDE HOACLAND MARY WHEELER 1921 MARION BENDEKE MARION FELIX FRANCES DUMMER LOUISE FINDCH ANTOINETTE FEE F 2 MARY IXACHAMPTON HARRIET XVALTHER 1922 RUTH ANDERSON ARDIS PETTIGREW ANNA BINGER CLARIS PETTICREW HELEN CHASE MARION RINCER ELIZABETH GRAFF IRENE SPIKER MARGARET 1-IAWLEY ESTHER STOWELL MARY JANE LUCAS IQATHRYN WHITING LEILA IVIEAD KATHERINE XVICKWIRE S 11 'd ' 315 North Mills Street ELEANOR SCHROEDER . . House President 1919 FRANCES LEVY ELEANOR SCHROEDER 1920 LILLIAN BISSELL 1-922 I ROBERTA BRIGGS BEATRICE SANREGRET HEI.EN KNILANS I-IYLOS SNASKALL H 1 l2flfff!2...lJ!i ..J..l1LflLJllYi!-..!,2ffTLl..JIH!f!22UIL ,J.'2fY!!!L!LiL,!LlLTf2l!Ll'l!2. Page 351 an r I Wisconsin in the Wczr ISCGNSINS war-time spirit is the theme which inspired the artist in the creation of this painting. Wisconsin's I-leroes, the gallant men who volunteered liberally and gladly are shown marching away from the great, white dome which stands for Wisconsin, the University of Wisconsin, and all of the great institu- tions of a great state. Above the allegorical figure of Forward, the symbol of Wisconsin spirit, hovers a mar- tial air-craft, and in the background is shown the outline ofa battle-ship. On land and sea, and in the air, Wisconsin sent the flower of her manhocd into the great struggle for democracy. Victory, with sword and laurel wreath, flies beside them-our boys, ,who have brought honor and glory to their Alma Mater, and a victorious peace to the world. :mv in munmuummnmi Page 352 iSCOlXSiIX. irdfie isconsin's Holt offffonor will for- ever remain her greatest heritage. On it stanb imperishably in- scribeb the names of more than 4000 of her stubents anb faculty who have an- sxvereb the nation's call anb enlisteb in the fight for liberty anb fltfumanity. Some have serveb in the ranks or on beck, some have playeb their part as oflicers, still others have kept turning the Wheels of essential inbustries, but all have been inspireo by the one great ffloeal anb have bent their efforts unceasingty to the one common enb-the vinoication o Eemocracy. One hunbreb of these valiant men sleep in foreign soil: as many are re turning rnaimeb or wounbebg twenty five are wearing military becorations fllt is the spirit with which every wiscon sin man is imbueb that has given this sityunivera place seconb to none in t e war' annals of the lanb. 4J7n,,m. HONOR ROLL ,ll-l--1.1 W.- :Z ,,,,ZZZZ :ZZ ,W ff. ri'-iy' Z 'K . . . . . . Z .1--2.i'I ,,,,,,,, egg- Z if Z Z is5,,,,,,,,,,,,,,,MW,,myWW,,,,,,,,,,m,,,,,,,,,,,,A - - ,,,,,,,,,,,,,,,,,, w,,,,,A l--- afwyf,,,,,,,W,,WW,,,,W,,,,,,,,,,,,,,,,,,,,,,,,,,,,i Z f 7 . ' 1' Z - f 7 Z TNVNVR RVL L Z ir? at Z Z 3 Z Z 4 Z' Z 2 if 4 Z 2+ f -IV Facult ? Z Z ' 7 7 Z Z BEATTY, ARTI-IUR, assistant professor of English. GALPIN, C. J., assoc. professor of agric. economics. Z Z Zi? Social. Y. M. C. A., Paris, France. Social. Y. M. C. A. gt Z Z . Z BENKENDORF, GUsTAv H., assistant professor Dairy GILLIN,J. L., professor of sociology. Z Z Z 2 Husbandry. Social, American Red Cross, Civilian Relief, 'g Z Z Z Food Conservation, Dairy Division, Washing- Chicago. Z Z ZWWZ ton, D. C. GRAY, FRANK, instructor of physics. g,,,,,,Z BAscoM, GEO. R., Major, Sanitary Corps, Camp Pike, Government. CSubmarine Detentioni. Z5 Z5 jg Arkansas. HAMBLETON, JAMES I., instructor in economic entomol- Z2 'Z BLANTON, SMILEY, associate professor of Public Speak- ogy. I A Z: 14 Ing 2nd Lieutenant Field Hospital Corps jj jZ I I . R, - ll I Z2 XZ Captain, Medical Corps, Psychiatric Replace- HAMILTON, ARTHUR, instructor in Romance languages. Z5 Z2 Z ment Unit, A. E. F. U Social, American Red Cross, France. ZZ Zi ,Z BONNELL, J. K., instructor in English. HARALSON, M. F., instructor in pathology. r Z5 Zg jg Government, instructor at Naval Academy, Government, Assistant Surgeon In U. S. Public ZZ 5Z ZZ Z Annapolis, Md. Health Service, Vxfashington, D. C. gg Z2 ,Z BRADLEY, H. C., associate professor of Physics. HENMON, V. A. C., professor of education. gZr Zi Z Major, Chemical Warfare Service, Washington, H Captain. d hi h Z2 Z2 ff D, C, OPKINS, P. Fr, instructor in topovraphy an IU way if gf Z2 ig BRADLEY, R. F., assistant in Romance languages. engineering. O U 2 lst Lieutenant, Infantry, A. E. F. Government. Z"""Z BRYAN, G. S., instructor in Botany, HUNT, ADA, instructor in home economics. g""'Z Z 2 Captain, Infantry, A. E. F. Dietitian. I r Z Z Z 2 CAMPBELL, O. J., assistant professor of English. r ll-TIS. L. Ll. IUSYYUCEOI' In mL1SIC. Z Z Zi? Government Committee on Public Information, Er1glr1CCrS. A- E, F, V gt' Z Z Z Princeton, N. J. JOHNSON, W. E., instructor of English. 5 Z . , CARLETON, P. W., assistant professor of Chemistry. Seaman U- 5- N- . , . if Z Z Captain, Chemical section, washington, D. c. J ONES,rQ3,rIEgEIfjLg0YDaPr,3fCSrjQf Of Pogleal Science- Z CARPENTER, WM. S., instliiucrgor in Poiitical Science. KELSON Tj EFZAQ 1235 this glnggsggrrrrg ' Z Z 4 Base Hospital, A. . . K ' ' " ' . t' t f f h Z Z CERF, BARRY, associate professorofRornancelanguages. ELLEY' elglitrlfrggf assls an pm essor O Omg Z Z Captgmrr Chemlcal Warfare- I-'ason Omccr' A' Food Adngngtration Lecture Bureau, Washing- Z Z Z 4 . - - . . . ton, . . f , Z 2 9fHAMBER'1AfN-Eh glsxucmf In muslc' KERXN'IN, ARTHUR R., professor of military science. Z Z ZZHZZ Uma ' . ' ' ' .' . Colonel, Infantry. ZWPIQZ Zz 52 CHISHCEM' agstruqor ln pattern makmg' LENHER, V., professor of chemistrv. ff ZZ Z? Z aptain, viation. Major Chemical Service Section Washington if ZZ fi 9 CLAYTON EDW. Plant Pathology. ' ' ' Z if Z5 I ' ' I ! Zz 2 Navy , , , LEITH, PROF. C. K., mineral advisor, Peace Conference, Z' 'QZ Z3 3 CLEMENTS, C. R., instructor In mathematics. paris ,g ZZ ZZ ,Z GovrXr1rIrgCS5I,iSi?6IgUCi0f 25 Naval Academy- LIPPITT, LOUISA C., assistant professor of physical edu- if 4 ' - cation. if Z? CRAWSHAW' DL' pfofessof of manual arts' . Head Aid in Reconstruction, Base Hospital No. gg Z2 52 Captarnprlllrrlrioisb Ngtirigal Guang axd Prgiienr 365' Ar E. ph 35 ZZ fimif o ca emic ui Ing, . . rmy c oo A. A Y hr - r - - r 4 - V cg sf Z Z of MilitaryrAeronautics,' Urbana, Ill. LIVINCE-3E'rgfrrS,r5fEC In agmc engineering Z"""Z - 1 .. . 1 Z Z CUMM1N0S,gNA., assistant In agric. engineering. U. LORENZ, W, F., asgocrare professor Ofmearcmer 2 Z Zig D r E - . . , h . Major, Medical Corps, A. E. E. gi, Z Z Z AHM- .' 'I 'nstrufator 'U P. yslcs' MARTIN, LANVRENCE, associate professor of geology. 5- . Z Zig D Lri-eulgznegit, Field Artillery. Major A E F at Z 4 7 IEHL , . overnment. ' ' ' ' - - , 5 f Z 4 - - . IVIATHEVJS, J. H., associate professor of chemistry. 4 Z Z f DENNIS, A. L. P., professor of history. Y A P M - 4 D f V 1 Z gt 2 Captain- Mill'-ary Imelllgence DIVISION' War MEEK WALTER J3.aZsscic?alSe: professor of physiology. Z Z ir Z DRANE Rolgglplrarament. XI,f3?lr:i2g5QL'.ID- gg . 'Major, Chefnical XVarfare Service. D Z Z f f , 4 , Ins ruc r I- ini a me Icine. VI , C- E., f f h - n 1 y Z ' Z Captain, Central American Medical Laboratory. 1 ENDIlX5Il2Jxcl'fT,SignaI Cg?pc?SBl.Il?eaE.,I dflfiifiation. Z Z 2 A' E4 F' . . MIDDLETON, W. S., associate professor of clinical medi- 5 Z Z Z DRESDEN, ARNOLD, assistant professor of mathematics. Cine' 5 Z ZWHZZ D SOcrfllWAmerrCan RC? CYQSSI France' Captain Medical Corps Br. Ex. Forces. 2 Z Z2 2 YKEMAI . ' " pro SSSQT O muslci . . . IVIITCHELL, R. S., instructor in English. 2Z""2Z Z2 ,g Social. Commission oIr5TCEaInIng Camp Activi- private I: A gg 5Z Z5 'Z ties, ashington, . . MORG , B ' ' -' f fc 3 sy f, , . . . AR, . Q., assistant pro essor o erman. -X fl if Z2 2 ELDR1Dfi lnstruceolf m Rhyics' F M Military Intelligence Dept., W'ashIngton, D. L. EZ n leuvnant' Cast rt' ery' Ortrcss On' OESTERLE, J. F., assistant in chemistry. gZl Z2 lg 'oe' ra- , , I Chemical NVarfare Service. g gg EI-SOM. J, C-, SISSISUMIF Df0fC550f IH Dl'1yS1Cal CdUCaU0U- OTIS, DANIEL HENRY, professor of Farm Management. 5 Z5 3 Captain, Medical COYPS, FOFE I-G8VCl'1WOl'Kl"l. Y. M. C. A. Agricultural Reconstruction, Paris, Zi Z Kansas- , France. ,Z ZZ Z2 Z E-YSTER. lr A' 5-I Pf0ff5S50f Of Pl'1X5l0lOgY- - PAXON, F. L., professor of history. E2 eZ as ,Z MaJ0'- Medical Corps' UYHVCTSICY 0fWiSCOr1Sin. Major, Historical Branch, Ceneral Staff, Vsfash- 52 MadIso'n, Wis. I V ingmnr D- C. Zgwgg FERNBIERQ, L-, IUSFFUCUOF In Eflgllshr PIERCE, R. C., instructor in engineering. ZZMZZ Z f riva er I A Aviation. f f Z Z FILEs, H. Instructor In English. RICHARDS' H. 51, dean of Law School- Z Z Z 2 Medical COFPS- , War Trade Board, Washington, D. C. Z Z Z FISH. CARI- RUSSELI-.,Dl'0fCS?Of Of hl5f0fy- I h ROEBUCK, -JOHN R., assistant professor of physics. gf Z Z 3 Social. llgssaciate ibiregrtor gnfvrfbmlngrician dUrI1- Pressure Expert, U. S. Eaval Experiment Sta- Z Z 7 . 4 versi y nion, on on, . ., ng an . tiOn,NeW1,O,-,dont 0,-,rr V E V 4 Z Z FITE. A- G-. IUSUUCCUI' In ROVYIZUCC MDSUZSCS- ROUSI-I, A. J., assistant professor of agric. engineering. Z Z Sergeant- Government, Food Production War Work. gi, Z Z Z FLJLCI-IER, C. S., assistant professor of physics. SAUGSTAD, JEssE ROBERT, instructor in music. Z Z Z 2 Lieutenant. Ensign, U. S. Navy. 9 Z 2 :kr ii Z Z 5 5 Z Z 2 f Z f f , , Z gy,f,,,f,,,,,,,,,,,,,,,,,,W,,,f,,WWf,,,,,,,,,W,ffm,W,,,,,,,,,,,W,,,,,,wwf,,,,,,,,,,,,f,Z,W,,,,,,,,:,W,ffMW,,W,,,,,,,,,,,,,,,,W A ,f ,,,,,,,,,,,,,,H,,,,,,,,,,,,,W,ff,,,,,,f,W,,,,,,,,,,,,,,2 Z X Q V 5 ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, , ,,,,,,,,,,, 3 V ,,,,,,,,,,, 5 I ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, V f W A W Page 354 1 1 11, ,,,,,,,,, 11, 1,11 u 11 1, ,,,,,, 111,111 1, W,W ' 7 1 I , ' 1 1 1111 1 11111 7 7 at if if it -A' it ia 7, 4 g A ,A Q if if it af reg gr 7 7 Q7,,,111,1,,,,1,,,,11111,111,111,1,1711,,,1,,1m,,,111,11,1,17 ,W,,,,,,,,,,,,,,,,,,,,,,, 1, 'ik X! ,,,,,,,,,,,,,,,,,1f11,11,11 7,11,171,,,,,,,,,,,,,1,,,1,,WW11,1Q,z11,,,1111,,,,,L11L1,1, 7k 7 7 7 V I I . 7 ,rx AVA RVLL 1 i 7 9 ' 7 it 7 I 7 SILvERcRUYs. ROBERT, instructor in Romance lan- TURNER, JENNY, instructor home economics. 7 7 7 ff ua es S ' l T h' ' ' 4 f 7 7 S S . Q I Ocia. eac Ing blind soldiers. 4 7 7 7 Government, Belgian Legation, XVashington, VERRILL, R. M., instructor in English. 2 7 7 kg D- C- Field Signal Corps. 7 7 2 SLAUGI-ITER, M. S., professor of Latin. WALTON, I H.. associate professor of chemistry. Z 7 7 ,tg Social. Italian Red Cross. Major, Gas Defense, Engineers, A. E. F. 7 7 7 SOUCY, E. W., instructor in physical education. WESTUWAN, W- L-i DFOICSSOF Of l'1iSt0ry. 7 7 7 7 Lieutenant, A, E- FA Govcgnnsient, Bgkan States Expert. Peace 7 7 7 1 . . . . on erence, aris. 1 7 77,72 STEINAUEB' -l' Ce lnstructor m PIWSICQI educarrorr WVISE, CLARENCE, assistant in chemistry. gpm, 7 f, ,7 Chief Petty Omcer Navy. - . 1, f 7 7g 7 ' Q ' Private, U. S. Gunpowder Reservation. gg 27 7 TRILLINC, M., associate professor of physical WVITI-IINGTONJ PAUL D., assistant professor of physical 72 fi 7 I rl- , , e ucation. ff 47 72 77 XV?-if Camp C0mmUnlllY SCFVICQ- ' Captain, Athletic Director, A. E. F. 7? 7 TRUEBLOOD. CHARLES K... lnSKl'UCt0l' ln English. ZDANOXVICZ, C., assistant professor of Romance lan- if 75 1? Government, Special Expert, Bureau of XVar I guagesl 72 77 7 Risk Insurance, NVashIngton, D. C. Lieutenant, Infantry. 77 9 74 77 77 7 74 77 77 4 92 67 75 4 ff if fc ,7 H 77- X ' ' 2 if fs 4 G cl d U d if ra ucztes an n ergrfaduates 77 fi 7 41 if 72 7 fi S7 777707 Graduate Stl1dCl1llS EICKER, G-EoRCEWg 2nd Lieutenant, Coast Artillery, QMA7 7 4 I OBERTS, ARD ., lergeant, Corps of Interpreters. 7 7 7 2 ANpERs,T. L.,CaptaIn, Construction Division, Q. M.C. ROUSH- G- Aw Cflliialn, Ordnance. 2 7 7 7 BERGHOFF, CLEMONT A., Znd Lieutenant, Marines. SATTREM, ALFRED MELVIN. Z 7 7 gg BIRD, DR. FRANCIS, Znd Lieutenant, Ordnance. SCHMITTI BERNADOTTE, Znd Lieutenant, F. A. 7 7 2 BLOMQUIST, ARTHUR W., lst Lieutenant, Infantry. SCHILLETER- A- E-. Sergeant- 7 7 7 kg BOYER, D. A., 2nd Lieutenant, Infantry. SCHRENK, W. T.. Private. 7 7 2 BRUCE, HAROLD R., 2nd Lieutenant, Field Artillery SCHOP-GER. A. W.. Chemical Warfare Service. 2 7 7 CAN1-U, ABEL, Infantry, AZE, F, QCOTT, MILTON H., lst Lieutenant, Infantry. n 7 7 7 Z CONREY, GUY W., Industrial. SEARLES, CARL C., Chemical Warfare Service. De- gf 7 7 Q7 COOKE, REGINALD, British Expeditionary Forces. CESSCCI- . 7 7 7- V7 COURTNEY, OLDEN KEY, Government, Dept, of Ag' SI-IERH, D. L., Private, Chemical Warfare Service. 7, 7 7 7 COXEN, IAS. R., Government. SMELKER, W. W., Private, Ordnance. 7 7 7 7 CRANE, MILLARD, Captain, Q. M. C., A. E. F. SMITH. GILBERT, Medical CorDS- 2 7 771177 CUSTER, JOHN SHERMAN, Y. M. C. A. Secretary, Paris. SPP-HR, WALTER- Sfifgeflni- 77""27 7? 17 DANCE, BENJ. DIXON, TAYLOR, WILLIAM H., Govt., Bureau of Standards. 77 7 DAVIDSON, ROBERT M., U, S, Navy, TISDALE, W. I-I., Government Bureau ofPlant lndustry. 72 57 72 '7 DAvis, DANIEL E., lst Lieutenant, Q. M. C. TITUS, E- G.. Captain, Sanitary Corps 72 27 77 57 DAWSON, THOMAS BAiNBR1DgE, TONVNLEY, l-IOBERT C., British Expeditionary Forces. Z2 77 17 rDOPIER'ltY, JOHN A., Lieutenant, Infantry, A. E. F. VALENTINE. HOWARD. ISU Lieutenant- 127 77 47 Killed in action July 20, 1918, VAUCHN, FLOYD L., Government, Federal Trade Com- 72 73 Q7 'EICKE WILMER H. Private F. S. A. E. F.. Killed in miSSiOn. E7i 77 Eg F R action Nov. 4 l9l8. WHALINO, HEISKEL, Lieutenant, Aviation. 75 79 27 ILTER, AYMOND 72 27 77,1177 FINCH, V. C., U. S. Shipping Board. 18 750,77 7 Foasres, O. w., Infantry, A. E. F. - . 80 . I 7 7 Z FOWLER, WILLIAM' Social, Y. M. C- AA DopsON, JOI-IN M., Major, Medical Corps. 7 7 7 7 FREY, CHARLES N., lst Lieutenant, Sanitary Corps. 9 7 7 FULMER, HENRY L., lst Lieutenant, Sanitary Corps. 1881 7 7 7 GARDNER, MAX W., Government. S H , 7 7 7 GIBBS, WILLIAM M., Lieutenant, Sanitary Corps. MITH' OWARD L" Government' Qulm' Ecuador' 2 7 7 tg sGiEssil25-8 CHARLES, died at Camp Dix, October 3, 1884 7 . , , I , 7 7 7 Ho R - 7 7 7 1 sTMAN, . E., lst Lieutenant, Infantry. - - 7 7 7 t, 2 HEDDLE, JOHN R., Private, Machine Gun Battalion. RICHARDS. RAND A., Brigadier General. 7 7 HEDRICK, ARLY L., Captain, Engineers. 1886 7 7 7 -IIIEMBRE, I-IELMER J., 7. 7 7 7 oHNsoN, A. L., Aviation. BELDEN, ELLSWORTH BURNETT 7 7 771,33 KEITT, G W., lst Lieutenant, A. E. F. In general charge of Y. M. C. A. service among Z 7 75 7 KELLEY, FRANK J., Signal Corps. Officers Central War Department' headquarters, 270027 75 7 KELLY, NORTON G., 2nd Lieutenant, Artillery. Camp Custer. 55 gf 17 KOLLS, ALFRED C., Chemical Warfare Service. ' Z2 27 73 57 KRUGER, FRED O., United States Navy. 1888 72 77 IioBEIIE'I', EUoENEClntegareter,lArmy of Occupation. JOHNSON MORY B A t D. t B f T 72 E7 ff 17 EE, REOERICK ., n ustria. - , f- SS - 'rec Of. Ureau 0 fans- 'E if LOTI-I, I-IG C., Sergeant, Znd Class, Naval Reserve. Porrarlorrf War Trade Board- 77 f7 UNDY, ILBERT, 72 27 MALLONEE, Louis D., Znd Lieutenant. 1890 7 7 MEHL, PAUL, United States Navy. H C , , gg D 7, H MOORE, CHARLES E., Captam Infantry . IMICI-IE, HRISTIAN, Lieutenant, Pacific Naval Coast 5, ,7 I I ' ' I I 75 97 MULHOLLANB, L. G., Infantry. Guard- , Z7 727077 MURPHY, ROY V., lst Lieutenant, Sanitary Corps. SHEPARD- JOHN' Surgeon- Medlcal COVPS- A- E- F- 77,177 7 7 SNOBLE GEORGE B. Lieutenant Infantry. Died of 7 7 7 7 wounds July 28 1918. 1891 7 7 . . . . , 7 7 ORT, A. A., Assistant CIVII Engineer, U. S. N. URDAHL, -1-I KU Federal -I-fade Commission- 7 7 7 -kg ORVIS, W. E., Government. 7+ 7 7 7 PATTEN, STEPI-IEN, Private. 1893 Z Z 7 PECK, E. L., Chemical Warfare Service. . gt 7 7 7 POTT, ROBERT, Aviation. BABBITT, ARTI-IUR, Captain, Q. M. C., A. E. F. 7 7 7 REID, ALBERT C., Government, Bureau ofConstruction. COSGROVE, JOSEPI-I, Captain. 7, 7 7 7 CROARK EUGENE VJ. Cadet Aviation. Died In Camp, JACOBS, I-I. I-I., American Red Cross Service, Italy 7 7 October I8 1918. ROGERS, CHARLES B., Government. 7 7 1 7 7 9 f 7 if if 7 X ' I f 7i'7 Zi 7 7 711111f11fff111111111f1111111111111111111111111111111111f11111111f111111111111111111111111111111111111111111f111111111111111ff111111111f1111111111111 1111111111171111111111171 111ff111f11,-1111111111f11111111111111f1111111111111111111117 7 Q .t 7111011 1111111111111114111f11f1111112 711011111117 7111f111111111f111111111111111f111111111f11111f111? K 7 it it at if 1 f 1 1 in jk is 7 M P ag e 3 5 J' K xxx f Page 356 Q Q EQ .x.xx..x,x,,.,,x.,X xxx. ..X. N S ,x.,x,..,x.,,NxN.NxN,,N..xx..xsN,x.xx.x..,.xxx t S X QQ QQ QQQQ QQQQQQQ QQ IQQQQQ QQQQ,,.Q.QQQQ,QQQQQNQQQQQQ Q, K x QC Q Q Q Q Q Q Q16 Q Q Q Q Q Q43 QQQ Q Q U-,u.k..L..-I-yn U3 R.. Q-. Q, Q Q Ssaassmag 5? '5555'i'E:a Q Q -4-lmO?fr-r Z owzm mmoxmmr I' :E fn- W- -SN X g v--1 x 711 -mn Q Q X Q "',Iy1wv'moZ FH-new-Omg Howmym- -EW . O Fr- T. P11650 , WZ-m5"m Zm 1-:pg Q Q 30312555 5252255111 52-wwf? Qca-Z? mggjgagig 5225592 1,1225 X Q I U 1 mm. ' I",mg-J -'r WP-PZUJ oc0.+' -' -F' 'mm 'm- Q Q- Q Q Q-Pm-S-11 1'-c-Qgwp Q0-.Z O -U Q- -c-:. m -4-40 m Q-.Om 1' O' H175 L-W' C0214 Q Q Q S Eguvg m, U3 'mo' CQ- Q -,SmUL.QI 5 -I-1::gQDU m' ' 73.277 QE? ZV7I0IXm OZ-ll-4 gas' fun Q Q Q43 mmgg 2Z"r1m UC.:0z:,O: 571: ,vi Zi? 32 -Z0- "' -CTU: - ' Og OCUPU1- Q0 33- ff' ZOL'-1-1 SiQ Q Q wzw 171:-E S0 I QT... mm -QP7' Ol-47' USR-' 'mm 03 Ig --7520 H Z 75 moo- Q Q X Q rr! -4 . m77:-0:1 Z0 ,F an-n fw,,,Z1 QUE- Us Cys' 'Fm UZ U-77' RI' Q Q Q Q -lgl-50-1-' 02101: wi, 30wID'U,Q1 'ca 1 wgmm 11,-fsfffbw-Oo-r CIJ,4H1-gms' ISP' V20 SYN Qi'Q :Cr-num,-5-fn Wmjjl Tomo: mUC9f Q gnc: -1942 UE. 3'S'!'c::" 1-5" HWY' Sl- :gm QQ Q 'Q H og,-"Of,c,g' Pr-3,Z"rf 1-Sowfw --SW Z' M H: fQCmP,fv'f'1 I- 12,05 .4-'Z OU Q Q Q Q g:,'U-min' gm mm' --QQOOS' - Q5-151 -- FU' g'11ZmQ5' Ei 2-m.-mgm? Zig. 5: I . gg, 1Q.E,m3 Q Q Q Q 7JP25'E:sD' 5'mT4O-'5'W' 'F OO' ' ' O9 ,..5'2.C 0" 9,1-1 571 S03,5'3' EIS ' Q ZH5' UO'9f-- Q Q QQQQQQQ l"fn cn. om'O -'U N-CUZ mm imma 33' -1394 ' ' 3' .- -HZ 90,-, 'UD 0.-1 f-ffimii Q Q QQ :Q ,.. . C rf P-1' f-Q rv- rv P-I cn? p-A , U, g..1 V : 'U 3.4 ra. pg . , - 5.4 - 5. ,.4 ...- ,.4 Q Q 2 2-3392-5 2 2 Q11 2 Qssgi 2 ? nfvm 2, 2' 3 33,5 X5 Q nam gg SPP? 3 Q5 QQ N ' 50' N 'C 5" v-1 5"1'-"Um: o "Go Qs 0-'Z' Uoc P OVW 5' .4 'U :'H- QQ '75 'UWM 2555 535 2,529 girngspg 233 11 0 EEF Q02 P52 'A 511112. Q QQ QQ 3237 ' " SJGEUU 59, avg. E, 5'f1""D ' --0 ' 'DR m - 'S002 C'-"S ' XS ES .mo Z-3 -5-1-152 C10 92. gm ,1,,, 55,0 PZ V Q14 - QQ Q-n,..j, nl QQQQ :PEW Q ' O-U-1 v- Q-1 L4, U: DOO ' 4 -1- 0 QQQQ 'QQQQ -.-1 O :QU -U O.- m-- -:H rv Q v0 0 QQQQ QQEQ cl O -135,1 M o -ff' -U "Url - :Om -1 QQQQ , , . . pu ff w Q-Q -1. -o QQ Q Q QSQE BGSU P, 6 C 5 C- mn Su' fn QQQQ QQ QQ . gg- Q1 ?f ya .0 rv . UBL 5077 ' Q QR QQ QQ . -1 ITJ V, -Q 0 Q QQ QQ ff A m 51' 0 U, O QQ QQ 3 -1-1. . D . no X X: QQ ru . ' on QQ QQ z '11 U, 513 QE QS Y' ' : 350 'QXQQQQQQ 417 -1 QQQ-QQQ ' QQ QQ QQ QQ QQ QQ QQ QQ QQ QQ QTIIIQ 5'fTli55E:E519.3f9?Q99E??E if-5"f5'g'r?5xQEU 2??55?55Q? E? 25 f719?E?Z?255'I 415599933 ?Z55I313199?w5 QW :J-ZZ U 0 qppqn Imam-,-E '-..w- .. r- -no n 02' b Hmppoww 5 QQ SQ E-31053570 C'-I7qf:,mm:: --lm,UmU1Z7: "ZCf"V'Z0Wm 5 LL by-lE'11'5mUZ'4 Z-ct"4ZU1C1Z7Ul" ,ug-,4Z2I:73'O3' QQ QQ wpwmwfpgggmyggxwr Ziicc--mo? Cmwggizgg F, EN 4215532055 mUF'5U1gg1Q1S -:Mgr---','3,Zm5 QQ SQ '-11:41-,U 111111. Zum'-'m ,rm-45-M545 '3z0wz7"'z,,w.4 or QdUm'Qwm'Z.O Mm Wxzwg 5'1ZmZ:,'-IZ?-ff' QP QQ F' 7' Voir--4 Wlfjapb? KZFUF' -4 V -FE'-do-1717- 'Z3cm7' 0 70:9 'um ZW O -' 'EO-Wm-1 U1 QQ QQ mgrlw ..1,,. :fo O .wr ,11-- 2,.N,Lm zz Ozm,-O gow-, 212 ,1.g.gm mizfff 119, cn ,,,-1 Q,1,111O Q QQ QQ M- 'Z ,U wZUg" .1 M1-,OZ Z- o o1Q07',U :sm -1--wryyoff . mcvwz' O, -IS'-OO' :9. QQ Q2 QQ -r-' Q03 m"4- 3,-I'- UCUIUF - -1 1- Fw O' z' fm- UJQ. 1- O aa. fx H49 FQ-002' puldrv U U1 2-.zmmmfvawc QQ QQ QQ -I-Q0-1 'Zhi-mm: Q- 1:0 mwom . mrm. -mm Qrfw.-, 'UOr-U, xmqmxm V ,111-.C -ago-Com ,Wg QQ QQ QQ mmg- ,U -gmc w C-n Ispmn :CW 211 .71-I Dx Om ,---on-1:-.11--. z,1FmE-4 1 Q.,,,-wZr,,. QQ QQ QQ Qmw .'-75. IPI:-I wx 5511 win- U- r11E--- ,HO -1 PU 0. QM '0:Z .c-Q m Z m:V'. o-I., - QQ QQ 2"E,v'D2Q'?w'WOS.1 Z H1 554-Svgwff' Qmm-of-Ez-T9 P2 '5'SQ1wE0ZQ4FPmCu.40Z' 00 z.453g,Q?1Dn W0 1.gn-1'lZQg'gEgf"2oCQg.2C2 gmwznga " U1 .4 305- 2305,-ff gs fgpcqgzgpogggn Q: - SQQWEE O-:17,,2Q-7111105 QQQQ Q 2 1 . -- C . -' L-' J zu f-f na rn Nl., ...rn Q'-U 'za 5 QQQQQ QQ QE aw 5OfLS'P12o1O89f1-2 U- 2 9--- --wwf wmv: - vw- ' 5 .NEP Z mg-1 PEI 4 wma- 5 QQ QQ QQUUQ' Ssmgc- ,Dngmw ,022 22 0 22- 35. 11.5590 OO oagf 74' 1.--!'4OP,:Z -C: - me, Pg- o - 5--Q-. Q5 55 FS 'if'-45 -1:3459-D-'r : NG: mrn 5 rr-4--5' gif" 5 ' J :WEP P--P' ' Q'-mn 0" O--1' F102 Z TIHQUP Q Q 5. . 1 -1 H, . -.QQ Q -:LI ,cha O- 3, . N ...Q. QQ QQ :OH OP- mc -Pmnlj P-' 'Oc-qi --S ff P" -'-- PU, f'5?m-- 1-1 O-4 09- -1 C 03,51 my rf- N n-I Z P ,.. 2 bf' n-I 33E:TZ9mx?f"Zmp?fQL,2?, 2 Qg.1',3m2'ig153 5, 3 ggggmgv glgggni Q3 gg 5"57n5'p22ffulffJ5'1n,2g Pg mgifg 3 325 5,3 2333.2-E gg QQQQ Q Q -DMT 'f'-nn-"' rm -Q1 - r-,mr - cn MQ -1 - ul 5 Om 1- 5--mm H wg ---.mfvp .w cn--2'--w Q Q Q Q 1030 "r1K- --O'T1m KTI- 5 Q iff-1: ,.. ::5O33,B QQRVE. 3, ...' 'fm bali- 3--0 O- Q,-R115 Q4 -1 Ng "' W:-'W Z5 Q Q Q Q j:.o,,Q .mOru.,, x In Fflmqmmj, 5 ww-5 555 52 gg -1-,---3 mmzgfflgm o J-5 14 mp 5 om' ru Q Q X Q 4 r "C 'UPS ":- 's :SIS O -- Qc 0 O-0' -F' " fn' -W, "' ""'5fvf' Q Q Q 'W 71 asf 5, 55 23252 sw QQ-GQPPQ5 2021 H325 3 if Q Q Q Q Q Q Q . mm- 5 f'-1 3:03. 'Q S -P - '-. -. fl no :mag 0 -rwofv 'N -1'- 0 Q Q Q Q '-2 No-2 m-5 Fri- -4 P D, 2 -n '11 0930 -WS' P3 0' 5"'T70- 3' 75 o Q Q Q Q 'TWIN 'USN 'pf' 'gp' 5- mm -fn 'U '52 of E. 'U "' m ' '5' 'V -1 QiQ QtQ ..-1 gf.,-1 www 1-1 O- -1 -1 B, UO M150 HE, DQ N m Q- U Q Q Q Q Q4 .-W 2, -' P -m rn S-n P11 Q nh-1 5-49.3 - F- - D- 0 w Q Q Q 'Q ' 53' 'Um' CTI . - - - ' V' -'Q4 305- IP Q-1 fn 0 Q' Q Q13 P F1-sg, 0- - fri 5 'D - ---M ' Hn, . F' 7' 5 QYQ Q Q V - Q. 3-f, -n - 71 71 . P1 mf m gm W Q Q Q Q -nm. Q. , O -- 0 . m 'Tl 511 Q Q Q 'Q U1 v KT! 7' U1 0 "' SPN ' QQ Q A1 P1 Q V 2.1 W fn Q Q ' 4 . I cn- n ru 5 Q Q Q Q Q Q xi Q 4 X N Q X Q..,Q..,,.,QQQ, QQQ. A 1 N ANmmQQQQQQQQQQNQQQQQQQQQQQQQQQQQQQQQ QQQQQQQQ.-QQQQQQQQ..QQQ...Q.Q..QQQQQ XQQQQQQQQQQQQQQQ-.QQQQQQQQQQQQQQQQQQQQQQQQQQNQQQQ X Qlfx-ml-wa-wgxqmgi Q 1+1+1++'Q A Qywgwgf Q Q wrfilrwx- Q 5 1 , 5 5 I S I 1 4 xxx f W ,,,,,,,,,,,,,,,,,,,, W, ,,, ,W ,,,,,,,, W ,M 4 N, M, W W, 4 , 4 11 'lr at ir 'Ar -k ir ,R if wk .Ay J, ,A .5 4 Z i 7,,,,,,,,4ff,,,,,,,,,,,,,,,,,,,,,,,,,,,,W,m,,,,,,,,,,,,,A ,,,,,,,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,,,,,,,,,,,,,,,,,,,, 4,WW,,,,,,,,,,,,,,,,,,,,,,4,,,,,,1,,,,,,,,,,,,,,,,,,,z,,,, Z 7 4 7 7 4 4 TNVNVR RVL L 4 4 7 4 4 7 7 4 4 7 4 if 4-k 4 7 4 4 7 7 4 4 7 7 4 4 7 4 if fi' 4 4 4 . 4 7 7 4 MILIS J M LANGE FDNVARD Ph " l D' - A Y M C A 4 7 f 1 . , . ., I , - , ysica Irector, rmy .... A f Z MONTGOMERY, H. S., lIst Lieut., Balloon Corps, A. E. F. LESLIE, J. W., Znd Lieutenant, Aviation. 2 Z Z 4 MORTON, CHARLES, Lieutenant, Infantry MEANWELL, WALTER E., Captain, Medical Corps. 4 Z Zig EASE, CEIDEIIA, ECIAL, A. EIR. A E F IIyIitiiaasiAi,JIgP., Lgeutenant, A. E. F. 5-kg 4 4 ELSON, HARLES ., Zn ieut,. nanny, . . . ATIWICK, ergeant. 4 7 Z QICHTER, Iljieutenant, IAvK1tioxn,IiX.IE F. IEICHARDSJ, MORRIS, Captain, Infantry, A. EI F. Z 4 4 AROENT, . ., ieutenant, . ., W . . -. OBSON, AMES 'LEXANDISR, Lieutenant, In antry. 4 4 Z 2 SIMON, EDWARD M., Captain, Ordnance. SOHERER, ANDREW C., lst Lieutenant Ordnance. 2 Z 5 2 VAN ZANDT, JEROME G., Y. M. C. A., A. E. F. SHERMAN, WILLIAM G., Infantry. 4 Z Zymgg WALLER, FRANK, Social, Director ofMuSic. SIMONDS, l'lERBERT R, Captain, Engineers, A. E. F. 3544045 gf WILSON, R. W., lst Lieutenant, Aviation, STEFISEN, Du LYMAN, Lieutenant, Medical Corps, Gen- ZZ Z5 52 YEXVDALL, J. A., eral Hospital, Manchester, England. gf if 45 ZZ STORER, DAN, Sergeant, Medical Corps, A. E. F. ZZ '7 74 4 1908 SWENIIOLT IIELMER Captain Engineers 4' 'Z H ,, . . I - . . I , I . I XI 3 A E P O WNBUTTLC' FWQAVIECE 43 gi BBOTT, LLIS ., overnment. ILLE, Ouis ., . '. . if 2x Z2 22 ANDERSON, VICTOR, Lieutenant, Field Artillery. WALL, JAMES I-I., Ensign, U. S. N. ig BAKER, H. W., I 4? Q4 BALCH, J. NV., Captain, Iznginecrs. 1910 gg gg gg EALSLEYIII-IENRYIE., Lieutenant. Engineers, A. E. F. A O III C 7. Z4 ENTON, OMER Lieutenant, In antry. Lwoop, M. J., Sergeant of r nance, lst lass. 45 if BLANKENAGEL, JOHN C., Infantry. AMEN, l'lAI'lI..AN, Aviation. gi COLBURN, GUY, Y. M. C. A. Secretary. ARNOLD, EDWIN B. Znd Lieutenant F. A., A. E. F. gg Zami? EOLLINS, IERTI-IUIR L., IPIrivate,xlnIIgaiItry. IQ-rwooDDMARIgN I9IrtlCnanXeeS A E F f 1 OULTER, OHN EE, ajor. I-. . AILEY, ANA ., . . ,I .A. ecretary, . . . f f Z 2 SCROWE, GEO. D., Sergeant. Died of influenza at BAKER, EGBERT EUGENE, Captain, Dental Corps. 2 Z Z g C Camp Mills. L II M C BARKER, D., U. S. N. I I 5 g 4 A4 UDAHY, MIcI-IAEL, lst icutenant, lx. V- . BEEOHER, DENJ.,I..ICL1lCI'12lI1L, n antry. 4 4 Z EISQUE, R. C., CapItlainAAviationiieetion Signal Corps. IBELL, HERBERT C., Lieutenant,AA. LL. F. 2 'kg 4' 4 LLSNVORTIHI, PAUL ., viation. . Ii. F. BELSKY, C. J., Znd Lieutenant, A viation. 4 4 Z FISHER, AUGUST, Liesutenant, Infantry. BICKEL, H. L., lst Lieutenant, In A. 2 7 FLOETE, FRANKLIN G., BOON, LEONARD, U. S. Sl-.ipping Board. f 3 7 fi GAEBLER, I-lANS,U. S. School of Aerial Photography. BROCI-IENSRATER, HERMAN. 4 f 7 7 4 . . 4 X 7 Q GILLISPIE, JAMES E., Lieutenant, Engineers. BREVVER, JOHN D., Iflajor, F. A. A. E. F. g Z Z if GRAFF, B., Captain, Engineers. Cl-IAMBEIKLAIN, G. W., Engineers. 4 ji Q GRONERT, TIrIEO, G., CONICEY, C. D., JR., Ist Lieutenant, Infantry, A. E. 3 g Q 4 HOOD WM. F. Infantry A. E. F. CSRAVEN, ALEX R., Znd Lieutenant Artillery, A. lg.. I-. Z 5 gum? JOECKEL, CARLTON B., Captain, A. E. F. CROWELL, GEOROE G., Lieutenant, U. S. N. 5 g 22 JOHNSON, J. CORNELIUS, Private, Infantry, A. E. F, DAVIES, F. E., Ilnfantry, A. EI lr. Zgnmgg Z2 ,Z KEMP, WALTERJ., 2nd Lieutenant, F. A. DAVIS, DAN, Lieutenant, Engineers. ,gg gg gg 22 KENNEDY, FRANK M., Major, Aviation. DAVIS, L. W., Captain, Engineers. lgg gg KRUESI, FRANK E., Lieutenant, Infantry. DONNELLEY, EMMETT A., Major, F. A., A. E. F. gg Z3 54 IIEUENTIEI O. O., lX6I:ajciII-, g.nI5Iineers. FREEMAN, COURTNEJ D., IIIst Ilft., Infantry, A. E. F. I4g gg fi 47 OTH, ERBERT ., . . . FUCIK, IROBERT A., 'cast rti ery. 44 Z4 LUDER, ARTHUR FRANK, Infantry. GILMAN, ALEXANDER, 2nd Lt., Engineers, A. E. F. Z3 gf jg 42 LUEDERS, AUGUST HENRY, Medical Corps. I CLICK. G. A., Metrolog. Section, Signal Corps. 42 Z3 gf MATTHEWS, W. W., Graduate Pilot, Aviation, A. E. la GRAEISER, FRANK JOHN, Hospital Corps. 36 jgwjg NELSON, O. H., Lieutenant, A. E. F. I HARD, WALTER, Government. gg Q 4 REHN, W. A., Znd Lieutenant, F. A., A. E. F. HARNES, WM. W., lst Lieutenant, Q. M. C. 4044447 Q 2 SKINNER, JOHN S., lst Lieut., F. A., A. E. F. HIDEARD, CLARENCE, Psychiatric Unit, U. SI N. g Q Z 4 SMITH, C. A. I'lOLONSCI-IIED, ROBEllT, lst Lieutenant, Engineers. Z Z 7 fi SOREY. RAY, Lieutenant. RACCONNEL, L. S., Lieutenant, A. E. F. I 4 I 5 g Z QIPAYLOR Base I-loRpiEalFA. E. F. IIQXIAARTIN, IEIEELMAR G?O.UClgenIQIical Warfare Service. 5 'f' Z 4 4 ROOMAN, ., ngineers, . . . UELLER, EOROE ., . . . 4 f Z WALMSLEY, S. M., Lieutenant, Cavalry. I NAFFZ, CARL, Lieutenant, Infantry. 2 f Z 5 ig FWALLBEIX, HILBERT C., Captain. A. E. F. Killed in NANCE ARCHIBALD Ordnance. g Z Z Z action, Aug. 21, l9l8. NOIKTHRUP, I'IARRY C., Lieutenant, Infantry. g i, 7 6 4 WIEMANN HENRY, Lieutenant. PIERCE, J. A., Captain, Engineers. I 4 Z WOLFF, HERMAN W., Corporal, F. A., A. E. F. REBER, I-IUOI-I J., Znd Lieutenant, Coast Artillery. Z Z 2 PLAMONDON, GEO., Sergeant, F. A., A. E. I-. I Z Q 4 1,909 RICHARDSON, W. D., lst Lieutenant, Infantry. 1 Q yI"'4f NET, EORCE, n Ieutenan , n antry, . . '. HIPLEY, . -i ., aptain, n an ry, -. . '. 1, HI, 77 A O 2 ti L4 t I f A E F SCHULTZ'gDAlINCW" Cavflrf' t A E F 4 7 Zi E2 BALL, EDWIN,Q. M. C. SI-IOREY, RAY, lst Lieutenant. 'IZ fg gENSON,V9UY, W C M CI I C A I: SKINNER, JOHN SHARISI Zcridflcigutenant, A. E. F. fi if ISSEL, AYNE ., aptain, e iea orps, . R. F. STAFFORD, H. S., Y. . . -. ervice. 12 5 4 if BOETTCHER. ARTHUR, U. 5- N. I THIESSEN, F. C., Shipbuilding Board. gg 22 BURRITT, CHAS. G., lst Lieutenant, Engineers. VAUGHN, J. RUSSELL, lst Lieutenant, Infantry A. E. F. fi Z2 CARTER, FRED, Medical Corps. WATSON, C. F., lst Lieutenant, Engineers, A. E. F. gi gg gg CENFIELD Field Hospital E. F. WI-IEELOCK, GEOROE R., U. SIN. I I I ,Z 72 Z2 COLEMAN, A., Captain, Engineers, A. E. F. WILLIAMS, FRANK E., Captain, Military Intelligence 52 5? Z2 ,Q CONLIN, WM., lst Lieutenant, Infantry. Board. 52 Z5 if CUDAHY, JOHN, 2nd Lieutenant, Q. IM. C. WOODIIOUSE, E. J., Lieutenant. gg 57 DAVIS, JOII-IN J., Lieutenant, Aviation, A. E. F. 2? fi " F . ' l A. . '. 'Z ' Fgxiifb, Siiiiey, 5.i5aLgSf5if5nt, C.. A. E. F. ' 1911 Z Z FISHER, BOLAND F., Medical Corps, A. E. F. ALLABEN, GERALD R., Captain, F. A., A. E. F. 4 Z Z 4 GAPEN, CHARLES E., U. S. Food Administration. ARNOLD, EDWIN B., 2nd Lieutenant, F. A., A. E. F. 6 Q Z g GARNER, HARRISON L., Captain, Engineers. BATCHELOR, ROGER P., lst Lieutenant, A. E. F. 4 ,i Q Z GAYTON, OSCAR, Industrial. BATZ, RUPERT J., Lieutenant, F. A. Z Z Q 3 GLAETTLI, J., JR., Engineering. BELLACK, KARL O., 2nd Lieutenant, F. A., A. E. F. 5 I Q Z GRAEBNER, GEO. J., Lieutenant Colonel. BENTZEN, F. W., Sergeant, AI. E. -- g f Q Z 'g HARVEY, H. V., Sergeant, A. E. F. BICKELHAUPT, CARROLL, Major, Signal Corp, A. E. F. 5 g 5 HEISE, GEORGE W., Captain, Q. M. C. BICKELHAUPT, WM. VERNE, 2 f Z Z g IIQIOGAN JAMES M., 1-t Lieutenant, M. G. F. BLAOKEERN, PALIIL, Hospital Corps, A. E. F. 4 Z 4 4 ESSENIcH, HARRY, Lieutenant, Infantry, . . I-. BLAKE, ARRY, ieutenant. 2 i 4 4 'ke 4 4 f 4 1 X 4 4 4 7 4 +4 4 if 4 I 4 4 I 4 4 4 7 f 4 4 7 4 4 4'k 4 f ' ' 7 X . ? ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,,.,, 2 I W , U, , ,,,,,,,,,,,,,,,,,,, ,,,,,,,,,.,.,,,,,, , X wm7 Page 357 Wf4'f:IZZ75lW 1111 11111111114 X f 4 f Zi' Zi' 4. 4 1 4444 5 4 4 4 xx A .Wx X , N' if W xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx xxx 4 5 4 4 5 4 4 xsxsxx S xxx 4 4 4 4 Z 4 4 41982 5 4 I 4 4 f 4 MP4 f 4 4 4 4 4 444444 44 '4 4 4 7 4 4 4 4 f I 44 44 4 ,4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 44 f 4 4 f f 4 4 ,if 4 gt 4 Zi' I 4 4 4 5,4 ff fi 4 4 4 X I 4 4 4 4 74 fr 4 4 4 4 2 2 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 N xxx 1 if 'k if A 4 . 4 444444444444 4 44444444444444444444444444444444444444444444,44444444444444A 444444444444444444 4 4 44,441 4414 if SSRRRRRRSRRRRSR Ss Rx SS St ' af xxx RVN VR BLATZ, RUPERT, Lieutenant. BOYLE, WM., Captain, A. E, F. BREW, H. M., Lieutenant, A. E. F. TBRIGHAM, STEPHEN O., killed in action at Chateau Thierry, On August 3, l9l8. BROWN, TIMOTHY, SR., Lieutenant, U. S. N. BRUE, H. N., Engineers, A. E. F. CORP, CHAS. I., Captain, Sanitary Corps. COSTELLO, MARK O., Sergeant, Aviation, A. E. F. Cox, TIMOTHY BROWN. CROWNS, ARTHUR, Lieutenant. "'CURTIN, FRED, Died of pneumonia. DAWSON, CHARLES, Sergeant, Hospital Corps. DOERR, HENRY, A. E. F. EDMOND, HARVEY, Lieutenant, Aviation. ERNEST, FREDERIC A., Sergeant, A. E. F. FLINT, ALFRED T., Lieutenant, Q, M. C. GOGCINS, I'IUGl-I. GREENE, J, H., Infantry. HAACK, T. T., Adjutant, Aviation. HALVERSCHIED, R., Infantry. HARTMAN, RALPH C., Lieutenant, A. E. F. HARVEY, WILLIAM, Lieutenant. HILL, CHARLES R., Znd Lieutenant, Aviation. HOWE, W. C., Lieutenant, U, S. N. HUTCHINSON, F. P., Lieutenant, F. A., A. E. F. JAASTAD, H. O., Sergeant, Infantry. KIRCH, ANNA, Government, Internal Revenue Dept. KLEINPELL, ARTHUR, Hospital Corps. KLUND, E. J., TLAMPERT, 'SASAES B., Colonel. Died in France, Jan. 13, l l . LEWIS, LEON L., Captain, Infantry, A. E. F. MCMAHON, F. B., Lieutenant, Medical Corps, A. E. F. MGMILLAN, C. L., lst Lieutenant, Infantry. MACLAREN, A. R., M. M. lst Class, U. S. N. MANN, KARL, Sergeant, Ordnance. MEYERS, IRWIN A., Captain, Q. M. C. MORRIS, GEO. LEE, 2nd Lieutenant, Infantry. NORRIS, HAROLD H., Research Chemist. "'MUELLER, BENJ. H., Lieutenant, lnfantrv, A. E. F. Died of Spanish Influenza Oct. 3 1918. MURPHY, PETER, lst Lieutenant, A, E. F. NELSON, EMIL, Corporal, F. A. IXIICKELL, G. H., lst Lieut., Engineers, A. E. F. NOYES, HASKELL, Lieutenant, F. A. OCHSNER, ALBERT, Medical Corps. PFEIL, PAUL F., Aviation. PIERCE, MAURICE, Diplomatic Service, Russia. RICHARDS, ARCH E., Private. ROBERTS, HIGH I-I., lst Lieutenant. ROSS, WALTER C., 2nd Lieutenant, Ordnance. RUSSELL, WM. SCHMIDT, HERBERT EDGAR, Captain, Engineers, A. E. F. SCUDDER, CHARLES M., Captain, Engineers, A. E. F. SHAW, L. J., lst Lieutenant, Ordnance. SLADKY, ALEX., Captain, Ordnance. SLATER, P. B., Lieutenant, F. A., A. E. F. SPITLER, W. I., Lieutenant, Infantry, A. E. F. STANLEY, STEWARD W., Major, C. A., A. E. F. STEPHENS, ANDREW. TAYLOR, HENRY STERLING, Medical Corps. TEMPLETON, KENNETH STUART, Ensign, U. S, N, TENDALL, R. G., Captain, Infantry. THUE, M. J., Chief Petty Officer, U. S. N. TINDALL, FLOYD G., Asst. Surgeon, Medical Corps. VAN CLEN, THOS. C., Znd Lieutenant, A. E. F. WARREN, DAVID M. WATSON, R. D., Engineers. WECNER, ARNOLD A., Aviation, A. E. F. WIESE, OTTO, Chemical Warfare Service, A. E. F. WILSON, SYLVESTER, Captain, Engineers. WINTON, OTTO, Lieutenant, Medical Reserve. WILCOX, HOWARD V., A. E. F. WINHOLT, W. F., TWINTER, OTTO, Lieutenant, Medical Corps, Harvard Medical School. Died of pneumonia, Wash. June, 1918. 1912 ABERG, WM. J, P., Government, London. AUSTIN, EDWIN C., Lieutenant. BARCLAY, A. J., lst Lieutenant, Engineers. BILHEY, H. E. BLOMEYER, ROSCOE, Engineers, A. E. F. RVLL BOARDMAN, R. P., lst Lieutenant. BRIGHTMAN, GRANT, Sergeant. BROKAN, V. S., Master Engineer, Engineers, A. E. F. CHAMBERS, CARROLL, Major, Infantry, A. E. F. CLANCY, LESTER M., Aviation. CULBERTSON, H. E., U. S. N. DAHL, EDWIN O., 2nd Lieutenant, A. E. F. TDALEY, FRANK, Sergeant, Field Hosp. Sanitary Depot, A. E. F. Died of Wounds, NOV. 20, l9l8. DAVIS, DANIL., Captain, Q. M, C. DAVIS, JAMES E., Captain, Infantry, A. E. F. DEBBINK, HENRY L., Znd Lieut., F, A., A. E. F. DUNNEWALD, PAUL W., 2nd Lieut., F. A., A. E. F. DRUMMOND, T. B., 2nd Lieutenant, A, E, F. DUFFY, FRANCIS R., Captain, Q. M. C. FARNHAM, W. E., Naval Aviation. FOERSERF HARRY R., lst Lieut., Medical Corps, A. O FOSTER, FAYETTE, Sergeant, Coast Artillery Corps. FRAZER, GEORGE. GREENXVOOD, A. E., Sergeant-Major, Artillery, A. E. F. GRIFFITH, W. H.. Captain, Engineers. GIKOTOPHORST, CARL, Engineers. HARSHAW, MYRON T., lst Lieut., Infantry, A E. F. HEADLAND, OSCAR, ' HOGAN, DANA, Engineers. HOLMES, DONALD S. XHOYER, T. R., Znd Lieutenant, Infantry, A. E, F. Killed in action,July l8, 1918. IESEN, HERMAN L., Private. JESSUP, NVALTER E., Lieutenant, Engineers, A. E, F. JOHNSON, ED. E. KADISH, HALBERT L. KELLDG, THOMAS. KEPLINGER, L. B. KING, RALPH, Engineers. KNEELAND, M. D., Y. M. C. A. LAUGHLIN, EARL C., Bureau OfStandardS. LAXVRENCE, JAMES, Captain, Chemical Warfare Service LEVITAN, ESTHER, War Risk Bureau, Treasury Dept LEVITAN, MORTIMER, U. S. N. LILLY, L., American Red Gross, France. MCGRATH, C. B., Major. MCQUAID, JOSEPH JOHN, A. E. F. MANN, WALTER, Znd Lieutenant, Aviation. MARSH, L. K., Lieutenant, F. A., A. E. F. MAYER, G. F., Q. IX4. C. MEARS, GEORGE S., Private, MERKEL, R. H., lSt Lieutenant, Aviation, A. E, F. MILLER, GLENN, Signal Corps. MUNRO, DANA G., 2nd Lieutenant. NASH, LEO, Accountant, War Department, France. NOER, OYVIND J., lst Lieutenant, A. E. F. NoRcROss, E., lst Lieut., Aviation, A. E. F. NORSEMAN, EDGAR, lst Lieutenant, A. E. F, ORTON, WM. R., Captain, Infantry, A. E. F. PALMATIER, HORACE, F. A., A. E, F. PETERSON, F. P., Aviation. PIERCE, M. XV., Lieutenant. PINTO, RENE NV., Znd Lieutenant, A. E, F. PLEISS, PAUL, Lieutenant. PORTMAN, ANDREW N., lst Lieutenant, F. A., A. E, F POTTER, CLIFFORD B., RICHARDS, ROBERT, Lieutenant. ROGERS, HOXVARD, Lieutenant. RUEDEBUSH, HANS, Sergeant-Major, A. E. F. SCHNEIDER, MARTIN. SCHREINER, ALF., Private, infantry. SCHROEDER, W. H. SCULLY, JOSEPH FRANCES, Lt., Medical Corps, A. E. F SIMPSON, HAROLD G., Aviation. SIZER, RANDOLPH S., Sergeant, Infantry. SKINNE, ROGER D., Field Ambulance Corps, A. E. F. SNYDER, CLARENDON S., A. E. F. STENGEL, A. L., Government.. STEVENS, ELBERT C., Y. M. C. A., A. E. F. STOPPENBACK, FRANK E. STORER, HAROLD W., lst Lieutenant, F. A., A. E. F. SULLIVAN, WILLIANI K., Lieutenant, Infantry, A. E. F 'TAPPING, W. G. THOMPSON, WILLARD C., Medical Corps, TOBIN, EDMUND PETER, Q. M. C., A. E. F. TOEBAS, OSCAR T., U. S. N, TRAYER, GEORGE W., lst Lieutenant, Engineers. VEERHUSEN, H. H., Lieutenant. XVALTER, J., lst Lieutenant, Engineers. fflfffnffrlfffffn1111ffffffffffffffffffnffzffuffffffffffn:ffffnffffffffffzfffffffffzffffffffff1Ifffffffffffffffufffffffuffffffffnfffnfff 1fu1ff1fffffffnf1111111111furfarff1141114-fuffffffffffffffff1nfnffffnfffff11111111111 4 ,.,,,,,,,,,..,,,,.,,,.,.,,,,,,,,,,,, , .,,,,.,,.,.,, , .,,,,,, ,,, .4 , .. ..,,,,,,,.,,,. , , i, .t ,k 4. , , A if if if f' if 'k 'Av 'A' 'k X . f 4 l Page 358 """ 'N' W 4 44444444444444. 4 4444444444444444444 K 4444444444444444444444444444444444444444444444444444444444444 N xx 4 4 4 4 4 2 4 4 4 4 4 E E 4 2 4 4 4 4 4 4 4 4 4 4 4 N X . ,ar 4 4,4 X 4 4 4 4 4 4 4 4 4 4 4 4 4 k xx 4 4 4 4 4 4 4 4 4 I 444 4 4 4 4 4 4 2 4 4 4 4 4 4 4 4 4 4 4 4 I Zi 4 44: 4 4 4 jx 44 Z4 4 fr 4 X 4 4 4 4 4 4 4 4 4 4 4 4 4 m 444444 444444444 4 4 4 4 4 4 4 4 4444444444444 4 4444 44444444444444444444444444444444444444444444444444444444 A 44444444444444444 Irgywwwww , -A- t if Q 74444 441 i' i ii 4444 4 'v44A FXVNVR WASI-IINCTON LAWRENCE Zncl Lt. Aviation A. E. F. XVASSONMJOSEPI-1, Captain, Engineers. WEBSTER, E. M., Lieutenant, A, E. F. XVEIR, JAMES H., lst Lieutenant, Infantry. WVESTPHAL, W. C., lst Lieutenant, A. E. F. 'IXIVETI-IERBY, L. P,, Australian Imperial Forces. Killed in action February, 1917. WIEBOLDT, E. F., Lieutenant. XVILMOT, MRS. ADA I'IOPKlNS, Statistician for English Food Administration, London. England. WVHYTE, MALCOLM, Lt., Engineers, Archangel, Russia. WILLIAMSON, ROBERT C., Znd Lieutenant. WILSON, L. K., lst Lieutenant, Aviation. WVITTER, Lieutenant, A, E F. VXIOLF, JOI-IN, Ensign, U. S. N. WOLF, VJERNER P., 2nd Lieutenant. XVORTH, PHIL D. ZNVEMER, RICHARD, Lieutenant, Q. M. C, 1913 ADAMS, CHAS. L., Sergeant, Artillery, A, E. F. ANDERSON, EARL A., Lieutenant. ANDERSON, FRED, Captain, Infantry, A. E, F. BAKER, PAUL E., Lieutenant, Aviation, BALDWIN, RAY L., Ist Lieutenant. BALLARD, ROSCOE F., Private, F. A. BARRETT, GEORGE A., Red Cross, A. E, F. BEANS, HAYT E., M. T. C., A. E. F. BEEBE, GORDON A., Lieutenant, Engineers, A. E. F. BILKEY, H. EDW., Social. War Recreation Board. BOHNSON, VAN LOREN, Captain, Engineers. BOISSARD, RICHARD, Mobile Operating Unit, France. BOULWARE, JUDSON POWELL, lst Lieutenant, M. C. BRADY, L. J., 2nd Lieutenant, Engineers. BRIGHT, G. N., BRIGHTMAN, HERB., Lieutenant, Machine Gun CO. BRINTNALL, P. C., Sergt., F. A., A. E. F. BRONVN, D. A,, Surgeon, Med. Corps. BRODESSER, R. A., Ist Lieutenant, C. W. S.. A. E. F. BUETELL, ROGER. BURNET, GILBERT, Aviation. CAHILL R, H. lst Lieut. C. A. C. A. E. F. CARTER, HOMER M,, lst Lieutenant, Medical Corps. CARY, CLARENCE, Hospital Corps, CONNELL, J. J. CURTIS, EMERY B., Aviation, DAVIS, H. A., 2nd Lieutenant, F. A., A. E. F. DAWLEY, PAUL. DICKENS, RIDDELL, F. A., A, E. F. XDILLON, HARRY, 2nd Lieutenant, Infantry, A. E. F. Killed in action. DOWNING, S. K., lst Lieut., Aviation, A, E. F. DUNNEWALD, PAUL W., A. E. F. D.YE, JOHN, JR., 2nd Lieutenant. EASTHOPE, STANLEY R., Infantry. ELLIS, CHAS. W., Ambulance Service. ELLIS, GUY T., Ensign, U. S. N. ENGLISH, NORMAN, Lieutenant, Aviation. EVANS, JOHN, Ensign, U. S. N. A. FARLEY, THOS. J., Ensign, U. S. N. FARRAND, 1. W., Sergeant, Engineers. FITCH, W. R. FOULKES, HOWARD T., Lieutenant, A. E. F. FRARY, PAUL V., 2nd Lieutenant, A. E. F. FRASER, E. M., Ist Lieutenant, Engineers. FREUND, CARL, lst Lieutenant, Medical Corps. FREY, ROBERT R., Sergeant, Engineers, A. E. F. GEHL, EDWARDJ., Lieutenant. GEORGE, MARSHALL W., Znd Lt., Aviation, A. E. F GORDON, STANLEY, 2nd Lieutenant, Artillery, A. E, F GRIFFITH, GEO. P. GROON, SAMUEL B., 2nd Lieutenant, , GROVES, ASA B., Lieutenant, F. A., A. E. F. HANSEN, JOHN E., Lieutenant, F. A., A, E. F. HARRISON, STANLEY, Aviation. HEINZ, ADOLPH, Infantry. HEISE, HERMAN, Lieutenant, Medical Corps. HOOO, FRANK VICTOR, Chaplain. VLA IQEFFER, RALPH, Aviation. KIRK, STANLEY B., Covernment, KIRIQ, WM. E., U. S, N. KLIEEORTH, ALFRED, Lieutenant. KNAUSS, GTTO A, KOCI-1, VINCENT, lst Lieutenant, Medical Corps. IQUHNS, GEORGE R., Aviation, A. E. F. LAMPERT, B. H,, Lieutenant, Engireers. LAMPERT, HAROLD M., 2nd Lieut,, A. E. F. LARSEN, H., Lieutenant, Engineers, A. E. F, LAWRENCE, MORTIMER M., 2nd Lt., Aviation, A. E. F. LESTER. JOHN KING, 1-lospiral Corps. A, E. F. LEVIN, ISIDORE, Private, Chemical Warfare Service. LEWIS, LEON, 2nd Lieutenant. LEWIS, -1-1-IEODORE, Lieutenant, Infantry. LOCKEN, ENOCH, A. E. F. MCCONNELL, C. F., Sergeant, Hospital Corps, A. E. F. MCCRORY, WALTER, MCEACHRAW, W. W., 2nd Lieutenant, Aviation. MCFARLAND, M. F., Aide, Pershings Staff, A, E. F. MCGRATI-I, R. D., Captain, Ordnance. MCKAY, JOHN GORDON, 2nd Lieutenant, A. E. F. MAOILL, DONALD G., lst Lieutenant. MAPLE, D, R. MAREK, FRANK B., Ist Lieut., Medical Corps. MARKS, HARRY CARL, Hospital Corps. IVIARTIN, JAMES G., Sanitary Corps, MILLSPAUGH, JACK W., lst Lieutenant, F. A., A. E. F. MOORE, HINMAN, Ordnance, A. E. F. MOORE, HERMAN. MORGAN, LYNN, Captain, A, E. F. MORCENORTH, A. S. MULHOLLAND, O. S., Private, A. E. F. 