University of Kentucky - Kentuckian Yearbook (Lexington, KY)

 - Class of 1916

Page 1 of 353

 

University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection, 1916 Edition, Cover
Cover



Page 6, 1916 Edition, University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collectionPage 7, 1916 Edition, University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection
Pages 6 - 7

Page 10, 1916 Edition, University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collectionPage 11, 1916 Edition, University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection
Pages 10 - 11

Page 14, 1916 Edition, University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collectionPage 15, 1916 Edition, University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection
Pages 14 - 15

Page 8, 1916 Edition, University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collectionPage 9, 1916 Edition, University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection
Pages 8 - 9
Page 12, 1916 Edition, University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collectionPage 13, 1916 Edition, University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection
Pages 12 - 13
Page 16, 1916 Edition, University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collectionPage 17, 1916 Edition, University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection
Pages 16 - 17

Text from Pages 1 - 353 of the 1916 volume:

1. -,.' 5 - -1-.Tlx "1g'. 371.41 V 1. u 5, Q 1,L.3 ! 5111 1' -1 , 1'- 1 if.mT',I1 1'K4.X R I 'i . 1 N . ,. 11 ' ' z r, 1 .' 11 1 . 1 -Q 1 5, 5.0 1 . . X. H .1..,.. -- .ff 41 1 y 1 1 c . 4 . 1- 'Tn u A1' N' .M 'V' 1 1 '? 1 1 li S L f 1 gf 1 A 1.1 , . , 1 1 'f L 1 1 f I H 31 1 1 ' ' 1 1 4' - '1 1 ' ' S X . 1 1-. 1 1 ' 1.'x ' 1 V..lq1-,.- Q , , Qw1.lf 1' ' 1.1 . ,. .. 1 1. - ' ,F .'1 '2. .I wx' .ig .14 ,1"' ,. ,:1'Jv5' an rf 1 W1 ',..',4 - " 'A 1', ..-1 Q .' A. M.. . , . , , . . 4-"?::11,4 .x- 1 , 141. -. -1 .1 ' YN 4 1 1 . .. . N .,, .1 .fa , 1 1 .1 a.-,, ,1 .Ak-'. Q JN .,,, a 51. M- 11 ,.1,, I ., K. .mr-.,1 . ,15..1.,f.- , . '- , , 1 Y' 'Q1"f"..- . 1: f -' - 'Q :J '-"fn, , - an 145 -K:-in 1, 1 . 5.-1, ' 2'fV29,Q4'HgQjsI1j.- lg Q. 1' " 1' - - , '- ' - C' 1 H ,L A .114 Ho. .14 I, 1 . ,, .1-1+ r 1 , K .1' ...x.,!. 1 ' 1,"- 1 .Yr 1 1.- 1 .V 1 V12 "-1. u ' " 43.31 1,1711 +- - ,,,. 1. 11 1 'f.fm1 .1l,- jg 1 ' 11.4 'V 4 wc.. 1 11. ' 1 1 1 1 1 , .4 ,1 1,1 5 U. . I 1 ', f'5?1t 1 4 1 , w.. 1-1,. .M- if VI. n 1 , ,. 1 1 , xiwi ' 121 2.11. I 1 1 wa ' .1 ,,..-,- ' 1 ,. 1.-.1 1' 1-H 1 1 ,.1e ,, ,, 1. :Wu 1 yu xg .Q , 1 .vs 1,1 1 rf' 1. 1 - I .111 1 wi M1 ' 11., .. , 1 1.gfl ... 1.,1,1,4' X +7 1J: 11? ' 1 wg.. W ff. , . s I -1 H11 J1. 1 1 44.1 .W ...b . 11.1, ,,V . 1 .-1 1. 1 , 1 , ' . ,.,". Q" 1.11 - ,1' r,., 11'if'-'I W' ,AY 1 Q .1x,, 1: ' av .1Q.Q, A - X ff" Cwfmkjyy NX X IA--mf' Xgi-Qrgiiirgggpcpgkffvyf , jffjif N V 1, r '- , 1, lkx V if 1 Q Up f A T I f J Ali, f f N ffm f ' k j M' f u QM K6 hy! X ADX W uf fllr. Y f 7' Q, y 1 ff , in N7' KNGWLEDGE .. -?' Kwv if .f ,- 'A ' X L- f , ,Q M .. 'X lllq u X gb "f "H ' X. S-X , ' Q' - xx A 2' f x, 5 k .X D A fn .QL X , YJ A' XE:i?Jfxf 5 D f I If ? 7 1 A NJ- gh ' X - '- g , ff if L X1 KN' k N I v N r fglfiwu X 75,1411 , 1 if n nn --"1 1- 5 A ' I in k! Ex Liloris MI ' W W i r fam.. ,.,. ,NWA I uw.. Av-... 3 ki ff AN -s 1 S-, Q55 585, Sffbialifei. 4 ?Ef?i1ti'E5E2' ,. EIQX' r if lim III M y 'QE-f TI-IE I KE TUCKIAN VOLUME XII PUBLISHED BY THE CLASS OF NINETEEN SIXTEEN G13 'Z M131 3' , ni N"?f5v. vw ma- 5. 'I 'Mir 'I .Uvhm umxvnasmf OF Ksmucm QQ 4560, QWFTJIY fJfW3 59B3i9535E9 ggs 0 W Awww 'S-wmv' mm - 5 Y?2x'Q5isiG2i':22?5"1Qfi "P" ' 1' , W I y53E?iS'f'A "1?f5Ki?6?QZ5i??cP?sf?'W , I I I f Lv ' if ?y 32i2.mH?I4'r3s3'SGr'E'2.?a?A 322.53 5' "-qf93wr-1--:- 'pf ' J Q 3 Qs f 1 Q gf I" II, 'S .V aan' 3 Z-2 1 f IQ Q . 'G 554 .v X F ,Y h ' Q 1, 1: , 7 f:Iff:g.fIE 5 X I I T"':' , . Rig' J 1 l I 4 f ' ' , '- 34 JNXWIIIIIIIIIIIIIIIII IIIIIIIIIII llll I II I I I I I ll I I N III' Ill' 0 Q I if Qlwlb DEDICATION PRESIDENT EMER1TuS JAMES KENNEDY PATTERSON 3 - : IN APPRECIATION - -E OF 1-us FORTY-FIVE YEARS 5 I I .E OF EARNEST SERVICE 5, f 5 TO THE UNIVERSITY. E 5 WE DEDTCATE THIS BOOK. 5 ,E THE 'gy f 5 KENTLICKIAN E ,EJ 5 .E EN E 2.-.. ..- an lm -N Q wmv: I x Y ' Z . K -1 x.x ff -IA nl lmmmunnummunuunmmInmuunmmumununmunmllw Q75 . 7 .H ,N r Q 'H N u H mimitmuuflm xulmmmuluuummmu QI? Y it I ,, 4 , sglrluullnulqmlsmumxxQ, ' E T ' 1 'J ' -1'-had ,nw""" " ""u-uf-'Sw' 1 r I 'JI ll q ll I" FOREWORD THE KENTUCKIAN RECALLS AT ONCE MEMORIES OF THOSE HARDY PIONEERS WHO FIRST ,IOURNEYED TO OUR STATE AND ASSUMED THE ENORMOUS TASK OF BUILDING A COMMON WEALTH OF DANIEL BOONE AND THE REST AS A RECORD OF ONE YEAR IT SEEKS TO INSPIRE CONFIDENCE IN THE HEARTS OF ALL KENTUCKIANS TO FILL THEM WITH THE SAME SPIRIT OF ADVENTURE AS WAS IN OUR FOREFATHERS-TO DARE AND DO EVERYTHING FOR OUR STATE REVEALING ALSO WHAT HAS BEEN DONE IN THE PAST ITS AIM IS TO POINT OUT THE BRIGHT HOPES OF THE FUTURE. TAKE IT AND KEEP IT AND LET IT BE FOR YOU MEMORY'S STOREHOUSE tl 1 UID IIE If' llln ...5Q3-" "'--:gl ,. l l -6531, S 55352 3 o ' . 'gm afar' ' ' ' "iw "' " 2. "'-ifwsfiftffaf ... ll' ' '-. .-' iv- IN P I bu..-sv' .:. l E IIIIII: Z I 'E'- I E W I 1 I I : , I an W 1 J I I 2 ' 1 'S ' 'U ""'I' 'IYIIWIHIIVIHU'IIINIIWIIPW Ilvlll- vvll ww vlll14 I llllvnmvmulmvllmm vnnnnvvnnn rvlmvumun nnnunvv muumlm ulnn mn wrnnnnnrvnl 1mnnunnmmnmvm 1 1 : ll ll I - , 1 V 1 2 I: S E L' Q I ': ' I 1 is ' IE I . I : 5 : I : 1 2 . F 2 I - I W E .- Tn S : I 2 -. 'I : . , : - I 1 2 -'L' . .- I 1 1 : 1 I 1 lllllllllllllll l lll llllllllll I l ll l I l lllllllllllllr um SWEET MEMORIES LINC-ER ALWAYS C93 LET US WALK ALONG THE DRIVE U09 I 3 1 i L 4 .2 R 1. i i I I X ui T i 3 . . K I . x 3 g A V L u-- I WHERE BODIES BIG AND STRONG ARE BUILDED UU 4 BENEATH THE DROOPING WILLOW TREES .V --A - . , .. . ,,,.,.,.. ' -M 1' ,, V- ..kL ., ,',V.:,.VG,-will-'IT Vx-,EV-. ' iff' .Ik A- :VII . , V'w+1ffw"" ig j, ff V - , ' xg V ! I, :ij 7' t, ' 1 ' " flgx xx 1 - W-J.: , -fr' ...ff A " F fi' 4,3 V7 ,, wg . ' "J-if.-,:iVf" .. ,fa-' BWV. W- ' V , V 4-V ww 23 V, .L A, V 1. . fill fieffi iv.-Q: ,Q wi: u , ,,,V- -V: V -,nl 1 V L . . 1,-. 'tg,...., 7 Aff. - " . .UV n-- V , .q?.ai j l:"?, 1 1,4 is V . Ligul by ' " " V 'E'--V EV fp ff'1,.Mf' 2 EE Z' visa- fm E 1 .. A 4 ,V V. v-1 -Vf MWIKV, ,,V.,...1'v' " I , , . ., V . ' Q-.V-V, ' - VV: V. , - ,A 3- -V ' iwV'::,,N, K , I I4 5 1 ,272 H L 'IYLJ5' , ,, "TG V' ' n 'HU- fm.Vu-.:- V A- . 1, V :v,fgAr,Q,1, ' ' vb ' , h . 1 1 ?3jV,1I'5!'J11 f' ' ' ' ' Vx V -, V Lf,-fV'.ehV,V 1- s - - -, V,, ,V sm 1 fzz, E V V, V--af - g ' "iii Zig A ' V IGQHWIVN V ' .V A ., VC ,Q V 5 ,V 2141? V .. VV VV 1, -,V , 4 HI, ,. 1-mr, - . C 1 Am' :Tin W A ,V .VN n, V , A fs .J-4. 1 "Q , H' W JJ. A A U29 I I U A If OUR PRESIDENT U31 V - ,.,. ,M ,I ,7,,,..,M ,, COME AND TRIP IT AS WE GO, ON THE LIGHT FANTASTIC TOE , U43 ALONG THE. SHADED PATHS WE WALKED U53 l ix X THE OLD MAIN U69 l...Y, x 1 I I I D ig WHERE OFT WE STROLLED WHEN LOVE WAS YOUNG U73 RETORT AND CRUCIBLE. AND SUNDRY THINGS .yx 1' Y fw- USD AT. I l 41 r THE SEAR BROWN LEAVES ARE FALLING FAST U93 , b x ALL THE WORLD SEEMED COVER,D WITH WHITE C203 -1 HW, . . A ,O , X C20 2 l 1 E I n I 3 5 P L., 7 .. vi 1 Q i T I is N l W I 1 C243 k ja 'T D 1 ' A l 5. k f ?. ! x Q. C253 ,A 3 gl-51.9 75en1'uck.ian PRESIDENT BARKER , l C263 31916 g s W gnc? 7fenfLzcfcifr,r'r ff lgrnaihent Barker :mil Eepnrtmvnta In t N unquenchable good nature, a spirit of progress, generosity and firmness l Xulff have made President Henry S. Barker beloved by the student body and friends of the University. ' In the five years of his administration much good has been accom- plished. Various departments have been given new life by his favor and encouragement, and new departments have been added, causing the institution to grow in numbers and influence. Under his guidance a certain unity has been brought about, which has made possible the advancement of recent years. Where there were 721 students in l9l0, there are I,445 enrolled for the l9l5-l9l6 session. Likewise, the number of graduates has been almost doubled. One of the remarkable features of the progress of the institution is the growth of the College of Agriculture. Five years ago there were twenty students enrolled in the four-year course of the college. Now there are 253. The work has been done with a thoroughness that has placed graduates of the college in demand. A new interest in agriculture has been aroused over the State, and farmers are depending on the college and the experiment station as never before. Able authorities say they expect the College of Agriculture to be vitally concerned with the advancement of Kentucky along all agricultural lines in the future. The College of Arts and Science, under the capable leadership of Dean Arthur M. Miller, has become the leading college of the University in numbers, having sixty-six in the graduating class. This college has done much and will doubtless do more to place the University in the front of all Southern institutions. One of its most flourishing departments is the School of Journalism, directed by Professor Enoch Grehan. Although in only Hs second year, dns deparhnent has about eighty students doing pracncal vvork in journalism. The course has been elaborated with its growing numbers, showing an increase of about one hundred per cent The College of Civil Engineering is rapidly gaining strength under Dean Walter E.. Rowe. Especially good work is done by this college in its short courses, whereby county engineers are given technical training. It has done much to help along the movement for good roads in the State. Dean C. J. Norwood is directing the College of Mines and Metallurgy very ably. The graduating class this year is small, but the underclasses are large, and much interest is taken in the work. Undergraduates of the college have handled responsible positions in mining engineering during summer months, being ranked favorably with graduates of other insntudons. The Graduate School has had an unusual growth since its establishment within the last four years. Dean Mackenzie has handled its work with a vim and enthusiasm that has demanded recognition in nearly half the Statesuof the Union. C279 l l l 1 l 1 l 1 I l 1' l l l 4 2 3 1, 1 E Y "A li I 2 5 1 l l l l 5 1 1 5 l l l i r 1 l I J 3 at QI 2 S I S A xl I 1 1 . 1 4 i : E l is is gi ll ' 11 A ll lf t t i l t J .-.--1-,Z ll ft Q V e Q9 1916 gig?-ff7?-H-will 'il f 4815 e 3: Q59 'kenfuckian so Q The College of Law has advanced until it is accredited as a leading law school of the South. The course in court practice, handled by Dean W. T. Lafferty, is rated as perhaps the best in the United States. Its growth in the past few years has been very gratifying to its head and the University officials. The development of fundamental characteristics of successful engineers, such as strict obedience, application, personality, tenacity, and all the other fine traits of men like Steinmetz, Westinghouse, Carty, Edison-such is the one great purpose of the College of Mechanical and Electrical Engineering. It consists of five departments- the departments of drawing, practical mechanics, mechanics of engineering, heat engineer- ing, and electrical engineering. The fact that only one degree, Bachelor of Mechanical Engineering, is given from this college is significant. The young men studying for mechanical, electrical, commercial, or any other branch of dynamic engineering, receive the same training-a broad general course in the fundamentals of both mechanical and electrical engineering, as well as industrial and commercial principles. This policy has proven its soundness by the unqualified success of the Kentucky mechanical and electrical engineers in all branches of the profession and in all countries of the globe. This is the twenty-fifth anniversary of the founding of the College of Mechanical and Electrical Engineering. When the Class of l9l6 leave to take up work in the positions chosen from among the hundred opportunities available, more than four hundred graduates will be demonstrating to the world that the Kentucky-trained mechanical and electrical engineer faces the great problems of engineering with courage, ability and stamina equal to that of any graduate from America's foremost technical universities. Y P U iv? 5, "'Wli?glll"' l I 1283 ll L s s lt K5 21916 so fv 'J ,X Y if l l 2 ll al 1. .. lr Q! 'H ' 1' W tv?-V -- ---- -if . ...,,,. A-. Q if 3 759 'kenfuckian Uhr Hniunraiig, nr "1Hnttvr Shun" 'ESS than three-score years ago, among the many colleges west of the fjj W Alleghenies, University of Kentucky had its beginning. Nature could not have provided a better location than the heart of the Bluegrass, famous 14 for its pasture lands and horses, its hospitality and friendship. The heavens sent the rain, the sun shone upon the earth, the birds sang, the flowers grew, jupiter nodded, and Athena smiled: and ere the morning sun had far advanced the Potter's Q Shop was started. Its path of progress has not been strewn with flowers, nor cheeks been kissed by every breeze. Assailed by storm and blast alike, it has stood the test. "The rains came, the waters descended, and the wind beat upon that house, but it fell not." Its base was laid on firm ground. Jealous rivals have sought to hinder, but their thorns have brought forth roses dripping with dew. Their hindrances have been of little sig- nificance and consequence. The growth has been slow and steady, day by day a board was nailed and a plank was laid, until the shop was completed. The potter gave his life to the building of the shop and the forming of Kentucky's shapeless clay. The pots turned out have been carrier afar, for Kentucky's soil is conducive to the making of men. From her soil have come the Breckenridges, the Clays. and Calhouns. The University of Kentucky has become the leading Potter Shop of Kentucky in standards of merit. The field is boundless from which to draw, and "State" always gets the best. It does not excel in numbers nor in wealth, but it puts on its outturned products a stamp of worth which bears them far and well among the children of men. Merit is its mottog and its aim is an open road and a fair fight for all. It gives every mass of clay a chance to help shape and mold himself. He is essentially instrumental in his own making, it matters not where he may be, but here he is given an unusual chance to show his initiative and originality. If an individual has been here for four years and has been marred in the making, it is the fault of the pot, and not the potter. Over every class- room door might well be put the lines: "Honor and shame from no condition riseg Act well your part, there all the honor lies." Though yet still young, "State" has sent many able men into many lands. It always holds its own among rivals, often outclassing them on every hand, and bids fair to become the leading University of the South. In a few years we hope to see it take a place of merit among the leading universities of the land, a "Potter Shop" of unusual rank, turning out vessels of purest clay, bearing nature's noblest stamp, women among women, and men among men. C299 Q 335, b as 1916 eb J nl A l X X ,,,,..,. , ,f 'A 'SX I X 'I 1 XX ffl I I t i I l la DEAN MILLER Cllnllrgv nf Arm sinh Srimre - OME with me and I will talce you through the halls where men love art for art's salce, and science for its own sake. We are they who ponder. We love to sit in our high, lonely towers, where we may uunsphere the spirit of Plato." No thought of gold corrupts our eager brains. "Why cram your heads with something which you cannot sell?" they tauntg uransaclc your brain and you cannot find one thing that you can commercialize." Be it so, for we suhmitg our doom is fair. But we would rather let you have the gold if you will leave us our arts and sciences: if you will promise never to harass us more with taunts and stories of the poor cricket who, hungry and cold, went to the house of an ant for succor. C319 wwf. .,., , ,- ,, 1 -Q.J-'1-1'k,-,.-.-. f,,.....,..... ... Qs 382 31 Q59 ckenfuckian R Glnllvgv nf Arts auth Svrirnre FACULTY A ARTHUR MCQUISTON MILLER, M.A. Dean of the College of Arts and Science, Pro- fessor of Geology COLUMBUS R. MELCHER, M.A. Dean of Men, Professor of German M. HUME BEDFORD, Ph.D. Instructor in Physical Chemistry RALPH EMERSON BITNER, B.S. Instructor in Physics PAUL PRENTICE Bovo, Ph.D. Professor of Mathematics, Head of the Depart- ment WILLIAM E.. BUTT, M.A. Instructor in Economics GEORGE MARSHALL BAKER, M.A. Associate Professor of Education HARRY S. CANNON, M.A. Instructor in Cerman SARAH MARSHALL CHoRN, M.A. Instructor in German LLOYD C. DANIELS, Ph.D.' Assistant Professor of Chemistry LEHRE L. DANTZLER, M.A. Professor of English Literature JosEPH MORTON DAVIS, M.A. Professor of Mathematics ANNA JACKSON HAMILTON, M.A. Dean of Women, Associate Professor of English EDWARD F. FARQUHAR, M.A. Professor of English Literature DERRILL W. HART, B.A. Fellow in English THEODORE T. JONES, M.A. Professor of Latin, Head of the Department MERVIN JOE KELLEY, B.S. Instructor in Physics CINCINNATUS D. KILLEBREW, M.S. Associate Professor of Physics ALEXANDER ST. CLAIR MACKENZIE M.A., Lit.D., LL.D. Dean of the Graduate School, Professor of Philology RALPH NELSON MAXON, Ph.D. Professor of Inorganic Chemistry J. R. MITCHELI B.A. Instructor in Chemistry JAMEs THOMAS COTTON NoE, M.A. Professor of Education, Head of the Department MERRY LEWIS PENCE, M.S. Professor of Physics, Head of the Department JOSEPH W. PRYOR, M.D. Professor of Anatomy and Physiology, Head of the Department ELIJAH L. REEs, C.E., M.A. Associate Professor of Mathematics MCHENRY RHOADS, M.A., Ph.M. Professor of Secondary Education FRANCIS JEWELL, B.A. Fellow in English REUBEN T. TAYLOR, M.A. Instructor in English GLANVILLE TERRELL, Ph.D. Professor of Creelf, Head of the Department JoHN J. TIGERT, M.A. COxonJ Professor of Philosophy, Head of the Department JAMES E.. TUTHILL, Ph.D. Professor of History and Political Economy, Head of the Department FRANKLIN E.. TUTTLE, Ph.D. Professor of Chemistry, Head of the Department WILLIAM S. WEBB, M.S. Professor of Physics A. H. WAITTI B.S. Instructor in Chemistry W. H. STAEBNER, B.A. Instructor in Chemistry ALFRED C. ZEMBRDD, M.A. Professor of Modern Languages, Head of the Department Qs E ' P9 1916 A W A is 95821 2 etkenfuckian 'A s Q l tr DEAN GREHAN t Qlnllege nf Jlnnrnaliam HE School of Journalism has had a wonderful growth during the two years of its existence under the able guidance of its head, Mr. Grehan, assisted by Miss McLaughlin. It has earned the reputation of being the "busiest" de- ' partment on the campus. Aiming to turn out young men and women prepared to enter the active field of journalism, it serves also to exploit the University through local and state papers. Filling the need of a shop wherein to train young people for the growing industry of the age, this department seems destined to assume a high position as a unit in a rapidly progressing University. , l7!XC:LJl.1f'Y E'.NocH GREHAN, B.A. l , Professor of fournalism, Dean of the Deparlmenl Mancuamra MCLAUGHLIN, B.A. Inslruclor in journalism 4 , MARY CHRISTINE HOPKINS, B.A. Fellow in journalism Il C337 R Qs s QQQ as 1916 as' s 351 as 3341 lil I Q' f J I 'f w f A , -.-,off jf' w': fi! J ffj: ,fvjlr ',,,.-,,-,,.,, ' 1 -.,. j viz! 3.,.,. 1.' . -'fs ' , L fi i .- '. If A ,.,,,...- . ,. ......-.,, DEAN KASTLE Glnllege nf Agriruliurr OME hither, all ye who love the life of quiet simplicity-the one of true happiness and independence. It allows one to roam among the meadow grasses with the cows, and pick the meadow Howers. l-le can listen to the sweet sounds of evening, as darkness lets down its sable shroud. over the earth and he returns to his well-earned rest--the singing milkmaid, the contented, lowing herd, the happy calls of playing children, and the softly tinkling bells of the distant Hocks. No discordant note from the world outside can enter the quietness of his own, domain to disturb him. This is the life of the gods who on Olympus dwelt. C343 V J 1 l l I V I r gt, Z - 9759 'kenfuckian at BE N Qtnllvgv nf Agrirultnrv JOSEPH HOEING KASTLE, Ph.D. Dean of the College of Agriculture and Director of the Kentuelfy Experiment Station W. S. ANDERSON, M.A. Assistant Professor of Animal Husbandry CHARLES D. Boi-IANNoN, B.A. Professor of Agricultural Economics RUBY MILDRED BUCKMAN, BA., B.S. , Assistant Professor of Household Arts N jot-IN HENRY CARIvIoDY. B.S.Agr. Assistant Professor of Horticulture AUBYN CHINN, B.A. Assistant of Home Economics OT'ro S. CRISLER, D.V.M. Assistant of Veterinary Science HARRISON GARMAN Professor of Entomology and Zoology ALBERT HALLEY GILBERT, M.S. fUniversity of Wisconsin, 'Associate Professor of Botany FRED W. HOFMANN, M.S. fUnivcsily of Nebraska, Assistant Professor of Horticulture J. HOOP!-ZR, M.S.A. flowa State Coltegel Professor of Animal Husbandry ROGER W. JONES Instructor in Fertilizers and Feeds JOSEPH HOEING KASTLE, Ph.D. fjohns Hopkinsj ROBERT GRAHAM, D.V.M. Professor of Veterinary Science CLARA WALAND WHITE Instructor in the Department of Home Economics FACULTY PERRY ELMER KARRAKER, M.A. Assistant Professor of Soils EDMUND J. KINNEY, B.S.Agr. Professor of Agronomy RUDOLPI-I E. KNAPP, B.S. fUniversity of Michiganj Assistant Professor of Bacteriology CLARENCE W. MATI-IEws, B.S. tCornelD Professor of Horticulture FRANK T. MCFARLAND, B.S. fOt1io Stale Universityj Instructor in Botany DILLION S. MEYER, B.S.Agr. Instructor in Farm Crops WILLIAM D. Nici-IoLs, B.S. fUniversity of Kenluckyl Assistant Professor of Animal Husbandry ROBERT.L. PONTIUS, V.S. Assistant Professor of Veterinary Science GEORGE ROBERTS, M.S. fUniversity of Kentuckyj Professor of Agronomy WALLACE V. SMITI-I, B.S. fUniversily of Kentuckyj Assistant in Animal Husbandry CHARLES FRANCIS STILES, B.S. Assistant in Entomology and Zoology MARY E. SWEENY, M.S., M.A. Head of Department of Home Economics WALTER R. PINNELL, M.D. Associate Professor of Bacteriology EDWIN STANTON Gooo, M.S. Professor of Animal Husbandry E Qgg 9 1916 et T fi I B2 J WZQ 'Kenra ck ian DEAN ROWE Giuil Enginrrring ERE is the college for you who would live the picturesque life of the open. It has been proved quite often that there is no better way to win the heart of a sweet, unsophisticated maiden than to work as a civil engineer in her neighborhood. This profession has grown in popularity, despite that fact, and it is recognized now as being one of the most important of all. Kentucky and many other states have realized the importance of civil engineers and have looked with much favor on Dean Rowe's graduates and undergraduates. C363 t 1916 gf' at s L l l l H 1 i Tx X i 1 l I X K , . 1 t i I J Q t to-Hy - ,-..c. 2 E Y i Qi 5582 ZWQL-kQI?1lLlClC,iClI2 J ' w I I I7lXCIlJLff'f WALTER ELLSWORTH Rows, B.S., C.E. V Dean of the College and Professor of Civil Engineering ROBERT CRAIG TI:aIxI:L, ' Professor of Rural and Highway Engineering, Head of the Deparlmenl WILLIAM JOSEPH CARREL, B.S., C.E. Associale Professor of Civil Engineering, Head of the Deparimeni of Bridge Engineering DANIEL V. TLRRELL, B.C.E. h Acling- Professor of Rural and Highway Engineering I P C379 Q iQ? 9 1916 as I I 9 9 DEAN LAFFERTY Qlnllegr nf Emu COUNT myself happy that I have the opportunity of speaking in my own behalf," says the amiable young lawyer. It will surprise you to learn how long he can talk, even to the extent of "out-senatoringu some of our national Senators. He is shrewcl in his argument even to the point of sophistry. His eyes are keen ancl darting. He learns the tricks of mankind from his many dealings with all types of humanity. How is it possible for him to keep his moral balance, when hc is continually dealing with the inhnite crimes and miscleeds of man? Herein lies the secret. He loves his work, for he vinclicates the innocent. He would lose his own life rather than allow one innocent man to be punished. Justice is his theme, and his plea for justice makes him right ancl keeps him optimistic. C355 I e iff T QHQ 'kenfuclcian i I W 1 9 E I 'N Qlnllege nf Emu I f7!XC:lJI.'f'f 5 WILLIAM THORNTON LAFFERTY, M.A. Dean of College, Professor of Law CHARLES Kama Professor of Law I LYMAN CI-IALKLEY, LL.B. Professor of Law JAMES RICHARD BUsI-I, B.A. Assocfale Professor of Law Gsoncn WILLIAM VAucI-IN, LL.B. Associale Professor of Law j. EMBRY ALLEN, B.A. Assocfale Professor of Law REUBEN BRENT HUTCHCRAFT, B.A., LL.B. , Professor of Law C397 QI A Qi A an IQI6caf 382 9 If' 5 Q :gg 3: 9729 'kenfuckian A .sqm l it F, fli it 1 4 l . is ix! i li I 1 I l , it it DEAN ANDERSON l Hllerlianiral mth iilrrtriral ifinginerring "Hence, home, you idle creatures, get you home. ls this a holiday? What, know you not, Being mechanical, you ought not walk i Upon a laboring day without the sign l Of your profession? Speak, what trade art thou? 'Why, sir, a carpenterf Where is thy leather apron and thy rule?" Here's to the lad who works with hands-and brain-and with earth-made l l implements conquers the earth and makes her his. He has learned here in the University of Kentucky what a ten-year mechanic will tell him, that if he expects l i to hold a good job he must resolve to work sixteen hours a day, and seven days a week. But they are the men we must honor and revere, for the man who acts is the man to whom the world will look eventually for support. i L i C403 Q 533, so 1916 ef, F97 ir l i i 3 .1 4 I 1 ! 5 ff 1 l l Glullrge nf illlvrhauiral aah iilertriral Engineering FACULTY ARZA LYTLE Wn.HorrE, M.E.. Assislanl Professor in Sleam Engineering FREDERICK PAUL ANDERSON, M.E. Dean of College, Professor of lllechanical En- gineering JOHN SHERMAN HORINE, M.E. LEON KAUFMAN FRANKEL' ME' Assislanl Professor of Drawing Professor of Applied Mechanics, Head of Dc- parlmcnl of Mechanics of Engineering JOHN JAMES CURTIS, M.E.. WILLIAM EDWIN FREEMAN, EIB' Assislanl Professor in Tesling of Malerials Professor of Electrical Engineering, Head of DfP0fl"1ff'f Assistant Professor in Thermodynamics PERRY ROGAN CASSIDY, B.M.E. josEPH DICKER Superintendent of Shops Louis EDWARD No1.LAu, M.E. Professor of Drawing, Head of Department JOHN B. DICKVER lnslruclor in Woodshop GORDON THURMAN Inslruclor in Slcam and Eleclrical Laboralories JAMES RAY DUNCAN, B.M.E. lnslruclor in Eleelrical Engineering MARGARET MCPHERSON Inslruclor in Freehand Drawing C40 We if es 1916 or A 7332 9 Q Q A Q59 ckenfuckian ff X Y 'nil' i 1 4-f,.T:m A, F . 1, ,, d. il ,f , N 5 gi I fi, , H Ay 15:-..-. H. , . -f- --N., .-.K ..