'MURPHY, WALTER, Lieutenant, Infantry. Died Oct. 13, 1918. NOYES, EUGENE C,, Field Artillery, A. E. F. PARMENTIER, D. M., Captain, Infantry, A. E. F. 'PECK, HELENA P., Yeoman, Died at Washington, PETER, A. G., lst Lieutenant, Q. M. C. PETERSON, BASIL. POXVELL CHARLES HEALY Red Cross Service A. E. F PRIBNOW, ARNOLD F., U. S, N. PRITZLAFF, JOHN C., Lieutenant. A, E. F. RAIN, ERLINC. O., Lieutenant, Med. Corps, A. E. F. RATTER, JOSEPH C., Aviation, A. E. F. RAVN, E. O., Lieutenant, Medical Corps, B. E. F. REARDON, R. S,, Research Div., C. W. S. REBER, H, J., 2nd Lieutenant, Coast Artillery, A. E. F REIS. ALVIN C., Captain, Balloon Corps, A. E. F. ROBERTS, W. C., Lieutenant. ROWLAND, MARGARET, Red Cross Unit, A. E. F. RUNKEL, EDGAR E., SCHMIDT, ERXVIN RUDOLPH, Captain, M. C., A. E. F. SCHNEIDER, ANDREW, lst Lieutenant. SHEA, C. P., Social. Field Sergeant of K. C., A. E, F SHEA, EDMUND B., 2nd Lieutenant, F. A., A. E, F. SHEFFER, RALPH J., Sergeant, Q. M. C., A, E. F. SHERIDAN, JOHN E., lst Lieutenant, A. E. F. SHOOP, SIDNEY, Lieutenant. SIVGER, ALLEN W., lst Lieutenant, A. E. F. SLAGSVAL, OSCAR, Lieutenant, A, E. 1-. SLICHTER, SUMNER, F. A. "SMITH, EARL, Sergeant, Camp Zachary Taylor, Louis- ville, Ky. Died Oct. 13, 1918. SMITH, R. M., Lieutenant, Infantry. STAVRUM, SIGVALD. STIVERS, CHARLES PAUL, Lieutenant. TAYLOR OHN Lieutenant, Royal Field Artillery ,J . - XTHOMPSON, CARL, Lieutenant, A. E, F. Killed in action, Oct. 1918. TOPE,-OLIVER E,, Sergeant, Infantry. TRUITT, ALBERT C., Q. M. C, TURNBILL, ALAN JAMES, Corporal, Engineers. TWITCHELL, EDWIN. TVAN RIPER, JOHN, Lieutenant, Chemical Warfare Service, A. E. F. Died Dec. 27, 1918, WATTAWA, JOHN, Attache, Am. Leg., The Hague. WEBER, HENRY, Infantry, A. E. F. WAHL, F. R., Lt., Aide-de-Camp, Infantry, A. E. F. WEIL, EARL, Private, Ordnance, I'-ifiitil wt wk R S26 gr sw Sir N . R N Nl' R R X E! gills R R RSD SE Rs RS Rs Ss Xt Nt Ns gs XE SSR Rs R: Ss xxus 'gyms Rs Ri R: Rl ss R9 R: ss S S R My ks . R sit Q . it N sw N gi S gl' R 'NM HOPKINS, W. T., Ensign CAsst. Payrrfasterj, U. S. N. HORNADAY, WALTER C., 2nd Lieutenant, Infantry. HOSKINS, MARK H., HOUSEHOLDER, G. M., Lieutenant, HUGHES, ROBERT D., lst Lieutenant, Ordnance. JANISCH, HAROLD, U. S. N, JOHNSON, ROBERT H., lst Lieutenant, F. A., A. E. F WENDT, C. A. WHITNEY, E. N., Engineers. WILCOX, FREDERICK, Lieutenant. WOLLIN, ANDREW A., lst Lt,, A. E, F. WOODWARD, S. C , Aviation, ' YOUNGMAN, FRANK N., Lieutenant, Infantry, A. E. F 41111444414444444444444f4ffz44441111111114111110111144114f14a4f4444444f44ff414444444444444444f444444144404444414444444444444444104444444444444444444444444444444444444414f4444444444444444f444444444444444444444f444444f4444444444444411 1 444444444444444444444444444444444444y4444444444444 y444444444444 444444444444444444444444444444444444444444444444444 W Page 359 "U """"""' 4444 4 444444 4 4 4 44444444444444444 4 4 i' W if i' if W 4444444444444444444 I 4444444444444444444444444444444444444444444444444444444444444 ffffffffffffffffw . ,,,,,,,,,,, Ziftftty Z Z f-iii-ki'-kg Z 4,,mf,1fm,11Md,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, , , mm, offfmffffwfnfffffffwwfffffflfffmmmffwfffffwf, Z Z 4 15 4 2-ks: Z 2 Z f A Z . 2 Z Z Z 1914 - HENDRICKS, J. H., 2nd Lieutenant, Engineers, A. E. F Z Z I 3 HICKOX, SAMUEL S., Government. 2 Z Z ALEXANDER, A. HADDEN, lst. Lt., Aviation, A. E. F. HOFFMAN LESLIE Radio Section, Signal Corps. Z Z Z ,ig ALTER, FRED. HOWARD, NEAL F., lst Lieutenant, Sanitary Corps. 3 Z I Z ANDERSON, STEWART, Lieutenant. HOUCHTON, LOU, Engineers. Z Z Z Z ANGLEBLICK, R, C., lst Lieutenant, A. E. F. HUBBEL, WOLCOTT W,, Znd Lieutenant, A. E. F. g Z 'tg ARMSTRONG, R. N., Znd Lieutenant, Infantry. JACKSON, HELEN HUNT, Social. Y. M. C. A., France. Z Z Z Z ARNEMANN, GEORGE, Major, F. A. JACKSON, SYDNEY C , A. E. F. Q Z Z 2 BABCOCK, F. G., Ensign, U. S. N. -JAMES, HERBERT H., lsr Sergeant, Coast Artillery. Z - Z ZZWZZ BACHHUBER, LEOJ.. Ensign, Paymaster, U. S. N. JENNETT, RAYMOND, 2nd Lieut., Infantry, A, E. F. fg"'fgZ Z5 gg BACON, VAUGHN, Znd Lieutenant. Aviation. JONES, ALEXANDER, Hospital Corps, A. E. F. gg Z2 BAILIE, J. M., 2nd Lieutenant, Infantry. KELLEY, P. J. 522 Z3 gg BAINERIDCE, ARCHIE, Lieutenant, A. E. F. KEITT, G. W., Captain, Chem. Warfare Serv., A. E. F. 5 Z2 EAIRD, A., Et Lieutegaiat. C EEMP, SALPH, Cosrporal, Z gZ 3 5, AKER, EO., aptain, a oon Orps. ERR, PENCER, viation. - . . . 9 if Z2 BAKER, Ross, Chemical Warfare Service, A. E. F. KIMBARK, H. R., lst Lieutenant, Machine Gun Co. Z1 Z2 Z7 BARNETT, V. V., 2nd Lieutenant, Infantry, A. E. F. KINNE, B. I., Government, American Legation. Berne. V ZZ 1: M - f ff Z5 55 BASSETT, NORMAN D., KOESTER, C-. F., Lieutenant, A. E. F. 9, Zg gg BAUM, G. K., Lieutenant, F. A. KRANZ, I-IERMAN E., Engineers. Z, ZZ Z2 gg BECKER JOSEPH A. Infantry. KRESS, JOHN, Lieutenant, infantry, A. E. F. I2 ig BENNETT, FRED C., 2nd Lieut., Aviation, A. E. F. LAMPERT, BENJ., A. E, F. IZ, ZZ ZZ BERNARD, BURCHARD P., Corporal, Ordnance, LAMSON, FRED W., Private, Infantry, A. E. F. Z' Z5 gg BICKELHAUPT, IVAN A., Captain, Engineers, A. E. F. LAYMAN, KENNETH F., Captain, Infantry, A. E. F. Z ZZ Z5 BLACK, BENJ., Hospital Corps, LEVY, EDMOND G., Corporal, F. A., A. E. F, ZZMZZ Z "" Z BLANDING, JAMES L., 2nd Lieutenant, Infantry. LILLARD, PAUL, lst Lieutenant, Infantry. 2 Z Z 3 BLANDING', VIRCII, L., Lieutenant, Infantry. LOBDELL, W. L., Aviation. Z Z Z Z EOUCFIEIEJLDZ Igvliation, A. E. F., Italy. ESXVRY, L., Enggneers, ACE. F. C M h D d Z f 4 OWEN, . ., n ieutenant. I ACH, DNVARD, ergeant, amp uster, ic . ie g Z Z ix? BOYLSTON, JOHN W., U. S. N. of pneumonia, March, 1918. 2 7 Z 2 BRADISH, R, P., Znd Lieutenant, Infantry. MCCONNELL, STEWART D., Aviation, A. E. F. 2 Z BRANT, C. W., Lieutenant, F. A. MARKHAM, BURTT J., 2 Z Z g BRAYTON ARTHUR, Sgt.,Medical Corps, A. E. F. MARTIN, J. A., Znd Lieutenant. 2 Z Z BRECKENBRIDCE, WM. L., lst Lieut,, Engineers, A. E. F, MENNINCER, K, A., Asst. Surgeon, U. S. N. Z Z ' g BREWER, EVERETT R., Lieutenant, Aviation. MILLARD, M, B., lst Lieutenant. 2 Z BREWER, JEROME S., Sergeant, Hospital Corps. IVIILLER, GILBERT A.. Private, Signal Corps, A. E. F, 5 ,Z Z' Z ERICGS. ALIIEAN, Eggiriieers, C I MILLERLWVINI. Engineer? 2 Z f 4 RINDLEY, ENJ. ., ieutenant, ava ry. ISCI-I, OUIS ., Ospita orps. 4 X Z Z BRUCE, MALCOLM, lst Lieut., Infantry, A. E. F. IVIONTGOMERY, E. B., Yeoman, lst Class, U. S. N, Z ,WZ Zgfffgg BRUM, LESTER F., 2nd Lieutenant, Q. M. C. MORGAN, LYMAN J., Captain, Tank Service, A. E. F. 2' Z3 gg EUEHLER, EMIL, Private. MORRIS, VICTOR, Captain, Engineers, A. E. F. Z Z2 Q2 BUNDY, HARRY, lst Lieutenant, Medical Corps. MORRISON, ELTON K., Lieutenant, Infantry, A. E. F. lg Z2 gg BUSER, ARNOLD A., Sergeant, Infantry, A. E. F MURCAN, L. J,, Tank Service, A, E. F. Q5 ,ZZ Z2 gg CAMERON, M. REGINA, Am. Red Cross, France. NIYRLAND, ARTHUR L., Assistant Paymaster, U. S. N. ,gg Z2 32 CARPEINITER, IEUSSEIFL H., Captain, Aviation. 'NELsON, JOII-GN, Lieutenant, Infantry. Killed in ac- Z2 gZ fg 2, ,A5E, ARRY ., n antry. tion, ov. 20, IQIS. if if Z2 Q? CHRITZMAN, CEO. M., lst Lieutenant, NELSON, N. A., Lieutenant, A. E. l-'. Z3 'CLARKE,,BRUCEAW., Lieeuttsjg-Ent, A. E. F. Killed in IIGIEWNUGAN, D.GH.,CA. E. F.I I A E F xg 11 actwn On uausr , . YE, AMES ., aptain. n antry, ' . . -. Z2 if ZWMZ COBAUGII, HARRY, lst Lieutenant. O'CONNOR, A, J., 2nd Lieutenant, Aviation, A. E. F. fffffffg Z Z COE, NOBLE M., lst Lieutenant, F. A. OFSTRIC, HAROLD S., 2nd Lieutenant, Infantry 2 Z Z g CANARD, HAROLD M., A. E. F. O'HARE, BERNARD, lst Lieutenant, Medical Corps, ' 2 Z Zig CONELY, CHARLES L., Infantry. Otiveiz, JOHN, Coast Artillery. 5 Z Z . 3 CONSOER, ARTHUR, Lieutenant. OTJEN, CHRISTIAN, Captain, Infantry, A. E. F, 2 Z Q CORK-EY, JOHN, Lieutenant, Ordnance, A. E. F. PELLETTE, ARTHUR, Lieutenant, M. G. Bn., A, E. F. 3 Z Z ig COUNVIN, LEO V,, lst Lt., C. A. C., A. E. F. PETERSON, O. P,, Lieutenant, Aviation. Q Z 2 CRILE, DENNIS W., Captain, Medical Corps, A. E, F. POMEROY, H. S., Engineers. Z Z Z-gg Ciwwett, JOSEPH A.. PORTER, CLAUDE T., Captain, F. A., A. E, F. AZ Z ' ' 3 CUMMINS, JAMES A., Lieutenant. PRIESTER, HENRY C., F. A. 2 Zi Z DALLWIG, H. C., Chem. Warfare Service, PROCTOR, JOHN. 2 Z Z 2 DAUBE, D. O., Quarter Master Corps, PURCHASE, R. T., 2nd Lieutenant, Aviation. 3 Z Z DAVIES, JOHN P., Lieutenant, Aviation. QOALE, MILTON N, 2 Z Z Z ISAVIS, IgllARgI.1aIXijI.,I?nd Lieutenfant, F. A., A. E. F. REBER, L. E. Z Z ywffw AVIS. A ., fl iwlletlelnt. - viation. REICHERT EDNVARD E. Lieutenant. 1. Z if H D W, . ' ' 1f""?f fx 19 EMMINC, AYNE. REPLINGER, ROY L. f, gf DEWEY, ROBERT S., Znd Lt., A. E. F. RICHARDSON, L. H., Zntl Lieutenant, Infantry, A. E. F. ig DICKSON, CARL G., . - ROBERTS, G. F., 2nd Lieutenant, Field Artillery. 3 Z5 DOANE, RALPH Lieutenant, A., A. E. It ROBINSON, BYRON L., Nledical Corps. Z gg E DOECE, KARL. Lieutenant. Medical Corps. RUBIN, VICTOR, Lieutenant, Infantry. 1 Z2 gg DOHR, JAMES, Lieutenant, Ordnanqe. RUNDE, RALPPI T., Sergeant-lvlajor, A. E. F, 2 gZ EESNERIEIJRI. SCFECRUEESEEVK-ill COFPS- glUSCH,IL-IAIRRYLF., lst Lieutenant, Infantry. 5 gZ fg 44 l -. UEIUCCFS. - 'A - ANDS, . .. ieutenant. 2 ZZ ELLSWORTH, CHARLES W.l, Lieut., A. E. F., FYGTICC. SCI-IELY' PERQY' F, A, f Z2 ENCSBERC, R. W., Zrld LlCLltCr'lal'It, A. E. F. SCHADYJAME5 ALBERT, 2' Z? ERICKSON, KENNETH, lst Lieutentant, F. A., A. E. F. SCHMIDT, FREDERICK J., Hospital Corps. 3 ZZ Z2 if FENN, CLARENCE, Captain, Infantry. SCHWTT, H, Cu Ayriation- Q if ZZ Z'-MA? S581 BA LIS'-XCEEIVE. F. A.. A- E- F- gEYMOURCI-ELEN, American Red Cross, Washington. ZWIMZ , , , . ., via Ion ,... HAFER' , , 1 Z 2 GELATT, ARTHUR, Lieutenant, Infantry. SMH-H, KENNETH BU 2nd Lieutenant. 2 Z Z Z GETTLEMAN, N. F., 2nd Lieutenant, Engineers,A. E. F. SORENSON, E, DW Amlgulance, g Z GILLIS, JAMES P., lst Lieutenant, Marines, A. E. F. SOOTAR, DOUGLAS RW Hospital Corps. Q 2 Z Z Z GODFREY, ALFRED LAURENCE, lst Lieutenant A. E. F. SPERRY, CARLTON, Lieutenant, F, A., A. E. I-. Z Z Z EABERMAN LUCIUS- Emlgflr U' 5- N- STAFFORD, R. R., Field Artillery. 3 Z Z ALE, MERLIN C,, Lieutenant, Grclnance Dept. STAUVUEM, S. A., lst Lieutenant, Infantry. 3 Z Z .tg HARPER, C. S., lst Lieutenant, Medical Corps, A, E. F. STEVENS, BERRY T,, Infantry, Z Z Z EQYESjJ.RB.,IEnd Lieutenlhantni AAEEFF SSTEVENS, S. S., Private, Inlfantry. Died in France. Z Z Z 5 AD, . ., ieutenant, . ., . 4. . STRAUBEL, C. W., Field Artilery. 4 iZ 7 i? Z Z 5 i,Z Z 3 2 if 6 ii? 2 Z Z r Qfffffmffffffffm1ffmfffffffffffffffffffffffmffffffffgffffffffjfffffmffmffffwwff113ffffffffmwg,ffmffffff?1ffff,,mnfmff1fff,WwwW1wwfmyfm1Wmffmmf0111111111121ff',muffwfffffffffffqfi Z ! I ,,,,,,,, ,,,,,,,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,,,,, 2 L ,,,,,,,,,,, 5 r ,,,,,,,,,,,,,,,,,,,,,.,,,,,,,.,,,,,,,,,,,,,,,,,,, Z 'li' ir ai ni if ir ir ,,,,.,. , -it it if ir ir ik RZ I Page 360 W, 4 44,0440 4,44 . 4 4 ,,,,,, Z 4, gf A Ag f if if I 4 it if if if if ik Af Z tZW,4444,444,441,,m,4,4,4,,,,,,4,44,,4,,44W,,,4,4,,,4,,,A ,,,4,,,,444,,,,,,,,, 4,,4,4,,,,,,,,,,4,4,4,444444,4,44444,44,,4,,4,f,,,,,4,,,,,,,,,Z qt f 4 ' 4 Z rxvnva RVL L 4 4 4 if 4 4 kf 4 4 4 4 f 4 Z 6 4 4 4 4 4 if 4 4 iz 4 4 Z Z STREHLOXV, R. R., 2nd Lieutenant, F. A., A. EF. ELLIS, F. C. Z Z Z tg SULLIVAN, DAN T. ELLSWORTI-I, CHARLES WEST, Sergeant, Engineers. 2 Z Z THAYER, CHARLES, Ensign, U, S. N. FAVILl.E, JOHN. 2, Z Z tg rl-HXVAITS, FRED G., Artillery. A FIEWEGER, T. E., Znd Lieutenant, C. A. C. Z Z Z TORMEY, ALBERT R., lst Lieut., Medical Corps, A. E, F FLODEN, F. J., lst Lieutenant, Infantry, A. E. F. 2 Z Z 4 TROTTMAN, NELSON S., Lieutenant. FOOO. HUOH M., Lieutenant. Ambulance CO., A. E. F. 2 if Z Z VANCE, PRESTON T., Field Artillery. FOSTER, WILL A.. Captain, Infantry. Z Z Z 4 VAN CENT, C. E., Lieutenant, Field Artillery. GELEIN, EDWIN, Captain, Infantry, A. E. F. 3 Z Z Z VAUOI-IN, DON, Lieutenant. GILBERT, A. L.. Private, Ordnance. Z Z Zgwgg "VINCENT, JAMES, Lieutenant. Died in Camp. G.I.LE'FT, JAMES MONROE, 2nd Lieutenant, Ordnance. 411444, Z WAITE, OAKLEY, lst Lieutenant, Infantry, A. E. F. GLASPELL, DEAN, Captain, F. A. 5 eZ Z3 44 WVALKER, GORDON. GLASSNER, WM., Sergeant, A. E. F. Z Zi 22 WALLIS, JOHN L. GLEICIQE, HARRY. 2 QZ Z4 42 WELLER, DAN BRONVN, A. E. F. GOLIJShilI1'l'I, E, L., 2nd Lieutenant, Engineers. 2 WETHEREY, BARON R., A, EEF. GRAEWIN, ROBERT, Lieutenant, A. E. F. Z EZ Z5 gg XVI-IITE, IRVIN ARNOLD, lst Lieutenant, A. E. F. CSRAI-IAM, XVALLIS, Private, Marine Corps. 2 Z5 gg WVILMOT, LEMUEL ALLAN, Major, Canadian Battalion. GIlI3ENE, l'lONVARD, Major, Engineers. Q ZZ Z2 YEWDALE, RALPH BAILEY, Sergeant, Machine Gun Bn. GREGORY, CBMOR, Lieutenant, Aviation. Z Z? 1915 f'IAI.I3Yl,il'IAR1Ii!'f lirivate,IAk E. F. A - 2 ZZ ff if 'ALL, "RED ., st ieut., n antry, .E.F. Z Z! Z5 52 HALL, RAELVILLE C., lst Lieutenant, Aviation, A. E. F. 2 ZZ ADAMS, HOXXVARD A., 2nd Lieutenant. HALSTEDLJAMES, Lieutenant, Signal Corps. Z Z4 QDAMS, NXILLIAM gielultenant. Infaigttriv, E. F. lIjANER. l'AJ., UPS. IC gg x2Mj4 LBERT, RTHUR ., n ieuteriant, . . 1. . ANSEN, LVIN ., igna orns. Qmjf Z 'Z QLLEN, CI-IESEER, Istllfielutenant, A. A E F IIIIIARDIN, 23ddLieuteE?nt, Qviation, A. E. F, 2 !Z f 4 LEXANDER, OSEPI-I ., ieutenant, rti ery, . . 4, ARTER, .V . ., r nance etac ment. 4 f Z 2 BAILLIE, JOSEPH M., lst Lieutenant, A. E. F l'lAUMEIlSON, CLIFFORD C., A. E. F. Z Z Z BARRETT, GEO, A., Am. Red Cross, France. HAYDEN, VAN B., Znd Lieut., Aviation, A. E. F. 2 Z Z EASEY, Liellitc-:nant.U S Y IIZIEALD, IEOXVAIEJ Igwlilind Lieutenant, A. E. F. Z Z f 4 EMIS, ALTER, nsign, . . I . EATI-I, -ARL ,... 4 f Z ig BELLOXVS, HARRY H., Lieut., A. E. F. HEDOES, ROBERT, U. S, N. Z Z 5 BERGER, Louis S., Ist Lieutenant, A. E. F. HEEFRON, DONALD, Znd Lieutenant, Infantry. 2 Z Z BICKEL, JACK, Private. I-IEIDER, HARRY B., 2nd Lieutenant, A. E. F. 2 Z 5 BIRD, BYRON, Construction Section, Signal Corps. HEINECKE, WALTER W., Lieutenant, F. A., A. E. F. Z Z Z ig EISHOP, GEOIEGE M., ghei-nicalIWfarl'are Service. I:ilI2MENxvAY, H., Axationld A Z f' u, OLLENBECK OSEPI-I ., aptain, n antry. ENDERSON, RTHUR A ., st ieutenant, w viation, 4 4 Z Q BLAKNEY, GEORGE P., lst Lieut., Ordnance, A. E. F. HENDRICKS, CSENEVIEVE, Government. 2 Z Z 5 BOUCHER, C. K., Aviation. HENRY, LEVI L., Aviation. 2 Z ERADLEXI2 WM. R.BMo.unted Military Police. ' IQIOOINS, DENALD Hblst-Lieut., M. G.rBn., A.AE.g.F gg""3Z gg gg RAGG, ENDALL ., ieutenant, ILDRETI-I, ICHARD .. ieutenant, n antry, . . '. 42 if Z2 'BRAINERD, GEO. EARL, Sergeant. Died Of pneumonia HILDRETH, WM., Field Artillery, A. E, F. Z5 gg an October 6, 1918, at Camp Taylor, Louisville, IFIOAO, CI-E+.RLESvxD.,2Sggeant, Infantry. 1? if y. ODSON, RED ., n ieutenant. 42 sf Z2 BRECKENRIDGE, W. L., Lieutenant. HOLDEN, E. D., Aviation. BRESHNAHEN, GEO. T., Athletic Director, Camp Grant. HALLEN, EDWIN, Y. M. C. A. if if EREWER, THUEOW, llsxt Lieutenant, F. A., A. E. F. HOOD, W., 2ngLieutei1agtLA. E. F. F A 3Zl fi gg RITTINGHAM, . J., - viation. OOC, HARLES ODGE, n ieutenant, . . gi QA Ziyi? BRODDA, F. W., Sergeant. A. E. F. I'lUMPI-IREY, KENNETI4, Lieutenant, Aviation, A. E. F. Z2 gZ Z Z ERUOE,IlgfIALcOi.iigALieutenant, Infantry. SUTCHINEJNRE. H., Ist Lieutenant, A. E. F. ZMJZ 4 UDIG, RED, a io. LIOHES, . . 4 Z 2 BUELONV, EARL F., Hospital Corps, A. E. F. HYDE, WILL C., Lieutenant, A E. F. Z Z Z BULL, BENJ., lst Lieutenant, Infantry. JACKSON, JOE, 2nd Lieutenant, A. E. F. Z Z Z 5 BURNS, THOMAS E., lst Lieutenant, Engineers. JENES, HAROLD, lst Lieutenant, Infantry, A. E. F. Z Z Z , BURNETT, GILBERT W., Znd Lieut., Aviation, A, E. F. JENKINS, J. F., Private, Z Z Z ig CARPENTER, MILTON, Zncl Lieutenant, A. E. F., Russia JOHNSON, ARTHUR N., Lieutenant. 2 Z Z CARTER, RUSSELLJ., lst Lieut., Infantry, A. E. F, JOHNSON, D. P., Aviation. Z Z Z fg FCARY, GEO. A., Aviation. ' Killed in airplane accident, JOHNSON, FRANK E., lst Lieut., Ambulance Service. Z Z ' Z Kelley Field, Nov. 8, 1918. JONES, DONALD K., Znd Lieutenant, F. A., A. E. F. Z Z EATLIN, ERA M., Znxd M. C., A. E. F. EONES, IFIRED Rx5I3uI3L,dGLOvernment. F A 2 1 fp ' HAPIN, SUGENIE ., . . . ONES, UCH ., n ieutenant, . . , , f Z Z CEHASE, PAUIHW., Znd Lieut., Aviation, A. E. F. EEEAHMER, EXDJWARE C., Infagtry, A. E. F. 2 Z f 4 ASSERLEY, . AMMLADE, M., ergeant, viation. 5 f gyfffji COHN, MORRIS S., Private, Aviation. KEDNEY, HENRY S., 2nd Lieutenant, F. A., A. E. F. Z Zi Q3 CONNELL. EDW J., Lieutenant, Ordnance. KENNEDY, MARTIN THOS., Sergeant, A. E. F. gZ""2Z Z4 gg CONOVER, FREDERICK L., Major, Sanitary Corps. KIDDER, CHAS. J. FZ EZ ZZ SONRAE, POWELL, lst Lieutenant, A E. F. IIEILE, R. 1gndlLieIutenant, Engineers. ,g if OON, . . ITCI-IEL, . ., st ieutenant, n antry. 9 5 Z5 CORNISH, MYRON, Sergeant, Aviation. KLOTZ, C. H., Ordnance Inspector. 24 Z2 gg CRANDALL, J. S., Engineers. KNAPPEN, RUSSELL S., Lieutenant, Engineers. ,j gZ Z2 ERUAIPKI1-XJRTIIlJR Ng., lieutenant. ENIOHTLI MINNE ACNEB Vga?xIDepartment. 4 if 22 AVID, ILLARD ., VlaElOI'1. OOH ARRY, nsigri, , , -. , gZ Z2 gg DEAN, HARRY C., Sergeant, Infantry, A. E, F. KUMM DAVIS Corporal Machine Gun Bn. 5 ZZ ZZ DETIENNE, EARL, Naval Aviation, LANGLEY, THORPE M., Lieutenant, Infantry, A. E, F. 2' gd Z2 DICKSON, H. W., Aviation. LANV, H. B., Aviation. Z, Z2 DIETZ, DELMAR L., Q. M. C. LESTER, ROBERT GAYLORD, lst Lieutenant, Infantry. 22 gZ Z4,,,,gZ EIXON, HUNITETLIAP V E A EINGVOLBD, C. - g2,,,2Z f 4 OOLITTLE, . ., rivate, ngineers. OOMIS, . . - 4 f Z Z DOWNEY, FRANK E., Zncl Lieutenant, C. A., A. E. F. MCATEER, J. R., Coast Artillery. 2 Z Z Z DRAVES, A. R., Sergeant, Infantry, A. E. F., France. MCGINELY, EARL A., Lieutenant, F. A. 4 Z Z if DULON, L., Aviation, La Fayette Escadrille, A. E. F. MCKAY, ROBERT C., F. A. 2 Z Z 'DUXBURY, LELAND R. Died at Great Lakes ofSpanish MCKAY, JO!-IN, 2nd Lieut., Infantry, A. E. F. 3 Z Z influenza. MACHOTKA, J. F., Private, Aviation, A. E. F. Z Z 3 'EATOUOH EMERY, Sergeant, Infantry. Gassed on MANLEY E. P. 2nd Lieut. Engrs. A. E. F. 5 Z Z E Sepalo 1918. G IXIZARSHALII5, HONVAIPILI? Pi, Alyiation. Z f . Z DMONDS, RAWFORD, overnment. ARTIN, ATRICK ., st ieutenant. 4 f Z Q EISEL, T. G., lst Lieut., Chem. Warfare Serv., A. E. F. MOFEATT, HAROLD L., 2nd Lt., Engineers, A. E. F. Z I I f 4 9 4i:4 f4 4 4 4 4 4 fi 4 if Z 64,14ffmfffffffffffffffmfmff44144444441414,444fffffffgggfxfzgzZmffrzjzxzggfgjfzgff 454744f44f4m,44,,444,,,4 4 W4 fffwffffffffffffffff 4,4444,4.444444,444444414044444444144444ffffwffffmfl Z 4 i if if at t if if ,,,,, , ,,,,., , ,,,, , ,,,,,,.. ,,,, , ,,,,,,,,.,, , if ir ir if if if if 4 M Page 361 S mx S 5 4 , ,, . W, M ,,,4,,4,,, w,,,,,4,,,,4,,, , w Z . if it Z .1-if ,,, Z i t tr It i t t Z X f 5 fffffffnfn, -f 1111 X Z 7 7 Z f if FNVNVR R VL L 4 4 4 4 4 4 4 4 4 4 Z 4 4 Q 4 f Q4 4 f 4 4 4 4 f 4 4 f Z 4 4i Z Z 4 4 Z Z IXXIORAN, MICHAEL D., lst Lieutenant. ' 1916 Z Z tg MOORE, ROCER E., Instructor in Mathematics for 3 Z Z 3 Light Artillery at Camp Zachary Taylor, Louis- ALEXANDER, ALISTER, 2nd Lt., Cavalry, A. E. F. 3 Z Z M ville, Kyw Digd October 2, 1918. A E QLMON, C., Engineers. A E F 4 , 4 OOREHOUSE, M. LFRED, Medical Corps, . . F. LVORD, . C., lst Lieutenant, . . . 4 4 Z Z MOSES, E. W. AXIDRAE, GEORGE l-l. J. 2i,Z Z tg MUMMERT, MAURICE M., Private. ANDREW, EDXVIN L., 2nd Lieutenant, A. E. F. Ag Z Z Z "MURPHY, HENRY Died of pneumonia April 3 l9l8. APPLEYARD, G. S., Captain, F. A. Z Z Z g NEUMAN, LAWRENCE. AYRES, A. O., Captain, Engineers, A. E. F. g Z ZVWZZ NEUPERT, EMIL, U. S. N. BARRETT, N. DATER, Aviation. Z,,,,,,Z EAPELKAFC. J., Zndgieigenant, Eggineers. A E F XBARTIJETT, WILLIAMJGH, Diedgrorn ipinlal meningitis, Z2 54 ARDEE, RANKLIN ., ergeant, ngineers, . . . an. 28, 1918, e erson arrac s, O. 43 ,Z PARMENTIER, D. M., Lieutenant. BASH, F. E., Ordnance. Z5 PASSMORE, ERrc W., Chief Boatsxvains Mate, U. S. N. BECKWITH. RALPH M-,Serizeanl Z2 22 PEACOCK, K., Lieutenant, Medical Corps. BEHRENS, P- E., Znd LIC'-1ECn6nE. A-. A- E- F- gg Z5 PF151-ER' FREDERICK W, BENEDICT, FRANK W., Zfnd Lt., Signal Corp, A. E. F. Z5 ZZ EOOILIXCI. Yg.,ILieutenant, Infantry. QENISH. CPFC- Aa, Zigi' LICUKCYEUC-tl Zi ,Z OSS, , 4, leutenam, ENNETT, HOMAS DMUND, via ion. Z2 Z, 4 PROCTOR, ROY, 2nd Lieutenant. 3ERME. CHAS- Rn Q- M- C- 'g E4 Z2 ,2 RASMUSSEN, JOHN P., Lieutenant, Engineers. BEF-RYMAN,,BR0WNELL, 2nd Lieulenanl- 25 ZZ 'Z RATH, FLOYD CECIL, Sergeant, Medical Corps, A. E. F. BERTELINC, C- N.. 2nd Lieutenant- ZZ Z3 'g REID, J, WU Signal Corps' BEYERS, ARTHUR E., 2nd Lieutenant, Infantry, A. E. F. gg Z2 ,Z REUTER, EDW- C., Infantry' BEYERS, BERT J., 2nd Lieutenant, A. E. F. Z2 gZ I I , K ' r ' ' ' I ZZIMZZ REYNOLDS, EDXVARD S., Captain, M. G. Bn., A. E. F. Bl-0ECHl?Rt RAY- 2nd I-ICUUSUSHI, Infantry- Killed in ZZMZZ I 4 R F A action on July 30, 1918. 4 X Z 4 RICH-1-ER' REDERICK ' BOCART FRANKLIN B Med'cal Corps 7 Z 4 4 IEGER, HARRY W., Ordnance. i '- , ' ' 4 f Z Z ROACH, PAUL, Znd Lieut., Aviation, A. E. F. BOHN- RM-PH My Indusfflal- Z Z Z Q9 ROBINSON, P. K., lst Lieut., Infantry, A. E. F. BOLLMAN' C' C" Lleumngm' Infantry. . 3 Z Z Sono,-F, MEKERIELI S ' Eggarg, QLEEJRIEED B., lst Lieutenant, Aviation. Z Z f 1 , - , . . Z Rgiiitmiq Eciietnmtnt BOYLE- RUTH M. Y- M- C- A-. Frame- Z Z 4 ' ' " - ' BR XNDENIBERG EARL W Y M C A 4 Z Z 4 ROGER? LESTER C., 2nd Lieutenant, F. A., A. E. F, BRQNT 5 A Hoqpxal dems - - - 3 Z f 'ff OOT, oss. f 1 - -- - ' - 4 if Z 2 SANBORN, FREDERICK, Lieutenant, Cavalry. EFINK' SISANT-EY-, InfamfY- A- E- F- Z Z . ' SCHAAL, ALBERT A., lst Lieutenant. ROWN - FH Lleufenam- 3 Z SCHMIDT' W" Aviation' A E F EEZESQEEEABER S Ensit-n U S N Z Z 2 CHOEPF, EO LAWRENCE, F. ., A. . . - ' - -r 1 ' f ' ' 4 Z ZZMZZ SCHOOL, ALBERT A., lst Lieut., Medical Corps, A. E. F. Ft A" A' E' F' ZWMZ Z5 gg SCHROEDER, CARL, Lieutenant, Infantry. EUR ' 'HQJRACE Z5 42 29 SCHWARTZ, GEORGE M., 2nd Lieut., F. A., A. E. F. NHAM' ' 4? 24 f f - B H W l f 4 If Z? si SEEMAN JOHN Sergeant Hospital Corps A E F URN5' - A' n army' . 4 :Z 42 26 SELLS JVACKSOILIJ lst Sergeant Infantry BUTTERBAUGH' GRANT' Afmy Field Clerk- 22 YEZ SIMMONS JOSERHE lst Lieut Medical Corps A E F CAMPBELL' MEREDITH' Prlvate' Medmal Corps' ff 'EZ I , , ., ., ,... . ,I 5 Z2 EEFITATLEIEDRCIAEIRQILIMER Lieutenant CEQESE1-fxiIAE'l:'IEQiI"allT'lagt' . I Zg gy ' ' - ' ARLSON, AVIDI ., n ustria gg Z? ZZ gal-'QEIIZEEEEQIATLCBN W., Zrid Lieutenant, A. E. F. CARPENTER, ELBERTY U- S' N' A E F ZZ 5 5 1 , - V fi 5 Zeng? STEARNS, I'lARRY,l lst Lieutenant, Infantry, A. E. F. EQEEQQA'fgg:ncfIi,?-FlgLEHI5gg?55P?:2i'pQnKingb ' ' ' Z Z STEELE W. S. Lieutenant, Infantry. ' . ' ' ' ' 5""' Z Z 4 STEMBLER F L. Znd Lieutenant A E F CARTER' VINCENT, AVIQUOUA Z Z Z Z STWERS E RMMON Sergeant ' ' A ' EASSERLY, HEALNIRY Lnliiengtenant. QOIEI. C. A E F Z Z Z tg STOFFEI: ARTHUR Aviation I-IICKERINC, LFRED. ergeant, r nance, . . . Z Z X ' ' , ' . . if Z 2 STOLTZE, NORRIS S., lst Lieutenant, Infantry, A. E. F. CLANCY' JOHN F ' Qylamon 3 Z Z it? STONE C H lst Lieutenant Signal Corps A E F SLARKE' LQLE C'wleuEfl,?am' IW f 5 - 3 if 4 4 ,, ' ' " . ' . ' ' '. ' LIFFORD, HAS. M., emica ar are ervice. 4 Z Z 3 STORER, WILLIS D., JR., Lieutenant, Artillery. Died of CLIFFORD WM. FQ, Sergeant' Hdqst, A- E F- g Z Z ,S Wounds? A L. . CONNELLY, ROBERT M., Aviation. 2 if Z Z TURTEVANT RANK . Ieutenant Infantry, Killed CONNOR, EDWINJ., Lieutenant' Infantry' Z 4 4 "" amon 00" 9. 1918 Conoven, PIARVEY, znti Lieutenant, A. E. F. 4 4 Z EULUVAN' COLBERT' Llcutenant' Infantry' CONXVAY, CORNELIUS, Znd Lieut., Aviation, A. E. F. Z Z 2 TWENHOL5' CASPEE- A' Et FM d. l C CRANE, RAILLARD, lst Lieutenant, A. EF. Z Z 2 ALBOT' EORGE' ergfaam' 6 'Ca Orps' CROTHERS, WENDALL H., Private, Aviation. 4 Z Zymei TIFFT, THOMAS, 2nd Lieutenant, F, E. F. CuLNAN,JOHN, 2nd Lieutenant, Marine Corps, A. E. F., 4 Z Z5 Z TILLMAN, FRANK W., Lieutenant, Aviation. CUSICK, ED. TIMOTHY, Medical Corps, A. E. F. QZNUZZ Z, rg TORMEY, ALBERT, Lieutenant, Medical Corps, A. E. F. DAVY, GEORGE F, jg Ensign, U, S, N, 42 TREMBI-Y, JOHN MCC., Y. M. C. A.. France- Dieitens, I-I. F., 2nd Lieutenant, A, E. F. YJv?k1igCHLM6RVIQ:lI- ,Enslifnf U6 5- E F ku d , DISTELHOIRSTDFREDEAF-Znd Lieutenant, Infantry. 55 gZ Z5 ff . . ajor n an ry . . . I e In DOPKNSI , W A, , , 42 5 Z2 W actllgn Q-ut-X153 1918- DOXVNlNG, J., U. S. N. A 42 74 ARNER- t -1 - - F- DOWNS, FRANK EMMETT, Medical Corps. E 24 Z2 WEBER' GEO' M" Ist Lifiutenamf Q- M- C-Y A- F- DUECKER, NV. W., 2nd Lieutenant, Infantry. A. E. F. 'f ZZ ZZ WEBSTER, W. B., Captain, Am. Red Cross, Russia. DUNN. CHARLES Bu Private, A, E, F, Z2 Z' gg WE5'-Et HERBERT WH EAGLES, LEON K., Sergeant. 12 ZZ Z4 gg WHEELER, CHAS. E., Sergeant, Infantry, A. E. F. EASTMAN, WALKER P., Ordnance. 22 WHITE, S. B., Lieutenant, Infantry. EDER, ABRAHAM J., Ass't. Paymaster, U. S. N. Zamgg WILDER, P. W., 2nd, Lieutenant. EDXVARDS, E. B., Captain, F. A. QLWZZ Z Z WILLIAMS, D. H., Lieutenant, Infantry. EDNVARDS, P. J., Cadet, Aviation. 3 Z Z Z WILLIAMS, ROBERT N., 2nd Lieutenant, A. E. F. ECBERT, P. S., Znd Lieutenant, Engineers. Z Z Z Z WILSON, A. V., lst Lieutenant, Infantry. ELDREO, GEORGE, A. E. F. g Z Z 'tg WILSON, HENRY M., 2nd Lieutenant, C. A. C., A. E. F. ELLIOTT, JAMES, lst Lieutenant, F. A., A. E. F. Z Z Z WVOLCOTT. OLIVER S., lst Lieutenant, Infantry. ELTON, MORRISON, lst Lieutenant. g Z Z ig WOLFF, ARTHUR C., Sergeant, Ordnance. ETTER, ARTHUR E. A 2 Z Z XWOOD, FREDERIEC, Lieutenant, F. A., A. E. F. EVANS, HAROLD B., Govt., Food Administration. 2 Z f 4 OUMANS, OHN ., emical arfare Service. FALSE, ROBERT N., Aviation. 4 Z Z ZII.L1sCH, SCAR C., Sergeant, A. E. F. FARDY, MARTINJ., Medical Corps, A. E. F. Z Z ZILLMAN- H- A-. Captain. Infantry- FELLOWS, H. E., Sergeant, Ordnance Dept., A. E l-. Z 4 4 7 f 4 -'4 4 4 4 4 '4 4 4 4 4 4 4 lf? 4 'k Z 4 '4 4 Z 4 4 4 4 4 4 -4 'Q 4 Z Q41411114ffwfffffff4444444444444144444044444114111444114fgzzjfgffgzgjzgzfggzffmfzgffgizzffflZgfgfffjzZZZZZZZZ,,flNI55554jjzzjffffffy 14,444,444,WM4,144,444,ffffffffmwfffffiff112 Z R U D oe N ui or N S N 111111 11 111111 X 4 1 1 ft X Zi' 1 Zi' 1 fi' 9 9 Zi Zi' X Zi' 1 1 fg Zz 42 Za fi if 12 12 fe 1 1 4 E 1 1 1 4 1 1 1 1 Z 1 1 2 4 4 1 1 1 1 , : 1 : s 1: 4 4 if 9 1 5 1 1 12 1 1 xx 5 5 5 1 1 1 'f' 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4 1 A . . , 11 1 11111 . - 1 1 I 1 1111111111111111111 1111111111111111111111111111111111111111111111111111111111111A 1111111111111111111 f-1111 Zi 1 .. S , SWS New ASN S 7 5. 1 4111! 'E t Q at -1111 xi' f 1 1 7 I PXVNVR FISHER, E. W., Zntl Lieutcnant, Coast Artillery. FITCH, JOSEPH, U. S, N. FLICKINGER, D, W., Ist Lieutenant, Infantry. A. E. F. "'FOxvLER, WVILLIAM. Died in Camp. FORDYCE, JOHN. FRAWLEY, JAMES R.. SR., Lieutenant, U, S, N. FREEMAN, WVARD B., 2nd Lieutenant, F. A. FULTON, ARTHUR D, GALEX', S. B. GEHRING, R. W., Znd Lieutenant. Infantry, A. E. F. GIESE, JOHN W., M, G. Brig., A. E. F. GITTINGS, LEROY, Lieutenant, M, G. Bn., A. E. F. GOLDIE, WM., Aviation. GOLLMAR, HERBERT, Industrial, GRANT, G. G., Lieutenant. GROVER, STEVEN F. HALL, FRED M., Lieutenant, Infantry. HAMISTER, VICTOR C., Government. HARDING, W. H., Hospital Corps, A. E. F. HARVEY, DOW, lst Lieutenant, F, A., A. E. F. HASS, IVIELVIN I-I., Marine Corps, HAVERSTICK, GEORGE W., Ist Lieutenant, F. A. HENRY, C. L., Engineers, A. E. F. HOEFLER, THEODORE A., Ensign, U. S. N. HOFFMAN, OTIS, Aviation. HOHMANN, JOHN S., Private, U. S. N. HOLWAY, ORLANDO G., Engineers. 'HOOK LEON B. Cadet Naval Aviation. Died on October I4 1918, HOUSTON, HAROLD H., Lieutenant, F. A. HUTCHINSON, EARL W., Znd Lt., Aviation, A. E. F. JACKSON, ARNOLD S., Private, Medical Corps. JAMES, RAYMOND H., Lieutenant, A. E. F. JAMESON, JAMES A. JAMIESON, ARTHUR, 2nd Lieutenant, F. A.. A. E. F. JENSEN, BEN, Ordnance. JOHNSON, A.J., Industrial. Chemist, JOHNSON, GEORGE A., Lieutenant. 'JoRDAN, JULIUS L, Died October, 1918. JORDAN, R, W., Ensign, U. S. N. JOSEPHSON, CLIFFORD I.. lst Lt., Aviation, A. E. F. KELLEY, K. N,, Aviation. KERNAN, THOS. H., 2nd Lieutenant, Engineers, A, E. F. KESSENICH, A. M. KILAND, INGOLF N., Lieutenant, U. S. N, KIMBALL, ARCHIE, Ordnance. KING, KENNETH, Lieutenant, Infantry. KINSEY, J. B., 2nd Lieutenant, Coast Artillery Corps KITCHEN, DOROTHY, Hospital Hut Service, A. E. F. KLAPP, GORDON, Lieutenant, F. A. KLOSER, MARTIN, Lieutenant, Sanitary Corps. KNUDSON, OSCAR. KRAEMER, EDW. C., Ist Lieutenant, Engineers, A. E, F, KRAUSE, EMIL F,, U. S. N. LANDRY, WALLACE. LANPHILL, J. B., Ist Lieutenant, F. A., A. E. F. LEGLER, FREDERICK M., Transport Section, A. E. F. LEWIS, CHAS. M., Ist Lieutenant, Engineers, A. E F. LIGHT, JOHN, Engineers, A. E, F. LINK, OTHMER, Yeoman, U. S. N. LINLY, ROBERT W. IJQFTUS, GEORGE E., Hospital Corps. MCCOY, FRANK A., Corporal, Marines, A. E. F, MOCUTCHIN, JOHN A., Ist Lt., Infantry, A. E. F. MOGILVARY, EATON, Ist Lieutenant, Aviation, A. E, F. MCHENRY, ALAN T., Aviation. MCHUGH, GLENN E., Lieutenant, MCINIES, EARL, Sergeant. MCKINNEY, JOHN V., Captain, F. A. MCMASTER, PAUL H., Private, Infantry. 'MACNISH, GEORGE C., 2nd Lieutenant, Infantry, A. E. F. Died July 2, 1918. MADSEN, A., Corporal, Infantry. 4 MAURER, C. N., Ist Lt., A. E. F. 'MAHRE, RONALD, U. S. N. Died September 26, 1918. MARGARIDA, JOSE, Captain, Infantry, MAXWELL, ARNOLD. MEAD, FERGUS, Corporal, Field Signal Batt. MELAND, N. B., Marines. MELNIKOW, HENRY P., Base Hospital, A. E, F. MERRILL, HENRY B., Private, Gas Service Lab., A. E, F. MEYERS, E. R., Ist Lieut., Infantry, A. E. F. MILLER, GILBERT A., Private, Signal Corps, A, E. F. MOON, HERBERTJ., Industrial. MORRELL, ROBERT K., Engineer, A. E. F. IVIORRIS, DAVID B., Aviatfcn. 1111111111111 11111111111111111111 RVLL MUELLER, B. C., F, A. MURPHY, RAY V., Lieutenant, Chem. Warfare Service NELSON, CONSTANCE, Chief Yeoman, U. S. N. NEUBERT, EMIL, U. S. N. NEUBERT AIILIIN K. INIENVTON, MERRITT H., Infantry. INIICI-IOLS, M. I-I., 2nd Lieutenant, A. E. F. NIEDERAUR, PHILIP, Ensign, U. S. N. NISS, I'IERMAN, Cavalry, A. E. F. NOBLE, 'IRI-IOMAS B., Medical Corps, B. E. F. INIORTI-I, REYNOLDS B., Sergeant, Field Artillery. O HARA, OSCAR, A. E. F. CWLSON, SIGRUD, Aviation, OLSON, WM. A., Sergeant, Signal Corps, A. E. F, OPSTEDAL, J. A., Ist Lieutenant, U. S. N. ORR, EDXVARD B., Marines. OQSFIEA, HARRIET, Government. OSTRANDER, IRALPI-I, Private, Infantry, A. E. F. PARFREY A. C. Radio School U. S. N, PARTLETT, RAYMOND C., Aviation. PAYTON, M. A., Lieutenant, Aviation, A. E. F. PEASE, FREDERICK J., Znd Lieutenant. PEASE, WVARREN J., Znd Lieutenant, F. A., A. E. F, 'PERRHQQALPI-I, Captain, Infantry. Died Nov. Z2 PETERSON, EvAN. PFEIFFER, REUBEN R., Lieutenant, A. E. F. PHELPS, RAY, Engineers, A, E. F. PI-IILLIP, HAROLD WM. F,, Lt., Infantry, A, E, F. POCKETT, L, C. PONTIUS, THONIAS T., Lieutenant, Infantry. PORTMAN, E. C., F. A. POTTER, H, I., 2nd Lieutenant, Infantry, A. E. F. PRADT, L. A., Lieutenant. PRATT, D. F., 2nd Lieutenant, Infantry. PRECOTT, INAITCI-IELL, Medical Corps. PROUTY, EVERETT, Lieutenant, Infantry, PRUSSING, A, W,, Field Artillery, A. E. F. PUFFER, RAYMOND K., Captain, PYKE, ROBERT, 2nd Lieutenant, Aviation. RAMSDELL, GLENN I,,, Lieutenant, RANK, GEORGE ROBINSON. RAU, HAROLD L., Lieutenant, A, E. F. REQUA, E. L., Field Artillery. RINGLING, MATTIE, Canteen Work, Y. M. C. A England. RITTER, L. S,, Lieutenant. ROADHOUSE, XVILBUR, Aviation. ROBERTSON, SCOTT L., Sergeant, Medical Corps. RODRIGUEZ, SUMNER, Private, F. A., A. E. F. ROOD, J. Q., Captain, A. E. F. RUDER, GEO. L., Captain, F. A., A. E, F. RUSCH, HERBERT, U. S, N. RUSSELL, SAMUEL W., Q. M. C. SADLER OMER T., Y. M. C. A., A. E. F. SALTER, R. C,, 2nd Lieutenant, Sanitary Corps. SCHAD, ALBERTJ., Private. ' SCHAFER, F, B., Lieutenant, A. E. F. SCHIERZ, E. R., Ist Lieutenant, Engineers. SCHINDLER, DONALD, Lieut., Engineers. SCHWEPPE, ALPREDJOHN, Government. SEYMOUR, S, LELAND, 2nd Lieutenant, Aviation. SHAPIRO, NATHAN, Ordnance, A. E. F. SHERMAN, JOHN KING, Aviation. SIMMONS, HORACE D., Corporal, A. E. F, SIMPSON, GEO. L., Captain, Infantry, A. E. F. SLABY, FRANK J., JR., lst Lieutenant, Infantry. SMITH, EARLE EUGENE, Aviation. SMITH, FRED S., Captain. SMITH, LYNWOOD I-1. SMITH, WINFIELD, SNYDER, JOHN, Sergear-t, Medical Corps. SPAYDE, K. C,, Engineers, A. E. F. SPENCER, CHARLES E., lst Lieutenant, F. A., A, E. F. SPOHN, DAN, Lieutenant, SPOONER, TRUMAN R., 2nd Lieutenant, A. E. F. STAVRUM, EDNVIN R., lst Lt., Infantry, A. E. F. STEIN, WM. H., Private. STEINBRENNER, H. P., Captain, Infantry. STEPHENS, GLENN W., Lieutenant. STEVENS, GERALD D,, Aviation. STEWART, BERNICE, Government. W STONE, RALPH. JISTORER, WILLIS D., Znd Lieutenant, F. A., A. E. F. Deceased. ' STORIS, ALBERT M., Aviation, 1 01111111111111111111111 111111111111111111111111111111111111111111111111111111 111111111111 1 1111111111111111111111111111111 11 111111111111111111 11111111 1 11111111111111111111 11111111111111111111111111111111111111111111111111111111 111 1 11 11111111 111111111111111111111111111111111111111111111 11 1 , ,,,.,,,, 'ff , ,1111111111111111111 11 11.1 1 5 1 5 1 111 3 1 f ' 5 5 7 911111111111111111111111111111111111111111111111111A 11111111111 . Q111111111111111111111111111111111111111 1 ' ' 1 1 1 w Page 363 """f""" 1111111111111 l I u l I i I i 111111111111111111111111111111111111111111111111111111111111 11 ' - - muQQQ-QQ-QQQQQQQQQ-QQQQQQQ-ww Q ' QQQQQWMQ-Q-QQQQQQQQQQQ.QQQQQQQQQ-QQQQ-QQQQ-QQQWQ if 4' 'f' 14' lf' W 'F "' 'V 1' 'F Q -1' If W' If Q 74' 'W' 4' 1' 'V W' YQ SQQQQQQQQQQQQQQ-QQQQQQQQQvw.QuwQWN.QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQCQQQ-.QQQZQCCQCQZQQQQQQQCQQQCZQCZCGRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ2IllQ2212X121llllllllllI1122111113.3.Q11211lxQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSY E . Q Q Q Q Q Q QQ QQQ QQ - Q Q ii .555 5550555595555555555555555555555555555 5? 5 55555 5555555555 55555555-?l5'5'E'?E'r7????3,2"? 5? 3 :U Wofomwu www: :1zUc:5'::::::mmo xx:--u Q- rf 0 Of"""'Z ""0HH-mm--w 2'xZZZZ'7'mmmr20H'42I'WxHm I Q N Q O' o '11-xmmiw ,.,,-33m S U- ,,,..4,,.w,,,O,,,m,.Z-Q IH I U1-,mfno :gx-4-mm,-vw, wm Fz5z'om,,g0n-Qwooffm w Q Q Q 51O7gm30 mzzw'5w3!'3'-4C-5'5"ZzU1' u-ZZOomf"2- 5:1 m fWQ.1.' v-zfrzmfrwf-1 oT,'l7UO3'f,,mw:-P'm-:,."1O:mW1,2'-I ' Q Q jg mmcposvi...nq,,.,-,pZ!Z-lFZZ3,3,5m:'IZ- Uzxp -,U m-5-pvomoowibzgzbo-Em-omz-Ho5gc,f2p1EEo-sy, pm:-iw-EPT Sig Q ,,ow on-IwQ.,r-1102, - 2,1-momomrr--Z5 -2-my Z0m:I'5nwzwg.wCb3qforrf1Om,,w? zrg Z,-.gkjfy Q Q Oo H- -10 :Q- .CQ-O Likmv 21,-av QQ? I o-1 rn U1 mm --rn -7:- 4-eF?'w m- IFF'-.71,, L- -- U' Q Q 3 C53- CU: ml-:ml mo co:-IO -I Z- 1'-I o-'71 wil' Cm--'V WZW- I-L-' MI :Q 0- :U -P255 Zw or-O: QM' Qlnf Q Q YQ S'5m9'w"11'4 Z2zvvr'U9fFf'w::-Am'I'J'1 mmoic aim"--aQ'3 Ufmzm R-' U12 7U 'FmmOz7Pm0:'kH z""f"3'UU'-I,44"' H232 '- HWY - Fwr m' U- z"' 0'Ca-m fmz mm O50 - w""X'T11-'r1C- bn O W 7' W - ZPOU 'PWC L.o--mO:-Wm: 'rim Q Q Q -im I' 3--45, 2.44, 3,-IZ-3, wgw 2 m-471:-,,O1, - J-gs..O-sfcbm W,-u.,:' z rm-I .-no 2 ZwT,..41,, 73. Q Q Q AXIP 0 -cm' Q2-ms O:m'- 7' '4'-075250 HZ GOI wo '4""""U-W2 I5""'E?1OI1vOC3w-47'--2l'U-In'-"'X'o Q 5 31-,, .ZCQ., r-z ..-3 Z ,aw F' 1- L71 -Omgm 3, xooz mfjm U 01-vlvm 75 Q00 ., J 'l Ng. - pu, 5 U Qfg S -N'-1 "'- pl' m ' -ww Qs- 577 Www -IO Z - '-3. - '1vr U1-' 5- mm' 711: Cm":vUV' 5 lT1l"0O gu3I"' Egg!-'QP' J S' Q Q ' Dgwmgg- ?w3,.-KSPODU-5-3 I-3 rg: 5 53: DOME . . UUE, - ZLL LTIICWN-50 71. 90u:Om"Uz:vCn- - Z: E-UU3,5-03 G-5' Z Q Q Q CQ,o.52:m'U,4EQ,O-05.39, wo.-..43,-DPI mm 5-5 0 P9,Ff'-- ,Of-.K-1 ::,, :1 7-1l:f3,' 51114:.wg ,U -:ICWQI crm N Q Q N ' --0.011 33-go S'-I 'N' 2 W' cbs- F1520 EQZQ6' o "'wEl5 V2 -- Qu' Z9-mpfvl ,O -xml-' Um: O., l"m'V""g-- f""'5'.'4 3 Q 5 S MCU "'l"f'4O7'l: FUBCE '55 -A Zn---fam. O' m 51'-S2 ' f' uv:-1 l-- C" Z,,,7u-.l"'fv 3'--5' 30:2 ES: O. Q Q NW 'f'mE55"'-'z"fQf'R'91"-Q -Nw 23n7?7'l'53N'A5"54U1 'A 1-' 53.-'UA E 5 50-'.f'fQ"C3P3l'Z fvv'm"E6"'m ?3SCo?:f"35'g CNHC 5 Q EQ ZE,nmffc'5'gU,I::5'gmSw: g-,gn -QUOQ34... :tIg.N-mg "' QD ws? -:Q rv ar.. g,g55-bg Q-Vf'-nE,C5E, .,.,n-- 5.2 f-fgg.-Q Q- Q S QS .4S.C'g'...,-- SCH? .22 QW SE-V 03:0-r9-5 -1,-, 3,,... '-,gg 50,12 IJ ,..F'2,-,Ummg 9,4-Tim,-,G-. l-ngii 4-Q...-. Q,f',,,: -- Aww gg '0'Q,f3:,c21f-1-invggxffg :x l":,?, .mOC3f5',,,l--130-Z-Uco -1 ,I "'Wm-- QQ 9' I-mggfbcv-3,:f-'O f-. :SWK-0 -img 'nw 9, 53 Q QQ f'nP:1'D.w5'3a.N'5mZ- ZW Km' 5 Ofvg-'5"5,"l-U30 2 150-8 :1 3 r'CC":' OWS' H2I'49'25-f- "!?::'1 'SVR :1??J":s ff ? 2525:-fifggafg 3 5.25 af-353 5 wif, gs 10 -555552 g 5,2-.:Z?fa,-5 E-'sfy' Swag, Emma 3 QQ : " ff... .H ' U7--3 go -1 :s. ' "":"Q cf' -- on fu- H ::A,..""' :my 5-1 -of-f my 515 P-fiihia ma 559 552255 532: 12?-52 S T5 552327125 Ln :Snap-E-0 255. 5,2712 ?' jQQQQ is ' -53,-1 m':T'VVE,E,,LT'O '93 nag- 5' Q51 P, Om' 'S l :pm W S - O: ' I :bww ' F-N' gn-IQ, 5102 - 511 5' QQ W 515' -QTSHNDE F03 'f-Q svoffarm' - -Q -- C D 0 E?b?P:m2- DQ -r1DQff-- 55' " 0 ? 24' QSQQ -n sw 112,235.32 ga P-Sp: Q 25771 0:5 9 V1 F1712 P 2 Smm MS ' 55, Q75 MP WS 51 Q, QQ ' W' "www --' ml GQ " :Q 5" MQ -n J. U 0" - ' F, :Q 3, 'nm' - " QQQQ QQ - Q4 - . 1435, Q 9 . 'Tl - fn rv an . P - 'U W QQ Q Q Q frj , ja -1 3 - 5 .,, 0 . N m Q 'TJ'-1-1 m U1 AO- -- "1 -1 gg gb. .yy m 3 FD m 5 5 -, , 51 ... Q4 Q4 . . , 'Tl -- 4 M4 U1 'Fl mm 3325555 'Z OW Zig 'M 3 5 TF Q Q0 h EY - .. - ' 9 IT1 . C m IT1 "G 0 'Tl E5 , '11 Q -1 . , Q , S. 3 QA - ., ,S O F 71' vw Q' 8 F1 12 sn Q 11 3 3 V 5 NN - Q QQ IQ QQ QQ EQ 3332? UUUUUOnOmoononononnoomomonnomoomnmomoonmmmomfuwcuuncommonon co zzzzziszzszaesaaaaassessszsissizaazsszaza22X222asss5252525235?5??55?5????555????5i55?5?5Q V ----- -1ZZZ0"X'vZz1ozf4I"r-C72:v7v7vl'wmZ mmmxw rn 4xf Q-U, ff, 0 -am rn .. Q mmmjlizz mmm! -- M U 5-4,0 ig zu-aw: 4zZzxxH 304 foo:-Ohwzzzoomf-E .gmc-g n-n 1- QQ ---mm--m5"Um1,, ,U m4Zf-z2-?Ff?Qm!"f'Um- Zm 0:40,-gwmmimxrmmmmQz,P1ZEZxxo,,,:v:zuo5'7,202--mmggpxog 0 if 7UOl1'1O?'ZZw F75'C7'E54"T"'5"-az QJT' ' 5"'Z FU-'Oz Z:m"17"wr'2'PH"'f-- "'f"!'1"1-0"'mF"'I2"'bW'UjI3v2zF'm Sfmw? QQ 0542 Qgmir Z ' -75 m m07: mi-Z mm"lm 5",,Cj-.I-1-74-r"ZZ3W ' S O 7""Z '- 'av-Num, U7'n""5-' 'nr-3 :Q - 00,051 7U"U---Q5-f--Zwmggxg 7, mo r-Q-L' Z1 '11 l"IIZUo1mo.Im - :xp Cmm-a-ammormo N QQ 452712 Q- I-Pwvgmnw gg -LP? "xo0.7U.--io PU" P momr-iabmcm .-5052 Z"05"-'zgmm---ozw-0 Q Q Z77OUICy7Um' PW C,-, C2 UZZfT,"Ul"gpQ g' 04- I'k'L'3'CmUf7?"4:-Dv -47'F1oWrn ' r114O"'QEm Q: Wpq :Q Zn,-fC Q :Q 175 O-,mg-mmpmmxmfrr 1. U15 :gr O Cgw,-. WP -00UUOp 'U71Zm7O Em7of'j:EfU,-'-'2S',7,3,0I"I", :FI-P S-"-.'-'-4 Q QQ 'O7jml--wz'om-vifvfffz-"-I' 52 Fgp- mmffib wm?'0F'I 1021222171 m-4-wmi rw: 3'-1'3:,U' rm" P M- bm' 'U O' 'N Q SQ U73'U1,gmpfj-ZZm"'Z'N?V""l'1'?"'UJ jjwmyp' F- --.ml"' gzmmypro- Z- 'UW' E77UFf17'O7, Z ,.3gf0l-'FZ OTIW3' S CUFF qxxi QQ m'4W'O'z-- no7"'f?0 :AQ 12114-O-"5'X' 2UU'r1g-ZQQNF' J Q-wr-'-4 335:11 "-IFf"mUT14wU7U7'7J-CESUfQIwW0ZZZ',S1 -- -QQQQ is EIZAOZZU MZQWF QU- ...Q-O35'l"3qW?,--J C"J 00:10, UU' J gbmzi' 9Z:'I1"mml"0-5 m3'I-mm'0QOm XX -0 OU. U53 .' w-fs-'Qu.N---mg-Z Fm qqQ,0 Ig'pj 'farm '3'.U--PU mg Q QPF' JE' 'Uzuwof-'M gc 0,555 -I P1 HP5' E' Q "f,,gC3w3',3Q3,N3?g5EmgK.- 8 gh Fgr- Xazigag- : 3922- 5- Q5 Zm17,E'QOgSP1,Em 5- 52- 5 fi 2' '53 IFSO 32,02 252 Egg- 'S.'1vg-3f"eE,EQ:o'3S355- '9.:1UO-54'L.g5'S' :Er D-'Co ZFQ ng 27c:r'5'S 323: ,QOQQSEJ KFEZB Q ' ' ' -. " ' """' . G mf' '-A ,,": o nw- .4 sm' '-' nu.-V: is - are :Epox ml-' V' H8-"' 2'-'cnwfzxmzzwl-UE Q33 C F94l"iW"C0- sm ECCOFGOO ' -O--,rQ.- CT' no--' w Ogg nw ff Q -v -' 3,1-v :Om ,mn O- In f-:wk-wfrj :mmf-f --m,..G,or-f 5 mon.,-.C -1 Fm NO- Q 3 ,,-15 U,-fl"C O..--. ,AS g wQ'Em mE"2. 9,13 :CILZ E,3O5'm g:3f"m-350 Qnmm Eg:-' f-1 :gn m"O'gNNR':sl"---32097 C-:QU-ng "' SLNQ9 N Y "Q H f"5g-r1rv'f' UQ: N 3'W ,-gm. L-'mJ"5'3:Of-vw 3T'F'5 923- mg' - f-ff-f::"'lc05 5-7gnn'04-1'E,g4' V1 0' I-'g55Z"r1""" Q X Q - 6'f',:5' rw f' HJQE. :nf --:s,.1-f'3fw5'Zf, 'gi 9, 05205: fQ:w5f,f'3m3f1Clf'MnvL--Uw,4w3 Fnvwawggn---902, Q Q Q O gs H3 Q10 'q- mm 'Ewa f:?,UD5m- 5., -UIT7-3:-I Opf-f 5 5 Dug?