--N . DEAN NORWOOD Qlnllrgr nf illlinvn anh illllrtallurgg "Surely there is a mine for silver, And a place for gold which they refine. lron is taken out of the earth, And brass is molten out of the stone." He brealcs open a shaft far from the haunts of men. Into the path which the bird of prey knows, which the falcon's eye has seen, where the fierce lion walks, and the proud beasts pass, there is the place where our mining engineer goes. He leaves his footprints in the sands of gold. He puts forth his hand upon the llinty roclc, and overturns the mountains by the roots. He cuts out passages among the rocks, and his eye sees every precious thing. C423 pw .wp-A if ,wh -,ln W , 9 'M . . Q., M, ,AA-,,,,,, , f T' ,fbi ..L4,,K:.d w A, ,,iW - M .W ,tt ' , ,, N.-- ..,. ,,.,, Y SRWSC L Ill, if fir 4.f ,,. fri 4 1 x 21 A-1 3 I ! H , Q, 1, V 7 h S' i r l ,I If l W I l Q59 'kenfuckian Qlnllrge nf illlinra anh fllilrtallurgg FACULTY Cl-iAm.Es jossm-I Nonwoon, M.S. Dean of College, Professor of Mining and Metallurgy THOMAS jmns BARR, B.M.E.. Professor of Mining Engineering IVAN POPPERS TAsl-lor, E.M. lnalruclor in Mining and Assaying jossrl-I WALKER REED Inslruclor in Examinalion of Mine Air C437 wo o - 'Mm-o 1916 G, ogg Q - 'fame 0 f 1f f - ,M M',,LQg1Ql9 J S' L is fr re t.. J r if er. Cr'-.,f,0iii"fi xggiiiiifiigi..lisafgn-' DEAN MACKENZIE. imahuatv Srhnnl HE. question of organizing a Graduate School was brought to the attention of the former Committee on Degrees and Diplomas by Dr. Mackenzie, Head of the Department of English. This was done in view of the increase in applications coming before this committee for such work as is generally conducted in a Graduate School. By resolution of the Board of Trustees, in Executive Committee April IZ, l9I2, the Graduate School was created and Dr. Mackenzie was made Dean. Professors Lyman Chalkley, L. K. Frankel, F. E. Tuttle, and J. E. Tuthill were appointed on the Graduate School Committee. The first regular meeting of the Graduate School Committee was held November 27, l9l2, and since that time the School has grown steadily in numbers and in prestige. The enrollment for the current year is eighty-three, which compared with fifty-six of last year, shows a greater growth than that of any similar organization in America. There are resident students enrolled in the Graduate School from Pennsylvania, C447 F916 ci-sis? iifsiskf T 1 believed that under the capable leadership of Dr. Mackenzie it will grow even more in , K I I r liz Q 5815 9 929 Lkenfuckzan Alabama, Mississippi, Missouri, Tennessee, Indiana, and other States. There are also 3 non-resident students in West Virginia, New York, Virginia, Texas, Louisiana, Minnesota, ' Florida, Michigan, and elsewhere, which gives some idea of the scope of the inlluence of the school. l 1 The work done by students in the Graduate School is of a very high grade, and it is 5 numbers and influence, so that it will receive recognition throughout the country. i i , Q: I, 4, It 5, l i 1 l P I 4 1 i GRADUATE SCHOOL COMMITTEE C457 Q a a19I6s at QQ? 9 I . W I l l l l l l S I I , . 5 I gm IT" 1-At 5, ..- . A 14-:ff ,ml-,..f xg .Au zz ii . 1 .31 I-1 '1 I! ,, im ,N ll 1 I 4 4 gr xl! I J - n fy' A , 'img' . E7 E3 l "" "" "" ' i ?3 +' + " ' ' " ' ' ' ' ' ' QQLQMQQ SENIORS gg? S ' SOLHOMORES f 5 PRE sHMEN 1, v lfv f,fv pf, ,f i.1 vilQ, vv!, v ,1 vv 21,v ,zfvv n1fv l1,1v ,,1 f1Q fnQf1 f1,!fv fgw LQQ Wflf Qlf fQ.1 1..1 Af111Qv1.11v1fn.1vn1,1vff1i vQ v 11 v fi v 1Q v iQv 4,Qv ,l v V " ""4 ""4 "'i "" "" "" ""!""i ""i""' "' "' "'q "" ""4 "' !" b" ! b"4 h"' "'q L"V1 "' "4 "'1 "" '41 ""' "' ""1""'1 x5 P C473 kkTA'7i'E'f.ff' V V U ffA Awiwj ! 1 5 1 i 3 i n 1 3 w 1 Z ? i . I v . t A ,... .,. .,.....,..u...-v-. Svvninr Clllawa QDfIirer5 O. M. EDwARns. . . . . . MARY HOWARD. . . . W.P.MAYO . . . .. MARY LOUISE Doucl-uaR1'Y . REBECCA SMITH INA DARNALL . H. Faux . . juuus WoLF . 1 G. C. WILSON . . C. R. BARKER . . . R. E. CULLEN . . HERBERT GRAHAM . ". . . Se . . Prophet . Historian . Crumbler . . Oralor f My . . . .Presidcnl . Vice-Presidenl . Treasurer crelarp . Class Rcpresenlalivc . Clfiorian, . . Poel Manager Kenluckian Edflor-in-Chief Keniuckfan C487 fi ""h'1g.iigi "" -?'f.z"fQ...Ml..f 'rf .' wvf. n x 5 . 1 Q ,gf 3 ....-....-N..f:.-..4- X Q........Q..U..... ,- ,au A 4 .,..,f"' X821 .... . 3 9769 fkenfuckian vii."-ic 3 SENIOR CLASS RUSSELL FOSTER ALBERT, B.C.E. Elizabethtown Slgmu. Alpha. Epsilon: 'Pau Beta Pl: Prize Drlll Bnt- tallon 1, Captain 3, Major 4: B. C. E. S. Russell has been recognized as the leading military man of our class. As acting commandant he showed initia- tive, executive ability, and foresight. ln his enthusiasm over preparedness he seems to have concluded that all "Folks" should have a soldier around. LAWRENCE M. AMBURGY, B.S. Agr. Hinclman AgI'icultuI'nl Society. "Skinny" conceived a powerful liking for girls and dancing during the latter part of his term, and has devoted a considerable part of his time to it. His favor- ite haunt has been the Country Club. MARYLAND D. AMBURGY, B.S. Agr. Hindman Class Trcnsuroi' 43 Agrlcultui-at For-toty. M. D. always attended strictly to business, and "set no houses afire" in a social way. He did get what he came here for, however, and we suppose he is satisfied. In his own way he should reap a rich harvest in life. VIRGINIA FRANCES ANDERSON, B.S. Agr. Lexington , Choral Society, Vice-Prcsltlt-nt 2. A charter member of the firm A B C, Virginia has stood by the Hag, and greets us every day with the same cheery nod and smile. We often wonder what will claim her attention after June has come and gone. C493 Q ET fiQ 1916 as . - f 9 I . Q59 ckenfuckian 4, SENIOR CLASS CLYDE RUSSELL BARKER, B.A. Brooksville llnlon Lltorury Soc-lety: First lileutvnnnt Band 3: Class Puvt 4. Of course, I clon'l know what you think alnoul it, bul I can tell you what I think "Judge" for four years was hardly known on the campus, but in his Senior year he sprang into prominence as Class Poet. He is a hard worker and has his own opinions. PEARL ALLYNE BASTIN, B.A. Lexington Alpha Gnmmn Dvltn: Vnrslty 'Baslcotlmll 3, 43 Moun- tnln Uluh, Se-r-rt-trxry Il: hlbrury Club, l'1'1-slmlt-lit 4. lt is often said that athletics and studies do not go together, but don't you believe itl Pearl is the original "A" student, and wears the "K" besides. Also, she spares time to make a psychological study of the "hart" occasionally. ' JUDITH ELLEN BEARD, B.A. Hardinsburg Sic-cretru'y Y. W. C. A. Zl, Delegate to Tlluo Rldge 3. Cabinet 3, 4: t'hm'nl Club: Musto Club: Vlce-Presldent Horace Munn Snell-ty 4: lilbrary Club: Phllosophlnn I.lterary Society: 1'ennyrfvynl Club. She goes her quiet way and makes friends with all. ,ludith has selected the pedagogical career. and we pre- dict for her a success in this and everything else she undertakes. CARL Louis BERNHARDT, B.S. Newport Y. lVI'. C. A. Cabinet fl: Agrlculturnl Snclt-ty: Apple ,'lu4'Ig'lng Team: Domocrntlu Club: Slx-One Club: 4-K Club: Glee Club: llnlverslty Orchestra: Music Club. -N You may be right about il--1 don'l know y l Newport, one of Cinci's anterooms, claims this tall Apol- lo. Soon after his First whiskers appeared, the "little blind deity" smote him a mighty stroke, and we don't 1 , believe he has recovered yet. i503 l 4 1 X fp 1916 QE +R! 2 ,-1 ' D 5:7263 'kenfuckian SENIOR CLASS CARL BETTINGER, B.S. Covington But, the future lies ahead "Betts," the modest youth from Covington, aspires to be a champion boxer some day. 1 GLOVER BIRK, B.S. Chem. Owensboro , 'I'1'm-k 'I'vuni Il: lfnlnn Idturury Society. Here is a man who, by earnest endeavor and steady application, has done well as an undergraduate. He fought hard on the track and the gridiron to win a place where he might bring honor to the University. To him should go much praise. EDWARD A. BLACKBURN, B.S. Agr. Ludlow Sigma Chi: Alpha. Z1-tu: l'illl-l'll'll1'l1ll! Poum-ll -I: Edi- Lurlul Stuff, "KEN'l'lIt'KlAN: Bur-:Inca-is NllllHlH'1'l' Val'- stly Hand .limsk il: Bnttnllon I.luutununt :lg Class Foot- hnll 2: Y. M. C. A. 1'ublnvt 3. In "Ole Big" we have a man second to none. His goocl fellowship has endeared him to many. His enthusiasm and a spirit of progress have satisfied demands of the most exacting. His work in college is evidence that he will get what he goes after in life. ALFRED DUNBAR Bosuzv, B.S. Agr.. Owensboro lfnlnn l.Itt-rury Society: Ag'l'tcuItul'ul Such-ty. We have not yet become reconciled to Alfred's change to a Chesterfield in his Senior year. In September he could carry a cane more gracefully and wear a mus- tache more unconsciously than any other in the class. At the same rate he should be Commissioner of Agri- culture in two or three years. C50 Q 332, 91916 ve 5? . .39 gh? rZCQf'?7lLlC!6fC1l'l 'W SENIOR CLASS CHARLES LEROY BOWERS, B.A. Newport Y. M. C. A.. Cablnut. 4: Cuthnllc Club: 4-K Club: Democratic Club: English Club: Patterson l.tt:erary Society. "Roy" hails from Newport. He prefers to watch the battle from the hilltops. His favorite poet is "Brown"- ing: his favorite spot the library: favorite color, "Brown." ELIZABETH CARLETON BREWER, B.A. Eminence 'Kumm Kumm Gummu: Y. W. C. A., Secretary 1, 2, Cabinet. 2: Strollers: Choral Sncl:-ty: Phllosophlun So- rtt-ty: Cust oi' "College Willow" and "Call of the Blood." Divinely tall and most divinely fair "Carl" started out to lind fame in the realm of Mathe- matics, but after finishing Physics, Chemistry, Calculus, and Analytics, she decided the scientific course was too easy. So in her junior year she enlisted as one of the humble followers of the Arts. She has never been idle in the study of History, and especially of the lives of great men. For more than a year she made a special study of the personal life and characteristics of "Ar- nold," and since that time has turned her attention to "Boone" and "Clay," HAZEL BROWN, B.S. Lexington Irlbrury Club, S4-cretury -l. Hazel entered school as the middle member of the "Bugology Firm A. B. C." But when the firm dis- banded, she gave up counting the number of fingers on the hand of an ant, and devoted her energies to "Bow- ers." She has gone unscathed through Physics, Chem- istry, and Geology, and is now prepared for anything that may confront her. But we predict for her in the future: A path through the Arcadian land of golden sunshine and breezes, with "bowers" at her right hand. where every word and deed pleases her. ILEY BAKER BROWNING, B.S. Paducah films:-x Ifuollmll 1, 25: Preslflont IR-nnyrnyul Club: .luck- Hun l'urr-hnse Club: Ubsorvutury Assistant. lley can tell you the age of the hills as well as a jockey can tell the age of horses, and he knows all the slips and faults of this old earth. C523 ses- sa 1916 .- 53 qi Q 7845? rr fr.: C fi I fr f 'I 4 ' fu ff, .... .. L..- l Ile - l lil I ' l l Ein SENIOR CLASS l IM I l l is I g l I ARMIEL. CARMAN, B.S. Agr. Paris, Tenn. Alphu Zn-tai: AI-Zl'll'Ull.lll'Ill Soc-ii-ty: Bnskvthult Nan- ' anon' Il. Armiel has applied himself well during his four years l t I' in college, and is established in a high position in the eyes of faculty and student body. His is the nature that makes strong men successful. 11 fl 13 l I' ll l l il ELIZABETH ROBINSON CARY, BA. fl l Versailles l N Knmm Kappa Gummn: l'lrlIoso1rtIt1m l.tLvr':u'y Sm-loty 13 l' ,Class l'I-nplwt, Ulnss of 'IRQ Y. 'W. C. A.: Stnft' and Q xl 4 f'l'f1XVl't. I J 5 V We borrowed Elizabeth from the Class of 'l3, and feel il! the gainer thereby. ln spite of the handicap of ill 4' I health, she has made an excellent scholastic record, and l l has a wide circle of friends. f I I S 5 SAMUEL JEFFERSON CAUDILL, B.M.E.. I I Il Shelbyville W . lx 1 ' 'Pau Bum Pi: ltlunnyxoi- Class 'Football 2, 4':ipt:itn 2: l - Kc-rnvl Stuff st: 'lll'llllHll Stuff 4: Mountain Club: Pat- l I li tersun l.itvI'ury Society: l.ig'htwi-lglit Uhaunptun Boxt-rg j 4 Du-mom-rnliu Ululrg Pick und Shovel. l l I I l l Caudill has the peculiar distinction of being the only l 2 l Senior in his department this year. After some stay at l 3 West Point and Valparaiso he decided that the Univer- Q V I sity of Kentucky needed him. He is true blue and of 5 l the 42-centimeter caliber. i l I 5 l l GEORGE I... CI-IERRY, B.M.E. Bowling Green Tau 131-tn Pt, Junior Honor Mun: l'rcsi11f-lit -I: Dolo- Irate to 'Pau Bum Pt Uonvvntton 4: SccrotuI'y-'I'I'cnsL1I't-1' A. S. M. E. 4: Vtco-l'I'1-sith-nt Mum-hnnicals '16. I I Hom shall he become wise lhal holclelh the plow I ' l Whose discourse is of the sloclf of bulls? Therefore, George became a mechanical, but he is seldom seen with the sign of his profession, i. c., leather apron and a rule. He deals with the higher problems of mechanics. He is studious and businesslike, and has many friends among the students and faculty. C531 IS nf' if an 1916 6.1. f fgggmg J 5 QQ 7AfQmfefzC!cian I l ll ll A l Il .H l l NS SENIOR CLASS ERNEST HAROLD CLARK, B.M.E. Lexington Kappa Sigma: 'l'mI Beta Kalte: A. l. E. E.: A. S. M. E.: Muclmniuuls ol' 'lG: Class Football 1, 2. We don't ltnow why they do, but they do. Harold is one of those who has deprived us of the pleasure of his company except at rare intervals. We feel the loss. MARCUS JEROME CLARKE, B.S. Agr. Owensboro Kappa. Alpha. In a manner characteristic of the typical Southern gen- tleman. "Romey" has met the vicissitudes of his college life in a manner which places him high in the esteem of faculty and friends. "Petty" influences have played their part in his quest for higher education. WILLIAM WHITLOCK CLARKE, JR., B.C.E. Owensboro Phl DI-lta 'l'lI0tn: 'Pau Beta Pl: Lump and Uroas: Mya- tlc Thlrtucn: Keys: 'l'au Bt-ta Kakc: Class Football 1, 2: Battullnn Me-dal 2: B. S. U. E.: Trunslt Stuff 4. "Bill" is a true leader and a capable one. He is the sort that is liked by his friends and respected by his enemies. These lines are but a vain attempt at record- ing what he has done in college. J. FRANKLIN CORN, B.A. Harroclsburg Slzma Alpha Epallon: Lamp and Cross: Eclltm'-ln-Chlef Kc-ntucky Kernel: Varnlty Football 3-4: Student Mom- bur Athletic Committee 4: Class Basketball: Ken- tucklan Staflf 4: l'nnteI'buI'y Club: 'Pau Slgma: Kappa Pl: Sl.I'OllL'I'S Cast 2, 4: Alpha Delta Slnma iplutlgf-J: Glee Club 4. "I claim it was." ".Iudge." Always busy-manifold accomplishments. He banished uloathed melancholy." but called heart-easing mirth to him., Some of his say- ings may do you good: "When you feel blue, lie down and talce a rest in the arms of 'nature's soft nurse.' "I always do the best I can, and that's enough." C543 ki 1916 '42 9 ZW 75Qf2fz1cfkzczn fi: 'AEE SENIOR CLASS NATHAN MINTON CREGOR, B.S. Agr. Springfield llm-ut-v ltlxum l.lto1'm'y Soolt-ty: tilt-0 Ulub: tlhurul Su- ulcty: Au'rlt'ultut'ul Suvlvty: Dt-nmcruttu Club: Ani01'l1.'nn Gt-nutics Association 4. Minton has a very pleasant habit of nodding his head and catching his breath when he wants to assent to anything. He certainly has the air of a very busy man, for he rides in a nice little "runabout" at the highest speed, and his pockets are fairly bulging with important documents. HENRY FRYE CROMWELL., B.S. Chem. Cynthiana l'hl Dt-ltu 'l'ln-tu: Mystic 'l'llll'lt'ttllZ lmnilr und Gross: l'un-Hellenic Council 4: First hloutcmuit ltuttullon lt. Unptnln ft: tllou Club. Henry has got about as much out of college life as any man ever gets. More than one girl's heart will beat sadly for a time after he has gone. LUCILLE HARRisoN CRu1cKsHANK, B.S. Lexington Aurloullurnl Sm-lt-ty. ltocm-dim: St-crm-tary 1, tfnrrv- spmiflim: St-r:l'ctal'y 2: Phtlusnplilnn l.lt1-rfxry Society: tlhurnl Club: Asslstunt Iinvtertologlst It, 4. We feel "scearce-ly" competent to toss bouquets at a girl who has taken the straight agricultural course with such distinction. Lucille has fully demonstrated that farming is woman's natural vocation. ROBERT EMMET CULLEN, I..L..B. Flemingsburg lloury Uluy Law Smell-ty, X7ll7lt-l,l't'Hlll0lll -I: I'rulilbltlon tflub, I'1'c-sltlunt 4: l'uttoi-srm lrltornry Suolvty: Ecunmn- lvs Club: Dt-rnmrrutlc Club: Business Munuum' Kon- tucky Law 'Jourrml 4: Manager Lawyers' Football 'Pt-am It: Business Man:ir.:t-r "Kontucklun": Class Glfturlnn: NVlnncl' nl' tho Amorluun lruw Book Uunipniiy Prlzu lt. Thal'.s lrueg do you want me lo lell you why? When the class was looking around for an honest. energetic man for Business Manager of the Kenlucfgian. Cullen was first choice. He hopes some day to be able to hand down wise and just decisions from the Supreme Bench. His method is to "hew to the line and let the chips fall where they may." C555 i:-,.-3b:2ligg,.:"Lg:3'gLc1.4L.5-9 1916 5 ""' yr I fjfae Vfenfuckian il'.T.'i, SENIOR CLASS INA MARION DARNALL, B.A. Nashville, Tenn. Hiatt' and UIWHVIIC l'lzII-is SI-I-I1-l:u'y 1: ,l'llll0!-ltllllllllll So- uloty, ',l'l't'i1Slll't'l' 1, l'l'I'Hlfll'lll. Il-fl: l'lm'nco Munn, Suu- I-I-tiwy 2, VlK't'-l'l't'HlIl0l1l lt: Y. W. 17. A., Cnblnut Il-fl: Uvlel-filtu 10 Y. W. IT. A. C1IIIl'oI'I-III-u ut Blue Rlrlgc :lg l.ltcI'u,ry Club: l'IvnnyI'uyul Club: Strollers Gusts "Lost l'XlI'Ll.lillSU" 1, "HiI.:'lIoI' Edum-ulluII" 2, "1'yg'mullon and Gulntoit' 2, "t?lIaI'luy's-I Aunt" Il, "Kentucky Bolle" 3, "Gull ol' thu 'Hl0u4l" Il. Maiden fair with lhc golden hair lna is of that singularly happy makeup which does not know defeat. For four years she has been a shining light in the Strollers and Philosophian. Without doubt she could soon rival "the divine Sarah," if she so de- sired to turn her talent in that direction, but we believe we will hear "Moore" of her in a humbler walk of life. MARY Louisa Douci-IERTY, B.A. lVlay's Lick HI-I-I'utzII'y ui' Ulnss el: llUl'llUl! Mnnng llllllllfllljblllfllli Y. W. U. A. Louise started with the Class of 'l6 in the Sophomore year, but she has made up for lost time by her thorough scholarship and friendly traits. She has the solid sort of virtues that count for most in the long run, and make her a valuable member of the class. EDITH DEAN, B.A. Owensboro Kumm Kaimm Gummu. Edith is even tempered and good natured just to be, the exception that proves the rule about auburn-haired folks. She has been as popular with the whole University as she has with football captains and Y. Nl. C. A. sec- retaries. WILLIAM I-IEWITT Dlx, B.M.E.. Stephensport ' lhlt!t'lHllllI'2llS ul 'lily A. S. M. IG.: A. I. E. E. "Which" has always been a steady, hard-working fel- low, spending a little time in the old "Prep" before he felt "justihed" in becoming a Freshman. Those who know him appreciate him. C565 M"3iffifi'.:,'9 1916 Q799:f:-'Mid It gi: 'ff 9 fn 977162 'kenfuckian I 1.3 SENIOR CLASS CHARLES KEMPER DUNN, B.M.E. Lancaster Pl Kappa. Alpha: A. S. M. E.: A. I. E. E.: Tau Beta Kake: Mcchanicals of '16, President 3. "Scrubby" has scrapped nobly for four years, getting little credit in the way of popular applause for his efforts, but he has the satisfaction of knowing .that she appreciates. ORDIE MORTON EDWARDS, B.A. Caneyville President Senlor Class: Patterson Literary Society, President 4: Horace Mann Society 4: Henry Clay Law Society: Organizer Republican Club 2, President 4: Class Football 2: Charter Member I. P. A.: Champion Welterweight Wrestler 1: Champion Heavyweight Wrestler. "Ed," the quiet man from Caneyville, is strong for action. "When he leads a mule to water he can 'darn nigh' make him drink." His enemy is his friend when he knows him. LILA CAYE ESTES, B.A. Lebanon Alpha Xl Delta: Start' and Crown: Y. W. C. A.: Pres- ident ol' Phllo ophinn Literary Society 3: Vlee-Presb dent of History Club 3: Representative Pan-Hellenic Assoclatlon 3, President 4: Strollers. Lila is a delvcr into the archives of Egypt, Babylonia, and Greece. ln this last year she has not only been a faithful member of many organizations. but in spare moments has found time to get her diplomavand "run Elmendorf Dairy 'to boot.' " JAMES NAPOLEON FARMER, LL.B. Somerset Delta. Chl: Tau Kappa Alpha: Union Ltterary Society: Varsity Debating Team 3: Assistant Editor Law .Tour- nal 3: Henry Clay Society: Glee Club: Strollers, Cast 4:, Republican Club: Mountain Club. If it is a campaign manager you want, here is your-man. Jim is just about the best in these parts. But we cannot get away from thoughts of him as "The Major." C573 I l l l 4 l E l ll l 4 , li ,Jil jj .LI R 3 1916 , s..f,...f,,,,'j3f 9561 75Qnzfuclcian SENIOR CLASS ANN ELIZABETH FARRA, B.S. Home Eco. Nicholasville Slnfi' and Crown: A5:l'lcultuI'al Snulvty: Phllosoplilun, Vlco-1'I't-slrlcnt 3: Y. W. C. A., 1"rI-sltlont 4, Blue Ridge Deli-gate 2: Cm-It of "Kentucky Belle" Il: Ilomo Eun- nomlcs Club, VIL!!!-1'l'USltll'lll. ll, 1'I'oEtdont. 43 Deli-gate to Kentucky Student Voluntet-I' Convention 3: Student Assistant ln Home Economics 3, 4. "Betty" is about the busiest somebody you ever saw. She is the patron saint of all Y. W. C. A. projects, the guardian angel of the Home Economics Depart- ment, and the loyal advocate of democracy, friendliness, and frankness. HERBERT FRANKLIN FELIX, B.A. Eng. Hartford Kappa l'lg llnlun hltc-I'uI'y Snulely, l.'I'csl1IuIIt -lg lizllgllblll Club. Undoubtedly Herbert can ask more questions than any other man in the graduating class. There is about him now, however, a certain serious air that bespeaks prog- ress. An unquenchable desire for work and a latent talent will certainly put him near the head of the list in after years. JEAN OLIVE FIELD, B.A. Lexington l'lIllusII1IlIlun l.lteI'I1I'y Society: l-lorucu Munn: l.lbt'u1'y tflubg Choral Society. jean entered upon her duties as a Freshman with the rest of us, and has toiled through the four years with never-flagging zeal. But so quiet has she been withal that very few linow her talent for poetry. She was class poet in her high school days. Will she devote her time to teaching, to voting, or to household science? is a question still unanswered. JOHN SHUFF FISH, B.S. Agr. Georgetown AgI'lIeullu1'nl Society: Delnourutlu Club. Fish hails to us from Georgetown, and very few people know him, so quiet has been his stay here. He is a constant worker. C589 QQ- ,:.IQl6ef""ff" ,E - ff f f we Q 77enfucfczan CZ' SENIOR CLASS RICHARD ALLEN FOSTER, B.A. Marion Puttorson Lltorury Society. Wlnnor oi' 1'atterson Ora- torlcal Medal 2: Canterbury Club: Alpha Delta Sigma: Horacu Mann Literary Snclf-ty: Library Club: Treasurer Democratic Club 2: Annual Staff 4: Glue Club. It was good to have old "R. A." back after a year's absence, during which he was Principal in the Som- erset High School. A writer of sweet verses, a singer of sweet songs, and a giver of philosophy, Allen is an ideal companion. Allen will go to Princeton next year, and we expect him to make somebody "sit up" and take notice when he gets there. SUE HUNT FROST, B.A. Louisville Horace Mann Soutety: Hlstory Club. Sue Hunt has always been known as one of the hardest workers in her class. She has a certain fondness for dramatic readings, and the intensity she always puts into them makes them remarkable. ABE DAvls GALANTY, B.S. Chem. ' Maysville Economics Club: Sigma Alpha Mu Abe's selection of studies in the University probably accounts for the fact that he has made little or no noise. He may do it yet. JAMES DoUcLAs GARRETT, B.M.E.. . Fort Garrett Sigma Chl: 'Iau Beta Kake: Mechanlcnls of '16, Pres- ident. 1, 2: A. S. M. E., Chalrman 4: A. I. E. E.: As- sistant Basketball Manager 3. . No one will ever question whether "Pisgah" got what he came here for. Earnest application has brought a light to his eyes that stamps him as a thorough engineer. As is the case with all mechanicals trained under the masterful mind of "Little Paul," Dan leaves "State" convinced that he could not be better equipped to achieve greatness in life. 691 Q 32 r 9 1916 cs J 3 F ir W 1 l A , It 0 A l f 1 L R977 LlClCldH, Q, Q , f ' ' Q ' N 'l A , . J tl : 2 l il fl l -. L 3 SENIOR CLASS , J OT'ro PAUL GERHARD, B.S. Agr. V Covington 5 , Mysllc Clrcle: Lamerl Pe: Kappa. Pl: President Four-K 4 i Club 3: Strollers 2: Vlce-President Democratic Club 3: Art Club: First Lieutenant Battalion 3: Agricultural Society: Art Erlltor "Kontucklan" 1914: Blologlcal Club: Business Manager Varsity Handbook 3: Y. M. t'. A. Cabinet 3: Patterson Lltcrary Society: Jeffer- sontan Club. . 1 , l "Hyol" Did you ever have him greet you in that H i language? "She's a keen little girl." Did you ever A hear those sacred words fall from his lips? They I couldn't get along without "Hootie" in the University. ' He is certainly an artist, but somewhat more of a sclen- ' list, especially when it comes to chemistry. l FRANCIS SALVINI Gmocci-no, l..L.B. l A Lexington l'hl Alpha Delta: Henry Clay Society. F. S. is an earnest and well-liked fellow. There is but one objection to him-his fondness for politics. His ballot was for a long time the bone of contention in the famous "Senior Election." U X Joi-iN THOMAS Gooci-1, B.A. Hanson l Pr:-sltlent Domncratle Club 1: President Henry Clay Society 3: President Union Literary Soclety 4: Vice- Presldent l'. C. D. A. 4: Ronresentatlve I. C. O. A. 3: , Winner Clcws Prlze 3: I.L.B., '15: Glue Club: Hlstnry Club: Horace Mann: Kernel Staff 4. l Deep learned in the lore of love J. T. loves to sing-especially that little song that starts off: "Dinah, when l gave my heart to you." He has completed about eight years' work in the University t in about five. He believes in jogging on like the ped- , dler, and that a "merry heart goes all the day, but a sad one tires in a mile." 4 l v ANGUS NEAL GORDON, B.S. Lexington v W B.A., 1914: Agricultural Soclety. I l Angus has a broad grin that is quite infectious. But he can assume an air of mock seriousness at times that is puzzling. The thought often recurs to us, how does 1 y such a disposition help a man in a love affair? l l C609 3 ,il 1 S--S A-A-or 1916 - as A -0 l hs. .L-..,-.L ...., -.L,.....,, t Ci VL. S A ij 1 'I l l l .L I I. lj I I l v I I I l . I i l 5 l 4 I I l l --. -. X Q gfiee ikenfuckzan , SENIOR CLASS HERBERT GRAHAM, B.A. English Frankfort Sigma Chl: Alpha. Delta Sigma: Lamp und. Cross: Editor-ln-Chlet "Kcntucklan": Strollers, Cast 2, 4, Stage Manager 3, Presldent 4: Athletic Cmnmltteo, Secretary: Student Manager Interschnlnsllc Moet 4: Canterbury Club: Battalion Lieutenant 2, Cnptaln 3: Kernel Start 4: Y. M. C. A. Cabinet 3, 4: Editor Var- slty Handbook: Unlon Llterary Society: English Club. One glance at Herbert's achievement list tells what a power he has been in University life. Quite unas- suming and yet one of the most forceful characters on the campus, his inliuence has been felt in almost every college enterprise. With all this, Herbert is la student of ability, a man of high ideals who makes friends readily and keeps them. LOGAN NOURSE GREEN, LL.B. Hopkinsville Phl Alpha Delta: Mystic Clrcle: Henry Clay Society: C1088 F00tbt1ll 1, 2. "Pinkie," like the big little man that he is, has won an enviable position in the hearts of "State" students. Always willing to help out in the fun. or bear in his turn the brunt of practical jokes, he is almost without an equal. WILLIAM JEFFERSON HARRIS, B.S. Agr. Nolan, W. Va. Sigma Alpha Epsilon: Mystic Thirteen: Dairy Team 2: Wlnner ot' Saddlehorse Judging Trophy: Kernel Board ol' Control, Chairman 4: Lamp and Cross: Business Manager Kernel 4: Turtles: Agrlcultural Society. elf has bri htened thin s a lot with his read hand- 9. 