-rr Wm,-, 9'5"--.'g 5gg,':rv:,'O2 an Q Q 5 712' EQ vga, 32 32551 5555-5' H 2123551252 S. E?-Tggf'?-w5E22,mQE' -3gZf' f'S'5'afF:gfQl Egg E, Q Q ' --5, "" 5' 3 .l -Q "5-'-W - D "" Q ""' ' x: 4w"1fJ '-'.' rv" I-'G Q. xl-Q E 5 9' PS: -211 1355? ZZUWSQ iv E053 F3 S 05,5j42'?P1E-gaf'g'aF1H Em 25 SFR-35: 5 Q ' -... " . --.. rr V rf 5' " ,O ""-- g :x"'. ' , yr in g :z X 8 uf E? O wp, Pg? Q -53,2 Q E3 ?- QS. 25 m ?P?.S!'?QS:',T"'0'MEL 9 ab 23, 5' -C:,'Ll3x P Q ' 2' P fn iii?-3 521' 5, F P12 Sv 5 -QQUEE' -3332 5 in Q P3 9402951-2 rw QYQ Q g, 0 ' --.rr1sf-"Zb- Oy- 2 Q"5'-1. 3,g4"'-- ' mam:-" Q x 2 9' W 5 0215 m QQ 3, 5 5 il 'f'1?'ZF 5555- ffl 1 A1 5239 F1 Q ' - 413, ' Q . -' , '1-H-4-1411: ..,-3.3 - Q4 ' Q 5 P' .211 W ' m m m "mfr, -wmsem 1 ' gf, z 'Q 2' 7" ' ' ' 71- 'QW Q E Q Q Q P1 P1 1 vw P1 F1 F1 ex X Q S 'Q Q Q S :Q 1 'P 4 1' 1+ 1+ W 1' 'P W ' 4' 4 'F 'F ,X ll" if 'U' - 4' SX Q Q Q Q Q Q Q Q Q N Q Q S. Q Q Q X XS QQ QQ QQ QQ QQ gl XX QQ Qi X XQ QQ Qi is QE QQ NS QQ SQ Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q SQ I Page 364 fllfflflllllfffllfh 4 Z Zi' 4 4 Zi 4 f Zi' gi' ? 4 1 5 5 7 4 WX 7 g. xxxxxxxxxxxxxxxxxxxxxxxxxnwsxxxxs it ir t t t Z afnuunlulllf 'I R 4 uf444114444441444444144144444444444444fffmffwfffwfffzfffd DEYHLER, R. W., Znd Lieutenant, Signal Corps, A. E. F. DENPIELD, GEO. AUGUST. DEYLITZ, PAUL L.. Captain. DICKEY. DEAN R. COULD, STEPHEN G., Znd Lieutenant, Cavalry. GOWER, ARTHUR WM., lst Lieutenant, F. A. GRANT, EUGENE L., Seaman, 2nd Class, U. S. N. GRANT, RALPH A., Captain, C, A. C., A. E. F. 5 DIETZ, EUGENE F. GRAPER, LESLIE G., Industrial. 5 2 'DOCKEN, CLARENCE O., Sergeant, Q. M, C. Died in GRATTELO, H. E,, Private, Cavalry. Zig France, Feb. 10, 1918 from spinal meningitis. GREGSON, WM. FULLER, Znd Lieutenant, F. A., A. E. F Q 2 DODGE, CHESTER C., Private, Radio. GREUNKE, E. A., Lieutenant, A. E. F. Z g 'DOHERTY JOHN A. Lieutenant Infantry. Killed in GRIEM, ROLF, Aviation, gym Z action July 20 1918. CRIMM, J. EDWARD, Znd Lieutenant, Aviation. Z, 2 DONNELLY, JAMES STUART, Private. GRUBB, WALTER F., Aviation. ji Q DORSEY. LYDIA LOUISE, Government. , GUNDERSON, BORGE CARL. g DREW, FLOYD R., GUNDERSON, NELLIE MAY, Government. QE 2 DROTHING, HENRY O., lst Sergeant, F. A,, A. E. F. HABHEGCER, ELMER O., Medical Corps, A. E. F, Q, g DUFFIN, LAUREL, lst Lieutenant, Infantry, A. E, F. HAES, GUY S., Infantry g BOXVNING, JOI-E1 F., Ewsign, U. S. N. SAGEN, Zlnldllsieutenant, Ordnance. fi 4 UDDLESTON, ENJ. ARRISON. AGOART, M. , , 2 EASSON, SANFORD, Sergeant, A. E. F. HACOPIAN BEDROS, Govt. Airplane Inspector. Z7 2 "EATON, STARR, Captain, Infantry, A. E. F., Killed in HAI-IN, EMANUEL, Lieutenant, Aviation. QE Z action on Sept, 15, 1918, HALLOCK, NEIL, lst Lieutenant, Infantry. A. E. F Z2 2 IEBBEET, GEORCKA, Government. IIZIIALLS, J. Eg 2nd Lieuiinzgntlqlnfantry, A. E, F. fi 4 BY, AMUEL, viation. AMILTON, RADFORD ,... Z2 2 EDLER, R. C., Aviation, A, E. F. HANSBERRY, JAS.-H. Z2 3 EDWARDS, EUOENE F., Private, Field Signal Corps. HANSON, JULIUS 1'., Private, Signal Corps, 5 'ff' Z EDNVARDS, THEODORE. HARBACH, RALPH A. Z 2 EGSTAD, I'IERMAN M., Sergeant, Q. M. C., A. E. F. HARDY, JAMES E., 2nd Lieutenant, F. A., A. E. F. 5 2 EICHORN, HARRY LOUIS, Industrial. HARPER, BENJ. L., lst Lieutenant, Marines. Zig ELLIS, ROBERT C., Aviation. HARRINCTON, RICHARD, 2nd Lieutenant, Infantry. Z Z ELLISON,.E. C., Lieutenant, Aviation, HARTUNC, RAYMOND C., Ensign, U. S. N, Z ,tg ENDRES, OTTOJ., Captain, Infantry. l'IANVKINS, ESKIE TI-IEODORE. A Q g ENGLEHART VICTOR, Captain. HAY, DONAI.D L., Ensign, U, S. N. gh 5 ENGELKE, LEROYJ. HAY, ELLSXVORT1-I, Sergeant, Infantry, A. E. F. 5 Z ERNST, N. C., Aviation. HAYDEN, ROBERT M., Znd Lieutenant, lnfntry. Z 2 ERWIN, GRANT WEST. HAYES, ARTHUR MICHAEL, ESSON, VICTOR EMANUEL. HAYES, CHARLES, lst Lieutenant, F. A,, A. E. F. Z- g ETTER, R. R., Sergeant, Chemical Warfare Service. HEIDER, FREDERICK ALONZO. 5 2 EVANS, W., Lieutenant, Artillery. HEIMERL, W. A., Corporal. Q 2 EYERS, WILLIAM, JR., Engineers. HELMER, OHN H,, 2nd Lieutenant, Infantry. Z 2 FALGE, RAY L., Sergeant, Engineers, A. E. F. HELMLE, M. C., Field Artillery. ,Q FANTA, ERXVIN K., Lieutenant, Infantry, A, E. F. HENDERSON, BURNE O., lst Lieutenant, C. A., A. E. F gg 2 FARLEY, DONALD, 2nd Lieutenant, Aviation, A. E. F. HENDRICKS, W. C., Lieutenant, Infantry. Z2 2 IQARLET, JJL., Zigi Iiiegtlelnant, ILnIfaIEI1try.G B EEVENER, JE K., QSM. C. O d ,g ,g ARRAND ACK . n ieut. ac ine un n. EYMANN DGAR, ergeant r nance. FEENEY, JEROME-J., lst Lieutenant. F. A. HICKEY, JAMES SHERIDAN. gg 2 FELLMAN, J, K., 2nd Lieutenant, F. A., A. E. F. HIOEIE, I-I. G. Q, 'Z FELTON, I-IILEERT O., Lieutenant, Infantry, A. E. F. HIOSON, FRANCIS D., 2nd Lieutenant. Z, 22 FIEDLER, A. C., Lieutenant, F. A. HILBERT, OSCAR F. jg FIELD, HARRY W., Sergeant, Machine Gun Battalion. HILDRETH, R. P., Captain, Infantry, A. E, F. Z+wAg FISHER, ROY F., Sergeant, Medical Corps. HILL, EDGAR R.,.EnSign, U. S. N. 7 2 FISHER, CARL V., Corporal, Infantry. HILL, GEORGE O NEILL. Z Z FOsGATE,,FRANK P., Infantry. HILTON, EARL, Steam Engineering Dept., U. S. N. Qi? FOSTER, CARLTON H., Sergeant, Engineers, A. E. F. 1-IODGSON, ALBERT LEE. Z 2 FOWLER, DWIGHT S., Private, Engineers, A, E. F. HODGSON, H. E. Q 2 Fox, OSMON, U. S. N. HOMANN, FREDERICK A., Ensign, Navy. Z 2 FRATT, CHARLES D., Aviation. 'HOOK, LEON BECK, Aviation. Died at Seattle, Wash. 5, 2 FRANCES, HUGH H,, lst Lieutenant, A. E. F., France. Oct. 14, 1918 of pneumonia. Z i Z FRAZIER, CECIL AUSTIN. HOPKINS, EDJ., Aviation. 3 g FRAzIER, WM. C., Sergeant, Infantry, A. E. F. HOPPE, ALFRED G., Znd Lt., M. G. Bn., A. E. F. gf 2 FREEMAN, CHAS. M., Znd Lieut., Aviation, A. E. F. I-IOPPERT, ARNOLD H. Q 5 FREUND, WALTER E., U. S. N. HOIST, EDWARD GUSTAV. Z Q FRIED, D. G. I-IORTON, RAY, Infantry. 5 2 FRIEDBERG, JOSEPH, U. S, N. I-IOSER, HAROLD J., P. O, Z7 g FULLER GEO. lvl., WIS. State Council of Defense. HOUGAN, O, A., Ordnance. gg Z CEALBRAEJTH, VICTER ld A H IHIOUGHLA-ND, CLI? SANEOPiDd I - fi '4 ARD, I-IARLES ., ie rti ery. . OVDE, AROLD RTHUR, n ustria . Z2 'Z GARDNER, MILTON LEROY, Sergeant, A. E. F, HUGHES, DANIEL PATRICK. Z2 si GARIBALDI, FRANCIS, 2nd Lieutenant, Q. M. C., A. E. F. I-IUGHES, F. L., Znd Lieutenant, Infantry. 42 GARNER, LLOYD M., Captain, F. A., A. E. F, HUGHES, FRED P., 2nd Lieutenant, Infantry, EARRICAJN, GEIOIRGE A.,2Lg:titenant, Infaxtry,-A. E. F. EUOHESGIVM. R.iXZndELieutenanR Orrdfgiance. fs 79 EISSE, or-IN ARLIN, n Ieutenant, viation. USSEY, OSEPH ., ngineers, . S. . 'Z GETZLOE, LESTER C., Private, Medical Corps, A. E. F. IRISH, FOSTER W., Infantry, A. E. F, Zi ,Q SEVERS, CE-.RL, gaptain, A. E. F., Russia. EACKSONWJJKMES AFJR., Medical Reserve. 42 2 ILBERT, HAS. . ACOEIE, ALTER . fi 42 GILL C. A. , Infantry. JANSKY, CYRIL MOREAU, Government. Z2 22 GILL T. A., Engineers. JEHLE, CARL W,, Ordnance Inspector, U. S. N. gIlLMAN,gARL, I-geld Artillery. JENISOIGJ IVl65RG.itcRlig', Assistant Egitcgr, Wogneds Div ""4 LEICK, ARRY AMUEL. ,ar or , ommittee on u lic n ormation. Z 2 "GLoOER, WM. H., Government. Died of pneumonia JENKINS, GEORGE. U ' Z . 2 at Washington, D. C., October 2, 1918, JENKINS, JAMES W., Field Artillery. Z 'ig GOCKEL, ARTHUR P., Znd Lieutenant, Infantry, A, E: F. JENKINS, L. N,, 2nd Lieutenant, Ordnance. Z 2 EODPRIEEY, ALERXIQJ IUAVQREGICE, lst Lieutenant. XJENKINS, L., Znjl Lietatfant, F. A,,FAAE,E.E F f 4 OFF, AROLD ., . . . ENNETT, DWARD ., n Ieutenant, . ., . . . Z Ik? GOLDAMMER, CHAS. J., Ensign, U. S. N. JEWETT, CHAS. 4 F ' 9 if GOOD, SAMUEL P., Sergeant, Ordnance. JOHNSON, ALBERT S., 2nd Lieutenant, Infantry. Z g GQODING, L. E.,-Infantry. JOHNSON, C. A., Infantry. I Z COULD, E. F., Lieutenant, F. A., A. E. F. JOHNSON, CHAS. FRED, JR., lst Lieutenant, A. E. F. 4 4 ' ' Z 'W 4 Z K 4 1 4 2 i Z Qflffxffxxff 111fizlffxlfxixfl2211111111113714711111411411111111141111414ffffgfffffzffffgfgjjjgffffgfgfzfxfjjifgffjjf111441ffffffffnffffffff14144144411111111111rf1111144114ffff11y1411uffffffffffffffffffzff . ,., ,,,,,,,,,,,,,,,,,,,,,,,,,,,.,,, ,,,,,,,,,, 4 I 5 I ,, ,,,,,,,,,,,,,,,,,,,,,,,,,,, , ,, ,Z 4 I I 'i ,.... .... ui fr Rr A S+ If W X 1 Page 365 """"""""' W ,t 1 A f Af it , funfnfznffzuffr 41111ffl11111111111I1111lfllflflnfflnlrfzffl0111011114111 15.1 E 'fffff ff fffffe """""" "' i i n w f it t 4 f- -t 4 I! ,1,m,,,,,,,,,,,,f. ww, mama uv' I 4 ,t t t i ,t ,"L'.'I ,,,,,,,,,,,,,,,,,,,. Wffffffffffffff I-,ffl Z . . Zi ywffffffffWfffw,,,f,,f,,f,,f,,,,,,f,,,,,m,,,,ff,,,,,,fA t ' t' ,,,,,,,,,,,,,,,,,, ,,,,,,,,,,,,,,f,,f,, -A eww,,,Mm,,,my,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, f Z f A f INVNVA RVL L if 7 4 7 7 vw nk 7 2 2 7 4 4 7 it f ft 4 4 4 gt f JOHNSON, C. G. MENCEL, J. T., St Lieutenant, A. E. F. 2 7 JOHNSON, RALPH, Ambulance Service, A. E. F. MERRILL, JOHN ., ieutenant, n antry. ,fi Z JOHNSON, ROBERT C., Zncl Lt., Engineers, A. E. F. XIVIERRILI., JOI-IN F.,, Ist Lieutenant, Aviation, A. E. F. ,, Q 7 f JOHNSON, WM., Coast Artillery Corps. Killed In action. gi 7 OHNSON, W. S., Heav Coast Artillery. MIDDLETON, FOREST C., Seaman, U. S. S. Kansas. 3 4 Y , . , ft, JOHNSTON, CI-IAS. F., Ist Lieutenant, Infantry, A. E. F. MIELENZ, H. F., Q. M. C., Coast Artillery. gt Z JOLLEY, ALBERT R., Sergeark O. M. CK H d S 13 MILLARDDPAUL Sergeang d L. I f 3 4 I' ONES EUGENE B., Lieut., viation. i e ept. ILLER, AVID ECKWITH, n Ieutenant, n antry. 4 Z J 1918. MILLER, EDMUND, Government. Z Z, JONES, E. MORRIS, Signal Corps Inspector. MILLER, GEO. E. h gin, 7? JONES, VICTOR, Znd Class Seaman, U. S. N. MILLER, GI-ENN H-, Medical Corps. gg Zi JUDELL, MAXON F.. 2nd Lieutenant, Infantry. MILLER. IVAN. Avlatlon. 72 KAFFENBERGER, LEONARD L., Infantry. MILLS, J. A-. JR-. Ensign, U- 5. N- 72 X 1 - - - - I Z5 KAUFFMAN, CLARK E-I U- 5, N- RMITCHELL, JOHE1 L., llstchfuteriant, Aviation. Killed 7? KEELEY, CLARENCE A., Lieutenant In action une , , . In rance. 72 WKELTY, ASHER E., lst Lieutenant, Aviation, A. E. F. MILL, ARTE1-IUR Mqlvletllical Ccgps. 72 Killed, Sept. 26, I9l8. ONSER, DWARD ., aster ngineer. 42 KELLEY, KENNETH M., Lieutenant, Pilot U. S. Air MONTOOMERY, F. H., Base Hospital. 75 Service, MOON, Jos. N., Sanitary Corps. Z2 Z2 KENNEY, EDWARD L., Industrial. MOORE, 5-TEX? WMA. lllgdulitfial, F A A E F 72 KIDDER, VELOS B., Aviation. MOORE, . ILLARD .. ieurenant. . .. - - . 42 Z2 KITZMAN, WALTER L., Lieutenant. MORGAN, GLEN, U- 5- N. KLETZIEN, ADON15, Sergeant, Ordnance. MORRIS, FRANCIS J., Infantry. A 2? 75 KLETZIEN LOYAL H., 2nd Lt., Aviation A. E. F. MORTON, CHARLES DELOS, Ist Lieutenant, Infantry. gg Zim, KLONTZ, VERNON EARLM E 1xMiOSHER, JA BE Llgutenant, A. E. F. ZW' 7 KNICKERBOCKER, JUDD ., ngineers. URPHY, . ., avy. I 4 Z KNOCKE, LOUIS THIELMANN, Industrial. 'MURPHY, WALTER, Lieutenant, Infantry. Died 2 7 KNORR, ARTHUR H., Private, Infantry. Oct. 31, 1918. - I 3 i Z 2 KNOTT, ARTHUR W., lst Lieutenant, Infantry. NACHTRAE, LAWRENCEJ., Aviation. 5 7 2 KNOTT, RICHARD FRANCIS, 2nd Lieutenant. NAPIECINSKA, PETER A., Ist Lieut., Infantry, A. E. F. 2 Z KROHN, VICTOR, Lieutenant, A. E. F. NELSON, BYRON C., A. E. F, g 7 LADE, A. W., U. S. N. NELSON, LESLIE V., Industrial. ' Z Z LAMPERT, WILBUR. NELSON, T. C., lst Lieutenant, Sanitary Corps. g i 7 LANE, RICHARD K., Ist Lieutenant, Ordnance. NETHERCUT, DONALD W. 5 Z LANCE, ALEXANDER D., lst Lieutenant, F. A., A. E. F. NEUNENSCHWANDER, ADOLPH, Infantry. g ii 2. LANGHOFF, CARLJ., Znd Lieutenant, Infantry, A. E. F. NEVIN, WM. A., Private. g . Z LARKIN, BERT, Lieutenant. NEWTON, LOUIS C., Ist Lieutenant, F. A. 3 Z LATIMER, ARTHUR G., Lieutenant, U. S. N. NICHOLS, W. C., Social, M. C. A. g 7? LAUGHLIN, JOHN L., Zncl Lieutenant, Infantry. NIEMIND, ALFRED R., Private, Infantry. 34,0 ZZ LANV, VINCENT O.,Eanadian Royal Aviation Corps. NIKON, EARL K., Igdustriial. 4? LEROUSRY, CHAS. . OELE, ARRISON ., n antry. n 42 Z2 LEDERER, CARL S., Sergeant, Ordnance. NORDMEYER, CARL SORIES, Industrial. Z2 LEONARD, LOWELL A., Znd Lieutenant, Infantry. QOELTINGI5 WFALEER WM. S I C 45 LESTER, WM. P. ORTON, . ., ergeant, igna orps. ,g 72 LEVEN, MAURICE, Q. M. C. NUZUM, RALPH, Lieutenant, F. A. Z2 LEVIS, GEORGE, Lieutenant. OAKEY, WARREN, Zncl Lieutenant. LEWIS, RAYMOND B., 2nd Lieutenant, A. E. O'CONNOR, Clarence W. - gg gg 'LEXVIS STEPHENSON, Lieutenant, F. A. Killed near OESTRICH, CARL R., Sergeant, Q. M. C. gig, Verdun Oct. 31 1918. OCDEN, DANA P. - ggm, Z LIMBERG, LELANDJ., Engineers, A. E. F. OLSEN, HENRY J., Medical Corps. g 7 LINDBERG, G. H., lst Lieut., Infantry, A. E. F. OLSON, HAROLD C., Lieutenant. Q Z ig LIVINGSTON, EDXVARD M., Medical Corps. OLSON, WALTER. A h 3 Z 4 LOESCHER, CLARENCE A., Znd Lieutenant, Infantry. PALMER, ELBRLDCIIE AvIat8nSANE. F. 2 i f LOOMIS, ORLANDO S., Q. M. C-. PAMPERIN, A. ., nsign, . . . 5 7 LORD OHN B., Znd Lieutenant, F. A., A. E. F. ' PANCOAST, WM. 2 7 I , . . . , Q LOVE, JAS., Lieutenant, Infantry. PARSON, LEONARD B., Private, Aviation. g - 7 LUCE, ROSCOE R., Sergeant. PATTERISON, L. L., Musician, A. E. F. g at Z LUDDEN, HOMER J., 2nd Lieutenant, F. A., A. E. F. PATTISON, LESTER L., Infantry. Z Q it 4 LUEBBEN, GERALD A., Lieutenant, Infantry. ' - PAUL PARRY H., Industrial. 3 Z LEUTSCHER, HAROLD N., Sgt., Base Hospital, A. E. F. PAULSON, WALTER P. A gi Q MACARTHUR, HUCH, Aviation. PAYTON, JAMES M. Ist Lt., Signal Corps, A. E. F g Z MAEINNIS, EARL C., Corporal, Infantry. gEARCE, RUB., Eggineers, A: F. Z fm, MC ANN, RAY F. EDERSON, OHN n ustria . 5 gf MCCOY, LESLIE L., Medical Corps. Y PETERS, HENRY, Aviation. QAM, gi MCCRORY, RAYMOND JOHN, Y. M. C. A. War Work. PETERSON, ROGER F.,'Infantry. 72 MCDOWELL, L. B., Znd Lieutenant. PIEHL, CUNARD A., Lieutenant, Ordnance. pg 4, . ,, gg MACFADDEN, W. S., Sergeant, Ordnance. PINNEY, ARTHLQRJ., ESXIBYIDGS. gg fi MCGOWAN, MURRAY. ' POE, HARLES OY, overnment. . fg MCHUOH, KEITH S., Ist Lieutenant, Ordnance. POPE, CHARLES Base Hospital Unit. 72 MCMULLEN, CLEVE A., Sergeant, Ordnance. PORS, WM. E., Lieutenant, Infantry, A. E. -F: 25 Z2 MCNEIL, JOHN E. PORTER, RAYMOND E., 2nd Lieutanant, Aviation. 35 Z2 MACHLIS, JOSEPH ARTHUR, Corporal. ,I POTTINGER, CLARENCE Ah., S. N. gg MACKENZIE, J. N., Znd Lieutenant, Aviation. - POWERS, MARTIN A., Aviation. gg MACOUN, CHARLESI-ONrMOORE, Lieutenant, Infantry. PRANCE, ELMER W., lst Lieutenant, Ordnance. gg MAHLER, H. P., Zncl Lieutenant, Aviation. XPRIDDY, WELBORN S.-, Lieutenant, Infantry, A. E. F. 55 72 , MALLOW, RAYMOND S., Lieutenant, Infantry. Died of Gas Poisoning IH France, May 29, 1918. gg f ,.,,,f 1 , , 1 vm! 4 ' MANDEL, HERBERT W., lst Lieutenant, Infantry. PRITCHARD, OWEN J., Industrial. . 4 f . . . , 7 MANECOLD, JOHN R., Lieutenant, Signal Corps. PROCHASI-QA, J. F., Private, Field Signal Battalion. Z 9 MARSH, CARLJ., Fedei'al'Trade Commission. PUETZ, HAROLD, Engineers. gb Z MARSHALL, HARRY L., U. S. N. QUAIL, JOHN J., F. A. gi 5 MARTIN, AUGUST H. I QUICK, V. H., Infantry. D g 7 MARTIN, BYRON HAROLD, Lieutenant, F. A. RAMSEY, RALPH EDWIN, Captain, Infantry, A. E. F. 5 7 - ' f Q MARTIN ROSS C., Y. M. C. A. Secretary. RANISDELL, BAILEY E., Lieutenant, Aviation. 4 2. 7 MASSEE, RICHARD D., Reg. Sergeant-Major, Engineers. REESE, GORDON B., Lieutenant, Archangel, Russia. 3 Z lk MATI-IEWS, AUSTIN R., Ensign. REICHERT, JOHN W., 2nd Lieutenant, Infantry, A. E. F. Q MENDELSSOHN, ISADOR W., Sanitary Corps. REINHARDT, JOSEPH A., Government. 2 5 it 7 Z A ek 7 2 2 R , Z iiwifffifffifffgfffgffgffffffffffffffffffffffffffffffffffnffffff ,nf 1111111111fffnfffffffnfffffffffffffffuff ffffffff ffuffff aff ffffffnffffnfffffffffffzffifffifffgfffifq f . . , g ,,,,,,,,,,,,,,,, ,,,, 3 Z ,,,,,, N25 2 i 7 I 1 I 2, is if 4 Q A I 1 I Page 366 WR c .. If!! is Q 5 X 5 5 5 51 52 52 52 js 52 5: yi 52 52 xxxxxx 3 s 1 1 s s 1 1 s 1 1 1 , txt 1 111 1 5 -A-A xxx X xxxxxxxxxxxxxxxxxxxxxxxxxxxNxxxxx xxx 2 s s 1 1 1 1 1 1 1 1 1 sxx xxxxxx xxx ' 1 5 1 11 Z: 5 5: Z2 1? 52 1 Z . i gxvxxxtws xx N 'TJ n Ou N ,U . ox xi 1 Z1 1 5 52 5 5 5 5 5 1 . 1 5 5 5 1 1 1 7 1 1 5 5 1 1 W' 1111 111111111111 ir 'A' 'I ik 'A' if if 5 :111i1:21ii1::i21'i f 1 5 1 1 111111 0111 71111 5 1 1 5 5 5 1 I FXVNVR ROBERTS, MORGAN E., Lieutenant, Engineers. ROBINSON, ARTHUR H., lst Lieut., Infantry, A. E. F. ROBINSON, GEORGE. RODGERS, CLARENCE, Aviation, A. E. F. ROM, ROY GEO., 2nd Lieutenant, Infantry. ROSENHEIMER, M. W., 2nd Lieutenant, Infantry. ROSS, BILLY E., Radio, A. E. F. ROTHWELL, PAUL T., lst Lieutenant, Infantry. ROUTT, D., F. A., A. E. F. RUDE, THEODORE A., Industrial. RUEDEBUSCH, KURT C., Ser eant, A. E. F. SALSMAN, THOMAS J., U. S. SANBORN, PHILLIP G.. Aviation. 'SARCENT HAROLD, Znd Lieutenant, Infantry, A. E. F., Killed Nov. ll, 1918. SAYLE, GEO. W., Captain, Field Artillery, A. E. F. SCHAEFER, LEO H., Infantry. SCHAFER, HAROLD G., Industrial. SCHARDT, ARLIE, Infantry, A. E. F. SCHELLING, E. W. SCHILLETER, AUGUST E., SCHMIDT, DIETRICH, Lieutenant. SCHUBERT, ARTHUR F., Ordnance. SCHUBRINC, ALBERT H. SCHULTZ, GEO. I-I., Base Hospital. SCHUNK, OLIVER H., Industrial. SCHUSTEDT, F. N., Aviation. SCOTT, A. F. H., Captain, Aviation. SCOTT, EARL W., Industrial. SEIDS, JAMES V., Medical Corps. SELLS, JACKSON J. Sergeant, Infantry, A. E. F. SERVICE, GEO., lst Lieutenant, Infantry, A. E. F. SHANK, CARL BRADLEY, Lieutenant, Infantry, A. E. F, SHEARER, HARRY A., Medical Corps. SHOLL, LLOYD B. SHORT, R. D., Private. SI-IUEILEBARCER, FRANK D., lst Lieutentant, C. A. C. SIDDONS, FRED P. I-I., Lieutenant, Coast Artillery Corps. SIEVERS EDWARD C., Sergeant, Machine Gun Bn. SIMPSON, GEO. L., lst Lieutenant, Infantry, A. E F. SINNE, FRED E., 2nd Lieutenant, Aviation. SIZER, F. M., Zncl Lieut., F. A., A. E. F. SKABO, REIDAR, Corporal. SKIRM, JOSEPH, Lieutenant, Aviation. SLICHTER, LOUIS B., Ensign, U. S. N. SMELKER, W. W., Ordnance. SMITH, CARMAN B., 2nd Lieutenant, Marines. TSMITH, EARL, Sergeant. Died Oct. 13, 1918. SMITH, HAROLD D., 2nd Lieutenant, Infantry. SMITH, WALTON K., Foreign Royal Flying Corps. SNADDON, ROBERT, Y. M. C. A. SPERRY, DONALD D., Infantry, A. E. F. SPICER, MYRLE H., 2nd Lieutenant. SPROESSER, W. C., Industrial. STEELE, CLAY E., Sergeant, Q. M. C. STEINHAUCER, RAYMOND, Chief Petty Omcer, U. S. N. STERICKER, WM., Industrial. TSTEFENSON, P. LEWIS, Lieutenant, Artillery, killed in action November, 1918. STILES, P. G., Lieutenant, Marines. STONE, HOSMER W., Private, Medical Corps. STREHLOW, PETER C., Aviation, Canadian Army. STRELZIN, MORRIS H. STRONG, EDWINJ., Infantry, A. E. F. SUHR, LEWIS D., Lieutenant, Sanitary Corps. SUKEEORTH, HOWARD A. SWAN, HAROLD, Requisition Department, A. E. F. TAMMEN, THOMAS B., Marines. TAELILCOCK, ARTHUR F., Sergeant, Ordnance, A. E. F. TAUSSIG, WARREN A., Lieutenant, A. E. F . TAYLOR, GLENN E., Private, Engineers. TAYLOR, PAUL SCHUSTER, Lieutenant, Marines, A. E. F. TAYLOR, RUSSELL F., Znd Lieutenant, Infantry, A. E. F. 'TI-IOMASi?. A., A. E. F. Killed by loomb June 28, THOMAS, CHAS. G., Ist Lieutenant, Infantry, A. E. F. THOMAS, CHARLES S., Lieutenant, Aviation. THOMAS, FOSTER K., Znd Lieutenant, Infantry. THOMPSON, JOHN A., Industrial. TIKALSKY, CHAS. W., Sergeant, Ordnance. TILLMAN, ARTHUR G., Army Y. M. C. A. TREBILCOCK, A. F., Private, A. E. F. TREE, ORVILLE T., Ordnance. TRUITT, JOHN WM., Private, Medical Reserve Corps. TYRELL, DONALD W., Znd Lieutenant, C. A. C., A. E. F. UTEGAARD, THOMAS, 2nd Lieutenant, F. A., A. E. F. 1 if I 511111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 ,,,,,,,,,,,,,,,,,,, ,,,,,,,, ,,,, 1 ,,,,,,,,,,, , 111111111 111111 1111111111111111A REIS, CARL W. REQUA, FREDERICK L. REYER, l"ILIGO, Chief Storehouse Keeper, U. S. N. REYNOLDS, RUSSEL B., lst Lieutenant, Infantry. REYNOLDS, WM. L., Sergeant, Infantry. RICH, CLARENCE EUGENE, Znd. Lt., F. A., A. E. F. RICPIARDSON, GLENN C., A. E. F. RICKETT, H. W., 2nd Lieutenant, Infantry A. E. F. ROBERT, CPIAS., Ambulance Service. ROBERTS, HARLONV P., Captain, Infantry. 'ROBERTS, JOHN BASIL, Lieutenant, Infantry, A. E. F. Killed in action Aug. 4, 1918. VIGNERON, E. M., Captain, C. A. C., A. E. F. VANCE, SARAH, Government. VAN EVERA, Radio School. VERNOXV, J. REXFORD, Engineers Reserve. VAN PATTEN, EVERETT H. WADSWORTH, R. L., lst Lieutenant, F. A., A. E. F. WAGNER, MELVIN F., Motor Transport Corps. WAI-ILE, WALTER E., Ordnance. XWALLRICPI, WILLIAM, Lieutenant, Infantry. Killed in action, July 23, 1918. WALTON, CHAS. W., Ist Lieutenant, Cavalry. WARNER, IROBERT L. WATSON, ELMER E. WVATTAWA, JOHN, American Legation, The I-Iague. WATZKE, LOUIS A., Sergeant, Coast Artillery. WEAVER, R. O. WEAvER, WARREN, Signal Corps. WEBB, WALTER R., Sergeant, Radio. WEBSTER, BYRON G., 2nd Lieut. Infantry, A. E. F. WEEKS, LEWIS G., U. S. N. WELLER,C. GRAFTON, 2nd Lt., Infantry, A. E. F. WELLS, JAMES EARL, Government. WENOLER, HAROLD, Znd Lieut., Aviation, A. E. F. WERTI-IEIM, FERD E., Ordnance. WENCLER, HAROLD, Znd Lieutenant, Infantry, A. E. F. WERBA, ARTHUR, Private, Military Police, A. E. F., WERMER, WALTER ALBERT, Corporal, F. A. WHEELER, SYLVESTER L., Aviation. WHIPPLE, NEWTON D., Aviation. WHITLOCK, HAROLD P., 2nd Lieut., Infantry, A' E. F. WIENER, OSEPH B., lst Lieutenant, Infantry. WIENER, ., Lieutenant, A. E. F. WILDE, EDWIN, Hospital Unit. WILES, G. M., Assistant Paymaster, U. S. N. WILGER, CHAS., A. E. F. 'WILLIAMS, FRANKLIN C., F. A., A. E. F. Died of pneumonia, Paris, May 18, 1918. , WILLIAMS, ROBERT N., Znd Lieutenant, A. E. F. WILSON, WM. B., Znd Lieutenant, Infantry. WISE, MENTON B. WITI-IINGTON, JAMES S., Sergeant, Marines, A. E. F. TWITTHUN, ELMER WM., Government. Died in camp, Oct. 17, 1918. WOLF, CLARENCE N., Chief Storekeeper, U. S. N. WOLVERTON, FRED M., Private, Infantry. WOOD, I. W., lst Lieutenant, Infantry, A. E. F. WOOD, JOHN M., Government. WOOD, RALPH H., Government. WOOD, RAYMOND, Lieutenant, A. E. F. WOOTON, ROBERT. TWRIGHT, GUSTAV. Killed in action, Oct. 8, 1918. WRIGHT, HOWARD F. WRIGHT, MERTON LA MONT, Aviation. WRIGHT, OMAR B., Sergeant, Ordnance. WYATT, RALPI'I M., 2nd Lieutenant, A. E. F. YOUMANS, HENRY A., F. A., A. E. F. YOUNG, CARL F., Sergeant, Ordnance. YOUNG, HAROLD B. YOUNG, ROBERT A., U. S. N. YOUNG, WM. M., Ensign, U. S. N. ZELLMER, CARL E., Medical Corps. ZICK, WM. JOHN, Engineers, A. E. F. ZISGHKE, I-IERMAN, Lieutenant, Marines, A. E, F. ZU JEDDELOH, HENRY J., Private, Infantry. 1918 ACHENBACK, LESTER W., Sanitary Train, A. E. F. ALEXANDER, A. B., Lieutenant, A. E. F. ALLEN, GEO. B., Government. AMBLER, FRANK, Army Y. M. C. A. ANDERSON, ALVIN, Corporal, A. E. F. TANDERSON, MORGAN M., 2nd Lieutenant, Infantry. A. E. F. Killed in action Oct. 5, 1918. 111111111111111111111111111111111111111111111111111 11 1111111111 11 1 f 11111 7 5 4 l 1 5 ' 5 1 5 7 111111111111111111111111111111111111111111111111111A 1111111111114 411111111111111111111111111111111111111111111111111 ZW! X I ! W J f 1 'lr if t 'k 'A' 'A' I 1111111111111111111 1 011111111111111111111111111111111111111111111111111111f111111 'f'f'f"""" "' 7 ! 11 1 1 , 1 111 111111111111111111111111111111 11111111111111111111111111111111111111111111y11111111111111111111111111 i N R RNR1M ws 1 1 1 1 1 2 E 1 1 1 2 1 2 1 1 1 1 1 1 , 1 1 2 1 1 1 1 1 1 1 Z 1 1 2 5 1 1 11 fi gf 7 1 5 if 71 Z1 5 1 ff Z1 K Z , Q Qt at Z 1 1 1 1 ' jil- RR , - xxx A 7 757157 5 VIII' If 1 lffffl 1' if 'Ii' ir it f Tk 1 'k .. 1 , 1 it -Ar if i. tk ll? 1 4 1 5 1 1 7, ,,,,, I 1 'QV 1 I 1 Q 4 . I 1 1 1 I 1 1 1 1 -1 1 1 Z 7111, 2 11, ir gr. Ik 7,114 it ,I-5 INVNVR ANDERSON, CLIFFORD M., Chief Radio Electrician. ANDERSON, EDXVARD OSCAR, Medical Corps, A. E F. ANDREXVS, ARTHUR M. AUSTIN, CARL N., lst Lieutenant, Engineers. AUSTIN, KENNETH, Aviation. AUSTIN, ROY, F. A., A. E. F. XAVERY, HERBERT L., Ensign. Died of influenza NOV. 12, 1918, on board U. S. S. Hubbard. AXTELL, WAYNE O., Captain, Engineers, A. E. F. BABCOCK, W. C., U. S. N. BAHE, KENNETH E., Znd Lieutenant, F. A. BALCH, CLEON F., Private. BALDWIN, JOHN, Sergeant-Major, F. A., A. E. F. BALMER, STANLEY L. BANTA, G. V. BARGER, ROBERT L., U. S. N. BARKER, HONVARD FRED, Ensign, U. S. N. BARLONV, RUEHL, Sanitary Train, A. E. F. BARRETT, Arthur E. BARTLETT, HARRY O., Znd Lieutenant, A. E. F. BASCOM, DEANE S., Ensign, U. S. N. BAXTER, ROBERT A. BEACH, R. W., Lieutenant. BEEMAN, LYMAN A., Government. BEHLING, FRED LOUIS, U. S. N. R. F. 'BELL A. Foss, Lieutenant, Aviation. Killed in France October, 1918. BELL, DOROTHY, Red Cross Nurse. BELONVSKY, HARRY S., Znd Lieutenant, Hospital Corps. BENKERT, ROY FREDERICK, U. S. N. BENNETT, JOSEPH G., Ensign, U. S. N. BENSON, ROBERT H. R., Lieutenant, Aviation. BERG, EDWIN L., Aviation. BERN, ARTHUR, Q. M. C. BERTELING, C. M., 2nd Lieutenant. BIART, NAT, 2nd Lieutenant, Infantry. BIERSACH, HENRY L., Hospital Corps. BIGLOW. LOWELL R , U. S. N. BILL, J. RAYMOND, Seaman, U. S. N. BILLER, JAS. R., 2nd Lieutenant, . M. C. BILLER, JACOB R., Lieutenant, A. . F. BINNEY, THOMAS H., Sergeant, F. A. BIRCH, IMOGENE, Government, Social. BIRD, GEO. E., Sergeant. BISHOP, LAXVSON W., Ensign, U. S. N. BLACHLY, LOUIS B., Corporal, Infantry. BLACK, JOHN H., Sergeant, Government. BLAIR, JOHN C., U. S. N. BLAKE, GILMAN D., Artillery. BLISS, MADELINE, Government. BLOMQUIST, GUSTAVE E., Znd Lieutenant, Engineers. BOARDMAN, NEWELL S., Aviation. BOEHNE, JOHN W., Private, Ordnance. BOEING, JOHN K., Q. M. C. BONDI, HOBART E., Lieutenant. BUROESS, CHARLES M., lst Lieutenant, Field Artillery. BORWELL, FRANK C., Ambulance Corps BRADFORD, WM. R., Aviation. BRAGG, R. R., Cavalry. BRANN, A. J., Engineers, A. E. F. BRANINE, I-IAZEL, Government. BRANT, HOWARDJ., Infantry. BRAUN, EDNVARD J., Medical Corps. BRAUN, HAROLD, U. S. N. BRENDEMUEHL, ALVIN G., Sergeant. BREYVOGEL. A. L., Social, Overseas. BRENNAN, H. E., Infantry, A. E. F. BRENNAN, ROLAND E., Lieutenant, F. A. BREWER, ROBERT M., Private, Infantry. BRIGGS, PAUL A. BRILL, WM., British Army in Egypt. 'BRISTOL, FERN, Infantry. Died of pneumonia in France, March 9, l9l8. BRITTINGHAM, EDW. G., Naval Aviation. BROCK, HAROLD W., Sigzal Corps. ' BRODY, LAXVRENCE, Q. . C. BRORBY, MELVIN L., Army Field Clerk, A. E. F. BROSSARD, EUGENE E., 2nd Lieutenant, Aviation. BROWN, ALOIS A. BROWN, DOROTHY, Statistical work, Shipping Board. BROWN, LAWRENCE M., Sergeant, Infantry, A. E. F. BRONVN, NEAL W., Lieutenant, Infantry, A. E. F. BROWN, SIDNEY T., Signal Corps, A. E. F. BROWN, STACEY, Znd Lieut., Infantry, A. E. F. BROWN, MARSHALL F., Medical Corps, A. E. F. BRUNKOW, QRVIN R., Sergeant, Sanitary Corps. 11 1 1 fn RVLL BRYANT, HAROLDJ., Aviation. BRYDEN, JAMES A., Sergeant, Field Artillery. BUCHANAN, PERRY B., Zncl Lieutenant, F. A., A. E. F. BUCHOLTZ, A. O. F., Government. BULLEN CRAHAM, French Aviation Service. BURLINOAME, LEROY J., lst Lieut., Field Artillery. BURNSIDE, HARLOW, Captain, Infantry. BURRELL ROGER A., lst Lieut., Aviation, A. E. F. BUSH, HENRY H., Private, Medical Corps, A. E. F. BUTLER, C. R., 2nd Lieutenant, Aviation, A. E. F. BUTLER, JEANETTE, Government. CALL, LLOYD, Medical Corps. CAMLIN, W. J., Infantry. CARADINE MAHLON. CARPENTER, BYRON, U. S. N. CARPENTER, DON W., Captain, Infantry. CARTER, W. J. J. SCASEY, MARCUS T., 2nd Lieutenant, Infantry, A. E. F., Russia. Died of pneumonia, Sept. IO, l9l8. CASEY, MATTHEW J., Chief Petty Officer, U. S. N. CASEY, ROBERT, Radio. CHANDLER, W. S., Hospital Corps. CHILDS, MARSHALL H., Engineers, A. E. F. CHRISTIANCY, CARTER C., A. E. F. CLAPP, G. H., Infantry. CLARK, ROBERT H., Naval Aviation, A. E. F. CLEARY, THOMAS L., Corp., Infantry, A. E. F. CLEVELAND, W. l., 2nd Lieutenant, Infantry. COLE, EVERETT L., Ensign, U. S. N. COLE, MANLY G., Sergeant. COLLINS, CLARK S. COLLINS, HAROLD C., 2nd Lieutenant, Infantry. COMMONS, JOHN A. 2nd Lt., Infantry, A. E. F. .Russia CONATY, BERNARD M., 2nd Lieutenant, Aviation. CONELY, BROOKS L., Engineers, U. S. N. CONLEY, JOHN G., U. S. . PCONNOLLY, JOHN MARK, Warrant Machinist, U. S. R. F. Died of pneumonia on Dec. 21 I9l8. CONNOR, EUGENE P., Government. CORNISH, HARRY B., Private, Hospital Corps. COUTURE, ARTHUR J., Industrial, Island of Malta. COURIE, EARL G. CRAIG, WALTER S., Lieutenant. CRAMER, HERBERT L., Ist Lieutenant, Naval Aviation. 'CRANEFIELD, MARION C., Lieutenant, Infantry, A E. F., France. Killed in action On July 3l, 1918. CROWELL, S. D. CUMMINGS. JOHN H., Aviation. 'CURRIE PAUL MONSLER, Lieutenant, Aviation Pilot. Died in airplane accident on Kelley Field, May 27. 1918. CURTIS, KENNETH, lst Lieutenant, Infantry, A. E. F. CURTIS, WVILLARD L., Sergeant, Ordnance. DAHL, EDNVIN J., Aviation. DAHLNIAN, ARTHUR F., 2nd Class Seaman, U. S. N. DALLY, XVALTER R., Coast Artillery. DANIELSON, JESSE A., Private, U. S. N. DAVIS, DEANE G., U. S. N. DAVIS, DUDLEY, Znd Lieutenant, F. A., A. E. F. DAVIS, TRAYTON I-I., Aviation. DAVIS, RUSSELL GARDINER, Lieutenant, F. A. DAY, DAVID ELLIOTT. DAY, KENNETH S., Field Artillery. DEMING, JOSEPH BYRON, Corporal, Aviation. DENNIS, CHAS. E., Industrial. DENNIS, CLAYTON S., Corporal, Signal Corps, A. E. F. DEQUINE, GEO. P., Engineers. 'DODD, JOSEPH C., JR., Engineers, A. E. F., France. Died from Wounds, April 19, 1918. DODGE, NEWELL P., Znd Lieutenant, Infantry. DONALDSON, CHASE, 2nd Lt., Engineers, A. E. F. DONOVAN, J. R., lst Lieutenant, Infantry, A. E. F. DRAKE, A. I., Elec. Znd Class, U. S. N. DRAKE, RONALD J., Electrician, U. S. S. Agamemnon. DREXV, EARL F., Private, Ordnance. DROW, EARLE F., 4th Army Corps, Artillery, A. EDF. 'DURGIN, TRUEWORTHY O. D., Ensign, U. S. N. Died at Great Lakes, Ill., on October I, IQI8. DURST, WILLIS H., Private, Medical Corps. DUTCHER, H. R., Lieutenant, A. E. F. EATON, EVERETT H., U. S. N. EATON, HOXVARD O., Znd Lieutenant. EDNVARDS, EVERETT C., U. S. N. EDXVARDS, W. DONALDSON, Ensign, U. S. N. ELDEN, EDWIN S., lst Lieutenant, F. A., A. E. F. ELLIS, NED R., Private, A. E. F. 11111111111fn1ff,1ffffnffffffffffnfnfff10111111111110ff1111111111111fffffffffffffffufffffffffuffffffffnffffffffffffffufm ffffffffffff11111,1110ffffffffffffffffff ffff0,11fn1myffffffff1111111111ffffffffffffzfffffffffffffffi f 7,,,,,,,,,,,11,1111,1,fmmy,,,,,,,1,,,,W1,,,14 ym,,,,,,,,5 gm,,,,,,,,,,,,,,,,,,,,,, , . .. , . . L 1 , ?9'1iA'i'4i"4li'1frI 2 if if 1 iii f ' f , ,, ,fu KX Page 368 'f""" "" ff 2 mf, ' 4 1 1 if ir 'A' if 'A' 'k 'i l2 'ffl' fl 4 ' ' 1 I 5 Qu Q 'U sn on N w oQ Qo x 5 1 1 A . .QQQQQQQQQ QQQQQQ QQQQQQQQQQ-QQQQQQQQ-.QQQQS , .xxxQQQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQ ' Q,,,,,,,,,,,,,,,,,,,,,,,,Q,Q,,,,,,Q,,,,,,,,,,,,,,, . Qwxfu-x-ruff Q Q 1-wx-mr Qugfgfgx Q :earn-xxx-5, Q Q QQQ QQQ QQQ QQQ QQQ QQ W Q Qgx ' Q QQ Q X, Q x Q Q Q QIWQ Qi? Q Q Q13 Ex- Q Q IIIIII I 000000000000 Q0000000000 Q -r1'r1'r1'n-r1'rz-nhn'11'r1'r1'n'm'1'r1'n'r1 'n'n'r1 '11 Q Q E wbwrwmgbggggccwwwwwwwwww 0ooOO0r'gI':rf1mQQQ9 OQQQCCCEE71WOOOOOOOFr'l'?n,-vmmlfiz'-pbQglqglggggqggwgl Q QYQ r1WZZZZZZA:r'5g54c:3o,:.':Qzf:'w?g Zczggowggmw-5-1-H33 ggxzrzpmwmmbf-Xzggpmgbgwz1z5I5cwwnv:1::..,,mm:'p-ol. 25.4 Qi Q Q fswssasmsgzxgngaargazaaa mfgigamwamsmmm 22555m52555w,,g,mmm5Ug522mQ5-55s2a5g555,555 555 Q Q !f'nmZZzzzn,,:v'm,.m,,Q-l ,iw --'- Paz.mzzgsuzgwrz'?,wmmz-Z.-wgp.w5.gO,,-n-s:li-- mwmozzcr,-om..oo--Q 5.80710 Q Q1-Q :Z -"'- x.f-IOom-- Z-'Q 70-UAE QP- U "U ommz-,pn 5. 75C-rnz-:'I.Z0mzooz ma:-5025 zz-L..wzg--55m Qi., Q Q 0-' 2.3, - 'r-I w Oy I-2. -pf U,Q-7U"'..4C'Jf-3g3l"jj:'.-4:+1U- I 0 0 -U ' orwmzz-Q52--. OOF'-rp o ..0- Q X Q ' QSZO 2 F' mqmmnm-lm '3' U7 7:-Ol". O 33- -.1-' 0" Q-IZ7' Z 5'7::I:1WQI41bm5,' '-4-- 0 -5 I-. I' ' zp- O EQUFZ 5 Q Q O7U3.g:,:7U3,It"IZ. 7'ZF'Z:Umm -4Q- ...I-pg, mo' ,Tl '41-05'3CyT rnbo :CF'5,,C-mb -K-1,1 m IFIQ OZ 5 O --4 Z0 Q x Q .55 Hrooo.--1-5-,, :url 55120.-5 mmm U51-uf -5-zzfrvvmo U30 5-.Z- bP.,2':.OU5TU:Zrwb --wnb Q Q12 - I" FZI 2-42 ,L R-71 E51 V0 .'-'Z-r-5- 'UFJQWQ C1 02757 k-.x3,7oCI- Z 'Wg 52,0317 ' Cp-C ,-- 7UOV'Z7Up9O3P,: 5 Q Q 'Um'U8 CS UpQCmxmmCE3'ff1C 1' " 7' 'IWZU' ff' U"o3'm'-C-z1mZ'-LIQUZ POE? W' aWm3'P'-U'NGZm0l'7'3:-I" 2211- 3 Q S Cml"5r'3b7' gas' 711' Z3U'Z'U17u75'f:...2 :O53Pm,7' ""UOL.2D'1U4ZZ,?,r'+UUUf'1"U I--5077-4 -iOTn'u-4zC4U'3 -923'-f'V I: Cxr-up Q QQQ 4 ZF' Q mgmw U'0U1r'U-IM m 7-'2f:'ZZnZ1-fcn-UO::- -525'-. mm-?"Jm 'Iv-r-': 00--.'T1Q.lTJU F,'?0'ZC M- H if Q Q Cn? C.g'2O.U: -,4IP1m'-O -Un-fl'.:g 1-'-I0 1.- 4 'Z,. V--In--4"'W 1-' KT1- ZmN-2F'c01-- J O-5-Zywcn :wg Q -: '-" -' . 'Tl ' '-"-- "U.., UIF' - ' mn LTIUU- '-'l-'HZ4 - 4-i C--'UQ' Z " ITD' ' '-- N' F X Q Q 5 71' E"V'4Z QPU ZW' ' Z l"f'-'V moz- -- "I-13, ' Off" mi N "" 0-1.' 3:33 JU7m""' I-1 -' N 3 "" Q Q S Z"Uo.Fnm-xmO- 551 - '-'-6- 77- A1 ' - Z--CCL -10.-.rv :,UIE'Um:s452-5' "" Icnff QUHIZM: -5- 0 -P10-F' J "Off, Hgh QZJZ 'UVWN mm' O Q Q 3 -1,5 42-Bmw, an-1 5 Z -Qg...Q5nZ5fE2,O2.'z135'ff.S.5-.,571731:qfvU'1.:!vg .850-,O 'Zi-. '51,-5? COC-5,2Q.,,g":5 5:3175 Q QQNNS 4g',Z0'3"5'q5'Y2,3-'rg Cmlbm O- C 4-+:15.,.-,g,-Cn-gfmmgs 09,552-F-5.5 FU,-ac-OUT CZ5,-Q04 in --OG-:Q-l E ,-,E.Om:,l-of-PC'3.Q. 4-v--ln Q Q Q ' -- -4 cv ru -, U1 G QP ...,l I rv'1 0-IGO , 0... .......'-W: 91343 X QEQQ 55 2355525 Eggi Q 3 5E535i?5EFsS535E EmE5m5g5mg3Zi 3555 555555, E 55525555555 5255 QQ QQ '- "1 "...-- D"'m - mf-f ' " ' - :ww " '40 - 53 mz551f'-- Q 5. -ff "Q: A .. QQ Q5 g 25.52 5 L-'OA' U S F'-OPS 'S' ' Onom 35, mn ff- 'mmm -0. 5,5 dw :S - 3 -0001 5"n 05 QQQQ 0'-Q HZ -:B in - '55 mmm " "P '. O ::r"1."mCZf"'-m 54-0 5 3-F: w 'ADONFU G : -b QQ QQ rv em mm Q .ff ,...,,O,-H5 Jw moo. m -1 no. 3 . Q4 3 Q :x ,y1:sQ5 B, 3 -Zn an-,,, 5 ew. QQ QQ Q. Q4r3P:15' o C 'Tl U5 39155 ami' 5"Dm,rr1 0- - O ,un Jw JP'-v ,7"'T1F' P5-, - .-Q 3. J 5:1114-U D 2' QQ QQ -- - 'rm -1 ' Ja Q 0 -N: 3,-r. m wUm5 . :S , Z . 04- 55- 1' - 'Q F' awww- :1 Z m QQQQ 5 wma B -w 5 5 5 55555555 5925 Tw S 5 5 z 355: 255 3 ?'5 Q 5 50 S B ' 2595 QIQQ Q5 it O 'no' Z - ' ' -1- 9.S'1'-'Q' - 95 ' 2 5' 'J ' Emma," F3 O E '4 U ,T '13 ' 5 T1 513- SEQ XQ QQ ." 3: U' '-1 uEf40"'3" 2 Q f" Q Lv' O Y' ' ' w 'F' C . T' 5'- QQQ QQSQ 9, E ' Tn- on ' w"'5:'7J - 5' W If P3 P msn' 3 U1 - QI-n QQ QQ QQ -o ' m 3, " lf- S5 5' :x 0 - ' 5 -1 - P 'Q Q U, F1 CL OM. Q32 QQ QQ fn 3, ITT 5 - NN -4m UQ - P Q S I-rg , 3, mv 24 0 Q - P MEAL QQQ QE QQ ' - ,Tl 0. m ' 'S' '52, f Q Q ' :. fn S 'Tl -1 go? RS? - , - . 3: ,., Z - ff H QE ES U7 ' oo- pl C O T1 91 'TI ' cu ' " ml QQ QQ - 'n - Q .E B ' 1 - 'U -1 2 r' QQ QQ -n - mg cn 0 71 ln F7 mA ' W 'Q '-E XQ EQ . --. - cz. ' - ' ' U QQQQ S z 5 1 5 W f 35 XQQQQQQ ' . - . O. XQQQQQQ QQ QQ QQ QQ QQ QQ QQ QQ QQQQQQ 5555555555555 5555EE555E5E555f55555555 55555555521555555555555555 f5515521I51 X: QQ mo:-.5-zzmmnmm '-egrmr m 5 054 frm- O-nm-nm'ZZ"f'f'0'L.54aw 5'9i'92LL m ' ,'PP P QQ QQ 3545:-,,,.,.:g--an zm ,ug-I mmmzzzzzzvmooox. -2024-7 .--nu,-.1 01521-f'r-oc wwmz-ZA-4-Sanz -nf'-4'44Q2CFf'5' xQ QQ - m. - . gr: z F U11 yvy-ywmwwwwwzgncmmw z-II1mwQ- "':0---- -GJ" - ZUUUUUZ- ,xmvw-mm-mg QQ A2255 55 qw 255.5555 m5fO5-mfM55255551Zmwwzgagmszfafmmfps QQ QQ rn IZ-55.251-H gm- :Q 0-..7UZ'f1ZZZZZZ5E3Q!"Z ?3.g0.F'U'.g4Z-4Z-m- om-45"-Up. Donny? mxzf ??wnEZo- QQ QQ 0092725-'HZ I5"'Iw:"IO0mzfQ c:o7"""' FM.-0 r- 74 'X 'obrow Z-2 -ZwKW2L5d-OFZEXZQ '::z9ZQ- QQ QQ 353, 533,55 ,9g?nQ1f1y3?pC.mgf f1QEM5gzvnrj00O'25',55Eg,'?,Q5S7,'51zrQ,Iw1w5Em32,39 4- ?1Igf5g'5zz4,I9L,z7,gQgQz1- - mfg QQQQ Q5 0"w0?Q.":,ff'1mI:W'z'Uw'1'r0mO9'fmI5m5f'f53m'f:ZO"-w0'Z'25C0Uf5'EQ?19'u.Q- 1'O'b"'222C-AHF -. 595550552 qiixi QS QQ 7035-I' omwPZZvO2S-125:-ZS E"O Swfo :7UW"""3'?.'7"U:'ff1ZZ',F-1WZOZPU ,:5'Z-L 33ZQ0"'rOf5 2:4-4 WFDQS-40 QQ X: QQ -5 'nmmrrz-,-56, 45:11 0,,,P1:4OmzmS 3, 'f1:Q4OCC:,Z-x :onvm-I4 cLO.mZo5m. 000510 I bw- gzg QQ QQ QQ --C - P -I -no.-UEJNU W1 ms r-U-21155.12 Z.:-C 3, IV' I--4 -NMI' -.-w.5z---P.-- O5 7115055-0'1'l WP' , QQ Nr QQ mg 'FHIKHIWOS GW-Cgimg Z' ZF -'-vm-U75 rf1r'f1-.rf1:f'o -" "' Cum" U0 7' 'ml FCM n'lmmF'Om- V QM QQ QQ 0 W m ,5,:,,,,m U1-o.,.m,z -5. '11 m0 0 - mUcn.4.7: ,: fy Q-"'C5,.Z y,:10rgIF'l"o 2'--4-' BUZZ: INQQQ QQ QQ 500. 53,1---wU57i:C1 -z.nQ.,-05-!'U9lhoC5E,F2l-y-5,'- ,B -U-If OmE,,,5.,mI. 0-I,WZm go Nwqwgnncw El 5 QQ.. QQ QQ W9 9.4: 05" og Q50 iff r11m"Nm-- ' 4- Q nn.: Z 214 'Uni ' - ' "'fQc:um' O' 'O' m. QPFI Og-,0cn:'F1' Og A U QEQS E55 5553935IWgE5Sb?w?m3S3SQcg?5g5 52wEEZQ 50 5555? QgCS55Q?5g:gE?x?E55 gb.525iP-ZC5Q 52 QQ SQ 534 ---p.u'og:,' ,. Er'-1J9.40'0 '.,'5,'Q5'3cL2' -RSF? :x Ng 23" JO- -,w2J5'.-Q"fSf:,0 wwgimrlz ":F'l"f+'5C1'5m-'QD 3, QQ QQ 'Ng' 0 -'o 40 :Q-Qf",.1:,'unmU'O F"QffF05f-', F' Camp? rn :sn nf' :.l- 0,,'5',,!":,3f- Pg-Oo' Fmn Q-0.517 3uQ---YJ-, Q-45 -U-1 X2 QQ 5:-f CFOS"'1bm-1 --H5-Nwfurmlori'-2 f-e500 .mfv fn :S 0.0 - :1-- 'N rv .-Q' -1 :QQ Emir- . 3'0n - C14 QS. wxxxxw QQQQQQW ,.,-Q ' .-...N-1:10. Wmwm --sn. 7' :rg '-Z-135-'-' 3mN 0 ro O qua: -5?-5 - ml?--OmrQ,'T1f-15-1' l-' m,pcCF'O VW- Zn- E Q Q -O U7 W 5"r-fog OC' 50 5 "'OQf-fU7Q-l4- V915 Uh-153m rv l"3 IH C Q 53 .'2.O--1' --na,-,f-'-S"N 5- SS-'-1 Q' 'HH 5 Q Q :1 . 100 :-5 :nn :"'C-'Greg-'14 - 35?--1-M15 ' -Q on nf, .-,C5 0 mo- : 2-1.1:-5 5 5500, Z- Q-1 Q Q Q ' "'OmfTcna OW ,.':'wCff-.'Z- 5 Z-rf w gm WD ml "Mn :'U-oQ'UC'53?'rr4-,g-yo, 'Swain -E Q4 Q Q Us-15-,mn :IS 511--mm, ' ng. Uv.-, ,.3,E-- 0 'gm Q, Km- 5- --5"c fwa' -:asf-om Q O' Q Q95 23?-52-P S5 5'i2-,QQ22wF'15 Q' SQ 55273 Q5 SO O51 5 W' i3V'1?f?Qf35'5 Poffss 5 5 as 2wQ,,5'5z5225 fn 5 55C QQ 0-5 5 5-Q5 Q 'f1S5,PfQ2 1529 'Qui 5 M5 pn FE' 1457 fw:a'-N0 'rl 5 . ' P11 o. 0 9. ' mx 4 ".'mP: 5? Q QNQQ - 'wg' Q4-5 -Sm: mul' ' 350 -5 Q - :Q w fv w - - uw? C Qi- Q Q C 21 53 Qgi? '52 C fz 55 Em S5 C m 5 2 Q mm P1 Jim w 5 5 . , . L V, , Q sn T3 ,Q pimp, 0,5 w 3 55 Tam ,nag 3 ,F1 my pm Z Q, Q Z S - SU, Z 5' Q 0' Z- -1 r' ' 75' m' ' Q - 5? mm 5,5 - 5, - E51 A 73 P1 F1 - Q Q m 'r1, we 5 3 'ri 'ru 'n Q Q3 Q - -, - I , . . Q QQQ QI? Q Q Q Q Q Q X Q Q Q16-Q Q15 Q Q Q E Qyxxxixxxixxxixxxismixxxxxxxxxxxxxxxxxxxxxxxxxxxtxx xxxxtxxtbrzzrxtrrtrwzwwQQQxxixxxixxxmxxxixxxxxxxxxxxQ:X:?m :mxEm?:Qxxxxxx?xxxixxxxgixxxxstxxxxxQxxxxxxxxxQxxxxxxxxxxxxxxxxxxxxQxxxxwnxxxxxxxxxxQxxxxxxxxxxxxxxxxxgxxxxx QQQQQQQ QQQQQYQQQQQ www? E1 S Q Q Q Q """ "N" , f ff funn, ff sw 1 1 5 5 5 f W , , ., f,,,,,,,,,,,,,,W 111f111111111111f 5 . ,i 4 ' 4 . e . ,,,,,,,,,,,,,,,,,,, 11111 1111 111111 if - l 4 .t i, t -i t t t 4 4 if if it if ir -k -k 4 -..1., 1 '14 4 4 ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,4 LL ii 1. 4,,,,,,,,,,,,,,,,,,,,,,,,,,,,,W,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, 4 4 -14 L L 454 4 4 4 4 4 4 4 f X 4 4 4 4 LACEY, JAMES J. OVERBAUGH, MERRILL H., Infantry. 4 At 4 4 LANDER, MILES K., Ordnance. OWEN, GORDON, Private.. 4 4 4 4 LANG, ARTHUR. OWEN, HALSEY T., lst Lieutenant, Infantry, A. E. F. 4 4 4 4 LANGE, HERBERT A., Engineers, A. E. F. PROBST, FREDERICK L., Government. 4 't 4 4 if L W ' ' V W A ' ' 4 f f i 4 ANGE, M. W., Znd Lieutenant, Engineers. PACKARD, ERNON .. Vllat-1011 7 4 4 Z LAWRENZ, ROY H., Engineers. PAYTON, JAMES M. A., Aviation, A. E. F. 4 4 LEE, BURR EDWARD. PEACHEY, JAMES. 4 4 4 Z LENTz, ALVIN E., Infantry, A. E. F. PECK, H. B. h 4 4 4 4 LENKEL, ROBERT W., Corporal, Infantry. PEDLEY, T. A., Lieutenant, Infantry. 4 4 47,44 LEVY, ROBERT F., Ordnance. PELKEY, HEBE H- , 4,,,,,,4 44 LEWIS, ROY Eu Ambulance Corps, PERCANDE, ARTHUR GEOI., Radio. 42 44 42 IIZIGHT, ROBCEERT F., E-iviitcg I'l'ank Corps.I f IIZERKINS, JOAI-IN R., list Lieutenant, Infantry. 44 X7 64 INDBERG, USTAV ., n ieutenant, n antry. ETERSON, RTHUR . 7 gf LINDOXV, RUDOLPH F., Industrial. PETERSON, JAMES D-, HOSDiK21l Corps. Z 44 4g l-,1P5C1-IUTZ, I-I, Sq Field Artillery, PETERSON, OTTO N., ,Field Signal Battalion, A. E.. F. 4 34 42 24 LOGAN, LUCILE, Government, Shipping Board. PETT, HARRIS G., Private. 4 IIZOOMISLIJOHN L.bCofpoExl, Hospitall Earps. A E F EHILLIPS, QAIEJLD, lst Lieutenant, Infantry. 4 9 Zf ORD, ERBERT ., st ieutenant, n antry, . . . HILLIPS, . . . 4 E! LovERUD, ALVIN M., Private, Field Hospital, A. E. F. POLACHECK. STANLEY. Enslgn, U- 5- N- 42 54 MCCLURE, R. A., 2nd Lieutenant. POLLACK, HARRY A., Sergeant, Ordnance. 4 42 E4 MCCOY, WM. J., Marines. PORTER, CARL E., lst Lieutenant, F. A., A. E. F. 4, 54 42 MACDONALD, ROBERT PAUL, 2nd Lieut., F. A. PORTER, JOHN E., Aviation, A. E. F. 4' '4 42 MCGINNIS, DONALD WM., Chief Storekeeper, U. S. N. PORTER, PAUL, Corporal, Infantry. 4 94 45 24 MCINTOSH, CHAS. T., lst Lieutenant. POTTINGER, CLARENCE A., U. S. 44044 410,14 MACKENZIE, AMES N., Sergeant, Engineers. PRESCOTT, D. S., Lieutenant, Aviation. 4 4 4 MCKINLEY, EORGE, B., Sergeant, Infantry. PRIBNONV, W. H., 2nd Lieut., Aviation, A. E. F 4 4 4 4 MOMANUS, JAMES F., Znd Lieut., C. A. C., A. E. F. PRITZLAFF, EDNVARD F., Sergeant, E. F. ' 4 4 4 4 MCMURRAY, ASA R., Aviation. PRIEXVE, ELMER C., Private, Chemical Warfare Service 4 4 4i.g MCMURRAY, MORLAND J., 2nd Lt., Infantry, A. E. F. PROBST, FRED, Government. 4 i 4 4 4 McWILLiAMs, GLENN, Hospital Corps. PUCHNER. I. A.. 2nd Class Seaman.-U. S. N- 4 4 4 MCWILLIAMS, JOHN, Private, Hospital Corps. PUTMAN, RUSSELL L., Cadet, -Aviation. A 4 4 4 IKAAACHOWSIEI, JOHN EIENVARD, Prgaltie, C. A. C. SUISG, EIGSESSONFANIESLAVi51ticoinAFcgeigAn.E F 4 4 1 AHLON, ARADINE, er eant, . . UI LE , is ., s ieu . ,... , . . . 1 4 4 IRAAALLOY, ED1iVARDJ.,Sriggate, Avialtloni A E F ERXEDER, LESTER Xmblst Litgatenant, Coast Artillery. 4 f ARSHALL, ICHARD ., er eant, . . ,... AMSEY, LOYD . ecease . 4 f MARSHALL, THOS. GEO., Assitant Paymaster U. S. N. RAMSEY, JOHN R., lst Lieutenant, Aviation, A. E. F. 2 4 4 MARSHALL, WM. H., Sergeant, F. A., A. E. F. RASMUSSEN. VILAS, Interpreter of French, A. E. F. 4 4 4 4 MARTIN, CLARENCE, U. S. N. RIETZ, O. A. A 4 4 44,1194 MATHYS, LOUIS, Marines. REID, WM. H. E., Aviation. 41111124 MATTUSCHEK, ERVIN, Machine Gun Battalion. REIF, CARL W., Ordnance. 4 42 44 MAYER, CI-IAS. A., U. S. N. REINHARD, RAYMOND, U. S. N. . . 4 MAYO, F. P., 2nd Lieut., Aviation, A. E. F. REMSBERG, OSCAR Z., lst Lt., Machine Gun Batallion. 3 44 45 44 MEAD, HAROLD W., lst Lieut., F. A., A. E. F. RENTON, ALLAN, 2nd Lt., Machine Gun Bn., Hawaii. 4 34 MEIsELwITz, A. W., Coast Artillery. RHODES, EDWIN JAMES, Sergeant, Aviation. 5, 45 24 MERRILL, W. D., Hospital Corps. 'RlCHARDSON, JAMES M., Znd Class Seaman, U. S. N. 45 4 MEYER, ERNEST, Field Artillery. Deceased. gg 45 24 MEYER, WM. FRED, Private, Infantry. RIHA, JOSEPH W., Coast Artillery. 42 MEYERS, PAUL D., 2nd Lieut., Aviation, A. E. F. RILEY, HAROLD F., Q. M. C. ,4 4411144 MILLER, EMIL, Infantry, A. E. F. RINEY, GENEXIIEVE, Government. 434,54 4 4 MILLER, FORESCIS FP S. dA I C IEOBERTS, 5-LEQVEY, Sergeant, Signal Corps, A. E. F. 4 4 4 , ILLER, OHN ., rivate, e ica orps. OBERTS, . . 4 4 4 MILLER, JAMES C., Private, Machine Gun Battalion. ROBERTS, UNIUS S., lst Lieutena.nt,.F. A. 4 4 4 tug MILLER, RAYMOND, Ensign, U. S. N. ROBERTS, ORGAN E., 2nd Lt., Engineers, A. E. F. 4 i 4 4 4 MINKE, A. J., Engineers, Inspection School. ROBERTS, ROYAL A., Navy. 4 4 4 tg MOFEATT, EDWIN A., Private, Ordnance. RODDEWIC, GIL. F., Government, A. E. F. 4 4 4 4 INIJIIOODY, ,QEOIEN L., Assistant Instructor in Hosp. School. SOGERS, ALFREDCIQAL Hog 4 t 4 4 OORE, . . OHSENBERGER, . ., r nance. , f 4 MOORE, GEORGE T., Machinist's Mate, U. S. N. ROOT ELNVOOD, Private, British Hosp. Corps, B. E. F. 4 in 4 4 MOORE, GLENN EDWARD, 2nd Class Seaman, U. S. N. ROSE, Louis. 4 4 IFZIOORE, IEOEERITJ Iiieutenant, Infantry, A. E. F. Ross, lDIOROTHY,l-Goxgrnrnent. A E F t 4 4 ORSE, . . ,... oss, ERBERT ., ngineers ,... 1 4 4 4 MORRISSEY, R. P., Sergeant, Ordnance. ROSS, WM. H., 2nd Lieutenant, A. E. F. 4 4 44,44 MUELLER, ALFRED D., Private, lst Class, Infantry. ROTH, E. WVALTER, S. N., F. g 4 gg IVIUNGAVIN,-IAMESF.,QUEil't61'l"l'laSl2Cl'SCl'gE8I"lC,Q.M.C. RovE, LOUIS C., Private, Aviation. 440044 45 54 MURPHY, MARTIN, Infantry. Row, FRANK D., Corporal, Hospital Cores, A. E. F. 42 45 24 MUs1LwITz, A. W., Coast Artillery. RUMPEL, ARTHUR H., Private, Sanitary orps. 41 NASH, LUCIUS B., Ensign, U. S. N. RYALL, E. V., 2nd Lieutenant, Infantry, A. E. F. 4 NASH, NEIL E., Infantry, A. EDF. RYAN, WM. D., Private. I ' 45 44 NATHAN, WALTER S., Machinist S Mate, U. S. N. SABERHAGEN, E. E., Engineers. . , 54 4 NAVE, C. W., 2nd Class Seaman, U. S. N. SAECHER, CARLTON E., lst Lt., Artillery, A. E. F. , 45 54 EEWTONPJAJ EGRIS, liladustrial. QAUNDERSNFAIRFAEGC 4 fg 2, ICOLL, . ., . . . CANLAN, ARION ., overnment. gf IIZIIIELSEINLJA. C., Cleief PetFyFOfIilicer, U. S. N. ECHACHT, HRRLANDLG.SHQspital Corps. 4 fi Z4 IEMAR, OSEPH, orpora , . . CHLIcrER, LLEN, . . I . 4 gf NUzUM, WILLIAM, Ordnance. SCHLOESSER, WM. C., Industrial. 457044 NYHUS, PAUL, Znd Lieutenant, F. A. SCHMIDT, CLARENCE, U.AS. N. Q 444,44 4 4 ISIYHUSCWALTER, LEeluEena3tSFNA. ECHMIDT, EDWINA2l'iClgi.3El,1I1Cl'I3nC, Coast Artillery. 4 4 4 , DEN, ONSTANTIN . . ,... CHMIOT, ARL ., n ieutenant. , 1 4 4 O HORA, R. M., 2nd Lieutenant, F. A., A. E. F. SCHMIDT, OSCAR W., 2nd Lieutenant, Infantry, A. E. F. 4 4 4 OLIVER, GEO. P., U. S. N. SCHNEIDER, CLAIRE, Radio. ' 4 4 OLIVER, MYRL L., Aviation. SCHRADER, ALBERT LEE, Radio. 4 4 4 t4 OLSON, V- A-, U. S. N. ' SCHRADER, HERBERT E., Sergeant, Infantry. 4 4 4 OLSKEFSKY, ALEX. J., Private, Ordnance. SCHRANG, EDNVARD. 4 4 4 4 O NEILL, CLIFFORD R., Znd Lieutenant, Infantry. SCHREITER, HERBERT G., Private, Signal Corps. 5 4 OSBORN, GA A- I SCHUBERT, I-IAROLDJ., 2nd Lieutenant, Infantry. 4 4 4 OSGOOD, WAYLAND, lst Lieutenant, Infantry, A. E. F. SCHULTZ, ARLIIN D., Aviation. 4 f 4 i . 4 x 4 2 2 4 4 -A-2 2 i' 4 4 'A' Ik if if IA' iv ir ...... ,... , Z2,.1111llllllliillllliillllllli111111111112 'lr 1k ir if -A' 'A' 'A' 4 4 44W4 f . Page .370 Q 5 , 5 I xxx QQ E Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q QQ QQ NX QQ Q: QQ QQ QQ Q QQ Q. Qs QQ QQ QQ QQ QQ Qs Q5 QQ X. Q Q2 'QQ QQ SQ QQ Q Q Q X Q Q Q Q . Q Q Q 1 5 x.x,...s.x x,sx..s ,x,,,xx,x. ..xx,,,,..,,.x. S 3 x.xsx..N.xx.xxN., Nxxxx Q ,.Nx.x.Nx S 5 .,.x.X.xs.xx.x,.s.,.,..xx,..x. ...x.x,......xxxxxs S x f Q Q I- Q Q Q- f Q Q I Q f' Q X' iQQQKQQQKQQQKQQQRQQQQKQQQQQQQQQallIQC-KillCCQQQCCCCCCCQCCQCQCQNCICQCIQQCQICQX-.QQQQQQQQQQQQQQQQQQQRQQQQQ-QQtxxxxwRCCCCCCCQQCCCQQCQCCQCQCQQCCQQCCQQQQQQQQQQQQQQQQQQQQQQQQQQKQQQQQQQ QQQQQQQQCCfill:R112QQIQQQQQIQQQQIQIQQQQQ-QlllllllI1l1iQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ-MQQQQQQQQQQQQQQQ QQ' Q Sxxxxx Q S X Q A-Q E1'Q Q Q X Q Q Q Q Ql'Q Q cn cnmcnmcn cncnmmm cncncnwcncnmcncnmw mcnmcmnmmm cncncnmcn Q Q Q - wcnuzzns-ooo-Wwzzozf-e mmz. - rn '- - 33333: 5m - m 'f Q , Q Q Z mmm:o7u:v2r"r"r'I"r'r mpg yqwr--:mm :Zz-'7U3QCZ CCZ MZ WU xr-0-I -:pw -vb:-17112010-'r"7v'-124 Q Q Q UXp:U::zzzNNww"r'xZ02 mxC:7'3g.4 ETH., Q po., .Zm H-'QmcFrmFmuv-Ur'wZwmIIII1-nrCmZm-sm:EbxwF1-momww--4 . Q Q Q -1'w'U1mmml11'33I5EmOImZ m"!'QV'm-3'wEg5navZo-Z wm4 Zff"'9mn1m2F'1c:f-47:1 "" 'mmZWc1?"r'r,5-m7',.'7'-r-rf'b0'Z5 Q Q tg 'Q-- g-cwwwwnmf.p.Z'z,-QIQPUEQZQ. 15-.,m -m-131.-2251-'wgfwwgy7124--0173505-Qw'w6mmOxo5m.l.Z9,.pz,mgE,O,,., sim Q ISI'7"""5E'0CJ'-1-1'a.. 4-4m'-r1zO'-OmmC3O-egF5"110'3'P'-MOZEM L' ZU74QU0"1"mC'Q7f"I 5?'Um'Z1'QIw' 7'Qf""!'15'1 3 Q Q mm'Q?E'OU7IE2m'mpIT1' Im:Qz--13,-q-qzzgsimz QQQQQZQQQI-2wmCOm-3 .o-Igro-9C75'PfUm2D'!-ZO'F1g,i nf' ,..-IO Q Q Q ww-oi mv--lmrf1oQ,',UQ,.,'-x.QzZ-mfg, w-0zCQ',.FH-om:Qf'm2QZ,-r'1f'3:HU zQ-:.4fI'W ',WH-HPQ-71'gZ'.-nPrQBZ,,fQ.12V1'i QIQQ Q-Q mm, pqrpwqnm-ugwzg wzg-r-:O U7,C,41-mg-mg Jzfmok-2IW,,:,4Q-I:-og 5'3Pp: I-gmmk-.m :vc-ElmoUqm?4UQg-:c,,.c M711 Q Q Q f11ww'UbZ!""'-121-nox-S,'2Om.mo IOW-W -wg,7J"l1-157 Q: 'mZ-HUT, U-C7'ZQ1-Of,f'mm0f-'4g-,Q:O'4"O-"F-:Sr-0 Fr-7U7'w'7'f'nfv'Z 3 Q Q Wkxlqn QP rmm"wE mCyZ'm'00wHrCQ: 3 Pow 5r?UwwS-m ':U:3'mO-S l4Smqv1Im OZZU-mm H'G'U QlfQ ig ""f114Ir-V' ZUU-,f.lm"'l"0 4'.IQ-S.'N2'U-:- I-0110, rvO'P'. U73 -.fQQ- N,-UI Um-Q :4Z'U3.'OQ17'zIF7- -'ZIzmlQmO-4 S.Q zswmm. K": G- Z-rw'-ng mfhm-D5 -1' ' 'ipln -Q '-'5 -N- ZW: Qgb- -1: :Dwi C --UQ P 1? ' ' ' Am 4 ' TU-UCUPG, :Q-Q Q Q S OQ'?,!PUg Fm-2 3' QU: nam.-32'-UDQNJQWUWQ fl 2:39-m :.4cn'i3-.Q.-4 'NSD 1-QCZ45-N.Q,.1W7m:,m 15-.,.F'H'9f 0.3213 Q Q Q ' 'MN' imc' fewyzbggff' 5f,U5.2' J01".f.5U1mr'QP 'PPO' O-ww 'opt-rj' -'GWB ' 217 OU- "' N: E0-35:'?Dq2m5 OO' mF'Ug I-Omg-'Y"f'vF1 S S Q .-mg Z O H -1. 1 Gwinn. :.3Nl' n2,Q,o.,,,- Faq ,mb wkgvv-. Cm-lj., Fw.. ., J 3D.w005-an 54-qi :aww Q, C,m:,-I -12 Q Q Q w"cJ-751' 511 'QQ-7':'.,. :Sw Q 4--ng'-Q1fv,,n -Qr GC go. 5501141 sniqpw -'Q I--C Q --Am wife TJJ9, :Em -4-wo ,Q Q Q QQQ E?r3QQZQ5gQfa?3Q2Eg5 vga xgEEQ?Ea s55sgg555msEm5 QQ? SEQ? F522 555ggg2i33szE5ZwgQE5 33 QMS QQ --f"", , '1m"", g-. Qrv ' . 4: N., -1 I-fn .-.' . :1",-V., ru 4: -IQQ ... -Q ' C vw--rj 5'-' , -Q. ro if mmm WO ml-"'3Q4:m Em.-v DV' O f-f3"'5 14 --Qf'OQ-J -Z - ,Q :mn --- GP' 0f"CQbf"l'Q-Q I Z'-'U 3 rv"' x QS Cfiggm QRQW' ni'-3,m,?,reQ-O E-mg' ,, :QPQD-OZ - S5-U:-sgc, 3,39 miin FI Z2 C0 'G234 a:U,rQ3m CQ -Qmcm ' 3 QQQ 1-fo,-,. un GCN---3,-1O..,: :sm-1 3:5 on 5 B, -1- 3, .mm-O.. J 551: 'PQQ gl Q33,-O4-'m2 .H ,.,-.3 -,T QQ S :1 CY' --'53-'FD:.""oNmfl mfr' 5 DQZDFQ . :Q .T 5. ff D C4 - JN -'EQQQOQTQ4 wxv Q, Q mf' 5: QQ aim of gn-m 'zgwgnv :nw Q gang: wg Qsw QP 'Za is 5 Q2 as 'w'ZwQw Wg JU- an Q QQ ggff, gp, N' C. mmf- gym 053 :s -0: :W P7 ... CD51 2. gow mg an :1- Q V' QW' E,-1-1' - 'Q'--271 :QQ QQQQ Q . -. -nA "53,.,..D G., :Q ---f-.3 :N IAQZ om ,Ng-1.,. .C - 5-f UQ WMD Z 210, ff. QQ Q QS P? "- 2- 'TJ '4.-Q 5--0 mf! mv Ozrvf' 11 'A UV- :Q wg: -:s 0 53.91. Q0 ffl 5 - QQ Q .QQ - 55 . 4,,- '-5,500 51" ' E-:FV . :Tn .4 '-rl :sm-. A- C 5 O mm 71,-0 c O - Qc QQ Q QQ 3C 3-1 'Ja Q-fm,-3 f-v Nw 37 , ff,mQ . P ...Q W-fm -1 3 - QQ Q IQQ F5 S3 m5Z m?22, QP Q52 :C Q QV2 P W m 4 mg of E HQ ESM QQ :s, F, 3,- fm'-1. -m mg- Q4 - 5 m 7. 5 om Q ' 35 QQQQ Q 2 - -' Q acf . UQ- ' Q Q F - .Q w - 'M ' H Q'QQ QQ Z ' rn 'n - VU M 5 :ww :J - . H U"'. U 'Fl- QQ IF' 5. ..fQw ' 'U 'UPA-SQ .' - 3, 'U 1 Wm Sh -5 Q QQ x . - m 4 - - . Q EQ T1 3' 77 ms mZ Z . Q 3 X 3 E1 mA 'Z -'55 " W 'rl fn 'f 5' To E QQ ' - -nf 'U 4 - Q H - Q QQ 'rl .' ' 'F T1 fo O0 .QQQQQ - ' ' ' WN Q QQ QQ Q QQ QQ Qi as 4 II? UJUUUJUJUJCUUUUJUUUUCUED 'UUUUCUUUUUJPJPBPBPDPDPZPZPDPDPDPDPPDP NN'4""5 " """""" "' ' SQ gjggogjgaggggjrqmwzqgjggargajga gjmmmmmrwwswwzb Wgbwwgjgzzzzzgggggggo pgbgggg-riff 25555555555-f QQ fum'3'0ZZUZm-Q-'izcopngzzwm -amcO 27""c-.Zfwwwmz-i5Mv"- mr mQ'3O'-xiZwF1?PP?'UEoF'm"""'Fi'l':A3595 N sg rZgZQpQ5E33ggppgggzfgpgzzisbwzgiagmmggniggggggggfmg Ffggwgiighwgwiiigg-gwf?g,UO55g+5 X 3 m ' '-'-' . 21' ' -Zrn' - '..-: """-"'-ax-. ' :. -- QQQ Q 55555Ugzaopgzi2?mZ92O?i.-NFg?Q5mgEg5Fg25w-Im3gf:?QQ Z?2?g25ag?531WFm75fP3?E252zEx9QQ CIQQN QQ .- K.. . -lx Z-mn-np x'mm,: rv: w mo ,o .' ,W rn 31 r' c 4, -c,' 47-..-,Q :,,"g P c: QQQQ QQ mfgrvgbifmmgm 'P A'7'I'r-I'1'4uQ0V'Z- ZW.-P m'Q-55'UcI:'E7USZm7Zz Fmfig OW9'mfQ 5"4OmQQf'mz-4O'Q:-Efmwif' 'NQQQQ 53 "'1'o3Q"5""2U'U'3,3QE72?QZ39QomWC'Z'm Qwgfofuml' 27's-ZS:-c-'wig "7 mwO'QFf4'mf'mS51f"4f1 wo 10-ofhmgm E QQQQ SQ 'nzmuw -nmOg:11S.4 zfw-w -Owmm'U'Z -'H .wi 'L' -wr-m0 2-409 Ohms-15 53'-4'Crm4,,EU11mr-551 -- -,WZIM IXQQQQ QQ : 2 -XC' PMQ--mo'F'UZE"'t'::"2-Fri-Z02'Q' Z 'U-l"4P3b :'Qn:F'U': Zr- -CWI 4:Q"f'rr-.mo--o-WW527' 'ff QQQQ Q - ' U3-ff-QCD. N -NU. 324 ' -- BZ W- 'Wg-.Z-I . - '11 O' - Og" Om am " ... CZ. ,.-N"'F1 F' . Q' 3 If IPIWUUQQ E70 '4---'N 74 UJ' Q 9- 5 0 i elm' -1 m"' r- :Q ang -1 O-lTlf'V 1 0- N ml-"Q W3 EU? U- - 31 ITL 4 Q , .. U, C. O... - UZBA :Tl Omwy, po Nga: QM: U ,I-. . 3-.. Q .... ffg I- :JUJQ -.3 sofa ,. Q QQ - - . P o -. Q.. No. 39" ff-Q - :. :O - C 'V Zi: 5 Q .vw -, - . m- ummm mmf-fwma T1- Q3 0,1 Q NEED Q'-GSO'-',,,: 3 1 :xg-mane! UF: mo- -Z f-v-nm 5-ma fzmcr--..-Oo.Qo CU--5: r:.f.5-3 Tl, U, QQ FFJQOOF. E.,,: my m - 0513. OCQJ- Sf - sa, wg., Q :QC-UOCQ. si: -. 5 ,.. wgnf --- O: -'uwaognffgf-2' OBQQ rf On QQ Qwmo- n - - '59 -- --OmCIbZ'f-f fvcw Q-' -I '5'.,-,33,.., Umm If-44'Oog.:4 ,.--.-.'uP. ca-' F:-i1 Q Q 'U U7 'Q 075m rv- H 4 -'fl 0- - UU--NME-Omg' Q Q9 " 510001. QQ 11004 '4-1 -14 mac--Q11 Q QS 'T1ug'UA"'I1 97,'Tl.,Z' "' 5-5mg,,Ull"g ---' ,HNCOC Q mmg. 42. 30-UQDIQP ,.4 SSD' mf-f Q, 4 4 .,-Q-, - -'O-4-- ini- 0 Q yxxxxxxg QQ 'WFS' Q4'2"Z3. K,"-T O-",'5"'ZOUW'f5'A 53:1 :ffl N- FH-:moz Qo -'w:ZU9'Z: Q SVSU: 55 2 0:f"cnf-EEN Q Q NW svn? mm -9' -Q4"3 ZC':g'p'5'-5'U"'1 01 O." ZUNZ :sf DME ,""'T'v 'B " "'5'3fAD 'JDJ' C""'Q'?f 3 Q Q ff-li: '-inn 5 ..-1OZ.f-'N Zora. E. Z5 SE. 93. :TNPPHU-1 Q BO 5 Cf, :x Doo gf- T1 52. Q Qs X , ,. . 0' S 'V 5? Q-Q 9'-1" msn -3 Z ' cn mmm Q. -Q: 'FM U1 -000 3 "':5C'U :1"P :TI ZW - Q Q S 570139 -'U-5-' Qc D 5,03-S1-fi ' - ' 5' 91:11 0 mnpmbw' :J O33 Q '5"f"fQ 091 cs--b'593:s Q Q Q :SEN 91:11 - 5.-8535, 5-:D -gf UQ.-,ff ot" :gQ..4r UQ any :x ..,m'gn-1 0- 52, :fo-5.5. Q Q Q u3"w3PlT1 20 JP J 5 ""'1' 9--Q 'V ' 27' 3 m"r1E5' 5' 'pi 5' 'DD S5 P FQ- -1:1 Q Q .X 5.1. ...vi . F, pub... --. Um rrvry-rl H- L4 ..,.,O Q U :sm L3 . 5 on Q Q Q m VVQ, -1 - P '-'Sim N3 3" - --'Q Q ?n"'U I "'-' . QP' -1 I X L Q 2' 7 ,g W F BC lam Q2 Fwy ?5 Q 1 SS a is 3 Q2 3 W -nm QQ QQQ QQ sf' .- QT. wg, -34 3,-1 gn - 'F' ' fa: U O ' gr 'Q Q Q Q mo 71 EU, 3,-. Q - 3, :zv m I' Q2 :,- 3 O 71 -:TTI Q Q . ' . I Q' ' 'I 1' N .12 52 Q?-i Q FU- Em 1 E- H 51, +1 Of Q QYQ Q ' . . :. Q Q E '3 N' E I W m S Y Q Gm U Q Q Q 1-Q Q. ' S 1 : Q UQ- Q - Q Q 3 2 Q ' 9 T 3 51 F m 5i,Q Q ' ' t ' Q 'Q i-Q Q Q Q Q Q Q Q X , 4 X 2' iiixgixxxijQQQQQQQQQQixTxQQQQQQQxxgtrtrtttttrrrxtr2:1XQrzrrtbrttrrrrrtrrrrgxxx QxxuxiwiwinixQQQQQQxgQQQxtrrrrxrrtQQQQQQQQQQQQQQQQEQQQQQQQQQQEQQQQwivQgxxxxxxxxxgrr:XtraQQ:XrrrrtrtrttrrrQrtttttttttrttttttxEQQQQQQQQQQQQQQQQQQQXNixxxixxxi t 'Q X - Q N Q ' Q Q.,Q..Q..Q.M.QQ.Q..Q......Q.QQ.QQ..Q....Q 4 X x Q 'D sn an N w Q1 Q. A 5 1 5 5 1 5 5 xxx Ns K QQQ 1 11 M A Q., , Q f . . 1 ' I . V Id- I 4 ' , ,. ' I awffmnfw-if win-Trina-A1 7 it21111111111111111111111111111111111111111111111a11111111111111d I . 11 411111111111111111111111111111111111111111111111111111111111111Z at Z f f f 7 1 -4 RVL L f I 4 4 Z 2 V 4 1 4 5 4 if af 1 1 1 f f f 6 2 5 4 if fir A f .1 4 f 5 f ' -A P LMMZCICI USNRF ff 1 1 BRAAK, GAIL VANDEN, Znd Lieutenant, Aviation. FISBECK, INLEY -. - - rl SSS, - - . . . f f Z BRAUN, A. C. FISHER, RICHARD G., Ordnance. Z Z I 2 BRENNER, ERWIN C., Private, Engineers. FITZGERALD, ROBERT DRAKE, U. S. N. 5 5 Q if? BREXVER, RICHARD W., U. S. N. FITZGERALD, LLOYD, Sergeant, Infantry, A. E. F. gi Z 9 I2 BREWS-I-ER, HERBERT G,, U, S, N, FLADOES, IVIARTIN O., Private, Hospital Corps. 3 I Q Z BRIGGS, N. R. FORSYTHE HARRY-IH.ECanadianAROgal:Flying Corps. Z 7 , f BRITTINGHAM, LOUIS. FOSTER, ARTON ., ngineers, . . . 4 7 Z 2 BROWN, GEO. E., Ensign, U. S. N. FRANK, R. A., Sergeant, Engineers, A. E. F. 2 Z Z 2 BROWN, HARRY H. Private, Machine Gun Bn. FRAWLEY, JAMES R., Asst. Paymaster, U. S. S. Shaw- 5 Z 5111111 BROWN, REUBEN, U. S. N. mutt- 4 311211, Q Z2 Z, BRUDER, EDGAR G., U. S. N. GALLUM. EDWIN A-. Artillery- gg gg Zz ZZ BRUEGGER, ERWIN K., Private, Infantry. CAREER. FRANK W-. Hospital Corps, A. E. F. M 24 BRUNS, DARWIN, Medical Corps. GARNER, EDW- G-. Avlatlon, A. E. F. 1: if X 1 1 1 . . 11 , 1 Z2 Z2 BURGESS, C. W., U. S. N. R. F. GAVENY, STANLEIOH K., Aviation. gg ZZ ZZ BUTLER, MERRILL F., Sergeant. GIBSON, J- CURRIE, Infantry- 52 Z5 sg +CAIRNs, WM. B., Sergeant, Infantry, A. E. F., France. vGlBSON, PERCY D., Chief Petty Officer, U. S. N. 72 jg Killed in action July 30, 1918. GILDERMASTER, EUGENE O- , 22 if Z' Eg CAHOON, EDWARD D., Ambulance Service, A. E. F. 96LDERMAS'ER, H- EOYIJOYSI- CK-HSE AYUIIXYYECF xg 4 CALLAN, J. G., Government. ILMORE, LBERT ., ieutenant, viation, . . -. 95 gf Z' 2 CAMPAIGN, HARRY JOHN, Chief Petty Officer, U. S. N. France. Died of pneumonia October 3. 19l8. Z CARLSON, GEORGE, lst Lieutenant. GLEASON, BERNARD ROBERT. C-21DC211'1 A- E- F- sg ZZ fi CARPENTER, CHAS., Lieutenant, Naval Aviation. GLEERUP, XVM. WESTON. . gg W 'Z CARROLL, LAWRENCE K., Sgt., Hospital Corps. A. E. F. GOEDECKE, WALTER S., Znd Lieutenant, Infantry. 92 gy f f Z5 13 CASS, DANIEL E., Aviation Section, Signal Corps. GOODING, RALPH. - E Zami? 2111? CHARLSON, MELVIN R., Assistant Paymaster, U. S. N. EOTPREIEOIIEI, If-IIENRY L., Aigiaxonllk E F g Z 7 4 CHASE, LYLE R, OULD, . ., ieutenant, . ., . . . 5 X 5 5 CHARMOCK ROY J lst Lieutenant Infantry GRASHORN ROBERT A. Pvt. Hospital Corps A. E. F. 4 K y 5 , ., , - , . . - 7 4 4 if CHIPMAN, HAROLD R. GREDE, WM- J.. 1 f Z 2 CHUDAEOFF, GEORGE, Private, Hospital Corps. GREEN, J. H., Infantry. ' Z CLAYTON, T. Z., Znd Lieutenant. A GREENFIELD, RUSSELL S., Sergeant, Ordnance. 5+ 5 Q 2 CLEARY, MAURICE, lst Lieutenant, Aviation. GREGORY, MAKLEM W., Corporal, F. A., A. E. F. 3 Z Z CLEVELAND, CHESTER, Cadet, Aviation. GRIEVE, GILBERT G., Naval Aviation. 2 7 Z COCHRANE, JACK D., Captain, Q. M. C. GRISWOLD, MILTON P., Naval Aviation. gf Z Z 5 COFFMAN, RAMON, Hospital Corps. GROSSE- JOSEPH A-. COYIDOFGI- 2 Q ffl? COLE, HAROLD H., U. S. N. GURNEY, WM. W., U. S. N. k Z Z ' ' COLLIER, ROBERT, A. E. F. HACKNEY. J- 5- .IR-. COFDOYHI. Engineer? 3 Z Z Z COLLINS, CARL H., 2nd Lieutenant, C. A. C. HADDORF, CARL, 2nd Lieutenant, Aviation, A. E. F. g 5 Z Z COLMAN, CHAS. E., 2nd Lieutenant, Infantry. HADVES, MARTIN A. Q Z Zfngg COMPTON, DONALD ELLIOTT, U. S. N. EAKER-j MILTON A., Privage, Infantry. Igfwgg gg 3 COMSTOCK, W. T., Private. ALL, OHN LExANDER, ergeant. 32 4' 4 CONGER, PAUL S., Corp., Q. M. C. HARDELL, ROBERT E. 45 Z5 2 CONLEY, CREDE H., Infantry HARDY, EARLE W., Aviation. 22 3? Z? ,Z CONLEY, EMMETT J., U. S. N.A ' A ITIATCH, VERNON V.., Sergeant, Hospital Corps. 42 3 CONLEY, HENRY HAROLD, Chief Electrician, U. S. N. HATCH, ALLEN, Private, Engineers, A. E. F. 5, ,Z Zz fi CONNELL, ARTHURJ., Medical Corps, A. E. F. HAY, WM. J., JR., Field Artillery. gi Z1 ,Z CONNELL, JOHN W., Private, Hospital Corps. HAYDEN, CLENIENT DONALD, Private. gg 5? fi Z5 CORINE, GEORGE A., Inspection Division, Ordnance. HAYES' LOUISJ-, Aviation. 9? 27 CORSTVET, THOS., Engineers, A. E. F. - HAYES, MATHEW R., Radio Electrician, Navy. 7 "" '5 COSGROVE, FRANK W. HEALD, GLENN F. 4211117 1 7 3 Cox, OHN VANBRUNT, Znd Lieutenant. HELGREN, FRED ., Yeoman, U. S. N. Z 5 1 1 . . . . . 1 J f 1 Cox, LINTON A., Ist Lieut., Aviation, A. E. F. HEMSING. JAMES F.. Private. Marines- 4 A Zi, C G CHAR ES l f t HENN ERNVIN J Aviation 7 7 X f RAI , L , n an Ty. A - , ., . - 1 , X Z KCRAIG, -HARRY, lst Lieutenant, Aviation, A. E. F. HERRICK, D. L., Sergeant. Engineers Z 5 Killed August 30, l9l8. HERZ, ROBT. T., Private, F. A., A. E. F. 2 5 Z g CROWNHART, J. G., Znd Lieutenant, Infantry. HERTZER, J. O., Sergeant, A. gi' 7 2 CRUMP, KENNETH M., Corporal, A. E. F. HETH, LOUIS, Naval Aviation. Z Z Z 2 CUNNINGHAM, LAW., Sergeant, Ordnance, A. E. F. HEWETF, FLOYD F-. HOSpital Corps, A. E. F. 5 7 . 2 CURRAN, FRANCIS R., Lieutenant, Infantry, A. E. F. HITCHGOCK, M. L., Private, Infantry. 3 Z 4 . 1 . - - 1 y Zi 5 EURRAN,-JRELFIg., 2nd Lieutenant, Infantry, A. E. F. SIGBIEE3 N. B., N3vglIAviation. I 1, gt Z y 4 URTIN, . ., ngineers. ' ILL, ILLETTE, n ieutenant, rl antry. 4 y Z 3 CURTISS, FREDERICK W., 2nd Lieutenant, Aviation. HINDMAN, HARRY H., Instructor, U. S. N. Z Z Z Z DAME, RALPH WARD, 2nd Lieutenant, Infantry. HIPKE, Lucius W. 2 Z 3311112 DAVIS, MELVIN K., Industrial. HODGE, HOBART V., Marines. idling gi 3 DAYTON, WILLARD L., U. S. N. HOLCOMBE, R. F. gf Z2 2 DODGE, HAROLD A., Private. HOLE, DEAN. D A H 14 9 DOHR, DONALD, Private. HOLMES, PRESLEY ., rti ery. sg gg if Z BOONANEGERALDJ., Aviation. HOLMElSi G. L., Iiergfagt,-Infantry. 11 A 11 I 4, 1 OYLE, LMER M., U. S. N. HOLT, AROLD ., a io. 1, M Z3 gf DREW, FRANCIS L., Zntl Lieutenant, F. A., A. E. F. HOLzBERG, P. R., Ordnance. if ZZ Q3 jg DREW, FLOYD, Aviation, A. E. F. HOOD, ROBIN, 2nd Lieutenant, Infantry. 3 Z2 2 DRIPS, WM. C., U. S. N. HOOK, H. P., Sergeant. 52 42 7 DUNKEL, ELMER S., Government. HOPPE, PAUL E., Private, Coast Artillery. 1: if 4, 1 , 11 ,y ps 4 EATON, HAROLD A. HORN, WM. E., Lieutenant, A. E. F. 25 if W 5 EBBS PAUL ALLEN Private Field Signal Bn A E F HORNADAY H B 55 If 3 Z , . . ., . . , . . 1 1! Z5 If EDMUNDS, WADE M., Corporal. HOYER, ED. L., Cavalry. 22 if Zami? IEGER, HAROLD. HUMMEL, FRED E., Americangfgld Service, A. E. F. jgmjg 4 4 ICKE, CARL A., Lieutenant. ILETT, WILLARD E., Private, r nance. f 4 Z Q ENDRES, HUGO J., Captain, Infantry, Canal Zone. IVES, CLIFFORD ELIHU, U. S. N. 2 Z ERDMANN, ARTHUR A., Private, Ordnance. JACOPSEN, ROBERT L., Army Field Clerk, A. E. F. gi g Z . 3 ERDMANN, W. V., Chief Petty Officer, U. S. N. JACQUES, J. T., lst Lieutenant, F. A., A. E. F. Q Q Z Z ERNST, L. W. ' JAMES, BURTON E., Private, Hospital Corps. 2 g EVANS, HARRISON,.U. S. JEFFERS, AUSTIN P., lst Lieutenant, Infantry. A. E. F. gf 5 Z Z EVJEN, HENRY, Private, Signal Corps. JENKINS, LYLE NEWTON, Znd Lieutenant, A. E. F. g Z 5 ig EXLEY, ERWIN W., Industrial. JENNINGS, B. CANPORD, U. S. N., U. S. S. Oklahoma. 5 f ' ' Z FAITH, DON CARLOS, Znd Lieutenant, Infantr . OHN, HENRY A., Lieutenant, . M. C. 4 f 4 1 5' . 1 y Z FELT, GUSTAVE R., Marine Corps, A. E. F. JOHNSON, CHARLES W., Ensign, U. S1 N. gi, g I f ' 4 I 7 Z 4 A 4 4 2 6 A iz fi' 1 1: 1 4 j 75 4 4 f Z- 2 4 7 M A g i HKMW111x111x111X111q11111111111151111553313311111111Z1ZZZ1m1111Z1111111 11Z1:11111111111111111 111111111 111111111115 I1 111111 11111111Y111x11i1111Z111111 111114111q Z V L Y . . . 5 35 M 1 , 1,1112 4 d 9 11111111111111111111111111U111111111111111111111 1 5111111 1 ' I ' f NK S R R R R R R R S R R R R N R X R Rt R X R S S R R R R R Rx R R R. R: Ns Re R: R: RE Rs RE RE RX: RE N: Rx: XS Ri RE N3 x SX R S R R R R N R R N R E R S S E X R R Page 372 W Ill "" 'I' if i' 'A' i' 'A' W r IZZZZZZ, -sir 'k i' i if if fo s s 5 E 2 1 2 , : 4 4 , E 5 5 1 2 E 4 1 r 4 : 5 15 XXXNXNQ X Q X X Q X X X X X S Q X X X X X X X X X X X X Q X X X X X X X X X X X X X X Y Q X Q X X X X Q X X S S ' 1 - 9 I X S 2 X X E X X X X E X 7 5 1 155151 4 1 555115151. Z lv' v ,,,,,,,,. ,551 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNXXXXXXXXXXXXXXXXXXXXNXXXXXXXXXXXSXXXXXXXXX XX JOHNSON, HARVEY C., Private, Infantry. JOHNSON, HONVAIKD L. JOHNSON, . BERNARD, Corporal, Ordnance. Joi-INSON, OSCOE E., U S. N. JOHNSOE RUSSELL L., Private, Infantry. JONES, ELBERT W., Government JONES, GEO. G., Yeoman, U. S. N. JONES, JAMES H., Seaman, U. S. N. JUDEVINE, W. K., U. S. N. JUNCCK, FRED W., Private. KAISER, WM. T., Sergeant. KANE, EUGENE. KASIKA, WM. H., Ordnance. KELLOG, HORACE B. KIRCII, J. G., Ordnance. KENCHEL, JOHN. U. S. N. KING, CHARLES l'lOXVARD, Tank Corps KING, RALPH, Seaman, U. S. N. R. F. KINNEY, J. L., U. S. N. KINZEL, LESLIE, U. S. N. KIRCHEN. PAUL E., U. S. N. KLASSY, ERNEST R., Private. XXXNXXXXNX NX -k KNAPP, HAROLD C.. Private, lvlarines. A XXXXXXXXXXXXXXXN KNUTSON, O. ELMER, Ordnance. KORNREICH, EUGENE, Aviation. ty KRAMER, PAUL S., Private, U. S. Infantry. t. 1 1 5 , 5 1 4 5 1 1 Z 5 1 5 1 1 1 A it 'k if if 14 5 1 1 5 5 5 5 5 1 5 1 51 If 'I ff 5 5 5 1 1 5 5 2 t, i Q gi gi' 'I 9? I KRESS, FRED R., U. S. N. I KRUSCHKE, WALTER F., Private, Ordnance. KUENZLIE, ROBERT L. XCQIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX'SXXXXXXXXXXXX KURTZ, PAUL H., U. S. N. LACEY, DAVID R., Znd Lieutenant. LADXVIG, W. J., Private. Artillery. LAMPERT, E. H., Ordnance. LANGE, W. H., Private, Engineers. LANGEMAK, WESLEY E., Field Signal Corps. LAPPLEY, GILBERT F., Infantry. LARSON, GEO. W., Private, Ordnance. LASHER, PHILIP H., Private. LEMM, MARUOG CARL, Hospital Corps. LEHRBAS, LLOYD A., Lieutenant, Aviation. LEONHARD, GEO. J., U. S. N. LEVIAN, ABE, Infantry. LEVY, EDWARD DAVID. LINDSAY, RUSSELL G.. Ordnance. LINEHAN, RAYMOND F., Lieutenant. LINK, OTHMAR C., Yeoman, U. S. N. LINS, CLEMENS M., Field Artillery. LITTLE, HARVEY BONNELL, Marines, A. E. F. LOBERG, JESSE B., U. S. N. LOEB, RALPH E., Infantry, A. E. F. LONSDORFF, A. J., Engineers. LOOMIS, CASEY VAUGHN, A. E. F. LUCAS, SPENCER A., Corporal, Aviation. LUHMAN, ROBT. A., A. E. F. LUPTON, A., Corporal, Infantry, A. E. F. MCCARTHY, E. J., Signal Corps. 3 MGCRAY, SIM THAXTER, U. S. N. 3 MCGINLEY, J. R., Captain, Machine Gun Bn., A. E. F. 2 'McHUGH, KENNETH, Field Artillery, A. E. F. Killed 1 in action. MCINTOSH, ROBERT B., Lieutenant, A. E. F. MCKAY, JOHNQJ. MCKEAGUE, JOHN J., U. S. N. ' MCMAMEE, S. L., 2nd Lieutenant, Infantry. MOMANUS, JAMES F., Sergeant, Infantry. QXXXXXXXXXXXXXXXXNNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX MCWILLIAMS, GERALD S., Aviation. MAACK, F., Lieutenant. JONES, ONALD C., Znd Lieutenant, Cavalrv. KAHN, HERBERT lVlANDEL, Seaman, Znd Class, U. S. N. KAYSER, PAUL, Sergeant, Field Artillery, A. E. F. KESTER, HONIER, Sergeant, Signal Corps, A. E. F. KIECKHEFER, HERBERT M., Pvt., Hosp. Corps,A. E.F. KOENIGER, EDWARD RUSSELL, Ensign, U. S. N. KUENZLIE, DAVID B., Sergeant,F. A. A. E. F. LA FOLLETTE, PHILIP, Znd Lieutenant, Infantry. LEHMAN, DONALD G., Private, Hospital Corps, A. E. F. LEOPOLD, FREDERIG, Znd Lieut., Engineers, A. E. F. LOBDELL, HARRISON, American Transport Service. LORIG, ROB-'T. A., lst Class Private, Signal Corps. MCCABE, WM. JOHN, Sergeant, Machine Gun Bn. MCCANDLESS, DONALD, Field Hospital Corps, A. E. F. , MGCOLLUM, GEO. WILLARD, Private Infantry. 2? MCCOLLUM, EDGAR D., Private, Engijlaeers. McCoY, BRUCE R., lst Lieutenant, . P., A. E. F. MCMURRAY, ORA, lst Lieutenant, Aviation, France. MACQUAID, JOHN H., Private, Infantry, A. E. F. RVLL MAILER, ANDREW ROBT., 2nd Lieut., F. A., A. E. F. MANDEL, WAl.TER R., Yeoman, U. S. N. MANSFIELD, ORAL W., Lieutenant. IVIANTONYA, W. G., Seaman, 2nd, Class, U. S. N. MURCUS, L. PORTER, Zntl Lt., Aviation. MARKUS, NORBERT W., Zd Lt., Mach. Gun Bn., A. E. F. MARLING, llOBERT N., Motor Supply Train, A. E. F. MARSHAI.L, O. H., Private, C. Artillery. MARSHALL, CHARLES R., Sanitary Corps. MARTIN, FINELY F., U. S. N. MARTIN, JOSEPH, Aviation. MATZEN, HERBERT J., Sergeant, M. T. C. MEIHACR, ALBERT W., Private, Mach. GunBn., A. E. F. IVIEINKE, NORMAN T. MEISKOTHEN, EDWIN E., Coast Artillery Corps. MENGELBERG, WALTER R., U. S. N. MUELLER, W. E., MEYER, PAUL, lst Lieutenant, Aviation, A. E. F. MEYER, LANVRENCE, Ycoman, U. S. N. MEYER, ROSS B., U. S. N. MIKNA, ALOIS, Private. MILLER, CHESTER J. MISHELOW, EDWARD, Sergeant, F. A. MITCHELL, JOHN G., lst Lieutenant, Infantry. MONK, ROB'T. WM., Yeoman, U. S. N. MOORE, CHARLES F., Royal Flying Corps, England. MOORE, DAVID W., lst Class Seaman, U. S. N. lXflOORE, WARREN G., U. S. N. MORMAN, WADE l'lAMPTON, lst Lieutenant, A. E. F. IVIORSON, ORSON S., Private, Q. M. C. MOSS, CHARLES W., Harvard Radio School. lXflOLlLTON, FRANK S., Private. MUELLER, EMMET J., Znd Lieutenant, Artillery. MUELLER, WALTER EDWARD. MUNI, ARTHUR J., Private, Ordnance. MURAT, WALTON B., Industrial. MYRLAND, EIEL, Ist Lieutenant, Hosp. Corps. A. E. F NADEAN, LOUIS B., Signal Corps, Aviation. NAFZIGER, RALPH O., Infantry, A. E. F., Russia. NASH, GEO. W., Lieutenant, A. E. F. NECLEY, WM. H., Znd Class Electrician, U. S. N. NELSON, ERNEST D., Private. Sanitary Corps. NELSON, D. VANARD, Infantry, A. E. F. I SNELSON, HOXVARD G., Foreign. Canadian Expedi- tionary Forces. Died in Stormer, France, of pneumonia. NEWBURY, EDNVIN, W., Infantry. NEwcOMER, D. A. NICOLL, EDWARD WM., U. S. N. NIEBERGALL, FLOYD A., Marines. NIGHTINGALE, KVM. J., Radio. NOER, HAROLD R., Bandmaster. NOTBOHM, ALEXIS W., Hospital Corps. OBENAUER, V. J., Aviation. OLIN, W. G., Sergeant, Ordnance. OLSEN, WM. O., U. S. N. O'LAUGHLIN, JOHN R., Lieutenant, Infantry. O'MEARA, WALTER A., Private, Coast Artillery Corps. ORMOND, ROY B., Aviation. OSLE, WALTER, U. S. N. OSBORNE, R. H., French Service. OSGOOD, WAYLAND, lst Lieutenant, Infantry. OVERTON, ROBERT E. L., Lieutenant, F. A. OWEN, RAY S., Captain, Engineers, A. E. F. PAGENKOPF, HENRY A. PAIN, CHARLES E., Corporal. PALMER, JOSEPH F., Sergeant, Iniantry, A. E. F. PALMER, RUSSELL R., A. E. F. PARK, BENJ. H., Tank Corps, Br. Ex. Forces. PARK, LYMAN B., 2nd Lieutenant, F. A., A. E. F. PAUTZER, FRED M., 2nd Class Seaman, U. S. N. PEPPER, JOHN PHILIP, Lieutenant, Aviation. PERRIGO, BURTON R., Znd Lieutenant, Infantry PETERSON, CARL E., Cavalry. PFAHL, CHAS. ALTON, Coast Artillery. PINTHER, HAROLD O., F. A., A. E. F. PIRSOL, T. R., 2nd Lieutenant. PLUMB, WALTER GERALD, Aviation. POINDEXTER, EARLY W., Ist Lieutenant,EAviation. POLACHECK, JEAN L., U. S. N. POLLARD, SETH W., Aviation. PORTER, LYLE P., U. S. N. POWELL, HENRY M. POWERS, GEORGE, Ordnance. PRATT, HAROLD J., Ensign, U. S. N. PRESSER, ERWIN J., Sergeant, F. A., A. E. F. 111 1151111 1111111 11111111 115111111511111111111151111111111111111111111151 15111111151515111151111111111151511111511111 111 1 11111111111511111 51111115111111111111111111111111115111,-1 1 11111115111111 1111111 1111 11 11111115 1114 f 1 , . 1 1 5 W55155115151111511555151515,5,115115,5551551,551514 7551511555115 5511151151551,,511515555,5155515,15,555510511 , , . 5 5 5 I 1 5 . . A-Ar 9 ,, .. , if 1 11111111111111111111111111151111111f1111111111111 1 1111111111114 9111111111111111111111111111111111f111111111111111 WWW 1 Page 373 fffffffffff """ I 11 ,,,,,,5,,, 55 , - 55,55 ,,,,, 1 A , If i i i Y 'k 'k f ,,,,,,,,,,,1,5,,5,, Q5115,,,,5115,,5,,,115,,5,,,,55,,,,,,,,,,,,,,,,5,5 ,,,,,,,1,,1, f I 7 , 5 1 5 W N 'U xa :IX N XX., N -:X 5 h Q Q I Q NNXVANXNN 'xN"N'Nx Q h Qxxxxxxxsxxsxsxxx xxxXxxsxxxsxsXxsxsxxsuxxxsxssxsxy A X X 1, if i- 1- 1- it :W 1 QQ 1- Q X Q- Q- if 1- M' if 1- 1- N- E- 1. S SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXX XXXXXXX XXXXXXXX XXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.S S X X X S QS Xi,,X X X X 'X X Q X X N- X X. X cncncncncncnmcncnmmcnmcnmcn X -ff25229252522aa-zzfa122vw:af:?QQ2a-rss? X1 X gm-4-4 Hmf' of . ,. My :,:,:,3Fo.4 mmmbbfb - Y' Orom-4QgmomwmmmcoZ"P"0-4:-mz-:,mmcq"rf1 X- X 5 X z'N'I'31341555Qgxxff'SEMJQUggzqfgigzzzzmmmwmirW"Wf"7JCO05"'3'P?'0m mz-XmmrL-fnmxw-mmmUm":zP'4x0wW11wNZm X S Q X mooo5".yl4Em-22712-Zz-X5-,..E-Inf-my ---- -4-az::"ZUr'f,IUP1!'1I2f'4'j,m5Cg2?'W,Z --'1:wm,mwgOZ71w71mI4O,'go0mrQ5zZ2:-I?1'5' X 'X Nik '-W-W-pmg bw' x fnpww Z'm-m7'0:1'O7O7J'r1m"' 3'?'z 5pz':1N-Z-igawmrl U 'U"'-IZZ9'zl6'i""7 Sw"m5"'-u1mfT'ZP-Z X13 X X OUIJZ- 77 fn rl- EIL- mp - . QWFWZZ ZOO- - - . HIWUKUX- -U uv ' 405050 I' . U? -n. 357101 . X X X 5 fmiiirm' 5: FWICUL-:UZZ3'35?f'Z5', P154 Oigwmm -SPPJVU7'-x"1mQ-7'Z"no c XFBMWCZZO 02-350 K-21 3 'Fm E. 3 X 'Tl , . cz m C 71 , , 1 F' Q. L, Z O o 4 m-Z X X X gn I 71 . l- ,Z, Z A :X W o -0 71 , Db 71 77 X X S X -5,EZ2Z?:..nWQ,i'f1OEg2'Zb7joQOZIQ-mga--aUmE29E2gZ2Sr"-2z:'UEufZ::XV5wP7JbE-Fzgomofigfl y,wgwZ:I:ZoE"SmFfgjL7mWy X Q 5 5 11040 Um0mU"'-P 'QF'-": Gm- FZ 'EAW 'iibfffoqffl ":c3ZF WFW2: r"'U"I'm3'U'53'7U4Z"4'3'f"U' WFFWZUVH S 5 X X -Z-rf -XU 3:5 viz- U--'wp 2 O Q -fr-Wm wwf-C z F K mO3'F1w0:uCS'r1gz'wz E11-H01 :Wy-103-2 1-1 gunz X. X S13 ' ZUZ 55owZ4vwCUUm CL-U,5'-UWVZUW ---Ur-HCI'-I-5-3-?'f-2r'OZI'QWmWq ' :O H'::z7'h,Wf'UF.2-F:-'f":OQz1 'Ewa' iff? X X 'DFI Z5 -1.55m -3 :-- -rn' JJ' 'wx 1' 7'QX4mq5' 'HwEcWUZ'42 HZLAC 4Z5O'r-43a -52 O2 Z ml-uw Z XXX X X -.- . UU mm- HCQU . ww' WI m 111 O mimi -m- 5 IFF, M-4 Loi- - Jn- F- Im- 5440- 1 0: ,Zu-cz: UC- X X X S 2 ' - 1 FUSQ5- wi F- FD PD- CTV FO: :."C- So nk-:DZ 5-IQIQ: rf1-- 1 Zinn-1' :sw D ZQUI- o' 01- - an - X. 9' 'E X S Q X AJ Nm? Z5-13930 l-gy jul' X ,U 511012 43- O-U-szj J w. C SZF' IP: - ' O... - I-3 Cgg H-U Qg. III-1 Zvzk -Ulu,-0 ,..: Z' TIUP- X Q XXX-XXS 3 Bw C0710---U1-,-42 m Cm-X :'U5' wffcn-1 22' 1-Sq? . ear ' F FPYOW- -Ol' Z-.3- Q-wfm J Zi '0m'E,7X:1-X --::E'5'w -U11'C S X XX TX - QUE 5- Z"l33,Z' Q "" Elm' - "' 'So SF' GJD-1' 'Ummz l45!', C O--' 03 QE' 'f30m- w"E, m9,9,-1ff- QSQJ! Q-"""79Q fUZ. X Q N2 W F099 FDU' w- . UWC 9' OOM 4 0--'V - 23-9 3-:x ' FD so -'DON 4011 'C -5' "'g-sho" 7:'Um"'D' H50 l":-Suu-1' Aww 'XX XX Z --ws. ' Q5 of' 2- 5"- Zh' 5:1 1. m r fam D-X :ff f'-- ff nr' -.- 42 . --,-D 'n-"U-aw Q---5? m-- FD , 4, 2 523 ZZHFW' 3 'Big 32 Egg-1 E055 Z 3'-Q Z EEPT? Q5139E'g'-E-?Q'?lE??E z 3-'-: XX SX 5' af- 5 '11 cu: ' ' '-' - 5. .U - -X 'I Mffawrv '1 5 Q Cn-- ' 'ff -'- ,-,oX4O.5"1-X - P. XIX XX 0 up aw X gn. :S 59 nz, gnfrgv X: B 53: -Fr: gin P, ff gjjmmrv 903, 'Pm 2'UJm:s- - P. X XE XX yr rn- Q: ff- as 3 5m 5 022' X43 P ,., - ' gm- :sg 01191: I: 0. Nga: GOO " XX XX :Z msg my 5 H :M Q aa P -2 W - H ws-nm PU ,fn 3, nf-BPNVQQ ssss NSN 5' 22- U74 H Q 'O 2 5:1 SX ' E2 fn 33 3, 3f"'G2:3 5113? .PQ -1 '59 M-5m XXNX gg XX ..' :15 '1 , o m m an Q -V 4, m rf Hn: Qt- - ff 9.5" lT15",,,w QXX X x 1 U3 . U3 I " X4 , : ,., , rr XX X if X 5 X 202- 2- P' Q? 0? MP-fn W1 X- sv- -CRX X5 I 5 21 ' ' GS P P G S Q4 'im 9-5AmT11v-2 'm'kfJ'F1 N 2 F' ' . ' Z. - '- - . . :Q X Q S 21, Q 5 O X -3, ilg mv Z5 X, 7 H Q X - - . , ' ' .. XXX QQ Xi 3, 5 J 0 , RF- 3,2 - ' - Q XXXX X C -U1 -1 fn -, . :XXX QE XX X . , U I ,Q X Qt fb U, m un ITT m. 1 X: XX F7 . . '11 - -11 - , 1 QAXXXXX - - ff ,A-'1 XXXXXXX 'ra Z -n -n 'rm - SX HX - - - ,f 1 QQ XX f - I . X X ,V X S5 X3 1 N , XX X - ' XX XX X X- ' Xz:::XX .. - is V ' NNN 6 a a z a a xx .X - N X3 sX E7??5UWQJE?1j'?????9J??????55355555533 Lmf545425ff545255555555fffffgSQQQSf??fffff5f?5Ii?E37T'5'5E!E'E'E3E' XX XX ,,,.,.wmn .I -U " rm 11-mv CCWWWO Irrztrmmmmmmwz-mwbb:-hz r- X -, XX XX C.....UmxzC7'7'7jE75xQw'f,:2Z,-UUUUUWWD-lm an-swcccvvzvo--'r'Z5,f"f""'m-H-mmz1zl---on-1-aznwwz-:1:Io7jZ3"'Z,'0OE:-S2000 xx--. X5 EX SR' "wC7'I-I'5- F"-ITJZJP oooo -r-N Z?'O'L."'NO--'.-zzzuw rf'mZ"'U'ZwWg-i7'4k--mz3"-wmgvr-f-of" EXW XS 5X Q,VZ,Z'1'1--":- 5-7 32-no'rJ5"ZzZzSl--' - I-Q73O7'ff1m7UUT1mv5'15"500l-2xO5F'SQUL-MO -',,'2"OQ-img-imzzzmmggzm XXXN NX 9 rzo-.7'7J"'DPg1.OImf5I"':u2OU3,'"'-4,1102 'IPQO C-X710 S 'X.. ?:-NIE, 4wX,'O PUw"U.-FOQ2:-"' :r'p'II-CU qfixx SX XX Z-af"2om,Pr- Wm, 1',,,,-- U3,::3,U,.. F050-'45, uf 2' CQ mm Oxwb I-ormiliiwm-',,3,1OZ,,f-m'r1O U, .n-x-4,00 XXXX X5 SX bmfn-IP-4ZW3':u Z'IE"mZga-'67' 71:-r 4' Eimg, 7Uf'U'557O:CU'?'-4-.,7f'-:PCO--152: Ffwgmz- 7.12-'Oz--73: Us-mmo-S IXXXYX XE XX 2113, :X UmC-12WCP:ZfXU""Z5:'Q..-nmbayl 5,2 UZCDXUQU F1 Egwfqm ,,,Cw,l'm,Q,X.. XqZ1.wm -47515 32,21 7-1202 7, XX X X: :X 3, mNmX.wvOw4-4.1 W- "1 -3-yi X4 .-f,,0g-,:- -3'ZCom:Z'.V'wWo'W7-m-If -S Z.4Cf,, WNW DP. XXXX QQ XX .wg ram.,-o :-0,m3,03,c:mCz,- 2 Q rn - zU'iU,4m,7,D m - W., . O Ogg- ?P:X:O-Z, 5-3,p7,w INXXXX XX XX - : 5 ' CL" OZCIFDWO -77. Fr- TWU BU "77L.'X-'Cz 05' 4 Jvffl 'U I- uw- Jw UNU- o - Or- 55 wgggg- rn 5 V' SRXQ XS U3 rv U, jajjnm - J M' O' U' 77' PNK' 2. NFIEWWDZ Q-1:-sfgnyyuq' 3 F'-Og 'U-1 4 2 U10-E ,J rr C030 5' XX XX QC5' rv-E-nf mom Zjfg ' 31 :girl-ggrw 'Ik 2,51 91: 0-001 UQ 55 : CU-'H Q5 Tl"-1 F-'EEN In VU' r- 4 Z' 'VF' zm72 'C N1 N ' 5 105'-0. -7'-Ow 424-r-Q :r 'HD - Qo r 0 05:12 -N5 0 'U -----CFD ww-" 0o1hr1-- .3J'f5--cn -' H X: XX vgm. cm:--"W P o - " W-, -. 4 mm--C f- -40, - 7o-.m- Jw, - Q- Sf or-, 04- -n 2 ff'-. . QI Q -ww 'no' 0 X X ' F- W " 77 'L ,. zn . - ,,, :s P . 9' ... 'nc 'O cn A qw C . gz SSL-91l:,zZi5' 3- EQME, 299- RU, f' H Ugiw fSi'ErSgXf M532 6:15, 5-35402 QPOQ :ig Ea U, 5-5332-52315 p. Egfcagw, 5712? 933.3 tggiioz Q1 IS 92323. 2551131 Q? Zag gm ag-ZZ Eg 5, 14053 gg, . ggcg' Q55 HP, SWS X X rrj n m-RE, - mi? ' na' .nv cnc GQ 0 WDP '1-19: ' ' 4 l" ' -W' 3,3 ' ww ' CTUY CD Z 39" D 'UQ-n 3 5 S X ,UQ ' f' yn 3Q.:sg -- P-Xl" - 9713? an --- ':s-,-1 no -,O 00.3 5-. .swf-X ff Q 'Tl X X X X 3 D34 '11 FP, ,rp wo: D f-rn Q-3 . . rv N 3,-. "'-Q -. H51-r f' fn- rn - - Q X Q X an 411 Zmmii , ., - ' ,X ZUJ3: rv Nz: :PC rn C Q. ,A f-f Um- O - m --F' u, X X X 2 5' 9 --2,9 X m Z-2--V 2 -a D--P ' Q Sinn, 2 0 'L wm PO nbz, PYP: X X 3 5' Q' '11 Eb :P -ng ' 33 im 50 320 25'-M5 E 5 221' 5 sl 0 353 mil E" '3 'Pm af X -1 , I , ... - .:. -' i -, V. . , . En 3 5'-gn, ?' fn E' 5, 5'7" E ? 9-325, 91 3 39- nf Q 5 3 'rm E' E 2,511 m Q S 51- , DJ 3 m Q 'O-1' 5' ' Q , -U ua 0 - 5 -1 ' 3- . 'X X X X C . 5 IT! - - - , 511-4 ' 3 5 yn U, - -1 . gn n . X -5 X Q 3 ' 'Tl O 5-1 - - -11 . -1 . 50 Trl - yr -1 'T1 X Q Xia 52 1 - X C X X - 2- - S - X X UU - 0 . - D1 3, X X X 2 W 3, po - T1 vu ' K - 71 . 3, X X X X g X E E ' - m m -1 -n -U . X X X X M .- - X - 3 1 f X X 2- fn 4 -1 -1 1 W P 'fl A ' F1 X X X X X 5 X N X S XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSXXXXXXXXX XXX X XXX XX XXXXXX XXNXXXXQXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS S A X ,XX XXXXX XX X X X if 1+ 1+ 1+ 1+ 1+ 1+ 1+ 1 1+ 1+ 1+ if 1+ 1+ 14- 1+ 1+ 1+ wi- 11-'PX ?. m I 2 s xx 1 Z Z 1 f W ,,,,,,,,,,,M ,,m,,,,,,,,,,,,,. f. ' f t i if t- t 5. Z 1 1 mm mnffffuf fum Ir 1 I Z ' Z Z I Z ,,. .Z if ir if -4- -5- if in Z Z tZ,,,,w,,,,,,,,,,,,mffff,W,1,,wwf,,,,,m,,,,,,,,,,,,Z ,,,,,,,,,,,,,,,,,, ,,,,,,,W,,f,fm 9 Z,,,,,,,,,,,,,,,,,1fffffffffffffffwffffffffffmwffffffffff, t, Z Z 2 Z Z rxvmva RVL L Z if if Z Z Z Z Z Z Z 2 Z Z is fi' Z Z Z 2 Z Z ,kg BLODCETT, CLIFFORD A., Aviation, FALK, PI-IILLIP, U. S, N, Z Z Z BLOOR, GEO. J., Q. lvl. C. FARRELL, CARL W., U. S. N. Z Z Z Z BLONIEN, BERT A., Sergeant, lst Class, C. W. S. FEATI-IERS, LEONARD C., U, S. N. Z Z ELOUNTEJOHN Naval Aviation. FIE, A. I'IUBEIlT, Landsman, Naval Radio. Zi Z Z Z OECK, DWIN M., avy. FIEI.DS, A, B. Z Z Z BOOTH, EDNVIN R., Private lst Class, Infantry, A. E. F. FISI-I, W. I, Z Z 3 BORCELT, EDW. H., Industrial. 'FISI-ILEI1, I'IYMAN, Corp., Engineers, A. E. F. Killed Z Z Z Z BRADFORD, THEODRICK, Aviation, A. E. F. 4 In action. Z Z Z Z BRAMLETTE, M. M., Aviation. I--ITZOERALD, LLOYD E., Sergeant, A. E. F, Z Z Zywgg BRANDT, CLARENCE, Aviation, FITZGERALD, WM., F, A., A. E, F, Zfffff4Z EREIDSTERLMILFOIZD IA.,tHospitaI Corps. IIEORD, LECSETIE1 U. SIDE A C ,S gf RENNAN, EO ., n an ry. QRATER, . ., Orpora ,,.. Z5 if EROCKHAUSISIN, HEREERTSF. A., A. E. F. EREESE, HEREERT GEo,, Ycoman, U. S. N. Zg gf ROSSARD, ATTHEW I., ergeant, F. A. 'RElDEMANN, IRALPI-I F., Ensign, U. S. N. Z2 ZZ Z2 BROWN, 'ICI-IERON A., Radio, U, S. N. FROELICI-I, A. L., Sergeant, Hospital Corps. Z2 Z2 gg BUCKINCHAM, L. EVERETT, U. S. N. FULLER, I'IENRY C., Lieutenant, Infantry, A. E. F. EZ Zi ZZ 'BUCKLEY, OHN W., lst Lieutenant, Aviation, A. E. F. FULLER, WILl.ARD L., Ensi n U. S. N, Z1 ZZ 1, ,f S - ff , 1 Z3 QZ B Kldled in action Nov, 8, 1918. SABLER, EIIMER V. ZZ Z5 33 ULLIS, ESLIEJ. V AFFORD, IZUGENE J., Corporal, Machine Gun. ZZ EZ Z: :Z BUNDY E. B, Coast Artillery. 'CALVIN JOI-IN L. Private F A A E F Killed in Z5 ZZ Z: M . . , V . . . A. - A A H jf fg gf BURC, OLIVER M., U. S. N. action, Aug, Il, 1918. Z2 :Z ZZ BURKE, -IPI-IOMAS L., Signal Corps, A. E. F. GARDEN, GEO. P., Private, Aviation, A. E. F. BURLETT, KOHN S., Ensign, U. S. N, GARDINERLRALI'-H D., Aviation. Z2 gZ Zglwgg BURNER, KENNETH H., Industrial, GERMER, I-'RED M., Aviation. Zi,,,ZZ Z Z IKBURNS, ALEXANDER, Corporal, F. A., A. E, F., France. GIDDINGS, WM. W., Private, Q. M. C. 2 Z Z Z Died from wounds received in action March 8, GLENN, ROBERT R., U. S. N. Z Z Zig 1918. GOERNER, EDWIN F., Private, F. A., A, E. F. 6 Z Z Z BUTTS, STANLEY V., U. S. N. GOETZ, FRED W., Corporal, Ordnance, A. E. F. Z Z Z CALDNVELL, CHOLETT B,, lst Lieutenant, Infantry. COULD, STEVENS, Naval Aviation. 2 Z CALDWELL, THOMAS B., Naval Aviation. GRACE, J. H., U. S. N. Z Z Z CALLANDER, W. E., Government. GREGC, SCANTON H., U. S. N. Z Z CALLENDER, JOHN, Aviation. GREEN, GEO. E., Private, Machine Gun Battalion. Z Z Z CAMLIN, H. A., Elec. Engineering, U. S. N. GROSS, GEO. H., Industrial. Z Z XCARADINE, G., Corporal, Infantry, A. E, F. Killed GULLICKSON, WM., Engineers, A. E. F. Z Z Z Z In action. HALDEMAN, LENNOX, U. S. N. Z Z' Z EARPENTQI, EIYIERETT N., Hospital Corps, A. E. F. HALEYJJOHNVB,IGXrtillery. Z Z Z 4 ARSON, M. ., ergeant. ALL, OI-IN ., aval Aviation. Z Z Z, MZ CHAN-IBERLAIN, GEORGE H., British Ex. Forces. HANKS, CARLOS C., Sergeant, Q. M. C, Z Z ZZ' gg CHAPNIAN, FLOYD. HAMLIN, JOHN, 2nd Lieutenant, Artillery. ZHWZZ Z2 ZZ CHASE, ROLANDJ.. Medical Corps, A, E, F. HAIKICER, JOHN W., U. S. N. Z Za 5? CHRISTY, ROBERT HENRY, Naval Aviation. HARMAN, HUBERT F., A. E. F. Z E7 Z' ff I Z Z2 ZZ CHURCH, CARL A., Lieutenant, Aviation. HASTINGS, H. LAXVRENCE, Aviation. Z gg CLAUD, CARL A. HATLEN, H. C,, Industrial. Z Z2 ZZ CIRVES, FRANK, U. S. N. H1XNVN, GARVIN C., U. S. N. if Z5 ELARK, 'IXRIHOMAS g,aSeaman, 2nd Class, U. S. N. SOYDENQJOHS E., Clglor Serggant, Infantry. Za eZ fg 14 LARK, M. ., r nance. AYES, M. LATT, rivate, ngineers, A, E. F. Z ff CONDRON, GEO, TOLMAN, Aviation. HAESSLER, EARL A., 2nd Lieutenant Z' ZZWZZ CONGDON, CLAIRE C., Lieutenant, Engineers. HEFFERMAN, M. A., 2nd Class Seaman, U, S. N. 2 Z Z CONNOR, EDWARD H., Znd Lieutenant, Infantry. HEISKELL, A. ZHHHZ Z Z COPELAND, JOHN B., Aviation, A. E. F. HEISMAN, MILTON J., Ordnance, A. E. F. 2 Z Z CRANEFIELD, PAUL F., Infantry. HELD, ROLAND R., Aviation. Z Z Z g CRANE, CARROLL, Marines. HEISTAND, FRANCIS, Corporal. Z i. Z Zig CRARY, LAWRENCE M., Sergeant, Infantry, A, E. F. HIPKINS, J. N. JR., Industrial. Z Z Z , 5 ERANVFORDRROBERRQNQOI3 IAviation, A.IE. F. SOARD, Wen. D., Private, Marines. Z Z Z RETNEY, OEERT ., n ieutenant, nfantry. OLWAY, ORDON. 4 Z 7 Z CULLEN KENN A L' H N Ch ' Z Z f 1 , ETH ., ieutenant, oLT, ORMAN, emical. , f CULVER, W. S., U. S. N. 'HOOK, HARMON P., Aviation. Died of pneumonia, Z Zig CUMMINGS, W. B., Znd Lieutenant, Field Artillery. Dec, 15, 1918. Z Z Z CURRIE, EARL W., Sergeant, Q. M. C,, A. E. F. HOOPER, NEAL J., lst Lt., Chemical Warfare Service Z Z 2 DANE, EDWIN H., U. S. N. HORN, ARNOLD F., Industrial. 3 Z Z 5 DAHLMAN, OSCAR C. E. HORMAN, HAROLD, Y. M. C. A. Secretary, A. E. F. Z Z Z Z DAVEY, ALLAN C., Hospital Corps, A. E. F. HORNER, SPENCER. 