9 . Y . shake and smIle. Only one memory of him will bring regret, and that is the recollection of a Hower bill. His talents are varred, which his list of achievements will show. FREDERICK AMBROSE HARRISON, LL.B. Lexington Tau Kappa Alpha: Clnclnnatl-State Debating Team 3: Varslty Debating Team 4: .Tunlor Callaghan Prlzo 3: Associate Editor Law Journal Il, Edltor 4: Assistant Business Manager "Kentucklan" 4: Attorney-General and Treasurer Henry Clay Law Society: Patterson Llt- erary Society: Democratic Club. "Fritz" is an all-round good man. He is already a lawyer of considerable note, having practiced two weeks while in college, and among many other things he saved a man from wearing the stripes. YQ: ' .KE 'I as 3 1916 6+ g S' G SENIOR CLASS JOSIE. LACER HAYES, B.A. Owensboro Y. 'W. U. A.: Phtlosophtan Literary Society, Treas- urcl' 3, 4: Horace Mann lstturury Society: l.lbrary Club. just ask the professors about Josie's scholastic record! She "kills out Tige" with the same ease and com- placency with which she garners in the "A's" in geology. Few University students have ever had a better stand- ing for the four years' course than she. J. SMITH HAYs, JR., LL.B. Winchester Htprniu. Clit: B.A., B.S., Kentucky 'Wt-sleyan. Only the desire to add an l..l...B. to his collection of degrees caused this sunny personality to pause at "State" before entering upon what promises to be a most bril- liant career. ln this short time Smith has achieved distinction in his college and has a large circle of friends. ROBERT MILLER HEATH, B.S. Agr. Bedford llnlun Lllorury Society: Class Funtbull 2. 1'm nal noisy, just loud "Bob," the big curly-haired boy' from Bedford, is always ready for a scrap. He holds the "long-winded record on the Senior 'Heaven' telephone." An hour and a half was five minutes, and five minutes an hour and a half. When once on the track may he roll straight into the station. ELSIE. B. HELLER, B.A. Paris Phllusophlun: Varslty Basketball l. Lt, ll. ll, Manager Il, Captain 4: Km-rncl Stuff 43 Board ot' Control ol' Ker- nel 3, 4: Y. W. C. A. Cabinet R, 4: Dr-logate to Blue Ridge 33 Vtci--Prostclcnt Class Il: Staff and Crown 4. One look at this list of achievements is quite enough. There is nothing left to say. But it is a safe assertion to make that there has never been a more representative and popular young woman in the University than Elsie Heller. 4623 ' GT' 1916 ei 382. E 9 f"'J3',,wlT"19 Q59 fkenfuckrian Q 382 A l I R Il 5 l l 'nl V l l 'l l 1 4 l l it 5 -l l lr -5. Q E1 , ,fa We ikenfuckzan fs' SENIOR CLASS LAURENCE JEROME HEYMAN, B.S. Chem Lexington Gamma. Alpha Kappa: 'Pennls Club: Patterson Lit- erary Flmvletyl Uuptnln liuttullon ll, Cnptuln and Ad- .lutunt 4: l-llstm-y Club: Snapshot Edltor "Kentucklun." For months we have been expecting Laurence to desert us to join the Kaiser. But now we expect him to go into Mexico. There he may gratify his great passion for the military. Joi-:N HENRY HOGREFE, B.C.E. Independence B. S. U. IG.: Four-K Club: 'l'l'nc-lc 'l'unm 1, 2: lloldur ol' 'I'wu-Mile Ruvnvslg 'Plmmus .lm-l'l'ersum Uluh: lleniownllc Ululr: l'nttt-rsvm lrlts-rnry Sm-lotyg 'l'rlum:la- Uluhp R. 0. Y. D. johnny is a track man of note, as the above record will show. He is determined to'be a skilled engineer some day. We suppose he will. MARSHAL GILMAN HORTON, B.M.E. Braclentown, Fla. Mvvlmnlc'ul:-1 ot' '1ti: 'Pau Bout Kuko. How are we to "spring something" on a fellow who has. carefully avoided the spotlight always? We give it up, but we will risk the assertion that he is a good fellow. LEAH KATHLEEN HOWARD, B.A. Owensboro Horace Munn Snclutyg Musto Club. Quiet, calm, and goodnatured, Kathleen has done little to put herself in the limelight in University affairs, but she has a circle of friends that are bound to her closely. For awhile she was inclined to "Foster" some strange ideas, but it seems that these have been forgotten. C633 Q R E 91916 e ' f elgiififii--W9 J Q Qnmckian , ,,. ff' l'l ll ll ' 1 l l l l SENIOR CLASS MARY WELLS HOWARD, B.A. Benton Phtlnsophtan l.tterax'y Society, Secretary 2, 3, Ser- geant-at-Arms 4: Penny:-oyal Club, Secretary 2: Y. W. C. A. Cabinet. Il, 4: Horace Mann Ltternry Soctoty, Vtco-Prosldt-nt 4: Delegate to Blue Ridge 3: Y. W. C. A. Vice-President 3: Vice-President Class 4: l.tbl'm'y Club. The compliment of being elected Vice-President of the Senior class is enough to show convincingly the regard in which Mary's classmates hold her. Dependable, thor- ough, and sincere, she has "put Benton on the map" in the University. BENJAMIN DAVID I-lows, B.C.E.. Elizaville 'l'uu Bom Kuke: 'thomas Jelferson Club, Vtce-'President 2: Brooks Engtm-erlng Soctcty, Prfsstdcnt 3: Class 'Bas- kc-tlmll 1, 2, t'npl.aln 1: Assistant Football Manager 32 'Prunslt Stuff. We are such stuff as dreams are made of, Our little life is rounded with a sleep We don't know anything especially bad to tell on "Frcshman." But let us whisper something in the gen- tle reader's ear: lf a feller ugits in hard luck and would name it to Ben, he'd lend him a dollar and like as not he'd have to turn right around and borrow a dime." AARON BARON HUFF, B.M.E. Berea Mt-clmnlcnls ol' '16: A. S. M. E.: A. T. E. E. A few there are who bear the burdens of life uncom- plainingly and unnoticed, seemingly without getting any recognition for it. Such a one seems he, but, having applied himself and having a definite purpose, it seems that after graduation happiness and ,success will await him. ROBERT EDWARD HUNDLEY, B.M.E. Owensboro Class President 3: Owensboro Club, President 4: 'Pau Beta Pl: Six-One Club: Athletlc Committee: A. I. IG. E.: A. S. M. E.: Meehnnlcals of '16, Ed has tripped about on many a festive occasion, but he has also found time to make friends who will always stick by him. t64D Q 51916 ce. 4 - 'J A -. 4 Q 185 31 9759 Wenfuckzan EL, SENIOR CLASS WAYNE DICKERSON ILER, B.S. Chem. Covington Union Literary Society, Vice-PM-sltlcnt 4: Fmlr-K Club, Secretary-Cl'x'0asul'cr 4. The fact that Wayne is going to graduate in Chemistry proves that he considers no task too gigantic. This is honor enough to be achieved by one man in an ordinary lifetime. - MARGARET INGELS, B.M.E. Lexington Meclmnlcals of' '16, Secretary 1, 2, Il: A. S. M. ld.: A. l. E. E., Secretary 45 Staff and Crown. "Maggie" has the distinction of being the first and only girl to graduate from the College of Mechanical Engineering. She has not been a hanger-on, but has taken everything in the course from forge to the Senior trip. While not much given to pushing her views to the front, it has come to light since the war began that she is decidedly pro-"Dutch" ARCHIBALD LEONARD JOHNSON, B.A. Johnsonville Captain and Quartermaster 3: Treasurer Dcmocratlu Club 31 Horace Mann Literary Society: lrlbrury Club: Mountuln Club: Pvc-Medical Society 4. Johnson is a true representative of his native heaths, and, "by jacks," he is proud of it. His aim is to be a leader some day in the medical profession. He is the "lVl.D." of Senior Heaven. ' LESLIE PLHILLIP JONES, B.S. Agr. Sedalia Unlun Literary Society: Agricultural Soclcty. With a determination and studiousness seldom equalled. L. P. has managed to handle a University course in three years and still manage to get back to the farm before May. We believe that She must have figured somewhat in his early departure. C659 io 1916 e JJ I I l Z P. ' .............f--x f""""I'f'fI" ' ' ' 'df' fg Q 'WSI 'fiff if Lan 'I fi:fQ1-n.....--gdb-4'jf4.,'l,.Qlf.ljlffe' 'ff L' f. IL, I' "V '5-1 I 5 5 1'-ff-1 '-If Q' if --8.24-7' if If ' I ' ' l I I 1 i l i l . l I SENIOR CLASS I I I I I I I . i l WILLIAM CLARKSON JOHNSTONE, B.S. Agr. Nicholasville Al-Yl'll'llltLll'tll Soott-ty: Applo Judging 'IR-nm 35 Student Assistant ln i'l0l'llCllllUl'0 4. , li We are proud to he called the classmates of such men 5 as "Bill,f' for we know that his highest ambition is to I f be a man worthy to be called a citizen of his State. 1 , I I 1 I ll i f WILLIAM TAYLOR KENDRICK, JR., I..L.B. 3 I Los Angeles, Cal. i ' Doltn, Chl: Henry Clay Sm-tc-ty: I'ItttcI'smI Trittwait S Sm-If-ty: 1'rnhtbttlt.mn Club. I l I We have not recovered yet from Bill's wonderful tales l ' , of his athletic prowess. Finding life rather tame here, l " he did not linger long in our midst, but returned to his I 1 1' native West. i l ' l S ' E . I CHARLES FRANK KUMLI, B.S. Chem. I :N Midcllesboro Everyone knows that Kumli must have achieved while in college, but his own versio,n of it could not be printed. At any rate we wish him well. I ROBERT HENRY LAND, B.S. Agr. Pianly 3 Al-fl'it'lllitlItll Sm-ioty: lloinfwiwlltu Club. 1 l, If we knew something new to "spring" on Bob, wi: l' ' would do it with pleasure, but we don't. We have suspicions that some clay he will be arrested for speed- ing in his "llivver." I l I , I ' i I l 166D T3Z'MEil'3 1916 A ffl' v Q59 ikenfuckzan QiEI'l"I1EI A SENIOR CLASS LEON HATCHIG LEONIAN, B.S. Agr. Van, Armenia Apple Judging Team 3: Student Assistant tn Horticul- ture 3, Botany 4: Agrlcultural Society: Cosmopolitan Club, President 45 Biological Club, Vice-1'I'osldent 4: Business Manager Rural Kontucklan. There is a reason, but what is it? We might think about it tor months and still we could not thoroughly understand this son of the East. ANNA Ec.I.I LEWIS, B.A. Franklin Phllosophlnn Lltt-I'aI'y Society: lfIoI'ncu Munn: Y. NV. C. A.: 1'I'ohlbttlon Club: Il.lbI'nry Club. ln her quiet and unassuming way, Anna has made for herself a very worth-while place in the life of the Uni- versity. While her afcclions have ever wandered "back home," her friendships here have been hrm ones. CHARLES WILLIAM LovI-:I.I., B.C.E. Greenville Tnu Beta PI: IB. C. E. S.: Erlltm'-In-Chief' "TI'anslt." A few questions asked at random of the Senior Class will reveal the high esteem in which Charlie is held by those with whom he has been associated. I-le devoted his time to study and to cultivating a wide circle of friends. CAROLYN FRANCES LUTKEMEIER, B.S. Frankfort Philosophlan Literary Society: Agricultural Society: Catholic Club: Home Economies Club, '1'I'easuror 4. Carolyn is a Home Economics major, but she doesn't let it worry her in the least, and she can contemplate even Patterson Hall food without a thought for the bacterial Nevertheless, we predict that she will staI' at the housekeeping business some day. C679 st I a 1916 Q 332 J ' , cw f ff f?3175733W?Tf1f 'fjffft if G A: illfiaif GST W "f?::55i1'f1i,1,T.fi11i: flw, M, -..EV-nl, .. l l l , SENIOR CLASS 3 . l GAMBRELL MCCARTY, B.S. Agr. Owensboro Knppn. Alpha: Lamp and Cross. "Nemo" is a type of the true Southern gentleman whose mild-mannered, courteous ways have made him popular l with all his acquaintances. His quietness has permitted l him to dodge the limelight, but his absolute sincerity and f friendliness have won him a host of friends. l 3 EUGENE THOMAS MCCLURE, B.S. ll Gallup l l I neezl no apology, I speak for myself W "Fats" unquestionably is the biggest man in the class ' when it comes to avoirdupois, and he is no mean man when it comes to brains. 3 5 MoRRis L. MCCRACKEN, B.S. Agr. l Louisville Sigma Phl Epsilon: Alpha Zeta: Agricultural Society: Kappa Pl. If lVlac's ability to draw an income in after life is half as successful as his efforts in drawing illustrations for the Kenluclfian, we can safely predict prosperity for this sunny son of the Falls City. EARLE M. MCGUFFEY, B.A. Barthell Democratic Club: Mountain Club: History Club: Ma- sonic Club. I Still waters run :leap Mac, the auburn-haired son of old Erin, is a lover of his native hills. He does not like to talk, but "lVlyl the R dancel On with the dance, let joy be unconfinedlu Life as it is suits Mac. C633 YQem.-aries?-1E3g382Q,E.g.,,E3 1916 -3322 id 11,4 f Q fkenfuckian , SENIOR CLASS WALTER LlNDsAY MCKEE, B.A. Centreville, Miss. Kappa Sigma: Lamp and Crossi Alpha Delta Slnnm: Pnn-Hellenic Council 3, 4: Mystic Thirteen: History Club: Economics Club. "Maggie" is junior member of the Wallace-Pedley- McKee trio. See one and you may expect to lind the others- For il's always fair weather When good fellows gel together JOSEPH SAMUEL MCMURTREY, B.S. Agr. Vine Grove Brooks Engineering Society: Jci't'ersonlun Club: Class Football 3: Democratic Club: Masonic Club. joe can sing longer, yell louder and use the telephone longer than any other man on the campus. But if you've ever known what it is to visit his home town and feel that hearty, whole-soul welcome. you can for- give him all this. DEE Louis MCNEILL, LL.B. Hickman 'Pau Kappa Alpha: Law Debating 'lfeum 4: 1'rt-sldcnt Henry Clay Law Society 4: President Democratic Club 4: Vice-President Prohtbltton Club 3: Treasurer Put- terson Literary Society 3: First Alternate Varsity Dc- bate with Vanderbilt 3: Attorney-General Henry Clay Law Society 2. Mac, the noisy chap from Hickman. makes himself known and felt wherever he goes. The above record shows him lo be no idler. ROBERT Frrzi-won MACLEAN, B.C.E. Baltimore, Md. Tau Beta 1'l: B. C. E. S.: Transit Staff. Fitzhugh has established himself firmly at "State" by his earnestness, sincerity and pleasant nature. As an engineer he has won recognition already. Undergraduate days, tinged with not the slightest regret, are to him but a preparation for a responsible position in life. C699 Q fig-sg! so an 1916 EQ 9 .9 .Cihe iyfefzfu ckian SENIOR CLASS JOHN ROBERT MARSH, B.A. Eng. Maysville Alpha Delta Sigma: Canterbury Club: "Kentucklan" Staff: Kernel Staff: Captain "A" Company 3: Strollers, Ca t. 2, Il, Secrctnry-'l'rcasurcr 45 Winner of Journalism Prize 3. Only a few men on the campus know ,Iohn's real worth. He has worked silently and calmly regardless of any immediate reward. We who know him know only that when John promises you to do anything, you can jus! as well forget it, knowing it will be done. LILLIAN ANNETTE MARTIN, B.S. Lexington Kappa Delta: Treasurer Pun-I-lellenlc Counell ll: Home Economics Club, Treasurer 3: Strollers. I Did you ever see Annette when she wasn't in a hurry? From the mysteries of Home Economics classes to classic dancing: from music to "hops," she's always rushing to get there, and arriving just in time to have all the fun there is going. JosEPH MCKINSTER MAY, B.M.E. Prestonsburg Gym Team 1: Tt-nnls Club: Mountuln Club: Meehnnlcals of 'lfig A. I. E. E.: A. S. M. E.: Tuu Bela Kake. Joe has always done his share, and it is to be expected that he will walk up to receive his sheepskin and like- wise all subsequent honors with as much confidence and satisfaction as any of us. WALKER PORTER MAYO, B.A., l..I...B. Prestonsburg Vit-t:-1'resldont Henry Clay Law Society -Ig 1'reslden!. Mountain Club: Treasurer Senior Class. Already bearing the burden of a B.A. degree from the "Lone Star" State, W. P. drifted in here for a few years with the staunch squadron under Dean l..alferty's command. He lights hard for the things he thinks are right. C707 are 1916 G 4'-1 V A J l I I f . tI .V :lt 'S iii 1 'I I :I l :S fl .ii gi Il II Y ii Il li ri Ii' SI .Il Hi IS: fi I ll 'I 523 M. 'tah- ici? If Il Il fl fl l le lt lt X! ,, II! :lt It .Is N1 f' 'll' If f"?' -A x,.1 ,flu-. N ,5.,VfPr,7 rv? ffl Q, JI- ,fl rf I Q., I 1 1: .. U J.. I. Ik, 15 L. A SENIOR CLASS HARRY E.. MELTON, B.M.E. Danville PIII Doltn. Thetn: Mouhrtnlcnls nf '1G: A. S. M. E.: A. I. E. E. Harry has almost become a landmark on the campus. by taking two turns at university work. We believe he has done more work than any undergraduate. "Push" is always wanted, though. when there is any fun go- ing on. MARIE LOUISE MICHOT, B.A. Louisville Plillosophlnn Literary Smvlcty, Pl'GSlIl0l'll 2: xvlllltlll' uf Declamntnry Contest 1: Sl.l'0llPl'S. Cust 1: Phorul Sn- clety: Horace Munn I.ltoI'1II'y Socloty: Loulsvlllo Cluh. Vlcf--l"I'esldent 1, SOCl'0llll'y 3. -1: Prolilbltloti Uluh. Secretary 3, 4: LlbI'aI'y Club, President -l. Mary Lou first attained prominence as a sutfragette and a plain and fancy dancer of distinction, but since her Freshman year she has acquired a formidable and varied list of achievements. It has been noticed and frequently commented on that she hasn't been such an ardent woman suffrage advocate for the last two years. We are not certain, but we believe the same reason caused her to go to Paris. BENJAMIN H. MITCHELL, B.S. Agr. Eli Alpha Zeta: Y. M. C. A. Pnblnot It. -t: Bloloy.-:lr-nl Club, l'I'osldent 4: AR'l'lCtllltll'ltl Society, Sl'l'l'0llll'y 3: Unlnn l4li0l'D.l'y Society: Mountuln Club. "Mitch" has worked earnestly and has gotten results. The same sort of "pep" should make him director of the playgrounds of New York if he wants the job. KATHERINE MITCHELL, B.S. Home Eco. Bowling Green Kappa Knppn Gamma: Staff and Crown: Clitxrnl SII- ult-ty: Home Ecnnomlcs Club: Y. W. C. A.: 1Ct'lllt.1Ckl' Kernel Stuff 4: Strollers. VlPt'-ljl'PSlll6llK 4, Cunt 1. :tt Cast nt' "Thu Call of the Blond" 3, "Tho lGI'lklnIr's DnughteI"' 1, "Ruth" 3: Asslstxtnt ln Home Et-mintitlt-I-I. "Kitty" is probably one of the most accomplished girls In the Unlverslty, but one of her accomplishments you will not find lh her list of achievements is the ability of doing a remarkably large number of things at the same time and doing them all well. To show us that she could, Kitty completed her work in january instead of June. UU ssts ries 1916 ST -1: :ff- 9 959 ckenfuckian G- I 385 SENIOR CLASS WILLIAM C. MITcI-IELL, B.S. Agr. Neba Agricultural Society. Bill has friends, which is plaintly evident. We do not recollect of ever having seen him angry. His lasting friendliness has always been appreciated by those who know him. WALTER ELLIOTT MOBLEY, LL.B. Green l'IGnl'y Society. An honest lawyer is the rarest thing on earth Nlobley, the hard-working lad from Green, is the steady old wheelhorse twelve out of twenty-four hours. Hon- esty and franltness is his aim. He hopes to reverse the proverb, "Until h-l is full will a lawyer ever get to Heaven." JAMES l-loIvIER MOORE, B.S. Agr. Marion Class President 2: Patterson Literary Society: Agricul- tural Soctety: Varsity Baseball Manager 45 Republican Club: Student Senate 2. Jimmy has a special weakness for politics. His shrewd insight-has enabled him to wield considerable influence in class affairs. However, an attraction elsewhere has seemed to take his attention away from politics. We wonder is it for life? GEORGE PAGE NEAGLE, B.S. Agr. Smith's Grove Masonic Club, Secretary-'1'reasurcr 3, Presldent 4: Ag- grtcultural Society. George has been one of the big men of the class in both stature and influence. A memory of him that will linger long in the minds of a scattered few is the way he fought for the honor of his class in the gym September, l9l2. He is the possessor of a strength of character and determination to succeed that sets him apart from many of his fellows. C727 K Qs 9 1916 as s 335 W I QA? Wenfaclelan ef fee SENIOR CLASS LECOQ HERC NELSON, B.S. Agr. Somerset Alpha. Zeta: Edltm' lturnl Kontucklun: Foutht-rn Rnll- wuy Scholarship: Class 'l'reasurol' 3: Studi-nt Senate 23 Union Literary Society, Vlce-President 4: A1.':rlcullul'ul Soclety, Prosldont -1: Blologlcul Club. A leader of men, an intensive student and a considerate friend. Nelson has Given lo lhe lvorlcl lhe best that was in him, And lhe lzesl will come laaclf lo him J. W. O'DELL, B.A. , Lexington He look unlo himself a wife And lived happily ever afterward. J. W. has proved the exception to the rule of college students by entering as an undergraduate while no longer a benedict. A quiet thoroughness and earnestness has been characteristic of everything he has done while in our midst. CLIM WARFORD OWEN, B.S. Chem. Mayfield Gamma Alpha. Kumm: Euonomlcs Club: Amerlcan Chemical Sock-ty: 1'vnnyx'oyal Club. Here is another good man who seems to have been overwhelmed by Chemistry. No longer can he even see the attractiveness about Patterson Hall. HOMER PARKs PARRIGIN, B.M.E.. Mill Springs Mcchantcals of 'lllp A. S. M. E.: A. 1. E. E.: Asslstunt ln Machine Shop 2, 3. And yet another joined our ranks after the starter fired his gun. We welcomed Parrigin then, and we send him on his way, a graduate, with our best wishes. C739 W r r 39 1916 Gl l 1 fl Nl 'Tl mi fl lr: iz rl l ifl, lf.: ijt W tw lla l l Q. .l -ss Fl ill .lt ill si? pg: ll Ili 5.5 El, iii ii? ill ul , ,. rl. il' .22 ug. H ll. ll ll l ,I l-2 at ,F gf ly: 131 lii lit W ll: U1 til lil ljl tif ,. .,l 11: Wie 4761? nm ckian .Lf-5-1. SENIOR CLASS LELAND EARLY PAYTON, B.A. Horse Cave Y. M. C. A. Cabinet 2: Pcnnyroyal Club: Idea Staff 3: Lieutenant 3, Captain 4: Democratic Club: Vice-Presb dent Pro-Medical Socloty 4. Payton is a "cave-dweller," but if men in those pre- historic times were as civilized as he, the world has made retrogression instead of progression. GRACEAN Goonwm PEDLEY, B.S. Agr. Owensboro Kapp Alpha: Lamp and Cross: Pan-Hellenic Council 3, President 4: Tau Sigma: Owensboro Club. "Duck" has encountered few obstacles since his arrival here. Even chemistry profs have recoiled before his irresistible personality. A born gentleman, a natural leader, "Gracious" will undoubtedly make good in any line of activity he takes up. EVERETT SMITH PENICK, LL.B. Elkton Sigma Alpha Epsilon: Tau Sigma: Class Football 2: Glee Club: Pennyroyal Club. "judge's" mellow voice has brought joy to the heart of many a fair maid during his term here. It seems now that it has done even more for him. Here's wish- ing him marital bliss. ' DAVID MCCHORD PHELPS, JR., B.C.E.. Richmond B. S. C. E.: Tau Beta Kake: Triangle Club: R. O. Y. D. Dave is a man of few words, and we have been able to find out littleabout him. It is our suspicion, how- ever, that much might be learned about his "future" from one who lives not far hence. 1749 i l l l 4 1 l "'. I lflyff l 1 . ll l l 1 l i . l l . - -11 g l l A li 91 J' gl' rf SMI! t V . V , ,..-,, .f -, .- ., ta 1' .,,.. . ,.,.. . 'fy J 1 1 1 ', 7 i , . ,, , .1 .- . - . I x Y-.,..' A-,,...... . ,.....g- ,'k ,rf W LMA, , y ' A 3.,,.gfj,,.,1w-M WJ' V' J 4.1, Q., ,6 'ki 4.,, Jl 1 fi I l at tr' 1 SENIOR CLASS ERNEST RAYMOND PURSLEY, B.M.E. Hopkinsville Meclmnlcals ol' '1G: A. S. M. E. A. I. lil. E. Here is a man who deserves much credit for the work he has done in college. Although busy a great part of the time with outside work, he has applied himself to study with such thoroughness as to get better results than almost anyone in his class. ARTHUR JINKS RANKIN, B.C.E. Rankin Business Manager Trunslt 3, -lg B. C. E. S.: Tuu Beta Pl: Mu Alpha, Mu. A. is one of the quietest men we know, but as a musician he is there. He is recognized also as some engineer. HELEN RECORD, B.A. Pikeville A roving life I love Helen joined us for one brief year after touring the principal universities of the country, returning to her native State only after she had been in the far West. A quietness and sweetness has brought her close to those who know her. A HOMER LLOYD REID, B.A. Lexington Student Assistant ln Mathematics 3: Vice-1-'rcsldcnt Prohlbltlon Club: Tennls Club: Vlcc-Prcsldcnt Patter- son Llternry Society: White Mathematics Club. Along lhe cool, sequeslered vale of life I long lo slray Reid came to us in his Senior year from Eastern State Normal to put on the finishing touches at "State." His knowledge of mathematics no mortal would doubt. .t75J . -, .- .... . 1W"i"SHl W 'j ",' ggjflif-2T'V'4,,g,,,,r :J I 6 1 ,ii-"sf" l n YY? V 959 75enfuclciczn e LE Sw SENIOR CLASS JOSEPH CARR REYNOLDS., LL.B. Nicholasville lnturuolleglnte Prohlbltlnn Assnclatlon, State Secre- tary 4: Henry Clay Society: Law Journal Staff 4: Cathollc Club. Carr has not made much noise, but has worked along in a substantial sort of a way, getting what he wanted. We are told he is fond of black-eyed girls and "rolling." LEO JosEP1-1 SANDMAN, LL.B. Louisville B.S. 1914: B.A. 1915: 'Pau Kappa Alpha: Canterbury Club: Strollers. Cast 1912-13-15, Stage Manager 1914: Glee Club: Union l.lterary Society: Winner Inter-C0l- leglutc Oratorlcal Medal. As a songster and actor, Leo has not an equal. His chief athletic diversion is earning degrees. We wonder now sometimes whether his heart is in the law or dra- matics. X RICHARD WARD SEARCE, B.S. Agr. Lebanon Alpha Zeta: Assistant Blologlcal Laboratory: Agri- cultural Society. It is pertinacity that counts, and "Dick" believes it. We hope that this virtue will stand him in the same good stead in later years. We wish them both hap- pmess. GILBERT BERRY SHoUsE, B.C.E. Lexington Brooks Engineering Society. He, too, fell a victim to the wiles of a woman and was unable to finish his course in "single blessedness." If there has been any change, though, it must have been for the better. His work in college has been charac- terized by thoroughness and earnestness. C765 Q 9 1916 easel 9 4 1-3 9759 Ckenfuckzan Gi 'Cf l SENIOR CLASS REBECCA WASHINGTON SMITH, B.A. Eng. Paducah Kappa DI-lla: Stuff mul t'I'rIwn: Y. W. U. A. tfublnot 2, 3. 4, Blue Rlcllre DI-logntv 2: lN'llll0H0Dlllflll l,ltnI'nI'y Soclcty, Vtcn-1"I'ostIlent tl, Crltlo 3, Prize Essay Il: Strollt-rs, Cast 1, 3, fl, xylifl?-l'l'PSltl0l'll Il: K1-rm-l Stuff It: "Ic0HlLlClKlilll" Stuff st: Class 1'I'oplIet 4: l'I-niiyroyxil Club: English Club, Uliatrmnn 4. Here we have the personification of the ideal co-ed collegian. A masterful student, a natural executive, charming before the footlights and on the ballroom floor, Rebecca possesses a rare versatility of nature which accounts for her popularity with both faculty and fellow- students. ' WILLIAM LEE SMITH, LL.B. Sebree Dt-Im l'tIt: tllut- t'lIIh: lli-nry Flux Sm-lt-ty: Str-ullt-I's, Vast Al. Willie Lee has gained considerable notice as a noise- maker. He is something of a warbler, but his big claim for popularity and renown is "Father and the Boys," and his own role in it. KATHLEEN SULLIVAN, B.S. Home Economics Richmond Alpha Xl Delta: l"litlIIsI4IIrlIlnII l.ltoI'aI'y Snr-II-ty: Slrnll- ers: Home 1El'Illlt'1l'l1ll'H Club: Y. NV. P. A. Kathleen has come through the trials and tribulations of "The Department" with flying colors. She is famous for her kind and gentle disposition. She is always laughing, and it can be said of her truthfully that no one ever saw her angry. So unbounded is her good nature that we believe it will be able to withstand the worries to which a school teacher is heir. ln this, her chosen profession, we wish her all success. MITCHELL S. SULLIVAN, B.M.E.. Mt. Sterling Mr-chnntcnls of 'lfig Vnrstty 'Pruck 'l'I-nm 23, It: llultlcl' nt' Ont'-Mile llt'C0l'll tn I'tllVl'l'Sll3'. "Mitch" is a quiet, earnest, hard-working fellow who will undoubtedly make his marlc in the world. Even though he has caused little excitement while in college. he has gotten results and has a host of friends. C773 v., e 282 9 1916 ee. J ..f . 