3 Z Zyfffgg DEAN, HARRY C., Sergeant, Mach. Gun Bn,, A. E. F. HORNINO, WM. J., Aviation. - ZWWZ DENNIS, HENRY C., Medical Corps. HUE-BELL, ERNEST H., Musician, U. S, N. gg Z5 gg DICKENS, JOHN S., U. S. N. HUSTING, NATHANIEL B,, Industrial. ' 22 ZZ gg DIEHL, PHILLIP M., Sergeant, Q. M. C. HYMER, HOWARD G., Flying Corps, U. S, N. Z2 Z5 gg DIMMICK, EARLE W., Captain, Infantry, HYSLOP, VOLNEY B., Private, Aviation. gg Z' 'DOLAN, LLOYD F., Private, Q. M. C. Died at Camp HYZER, LELAND. ZZ ZZ Z5 ZZ Greene, Oct. 17, 1918. IRISH, JOSEPH. ig Z5 EOKE, I-ICB. M IVEY, EVERETT D. S 52 PZ ZZ 44 RARE HESTER . JAQUISH CASPER H, U. .N. 2nd Class Seaman. 5 if Z :Z ' - - . ,n A :Z Z: El DRAFER, HAROLD, Zncl Lieutenant, Infantry. JENNICS, DAVID HARRY, Znd Lieutenant, F. A. 15 ZZ ZZ 3Z DROLENGA, NICHOLAS C., Engineers. . JONES, RUSSELL, 2nd Lieutenant, Artillery. 25 Z ZZ DUNNE, NEWMAN, Private, F. A., A. E. F. JOHNSON, ALBERT R., U, S. N., A. E, F. ,Z Z5 ,Z EDMONDS, HOBARTJ., Naval Aviation. JOHNSON, AUSTIN, Private, Field Hospital, A. E. F. gf ZZ-,024 EDWARDS, ALLAN A,, U. S, N. OHNSON, D. B., Industrial. Zami? X 1 , Z Z Z EDWARD, LEROY E., U. S. N. JOHNSON, EDWIN M., Government. 5 Z Z Z EIDE, ARTHUR M., Infantry. JOHNSON, JAMES W., U. S. N. 2 Z Z EILER, WM. H., F. A. JOHNSON, JESSEJ., A. E. F. Z ir Z Z 4 EK, JOHN A., Sergeant-Major, Mach. Gun Bn., A. E. F. JOHNSON, LEONARD, Aviation. f Z Z Z ELLIOTT, ALVAH C. JULIAN, DALVEN, U. S. N. Z Z Z fg ERICKSON, LEONARD. KAASA, LEONARDJ., U. S. N. 5 i Z Z Z ERICKSON, WM. E., U. S. N. KACHELHOFER, F., Industrial. Z Z Z 1 I X Z tg EVANS, Jos., Ensign, Marines. KARST, WM. EDW., Sergeant. , Z i, Z Z Z EVERSON, CARL, Lieutenant, Medical Corps. KEARNS, EDWARD P., 2nd Lieutenant, Infantry. Z - Z Z Z FADIAN, PHILIP ., Znd Class Seaman, U. S. N. R. F. KIBBE, H. R., Cavalry. Z 7 f 1 Z if Z if Z Z NZ fi' Z Z Z Z Z Z Z Z Z Z ir Z V ,,,,,,,,,,,,, ,,,,,, ,,,,,,,,,,,, 2 l ,,,,,,,,,,, 5 I ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, 3 Z Page 375 5 1 A 7 S f xxx xxx xx xxx xxx xxx 1 5 ffffffff ff wwf ffffffff fffff ' f i. -Q 4 4 4, K Z ff, , ,mm fffffmfw ,ff Z ,ir t t i t t Z Z ItZW,mf,fmffmmmmffffffffffwffffffmf11111111104 ,,,,,,,,,,,,,,,,M fmffffmfffffm - Zfffffwmfff,wwffwfffmf11,ffmfm,,fm,f,fw,,,Z t Z f r y I-xvmva RVLL 1 1 2 iz ff' 4 ei. 2 Z Ike . 4 Z Z KINC, CHARLES C., 2nd Lieutenant, F. A., A. E. F. MURPHY, ROBERT JOSERH, U. S. N. Z Z KING, KENNE1-i-rJ,, U, S. N, MYERS, HOWARD K., Private. Zi Z Z 2 KITCHINCMAN, R. F., Aviation. MYRLAND, OTT0 E-1 Lieutenant: Z Z Z KLANDRUD LESTER Sergeant F. A. A. E F NEE'-EN, Be Corpofalf Hospital Corps' Z , . , , - - , Z Z IQLETZEIN, HOBART H., Znd Lieutenant, Infantry. RIiTIIFLiEQVgi2gqg'n, U. S. N- Z Z Z KNIGHT, HARRY W., Industrial. NILES, ERTQEST, F, A' E. F, Z Z RKOSS, ALFRED. Died at Camp Grant, Ill., on Oct. NORDBY, MARSHALL B., Aviation. 2 Z Z Z 13, 1918. NORTH, JOHN K., lst Lieut., Machine Gun Bn., A. E. F. Z Z Z Z KRAGH, HERBERT E., lst Lieutenant, Naval Aviation. INIUSSBAUM, HAMILTON L., Lieutenant, Aviation. 5 W Z ZZWQQ KRANN, EDNVARD P., Zncl Lieutenant. O BRIEN, HERBERT J., Royal Flying Corps, Canada. Z' ZZ ZZ KRAUSIEZ, QQJSTGVES Radio. gDELL, APIZBERT QRIXSI. CEI I I U S N Z fi Z4 KREG, . . . . . - ETJEN, ICHARD ., a io ectrician ,... 9 gf LAMFERT, FIJORENCE, Government. O'HORA, CLARENCE, Chemical Warfare Service. 2 ,Z LAMPMAN, CLIFFORD E., F. A., A. E. F. OLDS, RUSSELL B. h Z ZZ Zi 22 LARRABEE, EDWARD, Znd Lt., Royal Flying Corps. O MALLEY, EDWARD, Marines. A Z ZZ Z? Z? LATHROP, RALPH W., Radio. OLSON, JULIAN T., U. S. N., U. S. S. Minnesota. 9 ZZ if LAW, E. J., lst Captain'S Mate, U. S. N. OLSON, ARTHUR O., Znd Lt., Machine Gun Battalion. 2, ZZ Z2 22 LAW, ROBERT O., U. S. N. OLSON, LEONARD C., Aviation. 3, Z3 Z2 LAXVSON, C. P., Sergeant, MachineGun Branch, A. E. F. ORR, ROBERT C., Aviation. . ZZ Z? 5' LEHMAN, H. J., U. S. N. OSGOOD, W. PALMER, Quartermaster, Naval Aviation. gg if LEMENKUGEL, EDW. O'SHEA, STANLEY, 2nd Lieutenant, Infantry. gZ Z? if LEIMENKUGEL, J. M., Signal Corps. ONSHEA, VINCENT, Cadet, Marine Aviation. gg Z? Z4 LERDAHL, NELS C., 2nd Class Seaman, U. S. N. OSRAMP, A. M., Aviation. V - Z1 gZ Z2,,,,ZZ LEWIS, QUOI-IPL? Pcqigatce, kgedical Corps. EADDOCKHRYCHEN 11111, Zlstj ?rg3ant, Aviavxorg F Z MUFZ f 9 LEXVIS, M. ., n a io ectrician. ARKER, ERBERT ., n t., viation ,... 4 Z Z LICHTENWALNER, RAY, U. S. N. PARR, FRED, Aviation. Z Z Zig LIEBERTHAL, PAUL R., Sanitary Corps. PEARSON, RALPH J., Government. fi. Z Z ' 4 LINDEMAN, LANVRENCE O., Br. Amb. Service, italy. PELTON, HAROLD E. L., Signal Corps. 2 f Z LOGAN, CEDRICF., Radio, U. S. N. PERRIGO, BURTON, U. S. N. gi Z Z Z LUESCHER, ELMER W., Aviation, A. E. F., France. PETERSON, CARL V., 2nd Lieutenant, Infantry. Z Z Z Z LUND, ALF., Corporal, Ordnance. PETERSON, LEO W., Sergeant, Medical Corps. 3 Z Zip? LUNDBERG, GUSTAV M., Yeoman, lst Class, U. S.lN. PETRIE, HAZEN H., Private, Coast Artillery. Z Z Z 2 LYMANWSIEORGE C15 Lieutenant, Infantry. EETT, ERNSTEH., Colilpogil, Infaaitlry, IEC F. Z Z f F 4 LYONS, AYMOND . ICKHARDT, DWIN ., rivate, OSDICS Orps. g MCADAM, LINCOLN G., Sergeant, F. A. PIEH, WM. J., Marines, A. E. F. Z Z 2 MCCAFFERY, ARTHUR L., Sgt., Medical Corps, A. E. F. POND, STUART A., Signal Corps. Z Z Z Z MCCALLUM, VERNI ERNEST, U. S. N. POTTER, RUSR P., 2nd Lieutenant, F. A. g Z ZZWZZ MCEANDLESE, STAtxg.EY R., Rrivlate, If Igantry. A E F EOWERS, EDWARD U., Naval Aviation. ZZWMZ Z4 f4 Mc ARTHY, OHN ARTON, st t., n antry, . . RINCLE, DWARD. - n , gg ZZ 72 Z MCCLINTOCK, ALAN C. PRYOR, G. R., Znd Lieutenant, Aviation. 5 57 Z MCCONNELL, ANSLEY B., Pvt., Infantry, A. E. F. PUNGLE, ED O., Lieutenant, Aviation. 2 ,Z Z2 2 MCCULLOUGH, ARTHUR L. QUIMBY, JOHN A. Z, QZ ZZ Z MCDONALD, DURWALD L., lst Lt., Aviation, A. E. F. RAASCH, EWALD C., Government. Z MCDOWELL, L. J., Aviation. RAGATZ, LOWELLJ. A 25 gZ Zz 2 XMCHUGH, KENNETH Corporal, F. S. Killed on XRAMSEY, FLOYD, Sgt., Q. M. C., A. E. F. Died of Zi ,Z Oct. 25, 1918. I inHuenza, August'2l., 1918. jg Zz MCKENZIE, BASIL F., Engineers. RAND, WENDELL P., Aviation. Zimg MCPHERRIN, JOHN 2nd Lieutenant, Artillery. RAY, C. HAROLD, Znd Lieutenant, F. A. gg :Z Z 2 MCROE, WM. J., Private, Engineers. READING, CLYDE W., Aviation. 2"""Z Z 6 MCNAMEE, SHIRLEY, Zncl Lt., Infantry. REDIN, ROY W., Aviation. 2 Z Zi 2 MALONEY, GERALD C., Sergeant, F. A., A. E. F. RENANDER, ARTHUR W., Ser eant, Aviation. Z Z Z 2 MANN, LOUIS R., Znd Lieut., C. A. C., A. E. F. RENNENBOHM, OSCAR, U. S. gf Z 2 MARTIN, O. W. REUTER, WM. R., U. S. N. Z Z Zi Z MATHEWS, E. W., Znd Lt., Artillery. REWEY, ROBERT L., 2nd Lt., Infantry. gi Z Z 2 MATHEWS, M. C., Industrial. RHEINGANS, WM. ., 2nd Lieutenant, H. A. Z Z Zi Z IXAAXXVELL, GERALDINE, Bacteriologist. RICHTER, HENRY ERRYFIELD, F. A., A. E. F. get Z Zvi E MAY, GEIO. Loiislliflgrirlgas. EIETBRO35, FIEEDJ., Private, Medical Corps. Z Z 1 1 AYER, RED ., . . . ITTER, M., ieutenant. 4 f Z ' 2 MEIER, PAUL. A ROBERTS, GLENN D., Q. M. C. Z Z Z MELAAS, KARL C., Lieutenant. ROBERTSON, MARTIN R., Aviation. g Z Z 2 MELCHER, BURTON, Coast Artillery. ROESSLER, LESLIE A., Private, Engineers, A. E. F. 3 Z Z 2 MELVIN, ROY E., Radio, U. S. N. ROGERS, SAMFSON, JR., Naval Aviation. Q Z ZZWQZ MERCER, DONALD WINTERS. ROMIG, PAUL W., Lieutenant, Field Artillery. g,,,,,,Z Z3 ,Z MERWIN, GILE E., Aviation. ROSE, AUSTIN T., Naval Aviation. ZZ Z, 2 MESERVEY, ARTHUR R., Aviation. RUBEL, HENRY Scorr, Radio Electrician. ,S Z5 ,g MEYER, HARVEY G., U. S. N. RUSH, J. COURTNEY, Marine Aviation. Z Z' ,Q MEYER, MARTIN EMIL, U. S. N. RYDJORD, JOHN, Mus., Gen. Hdq. Board, A. E. F. g QZ Z2 gg MEYRICR, GORDON Radio, U. S. N. RYCH, EDGAR W. Z Z2 Z MILES, BENJ. F., Private, F. A., A. E. F. SADLIER, RICHARD E., Private, Aviation. 3 gZ Z2 ig MILLER, GEO. PAUL. SANDERS, SHIPP GILLISPIE, Sanitary Corps, A. E. F. Z ZZ Z1 Z MILLER, HARRY I., Radio, U. S. N. SCHEIDENHELM, A. K., Cadet, Aviation. 3 Zg 5 MITCHELL, DONALD E., Private, Infantry, A. E. F. SCHERNECKER, EDW. GEO., 2nd Class Seaman, U. S. N Z' ZZ ,Z XMITCI-iELL,4Ji?lEJIIfI9G., Lieut., Infantry. Died in Paris ECI-IINDLER, WETER, Engineers. Z fg 25 an. , . CHLOMOVITZ, ARRY. y 2 lI:A!lOEHLMANN,FVigLL5xMSFNSegt., Q. M. C. ECHMIDT, QRNO J., 2nd Lieutegagiit, lngmngryiq ,MM ONTAGUE, . ., . . . CHMIDT, ARLTON L., Petty cer, . . . 9W"'f Z Z MORAN, LEONARD E., Government. SCHMIDT, GEO. A., Sergeant, A. E. F. Q Z Z 3 MORGAN, LLOYD, Sergeant, Medical Corps. SCHMIDT, RAY OTTO, Government. Y 2 Z Z MORONEY, OHN R. SCHOWALTER, HERBERT P., Sgt., Ordnance,-A. E.-F. Z Z 5 MORSELL, . B., Radio, U. S. N. SCHNEIDER, WALTER E., Znd Lieutenant. 5 Z Z MORTIBOY, LEE, Engineers. SCHRAGE, C. T., Elec., U. S. N. R. F. Z Z . 3 MILDOWNEY, FENTON P., 2nd Class Seaman, U. S. N. SCHROEDER, JOHN E., Naval Aviation. 2 Z Z Z MULHOLLAND, L. G., Machine Gun Bn., A. E. F. SCHUETTE, JOHN A., lst Lt., Aviation. 5 Z Z ij MULVEY, WM. HENRY, Private. 1 SCHRADER, JOHN E., Naval Aviation. gi Z Z Z MURPHY, LAWRENCE, Lieutenant, Machine Gun Bn. SCI'-IXVARTZ, MYRON E., Infantry. Q Z . ., Z . 3 5 Z Z 3 3 Z ei' Z Z i2161111Miyagi1111111111fffffffffffffffffgffffnnffffffff 1 ff 1 ff ,ff ff ff ffffgfff ffffffffrffffffff ,fffffuf,1101111011111111111011011ff,ff111,10111,fffffffgfffnfffffffffff114111 fab Z , ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, , . ,,,,,,,,,,, , I ,,,,,,,,,,,,,,,,,,,,,.,,,,,,,,,,,,,,,,,,,,,,,,,,, Z A Z F if ,.,,,,,,,,,,,.,,,,. , ,,,,,,,,,,,,,,,, , ,,,,,., ,,,,,,, ,,,,,,,,,,.,, , ,,,,,,,, , , ,,,,,, , if if F F Ik Z 1 Page 376 A ' W if xxxsxxx xxx xx , if 5 I , , , I if , , 1 , I I 'Av , I , 7 'k' E s E 1 1 4 2 1 E 1 1 s 1 1 1 S 1 S 5 7 7 1 1 5 1 7 5 1 1 1 W NX X . xxxxxxxxxxsxsxxxxxxsxxxsxx-.xxxxu xxx 4 1 , 1 4 2 Z 1 1 4 1 1 E 1 1 4 5 5 s 1 1 5 1 Zi Zi 1 Zi' f Zi' Zi: 3 6 1 5 i1 1 7 1 7111 4 2 1 5 9 1 1 111111 'A' 1 1 1 if' 1 1 1 1 1 1 1 1 1 1 5 1 7 5 1 5 -111 W g1111111111111111111111111111111111111111111111n1111111111111 A 111111 1111111111 i . Z 11111111111111111 11111111111111111111 SCOTT, IAN C., Ser eant. SCOTT, OWEN L., S. N. SCOTT, RALPI4 H., A. E. F. SCRANTON, l'lUGl-l GREOC, ENGINEER, U. S. N. SEMON, EDWARD M., Captain. SHARP, DONALD E., Government, Bureau of Standards SHERMAN, HELEN, In Training as Nurse. SILBERNACEL, EDW. G., Hospital Corps. SII.vERNESS, EMIL L. SIMPSON, ALEXANDER L., U. S. N. SILVERMAN, EDXVARD, U. S. N. SKOW, CHAS. T., Sergeant, Aviation. SMITH, ROBERT EVANS, Private, Infantry. SPOI-IN, GEO. D., U. S. A. STALKER, NORMAN D., Ensign, U. S. N. STANDER, A. E., U. S. N. STAIDL, STANLEY A.. Aviation. STEARNS, WM. Y., Hospital Corps, A. E. F. STEELE, RICHARD, 2nd Lt., Aviation, A. E. F. STELLING, LENNO A., Private, Engineers. STEWART, DUNCAN J., Private, Field Artillery. STEWART, JOHN, Ensign, U. S. N. STEINLE, VERNON, Lieutenant. STOCKUM, S. F., Corporal, Aviation. STUMPF, HARRY R., Private, Infantry. SULLIVAN, SAMUEL, A. E. F. SUNDERLAND, PAUL, Musician, U. S. N. SNVEENEY, CHAS. E., Aviation. SWIFT, JOHN D., Radio, U. S. N. SWIFT, WM. A., Znd Lieutenant, Infantry. TAYLOR, J. L., Industrial. TAYLOR, GORDON H., Heavy Artillery. TAYLOR, THOS. D., Sergeant, Engineers. TEICEN, ARTHUR H., Hospital Corps, A. E. F. THEISEN, GEO. D. THOMAS, ROBERT K., U. S. N. THREINEN, BERT A., Private, Aviation. THIELDGENS, VICTOR A., U. S. N. TTISHLER, HYMAN, Private, Engineers, A. E. F. Died ir5France from Wounds received in action Oct. I I7. TOERNE, OSCAR T. VON, Tank Corps. TONER, HAROLD J., Industrial. TOOMAN, A. R., U. S. N. 'l-OUPAL, ADOLPI-I, Field Artillerv, A. E. F. TOUSLEY TRAHTIN TRANTIN , HENRY D., Hospital Corps, U. S. N. , ERNEST, Government J.,JR Artillery. TRACHTE, CLARENCE G., Medical Corps. TRUAX, LYLE L., U. S. N. XTYHLER, H., Private, Engineer. Died Oct. IO, l9l8. 'ULMER CHARLES H., Lieutenant, Marines. Missing Since October, 1918. UPGREN, ARTHUR. VALIER, RONALD B., Aviation. VAN ARSDALE, M. W., Pilot, Aviation. VAN GENT, PAUL, Engineers, A. E. F. VAN HAGEN, GEO., Lieutenant. VAN SLYCK, LOUIS W., Radio. Voss, EDW. F., Field Artillery. WACNER, NEWTON V. D., U. S. N WALDO, DONALD, Radio, U. S. N WALLIS, HARRY G., U. S. N. WALLIS, ROBERT S., Corporal, F. A. WALTON, WESLEY WARREN, JOHN H., Medical Corps, A. E. F. WARREN, WADSWORTI4, JR., Hospital Corps. WELCH, l'lAI.BER'l' A., Private, Engineers. WESTON, FRANK LAWRENCH, Aviation. WHEELER, I-IORACE P., Private, Signal Corps. WHEELER, WARREN G., Industrial. WHELAN, ALLEN. XVHITE, ARTHUR B., U. S. N. WHITE, KENNETI-I S. WILCOX, G. B., U. S. N. WILEY, ROBERT L., lst Lieutenant, A. E. F. WILLIAMS, L. H., Corporal, Infantry. WILSON, HERBERT D., Corporal, A. E. F. WISE. SOLOMON, Aviation, A. E. F. WITTENBERG, JOHN F., JR , Industrial. WOLFE, J. CALVIN, U. S. N. WOOD, BENJ. B., Marines. WOOD, JOHN, Aviation. WRIGHT, DUEY E., Private, Aviation. YOUNG, GAVIN W., Hospital Corps. YOUNG, DUDLEIGH J., Hospital Corps. 111111111111111111 -11111111 1 1 v11111111111111111 1111111111111111111 RVLL ZANDER, HENRY G., JR., Aviation. ZEITZ, EDWIN, Private, Signal Corps. ZIECLER, ALVIN, Infantry, A. E. F. ZNNICKER, M. H.. 2nd Lieutenant, Engineers, A. E. F. 1921 ANDERSEN, CARLJ., Private, Field Artillery. AMES, IQIRK, U. S. N. ARCHER, ROLI,AND H., Hospital Corps. ARNOLD, RUPERT S., Government, Bureau of Mines. AYTON, 'IPI-IOMAS W., Lieutenant, Field Artillery, BAKER, L. J. BAMFORD, WM. L., U. S. N. BASSATT, JAMES, Hospital Corps. BATES, WILI.ARD H. BENNETT, JOI-IN, Chief Yeoman, U. S. N. BERNSTEIN, JAMES E., U. S. N. BETTENOORF, ARTHUR J., 2nd Lieutenant, Infantry. BLATTER, RUDOLPH, Lieutenant, Field Artillery. BLOODCOOD, DAVID, F. A., 32nd Division, A. E. F. BLUM, FRED G. BOHMANN, ROBQT. B., U. S. N. BONHAM, EARL E., U. S. N. BOTI-IAM, RICI-IARD G., Medical Corps. BOWER, WM. A., Aviation. BUNDY, JOHN W., American Red Cross Service. BRITTINGHAM, J. E., JR., Znd Lieutenant, Infantry. BRITTINGHAM, THOS. E., Lieutenant, Infantry. BROWN, LLOYD JOSEPI-I, Sergeant, Artillery. BROXVN, HAROLD, U. S. N. BUETTELL, ARTHUR L., Corporal, Ambulance Service. BURDON, CHAS. E., Private, Infantry, A. E. F. BURNSIDE, GEO. HARRISON, Marines. BUSHELL, ROBERT, U. S. N. CHANDLER, IRAY W., Private. CHASE, SHERMAN, U. S. N. CHAVIS, W. CLARK, LORAN S., Private, Infantry, A. E. F. CONNOR, RICHARD M., U. S. N. CONNOR, WM. D., JR., Signal Corps. COOK, HAMILTON B., Private. CRAIGI-IILL, ELEANOR R., Medic. Corps, A. E. F. CROCKER, W. C., 2nd Lieutenant. CROSXVAIT, SCOTT T., U. S. N. CROWLEY, R. J. CURRY, ROBERT J., Radio, U. S. N. CUSSON, SAMUELJ., Aviation. DAVIES, ROLANDJ., Medical Corps. DAVIS, GEO. C., U. S. N. DAY, WALTER R., Marines. DEXTER, KENDALL, U, S. N. XDOLAN, LLOYD T., Quartermaster Corps. Died at Camp Green, N. C., on Oct. I7, 1918. DOWLINC, WM. J., Coast Artillery. DUNCAN, M. G. EARLE, KENNETH S., U. S. N. EDWARDS, LEROY, Radio, U. S. N. ECAN, TIMOTHY, Hospital Corps. ELLISON, FREDERICK ., Lieutenant, Aviation. EMEL, RALPH C., U. . N. EMERY, CLYDE B., Field Artillery. ENDRES, HUCO, 2nd Lieutenant, Infantry. FAUERBACH, KARL H., Signal Corps, Aviation, A. EF. FEDDERSON, N. K. FEDERER, L. J., U. S. N. FELDMAN, JOSEPH G. FELKER, CHAS., Artillery. FOLEY, LEON F., U. S. N. FOSHION, HERBERT W., Sanitary Corps. Fox, RAYMOND WALTER, U. S. N. FRANK, JACK WILLIAM, Radio Service. GIDDINOS, W. W., Captain, Field Artillery. GILLEN, EUGENE, U. S. N. GLADDEN, ALFRED HOWARD, U. S. N. GOLDBERG, MARK, Private, Coast Artillery. GRACE, H. R. GRAHAM, RUHL, Sergeant, Aviation. GRAY, WELLSLEY D., 2nd Class Seaman, U. S. N. GREGG, ASHTON C., Coast Artillery. GRUBB, EVERETT L., Lieutenant, Field Artillery. GURNEY, BENJ. F., Radio. HATCH, WARREN F., Private, Medical Department. HAMMOND, GORDON B., Lieutenant, Infantry. HARRIS, HENRY H., Aviation. r HALLATZ, CLARENCE, U. S. N. 111 1111111 1111111 11111111 111111 11111111111111111111111111111111111111111 111111111111111111111 11111111111111 111111111111 1111111111 111111111 1111111111111111111111 11 111 11111 11 111111 11111 111 1 11111111111111111111111 Ill I - Il rl 1 l lf ll . , ,, ,,,,,,,,,,,,,, 1 ,,.,,.,,,.,,, , ,,,,,,,,.,,, ,,,.,,,.,,,,,,,..,,,.,,,,,,,,,,.,,,,,,,..,,, . . . i' f f' , , ,, , t wk in if 'A' i f H ff 1 ' if i ai f K 41111111111111111110111111111111111111111111111111A 1111111111111 411111111111111111111111111111111111111111,,1111111 I Page 377 9 I 3 ' 01fillfillllllllllllllllllfllllllllllllflllllfllllrllllllflll 111111 1 11111110 5 4251? I 5: 52 52 52 fi 5: 5: 52 52 52 52 52 52 5: 52 1 2 s 5 2 5 1 1 E 1 1 1 s s 1 5 61 1 111 3 1 1 s 51k 5 5? 5 5 gf 5 51 5 5 5 5 5, 51 5 51 if 5 71 5 5 f 5 5 gt 5 Zi f 5 gi 5 at 5 5 5 51 5 5 5 5 5 52 52 52 52 52 52 52 52 NNX get Zi f Zi 5 if gf 5 TUV 5 5 1 1 f . , 4 11111111111111111 5 5 5 'Ar if 1 1111 7 1 111 1111 1 1 11112 TNVNVR HAMMOND GORDON B., Lieutenant, Infantry. HAZARD, CHAS., Student Pilot, Naval Aviation. HEAD, G. H., Private, Infantry. HILL, CLARENCE D., Industrial. HOPE, PAUL F. HOLLATZ, CLARENCE A., Sergeant, Tank Corps. ICKES, WILMARTH, Artillery. ISAACS, HENRY G., Lieutenant, Infantry. JACOBS, LAWRENCE C., A. E. F. JACKSON, LYMAN E., Private, C. A. C. JANES, GUY E. JAQUISH, JOHN H. Band Leader, A. E. F. JOHNSON, E., lst Lieutenant, A. E. F. JOHNSON, ROY S., Hospital Corps. JORDENS, H. W., U. S. N. KANARD, LEONARD, Private, Cavalry. KAREL, JOHN READ, Private, Infantry. KEHL, EDWIN M.. Private, Hospital Corps. KLAPPROTH, W. H., Lieutenant, Heavy Artillery. KLENERT, SIDNEY F., Aviation. LAMYER, MERRIL, Private, Truck Driver, A. E. F. LARSON, O. R., Ensign, Znd Class Seaman, U. S. N. LEAN, HOWARD WM. LEINFELLER, CYRII. L., Lieutenant, Artillery. LENTZ, ROB'T. C., Motor Transport Corps. LESSLAR, MONTAGUE. LIGHTY, HAROLD K. LINDEN, JOHN F., Hospital Corps. LOBRE, HUBERT, U. S. N. MCCOLL, WM. F. MCKAY, JAMES H., U. S. N. MCNAMERA, ED. J. MARSH, FRANK H. MATCHETTE, WM. MATHIE, HAROLD O. MAURSETH, LARS H., Government. MERKEL, LEOJ., U. S. N. MILLS, FREDERIC F. MOELLER, HERBERT G., Aviation. MURPHY, ARTHUR M., Aviation. MUTH, HERBERT J., Private, Field Artillery. NASH, WM. MORGAN, 2nd Class Seaman, U. S. N. NEWTON, ORRIN I., Aviation. NORD, S. K. NORTH, LUDLOW F., Ambulance Corps. OKSANEN, OTTO W. SOSTRANDER ALBERT H. Infantry. Killed in action July 19, 1918. OWEN, ALLEN K., British Royal Flying Corps, Canada. PACE, HORLAN, U. S. N. PERSTEIN, I. ARNOLD, 2nd Lieutenant, Infantry. PHILLIPS, HARRY A., Signal Corps. PICKARD, WM., Lieutenant, Infantry. PICKARD, JOHN, Aviation. POINDEXTER, ROBERT G., Private, Marines. 11111111111111111 . POTTER, DONALD WM., Private, Hospital Corps. PURNELL, G. W., U. S. N. RADKE, ALFRED H., Private, Medical Corps, A. E. F. RAMSDELL, IRVINC MEYER, U. S. N. RILEY, MAXWELL EDW., U. S. N. RISBERG, HAROLD N. ROBERTSON, R., Private, Q. M. C. ROTHSCHILD, JOSEPH D., Private, Q. M. C. ROUNSEVILLE, WILLIS, Corporal, Hospital Corps. RUFF, CLARENCE A. RUHL, GRAHAM A. RUSSELL, CHAS. W., U. S. N. SANDERS, WILLARD, Ensign, U. S. N. SAWYER, MERRILL, Infantry. SCHAPIRO, SAUL. - SCHELL, LIONELJ., Aviation. SCHMIDT, EMIL MORRIS, Radio, U. S. N. SCHROEDER, HENRY F., Hospital-Corps. SHORNEY, GORDON, Naval Aviation. SILVERMAN, HENRY. SMITH, GALBRAITI-I M., U. S. N. SMITH, H. C., U. S. N. SOLOMONSON, CARL E., Ordnance. SPARLINC, E. W., Naval Aviation. STURTEVANT, PAUL, Sergeant, A. E. F. SWAN, GEO. DEWEY, Royal Flying Corps. TERRY, OWEN R., U. S. N. THOMPSON, EARL, U. S. N. THOMPSON, R. W. TRUMPF, FORREST, Medical Corps, A. E. F. TUCKERMAN, GUSTAVUS, U. S. N. UBBINK, JOEJ., Private, Aviation. UHL, ARTHUR, U. S. N. VASSELOR, ERNEST C. - VASSELOS, ERNEST C., Sergeant, Personnel Dept. 'WAGNER, KARL, Engineers, A. E. F. Died in France of pneumonia, April IO, 1918. WALKER, WM. E., U. S. N. WALL, ARTHUR B., Signal Corps, Aviation. WARNER, P. W., Aviation. WARREN, JOHN H., Hospital Corps. WATTERS, GEORGE H., 2nd Lieutenant, Infantry. WHITE, RICHARDJ., U. S. N. VVILDEMAN, WM. J., Red Cross Service, A. E. F. XVILLIAMS, FRANKLIN R., Landsman, U. S. N. WILLIAMS, RALEIGH, U. S. N. WILLIAMS, ROBERT F., 2nd Lieutenant, Aviation. YOUMAN, CHARLES R., Private, Ordnance. YOUNGREN, RALPH L., Field Artillery, A. E. F. 1922 LATCHFORD, ELLIS V., Znd Class Quartermaster, Naval Aviation. 1111111111111111111111111f11111111111111111111111111511111111111111111111111111111111111111111111111111 11111111111111 11 111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111 5 ' ' 1: 111111111,,11111111111,11111,1,1,1,1 111111111111 2 11111111111 111111111,1111111111111111,1111111111 111,11 2 ' - I -1 111111111111111111111111111111111111111111111111111A 111111111111 . 91111111111111111111111111111111111111111111111,1,1 l M! Page 378 """""""" lIf 5 4 Q K 1 I V 5 1 111111 1111111111 1 t ' 5 1111111111111111111 5111111111111111111111111111111111111111111111111111111111111111 QCODQTED CEIOLITWLOD S Tecorateb for Qalor Arthur HT. Zllexanoer, '14, Wellesley, mass. lieutenant, Aviation RECEIVED the Distinguished Service Cross for bravery while piloting his plane during an attack far behind t-he German lines. He was seriously wounded in the encounter, but he brought his wounded and un- conscious observer back to the starting point 20 miles behind our lines, driving and safely landing his machine between fainting spells, as his comrades reported, then secured surgical attendance for all the other wounded members of the escadrille beforeihe himself was attended to. After his recovery General Pershing selected him as one of six officers, one from each branch of the serv- ice, who had been conspicuously brave, to investigate instances of bravery and recommend awards. Lieut. Arthur H. Alexander Flfatlan Ui. Amen, '10, Clarinbar, Kiowa ' lieutenant, 16. S. IN. Ambulance' WAS awarded the Croix de Guerre in l9ll1'7 'While Commanding the 5lst 'Ambulance Unit in Alsaceg Amen. enlisted in the S. U. I,.,1A,m ,ulance unit in june l9l 7. After completing hisl "training at Allentown, Pennsylvania, he was made ,Sergeanrtelwajor and sailed for France ingjanuary .l95l,8r. l'n,,I'uly and August Lieu- tenant Ameii attended nonfe5rrirn,issioned officers' school near Paris where he receiveclilris cdnimission. xlluge 380 t. Harlan 'Becotateo for Valor C3eo1'ge Carey, '17, Beloit, livis. lieutenant, 28th fllnfantry A' ROBABLY no Wisconsin man has received as - many citations as Lieutenant Carey. On August 2, l9l8, he received the Croix de Ciuerre with palm at the Barrech Nlarech al Ney near Toul. Commander General Petain of the Tenth French Army signed the order for the decoration, citing his work at Berzy le Sec in the Second Battle of the Marne, july I8-23, l9l8. Previous to Carey's award for gallantry he was cited by Major Geneial Bullard, commanding the First Ameri- can Division, for extreme bravery during the operations connected with the capture and defense of Cantigny, May 27-31, l9l8. Lieutenant Carey seemed always to be placed where the fight was hottest for he again ac- quitted himself nobly in the terrihc action at Soissons, July I8-23, l9l8. For his heroism at that time Major General Summerall, who succeeded General Bullard as commander of the First Division, cited him for the third tlme. Lieut. George Carey i Lieut. John A. Commons fllobn Commons, '18, mabiison., wis ' A Iiefutenant, 339th flnfantry A rlfitishilvllirtary Cross for bravery shown in service in the Archangel district.-' Lieutenant Commons vxgais' ongof, the first Wisconsin. ment fo go into training at Fort S'lffericlan inf l9il,.7. Sent to Camp Cus- ter, Nliichigan., he joiined thefsame regiment with a part ofvwhichfihenis now serving. 'During his Iilefiod of train- ing he became an expert the Browning machine gun, and'-many of his exploitsgifn Russia have been due to his adroitness and ezgpertness in control of this weapon. On Sept. 7, l9l8, he wen'tf't'o-.Russia and sawimmediate service. ' Slightly wounded, was sent forthe hospital but was shortly again '0I1v'lil71C?A'fI201'1t. It was during the attack on Kadish ,Lieutenant Commons Won his decoration. After almost all? this zmen had retreated under the heavy enemymlire, Lieutenant Commons with a fellow officer held his post, fighting stubbornly, and saved the day for the allied troops. . Page 381 S wecorakcb for Valor 3I'l'arrig1Q7. Craig, 'l5liClevelan6, Ohio lieutenant, Aviation RECEIVED Croix de Guerre with palm for con- spicuous bravery as an observer. While flying with the French army he flew far behind the German lines to get necessary information for artillery. During his return flight his plane flew directly over a German trench firing at the same time all his machine guns and severely crippling the German sector. One of the brav- est feats of the war, his commander says. At-this time he received the Croix de Gu'erfe'fzand yvaswcited again shortly afterward for braVeryf,g,g1Luggin'g'Manother Hight. For this he received the Creiix-de Gubrre with palm, but . . . A . 1 ' 1'-if' ' lbsthis life m the exploit. l-'Lx ,f X -, , 5 ' -1.-,,,-,1.:, . g in f Q if or or Lieut. Harry W. Craig 'fi Y' N g T - Qlrzrkk wg, If-Ns , As, , . , i ' - 355, r ,-1 ,., . f-frm - - I 1, 1 N L52 ' I Xij- ' 13.1 in " . Ir 1 ,3 A 'Z ..f?-.29 ,ig , cf -Y: , rw "Zvi ,aft - 1 ref. -'P , P' " ef ' " 'I 1 Jffarry illvblon, 1i3,.monbq,vr, ., , Y ,-,V ,dk .,.. ajax , IEUTENANT DILLON vxias .walked theiCro1iiv - in l C' awardfxvhe' wafsamenitioned in "twice 'for extigaolridignaryif-Tlifaveryp-in Hqjffyas in H G??ZfrelQ1edQ5SsiNP1 dated A1JjQ"2'Ql 918 'Mfor galllanthyminaagt?ib1fi'1i"fhe opera" fi . . Qs- I -' ' '2-- in ,I "au v w 1 Ay: .w - - C0QlneSSl'5ip,ifLEh6YAfinwl' ,attdeffoii iivheni the :Hifi Hanks j?3'iafi1y"hE1 ieQup,l , ,.f A :fmt ' J 'fer' w-:ag'fPz3.F .", 'Q' 2 -,Fir 1-'U 0.1,-'2'f.', fi' lFl??t'-f'I'?10d2f'i4ii2-' i K St0rm4.and,ioccupy Mfg, Y. was i L, QM . 1. Sid af all r V e toovlgzraliliQbJAQgtygQgsg'Ess1l y e I hwy-,?an.d by his splenchd ,5?h lfigfieet1ve possible." I it which won him his 'crossi jzierforrning a difficult serv- ice, l..ieutenant'Dillon was struck and instantly killed by a p16C6 of shrapnel. , ' ' Page 382- Lieut. Harry Dillon 'Eecorateb for Valor Starr S. Eaton, '17, mabison, wis. Captain, Company 1, 231-6 Zflnfantry KECEIVED Distinguished Service Cross for brav- ery shown July l, l9l8. During the Battle of Vaux, when hard pressed by the enemy and support and reserves were kept back by enemy artillery, with a depleted company he held his section of the line for nearly twelve hours. During all this time he was a constant example ofilieiqoism to his men, sustaining them and urging- t-hern to greaqger bravery in the face of almost certain de5'th.,,,,gljleiWag liilfled in action Sept. I4, l9l8. Pi' iiii '12, 1? T7 ' Q. rw as .'-.1 .L If ,....f9a.T.x l " My I , vw: tw A L Capt. Starr S. Eaton Y -.Lj-,i,.31-.,,2 MHA! A V I ff , fi ii"fw75fi'i ' lil 1 jr! V y Y w I -T: 'i,v ' . ,t t . it , r 'QQ 'r-r fiillotbiiibllf F12413ZZa6ison,'iR22ispe,g, ' " ' ' V ' tt"-'4 if , ' WJ' 'fill 14- -',gl, 1Q' 1 iff " 5 , 1 , , ,- ' , i gw"fi:3if5',.g"-if , "gJ:1t:l:.-1 iff -mpg V V- - l pfgshed, Servicefi-jiGfoss,Nfor-Ebrav-V ' '39ff1,s,,.x33- -il .1 vgfa3t,3vg,,f,.,-GWSQQD3 - I . y , A Aw -N 3, ,fv - ,I A- ef2aepggvgisliogivzjffatiiflhagtgau Thiiemy41:1g4August,i,?:1l,Q,,lg'8. 1 .uzrfwzwn ff, , -f f.xs..'a U -A 4s ' alt wa G XJ-- . 11Ns:'?":- V A gfgflarner hfasQseemreomtinuf6us.,servrce,,'s1nceQfhte'wentlitpwtghe ' '," H i -A -- fQ'K1iaiff-'Wfwifiti-. 'gy 'wif' 1:4 r 5,MenQglnQnkio1id1exif.d,wnmng-fiheff'I Qiilrfntnoubla ,ltleiseryedtat ,f,, - H ff-1'-rilzfrer hestetiim NediliaQ51un.feered'vasflan an+b'5f1anee'rdr1vefr 1'Z-Ifztivzms'-N' Q '6::',,e.1- "l ' 1, ,Q 55 j' - 5 A A , gg , . ' arigimqasgstfmff ff'g'onEi3aYnmeEgf:fwxfgteimfysglklmionthss lgarelf SGITVICCX -all fmt, w '- .M HH -1- i A ,ff f .'-.xf,1f"-INF, "..' 4, -- VV-H E31 8 f a, fifi'i'i1"4 ,.,," V 'PJ fit..- 552' WS, ,." 'f W., K , A, 3 "'- 1 9 ,gi fthe . l , 'EJ l . Cilvlsionifvfrs' ,'t' g :ac- V L2 wma as . r -,lm - I S 11ta1s0Hier2r 0f.y.h1Sr3aeg1mQaVfQ t f 'ffl -ff tagaiiistietbhe 'Guitar . .Wt ,g H , t ' iiii d5Yif?5li55'IT?5f1Y 72, . ' A fi ' z i aisbravery and coolness 4, 3.af?"5w "ilu Yea." LL. if'tf"k. - - . y displayed ,ait thatil z Ijgfggigayqarded him the " g 1 'United States decoratfi Ete1thg'1,,ht2i1id Work he was . l - A . 1 , - Osenitr home in Septemberagfprjinsggrgpgqigjgatf'!2Qagmp':Lewis, t and was awaiting ordersi' overseias'-when the 'F:lI'ITl1Sf2ICC . Capt Lloyd M. Garner was Signed' Pagef383 . t. Cyrus Catton Albert .175 Cfgiliizofej fi-jirfnceton,' Xl. 3. Ttiieutenant, IC. S. Aviation 5- .- ECElVE.D'Croix cle Guenre for bravery displayed near Verdun. He was one of the ,first Wisconsin men to enter service. For six Irionthswhewserved with a French ambulance unit in and around ljelgeagured Ver- dun At one time he traversed steadily for 48 hours a shell swept road, narrowly escaping finjury. Without food or sleep during that time his of mercy con- tinued until he' was removeclyqexha-usted. 'During the course of one of his trips a field which was ' swept by enemy machine.-giliil fairid Without assist- ' ance took out" several iEil1?1ffCh soldiers.: For this valiant service he . After thisgterm of service expired he aviation corps and served for some he Was killed Hear ISSOClL1I1 making a daring observation Hight bacli"fof'fthe4American lines. S 'Eecorateo for Qalor Glyrus II. Gallon, '18, Bozeman, mont. Ttieutenant, American Ililot of ifscabtille, Br. 127 .EIEUTENANT GATTQN was decorated with the French War Cross August 18, l9l8. At that time he was serving with the French. His citation came as an order from Chief Commander Vuillemin. Catton is described as an "excellent pilot, one who braves all hazard. Has never missed a bombing expedition since attached to the escadrille. Has on July I6 and 18, l9l8, particularly distinguished himself at the time of bomb- ing of the several passages of the lVlarne,' also on the 9th, 10th, and Ilth of August, during bombing expe- dition at very low altitude." Shortly after his exciting adventures with the French, Gatton was transferred to one of the American squadrons where his work was equally courageous. I Lieut. Albert F. Gilmore Page 384 Tecoraleo for Valor Uiicbaro Iffilorekb, '15, wheeling, W. Va. I Captain, 26' Eivision, Z3r6 Illnfanlry GAPTAIN I-IILDRETI-I, who was one of the first Wisconsin men commissioned and sent overseas, received the Distinguished Service Cross Nov. 3, I9I8. Captain Hildreth holds a rather remarkable record for rapid promotion. Two weeks after he received his commission in the infantry he sailed for France-june IZ, l9l 7, with the First Division, 28th Infantry. After a year with that division he was transferred to the Sec- ond, 23rd Infantry. After this his rise was rapid-pro- moted to First Lieutenant Sept. IZ, and, Captain, Oc- tober 24. For his bravery during the severe battles just prior to the signing of the armistice General Pershing, for the United States, pinned on his breast the Distin- guished Service Cross. Capt. Richard P. Hildreth i ' I Q 1 U A 1 if. '17, Kite lake, in , Ilgllllfildiihh Hero Squubron- I in ,isltingiiished Service Cross for: brav- X ,ery as time ef death, aSep.t. 26, I9i1l'8g Kelty was fiiS,tinguiS'h6S2l'2fS aa!-excellent .',, iiiilpt, ifor the Hun found impgssible to -er1gageisini,l5attle.g I-Ie his death While on an important aphgidigraphic missiombehindi the aiflefman, lines. ulilefyvas neaur1'f'Crepiong, when the :Wasp to brave, 'anti-aircraft'barrage to 'accomplish -his. mission! realized thatpthe success A, :of thewxArnerican fcigcpgipsgz gjiierided upon'hig?.f,iriE:ling the artillery -objectives., atterriiiting the impossible 'ai shell instantly killing his observer and that he crashed to earth and was lirrivltlie. fall. Lieut. Asher E.. Kelty Page 38:34- N 'ikcorateb for Valor Lieut. Phil H. Lasher 1, .- ,H , Y fjlbil FH. liasber, '19, Elgin, Fill. Sergeant, meoical ADQtdCbmQRt, 129th Flnfantry SERGEANT LASHER is one of those valiant spirits whose bravery consists of endangering all to help a fellow soldier out of danger. ln a fierce battle in early September, l9l8, the Americans were lighting along side of a company of English. The "Tommies" went over the top in spite of heavy enemy shell fire. Lasher saw one of them fall in a spot entirely unprotected from the terrific artillery fire. Observing that the fellow was not dead, Lasher left his trench and started out to help him. Gblivious of the shells which iwere falling around him faster every minute, he went but and, ministered to the wounded Britisher. Hiesyommandsf' recommended him for his decoration, particularly on account of this actiong although 'his other lservites had been equally meritorious. A ' V 7 f 3'l'f.'fEf,e3bertQ .i A ffnteljjifeter' R. LE ERT, an inseuctofiin the.Uni- versity, received the Croix, defiuerre while serv- ing as, -interpreter of prisoners- under fire. . For frnoijthsf during the worst fighting fof the Wai' Leberti served close 'to' the frolitfiflines, usually in ieontinlsial danger from enemy artillery, Hue. He is at Qiieserrqlwitli the French High5Qornrnission,,fiin1'rWashingtoi35J'3 7 V V Q ix.: ' ' N ,VW M -I . ,g "'ea V tenan ar-IIIY, 111 fhteg Dame of' Chateau, X 'D ,December fl91i8?S3fQiIih'eQ5presentation was I ff .3-2 i -' N 3. 4. Ci - J. ,a.., E,nM.i,v 7,2 y f '7r5,f- -ii .lg.iii.:1fr.-V, : . T. 8 3,211-3i,?gV..'!-If SQF1fhCaS5219i1'EaOVeH- .. -"F0rr.+i1err Y f . ,wfffffsr .1 1 ., 4 .. :ww:4aL,.,1,.i"w'xf4- ... - . ie-H tquous sqvices ln act10n?dlc17fiinggtlyesglgancleisaoffensivew' of Qctoberi' 31 4 iiii Llndbqgiggwifmughligiiigds, had many narrow escapes-J through his hel- ibuti not carry his 'name and number"."" fI 1 ' ' i ' Page 386 iilfisf ut. Gustaf H. Lind ism in St. Mihiel drive, Sept. I5, l9l8. S 'Decorateo for Qalor Casey V. Tloomis, '19, milwaukee, Wis. Corporal, machine Can Co., 6lb Keg. IC. 5. marine Corps RECEIVED Distinguished Service Cross for hero- Loomis left the University shortly after the United States en- tered the war and enlisted in the Marine Corps in April l9l 7. He trained for three months at Paris Island, was moved to Quantico, and sailed for France in October l9l7. His official citation reads: "The Commamder-in- Chief in the name ofthe President has awarded the Dis- tinguished Service 'Cross to Corporal Casey Vaughn Loomis, Machine Gur1'Co., 6th Reg. U. S. Marine Corps, for extraordinary.- liergilsm in action near Thiaucort, France, SeptL'44l15,,t,l9lr8. During an enemy counter at- tack Corporal Lg6ifr'i1iai?Rrol'ifntarily left a sheltered posia, tion., and in entirgeldissregiarel for his own safety, set-.sup his gun in the ,,Q1?n,f,u-ndenia heavyderferny fire. se- curing enHladingiT'HI5fie.bn' therfadvamfingqenerny, he broke up the counrtgurgattddli within IO0 yards.-.of our line." Corp- Casey V- Loomis QgrpdE5lWLooiiii,sEig5zas.3at thef front "'i' from 'March 5 to , Noifil l, l9l8.j' Hiilfriived a slightrwound at the Ar- gonne. At that his, regiment Was decorated by the French withitlfe Legion of I-lorior. - ri! 5,1 1 " ' Jg .. A M, -wh? X-,Jr.,1. 2.2,-x:.i,V .- - 2 rv 1,4 'auf . r . , Q, .. ,. as Wafmkrzxr. gmreey, r as ia .s . J - . , . ir M ,... ' f C ati Bel1eafuA"'W6od .chaise-'rrhiefry tis, wiiiela the V V ' 'if-wiliii 522"ffi-fi:f.,sf"i- ' , nfl ii gf-1 r. 'illffiffrvlnfszfso d1st1ngk?15hCdrflifimsrelvf-QS'fbisfsstwrfffungQ-they ride 1 rg., .vt ' - nu .. ' wg, -,ax .... Corp. Frank A. McCoy -u 'fi -' It Jr' Aiea +L ,,, , ,ra the Cf011iyQdiCgQiiil'CffC 2 1 mrinre. owaadf 1-' ' LQ flair 'r"'T2'? A 1 - , - , 41 'rt SA 13 of, Honor. W. The? a:1??A..,,the1 only :to receive' glii'eifLegion oftljlonor. nearly every man engaged was McCoy was se- 1 ' ' d d if 'riltlwa vere y injure an ig9y,go..tQrig E,g:ea,p,. we ' 'Z Qiwgilf.. f-" ,N Page U87 N Tecorateb for Jalor 1 A Lieut. Paton IVIcGilvary Ora Ui. mcmurray, '19, Evansville, wis. I 1 Ttieutenant, :Aviation RECEIVED Croix de Guerrefor bravery in flying. McMurray 'was one of the' first University of Wis- consin men to enter service, going over with the ambu- lance unit in ,Ianuary 19171. I-Ie saw 'violent and cori- tinuous service .as an ambulancedniver during his six months' service. After lhis' term of? sfervice'L.ieutenant McMurray enlisted with the American army 'as a pilot: While Hyingivviith a French' escadrille- he was sent over Withrfhis observer to spot enerny positions far back, 'of- the lines. Four Foklcers attadketif and he succeeded in driving' them all off, after-criippling two machines. On his returrihe flew immyediatelyf over an advancing' column of, 'artillery and 'enemy anti-aircraitgfire succeeded in seriously disa15li1YgQ,tliisifneW force with his machine guns. In flying slightly wou nded. The French government' him the Croix de Guerre for braverysliown oritliis and other similar oc- casions. Page 358 Ilaton mc6ilvary, '16, mabison, wis. lieutenant, 15. S. Aviation A-f'IEUTENANT IVICGILVARY is the only Wis- consin man who has been decorated by the Italian government for bravery during the war. For over a year lVIcGiIvary served with the American troops in Italy. During this time he made many flights over Austria, in bombing raids and as observer. I-Iis first decoration, in the form of the Croce de Guerra fthe Italian cross of warj, came after a successful observing Hight over enemy territory, September 20, 1918. Dur- ing one of the raids Lieutenant IVICC-ilvary accom- panied the circus of which the famous poet and aviator Gabriel D'Annunzio was a member, and had a fierce encounter with enemy planes. During the November offensive lVIcGiIvary's bravery was again conspicuous, and he was awarded the Bronze Medal for -Valor. 1 1 1 1 1 1 I Lieut. Ora R. McMurray S Tecorateb for Valor George 55. noble, '14, mabison, Wis. lieutenant, 168th Ifnfantry, 42nb fDivision HECEIVED Distinguished Service Cross for brav- ery in action July 28. During the Allied drive in which the Germans were pushed beyond the Vesle, Lieu- tenant Noble Was severely wounded. ln spite of the dangerous and painful injury he remained with his platoon in the midst of constant and severe action throughout the day until forced by loss of blood to stop. Like many, other Wisconsin heroes he wrote back, "1 did nothing at all Wonderful." But in spite of his pro- testation, his major gave him a high recommendation as one 'of the bravest men in his command. l-le was later killed in action. Lieut. George B. Nobl Capt. Paul Meyers r. 1'gig1j1'1' arfdfriflb firefl' Meyers is 'one' dl' only fflaul fill meyeers, '18, milwaukee., wis. Captain, Observer, American Tfscabrille BRECEEIVED Croix,d'eGuerre for bravery in the drive to Ap etmoungt, on .May 13, 1918. General Passaga, COIri1frIandingF'the'3Znd Army Corps, cites- Mey- fersuin his order ofthe day. "Gm April 12, 11918, intrusted by the command! an' euiggent mission, he did not at 511ies'ita,t5,to ,cross the linesgatva low altitude af 300 meters, despite unfavorable aigmqgphleric conditions, and to ,exe- -cute the required reconnaissance under violent macliine or three who have received the de Guerra Lleutenanti Meyers was Q 'one 'of th'e'15Jesft,1foQ1E12iQa11llifga pains who lever Wore the "Wi."' ilrle "lI.'m coming back for one more good year i 15IaitljfeffieswibxWlsconsin." We are Waiting for him. 1 g - ' e Page 389 Lieut. Gordon B. Reese TDecomte6 for Valor Gorbon 35. Reese, '18, milforb, 52. IIT. Ttieutenant, Flnfantry HECEIVED Distinguished Service Cross for actions during operations of Oct. 14, 1918. Lieutenant Reese is the only Wisconsin man to have received a decoration for bravery in Russia. During the fighting with the bolsheviki along the Vologda railroad he "re- connoitered enemy positions andxbrought back more useful information which was greatly instrumental in the success of the operations on 'Qctober 14." Again in the same recommendation forwgward, the command- ing officer states that "Since joiniinfi theycolilmn Lieu- tenant Reese had frequently fshoyggnayggeat' daring, loy- alty, pertinacity, and devotion, had given a fine 1 . ,, ,V A example to his troops. tk ' in ' , , fflhj, ,",j , ,nu-1 1 . , .,,' .-. -. -bgzakq . V 1 ' X 1 - 1 I i ' 1 K f.- - , at af.-f' ' V :ii Arthur jiobinson,-'17, mabisdn, R2?is.f 1 lieutenant, filnfqntrgi it V liiCiEiIvEDiii 1st1nguished Cross for 1' gal 'flantryiiand heroism displayed? under fire near'VilleE SavoyeE,,Aon',LElre riorth side of the Riverton August, 2Z,,,191i8Qf'f' kj ?'Screened ,smoketofnpiar heavy barrage. and the dGfx5C 55534. ith? lCHQ!i15611ha.Cl'Q15l!5hii45rf01W4'i4i ignifis Shine' gun to s"s riQht'fif1,arik'of: CQm15any the lf0igi'r?Iif2tCdlLA.l .gud .loriifmedl ei? 1' 565121155--gil-ifikisiis' fire "" LL 19911 the Emtirfrffskimpany, .GB-Usillgf many Casualties. Lieutenan-tfj'i:RQfbiprQs,on.1'attaclgedi mafhiigl and 'bf members '7 crew. V-.under 1 ""' "1" Hfelhe 'fUU1i9d51?H5 suh upon the," advancing and heroic action caused Casualties in breaking UD fa -,'- his C0mPaI1Y,S position..Qseriouisly-.5"ii',p. ip . Pane 390 3 1 1 , A - . , P Q 4-V 1, ss. Lieut. 