1 L 1 , 1 his ,.1 ti' In 1 1 5 1 1 1 1 1 2 l 11 1 1 1 1 N.-. 11 ,il 1 11 1 ill l 111 111 11 11 -li ' 112 M. lift' 153 111 1" 1 lil . ,1 1 1 A X.: 1? ' :Z il' ill 111 ' H1 111 li il! 111 111 111 .-1 V1 1,5 111 11' 1:1 111 1. 111 11 11 ii 111 1.1: 11' 111 11,1 111 .1' 1? 111 11? 11 Hi 1 1,1 111 111 131 111 111 Q11 111 1117 111 1lA A1 K ,.,..,.:, l 1 1' 1 ...f?w,..Nf- ,WM--,Q 1 ,- .......---. 1 . 2. A l V1 1, 1 1 1 , 1 1 1 1 l 1 1 1 1 1 1 1 fx - 1' ' , , f ,,-, , SENIOR CLASS KING SWOPE, L.L..B. Danville l'hl Delta Theta: B.A., Centre College: Law Debating 'lk-nm: Henry Clay Soclety. t Not having inquired into his history at Centre, we know very little of King's scholastic life. At any rate, he has "the gift of gab" and is some stump speaker. THOMAS CONWAY TAYLOR, B.M.E. Greenville Alpha Tau Omega: Mechanlcals ot' '16, President 47 A. S. M. E.: A. I. E. E.: Pan-Hellenic Council. Tom is the quiet sort that does not continually remind you that he is here.--But in his own solid and substan- tial way he has been getting good things that many others have overlooked. NORMAN N. TERRY, B.S. Agr. Fulton Agrlculturul Society. Norman is known about the campus as the man with the broad "understanding," so broad that one cannol approach him, though, on every side. His power has always been felt in class politics, but this was lessened somewhat in his Senior year. Answer: SHE. RICHARD SToKEs THOMAS, B.S. Agr. Falmouth Agrlcultural Society, President 4: Alpha Zeta: Demo- erutlc Club: Student Laboratory Assistant 4. "Dick" may not be a "light" in the social world, but he is a "gun" in the Ag College. And when he be- comes director of a state experiment station may he reap the rewards which come to one who has done his work well in a chosen field. 1 4: V . . .-ij" 1 3 ' , . ', . V V 1 ,, ,l',.f.:,,:,g'5?4Z I L: V2.- .4 -- ,' gr - : 5.,,f,5L,- -,, ' 'ri A Q' '11 ' '11i"r'-':1t2'.is iZ?l,:1., 1rzfafl":1?.LYP11f:3'?1isi C737 . ee.. . IQ . ,-,.-,,.e N-...W """"": 'f'?7Zgffjjfgj"'ig'1'i11iL': A 6 'C7fl.A..., T jf"T - ff Iv . . -A VAH' ,. ,,.,.1f jfiip fi-JC?l'i 2' Q SENIOR CLASS JAMES WILLIAM THOMPSON, B.M.E. Falmouth Alphn Tau Omega: Lamp and Cross: Vnrslty Fuotbnll 2, 3, 4, Captain '16, A. S. M. E.: A. 1. E. E.: Neclmn- icals of '16. "Fats," we call him now, and ever will, even though he may become President or a Captain of Rough Riders. On the football field he won his laurels, and in the same "big" way he should win them elsewhere. PREssLY H. TIPTON, B.A. London I have nothing lo say "Tip" wandered over from Eastern State Normal in his Junior year, but he has not yet been able to get ac- quainted with lhe "State" atmosphere. He roomcd in Senior "Heaven" and was one of the quietest "angels" therein. Study is his chief pastime. josEPH EDMUND TORRENCE, LL.B. Cynthiana 1'hl Delta. Theta: Phl Alpha Delta: Henry Cluy liuw Society: Y. M. C. A. Cublnct 3, Prcsldent Al. Joe is well known as the man with the melodious voice. It is quite certain that this will place him in a high position some day. Good natured, sympathetic, studious, and reliable, he has made his presence felt while on the campus and has won many friends. FAY TOWNES, B.S. Agr. Madisonville Agrlcultural Socletyg Manager Varsity Football TL-nm -4: Assistant in Dairy Laboratories 4. "Doc" is a man of clean moral character and a hard worker. He is admitted to have been the best football manager in many years. C793 1315-f 19176 Q. V l l l -m....,,.. .xr Lf , Lvl ri 2. Cm l J ' ...-.s.- ..., ..---H- A s-.s......s...s., J' ' ,M "f'l,5!, ,ffl 'TZ if ' 'A hlvvwf 'C ,. SENIOR CLASS JULIA VANARSDELL, B.S. Home Economics Flemingsburg Y. NV. U. A.: 'I'r'4-nsun-1' ot' Phllosophtan l.ltt-rm-y Sn- r-tr-ty 3: Vll't'-l'l'l'Sltl0l'll. oi' Home Economies Club 3, President 4. Julia joined us after we were well started on our col- lege career, or thought we were. She has spent most of her time in the sacred precincts of those who follow the "economics" path, and if you want to have her good will-let me whisper it in your ear-don't speak disparagingly of "The Department" in her presence. Rov ALEXANDER WALLACE, B.S. Agr. Cerulean Springs Alpha. 'l'uu Onu-ga: Lump and Urosst Ny:-ith: 'I'l1h't00H1 Keys: Pun-Hellenic Ununuil 3: Alvin-t1ltul'al SOCll'tJ. The class of "sixteen" is glad to have been able to borrow Billy from our predecessors. His effervescent good nature has brightened us up immensely. Without him, what might we not have done? GEORGE WITHROW WARWICK, B.M.E. Frankfort I'I Knmm Alpha: Mystic 'l'hh't1-on: 'l'uu Bt-lu Knkeg Ili-muumtlc Club: A. S. M. E.: A. 1. E. E., Meehan- lvuls ul' '16, Few persons would ever suppose George to be a prac- tical engineer, because in appearance he always seems more like a student of art. We really expect him to arrive, though, some day. CLAUDE COLUMBUS WATSON, B.M.E. Georgetown 'I'aiu Betu. Kukeg Muclmniculs oi' '16, A. S. M. E.: A. S. E. E. "Cl1oppy" is a Finished product of "Little Paul's" de- partment. He is satisfied that "hanging and wiving go by destiny," and firmly believes that he is destined to marry a light.-haired occupant of Patterson Hall. C809 51 fe 1916 I t l v r 1 5 l v A ir ,. , . . 1 l 5 F 'J . i l 5 3, ll I H -J i v xi 2 J 1 'I 1 5 rl r I 5719 7dG'Ft? fu e17!'if.I'eTfZl'i 'fi' '-iff. s 3 l FRED WHITELY, B.M.E.. Owensboro A. T. E. E.: A. S. Rl. E.: lll't'll!ll'Ill'lllS OI' 'itil 'l't'ttl Bom Nuke: Owvnslmrn t'lIIh. "Fox-Trottin' Fred" is a great lover of power plant work and is fond of speed. He is a quiet, "say-nuthin kind of a fellow who is a congenial friend to all who know him. He thinks man was made not to talk, but to be seen. ANNIE LEWIS WIIITWORTH, B.A. Harclinsburg Alpha. GnIr1nm DI-ltn: Pflll-lll'llt'lllC f'0tllH'll 3: Stuff und Ui-own: Y. NV. U. A. Unbint-t lt, 4: Honor' Systt-III Committee 1, 2, It: Ptrtlosolihluii I.ItuI'm'y SIN-in-tyi 1'eIII1yI'nynI Ululm. St-I-I-I-tuI'y tt: l4llDl'Ill'y Uluh: KI-I'IIt-I SHUT 4: Dologrutt- tu Blue Ridge 2. Among all the hard tasks of this ever-busy Senior, the hardest thing :he has to do is not to blush and look conscious when "Zemmy" teases her about her beau. She looks especially embarrassed when "Zemmy" says he's from Missouri. We wonder, why? EUGENE PAYNE WILKERSON, B.A. Lexington , A Patterson l4li.l'l'fll'Y Sm-tt-ty, Secwvtnry 23, x'l1'l'-l't'4'Nltlt'ltl 1 4: Class Tinsobnll 2: Dl'l1ltlL'I'Hllt' t'lIIh: Ito:-:II-0 Munn Lttorury Soc-tr-ty: ltr-prvsunuittru K. t. 0. A. "Beany" is quite accomplished in languages. He longs to go to Gerrgany, where he can say "ich liebe Ste' with all his heart. I BURTON FORCE WILLIAMS, B.C.E.. Athens f BI-nnka EDI-Kllll'0l'llHfI Soc-toty. . . . . I E Memories linger still of Burts mustache and goatee whIch he wore upon returning to the fold in September. 3 It was longer and spread over more territory than that if of any other member of the class. He is already an wi engineer, and we expect him to become a professor soon. I 5 E 5 I 7 I . P I I CSU i F 5 5 5 l , - f-. i 7,7 A Q-.....-........ ,.....,..--..-f' , - 9 1916 -- " ....I-.-.- -.............,,, . .,W,,.1,....Q,-.,, ' J, ., ,, . .-.. .-.....,...-...,..... ffl . -,WW,.L ,L ,i 5139 mi ffl Clczafz fkirzg- f fl .9 : 5 l i l l t l l 2 l i E 2 i 1 5 l Q l i i l l x P 5 l 2 i 1 l i l X I E l 2 l l l H 't--..--..,..-.-.-,,,,. - ' SENIOR CLASS GROVER CLEVELAND WlLsoN, B.A. Paint Lick 'l'au Kappa. Alpha: Class Orator 4: Vnrstty Dcbntlnl! Team 4: Annual Staff At: President Patterson Literary Society 4: Winner Bennett Prize 3, Crum Medal 2: Class Debating Team 1, 2: Assistant Librarian 3, 4: Engllsh Club: Horace Mann: Mountain Club: Demo- cratic Club. f'Pickles" is especially fortunate in so much that some benevolent providence has bestowed him with "some voice." It might be well to watch him as he passes on. JULIUS WOLF, B.M.E.. Lexington This was the nobles! Roman of lhem all 'Pau Br-tu 1'l: Tau Kappa Alpha: Canterbury Club: Senior Class ltoprosentntlve: Varsity Debating Team: Varsity Representative K. I. O. A.: Patterson Ora- tortcal Mt-dal 3: Crum Dt-clamatory Medal 4: Patter- son Dr-lmtlni.: 'Foam 2: Class Basketball: Strollers. "Judy" has done as much as any other man in school and lots more than some of us. He possesses courage. scrutiny, cosmopolitanism, and dogged pertinacity. NATA LEE WOODRUFF, B.A. Eng. Eminence l Kappa Kappa Gamma: Stall' and Crown: Y. W. C. A. Basketball Squad 3, 4, Captain Second Team 3: "Kon- tuc-klan" Staff: English Club: Chorul Society. ' Never a task was so diflicull that Nata Lee did not welcome it. We couldn't have done without her in our class. Her quiet way of doing just what she should always has won for her a host of friends. HERMAN WORSHAM, B.M.A. Corbin Kappa Alpha: A. I. E. E.: A. S. M. E., Vice-Presb :lent -I: Met-liunlcnls of '16, President 3: Class Base- ball 1, 25. "Dolly" is quite a favorite in "The Drawing Room," and that is going some. Sometimes, we fear, though. that quiet manner of his is going to make him irresist- ible to some young lady who will kidnap him. 1329 SENIOR CLASS ELIZABETH BELL ALEXANDER, B.S. Agr. Midway Class Secretary 3: Agricultural Society, Secretary 1: Y. NV. C. A.: Phllosophtan llltcrary Society: Assistant in Gymnasium. "jeff" has achieved distinction as a graduate in the College of Agriculture. It is not expected, however, that she will become a farmer, but later will "FosterJ' the cause of home economics. She has gone about her work quietly and earnestly, and has been recognized as a real force on the campus. JAMES HENRY COLEMAN, LL.B. Oak Grove B.A., 1915: Phi Alpha Delta: Alpha Delta Sigma: Tau Kappa Alplm: Union Literary Society, Secretary 3. NVlnncr Orntnrlcul Medal 4: Lieutenant Battalion 3, Cnptnln and Quartermaster 4: Varsity Debating Team. Henry has delivered the goods while in the University, as he may be expected to do when he takes up the practice of law in some faraway country town. If earnestness counts for aught, he should win unusual success. CARL PEAK ZERFOSS, B.A. Ashland 1'hl Dt-ltn 'Flu-tu: Union Literary Society, Oratorlcnl Medal 1: Y. M. U. A., Vice-Prcsltlent 3. Cabinet 4, General Secretary -t:- Mystic Thirteen: Lamp and Cross: Varsity Football 2, 3, 4: Varsity Basketball 1, 2, 3. 4, Captain 43 Varsity Track 2: Tennis Club: Class Representative 3: Athletic Committee: History Club, President 4. Karl is one of the strongest men on the campus. He has firm convictions on almost anything you may sug- gest. His sincerity and earnestness have won for him friends who will always stand by him. can l l Q 4 l .ti l E E G a ll ll ,. it 1 ! Il li ll 4 3 QE ll i lr Qi i l I l ...af K eo 1916 ee Q 5 .Y l-f1"" 759 Wenfu clci an if ?i'lfi4Ft l Q 1285 3 Q fkenfuckian -2ii5i5'iE.'f""-:!' . "2-'52"i'iE5?f?"EF1?T" . ' ' ' 4, "4"' " " 42+ f " "-"' ,,,.jiI4"'i'.lI'f.QF'2Ff.':?'irfEZ1f ..,, .. ' " , ,. . . M......W........M...,. .f5.ll!llH..,.. .. ...M , . , N" . f ..,.. - A,....,4 , ,,.A . ...,..., ,4..,,.,,,...,4 , .,.AA,,,, ,...4. ..,. ,A.,, 44,. . . . , , , . . , ji 35--g f 1111841dllM1IIMUIRIIKUIIIHUHGHUHUMHHUMINIHIUIHHIUHUIHIifllilltillfllllilllllldMBHMUHWWIIIIUHUHUUNDHHIlfdillllllhflhllllll ! ' I fr' i' ' if rw W in - 1 1 1. 2519 -l e A nggg 45 2 55?G L... X:- 45 Q 5 J F5595 " Q PW, 2? , L.. 1 1,1 5 2' ,, s.AD4o"wuf.sX.z 1 -- -- 1 wtrifsn-:Tv 42.-1.5-,732 A awk-'fww . :mf V"" '3 V 'f...QIi'9 A V .14 1 ' '3 1 bi- H114-F-2? " :T ,f u 'QJQH' :gi .4 A i E-Law ZS Qfi giiii 525- fu Gi!fx:a-1 srwq . "1 . --E. .-.. , iqfgal I ,Z 5551255 R525 if kiii QQAPT i 55:5 4-1 HS.- . ,.--..,..... ,-.,..- ,,.. . .,,.,., -,...-,... .... -..w...- .,,. -. , ..... - .... -.... ,..,. . ,,.,, Mm-, .... ....,.,...- N , gf, :"ew'nHiF"a1fGH".ff .1"'vFE1f:mi'12"'i 'ii'if'Ii 'n'2an'-WII"5iI'f"'f'1 l'i1'!i'lF-I'I'f.'fH'i 1"-'I"'n'w'l"i""i i'i "' :as - .4.A., . ,..4 , ,, A,.A, ,. .,,, ,..,,,,4,,,, ,, ,,,,,, N, .4 ,,,,, ' Q, """' w" 'ar' 45 """ " -1 " .,..,, 4,,...,, ..,,,, ..,, ,.., ' ' 11 ....,. xfx. , ' , .. C347 Q Q2 a 1916 fs 332 'Q . ,.. I , - f , " A N' ' rw 2' " f 7 'W r 1' -f ,.