'Arthur H 'Decorateb fo Hicbarb wilson Steele, '20, Oak, fflarh, Fill. liieutenant, Observer 166th Hero Squabron .QEIEUTENANT STEEL was awarded the Distin- guished Service Cross for great valor in action near Bois D'Barricourt, France, October 23, l9l8. While on a bombing raid back of the German lines, Lieutenant Steele accompanied by his pilot was attacked by six German pursuit planes, and the enemy began riddling their plane with machine gun fire. Lieutenant Steele fought them on, all sides and is credited by mem- bers of the Eleventh, Aero Squadron who were flying over him several thousand feet with having brought down one -of his opponents. He was wounded twice in the leg and wtwiceiinitiiie arm but in spite of great physi- cal agony he c5fiiibimu'ed fighting. Each time he was h-it he was knocked' down iritdg the observer's cockpit. ,,:,! last, however, Qply tail gun waslin--working condi- tion, the othetftwgoVbei'ng'fhopelessly'gdisablehdy:by ma- chine glln bulletsuiand Lieutenant1'S'fe'eleQgiik uncon- r Valor wi sciousiigtoithe'Afcgcljpitfi Steele, a iuniioif-iin'fLetters and I-ieut' Richard W- Steele Science, re-entereiiiifilie''University fin Aprilf 11919. ol " r ".,, ,',, 'k.f'f'.-S . ' Lieut. Edward C. Twitchell 'I' qf,.', ' 'f'-1"-1-V ,Jar fig' f -4 .1,1ir,e.:f- ,,1- , - .- ,ns are rbi'-sem ,, lieiiQfHQers' ,training-ieamp at , is iiiggcourse hee atsfcommis- Tfbwurib, -EL., Ewitcljelfl-, '13, fitliiibison, wus, ,X ii L L P i ?llieutenaiyt,'fAt,tillety it Nlarch, ' l'9l7, -l5CfQE97,fthe Qi1i.15Cd"faStates Entered theiwar, Lieutenant? ,Edward'Twitchel14 enlisted 'for ,monthsf gservice,-1,fwi'tlio1it payg, ,wwitlfithei l'Nbrton- es Aiiibiilance' Ther' Qiorpsfjhsawijalmost ' con- ' Eixiuous itheijiiront drives jqf' 149311, -Woifkingftjonsjggntly under A At.,thefclosC" of. his i',.- deco- rated 'asga tiiitiuitei-rto,,-"his :'f yalior under 51-if1fQil,iIIi'ilQY51fYi-,ii 'tr' ' ' 'A' 2- -e'2k'+,sax 'z .?- iq, i 'Z ',,- are-It f ,, i "'F' uf1i"1feel,iHg "" tha1g'1higi3wantedf--to 'agamtigiver aslliffm' the fig" gift i.ii t'i1':1f.i ,", ,,-, M5 -- . 34,5 . r Sixth Eels is V "X "lVfarehff'I3 X3li9llQ?f3fh'i 'asf-sevenelS?f7gas'seds Affterwhrs -' -ffr- 1 -e-17 fy 1, - J one Of four was-from , 5 A 4 if fr an , l 'Lear si'61iedif'fSee9nd weeks later pro- 'moted to First ,assigned to the l'07th Regiment, Guards, and sent again to ttie?'Eii'5nTif itached, and later seritlto' the States.. He was stationed at Camp McClellan, Alabama, as Operations Gfficer when the armistice was signed. Page 391 f A. Mor 'ihcorateb for Valor QX. mortimet Van Cstranb, '16, mabtson, wis. lieutenant, K1 O3r6if11'ie1bifArtillery "'!'LIEUTENANT VAN OSTRAND was cited for bravery in action on june 19, 19181 1 During this engagement he was severely gassed and was forced to spend several months in a hospital. Van Ostrand re- ceived his commission at Presidio, San Francisco, in 1917, went overseas in January, 1918, and saw active service continuously until he was wounded. The divi- sion commander cited him as follows: "On june 19, 1918, during a heavy bombardment by the enemy on position 413, Toul sector, First Lieutenant A. M. Van Ostrand, 103rd F. A., exposed himself to this intense fire to assist two men from an ambulance which had been hit and was still under fire, becoming severely gassed himself on this occasion. The division com- mander congratulates this officer on his gallantry and self-sacrifice." Since his recovery Lieutenant Van Os- trand has acted as instructor in the Artillery School at Saumur. A Uianbolpb 11. ewaoswortb, ffl. Gbomas, My. , Captain, 3Fiftb Tielofftrtililery' 'A QAPTALN f'DUCKY" .WADSWGRTI-Ig, Editor' of the 19'17'Badger, survived nineteen monthsof ac- tive fighting, overseas and came- through without ia scratch, and with both the French and Belgian Croix de Guerres as envious memenftos of the long service. Captain Wadsworth had charge of-za battery of regulars and was under fire at 'Chateau Thierry, Argonne Forest, St. Nlihieland Soissons. entered' the First Officers' Training Camp at Fort Sheridan!! iii 1917, and was se- lected for overseas service. iiiiriiediiaftely after hewas commissionedg A Page 392 Captain Randolph L. W X Tecoratcb for Valor fDonaI6 W. wlbite, '18, manitowoc, Wis. Ttieutenant, 23rb illnfantry ,'LlEUTENANT WHITE received the Distinguished Service Cross for heroism in action Nov. I I, I9I8, the same action in which he lost his life. The recom- mendation to Congress came through General Pershing based upon the favorable reports of White's command- ing officers. l-le was mentioned "for extraordinary heroism in action near Landres-et-St. Georges, France, Nov. I, I9I8. When the advance of his battalion was hindered by a strong. enemy machine gun nest Lieu- tenant White led his platoon forward in an attack on the hostile position and was killed at the head of his platoon just before the last machine gun was put out of actionfy t. Donald W. White Major Lemuel A. Wil Ttemuel la. 127-ilrnot, '14, Vaincouvet, 55. C. Y major, 29th Vancouver Batt. Znb Canabian E. HF. mejor WILMOT received the' British Military . Cross for valoreshown in ,actionla-nuary 29, I'9I 6' Wilmot. is prpbably the first Wisconsin man who saw active service, ,and doubtless the only one to have risen to Such rank in the Canadian army. He enlisted in I91Ii5, abd-'soon rose to the rank of Lieutenant. I-le was in charge qff ,the .scouts at that time of Tobirfs Tigers, the famous crack Vancouver regiment. One night with two others he crawled across .No lVlan's Land ,and cut the German wires. They stayed gin this -dan- gerous position three hours., knowing well that the least sound would mean 'immediate death. They attacked the trench, silenced the semtries, and bombed the dug- out, capturing several prisoners and putting those who resisted to the bayonet.. Lieutenant Wilmot was slightly Wounded in the fracasi I-le continued in active service for over a year, after his exploit for which he re- ceived his award. l-le was then sent home as a training officer and raised to lVlajor's rank. Later he went to England and served as an important member of the Munitions Council. Page 393 'Decorated for Valor Lieut.'So1 Wise ' 1 fc? ft. Sol Wise, '17, Cincinnati, Ohio Ttieutenant, :American Cliietveiwifscabrille, no. 111 WAS awarded the Croix de Guerre on August 14. 1918, for bringing down a boche plane in the bat- tle of Picardy. On August 11, Lieutenant Wise with other American aviators engaged in battle with Von Richtenhofis famous flying circus While making a bomb- ing raid behind the German linesi "Vui11emin," com- mander of bombing squadron No. 12, cited 'Wise as "a calm and sure observer. He has..-taken part in some of the most difhcult missions and! has acquitted himself with intelligence, bravery and modestyf' At the time Lieutenant Wise received hisiasvgard, his Escarde re- ceived its third citation together Withia Hag bearing the Croix de Guerre with palin fqfncbfififfnicuously brave "inservice In the battle in which Wise was decorated his riiachine was -stijgck four ibuliets from the Fokkersmand ti'i6"'sSROtS repaired, by -gblfack crosses to mark erieiriy "hits" X 3. f ti H V..-' ., 17 1 1' ""--a,4g,,- ,, - , 1.4. , 1 7'+1:gn,n,4'!':5!""' 1 if K N? ,Q- 11 'I X Qijgllermaiz- Ziscbhe, Hoqiqqnjgtwfisi. A 'Captain,lC'. S. Ittiivirinef gl if gf fisggsenior -Qlass' , of was decorated with tithe Croix. de Guerra, tcigerher' vggiith "st irom,,Mars1gal Pqetaln, for fat 'Thieiiiry' in machine ffibrsqnal eiisregafd daiiiit-'INA gold and set ini-'4the:'1rnedaki ' '31 JA V: 'K' it Yi 1-' ' . ' ' whichvgas ,presented at the 551053 hostf11it1AQi3j3?1Qaptaint'-,5Zi5Qggg1iiik5i5ifAf2fsf"'?One 'of vteni-,horioliff graduates ofa in they 1UT'Si Marine Corps hostilities inQ19l7. He was saw much active fighting '.-c, Thierry where they ,coveted r-" fglory. 1 e Page 394 ' .. daring, ua- i its Captain Herman A. Zischke -L 1' 'FG J:t':.,Nn 5 653fszf'fi5f - lqffiffil 4 5 If P' 4-F' 2 L- 5 x ,..1 . f wrN,..,.v,h., , A Af ,, 2 gn I' X 'ff' k5:1'i--1173- if ' A ,f',5'Q,V.f 4 N , . 'i'4Q.3?":f9:333?SB.v' U' - 5,1 Faris if zifwga f ' X ya '. Qmffkfaf nf. :..?' W'-i31Ql5ls25'7 lf' 1 ws., -' ' ' V Q 1 : 4 nf' 1 ,WQMNNM . - ' iw-AA ,., 'L Imam. um--'f - .naw ...Q Wisconsin 's First Contribution to the War Gite Famous Badger Ambulance Unit Q i Capt. Lloyd Garner, '18, in Charge of Repair Work on French Ambulance.: for the Front One of the most interesting, but hitherto unpublished bits of Wisconsin's part in the World War, is that of her ambulance unit. In early l9l6 it became evident to people in Madison that the University should be represented in the work of mercy being done by Americans in France. Consequently Mrs. Robert Van Valzah. Mrs. A. L. P. Dennis, Mrs. Hobert S. johnson, and Miss Mary Oakley, began to raise money to send some men to France. Their Hrst move was to bring a special war movie here which served to raise the first money for the fund. Shortly afterwards these same ardent work- ers brough Maxim Gorky's son to Madison, Lieut. Zinovi Pzechkov, a member of the Foreign Legion touring the United States under French government auspices, to arouse interest in allied relief work. He gave a lecture in the Woman's Building which raised 5100. . While the volunteer committee was debating what to do next to raise funds, Miss Belle Crowe, of the Irving, in November l9I6 came forward with the munificent offer of sending two boys to France as ambulance drivers. This offer toglether witilasie money already raised served to send Healy Powell, Harry Craig, and Ray Williams to France early in anuary . An incident to show how true these first men were is that during action on March 19, Crai received orders to go into the woods just behind the French third line of trenches fthe Germans had already captured the first and secondj. The woods were full of gas shells and the lighting was less than a quarter-mile away. Craig and three other men drove ambulances into the woods and for many hours continued to carry wounded out, constantly endangering their lives. After the expiration of this gallant Badger's term of service he returned as an aviator and was later killed while driving a bombing plane. V .In the meantime Madison and University people were not idle. Mr. Barry Cerf and Mr. Eugene Byrne of the University formed a student committee of 20 men to raise enough to send a Ford ambulance and to maintain it as the University of Wisconsin contribution to the work of mercy. While the student committee was busy canvassing for funds a town and faculty committee composed of Mrs. Hobart johnson, Mrs. A. L. P. Dennis, Mr. Barry Cerf, Mrs. Robert Van Valzah, Miss Belle Crowe, and Mr. Eugene Byrne attempted to raise enough to send 20 Wisconsin men overseas. This combined with the student funds would pay to maintain a complete ambulance unit, which is composed of one ambulance and 20 men. The students succeeded in raising 5800, three Madison alumni-Carl Hobart, Morris johnson-gave SL000, and lesser sums were contributed. These funds were sufficient to send eleven men chosen from over fifty applicants, many of whom had tp partially pay their own expenses. These men were Ora McMurray of Madison, who iater received the Croix de Guerre, Albert Gilmore, later killed in action, Leslie Rowley, who received Croix de Guerre, Lloyd Garner, another recipient of the French War Cross, Stephenson P. Lewis, also died in action, Ivan Fay of Evansville, J. A. Evans and A. R. Evans of La Crosse, Richard H. Stout of Indianapolis, Tom Hefieran, who was later killed in action, from Chicago, Gilman Blake and james F. Jenkins of Grand Rapids, Michigan, who went as hospital orderly. ln the summer of 1917 three more Wisconsin men went over as heavy ammunition truck drivers, paying all their own expenses. These men were all physically unfit for regular army service or were under draft age and did not want to be left out of the big work. They were Hugh F. Brown of St. Louis, Mo., Merrill M. Benson of Sterling, lll., and Harry B. Haley of Madison. Shortly after this the Government took over all relief work as part of the American Red Cross and so closes -:A little known but interesting chapter of Wisconsin's share in making the world better. F' A FIGHTING FAMILY-judge E. B. Belden, '86 fcenterI and his two sons, Lieut. J. E.. Belden, 'I7 fleftj and Lieut. S. R. Belden. 'I 7. Judge Belden served in the Y. IVI. C. A. as secretary in various can tonmen ts for Hfteen months, while his sons were assigned to infantry cam-s as drill instructors. All three are 32nd De- gree Masons and members of Chi si. ' THE CYCLER-Lieut. I-I.Stan- ley Wanzer, '17, before the post ofhce 'A in the little village of Raubolt, just west of Chateau Thierry, where he was billeted while awaiting orders to join a new unit preparing for the great advance of last July. AT VERDUN IN 'l7- Stephenson P. Lewis, 'l7, is shown in the foreground be- fore his hospital car, ten miles from Verdun, on the day American forces joined with the Allies. I-Ie entered the French service in l9I6 and served as ambulance driver along the Marne. Later he was transferred to the Ameri- can army, commissioned, and killed at Chateau Thierry. ALL 'IS-Four of last year's graduates re-united at Great Lakes. Left to right: Thomas Hardy, Charles Ewing,-Arno I-Ioppert, and Ensign Arthur Dahlman. Wisconsin Battles the U-Boat Menace V , i ANTI-SUBMARINE DEVICE EXPERTS- One of the most important scientific contribu- tions to the winning of the war was rthe submarine detector invented and perfected by Professors Max Mason, R. Roebuck, and' E. M. Terry of the physics department of the University of Wisconsin. . After a series of preliminary experiments conducted on Lake Mendota under the direction of the university had proved the success of the invention, it was officially adopted by the War Depart- ment and the scene of experimental operation was moved to the Naval Experiment Station at New London, Connecticut, There the device. the nature of which remains a govemment secret. was perfected and upon being employed on American and English transports. revolutionized sub- marine warfare. Not one of the vessels outfitted with the detector was sunk, and in nearly every case following warning received of the approaching enemy sub-sea boat, the latter was destroyed by means of depth bombs. h All American ships were outfitted with the Wisconsin submarine detector before the close of t e war. The picture above shows a Captain and group of scientists attached to the U. S. Naval Experi- ment Station, New London, Connecicut. Three Wisconsin men are shown: Professor Roebuck, top row, sixth from left: Professor Frank Gray, top row, last man on rightg Professor Max Mason, bottom row, fifth from left. A SKY GUARD-The experi- ., A mental work on the Wisconsin sub- s marine detector was carried on from the group of buildings in the fore- . ground. The entire area of the Naval H i - Experimental Station was under - ' r K 1 .I A martial law and no one without the if-H 4 ,V In ,,.. " ,lk highest credentials was permitted 41 - .. .. ,.',,,.- V - ,. ' . f .Q ,.,, ., -,.-ow.. ' fs - - - - T'-mgfi -- K- ----- r asf' X-1 anywhere in the vicinity. Observers .ilillilgaf ,, :Mc-1 - C-f, 1. ' S' ....- .1195 -N - - In balloons, llke the one Shown' kept Watch of the Sea Coast to Prevent Q-4-'fsS:rss.1f-ffifsszim,-awmf?ra-fe fs.. - ,.,v,wf,- .t - . - 1 - - tw ig: , -Q :,- f any possible andmg of spies on, the "1 5 - --.Av-. L- .... . -Q.. ' . water side. "X i F . .5 - l 1 1 als i i 5 '1 S --9' 1 " r' 1,1 , .ig , ji 1' 3 kv- l Q -. p -li 'iqx i ' 1-"Za - - . ' ' ' ,. V -- 5.52-'3,u'55S . ' , , ,x 1135, :LLT514 ' - jr. , w -,wi 1:L4:,..H H- .,,-Ka., ..,.,,g,,..:g' ':a.1TfT'jfig-N Q- f 'I is 5325, . , ug... W. ,i '.c..:.-.. . .V , -,T ,.. nllw , f-A. . J. ...-- ui-id, ,:, Hg., . w?z"2l,1f-"Z".fj ."i'f--:Q--.4-it -'eicti--3.31 - ""- . Vi' 2' 1. " "kt Tjl4Ki'fi 4, 4 .. . ----1... -1- -fs -f., - -5 .- . ... -., N. .i,. , . -if S-...f .. .- .. ."i?1:"i'l"' '.fFiW'-ft' 11.-A-fJ-' -' 'v . . . --of-'-5-el--1.4. ,915 u.:,1..:'- y uan-. ' - A .-.'. w - ' I. ' . i Y, lf' ,, L 'g,,,'r.---'Y . -'N . M ff' V - -' -Q '. mf .- .A . l.. 2 -A ,- ' 55-31 ra' 'Q M4 ',' '. 1 , 1----M ' - " giftfw. EQ- e- ima?-' I ' 1 1 .Ee .- e 1- . . ---- - ,. L -.I-il? - --iz.: -' . -. -'--X - 1 -- - --g SECRETARY DANIELS STUDIES INVENTION-just prior to the employing of the Wisconsin submarine detector on all American ships, the secretary of the navy and his staff of experts studied thefdevice at the Naval Experiment Station. They are shown in the picture land- ing from a submarine chaser Hying the flag ofthe Secretary of the Navy. Secretary Daniels. Thomas A. Edison, Lieutenant Spafford, and the Five University of Wisconsin faculty members in charge of the demonstration are in the foreground. THE U. S. S. THETIS CAMOUFLAGED-Was em- ployed as the ship on which the submarine attacks were to be made. It was the first merchant ship to be outfitted with the Wisconsin submarine detector, and in the experi- ments was used in conjunction with the submarine and submarinechaser shown in the other pictures. -- 'rs' ... --L...- -' '-1:--T-1J.-.,- ..,...-- ::.'.L. . , . " Q'...,.f..w "- -. " QI , -f'- - :- " ., 'swu kg 1-.yn-., . .. 4- , J -f,-4 -' an if ::1...,'.:.,:14:1:-'aff READY FOR AN ATTACK-The American sub- marine ul-ll " used in connection with the test work on the Wisconsin submarine detector at the Naval Experiment Station, New London, Conn. This under-sea. boat 'f at- ticked'A'lJt51e,"Thetis" and was itself "endangered" by the c aser . WILLIAM H. DABNEY- Superin- tendent of the University engineering shops from l907 to l9l 7, served as general super- visor of construction and installation of the Wisconsin submarine detector at the Naval Experimental Station. He is here shown with two small American subma- rines used to f'attack" t-he "Thetis" docked in the background. 1 1 1 If I S. C. 19. -Submarine chaser 19, shown here, was the first vessel of its kind to be outfitted with the detector. lt was used in tryouts held along the Maine coast. Sturdy boats and sturdy lads. They have to be to stand the racket. The picture to the right shows Prof. Frank Gray on hoard the U. S. S. Thetis while the latter was being ap- proached by the submarine 'Al-ll H for an "attaclc."g At the time the picture was taken, the submarine was more than ten miles away, but warning of its presence had been received half an hour before. Prof. Frank Gray r . . Q I 1 i 4 , 3 W Y . r - ' 1 N' ' X 3 I WX -F VY 1 J I --- 0 . A ,. on , ! 'g f' 53 . ' 4 1 ta" ' e "A ' W. IKE' :f -N 4 V, Y' 4, P ..-f -Q .p r 1 ity 54' --.. ,. : . . ,. x 1 eff K J: , f Li ,lj 5,4-5 ' I lf- - .qxf -' I he -I A K . s- 1 I , ,V K iv .4 K ,. ,.,, it 1 1 I V rll' -YQ 1- 1 'f X.: - 5 G v:,r 1- ' my , K ' 11 Q r T-ii? U MUSTARD GAS, I SAY !-Capt. V. L. Bohn- A QAUSAGEH-Transferring commander son, '13, arguing with a fellow officer of the Gas from sausage" balloon to S S Gloucester. Service over the fine points of awestern-front at- Lieut. Kenneth F. Whitcomb, '18, pilot. tack just being launchedlby the enerny. ' b -'x BOUND FOR BAGDAD-The front figure in this group is W. R. Boyd, '18, who spent Fifteen months in Egypt and Palestine in English army Y. M. C. A. service before America entered the war. This picture shows a' portable movie show being transported across the Mesapotamian desert. ENEMY SPOILS-A captured German " l 03" rifle and musket. Abandoned by the enemy in HUSKY A. E. F.r'S-Sergt. D. L. the great retreat forty miles east of Verdun. Dietz, 'l7, Cleftj and Sergt. A. lVI.,'Dunn, Lieut. Carl Harper, 'l4, is bringing the musket '20, being entertained at the home of home with him a as souvenir. a grain merchant. Dinard, France. I 1 a 1 'I - CAPTURED BOCHES-German prisoners under French guards, Soissons, September, l9l3. Picture taken by Lieut. Harold Blommer, '15, attached to the French forces as interpreter. V A V' I gi 2 if, . l V so 2.2 rg. l 1 2-,:s:wv:Q W-.,:- ""'-i"w-':fP',f-166,54 aw . . i I .ya Q F l i K. w W, 5. A WAY SIDE SHRINE.-Crosses such as these are found at almost every intersection of roads in France. They typify the devout spirit of the French peasant, who pauses for a moment of prayer before each. Sergt. H. A. Edmonds, 'l4, and Sergt. Floyd C. 4Roth, 'l6, are seated at the base of this shrine near Moreau. I l I . . J l i i . is - - E ' x V 4 :T Q 5' . Ca 1 ':i2zifai5e:?3 ' -5 f , '.?'5:"laS:5ifff?"'5-5,9 V 43314 ' 420 -L12 1' , ' ,,. 1,--,VA ..,. ,g,-35319, w Say- Q :fa x 155355 .H - " -ff.: an 1 - H s -A -'Ri L . Q ,gk fasw sfr. l' . " Q IL l - gf -:'1,,gf55.:g,gQQ Y 4 - r at BACK WITH A SMILE-Lieut. Edgar A. Baird, 'l4, was engaged in al- most continual fighting in the vicinity of Chateau Thierry from July to Sep- tember. l9l8. He is shown here on the day of his arrival at a rest camp. 75 miles behind the lines. Happy? Sure! Not a scratch! A GUEST OF ROYALTY- Lieut. Kenneth W. Ericksonf 14, of the Field Artillery, was in act- ive service near Chateau Thierry from July to October, 1918, after which he spent two weeks in southern France. This picture was taken in the gardens of the Prince of Monaco. who entertain- ed groups of American officers. FUSSING IN FRANCE- Lieut. Clarance F. Watson, '10, fleftj and Lieut. Edward Holmes, 'l1, spend a Sunday afternoon cycling through a Parisian park with two French teachers, grad- uates ofthe Sarbonne University. FN'-. '-,,rf'L7. ' f THE HOME OF LAFAYETTE-Lieut. Kenneth Curtis, 18, of the Military Police, was billeted on the estate of France's great republican at Cosne for nearly a year. ln peace times, thousands of visitors are received each season. Everything stands just as did during the French Revolution. ,a-' , ' THE LUCKY THIR- TEEN-A group of col- lege men with the 20th Engineers. While all have been under heavy fire, not one has been injured. Top row: Herbert Ross,' 18, A. J. Brann, '18, H. Lons- dorff, '19, Henry Mc- Adams, '19, Sidney Thompson, '17, Sergt. J. M. Hussey, '18g second row, from the University of Michigan: bottom row, from the University of Chicago. 1,1 ., . ' x , ii? V- 1. JUST A BIT OF JAZZ-Edwin R. Booth, '20, extreme right, helped to sweeten army life for the troops training in England. The other musicians are Harvard, Michigan, and North western college men. All six are now touring the country with the Victory Boys' Band. A HTAUBEH-An enemy plane brought down on the Alsace front. These small airplanes move with terrihc speed and are used in obser- vation work, but are not constructed for fighting. The pilot is unable to defend himself from attack. 9 3 1 ' a PINE ISLAND, CUBA-Louis A. Manthus, '16, of the Marine Corps, was garrisoned at a Cuban internment camp, where some hun- dreds of Teutons were kept as pris- oners after attempting to stir up popular sentiment against the allied cause. .- A DARING FEAT-Picture tal-:en by a Badger aviator of a daring Canadian pilot per- forming for the birds at an altitude of 3,000 feet. :Wi v- IQ ROOM FOR ONE. MORE !-Lieut. Clarence E. Rich, 'l7, always had an eye for the artistic, so trust ,him to pick out one of the most romantic and picturesque nooks in the Palace Garden, Ver- sailles. But he wants company, for what's a ro- mantic spot-alone? TURNING THE "PROP"-Pilot "Bill" Reid, 'l8, about to "turn over the prop" for a friend going togtake a joy ride among the clouds. V' UNDER ARCTIC SKIES-Lieut. Gerolcl E. Luebben, '17, receiving the U. S. home guards at Fort Liscum, Alaska. I i .1 V A COLD RECEPTION-Rollin C. Hawkes, 'l8, third from left, wears a pleasantsmile in sri-glie of the big blizzard which blew the transport on which he was bound for France 200 friilesfout ca 1 er course. ' I 4 l 1 LET HER GO!-Lieut. Kenneth M. Kelley, '17, was trained at Scott Field, Illinois. Later he served as an instructor and exhibition flyer on various American fields. He has won several prizes for both speed and stunt work. He has just completed a tour of the country with the "Flying Circus" in the interests of the Victory Loan campaign. A VETERAN OF CHATEAU THIERRY-Lieutenant Vemon C. Quigley, '19, of the Trench Mortar Battery, was in front line trenches for nine months, in the thick of the- fighting, but escaped w i t h o u t wounds. V A BADGER BALLOONIST- As a member of the air service, Major Alvin C. Reis, 'l3, was called upon to do observation work all along the western front from both airplanes and Hsoapbubblesu during his ten months of active overseas work. From the balloon here shown, hefclirected the artillery fire which destroyed an enemy ammunition base in the Verdun sector. X -. .Tip kg ..,.. ,l -- g . kg, V?-. YTLSYGW. 7 .cf-M, ig 1, -A , ., -,, .F,1ff--.- f ...rwvvr,,... -1 .1 f-rw I,, THE "DEVIL CANUCKH-Picture by Wisconsin aviator at Taliaferro Field, showing dare- devil Canadian "taking an FROM THE HEIGHTS- Bird's-eye view of a French city taken from a height of 2,000 feet. Badger bird man Ujazzing around" in the fore- ground. Name withheld by request. - airing" on the body of an English plane at an altitude of 7,500 feet. RACING HOME-This photo taken by a Badger airman at Taliaferro, Field. Texas, shows the "birds" in flying formation racing back to camp after an hour's spin in the clouds. "THE POPOTEI'-A party of allied country ofhcers enjoying an outdoor dinner in the Parc d'America, Paris, in celebration of Bastile Day. Veterans of Verdun, Liege, Brussels. the Marne, and Pavia were present. Lieut. Frederick Pfister, 'l5. is seated at the end of the farther side of the table. SOME. CHICKEN, WHAT?-Mem- bers of A. E. F. were frequently billeted in small villages where few accommoda- tions could be had. Consequently, any- thing that suggested shelter was pressed into service. Lieut. Harold Wengler, '17, was quartered in this chicken house with four fellow officers for eight weeks. NICE IS NICE.-Forafellow to spend LES DEUX AMIS-Capt. James D. Basey, his furlough in, says Lieut. H. B. Heicler, 'l5, and Lieut. James D. Boucher, 'l4, at Biarritz '15, but who wants to live there? Too France, where the former was recovering from a many steep hills for one thing. serious gassing received in the Alsace-Lorraine sector seven months before. U FLYING 6,000 FEET UP-This picture shows Canadian aviators in flying formation at a high altitude and gives an excellent bird's-eye view of the beautiful Texas scenery. Many Badger aviators were trained at Texas flying fields. , a WHAT WAS VERDUN-Few cities in the war zone suffered so much devastation during the past live years as' did Verdun. ln the path of two fires, what was one of France's fairest cities, is today nothing but a mass of tumbled stone. This street, Rue joan d'Arc, was formerly lined with magnificent dwelling houses and public buildings. The battered walls, the appearance of the lawns, and the picket wire are indicative of the condition in which the whole city now stands. Major Alvin C. Reis, 'l3, is shown in the foreground. 4,,. BEACH BEAUTIES-Five Wisconsin men all lleutenants m the aviation service enjoying sun bath after a dip at Biarutz, France. Left to right J W Kunneke I7 Linton A Cox I9 I. D. Miller, '16, E. A. Arpin, '20, W. Buckley I9 Freak Crashes .7 From Flying 0 Eacperiences Of Badger Avia tors A MIRACULOUS ESCAPE.-Remains THE SMASH-UP--A disastrous crash at of a scout plane following fall of 4,000 feet in Love Field, Texas. a tail spin. The pilot, Lieutenant William Reid. 'l9, was unscathed-a miracle of the air game. 1: ,I Z, . . , : i4 um... ' ' 1 A REAL SMASH UP-All that was left of the hydroplane of Lieut. Harvery Conover, '16, of the 90th Aero Squadron, after a collison in mid-air. from which he escaped uninjured. The salvage crew is shown in the background. i ' QQ 1' A Qjlffore Crashes X. 21 '- . ..,.. . V f ima--1125-.'i' 1" .. .sr:v?f" P. Mzi-1!5,f'5'-57 I , .f .,. if-2i1ifHmf'f" ., .7 A, -, , 2t4'..i'5f,-1 154 farm . 65 .1 A A V .x X Ira: up J 45.3 I- N I .. If Q E' ' ' wwf- f I HL... L -' 112' fl.. V "ilk 5,2 'fi - Y. -I 1.x , IJ, V - A 1 . 1,1 .:' s In " ' -- . -af. ,. . , . H, '-'-www, .. ' ' ii V' , , . , , -, , X jx s Ik- ii ,I I. in . I -we ws . . , ' , H ' 4 , iff-gf.-'-if ,- . V, - . r--' fb...-i . rw- 3+-'ie-rw -4, ' ' ' , f' - i+:wf-r-x-mL5m1uiv- - . JUST DROPPED IN-Lieutenant "Bill" Reid, 'l9. Hies into barracks with his sky ship in an attempt to find the shortest way home. He did. NOSE OF SAME. SHIP-As seen inside of the barracks. CASUALTY - The passing of a "tailspin" and its results-one fatali- ty. Photo by Lieut. "Bill" Reid, 'l9. WRECKAGE- Picture of a fatal crash at Love Field, Texas. Taken by Lieut. S. H. Harrison, 'l3. 'N N-1. S' I ' - V . . I . 'X of Going Up and Coming Down ,,... .,, A . mf V . , , . ' six fr , B X is , S mi iid-f' -Q A W -X.. I ' any . pf ' X ' -V ,V l - - ' .se .fvhafi ' .I I fe, , - ' I . ' f. f 5 . . -:, - ' " ... - ' W Qi-:rss ' ' I0 if , - -.. ' ' 1 v l If f L X, E . I g ,. ..,.. - .f-wi '- ., W-g25' :'1v y "Z,.-ff ' 'KA , ,545-X "!"M....,, , .iw-..:e. ,i .1 f..--.,-.-Q. 4-.35-1 -- ',- -I " f.f,,,K WH- f--+5 Q" jubfi - ,-25732.-Q 'L'1A43:r1'5iE my-. .et,:f,x.:'f . 1.LZ.':.f-m'-'sfffii-1.-N qw- : fA.s.':J 0 .' P: 'Af"'-'..f?2:l Q. Aaffiliv'-fs13i.' 1 - 1:55 'Bidi-i'2.f1i -QS 4:1 -we A L3 z.'-.-fzf' 45,-.N.frff::mg.'S.r-wha'"-e'a??'f9sS:':":f-we-fg.Q,.-f1,-.--A 2 .- 1 .1321-:ami '-Qk.,i:.1f+.x-d-:::Sa'e:, -, ..v-eg-saws-4?w..f wQ...'.f3.r-:"f 1 inf' ,' . A- 'YTJ+ri'ff.."'f?35t -'lu ' , ' -'ibffig -MAE 'I "' - ' "' ""'-'Q' "U N 5 A' "e .1 . CUTTING HER TAIL OFF-Crash at Taliaferro Field Texas. No fatalities. '1 1 3 A MIRACLE-Snap taken of a Wisconsin man's plane taken after a. forced landing sidewise in the heather. N0 casualty. ifiiefe ' .257 it . GOING UP!-Lieut. George M. Chritzman, 'I6 , at Kelley Field. After completing his training, he served as bomber near Verdun, and aided in destroying an enemy ammunition base there. He is now employed in the aerial mail service between New York and Washington. UPSIDE DOWN-Lieut. S. H. Harrison, l3, experiments with new landings. He has just landed, upside down but unhurt, and is waiting for the wrecking crew. 1 FORMATION FLYINC-v-Part ,Ti-y of the tactics at Ellington Field, 'I6 which Lieut. David Mossis claims he thoroughly enjoyed. HOBNOBBI NG WITH ROYALTY-Burdette I. Kinne, of the Romance Lan- guages Department, is an at- tache at the American Lega- tion at Berne. In off hours he spends his time making the acquaintance of exiled nobil- ity who may be straying about. He is here shown with Prince Pierre Boycoyans, grandson of the former Prime Minister of Roumania. Bur- ileite says that he "likes the Stunts Above the Clouds NO TRAFFIC COPS- Lieut. Wm. H. E. Reid, '18, looping the loop at a height of8,000 feet. Lieut. Reid discharged from ser- vice. is now a senior in the Ag school. f": ' 4' K" V ' :nav-11 1' V aa .- ,: , Vg. ff 45141 ,Q 5- 5 A. N 2- W. uv ,N .:3z1: .-"' 'lf .9534 ' , X I- Yam - 1' s " nf" QQ A -Q5-.bf Z ., g,,. 4- 513 '1'.tf V- .-'Iii T Q.,-' .gf'41"1 fn -.- " .. - , , 1- ' K1 - ' 41 .. L1.yf,,A. A Z . 4. - ,V ul, ,uf .. . I dx .. f ' XV . f 0 'gms 'H , - - --- -A . 1 is Ama. -also . Q. y. x""vi' -V . . 3. .. -V... . - X fi ww.-.. A p ' 7 pf -if we . 1 .9 ,I 1-pgs w. ,ah wt.-.,s, A A Q:-.V 5, ,F -f . ,'s4Ytff9-..ff1-S-N w. " if 1 " 39- we .-at f, " it - - get ,,,, .. A " ', . f Tig ' H .. X- , so I 2- . as Z? V , Ve Q - af? is at - -V . iw 'Q '- . ' ' -V LOOK OUT BELOW-Truck train passing throughistl' Voe, France. Taken by a Wisconsin aviator from his plane at an alti- tude of 5,000 feet. ' ' 4 V! OH, FRENCHY, FRENCHY!-They're all fine fellows, these brother-republiclieutenants and captains, says Lieut. Frederick Pfister, 'I5 flast man, front rowD, but their lan- guage is so queer 'n all that! Still, one can have great times with them. Taken in Parc cl'America, Paris. PERSHINGS CHAFFEUR-Upon his arrival over- seas, Sergt. Sherman M. Sykes, 'l9 frightj was detailed as chaffeur to America's Commander in Chief. The four stars on the windshield signify that the car is General Pershing's. Sergt. Sykes was drum major of the University Band when attending Wisconsin. ,F . Q VTE? gfj,Eff5QQE"f2.fiff. I' -1 ii- 5' ,ml f,1.v,uv,ts-ff wr. H Y 1 ii m ' t,,..',.,c.,.,, 21- - - L, , ' rf! It -,,7'7?Tf2' ' ' A' Q , . ,.,, W M233 -aw:-,g....,. .,- , . -, ,. .vm 4' I WA- 1 x.---- -.....,. .... . J if-. . ,wwf-News . , 'V jizznzij "' c..c,,..1 if , l COSMOPOLITANS-Five nationali- ties and three languages here! Still, every- one is happy. Seated on left is an Italian Y. M. C. A. directress, right, an Eng.ish captain, standing left to right, a French lieutenant, a Scotch major, and Lieut. Strand B. Gely, 'l6. Taken in the Palace Gardens, Versailles. SlCl'lTSE.ElNC-l..ieut. Arthur I. Barclay, 'l2, third from left, and two Harvard chemistry pro- fessors, officers in the Chemical Warfare Service, being shown the ruins at Verdun by a peasant whose father served under the first Na- poleon. .-,I --W.: Y . yt ',.'Y I, '11-Q.. ,- A.. 5 w .., 'r ' U wf1ff"fr "-age :, l , . ., YQ . 41 EJ ' .. ' i , tix' f 1 -V 4, -fg,.,gx--x.fi.gr,, .. Lf ,- W- 41 iw:-4'f-.,,,. -- - ---- - ' - X -.,,JE1.g 1 .kggygw ' , ,. a wi. N A :ww gSg,w.,,.m 552 , Vi .FN YN 'TW 5' X,Q.N.fU 'f iiitxlif xv! al w,,,ML ,, ' rn, QQ, .:.,,,.L ,, M,- . I Q v w . 1 eg, Q ,i f .ig-L. yy f gQf5,e?fEi,'1ii, . 7 i fi-iigfg 2 f , Q rw -2:1 'mb ,siitkwi-.u 1 , . ,,--97 -1 S ,f A uf F 1 f f :"5G:'my.fgi,,,..qQ wfsfsfmw.. 2 W if A ' aff fl 5. f vm, v l . 1 2... i VICTORS IN FRANCE-General Rebault of the second French army, his staff officers, and Major Howard Frocher of the American army, congratulating the winners of the athletic events of a field day staged at the American officers' training camp in the suburbs of Paris, on july 4, l9l8. Lieut. Harlan Amen, 'l0, fifth from the left, was winner of the cross country run. Six weeks later, he was awarded the Croix de Guerre for bravery at Chateau Thierry. CERTAINLY I LOOP!- Lieut. Herbert Mahler, 'l7, in- structor at Kelley Field, won an enviable record as a "stunt Flyer." rm l BOUND FOR BRUSSELS -After the signing of the armis- tice, letters of congratulation were written by American officers of the first army to the authorities in the Belgian capital and dis- patched there by airplane. Maj or A. C. Reis, '13, is here shown in his machine, making prepara- w N -'asv 'f N' ,,1f-i':rY5ir?f'19w Ifgjchii '1',.iQffa:f5iEQx???f fi-.Ji M, 1... " --f-f-Qi -fwfr ,af ,.-I M :aft I LW' viii. 85. ifqzq i ' ' ?2i'isf tions for such a H1 ht. ' fxlwif f- A it it :fa 2.795 I ' tl- E", 'fdnfv wwf' fi :- 1' qfig',,f4 ing' , . A ff. ,i J .,1a,?,li.,- ig X' fa, Tin W -giiicfi. ' r -. H be 1I':r:w-. , O Qi A sf . : Xt . LIZ. x -1 , ' r,'2tz':'-Lf ,' Wil 'J P ' "V la 1 X eg 'ff'-:fi 'W-' .f Lew" R'-fr 5 ,, ..,i i . ,.,.. - . f W M, . J ,MQ . ,, . 4, ' 5 1 f ug- ..:4 - 9'-'-' ' 5.1. V 'ply . f, VL, ,uw 1- 1' 5 K' 1' " EE --Q"-35 if- if ,Lff l 'il ' 'iff 3 ,.. . Q:--'Ili , fig, 'Z ,, 9 J' . . H C 'iff ,f . ns-L", it f L ?f""" .- 'f"-212' W, 1: ' "' ew -V, r - fr ., fr' ' "':ff,.M.'- R : . f Q"fj,1IQQqz'.'f- .AJ ' , ,--, . ?kf"f1,.x le '31-ffl-fV"' - "Er: f . ., . L Q1 2 A 7 ufli. .. 1 2:7 :.:e.1,,: ,ZA ,Men , LS, Y 1, wwf, ' .JQV "ez: 4 fa' ' .. Y X , G.-cf.. iw- A - - ' H' ..i'.".'." '-.' g.Q:',.. ,S i -l 'V L X ul '-. OR: 1 elflilrs - ' ' ' . 'Hifi' - .-:i'A"'3' I ,L' Maw- 12.55-'?ir,,, '1 M' -J ,-,. -- .. - ,943 2: - B . f f'-fa?-'JE-t'f?K' ' -' Q ' - f 1 f ff Z , - .4 ., wwf ,,:f - 'LMA :Z.,'Jx4i'f' ff :fav J.ae,w? 1554.144 3 I . , 1 11 was 1 ,z V., 1 , ,f V 35"- ' M. . frm gf q il WX an xi' J' H N 'Y ,., Z-:"r9" Mens NOW FOR BERLIN!-L. S. Clark, 'I7, with the army of occupation in Trier, Germany, says that he is taking this Royal Prussian Artillery helmet eastward with him and that he will wear it during the triumphal march up Unter den Lin- den. ' He took the tin hat from a Boche prisoner, captured at Verdun. , i I 1 1 1 SAlVllVllE'S SISTER - M a r ge t "lVluggs" Rowland, ' I 3, who has been in the Red Cross Ser- vice since the spring of l9l8. She has served at Verdun and Chateau Thierry, has been in over a dozen bombing raids, and has helped rescue pati- ents from a burning hospital ten miles behind the lines. She is now in Siberia. ON ALPINE HEIGHTS-While on furlough after four months of constant lighting on the western front, Lieut. Stevenson P. Lewis, ' l 7. accomplished a feat which won for him undying fame among the hardy Swiss. Alone, and with little mountaineers' equipment, he scaled Mount Blanc, the first of many thousands of amateurs to succeed in the venture. This picture was taken in the upward journey, at a point where he left his companions. Lieutenant Lewis ,was later killed in action. l A IPAL IN THE HEAVENS-Wisconsin aviator sights a pal above the clouds, altitude 8,000 feet-the "pilot's para- dise. " THE RACE BEGINS-Squm dron of "Devil" Canucks at the start of their race through the clouds at Fort Worth, Texas. Canuck pilot in the foreground. Excerpt from a Wisconsin avia- tor's collection of photos. I I 4 BATFLE FORMATION- Remarkable photo taken by Lieut. William Reid, 'l8, show- ing battle formation of a squad- ron of .planes flying at same alti- tude over Taliaferro Field. Texas. ,,,.. N1 .r.-il:--1ig:g:,,w. .,i4.g5,.,-..i.5' 3'-Li,L23:5s12m1 wg Wray-4:s.',fda:--va: '-fp-sf ,f.fff,Wyt,.f:-f,,ff 5 f sf:-z if - W,":--v-f"'f- gm. ? V 1- 42' 1692?-'L V424 l- ,.,-:sax-gf,f5gx.,5f1fgyw ,. ,VL nb: W . zefifff-95 5'?v,.--'w:-yg.m-.:,q,,af- ....1 7 ' V f A ' t " 9 :ia 'ff1.fi- - -5 Q 'x2jvJ.m3Zg- '. " X ff? F '- -fl-'-H'--' A """ N. ,, '--- 1' ., 'Sf f . Q -. ' . ' fi .- ---eifws Y 4, f 1 W f ' - X "Q :--,-W-1 .e-04+ S ff!-f:'f-""" .- -. w:..fmfi., ,, 1, ,..,,g:i., am.Af,x,,f,..:,. f,,, V - , 4 2,4 - 1 nr:-ff-L f' '-"+9sw'?'w 'ffl V . M -- ,ss f--fs V a - Wh ' V f zgigiwriyfc, :ff z-, Neff Q , .V 9 f L2 X' Gif'-F556 vw . : V -1- .A -1..,fz:K- my . 5 W een' ,L f .2 nf "2"'m"-LT' 2X,,:".h'f WW: 1:,Yfff'lfSJ 5 - -6:4'w.fa.,4s.a:-fw-A-A '- ., 5 , ' YF? ' i -. ii r .1'c'-1-:sr , 1. QTY?-F,t'?f' 'k"i"'?'E54 of -ici IN THE FORESTS OF ARGONNE- After three months near Chateau Thierry, where the heroic 32nd Division checked the Hun advance and turned the tide of victory in favor of the allies, Sergt. Arthur F. J. Stoffel, 'l7, who directed the ambulance dri- vers in one of the Sanitary Train units with "les terriblesn was transferred to the forces stationed near the Argonne Forest and again saw the enemy in retreat. This picture was taken while a road over which Sergt. Stoffel was moving wounded men was impassable, due to German bombardment. I fb f W trial' -. x x N A PATIENT PATIENT- Lieut.igWalter C. Hornaday, 'l3, of the Rainbow Division. was seriously wounded by a shrapnel shell during his eleventh month of service at the front. l-le is here shown on the porch of Base Hospital 23, convalescent after three months spent on a cot. "English Spoken" says the sign. "Yes!" says Lieut. Hornaday, "but it's a long time a person has to sit before someone that's able to comes along!" TRENCH DEFENSE. -Badger avaiatorfzsnaps trenches 3,000 feet below while performing contact patrol work. These tren- ches, near Verdun, had been 'abandoned by the enemy. x V PSX, ,, .E ., -, . ,vp V ,. -"' . fr . ' -1 awe s 1 l 4 v 4 di.. ,V I , -4, fr .i ,,,. , .af P-QM ,,,. .1 . f W4 1' -X . .-V1 '1 .. N + 4:7 -N ,N u A gf . . I 1 ., , :B 45' s X" EEXJH QQ, K ff mi 1 H4142 F' ., :,'2'swawg I 5 ff 1 Y 71 K, 1 .R if gm. 1: - 1' .e"4'11i',.'q.1' nl-,mai--lf. n Ya W, ,-,Q ,olivia--sf - ,asm-2 .imf ,wie ,lk 1 .,,.g. ,. A .Fm K. V M? 'Y 55 5, ,Q 4-, NXVQN il 9:T2Nli'i.,.f.,p1Qfw I ff, I -,vf- Gifts" " HOME, SWEET HOME-After an enemy bombardment of the village in which he was billeted. Major Alvin C. Reis, '13, of the Balloon Service, re- turned to what had been his comfort- able quarters for some weeks. That the Hun gunners seem to have felt a per- sonal antagonism toward him and aimed accordingly, is suggested by the result of their efforts. ' A l 1 r A THE VILLAGE CHAPEL-A 16th century church at Mandreaux, France, dynamited by the advancing Germans. Lieut. H. B. Heider, 'l5, of the Coast Artillery, standing in the doorway, -could not Find a single villager in what had three years before been a prosperous settlement. IN THE. WAKE IOFA THE.-' HUN-For three months, Sergt. Howard Thomas, 'l6, and Corp. joseph Kowalski, 'l4, members of the Field Artillery with the historic 32nd Division, were under constant Ere in the vacinity of Chateau Thierry. This picture taken ten miles be- hind the enemy line on August 3, 1918, during a "rest" period, shows the damage done by a shell which had burst only a few minutes before. Notwithstanding the possibility that another "whiz bang" might drop at any time, both Sergt. Thomas fleftj and Corp. Kowaski Crightltseem 1 S 15555221 if '1?5ffigf.f- . 1 to have been quite at ease. if 1 i sz. iii . - A - ,v 'yifqgi if x 4 i wi - Y -. X , 'N A --15-. ,p..w.,g,, I 'n , , ' C., 5- .. kg -' - 1 A' A lf' ..-- . ' 4-H LQ Q . -few 11. 1, A--0 1 :Q . si -.1 .lx lr , Ii .fl .A-J 11,4 ' -11 1' .ijk . -"tl ' ' W., I ffl' " ,,. 4' H X... KL. W -I. .' 'Qui . l' f ' ,ff 'f "" "1'x.f'1. , QI, '- ' ig 3'-,sg p.jLf" -, ,I 'iglfigi in - 'li' V2-2 " f ---X 'Q' fi , 41 1 I 1 . 1 1 . 5 , i I . .si , N , - 1 ,fp 215121 ' , i 4A,- ,. Q . Y... ,,v. . I I 'i H . , ' . - 5, . wg. w5gyfu21i7Q-,ki .. . ., ' , , 1 . - A . X. , evififfif' if -.. . " is ., JF -,:.:1.5..,.,.g.,,5 -X ,. -K L., ,. l -L ...eJme..fzsm'..' .. . H K . Q ' ,. RARIN' TQ GO-Lieut. H. S. Harrison, 'l3, taking off in a De Haviland plane equipped with a Liberty motor. THE. FAMOUS "276"-Lieut. Wm. H. E. Reid, 'lB, ready to take off in "276," the plane in which Lieut. Webster made the altitude record for Hispanica motors. . K., . 3, , - af- I l WRECKAGE-Crash of Lieut. H. S. Harrison, 'l3, with another plane, which resulted in a broken arm and other minor in- juries to Harrison and death to the occupant of the other plane. One plane is partly burned. ZATTAH BOY!-l..ieut. Arlie A. Scharclt, 357, Wisconsin's famous athlete, wears three wound stripes. Of fifteen months of service overseas, twelve were spent in hospitals. ln three engagements, he was wounded by shrap- nel, twenty-eight pieces of which were re- moved from his body. One time he lay in No Man's Land for two days and a half before rescue was possible. V "CHUCK" TAKING OF F-Ensign Charles Car- penter, 'zog taking off in at giant " 16" seaplane at Pen- sacola, Florida. More then twenty Vvisconsin men re- ceived their pilots' licenses at Pensacola. x asia-biamdsienggy -wg, 5 ., 3 l ' A s sr. Wisconsin Naval Flyers 1 2 gi tl 4 I ,'jOHNNIE" RACES THE. BLIMP-Ensign "Johnnie" Schroder, '20, flying in his seaplane at Pensacola, Florida, challenges a "Blimp,' to a race. The photograph was taken by Ensign Schroedefs observer, and shows the dirigible running neck to neck with the seaplane. SANTIAGO HARBOR-This remarkable photograph of Santiago, California. was taken laygnsign Howard Stark, '20, from a height of 4500 feet. Many Wisconsin men were trained at antiago, - X x,f'HV' r Q, if SANTIACO FROM THE. CLOUDS-QTl1isEphotograpl'i of Santiago was taken by Ensign Howard Stark, '20, from a huge "l6" naval airplane. ri l w CALDWELL CRASHES Ensign "Tom" Caldwell, '20, forced to make a pre- mature landing, "stubs his toe" and his plane noses in the sea nearly a half mile V from shore. A miraculous escape for both "Tom" and his observer, who were rescued by a speed boat. The plane was salvaged by the wrecking crew. T I READY FOR "DIE TAUBEN." View of air ships in battle forma- tion, taken by a Wisconsin aviator in a trailing plane. Note airdrome and French countryside below. I .1 Y ES -. ...GW Fm ENC!-155 ...BUD GAR F391-ATR UNF- ! C F. M0055 0 -' ""UHsbmM4A: .1 'WT' A550 DI ..Z',1jjj,1f,f'h1,,Lj1..1,, --fm 1,,,j -1 1.,,,'Q01 1. 1.1, 1... "G 1 1. 1 1 1. '-111. 1 1.,, 111. 1 11...,,Vu I TVU5 J rn WW S... QQQQ' Y' L1 . . 0341? S53 1 ,1.'h.-11.,,, P 1, 1' 1-1. ,.... ""'f111., ,""1s- 1.11 'D "' AJ F 111 5 1. D. ,, , "f'f--1. ...N r n1,,,,, 1-,,, I nh:- ..-- ' ' - - fd--31 .",.37,n1E. gg, .i,,f...,'Qf,'g . , S .X , -151.771 'v .11"n '11 '.'1f' 'W 11,,""" .1 N ASK. Q.. f.w.w .4 W' .. N vs BW VPN Nb K5 . an XWORBQYNQ! Avy. JW ww .50 ww Wg A SW 'H X v. V :NY -.G S 5993 - Q . .... Q QQ! GLS .Bw N XY wi.--Ti. ..- f.--,,.0,,. ff.. Y -1-" f'.-- . ' .--'X.-'..- X... V.- ,,.4,,..,,.. M.. lv. X Q 9 . V ..--1 ,..- ,,.f ,X.--,,..--Q.. X.. , UN. ,,..v,. S ffgp' 6YJQY1Qb4Y5""' QB Q, Q Q.. ,,,..,.-...,,. ,. ..e 1.-'C 1 it '29, 4 XXI. Xfuvi N- ., .. ,,. . . S, 1.91.10 .. .0 . . 'Q..v',,.2'- 1 F, 1 . 4' .UP . ' .6 1- 111: fur..-.1 ,.. vw. N..-,,.,,. 1 1 ig..- .. ,- rv x .. - ... .. X .- L,u,,..s.1,,1 .9191 ' xv' ,,. ,, G. .1 M. ff... .11 .... .95 . 1 4 1. e Q,qg1Q4, e , ,.4k,.4' 3 n 11.1 , '-A .,,' ,,- , -.11 11" ' .,. X -5 - 1.1, . . . C 9 N 45 A . 1 . P . 1:- .. . , .ff I -" ' ' " .b. Q? Y' Q .CT - Y. Q: Q.. 1,51 - Q1 'S . Q .SYS 1 i F .---f ww cj',c'1,5 Q fc. Q1 K1' 4 5 Sk-1 .P ,. 'Prbfl , A, Ernst Wr ..- 1--11.1-...T ,. 1,4 fm, ' A,5,,,:,f,I ....... 1 1 111 . G. 1.51 .EP .N.N9'., ' 2 .1 553.99 We .Iv .41-'W .. .1 . .1..11.. -'1I..""" 'f K.. ..., 1 11.-. 1.. . 111.1 .1-1 .... 1.1. 1.1. -- 1.11. 1.1. , ,.... .. ,',,-,:Hg:,g1h-1- .... ,.,., ,H 1 1 . v ..'- 1 U L "' 11 1 1. ,11.11..1.11-. J...,,,. ,,,.1'4"H 11.1 I I ' , ' 1.1. 11. 1. .1 1 . 1 1 - .... ,, Hg . ,.... ,. .11- 3 an 2.-A .-'-'X ........:fm...f 1-Q.-1.1 .... .-1 .. ,.. .. ..,....,,..-U .... .-1 It H 1. 111.11 .1.. "Ei -"-1--1 '-' --- 1.11 1 1 1 1 I' .1 1-....1. 1- . ' .... .. " ' 1. .... .11 . xii.. -52.1 1 J 5.-1 ' , I- .. .,.,.- ...I-' ....-1 .1......,,,.,, , ..i',,,.--- -' f,...15Y1f.- ,,'.. xg.. -1,111-:Q L A .. - ...1 ,..- .-', .. . f --' ' .., fm' 5 4... ' ..- 1. .11- 1 . .1 '.- 'ffm- . wi- - Y ,fm 11.1.11 , 1..1.,.11 1. f A H I ,-,,j X. ,,.1 .qs .... .,.,.11,11,, 1- ....- .1..1.. T11-Q 11.11. 1-.. 14-1-1. 11. 11.. .. ,. xv ,. x 4 ,.'f'Q,w s , . D. ,,.., .1.... 11.11. .-H' .11 1' 1-'X-'I' 1 ,m,..z. K I1 1 vw., 11. 11.-, V Q- ' W .f'..H-11.-1.1, A-1.11 9.11.1 ... ak.---,11.1... .. we .... .-, . ,.A .... S. ,.., .6 ng... ,.. ,.. ' '11 vi-' ,.v'x..X"1.. 1. Am.. fd' .B U.. ?.,,..h,. ,Q-1,551.1- A .A . V. aww, oi, 0,4 ,Q v-1.1 ..- .. -- .1 5 .1 -1 1 3 " 4 X' 11.-1 Lf' .11 1.211 .111. .1 , .1 , . ,...1 ....... A,.,, .J K tw.:-.1 K W 1.1.1. ,111,11.1.1 .. K .1 ..1- 1 1 1 -.1 '- ... nv W 1-1.111.111 . 1 .:g' ,.... .,1,, 1. 11 , 1 , , ,, ' 11 . ..1.1.1.1.. 111. . if 1-1-1 .1.1....1.. ....... 'HM 1.1 1111... .1 ""' 'Y' "' 1 1 1 1 ' ' ' 1 x A ' C' - .1......,. ,,,, ,, ,,, Wm Y ., 1- 1.17111 - 1., 1 ., f Sixty-six Wisconsin Men Nou 'fem ""1., ,-'11 ,UA ' 'I .111 F 1 A H , ..11........1 1 . . ',,f,1- I11.-51.-5.1 ....... ..1I.1l.E:,11'Qj1ppg1-.1-1 .. ....... .1 ' .... ...1f'.'Z,",f,1m-- 1.111,,-...'.......... 11.1 , I 1.01.11 .1....-.... 111....:'h " H. -1 .1 -1..1..,..... 1,,,,,, ,,,,'y,j45g:fo1--. -.... .... .1.1...'1C1 I,Qfff",,, .. , 1. ...,1.1... 11. .1..,,,, ,,,1, .111.... .. . .W . "1KnA-dy..-1131... 'h , - H- 111111. .. -.... 1. '. . 1 11. ....,....... T..'YJ3.'1"'1'i',",U----1 , , H M . ,.,.1. fI!.11I .Kr-.1 111111. '. "du I 1-1.111111 11.2 " '1x11.111. .- 1111.. .1-..,,,. ,., ,,,, 1.1..111 11. 111. 1 . 1 " "" ' 1. 1 1-1.11.... .111'..iC '11-11-1--1.1. .1....1.. ,.:1'j"f"-' 1 11.1. 1.11. 1 ,U , . Q' A A 1.115111111111111 11111s1f,1.f11111 111111 11111111115 151 Sewing in 'Yarious War Branches FDOTBALL MEN ENLIST IN AVIATION CDRPS sm,--1. w1.1-1.111111 2.1.1111-1, 1...-vu ".... ,.... ... 1...-1 an 11.. .-.1-.... .11....11.. .1 .... 1.n.11.1.'.. ..1-.111 11 1.1 111. 1..1.1011.y .11 .1..-. fm. 1.9111 b. .11 ..11,.1111 .1 .... pf...-11. .sn-1. 1: 1 ww. 1.11. 11-. 111. 1..1.., -rv.. 1..11..111-. .11 ....... va., 11. 1-1-119.11 1.11 .... .wr-11... .11 H...-1:--1 .11 11.-. -....-W...-1. 1. ..........11. ...111.m.-1 or 11... .111f. 1-31.11. 1.1.1111 1 e 11 . mm. ...fm .v1..- ..11.1. mf nv..-ya f.-1.-. 11-1. 1 ....... mf ne- it s of -NM 'F C life Near Battle Ff0ntT1...:...5 k...n'111e .1 1.. 111.- .111 , ' nr..-111.1-1..."'q' 'me . up - 1.11. .1 . .... 5.1.1. ...-1:1 1.-. 1.1 1.1. .111 .,,.,,,. in 11. 11. 91.11.11 1 11,- . .11--.... 11... ' z 1h.11n.. 1 11 . - V' 1 mm ,1",:fJ1f::-r11111.11.1.- 11 1.1 .v :. 2 -1 . 1. .. 1 1.1.1....... ,. 1. .111 QM, ....... .-..., ..--.. 1 .., . 1..- 1.. if -1- 11. 1. wr 1-1 14. 1 1 ....-.1 .- H H, ,. .... .... ,..,,,,,, 1-11. 1 , 11 11..... 1., ,, .. 1, ,W M., 1.-11.......1. .1.1.1.1. .1111...11 .1 1....11... .... rn...-.1 1 11.1 OVER TOP WITH Former Univ ' 1 ,.111. 'ifsily Mun Desc MARINES ' .sb 1.1 . ol L...11.....ff1.. on Fa""'uS C"-HS' -111 1 1'1,.1.1 111. 1.11. .,. .-.1.1. 11 .1.... 1.1.1. ...-1.11, ,..,,, :,"' -11.11.111-.... 1 . 1 .1.., 111. 11 1 . 11.111 .11 . -'-' ..1- ... 111. ,M ..1.. ........: ....11..1 1 '11 ...- 1 .1 1. -11.-..- 'r11.1. .-1 .1..1-.1 .111 1.1. 1- 11 .1.f1.11.., l' s, ..11.1... :n ....... 1-.. 11.1 .1111 .1 .11 115111. .-11.11. .111. ' 'C-1 .1.111... 1 1.. 11. 3.11. .... uf 1. 1.. 1. 11. --v11...1.-. 1, I. .... 1.. 1. ... 1.1.1, ..,,1,,L'g,1- M , 5, uk.. 1 -- M1-1 1111- 1.1111...11.,, . um... .... 1-3 . 11 .. 1.1.1, ,1 1. .... 11111-1.1 1 1...,....1 1. mu ... ..111.1.1f1..1 .11 1. 11111 .-.... 11 .,.., ,,,,, - 1... .....1...1'.1. .... 'f H-11 111 11... Jw 1.1.5 ,J-3.1 ....... ..-11.2. f.-1. 11.11. -'IH 11 1... .... .1 . 1 11.111.111.1, ... ,VU 11.111 11. 1 1.rxn...1.-.sg .1 ,. . 111.111 af. .111-1. 0' .... .1a.1-11..-.p, 11. H ' U 111111. .1..111.: A.1.1.. 1 , , 11' 11 . 13.11, 1,1 ... ,wo . wo... .... .11... .... ,, .H ,.1f......f-,,.+, Y - 1. - v ,.. fr .-...f-',. ,-1, 1' 1.1-4, , .v , ,Q .. k,...m,,: 91 J, iv... NR., 193. .1 .. .4 Q-,.x,., W.. ,.- .. ,.... 9 - Q T. -oo-. . f'.1-wi.. " .... .1- 91- -H xpix W .vga U.. Q 4- I .1 ,V ,. ....-1 wi. X - . ., W ,. ,.p..,,6 Q.. .. . , ,wg 1. 1 . .Q . 1'."Tx,f7,..' 'x 9'-mi. . , -Q .. ,,.5X1".1 .f-fl. Tt?,.LQ:1Q'..1f' J. fx X 9'-1 .K2.5f,,.1...-N'E.1' 1, '1..7i,.. 3 .. 5, 5m ..oHW . X S 2, Q, NIWWX a 0 NWS 'n A 83592865 .N...Xe. How' W... W wgon ...Nj ...'g,,. ,zo .,.. V. 1...1- W1 .--E ,. in-'Q23'-2 1 . E' -1.1- e v .10 . E' ., ...'r1,...-....-',,..-1, , S411-vc.. T2-f ' ':, ::.--11... 1.'vn,,,... P,.....1" g....v, ,5,..,: ...Q .,...g,.. 11, .mf"..- -3 1.--,.. 11' ..rnh,, ...r 21.-"' Y.,,.1 .11 "' ,.,,..: ...N " ,..1 - , 1... .a"' un' ,q uw ,I rf. .U B..--,,,. - .... ' . .11 1. - L -1 .. Y' .1 .F 1. '5K.'Q.'F.5'3175-' o ,.. 'gihovgc .1 ,:,.. 1.-1' ' .WY .-HA 1 -1 - ww. W..- ... H... M, .w M ,.. ..1 H.. .... . -'RX Wg, -1 f Q. .1-vm --, ...Q L..-'U' .A - .. ' -f , ',,..f1"...w ' ... QQ"...1u,, .1 .o ',..3 1 1 .1 ' ,.1.h,....-" 1 ...I ,110 , 'xvnvf ..."J'Q,,1n 1,-.wf wif ,.1.- '1',1..- D . .. 0 ,,. ...g",1 .,.. , v-,...4"...f ' ' ...- U.. ....',,11. .11 ,.. .,...v .... ,,..v. ,.. sv" ...r -11c,,,,... .I ,,,. ' .1.:' .0 no' 1. .-QW... 1... D..." .11-".,,. H'-,.... ,,..v-"' .1 . ,,,.. .LY,,,..mn1, .gum .-1 .. , ...qv-M.. I ,.... iz: Q. .1- ...gn dwg.. 1 , 1 .1.',y.,,..1:, .r N111-,..-1 . 11 .... .v.- 1 .. 1.1 1.11 1. 1. wwf . 1111 1 11... -11... 1.11111-11 ....-.1 111. 1.1 1-....... .11 -111 '......- . v, -.. . M--. . 2 4 XR.-j,,,.1 . .Q,,.Q,..X'2,1fg.'i 1fA..g,,.f'-.0 vcfaos.,-1 M ,,,, Yay A . ,,.H 5 V. 5.-0.1 ..- ,.... 9. ,Q .... 1- '..'..1 . ,. .19 .-1 nv." ... ,.-da' .ff .11 -'O-W-rn.. . . .Q , .NW ...- NYS... 1- , J.. , k xl. 10. .'- , 1- .... " , '. .f . , pg.-2. ' 1- X T-........," ',:f,"y'5Q,'---1. H.. v . g, ' .-.-,'.- f I M .... . . 1..11... -f .... iv .ww -1 1 . . ,, Q . .. .. ....1,, 1,,, ..' J v .1 .-1. - n.. gm " " 1 I' 1' 1 . 1 f .W .... .1 "1' . , , 1 1 ..,, .11 , 9. e wg ...I gn ,md I Nm' Y Q AUX., 8 - 1. . X ..W"'Ef1fkf 1 .-.111. A ...MN M " '. ' .sf 1 .. .... .1 . lm- Mn 1-1 1. "'X..1 " .1 1 f,,.1-'TZ-1',, "f"..-1. N, .. Y ,, .2 W... I. 5.1.1.1 . , ..1 . ,. ..""'f':1f-'15 f-'fm-fy ...iff ,,...,,,,, 4:11411--f .1..- 11.1.1 .1...., .1-...11 11.1 .-.... " "Wh 11 .... y.-11.111 -1 11. ...nh z 1 1..111... uv' . W.. .1 1.11. " .... c. 1,,. ' 1 -.1 ., .1.111. 11.1..1,. nr .1 .1.11.l.'f'.-I Qi. ,f .......-S .. .:::1'1.: 1 . .3 -.. .11 Q. .1 . ., , g , 3 - ,A ", wc, 1-1. .1 .625 od' .sv .-0.--Q,.1gg.. 113111 YW X 0 nf 1 .G ..'LU.1-' V.. -,. -9- 1 .-- .... ...J .X',.f", v' 1Gc..1,.. U... .W .1 'fp ..1 D .... ,,. 1 . ...J . .M . 1 .,.. hs ... f:,L,,.0:l,c.,.B, u, .inA.,... ,,,,... Q 11. 1 .1 ...- .... "' 1 .9 ,xo 111. 1.1.1.1 1 1: .. 55. 3.11-,N 3, W, 1 1--1 1.11. .... .... 1.11.1 ..1...11. .... 1. ....... ....... .1111 .111-11 :mm 1. 1.1. . x-JS. 'V' 1 .ul 1 .vt rv 0 1. 1.-.., . -1-1 1.1.1 1.-.1111 11.1.11 ..11. 111.11 1111.111 1 .1 11. .1 10.1111 1 L ,. 1 W X ,. . ..., . ,.. . 1 . 1 1' 1' .1 .,.', 1 -' , :L -- . 1 ..- .J -1 .. .- .1 ,.. , M... ,,...',.- V- K, .. ,.. ,,, ,. ,- .. ,, ...,..x..,,v i, ,, P-,,,. H ,, ,...- ,,.P',...' .:,,,. .Q,,.X,.4v.,- .1 .1,..'Q' . .. ,1 -.- . -fs. Nm' .'-"N, - 1. ,.... f - .x.q, . 111- 111111. 1 41.11. . .. vm' . ..n,,,. 1, . . fx, 1"' ,..-' ,.1 11. 31.1. .. .... 1 . . 11. 1111 hlrwqltv Nb D 4 'X . , .' .1 . ... . .1 ." . 'dgvd ,.... ,.. 9, W .1--' .- l. ' 7.11, -1,31 ,"1.,'11 11 'T ,UA 4 ,, M ,L 1 '.'M'f' '1 11 '11 1 -1 . ,.. .,. . , , .vu.,.g,.e-' ,,.. -,,..1',,,.. I .:x,,..- ,. . . . ,..1 .-1 - . , 1 , v , ,X . ...v,,,." 0.1 ' 'AN .. .1 B. ,M . . .- 1 Hx 1' xx! 90 rlx ,. , 1 ,.. .. ',,..-5.1-,..1 ,.-1 K-,,..f?, .tn .v .Q .1,,,..Q 9 ST Ulm QS: Q9 AY- L- . S . G - 46 ,wigs ,. "l.v'g.-"' . 911. .1 ,f .- X fix F' ..-1-'L-1' .1 1 ' 11 1- ' 1-1 ' ' ' nf'-1 'JM-"?. 4 1 n ... 1 -. nk, iw 1-,...-'31, f J , I. 1. a A. 1 I-' .w ...Qs ..k,,-1 U1 11 'o '11 ,v .- - . 11, 11 "-fl' .o 'r .. .. 1, 1 N... . . . 1-, A . lf. Q , .1 .1,,, .,,J1. 1 YYQQY39 ...N .., . 011-31. 14.1, 1.,,,' Q, Q ,,.,.-'.,,1. ..,1,f.,,.1, 1.,,! , Y- YB I1 f 1. f 1,615 J1,LN11,,' 1.311511-.,,hv1, If ,.... ...111,, 1 71, ' . 1- 'gy ,. 1, 1, , bw LMS-1 1,0 . , ..,, 11, '11 1 "' 1. V1 1501, . 'fa 1. 'f . 1 Q3 'ag 15 Ay' . A .. .,. 'ca 1 .- ,..- 1 1 L , ...f,'-211fn1,L'1 . 1. f.,-11 ' 1, 11,7 .f' -', ,G1,,'H1, '11 ".1 "-.1 '11 1- 4.1 .1 " v. .. ...H .' ,..-1 01- 1, -11,11 gn. SV .3 .ur .N .rw-..1,','1. V. 11,1 . . 1.1 -mx ...gil-Y C.. -' .w W -...-3.13. ,, .L X.. ,,.. 111, H1' 11' 1. xr., - , 1.0 1 .,- .1 --1,,, .. ,,.. , 1,, , , . .1,' X1-1 -. . ., 1.-,. ., .2 . "'. M' '-1 ,-11,' 1--1, - ,.... 0, .-I ,.. -5...-51 111,. .. 1 - 1.1-,,, .q ,. ,w,.- ,. , .X X. .-0 1. .. F111 .fx N, .1-J' hm' 1 11. .A ....1....1. "N 'M rw- 1 .25- ..... .1111 -- ' 11 -111.1 , BS a , ,. , 1 7 -- C0 C ...Ken . '45l':':-Jl:1L.1u1 .... 1.. -- A M e 'kgs X ....... ....... 11227. "' " .Nod . 'NYY 6, .... 1 -as ouch ,....- ' NW 'Sake .... 3.iJ1'2?'- an ....-Y, 1: .11 ..- ,J .--- .1-1-1 .1 .... N... K ,.. ,U 1 - -. 1- - -- lo .1 A ..-:.J1.-- 1.gy'.1..s WM" 1 11... ' I M, wQ':'.x1m.. .11 .1 ,.. I 1111 ,D H, - 1.11...1.-.' 1-1...-Ti -.fT.'.'--rgg,gfg ' J' '....u1:..Y........1., iq.,- '11:.-, "' ,' , ' 1 S 1 11.11. -1-1 1......1. .. , co 11f...," .,g-5 v 10. FY IW.. 1. 1. 1 0 1. ....... 1 32' 0 0 ,I 1 -lj. 1 1, . 1 1 1 we , 1, .1 M -1, ,V vt.. .1-'..H'.1'v.f' .f',v'. 1 1 1 . 1- 11L! n 5 1.11. 1. si. 313751. s re..-1. -11.1 ....... 11. 11,1 HOLD SHE rx 5,1 SWAN or T. .'1.T,,1,,:' L P10111 U--SHOCK MIHIE 11.4.1.1 s...a , . ' and 111.31...L"f3... ...1....11,. 11.1.1.1 '- H111 . ,fa wr am... H 1 . . 1:1 1-1.1.1.1 ,,,,, 'W rr..,.,, A 1111.11-.1 .-. .., Wa 1.-1.1. n 11... EL 1 1 -.:. if 53:11-f' 1 ... -X M1 ...., SY B. - -1 .. . 1 '.1 hgdl:.f hcl... -p..-1. 1' 2 .1 ,. . 5,.,1.. ,.,,..- ,,,,,,, N -1. :' ,---1 .1f..'5"T . 11-1... . ..- .A ,A 1.,., W -1111 .....1..11.d I 1f'.1'Q"2111 .... 1f1.:',,f"""' 11112111-112' -1.4 mfg- .-...mg .,,,:P"'H 11..1.1, "rm .'1,"':- 1111... 1... 'h' "Wd : ,. Y, 1. 1.1-. SI2'2g-,.,'g-L 1h5.?fg,'-1 111.T'1f..7 ' ' I - rr: . ,gf-1 -1 11.11 .f"!1Q11. .11..1n.1'Z' F' "W 11. 11.2"f rm... .1.1"""" """'1lx 111.1 15 ' 0' S., ..111.- "W" rw. -1.111 1. "1 1 11.1 1 M 2--1 ' MTF-.-:..1 1',.-1,-,f-.1 mmf ' -'hr nn. ....,, f --- . 1 - I-111 ,,1,,Qd Q 1-1.11.1 5.513 '7 M 1-1.1 11 111. ., "' f' fr .... - 1 -1 . W1 wr o ,1" 'nf .1 .1 11.:1.1. 11.95 ,, 4, CofX , ""'f I 11.1.1.2 ... -11... '1 -7-,, 4, 11. 01, 1 ....-ff I.. 1. , 2 , '91, 'A-.,, , 77 'lf . L, 11, 1,,11,,,X44, o E, c.,:1s.Rfo, 'L 'va' for ' 91,4 DN 14 11, 1. 1-1 'f1.-.-- 91. ff.. 1 ' M M. 21. . 1' '11 11, .1 I.. 111 A. 1."U." .,. Ao -V 5,11 :1,"1. ,1,,,':,,'u ,fm ' X 145. - ,,'- 1 . 11. 1. ..,,- n,, 11,, -.,"v 'j4"11f' h..' 11 'D 12' JH 11,,'1., 1, 1 , Mn. 1. 1 r1,,, 11,-I ,D 111,510 .f.,11 bla,-,:1,. 1,421.3 .1211 ,L . ,211 1 'G.,:.,,3 X , ?'11:5 ffl 11.2 ,' gb X .W 1. " f 11, , 11 -A , -.1 a1,,J41,'i11 5 ,.,,y.-,, 77.f'11,f:'1.,,' 11,5 A5 'A A Y... Q.. - Q30 9.673 ss ."v ws si ...Q ,...g'.1 ,. ....... ,mb mv .1-L ,,.-1.1 ,.-16, 2.42. .v 11- 1- .1 .1 Q .Ni s if .1 N 0 5 6 1. ' . .CQ -Q5 127- Q. j..Q1 .H un.. .1--. . .v .0 Q. G. .. .. .1. 1 v'-.v v. .11 1.s .6 . .w..,,.-j..f1,,.. . 1 . ff.. VN: ' 1-1' ' ' .1 ff 2-gff . 'J , 1. :',,,...f- wx,-1 ,,...N..K' 4' nf' 1. 11 1,, 1 ,. 1 . 11... L I K fx' .N A .e ,,, sfw. '1 Vg., vit" Awuvf .wnsfw-f -f . Y A , 1 wi W ' -,,,,Q - 6 - ' If ,tg 'Q mv.:-1:1 . .Afrzvi fp V il 4, N .- L , .,,. M, 5 N .. .-,ZW .545 , 71+ ,. f w '?? Mfr:-.. 1 . eqif .fl .',. fy ,H"'Xff1 'if-1' 'i",?2, .Q-v,f," V ie 'Pr ' i TlL,,.Lll5fL,Q'.. W 'V ':q'.'+ 1 1-'rl-,-, . ' Q X V A 'LTV A f, -VaQ'Q5:fn11Vip,,j..fl,- - kw- 1-a 'H . . 5.51 . V eff-mvqezff-V-v :- X.-P I AWS-Wwnilnww G . ,X 3. .tin 5 Q .,-Q 1 4 sc ui' , Amff , 1-2, ,5 ,Q .3 1 mg jufjg-'ts Aj R 135533, W-fl if ' ...QQ-Vff mi ' 'mill oldies?-fQ'0 "f1issw'llW ., 1 , 6 Q ,A ' -W"""' "A' ' H exxrwigf -S. -f " " . 7' fm ft" 1 1'H1sf7?PfV is 7i?PtC77?"fi'-A wwf 'A 3 ' afiwigzfif.-.f2'f"X?"?a :Q '11 MV SEV " "P uff HN V V. 1 h -1,.Vfx,,3V .L Egg, X r 5,3 I5 ,S my ' ,K E 1 VMS V e 4. V 3 ff. l :.- ,NA X gf re-'-fm., l, 'if fi,".fV",,,ff' .. ...,..-..-H V .- VN' ,,,V1fiVfwe ,fu V --L -'-s-.- I ,nys -- sf. VV V '-Vtkwrf'-'.lf.h me :f wimiw - e-. - 1 A , W .W ' were ,. ..sw'- -::',. 41-V----W -Vp-.,f,,, if .7 V. ff' 1 a n 'lah viii 3' if 2219 "e f . L' WC l , 19 ,5 E W , if 5-u ' fi-'f 1 ' is . - if 5 mu VbV'f'7" -f -W ' :V-s22ferV!z22ea 'IN Wlwliifff ' l' "3v'flif i'i"C'kE4? WV: Qgsgiii-2f.'t'-V7 :HW-fs V,'2r l1?7? . . ' 'P' ' A I 1-V i ' 5 - " ' 1 'U1'n '5f9s?3-aS""Z I B ' '43 4 " , Va' 'f 's'2'w - nw- W. " ',.' V' " . ' " .-If' W' 1 ' f V 54 H 5 5, ... Li .,e.-M 2 .M M ,, X ,AMW . W4-,sl mf . A A im ... , , I W zu- V 3 .:-:lib -. ' . V I V .,, ,H ,Ar , - - 1 . ,J , V. 4 l--I " 152 UV' 3 ' 3 64 ' ,Q'2f,:2SQ.qf,j:f ,, 43, , fgyeif-'Z ' ' .1 -51624 'rs i 51-2 " -fer Ilftaii' Wy. Va .VV. . - -I ' "" T-. 'M?:lt'T'-, '7 V ., " fl V' ' V? 'f1, 'f' 5g"4 .iff we-f - V V. if 2-L-:H . .ti e - 'M 'QE 1 . L ,Q-'figiizz 1 eb pay . ,v ffygfgggiifu .?., f .IL L 'Z ' " wif? .... sail---f--A 'Li ,Sqn - Vw V' .- f., 5 " Ti FN? r , ij 'nf ,if '1 1 ..,g'V, - tg. f f ,EV if - " . .Q-,Q " . 35. :1VV2V.f3:, ., --V. 'T ,o . . . ' 1 2 af f 'N ' VV . - . if A ,J . -fi ' -.ff .31 'f wx YJ . f .,-. me-gg 1' ' A .V Tit 'S X if l :Q f ,,f.sf.gf VN-31 1-fm ,.5.4f' pf Jw f " 1,5 .t ' -- WL. 1-W? ,-aff,-' A- -- T gf! I' ' ,L fi- ..,..- ,i KM .I iv-Q Ili., ., 4, V Q- il- Q , KV V . . I 1, . -, V1.3 VV - , JN53., ,Qu Q, gfgjg' -. -5135, .rffj .W L 1 V v . ' - -' 5 13" , I .gjfw 1 ' ' 1 fr' F r- -V fr if M V w w' fb, OFF FOR SHERIDAN Q -AN HISTORIC PHOTOGRAPH--On May l2, l9l7, the first of Wisconsin's volunteers were given a rousing send-off by University and townspeople who turned out en masse to bid them Godspeed. Few of these men have missed the thirlls of actual combat, and several of them heroically sacrificed their lives on the field of honor. . LOYALTY DAY, I-9li1-Wisconsin's first patriotic celebration was held on March 3I, l9l 7, just prior to the break in diplomatic? relations Germany. The entire' University turned out to demonstrate its unqualified sup port in backing President Wilson during the critical point of the German-American negotiations. i 75.1. . fb fri if -zu f X. .'. 1,, , 1. if-V , fgggg-gt Q55 A w. ,. DWP gigvw, bf. . . wi V , Yi v"s's,? , rfia V if l 3 .., 4 ,IW E: -'X 1 1 i I 5 --I NAVAL FLYERS-ALL BADGERS-These naval aviators in service at the U. S. Naval Air Station. Pensacola, Florida, are all Wisconsin men. They are: Top row, left to right, Ensigns K. F. Whilcomb 'l3, D. julian '20, T. B. Caldwell '20, D. P. Spurrier '19, H. B. Stark '20, V. N. jones 'l7, R. F. Tillotson 'l9: lower row, left to right, Ensign M . P. Griswold 'l9: Lieutenants L. A. Hammer 'l7, G. C. Nedry 'I2: Ensigns C. H. Carpenter 'l9, T.'W. Tuttle 'l9. BROTHERS-ALL BADGERS, ALLZSOLDIERS-Five Wisconsinfmefin, brothers, all enlisted in the service of their country. ' F 4 ., , X 1, V, . f 1 v 1 ,bi 3 ik. -M ff. 1M"KCCw' P'- Wm, K 1, ,Q ,K r V --A 4 fy ' ' 4--flf?lsi1'l'.f FARMERETTES-BADGER CO-EDS DON OVERALLS-To help push the war to victory, many of Wiscon- sin's women filled men's places on farms during the summer months. Sue Oleaen I9, is pictured shocking grain in her fathefs wheat field in lowagf-Ingrid Nelson 'I9 was caught painting a silo: jean Patterson 'I9 and Jeanette Lamb ' I9 are shown at the noon hourinstheir masculine attire and Corothy Martin is hoeing her big patch of potatoes. Oh yes. behind the plow is Marion Olbrich 'l9, doing the fall work on her father's fram in Illinois. f Q, x..x-..,. HONORING OUR HEROES-Wisconsin's mammoth service flag, bearing more than 4,000 stars, was most auspiciously dedicated. ln the shadow of Lincoln's statue, on Memorial Day, l9l8, great tribute was paid to Wisconsin's volunteers. ROOSEVELT OUR GUEST-Among the memorable occasions of war-time Wisconsin was thelproud reception accorded the great "Teddy" fMay 28, l9l8D. The picture shows him at the station being escorted past the cadet guard of honor by the late president of the University, Charles R. Van Hise. By some odd coincidence of fate, these great men have both recently passed away. "I congratulate you on your fine record in the war, and I congratulate the country evien more," were Tedcly's words to the students in his address at the stock pavillion. "Wisconsin xjbse to the need in a way which will forever after make every graduate of it lift his head in pride the University's name is mentioned." i ti . fa, ' yi . 1 -Q - ...leislwfifefdr film .115 5 .nw-.W 5 ' , - 12,4-iq .'1 'fwwg J. M, ., ,,., , . .AA 3 :4"f'f'r-. ' - '- . 5. 1:33 ' -4 5 7-3 ' -A ' ':.,xt.: . Q,-T3 .gzf Y r i ' vc: 5 1. 1 J? . ,. J L F.A,.,, CO-ED WORKERS-DOING A lVlAN'S BIT-Many of Wisconsin's women answered the country's call "For every Hghter a woman worker" and donned the masculine overalls to work in munitions plants during the summer months. These co-eds devoted their entire vacation doing manual labor in the Gisholt Munitions plant. They are left to right: Ruth Johnson '20, Elisabeth Head 'l9, Ada Kroening '20, Ruth Martin '20. WISCONSIN RECRUITING HEAD- QUARTERS-Gov. E.. L. Philipp is shown in the center with recruiting offi- cers of all branchesoffthe service. More than 43,000 lmen ffrom the state of Wis- consin enlisted in the various branches of activefmilitary service. . 17 1 '. xi' K in l P 1 . 9 . ll! I N ...N N I x A I . .,,. ' iiiif- 5 EMF' ' . 0 wif ,f I 515 .,f - A .Q ,,. ,X .sf " ,, 1 .nfl v " -:1,,..i?,1 v- 1fE21kf"-z '1 'A 11 . , .5 ei .ffmwl - I WISCONSIN PROFESSORS DON OVER- ALLS-Professors Carl Russell Fish, History, and F. B. McGilvary, Philosophy, who worked at the Northwestern Ordnance plants during the summer months. The picture above shows the professors at noon-time, enjoying lunch with a fellow worker. TAFI' VISITS WISCONSIN'-The ex-president is shown shaking hands with the late President Van Hise at the S. A. T. C. Review at Vilas Park. "A splendid review, and much credit to you who 'stood by' "said Taft when address- ing the troops on the lower campus. X -. 7 if Q 423' , X R, ,H THE S. A. T. C.-THE MEN WHO USTOOD BY"-More than 3,000 men enrolled at Wis- consin and drilled intensively for several weeks. Had the war continued, these men would have played an important part in the final act. The picture shows the entire regiment in review before Ex-president Taft. who paid them high tribute in an address on the lower campus after the review. I '- BRYAN PLEDGES A. O. Pl-Not least of Wisconsin's distinguished war-time visitorslhas been Wm. Jennings Bryan, the grapefjuice authority. "Bill" was the guest of the A. O. Pi's for luncheon and he has their tacit assurance that when the women vote he is going to get the long angle for presidency. . 1 .,, K. .. .. t Q. .X V-'ifxgj H, AL 1, , ' ' i -1 1-1 ,rp 4 X 1 ' " 1-......1".h .zo - '1 J A .. ,. , w. . .Li ,uni-4 ,,1 ,Awami Y lr ia! 1 ,E-,1 1 1 1 ,' :a1?1 :.. f , J- P4 .' ' .V .vp 1, '1 X pr J ifqgvila ,, is E f in 151 J, 'f' .t-,..1s-' l .Q .lfli T51 ' 1:1 ,il ,KJ Mai' 2-r I 1 I I ' . A1 . 'dim 1 I 5--121, 1 '11 ryj' if ' '?'-,J 2, 12351 EK , 1 ' . sg: 1 ' Z 1, i 'x 1 is . 1 fb? ' a if 5 -2 . '11 lyii' 1 bfi J - , J i 1 , . 1 fl ' f -:la 4? Q, . 1 . Ii K 11 if 1 ' l, 1 '.1' k, .,. '1 1 1.' , . 1 5 1. 1 -5 ,,L,,.,,. 21. ,,,.iW 1.4 ...f 'S , an 1 , ' 11f"'L7 1 ' ' - ..'1'1 L., 1' .' 1 .+.1'-, ',.u1'xM 2.25--r -'I z., .Leg-J,-rf, -:-- M53 4 .1 Wisconsin Aids Fatlierfless Children ofFrance i Ruinszof a French Village The University of Wisconsin early came to the aid of the war-stricken children of France. ln the fall of l9l 7 the students of the University of Wisconsin became interested in the work for the Fatherless Children of France. Through the inspiration of the Madison Committee, plans were first laid by the Student Committee under the Student Council for the adoption of a whole village, the village of Montreuil. Helen B. Smith headed the student committee. Her work was taken over in October, l9l8 by Gladys Haskins '22. The university women under Self-Govemment Association, arranged orphan boxes in all the rooming houses, sorority houses, and both dormitories. In the First six weeks over a hundred dol- lars, mostly in pennies, came in from the boxes, and the first three children were adopted. The yearly Christmas Festival of song, given by the University Choral Union and Glee Clubs made it possible to adopt six more of the children of Montreuil. Gradually the interest spread until organization after organization, sororities, fraternities, individuals. and university departments have felt the joy of sharing in the great work for beloved, courageous France. Through such cooperation the number of adoptions reached sixty-six, the children living in Montreuil, Sevres, and Lyons, and other French towns. ln the fall of l9l8, the work was resumed with fresh impetus. During the week just before the Christmas holidays, three Christmas trees on the campus loaded with stars representing individual contributions, repre- sented over four hundred dollars for the children. With this money and seventy-five dollars more gained from a moving picture benefit, together with other dona- tions, five new children have been adopted and fifteen others readopted. The need for a continuance of' adoptions is still very great and the University of Wisconsin will continue to . participate in work of keeping and making happy the children of France. . 11 -4- t -YQ ' , 1 . A . F f1 ,mi 1 W , 1 Solange Quiot e 'S' 1, M-- ' 6 K . ' A ,Qui l ' f X 1 . . . A . l I' '1 - , l ' 1 . 1. l . " " 1 17 'Q f ,T .312 2 1 "-f f . 1 H-: " 2.1 '--1' 1.1 . ' 1- ,J .47 - L' .-'f-11' 'fkn..1,. I , , 34?i'15,35F-G '-irgs.-io .1 m"If'F?"'ff1 I' ",.':: ff' -iii, i , "FV KJ1 'Sgr' aw- JQQW iG1Ll-gzfif' -1 'Ali ' -"W Wm' " ' 'L . . '5'i2i1-.enBl1i.v??!la.: .X :FL .1 'ellis 1, EW, at .15 h ,Aff W' ,ff I N .. , ,X V, ,Now Y x - I iii 1 ww Gy 14: 7 fr rm , n .. 1: Q' 1 1 ,V .--., My Fatherless Children .f i., I r U l v E The Kappa Orphans from Montreuil Germaine Rigoulet, Montreuil, Adopted Renee. Adoptecl by University at- Large rm 1 l by Barnard Hall :i3,33?,,f2fi5rf 32,123 W' if- fvwmw. fqff rmg:gr3tQiSM0aag?g03fALff M alfalwama. , -31, WMVQLWMMLL ,,,,.m,fvZ,ofojw,afvZu. Oie-Mum.. DMA. GLC 'MDM 5"Wa":f'fwa"u Pd, fgoccafsfwfuv. all ww: '4qVCQfV"A 1'JMfJ J -UVL, '11fVJf04AM,L 41-01419 Lmmcmual cf! Iwi? gfggfmk, b941AAfb'f1f1,0f3 Clluew Lwvw f Em f51,o4M4wA.- DLL A Wfflwdl- Ed: 4A1oM-A woua .oowvt 'wo fG4,v5ofww ILL Ebofve Q,M1',L Ctrlc 4044 gvafml cdwa !lgJLVe. C Oqnother Letter from Renee Montreuil, France, Chere Mademoiselle: Le 20 Decembre l9l8. J e profite de mes vacances de Paques pour vous envoyer cette carte. ,Ie vais vous dire que nous avons ete bom- barcles par les Boches, moi j'ai paue des Gothas. Nous descenclons tous a la cave mais nos mamans ont du courage. Elles pensent a nos vaillants soldats qui com- battant sons la pluie cles obus. C'est si terrible supplier l A front Francais en ce moment mais cela nous clonxiefaf 1 clu courage. Mademoiselle, un bon bon baiser de votre petite amie de France. 'J Renee. V -'x Q 4 , l 39 ' bfi :U x J , 4 - 5,3-'S Q : V1 Eli Ewin- wp-,f Q L53 ,M se, wha fr 'V 4, 1, ,.lv'., l 'E ..l' , 1 X W Fri-,,..w""'S,:, A 4 'f f l 11 , , V V+-f I L .ws - Q X Wh W ' ' ' H Z ' F Z 6746 ISCOTISU7. S Q p 18 6 I k ' . ' ' 5 I bzynnzs-:nn-an uwscm ' um-mm ae Janne: num , H 3 ' - , . .. : 1 S, v - J - ,f'4...X a ,A-tg, ,. V ,. N. 5 4 -- f i e el ,. 1125 5. P - ,Q A 5 ii' il-1 N .5 : 1 Q ,Q-Lg. ' f 23' i?T??".e11 i 1, lv li fi i .. li-: 4,-Q ggagL,,,,,!f Qt . , .mage ---sp i '- ,fikf 4555 "rf 'QPU ,'5'i Lyon-Home of Ten Wisconsin Orphans am Q fe 1' , l"!'5ik uf' """'q5gC.E7ql"""' r ww -.iu'::'icr'x'u"-nu-rm-if. zgaspfflxfzngassagueaeezs.viemti mscsseiinensiiggmm - - - '- ' e sxffw K- pm: A msg! iauanllcsqgga gi--wif 1. :gill 5' hu 4135.1 E limingliint :M 1 --ggi, if so :aagssaw we Clllig fitE3i,,,,.,,, w . fm - 1- ,ii , ,,. in wifi?" w el 2 Leaf s .,.. " 'fir if wma. " lv -A-' .4 . ""Sui1LRhn:Q School at Sevres Nl ntreuil-Sous-Bois Montreuil-sous Bois, the first '3Wis- consin City" is just 1 outside the city ' walls of Paris and is only a fifteen min- ute ride from the heart of the great French capitol. Sevres, the second "Wisconsin City" is a town of 19,000 in- habitants. situated onlthe left bank of the Seine River. and only forty-five miles from Ver- sailles. Lyon, the home of ten of Wis- consirfs orphans, is the third largest city of France and is located on the Rhone River! I 1 War Orphans 2 Lucienne Metivier, Montreuil, Adopted by University Girls. Fi it i'fAiQifJ'5 , nw, . , . M . . . , "f 7 'mi' .. .,- -5 M L lf: ,ge AQ From Left to Rightg Felix Davoine. Adopledbliy I Ye Cath Inn, Albert and Almee Davioneg Adi L opted by the University-at-large. J v x 1 x " 1' nb ffgw: vflilr' 5-K A ' v.ff , ' 5' .l Q J ji 'gig -wwwm. mx., - fifty .-I f? T - F H' , 1 . 4- if-'W,"14.:-1 M " oAL.1'if'Ew4aaQ.,w.a1,' JH. gr-ff A, '. . l., 1-,tflf "f" 'Q wif J YT 25 ., Af -'ff ' -,. .. ' , -Y Mmm-.- . 1 R5-EW9' ,ywmw A L 'Af Q 1 'www ' fl 3 YW fl wil A' ' j ' V-awww X i l '3?11,f,g..f fi? flu., 'gh 2,5 jlffq I . 'ck 25,3 1 fl' lt jk if 'fl' l fl. f'?vn?ff: ! J . I l I l ' S 5 , l 5 1 .X , .w . 7 A l . 1 . -5 . l 'H' fa l 3 L24 ll - X H 1 .VH A ll .2 , v T 5 3 5 .i l l y . ,N M .6 '.'.2'UJ:'1AY-, , K ,-1. , , . J ' all 'af ffl' ,f 1, 'I Q -ai 3 5 - le 1 an fx Sl I , l , X - 17 l ' 1 l 1 g,s.I' w 1 5 4' y V E25 H 1 , l l 'ef 4'53s'f'5 Q 5 ' l VE. ? A + V- Fix " - 1 ' . X L :if 4 , - Befgggvtiaxyxlsgeglg llzline elmziievfjxizzgxglltiflKg-cl-ggnsgllxvlzgl-gel'Intl-tl'lg6ggi-gcglvgqwmfxalxiglgflseglll la day of strenuous celelnratibik' J , 5 if The pxcture on the Capltgl steps washtalcen gt 3 a, m. on the mogning of Victory pay. All day long co-eds, S. A. T.?,C. ' 4 -,- Cy.: iz? .jill ' Q33 'gf' ' 1 ,. SSH. -.. .4 .1-lf . ...., Q X, . V f V., . . ,I 4 ,324 . gg I 2 1- . " r ll 5 Q ' E, l '-.fi V ' his , S men, and townspeople Jomecl m stagmg an Impromptu celebratxon unparalleled in enthusxasm. VV .. Q . 4 V 5 r-Q! . , 1 Q." , gl .CTN - "K l ,Fl ,La ff 'iii 14 wi ' 1 A ' ' ' ll- . l . f rf lf-4 ,H L V 415. ,, In Vi- . vw .fggfvtyl ' vii:-,lg by ' ' E ' ' , . , f U l - ' ' .le-'Xl' ' F ' L" " '3 ' ' " ,Q ,X 1 1 -,mx f f ,,'gM:'Y5. r H L I I. Q I, . E, , . .5 " Q. Q, .- .H ,, , 1 ' , ' 1 .lv ., ,gpg-, , , ,uf 4, V - f ' , '- Q.. 5,21 i" '- 1, . 11 ' - 1' , Q, yi-l5'qi1f, . in Egg lmfh V . 'fy X ll -Q X- ' U . mf . 'ix 12 M- .J ,. all 1' Q V .e fx :?'5H.ifl'1 ' ' l- I i'.5'ig,5qfi. wr: . . wg . ' 91595. l , ,-.i1f.i,p.,g ,, fr ",'i7.f! rf 'F fgq.-f ' 32437 g3:i1yiw,13n'fl ?+ - .- 'g' 4 'XAti,gg'S 71J '5:,:l fvjfl H 'TM4-5116 EH? 4? f1sgfg2'.1Asl41ilEg l, A27 ' fl -My 4 ,ff f J 1 -' .Wm ...m'-4'-eq 4: 4 -xv ll -UM QWQR-'W . - n f n 'vf' V :7iLf"ff1 - '1,.:. 2 - -" ' ' -'V 5499' PWEQE? -J L i '- ' fi W- x 'li ,fi -, nf., L ,-Lu.: mg. 'L , ',,.5I9i,-K. , : l ww- ,- -'I J 23:- 1 ' Ayn'-.wr ,ge 21'-33 . .:f'- fefww . All-v , f '1 144551 -' 5+ " ,Dyfv-4? '- uf. -.. . fi- -ff :-4 "'-':. if -'-f-1'-'W:si2lvlf'-,- .Li r "M-wif:-':'fi' 1 ' l . ', nffm: :QA mat - J,Tl:5'4:4'22mggv.' 1 .L f , f .L f , ,--...wml de: M1 ---"- ww- ' -QW 14 -A H w e,, r . R, , I 1 .......,,K , 41. 'MM-.., 1 , XF,-M-':q.n,.,: -7' j9,,.,,,,, M Xwl", i ff-1-.,.,,,5E a.?l'z, A V " mv, r3g.f'xL .Tc ,1'ilil3lf- fr V -f 2141-f.dfh?1alE ii -V il ," "1 l .f'?2..-W9 if i' ml FQRYV. iam' 2 7'l'WgT'1 3 ,lx l F' 'I 'rf 1-i ny ' i 126- fl ISU ' 27' 'Cf' ' --f ww if , : ,tial , 1, 1, 2 .,,'-,Q njgwp 5 1 J w LH1. J . ' ' f Nr 9. . iilvi-rr 1 Y ",,.',evfu'f"nf J f 'r""':Tf f' A ' L ' .. " -1 ff ' " ' f 'Ci' 1 -wr. A: f .. - r- ..,' , - -2,5 w ' w , A 3-f -- - V ,G-ja -- ' 'lim' "2 ff' XB"3li4.il-f7f"'fi" . " f f' F.-+ 1"-27fi'i."f I - V -,,vl-:gJr,,,M r-,uma 1 V 15 ' fl, ' ,,',,f l .. 4 , V di ,. if fl ni P1 W1 ll", . . . I. ,.. ,. -eel-i::liv'i3,1 lllefxf., . -q.,51w-L' ' ,fmpzfq ex ,, ji if X' 'ffl V' Ji", 'l ly fi lt ie. i , . 4 , ilfir' .77 qw, x ., ,- ., 2 1.1 ls, ' Hornbeck ! I i 1 Martin Westermann WI - . . . . TH Wll.SON TO EUROPE These Wisconsin rofessors accompanied the American peace delegation to Euro e as authorities in their specialized lines of work. Prof. I... Westermann, as a specialist on Turkey, is a member of the history department. Major Lawrence Martin is professor of geology, and Capt. Stanley Hornbeck is on leave of absence from the political science department until he completes his work for the government. Wisconsin has furnished more professors for this sort of war work than any other university. lr 9 l V is LIKE MY OVERALLSQ-Hazel in I Brashear ' I9 as she loolcecl when inspect- 1 5 l ,rf V6 ing 4-inch naval guns in the Naval Ord- f nance Factory, Moline, Ill. last sum- mer. fm ll 1 . - f v V , W A v I.. Q l. , r OH JQHNNIE!-Ensign john W. Blount '20, before- flight 05 the Florida Coast in naval airplane. I v - 4 ., f, N 1 xifzfzi . ,,,. ,, 1 ---- f. , ...mf l mum x ,-"4 ' il.-Vi lf" 123575 flu - ' 1 ,bv ,W ,S ,R .X ,dwg fKQ4,.s . 43' v -mls. 'L I 9'-,U,..15,:3s1A we-nf 1-. fjfiiili X, 7 .. fz54,fn-154,32 r :g.v.a..-.2-.EMf...m. .5 ia- ,,,.'p1ifQ3g-V54 5'-fi-"Mfr, 5 : 5 if., .' file , ., ifcgq. ' g' ' f, 'Tn , . . unify N I , Q , ,.. I. ., f , f. ,s . . , -e.,"tf,. gm. ,f -,, L, V ,. -. e , 'Lyn' ,"' ' "L Risgf ,E 'JM H-..s...e..e...-4..?Q Hpswvc,-mfif .. . J, - .. v-A . 4 .ff . 5. ze 1 'ff' ',,.mfwa,.. I N. x, 1 , Q ' 'mcg ig' .mfr li 'f kj :.5f5,fffE,rgs.jiS'ff4'3 J "l1f4:'-f1f'7 aw., ..,. Av' :N 5 9151 .f j'r1 RXEQ ..,. ss.-- ..., -..,-... ..., --c.,. ! J. ' Q i The McElroy Affair 1' 'vii 625331 ,H .H . ??5s4ff"'c' 1 1 1 1 1 ' .- A -b -. .r .mem THE BEGINNING--THE LIBERTY DAY PARADE-This photograph shows the caclet corps marching through the rain to the stock pavilion where they were forced to sit in drenched clothing for hours. principally on account of the long-winded McElroy speech. Because a few of the cadets were physically unable to endure the irrelevantfoutburst. the Princeton professor on returinng East spread false charges of U. W. disloyalty through Eastern newspapers. ' LIBERTY PARADE cosrs Two L1vEs 6. Q X 1 - - Jann A. nomum as recom: vue-nu. Aero nun can or X N mzuuouu '83 SXV-riff X . Q, SY' Weis' def' 555-:.g.:::w,g4:n:1g: A mana .mm u 1 1-un or ua- um-. mmf ur ww -.ef-.ma mn -.my -nm .mm L xg.-mn --armed ...rm -me-nw, :nu N- map in-.L pn. wma H-mu-Q. mem- rr-rp. wumm mr .rm ' 5 mms nv vu 1 9 0 " 44' S56 GKYQQF-5' ,."S't l ' '37 222.4721 1.5.11-2. fax -1 H vu ww I.. uf-am. nm-M. in nu Ng, Q 4 695009 ,....0iy, Rau .mm by B.. .Eu R In ' Q Qs 0 is me -'M H H - Y- all 4 .Q e "ee M'- Y 4 ' 1 1 - .- -. . srws.. .mann A-nm N- X 52 P1 Q' pi 4 fvtvi' ,ef I 6 .v - . , I, ,w v 0 .4 ,,.-yi. 0' if -v' ,, " .- ..nl .--ummm. nn. .mr mn wmpaw .549 3. ,A-'fr-'I--, .. 141.3 Mc? 44 , v"'-Wilszit a- -eift-vw-'L+ 'A-,VJ . fl "."4. 'fe' a"e51,K' 9. X 4 10 3: .Lg..kr,.4 ff. r . ,.g, ei-1.5 f.. .fm .3 in - ..-. WWW Qin ..,WQ,gff . QQZFVX W - 44. '.gf'Zv,, 51' . Qhr 4f,a,,ei 3' Qi? 6954, 46143, 0421-,QSM 'av '2.,g.,f.,,:- 3. Q MQ, f ,g.,a?h4gl:,-4.735 - -ifL.,.'glg.geg3g-4gZ'Q' 416 , . - , . .. v'f':2f1:f:Q-'zfr.51.Z 4 ,B . " we N+Q e.,4 lk. 3' 'L' 1 r' .GM A 'css' of ev" "rf vuxakf' e" W 1"'v 'Y ' '-"u4"'14 'fs K me iw .QQ2-:Q - fu QA xx .f5w22i ff.f2'.'f2ff4a. 4 w -904' Nifarn v- Qelir' J Q4"F': 'xxx-4' Il" X '-S."-"f"'f","l' iq", bww 'Q f P".-'.-,,. 1.41. ph" 'Le' -Q' .-'Ss' r-'X - K 'iw 'J ,+qg'f.g4,"v'+ , .'si'4,'MK J? Q +.g:,.v.,n":f.w:c: agyvdxrg vga, .-K..r:Q-NP.,-xea3.fc QS, Ya ,,j?Q-,4-j:,'g:.4:, szzsfsxfs QQ5? 0 l . P , . A . 1 ' . .-,-ZLZXQLLQ 4.5. +-fgixgggl f...f4n.W,1x,-,-1,3 X 'Qgf-gg-3igL,g4i'f3.,+Iw4w,"qa53fv.,.. 0 A , Q, 4, y.,iu.,4 .,ef,, , a,.a4,'fi-45,-444 ,' QA ,Q pg, Q, Ns...-Q, og., if . .- of 1. 4- 'f.,,, fa, . ,,,"Q,Q.?.,S,fs, kg' U,,n,e .wo ,Q Q04 ,nov 4. ,N .f y ,.v,,.1 ,Q .- 4 4,-. v, ,gb 4, . gig, 'X A ,+ i,.+X1 ,,of,0,f,+.-,v,o,.o , Q , M, 4-N.. 6 4,44 1? 4 16544, ' x55 x 'QS' g--4s..g..+.-2.5m-':+g..,g,1, -1,-if ,P X49 , 4o.3w.,T." 'cpl' Z 4 4 X 0 4 V X N f X, 1 've 4 Q44-6: 10+ xy .r . ,,1L,v-,. -qv Q Qs Ss 4. .. +lfl'f"" ew-if . 'Q-as 5 K S S -1 1: v FM' + v'ff'3'Z- "fe" QMFAQW' wx yi. . -wg '5g3,'e4+ PV ry' 0? xy. '53 '53 Qfssf ff g2a.f,jf'i'7 . 620 0 ug If xx si". .Q . 4 is Q ir if Af. if? amz. 411' "'x:f+13"f +7 S ,hs 5 1...-ex I ' .ll FQ.. ,. is fc-I liiffg 3 fy-v.,..',:s -'Gm f A 33 A 'QQ Q , Q Sgr fi, ling, Q , . -,5N .n3,,.-QL.-,:0. 3. .21 gg: , X4-qi, - 4? A .-:af Qgffi. :Q gg: N, ,,.-Q. 'jjj' , 0, 0 :Ny ,W ji, ,L Q? 6 Q . .,.r ...N 1 1, 9,0 8' .Q -r-I Q vc HCI: H ' . t5t'!-f QQ? 3 4- 4 5: ' : z. -, ,.- gf-, w .-'N -X. A nie ,Az-'i, oi' gp 431 55' :.s,i'1r:A5rf-25' ff .5-If f hy egm.-33 3353--,.1gQQ3::i-g,.2fg"1,Qg.lv:'-.5Q',a'Jj?Q'f-, A52 H fat .4 tn., P?-w -fs N.. rg .. . ' 1 -sr '..w1.-H+..-' N'-'l,.."v..' w'waff-1.11,-pg-5 -p ' "' 53: 54' 05?-fi " Q 6' 1' 6?"' -'rw' -"s"x-"r-W..-H 'U-'X 'X 1.f14.av,,V"' --1 ' ' ff-:Tiff-'-Fr:-s'I-13 Sl: ' 4- 'is fri? ti-K l"':i-"3'i::x"'1 .- " .9 2'512L3m '2- 4 is e .f s 1 .- -1. giui .is..f.,, gh :' 31,5 ,Qlrs :fn ..-Q.-j,..n .e',.v,.v , rw',n-..1o'L'5"'.v3A4"1', 5 ea N.. Q . 5, i H-,..,v N . .-,.- 3' -4-A-g4f.G - -sa :g"'f," 5 ss .-, 1 as-sqfsg ff,-f' .f-..fw,,.-xx, 4' . b fi' ' I Xe' X rl' P' 4-"S'?5a3 kwin Y-' ce'E -i'44Yj4.'.:' iq.- N 'JI pf! -' "':'?.-L' ,,.'..- 'Queue 'f-U34 - Y Xxif- if iff ? xr. 1,1 gl. , X e cz in .' :lf uw. -'ici v v ., f "" : ' 04.5 2. fa 5? in f.4,4.. if 455-Q 9' 'W if 1-51511 .'.. f K .,... .. X .f21fimlcs1.1i :ka ts. lg? R ,AQ WH. giiglrkxl WN,-51 6 .qaf'ffm'?-fn. ,. iw me . 4 K - . .X yy. A -5. 1 , A M tl s. if . ' 1 ,J 1 L-.,. -fray? ,Q 1.. 'QI fn'-1 f ui -Mu 'fri A . i ff ' ef ' lv ? " 'ILT '-:.,feJ- :gr IE '15 'VARSITY OUT-The efhgies of McElroy and the Kaiser were flaunted through the streets for hours. McElroy's efhgy was labeled "McElroy, Prince of Asses," and the Kaiser's dummy was dubbed "Kaiser Bill, Me und Gott " Y '-s-c LAST OF McELR igtudents danced wild about the Ere which consumed the effpgies of the two characters held in mutual contempt. McElroy was forever squelched. ' , 1 T--.mm , 1 , 1, 11 , X 1 '---1-11 11.715 1 1 Qi im: 1 " 1. 4'f-,,:g35 ,1-rg L,...:E V' ' L N '.Z'L31f- S?15'-fig?"- -1., - 1 f., 11,1 11,1 , 1wgX I -'W -fi , ii 1 .qw 1- 1 was 1,11 " ' 1 'z'-1,25 nl q,j1"" -' E-'L GT ij. Q - 11X 1 SLUYALTYE E. W111-11 1111131111001 T51-'RN-fy W S Nw Wm 'mmf2sa:1'2:2a3S?zJ,Hb-'- K. ' f 52' Q19 -,X T- W an 'HURoor.oFLueus, 1 W- 11 1 1,1 Unwer, 3 'X j9UE1m-rev 1-X 'AsxA"5 .5 LEADS CHEEHS Fgg S-UT-5 - wx 1 1 yxuws cvwc1sm5ixQ ax XXV Q3 gg? 7' NNW M we 1,111 ,111 1111 1Q.1Xf- 8,169 n,.f?jj?j'm-my.133 , 1 I 1 V , xf,Q 5 1. 11:.111tZ:T:'-:':1L A X1 an 1551 jst F W, 1 1 1- .11 Q1 1 rf' 1' 0 111' - ,,11fUf v' Ln' ,Tw Q 116 D 1- .11-'1.V'11 Ki 1M'.11Q -'- . w- 31- 1? .Pie W1- .1- v,.gx,,.1. K 1-' 11 -111- ,. 1-3.11-'11--X' . 1 KSN.. ,. ,, 1 N --v or 11 Uflsler Dem 1 1115-I3-3311 4 W ,,, V, R1 .611-9,1-9Q.dw5111. .1,k ents 3 Ffarin . JP' ,,-'A 1101111 X", "'Y'gfn 111121111213 1 culffllnay n '7' Siu. 10 11. r,vivh1,1-M11w 111h111111..,11, HMU11 ,man van D, U .11 ' 11 ' 1 11 1 ,Ll-l111111..1 1,1 5, S ale Affair ll- 1111.1 1 ,NG S 1 21 K ,'1f"i111- 4' 1 1.11.1111 11- v 1. 11-fl sv" 11 1111 XX H3559 QZSX 19.8-Q' WY- Sxyikmnx Yami-5 xgfinffvm QMS YA ,,- azsxoanrs sa 1 hm m1 1, X111w1v11n111s1 f wxsmmsxuxm owen roman P nuns uusnnc, nu ff: mu as LA ron: can cwv-rx n u-v -111 1111 1111.11 11, 1-1-111.1 1- 'rn . w 11 1.111 ms .. . . 11111 11111.-.s1.1. 11- 11 1 :Ls a. :1,-- 1111 11.11 1111.1 11111111 111 ,011 11111. .1 -1.1 ' 1.111.,11-11.111111 111-.11 11111111111 111 1.111.,11.1111 11 5111, of 11-111111111...11111:1 1 11, 1.1 w1.1-11 111 1.1 H65 TS- 1 1 1-1. 111-1,1111-1.1 11,. 11. ... 1 1111. 1.11 1111111141111 QMYY 1 -5 Y YOQXY P390 X '-:,:"c1.1 X .1,,,,,, :mer-.,"::::r:.,r::::":, 511111 153, "m::'.xu1':':-. .1 111,11 1.1 1114 r 1111 T'f'1kX1 110111 11 R 1s,2Vb,:,FQ,, ,,.'.,,4k 1 , G " Q' Q WZX1-5 a 11- m11M -11111. -1- 11111. PA LL? W 7Rlo11c S 1.114 1111 ,7 0NGs 1, " -n-11 " h .1 f.,f,,j--'-1T1'N 1-Lili' --1- .M 11 n11.,,'j:--1 ,,, If-1.1. mfg 1, , X QL 1 Q, 1 -1 -1 11.1 , 111. 'fu - 1-A111 'm ,, 1--11' d'-11T,"n- 11.2"--1, ii".-S 'fy-11 11.1 1 .QQ V n lf' ' 'v 1 1.4 1 sy 11.,. ,D T1. "'--.,g'-11... Lf---11"1,'g---1.1Z'.2iZ"' QV ,v,,"1,"g,., . Q 11, - L' 11.5 0-225,11 1, --wa? 111 -1 .2 , 11 f 1 , A 11 N -0.1 Y'-- ,1,.,, 4 G 411.4 q.v,x.1-- 114111 m"K7w1. 11 1.1 , 1 1 0 , 1 1. , 1 , J- .1 N11t1..1,,,H' G-1111. 11-. 1 .1,.,1 ,f,,v.1"Cn1:1111 11.. 1.1 F U ,J 11.11lr:,, N , 1 11 A5 Amr UF BUNTEMFT41 'Z 23 4- 6- 4' 0 -2 fr- 0 '96 2, 45, Ach I fe QM, J, I: 21551,-1,V1jg.Q,25j13,,1,X 19-Q ee , 4,00 fx I J' 0 Lui-fh?:' 4Q'w -'x . N. -1- , , - V- 5' 'E aeffx .,,z'?',4f 1 9 5 0 1 '9 f 11- . 121-1111, 6 Wg "e"1'1r-amz -'11 Q21-.'f11.f :WML , L 'f-1-Y-',-:xi 0'2- ' fe 'Zi' 49 11 I ,ffm 4 0 239 eff 44:15-+1 4 "-v " w,1f,1,1r1,f-, . 6,04 Q F S 1 9, di'9,9t4' 'iii-.L1., -414 f ve. 14-.4,-neg. 411,-1 gf ,. ,- 951 'aaa Q, 4'3?,'q, QI. . ,M . , ,,,,,' his fa-M,-, 21951315.71 -45, 'SJF11 -' - any 4, - U94 , ,-. ae--A .f 1.1, . , Z-if 1 --if 99 I , 1 ' '14 ' 5 cr- '5 If 61? 'f?,f'v'a 'hiv ' ' 51 2 I 4 Q 233211, -1 . 'b,LWCk, 'Vw av ., I kv -4 5 "Q,S'4--,Tx ",2'Lf'."2 '1 0-m1f.'1" I-b:,c,,,., . 1 1,,c 'eu' . . M5 'wad 0 fs, ..1r-451-., eo '01, 00, HW- 417 , I J ' ,-1-2.-we-1-'i-"1X '-1 off "M 'f U04 341' "fi-1 W 00 f 1. W. ,W11 Qyfmi-,Z,Za-,f1Qi,'1,V:tf..,5 . .1 -:1 fx 1-.1-1:-MQ1'-:f11:.,w4:'.1--1 4 ' Y1 1 1:-I3--J-.-.-1'--12"-K-I'1-1-:Q' xx . l v.,,e.,,:.4,q5:1,s,.,q ,avsgvv ,X X . ,' A .ue Q,,,o,,,eQv1L.,v, 2, .311-if. f Wa - fn?-1: 1.1-215' '-'-z2f:2:w--2-f W Q x W- 'Q G1-iif-tr? W K' mm K .1,,1.1.1. .11 1111,..1,.1.1. I H' 1 1111 1- ' ,ku 0, 11, ,L 1 N ' "S "-f"'71"z'.',,:,,151 f 06 S 'wa X -1-:111111111111l N . .1111 11.1.1 1 9 9111919 4 1111111 1 Z m I Nw? 11.5.1 111. 1, P'-'X"'. --' 2111- -1-11. .1-1.11111 1. 111 5...-ww fm., 1-6yL.111---,fx,,,,1,1- 1 11... 1111.1 11. 111. 1 W,,1.1 1-QWA1.-jg nm 11- A-911.1-A 111 11111.11 1 1 X' -1.1.1-11.111 .va --Bw 111- 1 111 111- 11111. 11111 ' uv' ,,111"' ,,f111:1- 11 11.1.11 X " ll LL In 1 1 -1111 1111 11 1111.1 111 1119 we 11.11.11 .111 111 W2 Wu' , 91156-M ,..1.., .1 111.11111 111. nd luv! s 111-1 L. lawn 1 r 21 111111.11141 11:1 W1111-111111 111. 1 5.1.1111- 111111111 11.1 1 1111 x-111111 111- --j,,..11 Q-g,,,1.1 M I 'X' ' ,.1.411 11.11 11 - ...11 1 1- .11 E121 . 11.1115 ,.--- 4, ' 11:1 11: 11 ,1 3.1.11 '.11.....1- 'QS .111 Q' ' 1 111111. . 1111-V' 111041 - .xv 1 m,,,11 A V, ,,. 111111111 ' nb 'N ne an W1-A111111 non' 1 lou! 1 A1111 11 111111 1 1 11 111.11111 1 1411 1111 1111 m 11.1 4 11,1 n 5 1 1 -11. -1111. -1111, 11. 4 -L 1 wx. '3"'. 1 111 11.11 1111 U 11.1. '1111,.Q" .1111 01.1 -I 1.11 'ff 11,f "' 1 --11 111.- 11. 01 11111 1111.1 11, 111. A11 . 11111111111. 1 K 11.1 1.1. .,, .11a- ,,11w 1, 1, Q n --"".1- mn Inu-1 :haul N bonu In 1111-11111 111 ma 111111 , 1. ..w-" 11114. W w wx 1 1 K M' 1 -1 ",?.1.x 11111101.. 11,111 111111. -11.1111 Jn. 11111 1-111 1 1 .11 11 1-.111 o a 1 my my-11111111 I 1- 'K Y- 111 ef xo ,V '11-'Q'3.1. .-A 321 '1..Y. 1- -3,1111 . -W 01111 .x,,,..11.u ,,.1f1 111 1.11.1 1111.-1111... 1 1, 11'-W 11' 111.11 1111. 114111. 111 -1111111111 04,'1f,f v D 11111 11-.,. -11111 -1 gm. vw wa 1 770 if Smvfl-fgtkos I I K 4 11 911-1111. 'J...,. 5-,111 R W 1 N M ' '1 111-1 ,5, .11 . U11 111.1 11 . ,fu-:m,,,,1a -11111.11 11111 1 11... .111 1. 1 N, vt .,111r-W ,,1111--H 1. 111 ,A 11 1 1... --' '11 -' 'fi T- A-""'T,1111fq 1111111111 'l' 1.1111111111 K. 111- "6 P11101- 1.1 1111- M111-n ,.,1n- ,,, 111- 1, 1 - ,1 1--",',.1.11w w,,.,1- 1 1 .11 11. 1, mf ".1111 U. -1.1 .-sw'--H 1 , mg- ,111 1-viwxt X LN B 1 111 1 , 11- X.1-,52 ww 5.111 3, ,111 Q 1.3. ,,,,Qu5y,.,v3u11a M ,111- WW' uv """,.. -1' 1, 1- 1- 111 5,1141 'imm- n in-45 NW' of cu.-1 ..F,gnL" xi Fra: :EW Y? 1 i 'Y Laws A , 311:11 "f"f'4', .511-1' UF fx 1 "Pl Nun l' 11? 1.1! H' "N 1. .....1, x 111.1111.E2.",i,,""-111 1....CL2," 1 , 1-1.1.1 NU, lg-1-:mm : .1u111, ,W ul nm my 4 -1-1111. ,. ' s1,,1,e,'LgffP1a1,e, X Q5 I W 6 ' -1 Meg, 4.11-,11 :Sm 1.5 R'-'Y To '1 odfyoijss ,Lx .1Lf'l'11111.1..+ 0, -4 K4 1 ,fo 1 ,1 A. -1..,oM.11.,,,, 'v 111 ,,. " 91:9 p '1 491 93.1-15-A "I 1:1 D' HI 1-1, 1 1 K n , . f-s11fc.- --1: mf- 11. ' -4 'r . , ' f f --1111.-1,11 11,11 , ... N RETMCT7 r 1- .1, 11.fY1' " .11 11.g,.Tf15l1m11,., .hu ,mt M 1.0! 1111 , 1 am A 'Wil slam. 1, ,, . ! 1.1. ---111.,qf1.1., yn, , , ' , 'uhh F lmbn. Lrrmy ,I- 1 111111 , . 11111111.1- -111, ',,.,,, le11"f' ruff I -11 11 11 ..... , .. 1.11. 11,111 1.1.1 ..,, , , 1, ,, , , .... 1. """-- 11L. . '1"- ---11. .f 1 .11.,11.1... . ,z--I xtv' rf 1 vw 1.1.11-Q,,.s:Q'5riv,1:m g.r,,k.n r , -I 111' f-1111-,I H1 D 1 -11, -1 1,,,1S,l.a.u rf. . H- N., -111. . ,ho 16' ,,1- ,-1 Y' ' 00' .X '4 11' 11-'111H"111 ' rw.. -mf" 111 , 0' N' v""w-X 41,1 -1.11, . ,,..Vv I 1111-111 11 M., 11 -1. ' m1f"' 1.11.11 . 11- 111 e-' -X . - . rf 'Y J W' "YW gy-11, yMl11'1,jIf:.1-...,K--f. 3,, 11.1 IIA. KE ll n ' PH ' ' "' -1,' 11. p-11? ww .vw ,11 "L W 41-X , 1.1, nu. 1 11111-1, 1.11,,,,3,,1. X, ' 1 11 ,. . 1-11.1..1.., , 1 1g . -1 -4 " '--I-:1111..1. "A Y -- 1-111 114 1.1. gli.. 1 ' ,, ' 111.N'h "I-111, ""'r. 41-1-,1 1 v",1-21111121 gl , 11 I I 1 my k1.,,-1.1-. ., X A 1 :Tn-11 .mu W-dv-1:11 1.1. -f111.,,,t-f.1.., l7.,,,,d ml 1 . 1. K 41121 -111," 11.1,,, 'M 1'1" Nzvfgigjcwuus- 'Nw or men ,111-,111-x:,.,1.,,1N, If-.1...,n 1. ,R 1- ,11 '1-1..,, 111, 41-fu , .1 ,h .1.1.11,M1,3 KM BM: I I 1 I ' 1 ' H-Q1,, ,1-o 111 i 1 , 1-f'2.11f' x1f'z,1- 11J,,'- 1... X--3,11--,1. -U11 ,,,, fy-1... 211-"'1.111'7 I .'-- - J""--- 1,1110 . ,QL-1.1. W M , Wm N .ii-111 " ---11.1 if1:1,1,. " L 11, ,gl-111 ff., 1-1 ,A -'1 . un., 1.1. 11 -11.1 N1 1 --1. , v,1,, 1 lm., .1. .r.,, ,W 1 2-1 ,, 111, .f,f,Q---1- ....111,,,, H-1. ' -H 11-1, " -X--1111111 , M--1111 n-111. 1. 111.1 P muon ' ' ' :f15sonoN 'Mr-urn. W 'H' "vTmo'r5 '4 15:1-1 ' ' - 1-1 -31,1 wav.. wlwlwu .- A11 1 vnoocvznwuun ww '. 1 li, 111 , X W ,f IW 1, 1,-11, fa Q1 0 11,50 WW v'2"-.,"f- -11 I- X afar ' . WU 1 K h Wy' '45, N,-1 ,4- 'Rf 1-QW mf-4' ag.-as 5 f ' . 4 '41, -'ab0a:f1M fr, 1,1 ca Y, f 111 4 SWR W M. Q26 ,gh J W 11' af X 41,1 H3735 ,uf M-"" 5,1410 . H. , gl. , - M, wks 1 Ko x5n0V gg 'mea ki 9, Raj." ' 9 ww P4 M2120 NJ 4 1,-14' .,-1 5 ' .Q x i,,1.1,w, ,,, 11.5, ,. ' ' 1.1 --' '.1 F fy: ,Qu I M X E '- 11-1 Y-1 "M u fr .73 'WW 1 1-- X'.11-- "1.1 1 .11 M a3:"'-'SST-if "9 1:9 0.1 e ,1 1 , A , 11167 4- 'L .0 -110 .111--"11 ,. .lb J 'fn-....----f. 1 .1 11 1. -f ' X311-1-13.1.1 ,,.1dA,. ,nt 11- "111-1 ,.,.+1 ' A hm '1 -1153.11 .X ' "'-A'-' A x Y V 1 ffzlhflf- 'zz 111- ',.'1,,,1, - ,. 1 ,I Quo 'dr 'L1.vv:', 1 -:'v',,1114':,,,1ud, , . 1. 49+ -"" . ' 11-- use , .gx,y,L!.,. .ga K 6.11 - .1 1 1-.11 - f -y,1"1.--.11- 1-1 '.. 'QQ " .11 11,14 1-'31 v 4:1 - 111 , . 10 1 ', S Of' Mv f c .',11 I, x - 1- , -fa A 1 ,111 011: 11 7. , 1, 1 1 41 e.. EMA "fi-"Z ' 1- - 1 I .1 .11 1 s 4 1Subx3 ,11v:':A,, ,,, wo, an I 1-X 11 19 N11' . Ay N W' X A9631 4' ra 1- 11-X6 X 11,0 ,111-16, X me 1- -R 1., ' "--- '11-ffaiff-.2111 -1 ff' .11 -0 .. - A ,,,v'N.,,111M ,- v 1.01 pm f - a .' galmwlmnu , 13,21-v "" I 1 om, wg, .,. . id '- "--'-1, "-u'b.,-mkvef. "f. 1. 1, 1,-1. wb. 'h'112"ij'-.'gy . ' l - . . 11 , A N., g, 'lgfflsfl bib' T,"2-."'- Pl nh., 551. "'u. 'ff' lr. X 110131 P, F1111 91.1. 1 ,F ... .Q.,,",.,,gX 1 1.5- . Q-2 -11'-111, mf. 1 11 lf' 1""-11, 4-1 1.1'4"'. ln - 51 b 'wJZ::',," 5911 57" 11. 1-1- .1--3 V . .1 -- ', ,.1. ,,,.1 1 yy Tues K9 M 1111ef1'l BY N" W" . sm Nm Z' - - ' '. snS WWW Z WE." ....fm Y ,,.111 '1 ,111 1-nn ' ,A uw 111121 111 'N ,1 1111-- ,1 I 1 1-----3: 1-Ml 1, .1 .111-111:. 1' 4111114 1 W, 11111: 1 .1 11 - -H-::.....1l1.:' 'H ':"'i:1:1. . su-Y 1 H 1 11. '11.. 1--gf, 1,1.1.1M , 111.-. ln! :N Fun 111111. 11 -11:5 1. .1 1 5 -,, K ' -"H" ,,.111v.-v 1. 1 , 5, 0, 1,11 1.11.1111 :mn 1, A.. 11, 1 511.11 1- X M ' X' 1211. .1 1.1.1- - '- W 111:1- .11 11 1- c.a.11 rr-- 111 vu -vi-Y'f"d .1 ..... 1.1 - , .,.... 1.1 G " x nov ll .1 nl K W ,, 4, , ... 11 . ..,... 11 "' ' ' .,1.1.--1 A -11-1 5 w , . 111 ..- '::.:..1,- ,L 211131111 3:c,..,1-:inn , . 1..., . UVM 111, 1 ., .U - -J ?3:fw'1g-::--'--W W - -. - -1 A .11',.1- 1e ' ' -P, 1 11... 111.11 -- V I ,,,..1.11M 1..,,1.1 11 vm-X ,,,,,,.1,.. 1. -V-' ' ...11. 1 ,,..11..., mn .111---"' " ' ,1.1, 1,111.1 -41 5. '1 17, W 71. ,1 6-. ' -.1 , 1 ff 3 "Q-J? xx- f -'J , sig?- 1521. :- .f,,3:1I-- - -.. H1-1 ,ff ,.. 92114221 JL ' " -'1-AM '1 -- L51 lE6.TXiZ6jg-EJIXB OIXO 1' and Clas,5f5oCie'lTez5 ' W V 1 I I III I J I I IIII Phi Beta Kappa tg ,fggyvfc f 1? 4 23405 if VBJMQ 0 ,4 fgsohwff fn v W5 firm J M "'2M,3"-s EP Ag AJR! 6 if 45 'SCE , 13QZg'mf " W I1 WT I. we gg' f y W Hf',,,g522' 3445? I 5 I -I 2. I My - I Regents FLORENCE GRISWOLD BUCKSTAFI2 JAMES FRANKLIN TROTTMAN GRANVILLE DUANE JONES CHARLES H. VILAS CHARLES ELMER ALLEN FLORENCE ELIZA ALLEN KATHERINE ALLEN ALBERT WILLIAM ARON F REDA MARIE BACHMANN LELIA BASCOM EDWARD ASAHEL BIRCE WILLARD GROSVENOR BLEYER MARY VAN RENSSELAER BUELL CHARLES HENRY BUNTING HORACE THOMAS BURGESS WILLIAM B. CAIRNS MARIE LOUISE CARNS RUTH WAYLAND CHASE FLORENCE MAUD COERPER GEORGE CARY COMSTOCK MARY CECELIA COMSTOCK PERCY MILLARD DAWSON ROBERT CONRAD DISQUE ROBERT ELKIN NEIL DODGE WILLIAM HENRY DUDLEY RICHARD THEODORE ELY ADOLPHINE BIANCA ERNST CARL RUSSELL FISH GEORGE CONVERSE FISKE ALEXANDER GREEN FITE ALBERT STOWELL FLINT GORDON SCOTT F ULCHER CHARLES JOSIAH GALPIN EDWARD HALL GARDNER LUCY MARIA GAY WILLIAM FREDERIC GIESE JOHN LEWIS GILLIN EUGENE ALLEN GILMORE ALFRED PAUL HAAKE HAROLD COWAN CHEETHAM MILDRED L. FRAZIER MIRIAM LOUISE FRYE THEODORE M. HAMMOND IM6mb6l'S in Faculty KATHERINE HALL WALTER WVILSON HART VIVIAN A. C. HENMON LEE M. HOLLANDER FRANK GAYLORD HUBBARD GRANT MILNOR HYDE LEONARD ROSE INCERSOLL JOSEPH J ASTROXV LOUIS KAHLENBERG WILLIAM JACOB KELLER ALEXANDER KERR JOHN LOUIS KIND EDWARD KREMERS HENRY BURROWES LATHROP CHARLES KENNETH LEITH WILLIAM ELLERY LEONARD CHESTER LLOYD JONES ARTHUR S. LOEVENHART FREDERICK A. MANCHESTER HERMAN XVILLIAM MARCH MAX MASON WALTER J. MEEK CHARLES E. MENDENHALL HARRY LLOYD MILLER BAYARD Q. MORGAN FREDERICK AUSTIN OGG JULIUS EMIL OLSON MAX CHARLES OTTO JOHN B. PARKINSON FREDERIC PAXSON XVILLIAM HAROLD PETERSON ANNIE MARIA PITMAN JAMES FRANCIS PYRE ARMAND J. QUICK FRANK OTIS REED DOROTHY E. REID Class of 1919 Elected as juniors JAMES ARTHUR GOUGH HAROLD MARTIN GROVES GERTRUDE JACOBS IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I HI?EQIIIZKEGEIYEIIPEEYIIIIIIIIIEEISYEIPEIIGHFEIEFII I Page 444 IVIARY EI REID HARRY SANGER RICHARDS FREDERICK ROE EDWIN ROEDDER LOIS K. M. ROSENBERRY HARRY L. RUSSELL FRANCES ELLIS SABIN XVILLIAM AMASA SCOTT GEORGE CLARK SELLERY ELMER LOUIS SEVRINCHAUS FRANK CHAPMAN SHARP GRANT SHOXVERMAN MOSES STEPHEN SLAUGHTER CHARLES S. SLICHTER CHARLES AUGUSTUS SMITH ELIZABETH ANITA SMITH HOWARD LESLIE SMITH HUGH ALLISON SMITH WALTER MCMYNN SMITH SUSAN A, STERLING ASA CURRIER TILTON WILLIAM TOTTINGHAM WVILLIAM TNVENHOFEL EDWARD VAN VLECK RICHARD VAUGHN GEORGE XVACNER OLIVER PATTERSON WATTS NVILLIAM WESTERNIANN FRANK ERNEST WILLIAMS WILLIAM H. WILLIAMS ALEXANDER WINCHELI. MORTON OWEN WITHEY LOUIS XVOLFENSON KARL YOUNG CASINIIR ZDANOWICZ CARL LEMM-MARUGG HELEN B. SMITH MARGARET SPERRY I I II H- ImmImIiimiiiiwimmn InnmInmiInIruiiwumnImInumInIminiIiimuIimmuinmmi mmInnwInmimvInImIIIIummnumiInImIIIIInmiIimmiwummIninmirInmiIIIImmmImIIImimiImIninInuInumInIIIIminiimmiinmiImmiInIIIIinummiumimiinuu miimiwmim IIImnIImIInmimiuiIIIImrInIII.miIiwmiiiiiiiumm IIIniIuiIIIIIIIIIIIWIIIIIIIII I1:IIIIiiwimmiimm Iiiiiiiiimuwiri I I II III. I Irivm min mn InIIInImmnInIIIIIIIIIImIIII.wI.I IwiimiuiiviimiiiuInmiimimmIumumImImInvimIiiiiimiiimniiimm mymyIiiimmmmiiiiiimmmiiiimmmm..IiimmninmiimwnmiiumiminiIumiiiiimmmnIIIIIIIIIIIIIIIIIIIIIII mumnmiInInnInIiiiiimiinnminiiiumiIiiimiiuminmiin InmmmiIInmiimmiInumuiInIInImimunimiiiiuIIIImumIinimmiInmiInvwuniimmiiiui.nw.InmmIu Immnwimwiiinw IInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ImmmiminimumIiiiiiwmimiiim Honorary Engineering Fraternity T B P ' au eta I Brenner Werba MURRAY CHARLES BEEBE EDXVARD BENNETT O1-IN GURNEY CALLAN OBERT CONRAD DISQUE PETER FRANCIS HOPKINS FRANZ AUGUST KARTAK LESLIE E. KELSO LLOYD L. CALL RAY E. BEHRENS DAVID -I. BLATTNER HERBERT GLAETTLI ERWIN C. BRENNER PAUL IWIUNZICKER Blattner Koehler Wise NVOrks Behrens Peters Warren Glaettli Schmidt Ragatz Stern Members in Faculty OTTO LOUIS KOXVALKE JESSE BENJAMIN KOMMERS NVILLIAM SPAULDING KINNE EDWARD ROSE MAURER DANIEL WEBSTER IVIEAD -JOHN ALEXANDER NEWLIN JAMES DAVID PHILLIPS Members in University Graduale 1919 Elected as juniors JAY E, NEWTON LEO J. PETERS, JR. Elected as Seniors WALTER A. KOEI-ILER EMII. F. STERN I 920 Elected as junior ROLAND A. RAOATZ ,- :Urn YU-1 i "i- I x .D 4, C Joi-IN REESE PRICE HALSTEN BERFORD THORKELSON LESLIE F. VAN HAGEN CLAYTON NORMAN WARD JAMES WEBSTER WATSON WARREN WEAVER MORTON OWEN WITI-IEY ARL F. HAYDEN ETHAN W. SCHMIDT GLENN B. WARREN EDMUND M. WISE EDWARD O, WERBA LAWRENCE P. WORKS ............................................................................................................... ............... .. .... ............. .............................................................................................. .................................................................................................................................................................................................................................................................... .................................... . .. .... . I IIIHIIHHIlilllvllnlullullulwlilllirlullwlvllxlinIlllllulllilluluvlvlll M 4""'m"W"""""' vmIIIInmiIIIIummmimmnuInuimiIIIiInIIninIIniminImmIIIIIniIIIIII.ImIIIIIIIInInmiInIInIiwimiiimiimiiIImiInIIiimiuiiiumiiiuiiInIIIIIIIIInIIIIInInIInumIIIuiInIrumiInInImuumimiiiimmiriiiiiiiInmmiiiIIInIInImInIIIIIIimimmummIIIIIIIIIIIInImInnmIIimIIniIInImIIIIInII.IIIIIIIIIIninIIimimmumiiiiiiinum 'mimi nIII..wIn mnIIIIIIIIIIIIIIIIIIIIIIIIIIIII WEEE? Page 445 a s a s 32 Honorary Agricultural Fraternity Alp ha Zeta Founded at Ohio State University, 1897 Wisconsin Chapter Babcock, 1905 Number of Chapters, Z4 Wallin Stoltenberg Caldwell Drier Clarke Reid Koehler Wilcox Smith King Anderson llflembers in Faculty HUGO WILLIAM ALBERTZ ALEXANDER SEPTIMUS ALEXANDER STEPHEN MOULTON BAE-COCK GUSTAV BOHSTEDT JOHN WIl.LIAM BRANN DONALD ALAN CALDWELL EDMOND JOSEPH DELWICHE EDWARD HOLYOKE FARRINCTON JAMES GARFIELD FULLER LAWRENCE FREDERICK GRAEER EDWIN BRET HART EDWARD GEORGE HASTINGS GEORGE CALVIN HUMPHREY JOHN AMBROSE JAMES EDWARD RICHARD JONES LEWIS RALPH JONES JAMES GARFIELD MOORE RANSOM A, MOORE! FRANK BARON MORRISON GEORGE BYRON MORTIMER GEORGE FREDERICK POTTER HAXRRY LUMAN RUSSELL l'IUGO H. SOMMER HARRY STEENBOCK HENRY CHARLES TAYLOR EMIL TRUOC RICHARD ENGLISH VAUGHAN JOHN CHARLES W ALKER HARLOW LESLIE WALSTER XVILBERT WALTER WEIR ANDREW ROBINSON WVHITSON OTTO REINHART ZEASMAN JAMES GARFIELD RAILXVARD Nlembers in University Graduate School ELMER M. NELSON ELMER R. CLARK ALLMAN V. DRIER WILLIAM H. E. REID J. ARLINGTON ANDERSON C. HOWARD KING 1919 1920 71 E A MELVIN F. XVAGNER HUGO A. STOLTENBERG FRANKLIN W. XVALLIN ARTHUR N. XVILCOX WALTER B. KOEHLER XVYMAN S. SMITH .. . .IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIM' we II..I.III.IIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIII II III: II I II II I II IIIII IIIIIIIIIIIIIIilliiliiiIiilliiliiliiiiiiiiiiiiiliiiiii1Elilii1liIIIIIII I I 'M Page 446 I I I I I I I l I I s Honorary Chemical Fraternity Phi Lamba Upsilon Founded at Illinois, 1899 Wisconsin, Beta, 1902 1' I L.. , I f rf STEPHEN M, BABCOCK HAROLD C. BRADLEY EDWARD B. HART LOUIS KAHLENBERG OTTO L. KOWALKE FRANCIS KRAUSKOPI-R EDWARD KREMERS VICTOR LENHER E. DAVID FAHLEERC CARL F. HAYDEN PHILIP J. HICKEY CLINTON KLEVENGER ALFRED E. KOEI-ILER ERWIN C. BRENNER HAROLD C. CHEETHAM MINC-HENC CHO EVAN P. HELFAER FREDERIC A. HORTON 1 s I C' IS GT fjf Members of Faculty JAMES H. XVALTON, JR. Members in University Graduate 1919 C. N, HATTLEBERG 1920 ROLAND E. RAGATZ I.II..I...I.........i....iI.,I..i..I..I..II.,...i..I P a g e 4 4 7 A. S. LOEVENHART JOHN MONTGOMERY F. B. MORRISON JOHN L. SAMMIS H. A. SCHUETTE E. L. SEVRINGHAUS HARRY STEENBOCK EMIL TRUOG ELMER O. KRAEMER ELMER M. NELSON M. STARR NICHOLS ARMAND J. QUICK HUCO H. SOMMERS PRESLEY D. HOLMES CARL A. HOPPERT IRVIN W. KEEBLER ALLEN SPAFFORD WALDEMAR VELCUTI-I mmmvmwmmmlmlmmummnnmfmmnmummmmmmnummmnnmnmunmmnmmmmunmmnmummmImnvLInIu1IIInnmnnmumnmummnuqfufmmwlnllxllnvmm,nmmmmulnlmnxnggnlqlggETEHHT:nnuxIugMrgmyur!ggQfmgggwwgglwwwrmgnnnuII5553g5M5y31T.vgy3wg5g ,vg5QJQ5wMgvjygggI1ggwgggvjggg1gg2 5 E5-T""'..mmmmmmT"u1nnnT'lumnmm1I1nwI1.REWEIn-u"'NuI1.In".IfII.1..M',m."'.miREiEmimm..mmn.mmm,mlmmmIf,II11ml.-mmmmmmmmmmmnmmmllmmm-"""numu1nuIIXIIuIIuI11IIrvII1mmmmmnwmmn1II1mumm.mnn"".m.mmummmmmmmmmumInmnmmnmmmmJInmm,.mmmT"m..m.mmm..nn,mumumnmnm1II1I1mI1.II1II.1ImmumrumI.mmnII1mnImImlurmmIn1ml1mmmmmumlm.-run.Hung E 255 Honorary FOFCHSICS Fraternity :EE 522 E55 555 555 EEE EEZ 555 1,2 Delta Sigma Rho IW embers in Faculty ALFRED P. I-IAAKE ARNOLD BENNETT I'IALL 4: JAMES O NEILL JAMES F. A. PYRE Members in University JOSEPH B. BEACH LEROY J. BURLINGAME HAROLD GROVES FRANCIS D. HICSON JOHN C. WARNER EEE 3 gummmJ1mlmmyrmnurmKmummmmumvmH.JmymmlnuInmm..rwumm.mmmrInJ.mmU1mmm'1nm-mmummmIn1In,mmnumnnJmU.mm..m1.HW.mmJmrmm1m1InmJufmlInrmmnnm1.Hfmummm..m1mm1umm1.1InyuJH.H.ummmH.mum,HrmmH.vm1Inmm,mm,fmInmmmmum1InmmmmlmmunmlmnmumummmnmmmmmmnmummnIII1H1H1muummmn1nmummummummummmlmummmfnurlmmnEE 5 I ..,...,.....,..--,-.-,...........-........ L... ......,.. .. L.-..-..,-...........,....... ..,.. ........... .,.. -.-L .S..,.. .. ....... - .,..... . ...... -L ..... -.,.- .... ...........,. - .....-.-............-.-..,....- ,,... umm numwmwannuwvmmlmumnuuwunnnmmmmvIn1mmwInumnmummmumwmnmm.mmunmmnumm1mnumummunannu:mmm1nmmmmunmwnnruwuwnumnnunInnnnmum1ummnwnwInwununwImmulunnnmmmunumnumvuu11nuanwInummvuvmmmvuwufwnumannumnumnnwunnumnuummunmuunmII1xI11II1IInuuu1IIn1mnmmmmnmlmmnsmmnmuun1unnumumnumuunvmnummnnumnmmnunummumummnm P a g e 4 4 8 mn-mm-mwmu-.mmmm .....m.u .T .mn u n nm u mmmnmnmmmuunm m n mnmmumuml un In un " " ' ' l ..n....,... ..L..,,.,,.,,....,,. ........,,.. ......,,. ' ' " ' ' Honorary Commerce Fraternity ' Beta Gamma Sigma Vanden Braack Cot frcdson Edwards Pease Edwards Linchan Frochllch Kellogg lvlalzahn Gardner Scott Adams Gilman Elwell l-lag den flflembers in Faculty FAYETTE HERBERT ELWELL STEPHEN XVARREN GILMAN EDWARD HALL GARDNER XVILLIAM AMASA SCOTT Meznbers in University 1919 GORDON DALE ADAMS HENRY LAWRENCE GOTFREDSON JAMES MATTHEW HAYDEN I 920 LEROY EUGENE EDWARDS RAYMOND DELOS EDWARDS RAYMOND FRANCIS LINEHAN WALTER ERNEST lVlALZAHN GAIL VANDEN BRAAK HAROLD LANFROM FROELICH FRED CONWAY l4ELLOC-G HARLOW HEATH PEASE Q A 'i 21 Q, I' T A v 'ii ff?" K..W.w..v.-T..W.T.UT..m.mu-ww-NIT mum umu u mul u TnTwmTnmnmummmunTnmTuTTuunmumuuwm Page 449 mmuummIunnnIImIIumIIImIInmIuIIInImnIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII u I unz In n I n n In n n In un nu I ,........,...,.......................,...,.....n......L-..m.... ....:,i......i,?......... ...... u...... . ...H 1 1 ! l....T.... ........ L.. W u ..,.......,.,...... ....... ,. ..... ............. I In I 5gumnnnummnunnxnummmmImImnnumnIuunmmumImuImnnnnmmInIm Honorary Medical FraterniLy Sigma Sigma new xx ,Jn ggy. ,D ff, ,, L. fABWwfm .f t l5?g.,.,B1f Members in Faculty CHARLES R. BARDEEN HAROLD C. BRADLEY CHARLES H. BUNTINC- WALTER J. MEEK WILLIAM S. MILLER F. C. RINKER PAUL F. CLARK JOSEPH S. EVANS J. A, E. EYSTER O. LARSELL ARTHUR S. LOEVENHART G. H. ROBBINS W. SALANT BEN H. SCHLOMOVITZ W. D. STOVALL ROBERT VAN VALZAH Members in University 1919 KARL K. BORSACK WILLIAN1 C. LARKIN WILLARD A. CHIPMAN EDWIN F. SCHNEIDERS JAMES A. GOUGH ELMER L. SEVRINGHAUS GEORGE H. HOYER WILLARD M. SONNENBURG C. J. NVHITE 1920 CLARENCE E. BACH R. KENNETH IRVINE BEN G. BRICKBAUER HERBERT A. RAUBE ERWIN J. HABERLAND ERWIN G. SEYBOLD VERNON J. HITTNER HERBERT B. XVRIGHT A .... . .. ....... ... .... .... ........ ... ..... . . . . .'asIsisInan:zzInIssI:azsasIa:szauazszzsxazvzazszzx ... . . . IIITHFEHE... Page 450 I - .,...,...., x Honorary Electrical Engincvring Fraternity Eta Kappa Nu Founded at Hlirzois, 1905 XWisconsin, Theta, 1910 XVISC Scott Hantzsch Blattner Knoerr Lamont Scigcl MURRAY C. BEEBE EDWARD BENNETT ROBERT C. DISQUE DAVID J. BLATTNER TOWER W. KING JAY E. NEWTON RALPH E. I-IANTZSCI-I ERNEST A. KERLER NVorks Peters Members in Faculiy JAMES W. XVATSON Members in University 1919 LAWRENCE P. XVORKS 1920 ROBERT C. SEICFL .amwwwwv eg .2 X f'.f'WT S ' ,ff WIN R, Q I rgg 'T'L YM Q 5- x 9 Q- 'wp.w..A 1 N67 xxdfxw Q IIIIIIIIIIIIII IIIIIIWIIIIIIIIIIII IInIInInumm-.IIIIII.IIn.IIIInI.III.IIIWWIIIIIIIIIIIII Page 451 Kerlcr Kmg FRANZ A. IQARTAK ERNEST O. A. LANGE JOHN R. PRICE LEO. J. PETERS KENNETH L. SCOTT EDMUND M. WISE RUDOL.PH R. KNOERR DALLAS R. LAMONT IinummmmmmimiimmiimimmmImm -I.. I mmimimimimmiiiimIimmuiimii I II In II Imimnmiiiimiimm W. ----.--A-............-M-.........--.........-...........-................. -..L..,.......... .-.,,- ',,..-...........,..... l' l Honorary journalistic Society Theta Sigma Phi Founded at the University of Washington, 1908 Wisconsin Chapter, Beta, Established 1910 Tener Briggs Kleveri Pine Pettibone Vinjc Collins' Ludlum Robinson Heise Whiteside McDonald Ojfcers ' KATHERINE PAGE WHITESIDE . . . . President I-IESTER ROBINSON . . . . Vice-President ALICE V. PORTERFIELD . . Secretary LOUISE LUDLUM . . . Treasurer LOIS MCDONALD . . Historian ETHEL VINJE . ..... . Keeper of Archives Honorary Members WILLARD GROSVENOR BLEYER MRS. AUBERTINE XVOODARD MOORE EDNA FERBER ELLA WHEELER XVILCOX ZONA GALE l'lONORE WILLSIE Active Members Graduate lVA KETCI-IAM BERNICE KUNEY ' 1919 FLORENCE COLLINS HARRIET PETTIBONE MILDRED EVANS JANE PINE LOUISE LUDLLJM ALICE V. PORTERFIELD LOIS MCDONALD l'lESTER ROBINSON BERTHA OCHSNER KATHERINE PAGE WHITESIDE 1920 ADELINE BRIGGS GARNET KLEVEN FLORA l-IEISE ETHEL VINJE ESTHER VAN WACONER 3 ' 9. 1 -q W :"L'm'L l""'i"'""""1'l"i":"""' '""""""sf'l'i-"i'iii'i ' ' ie Page 452 IIIIIII: E E v'z1:11un..... II.,19:I21:I:Il:u:2uI:!::..,.,.,..... ' I --IIIIIII 5-g.......,.. ...II II......II.I.I..II.I. I I I I I I :zIa::I::a:::I::Qgg ess E EEE E . E E : E 5 Honorary journallscnc Fratermty I . 2 Es E E55 EEE Sigma Delta Chi IIIIIIII IIIIIIIIII I S7 E D sn. N Q. Q A U N 'U In s: S CI E C. N 5 2. Z? ,SA xo Q NO III III IIIIII IIIIII IIIIIIII. Wisconsin, Iota, 1911 II Ei: . EIS EIS 52: s I I I Q.. E55 z: EEE sis 'EE " Members in Faculty , E WILLARD GROSVENOR BLEYER GRANT MILNOR HYDE WILLIAM ALLISON SUMNER ' Members in University s Graduate If FREDERICK W. INACKAY , 1919 a EDWARD L. DEUSS JOSEPH R. FARRINGTON I WILLIAM E. DRIPS JOHN L. KLUG JOHN R. RAMSEY E 1 920 HAROLD A. GILL LINCOLN A. QUARBERG E BERNARD E. MEYERS OWEN L. SCOTT BERTRAM G, ZILMER 5 E 5 55 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIE 2 K EEffW1'!!E!iL......,.!T1'l!f5T3!1."3l!T2!'.'."......""''!-M...,...e.....,.....L.---..,-,.,.-2..,, , .. .. .. ' M' """H"U""""""""""""""""""""' :.nIIIIIInIIIIIIIIIIII II I II IIIIII-IIzI-QIIIIIIIIIIIIIIIIIIII II II I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I II II I IIIII I II-IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 453 Honorary Economics Fraternity C34rftus Altmeyer Elsom Chu Ferger Hsieh Kiekhofer Ely ,Krueger Perlman Chapter Roll Wisconsin Harvard University of Denver Washington University of St. Louis Honorary Nlembers PROE. JOHN R. COMMONS PROE. RICHARD T. ELY PROP, WILLIAM H. IKIEKHOFER Members in Faculty ARTHUR ALTMEYER LEONARD B. IQRUECER KEATS S. CHU Active Members BERNARDO W. ELSOM XVIRTH F. FERCER HSUEH HAI HSIEH HARN'EY J. XVEISSE K i ftfl 1 k :Q K, A... .... ' L 3 .,,. . V Page 454 ELBERT W. JONES RALPH IQARCER JACOB PERLMAN HAROLD W. REED 1' ' ' ' ' ' ' ' ' ,. "' 1 ' , I II I I II I I I III II I 5 EE EI E I I E Ez I BWIARCUERITE BEATTIE FLORENCE GRAPER BETSEY MADISON . Nf1AE GROENDYIQE . ELIZABETH AMERY CORA BINZEL AGNES BOEING IVIRS. CLARA BURHOP EMMA CONLEY MAE COWLES ELSIE LEONARD MARCUERITE BEATTIE FLORENCE BEATTY RAY COOLEY LAURA FAVILLE Honorary Home Economics Society Qmicron N u , s ,A I '24 5 ,A- , I ' ..6O" :LQ 551 Q 1 Eta Chapter 1915 I Ojfcers A46I7'11D6l'S in Faculty President Vice-President Secretary Treasurer JEAN IQRUEGER BETSEY MADISON HAZEL IXXIANNING .ABBY I-. IVIARLATT MRS. NELLE NICHOLS DOROTHY ROBERTS CELESTINE SCHMIT M6mb61'S in Universiziy 1 91 9 ADA VAN STEENEERG FLORENCE GRAPER MAE GROENDYIQE MARGARET HUTTON ELIZABETH SUTHERLAND E 1 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I F1 II In I II IIII I I II II I II IIII I IIII I IIIIII III I II II IIIIIIIiiiiiiiiimiiiiiiiiiiiiiiiiiIEIIIIIEEEIIEIGIIIIEIIESIIIIIII I I III II I III M IH H Page 455 J 11111111111111111111111 111111111111111111 11111111111111111 11111111111111111111111111111g11g1!111111111111111111111115111111111111111111111 111111 11111111 1 1111111111111111111111111111111111111111111111 1 1111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111uu11111111111111111111 11 1 1111111111111111 111111111111111111111111111111111111111r11111111111111111111111u111m11111111111111111111111111111111u11v 411111111111 111 111111 1111111111111u111111111111111111111111111111111111111111111111111 111 11 111111111111111111111111111111111111111 111 11 11111111111111111111111111111111111111111 11 11111111111111111111111111111111111111111111 11111111111n1111111111111111 1111 1 11 1111111111111111111111111111111111 11111 11 11111111 11:1 1111111 :11111 1111111111111111111 ' Honorary Mechanical Engineering Fraternity Pi Tau Sigma Nelson Larson Corp Berggren Bellaclc Mueller Williams Warren Phillips Schmidt Gaubatz A. E. BERGGREN J. G. CALLAN C. l. CORP Members in Faculty 1V1ember.s in University 1919 WILLARD B. BELLACK EMMET J. IVIUELLER EZTI-IAN W. SCHMIDT 1920 ARTHUR W -GAUBATZ A f515Q1. 1 111111111111111111 1 1111111111 1 1 1 1 1 111 1 11111111111111111 11 11 11111111111111111111111111111111111111111111111111111111111111111 111 1 1111 1 111 1 1 1 1111 11111111111111 1111 1111 1 1 1111 111 11 11 1 111111111111111111111111111111111111111111111111111111111111111111111111111 Page 456 A. L. GODDARD G. L. LARSON I. D. PHILLIPS EMIL F. STERN GLENN B. WVARREN EDWARD B. WVILLIAMS DELMAR W. NELSON f iz ... 4 4-I Q livfhmfyf .Q ,.- , U 5 ' Z , 1, 1 11111 1 111111111111111111111111111111111111111 1111 11 1 111 11 1 11: 11111111111111111111111111111 1111 1 11 1 11 11111111 11 1 1111111 Stern I I I I I Honorary Athletic Society Star and Arrow I If Nlembers in Faculty THOMAS E. JONES MAURIGE A. KENT ERNEST O. LANGE GUY S. LOWMAN CARL P, BAUER CHARLES H. CARPENTER BERNARDO W. ELSOM LUGIUS W. I-IIPIQE STEVENS COULD I'IAROLD KNAPP RONALD W. RAMSEY 1919 1920 JOHN R. RICHARDS FRED E. SGHLATTER .JOSEPH C. STEINAUER GEORGE T. BRESNAHAN HAROLD C. KNAPP ROBERT IVI. SUTTON EDWARD B. WLLIIAMS KING G. WOODWARD ALLEN SPAFFORD GEORGE E. VAN HAGEN FRANK L. W ESTON ANTHONY G. ZULFER 1921 MILLARD M. BARLOW PAUL A. KAYSER RUDOLPH H. BLATTER WILLIAM H. MATCHETTE CLARENCE W. IVICINTOSH IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIImmIInIIIIIIIIIIIIIIIIIIIIIIII Page 457 I I I n I in I u I mu iiiuimiiiiniiiiwe uiinliiiiliilikl CO. A CO. B CO. C CO. D CO. E Co. F CO. A CO. B sas Honorary Military Fraternity Scabbard and Blade Founded at Wisconsin, 1905 llyiseonsin, Company HA" Number of Companies, 17 Living Members, 2,000 Hammond Slaker Rewey Melnherrin Slichter Atkins Creenslacle Tuttle The Brigade First Regiment Wisconsin University lvlissotiri University Minnesota University Pennsylvania State College Cornell University Washington University Iowa University Michigan Agric. College Purdue University Kansas State Agrie. College Illinois University Ohio State University Second Regiment , Iowa State College 'W. Virginia University Arkansas University Maine University if CO. E XVashingtOn State College !V1embers in Faculty MAJORJOHN S. WOODS, U. S. A. VAN L. BOHNSON CAPTAIN THOMAS E. JONES, W. S. Cv. HENRY A. SCHUETTE LIEUT. WILLIAM C. ATKINS, W. S. C. Members in University 1919 MARCUS LULING BAXTER THAYER ZACHARIAH CLAYTON ' IRVINO JONES GREENSLADE TI-IOMAs W. TUTTLE I 1920 LORING THEODORE HAMMOND DON V. SLAIQER 5 JOHN W. MCPHERRIN ALFRED H. TAYLOR ROBERT LIVINGSTON REWEY H. GORDON TAYLOR f 3 .. 'K 1.151 -' JSE fi" 5 EiE53iii3EE3EEEliiiiE551iiiiiiEEE?E5Ei5El5EE5i5i..,..,. I I I .I .., Page 458 gummmmlrnmlmm.mmImmImImImInImIIIIIIIIIIIWIIIIIIInIInInummInIIIIIIIIIIIIIIIIIIImunmmrv-IIIIII,mmIm-.II-.ImIm-IIIWIIIIIIIIImm-IInImIInInmm.ImImInfmInImImInnumImmfmnwmlmlr.mmmmm.Imm,ImmImmmIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIW'mmmm.mmImmmm.nuIInImInImInI.IIImI-IIIIIIIIIIIIIIIWIInIImmuyInIInmIIIIImInIInnmlmumImIIIIIIIIIIIIIIIIIIIIIIwrnummy-IIIIIIIIIIIIIIIIIIIIIIIIIIIIWIIIIIIIIIIIIIII--.II-IIIIIII-Ig 5 gum..m.m.mm..IIn...mnIm.IIIm...I-I.mmmI.mImI...IIII.-II....mmImI..mmm..I.HWIIIII,IIImuIIn,IIImInIm.IIIII.I.IIImIIIII..Inm..IImmII...I...I..I.Im-.IImIm.IIIm..IImI..I.IIIm..mmI.m.mmm.ImInIIIImlmIIIImI--WMIII.IInIIIII-IIInIm.IIInII..IInInIWImummmInInI-InIIIWI..IIIInIInIInInI.IIInImI.mnmrInImI.IIInmm-IInIIm.IIInInIIm.IIInImIIIIIIIWIIIIIIIIIIIIIIImm-ImIInI..myI..ImmmuummmInImInI..ImIIIII.m..I.IIg 5 555 255 E rg 5 sz EEE E . A E as E 2 5 E E: - :aa an E as Honorary Senior Society EE E: EE :F Ez ass E52 age 'Sz E55 -W EEE E55 355 Iron Cross -n E25 EEE -3 - . 5,5 , I L E5 iii EE EEE LEROY JAMES BURLINGAME CHARLES HAND CARPENTER EDWIN LOUIS DEUSS MILTON PETIT GRISWOLD HAROLD MARTIN GROVES ess EEE P2 E :I- EEE ass ESE EEE 555 EEE E15 EE ass :ig EEE E55 EHEMIIIHI.III.W.,III..,5I5,mm...I,,......II..-..,I.-.......,I......m.......,...II.I..,..I.II..I.IIIm...I..II..,..,...E51.m,I..I..WIIII...I..I..I.......m...,...,..,...W.,....,,..I..,I...,...,,...I..I..I..,..I......I......,.m.II..I.,.....I........,.....f.m...mr..I........I...,..N..I...III.,Im..I...IIm.I....I.I...I,.,..,,..m,..,II.m...,.......I...I.I,........III.I...I.I,...,...................I....I..W.I.m.I....m.Im.,I..I.,H.,In.........,........I...,.,.I........I.....,......,.....I..,II,..,..,...,: gg EIIIIIIIIInImImIunmmmunnummmmmumInnumunInmnunnnxmmInunImunummmnuvmmrumnEiIEiRiIIIiYuImIn?mlIi?EiillmiilmliliiiGiimiiiiiihxununnnInmmInuiuInnmmminuunInImmnumInummImnmummuInmmmnnumummnumuIIIIIIIIIIIEIIIumunmnmnmnmmm:mumuInumuInnumIIIIIInIIIIummIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIInumnmmunnunmmmrmnmmlmIuummmmInumnummlmmIIIInrnrnmmmlmumlmnmvms P a g e 4 5 9 vu In I Inu III III: In I In rx iuux II I Inu: nn: Senior Women's Honorary Society Qflfortar Board 3-11 if Mortar Board has a three-fold purpose: the stimulation of scholarship-the furtherance of Interest IH worthy endeavor-and the increase of College activities. The members are senior women elected on the basis of scholarship, womanliness and service. LUCY WALLRICH . MARGARET SCHULTZ ADELAIDE PAINE . MARIE l-IJERMSTAD JEAN PATTERSON VIOLA PLEUSS ALICE PORTERFIELD JULIA Posr SUSAN RAMSAY Ojicers Mein bers mimmm I.III.III..IIw-IIIIIIIIII niInIIIII-IIuiInIInInIInInIuiIuiInInIInIuimmmmuiriii Page 460 . President Vice-president . -Secretary Treasurer VELMA REID LULU SAUL MARGARET SCHULTE l-IELEN B. SMITH CLARA XVILLIAMS :sux H1 I I 1 I1 nu um vu rm umm r rum nw nu unllxmnluvr1rnl1rn1un1lnu1v1un mum: 1 nn Tn: rrw r vu In n Honorary junior Society White Spades 1919 HERBERT M. BAKER CARL P. BAUER CHARLES H. CARPENTER EDWARD L. DEUSS HAROLD M. GROVES ROBERT IVI. SUTTON 1920 JOSEPH B. BEACH J. GEORGE CROWNHART LAURENCE W. HALL H. KENNETH HARLEY CARL A. HOPPERT BERNARD E. MEYERS LINCOLN A. QUARBERG RONALD W. RAMSEY OWEN L. SCOTT WHITNEY N. SEYMOUR ALLEN SPAFFORD ARTHUR R. UPGREN BERTRAM G. ZILMER ANTHONY G. ZULFER iiGiiiiiiliiliiiiimiiliiiiiiiFiiiiiiiiiiiiiiiiiiii Page 461 Sophomore Society Skull and Crescent Chapiers Minnesota Wisconsin 1Ui"l9i5 Clark Bunge Farming Bolender Manson Murdock Wakefield Kaiser Waln Wheeler Brircingham Follett Paul Harris Srolre Mmchell Royce Carver Wolf Travers Schaab Smith Pond Fagan Aclive Members 1921 JOSEPH BOLENDER THOMAS BRITTINGHAM GEORGE BUNGE HORACE CARVER BURTON CLARK ' ROBERT FAGAN LOTHROP F OLLETT JAMES HARRIS PAUL KAISER CHARLES MANSON I mlmlmm Iulmmrmmmll IIIIIIurInInInIlIIIInIInluIInInIInInIlmwrmrllrrrml Page 462 XVILLIAM MITCHELL HAROLD IVIURDOCK HAROLD PAUL THOMAS POND HENRY ROYCE KENNETH SCHAAE LEWIS SMITH HERBERT STOLTE CHARLES TRAVERS IQENT W AIQEEIELD In ,l..m..,..w.l l . gig.ml..mm.lw 1 EEE :aa 232 E55 555 225 525 iii E32 is if ggi .4 Sophomore Society Skull and Gresent Sltockey Seloage Beardsley Leaper Scott Lillieh Ivlulhenburg Holbrook Vaughn Craas McDonald Allen IVIacFadden Kinnan Chabdourn Keyser Bronson Clark Smith Purnell Stock Bryan Welles Gregg Brown Zubrocl Stevens Stavrum E Pledges 3 1922 HARRY ALLEN DONALD MARVTN - EDWARD BEARDSLEY ROBERT MCDONALD ' CARL BRONSON CHARLES MUHLENBERG 5 DEXTER BROWN WILLIAM PURNELL RICHARD BRYAN DONALD SCOTT REUBEN CHADBOURNE I-IAROLD SELVAGE JOHN GREGG FRANK SHOCKEY KENNETH GORDON FRED SMITH PAUL HOLBROOK THOMAS STAVRUM ELI.IOT KAISER GEORGE STEVENS 2 ARTHUR KINNAN DONALD STOCK 5 WESLEY LEAPER GLENN VAUGHN JOHN LILLICH I-IORACE WELLER , WILLTAM ZUBROD il? il? TE isa 55? ?lE.T!lflHlU.......l ' L............--..........-..2!5E!!ET!L ..., -,..,,.-,. .... ,.J..,.,- ,,,,v..,,JJL,,,, ...,,, ,,.,,,,,j.,L,.,, JifEHEESEHT!TEE!1T!!TE!!E!!f!!!!!!E-.,..-..-,......E....-..........-.J........-..-l-4-.lvl--A ---------A-M I Page 463 . President J v I I In I I I nr I un :nu unxum I I Sophomore Society Inner Gate Florea Fairfield Mclmosh Brindley Chamberlain Comey Grace Miller Pauly Pinkerton Gray Reps Schramm Elder Y Dorries Paddock Siebert North Goesslmg Ojicers JOHN W. BRINDLEY HOWARD R. GRACE JOSHUA G. ELDER D. VAN PINKERTON Members -sophomores JOSEPH CHAMBERLAIN FRANK A. COMEY WILLIAM B. DAYTON CHARLES W. DORRIES GORDON G. FAIRFIELD WILLIAM B. FLOREA FRANK W. GRAY W. WILLIAM GOESSLING RAYMOND F. LAMMERT LAWRENCE BARNETT JAMES R. BEMIS JAMES R. CALDWELL COLEMAN CLAGUE HUMPHREY DESMOND ARTHUR N. DONELLON WILLIAM B. ELLIS STEPHEN L. FALETTI DELOS HARRINGTON WILLIAM HIECKE DONALD M. KASTLER Freshmen 'K . 1 .RI A In I I lliiilililiEliiiiiEiiliiiliiliiiiiiiiiiiillilllliiilhl Page 464 Vice-Presidenl . Secretary Treasurer CLARENCE MCINTOSH ALLEN H. MILLER LUDLOW F. NORTH JOHN M. PADDCCK JOHN O. PAULY DONALD REPS FRANK H. SCHRAMM TAYLOR H. SEEBER CHARLES W. WINSTON ARTHUR KNOCKE DAVID J. MAHONEY BERNARD MAUTZ STERLING PETERSON ROBERT PIERCE DAVID T. ROBERTS HARRY SCHXVENKER GEORGE STOLLEY JOHN W. THOMPSON ARTHUR WATSON PAUL WRIGHT g.,.,..I......., HIAIINIAVIV INT. .H T E E EEE EYE E25 EE gfg Els EES ESS I I I s I EE :gs E I I E 15 EE si I E I E E S E 5..niiiHFFiE I I u uv war mr I I u r I III vu mum uv I I ru QfN4y5Zic Circle Nunn, .A Officers ADA KROENING . , President RUTH STORMS . Vice-President BERTHA BLAUL . . Treasurer Members 1919 LUCILE BIEBERMAN LAURETTA CONKLIN MARION BOYCE DOROTHY GRACE LILLIAN CLARK CATHERINE MUNSON MABEL SMITH 1920 JANET BUTLER MARY ELLA FERGUSON FLORENCE F INNERUD ADA KROENING 1921 BERTHA BLAUL FRANCES RYAN MAR JORY DONALDSON ,JULIA HANKS DOROTHY HOLLANDS HELEN MCCARTHY -JOSEPHINE BLISS- EDWINA DEXTER MARION DOWNING ELLEN GOULD KATHERINE SCHMEDEMAN GRETCHEN SCHWEIZER DOROTHY SEATON RUTH STORMS 1 922 MARY MCLEAN KATHERINE MYERS FLORENCE SCHROEOER ELIZABETH SNIDER ELLA HULL ALMA STRAIGHT EVELYN LEE ANNA VAN ARSDALE 'T' "" 1 """' I :seanaffIEfffaffffiaszaazszniaxzfififfffiifiEfiffifixansz I I 1 Page 465 fpan-Hellenic Association Pan-I-Iellenic Association was organized to maintain sorority life and inter-sorority relations on a high plane, and to be a forum for the discussion of questions interesting to the College and fraternity world. First Semester CORA MAUTZ . DOROTHY GRACE . JEANNETTE LAMB . LUCILLE EVERETT , Seniors FREDRICA ATWOOD CATHERINE MUNsoN I-IILDA KIECKHEFER ELEANOR DANA DOROTHY GRACE . JEANNETTE LAMB . RUTH BALL . . LUCILLE EVERETT . VIRGINIA TENER GENEVIEVE GOUCH CORA MAUTZ . RAY COOLEY . IRENE FOLCKEMER . NINA MANN . Officers President . . Vice President . Secretary . Treasurer . Mem bers Delta Gamma . . . Kappa Kappa Gamma Alpha Chi Omega Gamma Phi Beta . Pi Beta Phi . Alpha Phi . Chi Omega . . Delta Delta Delta Alpha Xi Delta . Alpha Gamma Delta . Kappa Alpha Theta . Achoth .... Alpha Omicron Pi Delta Zeta . . . miinmummmiInimI.III.m-immvlmmm. inIIunmmImm.m..iIninu.mmm.m.w.i. Page 466 Second Semester . DOROTHY GRACE . J EANNETTE LAMB . RUTH JOHNSON . RUTH BALL juniors ADA KROENING lVlABEL SMITH LOUISE SAMMONS HELEN I-IUBBLE I-IAZEL WRIGHT GERTRUDE KING RUTH RUGGLES RUTH JOHNSON DOROTHY JONES DOROTHY SHURTLEFF ADELIN BRIGGS VERNA TUCKER MARION MCCAEE GoLDEs KISCHEI. f l'bj-QIWXHTGS I I IIII I III I II I II II I I Inu IIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I CPM Delta Theta Founded at Miami University, 1848 Wisconsin, Wisconsin Alpha, 1857 Number of Chapters, 85 Grubb Bell Harvey Evans McIntosh Gesser Chapman Moroney Huszagh Clafiin Umbreit Donnellan Carpenter Duncan Boeing P. Wright Paddock Sweeney Webster Wakeman B. Buckmaster Maurer Deysenroch Schwencker Kucheman D. Buckmaster Geiger Moody H. Wright Pradt ARNOLD BENNETT HALL GUSTUS LUDWIG LARSON HARRISON EVANS DEAN ALBERT BUCKMASTER LAURENCE BRINKMAN CHAPMAN LOUIS JAMES HAYES EARL EUGENE CARPENTER CARL FREDERICK DEYSENROTH MYRON GEORGE DUNCAN WILLIAM GREGORY LOUIS FARNUM BELL A PAUL JOHN BOEING Members in Faculty EDWARD ROSE MAURER FLETCHER ANDREW PARKER Members in University 1919 1920 NORMAN ALBERT KUCHEMAN EDWARD LEONORD MORAN HERBERT COLE SHERMAN HERBERT BEACH WRIGHT 1921 EVERETT LORRAINE GRUBB LYLE CLIFFORD HARVEY LYMAN PEYTON HUSZAGH 1922 GEORGE GEIGER BRUCE MACNEILL BUCKMASTER JOHN GESSER PAUL CUDDEBACK CLAFLIN II IIII II I I ,I , E 5 Sw . ., es?" I - "9' i 'T A4 5' Page 468 WVILLIAM DAVISON STOVALL WILLIAM LINN WESTERMAN EUGENE DICKENS MAURER CHARLES VICTOR SWEENEY HAROLD BEECHER TAYLOR ARTHUR GOODHUE WAKEMAN JOHN MUNGER PADDOCK ALAN EMMONS PRADT JAMES MILTON SCHNVENTKER CLARENCE WILLIAM MCINTO SH ARTHUR NEWMAN DONNELLAN FREDERIC ALAN MOODY GEORGE MACKENZIE UMBREIT CHARLES LORING WVEBSTER PAUL ARTHUR WVRIGHT n IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I I I II IIII 515 --A 552 21: -M:355335515551555tg3gg:35mygg1551gf5gg5555553153555gglmmmmlmggMymglm155My555mm55535555M5155mm!I5mrugwun3ggtyQ555:11intn:wanInm3lyqlwnufulwunvmuwInwrywuwmfumyfyInwufw11win1IHfumuuNmMvmInwuwm1u1XHwvumHInul1Inwu1vuwu1u1mnynwI.uvu1nvvuwnvumuwm1vunl1mNInulumm1n1mnuX1Hmmum1H1m1vuXH1mvmmm11InH1XnXWWWV..1mvmmlm1.fuInm1m1VHnuulumm1H11H1Wmummmvmmmuwmg g - 9wuwmwInwufwInwu1nwwmfnww-1wInfuwInmunwuwmwfmuwinwInruwmwInwuwnlWannlmuanvuvuwruwInumnruwurnuwmyfumvm1nyfunu1InInw111mwInm1nunwfuw-.1w.1wmwnwuwwwmwIn1mul1m1u1fnyn11u1anm1In1uW1u1InWnwnlwuwwHwrnnl1nnummmlmmmuwlmmmlmmfninmmumummlmHwWwIH1m1H1fuXWrmm1mwinni1nhl1XmdhwI11In1nl1.liinuni1I,INA,iiUlm1IliEin1Q51'iiHH?yiw1Ei1iiihiuGil11yi55.4HH151wlilN,ll1MF.11m1m1nluluin1inm1inm.ummuwW Q 3 E :EE 5-5 E 'IE :fi 215 :za 'W W- E55 EE sag gk, . f , as :sz ESE Ei? gf? sf: 4: EEE E22 Egg :Ez EE EE. ,.,- Ei. .., EE Zi, ,,, :ge :zz 5, .., 55 515 555 EEE E55 EEE EEE E55 2' ,,, gs gxs age :gs :ag 155 Ska W ' ss, v ,. p A- I I: :sg as fl: EE V 552 :E 5.2 SE 5'- .UmnunuInunumInvuruummrnummvuunumuwnuunnuununmummnnummmvunmmnnumunnuvmmmunnmwnunvumm:wnurnunnulunurunurmnwnnummmnuunnumumnnununmunwmmruwuwrvrwmmwnuwnumm