- if fi Rf f'5.,, 1 ,H 1' 4 2 ' :. ' A f'j,fg,r f'-3' ,J , if , A ILLIAM BENJAMIN MUNSON, B.S., was born near Astoria, Fulton County, Illinois. He attended the Agricultural and Mechanical College, from which he was graduated in IB69 with the degree of Bachelor of Science, being the first graduate of the young institution, which was established in 1865. Mr. Munson began his work after graduation as a civil engineer with a railroad. A year later he entered the drug business, but decided after a brief period to cast his fortunes with those of Texas, a rapidly growing State. He practiced law in Denison for a time, entering later into real estate with jot Gunter, which proved very profitable. The firm was engaged also in the cattle business. In i883 Mr. Munson purchased the interest of his partner, paying 5560.000 in cash, which marked quite a change from his college days, when his income was about Sl a week. During the next few years Mr. Munson was one of the foremost organizers, promoters, and executive officers of his section of the State, and it is said that he almost "made" Denison, his present home. He organized and was President of the Denison Gr Washita Valley Railroad Company, and likewise organized the Southwestern Coal 81 Improvement Company, through which he operated coal mines at Colgate, Indian Territory. He was elected President of the Sherman, Shreveport 81 Southern Railroad, and of the Light 8: Power Company of Denison. In l905, with his brother, he bought and operated the Denison Cotton Manufacturing Company, which is now one of the largest cotton mills west of the Mississippi River. V The Munson Realty Company is another branch of business in which he is intensely interested. This company still handles large real estate deals in and near Denison. In college with Mr. Munson was his brother, Thomas V. Munson, deceased, who graduated in i870 and later became the leading expert in grapevine culture in this country and in Europe. C859 "ii-:fs eiliifizfffiggiie 5956 a -ssfgziif rw OEL IRVINE LYLE, B.M.E'.., lVl.E., was born in Fayette County, Kentucky, February l4, IS74. The same genius and enthusiasm which has marked his career as an engineer was evident while he was a student in the University. He was a member of Sigma Chi and Tau Beta Pi fraternities and was prominent in athletics. ' After graduation he was connected with the Pullman Company, Cincinnati Southern Railway, and Buffalo Forge Company, becoming managing engineer of the latter company in l90l, which position he held for seven years. In t906 he became general manager of the Carrier Air Conditioning Company, since known as the Carrier Engineering Corporation. As an associate of lVlr. Carrier, a genius in air conditioning, he has been an efficient manager of this corporation, which entered into an almost unexplored field. He is a member and was President of the New York Alumni Club, and also President of the Alumni Association. He has held numerous high ofhces in various engineering associations of which he is a member. Recently receiving his commission as a trustee of the University, Mr. Lyle is now in a position to do even more for his Alma Mater, which is naturally expected of him because of the intense interest he has taken in its affairs since his graduation, being a prime mover in almost every advancement. C863 t L HARLES R. BROCK, born in Laurel County, Kentucky, in 1865, entered the State College of Kentucky in january, IQB7, and was graduated in l890 with the degree of Bachelor of Science. He was ambitious from boyhood to enter the legal profession. He studied law for two years after graduation, while he was teaching school. He was admitted to the bar and opened his practice at London, Kentucky, june, l892. He was married to Miss Katherine Brown in june, IB93. Mr. Brock went to Denver in l9Ol, where, after a few months, he was unexpectedly made Assistant City Attorney. He held that ofhce for only a few months, resigning to become associated with one of his present partners. His. unusual success is attributed to a devotion to his profession, which preferred a meager income from that source to an income many times larger from another source. As a member of the hrm of Smith, Brock St Ferguson, of Denver, Colorado, he has received liberal returns for his keen devotion to his profession. For more than ten years he has been a professor in the Law School of Denver University. In politics he is a conservative Democrat, recognizing that with industrial development certain reforms become necessary, but always insisting that reforms should bc attained with due regard to the limitations imposed by the Constitution of the United States. An intimate friend has said that in Mr. Brock a vigorous intellect is associated with a strong moral sense, sincerity, integrity, candor, and honor, wherein may be said to lie the secret of his success. C573 3: ,. .iv . ..-. 5 H f f I,-, rm .J x 1' X r T UFUS LEE WEAVER, born near Frazer, Wayne County, Kentucky, was graduated from the State University with the degree of Bachelor of Science in l895. He was steward of the students' mess, President of the Union Literary Society, and represented the University in the intercollegiate oratorical contest in l895. After his graduation from this institution he entered the law class of the University of Michigan. While there he was prominent in student activities, and was class orator during the graduation exercises. ln September, l898, he entered the law oflice of McKelvey Gr Mattocks in New York. After one year he was associated with Hon. William B. Ellison. In l90l he started in general practice alone, with which he has been occupied since that time. V Mr. Weaver was married to Miss Sarah S. Harbine of Xenia, Ohio, in November, l906. Being interested still in his Alma Mater, he became a charter member of the Kentucky Alumni Club of New York, and was elected its Hrst President. He resides at Westbury, Long Island, and has his oflice in New York. cw l 1 ' 1 l 159.596 .13 ......A,f... .......- ..... ...Q - - - . . ... .. ILLIAM 1... BRONAUC-H, B.M.E., was graduated from the University in IS99, receiving his master's degree in 1903. Immediately after graduation he entered the employ of the Buffalo Forge Company, Buffalo, New York. Leaving this company in l904, he took charge of the public building department of the Sturtevant Company, devoting his time to the sale of heating and Ventilating plants for public buildings. Later he was appointed Chicago manager of this firm, which he held for two years, until going into business for himself operating as the Iroquois Engineering Company. This concern was incorporated later and took up the designing and building of the Acme Air Washer. The Hayward-Bronaugh Company was the next scene of Mr. Bronaugh's activity, but he sold all interests in this company in july. l9l5, and began operating for himself under the name, W. L. Bronaugh, Manufacturer and Contractor, Chicago. In I9l2 Mr. Bronaugh married Miss Mabel E.. Tallman of Chicago. He is Secretary of the Illinois Chapter of the American Society of Heating and Ventilating Engineers, and is an associate member of the American Society of Mechanical Engineers. His principal diversion is golf. He is a member of the LaGrange Country Club and the Chicago Athletic Association. While a student Mr. Bronaugh was active in all general activities and was a member of Sigma Chi fraternity. As President of the Alumni Association of the University and as an enthusiastic member of the Chicago Alumni Club. he has kept in close touch with his Alma Mater. He always returns for the commencement exercises, and mingles freely with graduates and undergraduates. C399 l i fi' fir. f, : WV, ur fr' 11 Y . I lf. 1 l Q E A A 3 Q59 'ikenfuckian A A V ' MAX gifs.. 4 H. W ,xi " ' X OHN E. BROWN, born in Shelby County, Kentucky, August ll, IBB3, was graduated from State University in 1903 with the degree of Bachelor of Science in Agriculture. While in the University he was a member of Kappa Sigma, Theta Nu Epsilon, and Lamp and Cross. Since is graduation he has been quite active in agricultural pursuits in Shelby County, being an organizer of the Burley Tobacco Pool from l906 until l909. At present he is President of the Shelby Loose Leaf Warehouse Company, director of the Citizens' Bank, a deacon in the Presbyterian Church, a member of the Tavern Club of Louisville, and is connected with numerous local organizations. He is a' partner with his father on ,a farm of l,000 acres in Shelby County. In l9ll he was married to Miss Sarah Elizabeth Logan of Boyle County. Mr. Brown is a grandnephew of Rev. Archibald Cameron, who was a pioneer minister of the Presbyterian Church in Kentucky and left an indelible impress for good on succeeding generations in Kentucky. 1 k By his work as a trustee he has shown his interest in his Alma Mater. He is expected to help much more in bringing the University to the front. 4 . C909 Qt s 91916 ceq s 382 A 'J i l ALTER GILBERT CAMPBELL was graduated from the State College in l902, after which he was connected with the Experiment Station for two years in the Division of Ento- mology and Botany. Later, when he was transferred to the Division of Foods and stationed at Louisville, he took up the study of law in the University of Louisville. He graduated from that institution in l906, and was President of his class. ' Mr. Campbell began the practice of law in Louisville as partner in the firm of Campbell 8: Young. ln a short time he took an examination for food inspector under the Civil Service Commission. with about l,800 others. Later he was called to Washington, and after a subsequent examination he was offered the position of food inspector. Since that time his rise has been marked and rapid. He is now Chief of the Eastern District, with headquarters at Washington, D. C. Laboratories and inspectors' headquarters under his supervision are at San Juan, Porto Rico, Boston, New York City, Buffalo, Philadelphia, Baltimore, Washington, Pittsburgh, and Savannah. Mr. Campbell is loyal to his Alma Mater, and it is to be expected that in his position of influence he will be able to do much to advance the interests of the University. C90 ,fl .3 uf x gfie ckenfuckian EORGE. G. BROCK, B.A., born in Laurel County, Kentucky, February IO, l87l, entered State University in ,IS94 and was graduated with the Class of 1898. Mr. Brock was reared on a farm. He taught in public schools of Laurel County before taking up his collegiate course. After some study of law at Transylvania, he was admitted to the State bar, and has been engaged in the practice of law for sixteen years. Mr. Brock was married to Mrs. 'Nannie B. Baker of London in August, l907. He is now a deacon in the Baptist Church of London and is actively identified with the affairs of his town. As an alumnus and as a trustee he has shown deep interest in the University, doing what he could to help it in its forward movement. C927 i28fN"'Mf'-fs 1916 42 A 'sag AMES W. CARNAHAN, B.A., born in Knox County, Kentucky, in l870, entered State University in l890, graduating with the class of I896. After graduation he was an instructor in Sue Bennet Memorial School, London, Ken- tucky, going later to Berea College, where he was instructor for two years. ln l90l he accepted a position with Ginn 8: Co., publishers, and continued as general representative until l9l2. ln this year he organized the new hrm of Lyons 8: Carnahan. publishers of school books, which is doing business in all States, with offices in Chicago and New York. The house of Lyons 81 Carnahan furnishes many of the textbooks now used in Kentucky. Both Mr. Carnahan and Mr. Lyons were formerlv connected with Ginn 8: Co., with whom they are now dividing honors in the school book field. Mr. Carnahan is married and has two children. His business connections are well established, and his company is now one of the growing publishing concerns in the country. C931 N l 1 1 J t t i l NN ti is 552 lt? ill :'5 lie :if Hi 1. 25 SIL Hs lm It if! ti lt 1 4 Qi it ?l 5? ii! rig iii igf si: iii gi? , 2 1 A I ' , , i , , yi--M "-- Q .. , f f,.,..5, j i Jr N WM -, X15-' 't ,W ' Fx' A ,f -V - X 1' , 1 rr-f K "" if """" " V V. . ,-Q ,IJ M ,ggi .Mfr , 1 1 fi ,fi ffm.-. --..-.., ,,,..,,,.,,-,.,-., 7-M-3" LJ: J-' rg, .M f Q,-x., I xi C ffl.. 1- -1...-u Lfi. 'C,,,,,,,,,,,, OVERNOR AUGUSTUS OWSLEY STANLEY, born in Shelbyville May 2l, IS67, is the first Chief Executive of Kentucky who attended State University. ln him the University feels particular pride because of his achievements, which were made possible by the same characteristics that were first in evidence when he attended "Old State." A sense of humor, firm convictions on every question of importance, and, above all, a wonderful virility and power of endurance, characteristics that have made the statesman stand out in front of his fellows, were evident even when he was an undergraduate. Governor Stanley is not a graduate of this University, but officials and friends of the institution choose to regard him as an alumnus, because of the three years he spent as an undergraduate, 1886 lo ISS9, and because of his deep interest in the welfare and progress of the institution. Looking upon him as an old friend, now Chief Executive of Kentucky, the University of Kentucky expects Governor Stanley to do much toward helping it attain its proper place among the great universities of the South. C943 1916 icii ,, Q i 1 1 I 1 W l 1 I I A f' l . v i I l K N 1 W . Q i l 2 f . If: .Z IA? I 'X J' Q A 191 42:1 32:13.-311' L' A -....1..ggJ 1 - W ' I griffflifisv f7fIQ WQIQ IQrzf:I1cf'IfzfI , A +, AARR r I I I I I I' I I I I W I I I I I I . i I I I I I I 2 1 I I I , I ' I I I I I I I I 4 I I I I I F I I I ,. ...A,AA ..A4 ,, , . . I I I .Uuninr Qllazz Gbiiirmz I I FRANK CRUM .... ........... ,,,, P r esidcnl BLANCHE WIEMANN . . , , Vice-Pfesiflenl EDNA MARTIN ....,. . . . Secretary J. NIawI.AND WATERS . . . . . Treasurer WILLIAM SHINNICK . Oralor I I C955 I I I I I 5 I I I I I I I I I . I J I I I I I I I I I I 4 A-.M 'Fi' .5 I e :I v f581iEi 3 9759 ckenfuckian liluninr lgrnm Gfnmmiitew ' REFRESHMENTS B. N. PEAK .................. Chairman C. W. HARNEY E.. W. HOPKINS INVITATIONS F. W. POTTS .................. Chairman CURTIS PARK W. C. NEAGLE - MAUSIC B. B. RUSSELL ..... . . .' . . A .... Chairman FRANCES GEISEL E.. D. Wooos DECORATIONS C. O. CLARK .... ..... ...... C h airman J. H. EvANs NANCY INNI-:Q H. B. CQMBEST HOMER PERRY PROGRAMS J. N. WATERS ................. Chairman L. C. MCCLANNAHAN WILLIAM SI-IINNICK PLACE J. E. MCMURTREY .V . . . .... ...... n Chairman O. G. SCHWANT C. M. HUBBLI: I J I I I 4965 'I A -A -- E , A ' f .dj . 1916 a 23? 5 L l l l l 'I I I 5 l Z I yy: fmt, y Q.,.-Q.f J 1 A " A..' I 3Juninr Gllawa Bull GEORGE D. AARON, LL.B. . HARRY D. ABELL, B.S. ................. . Phl Delta Tllotn: Class Bnscball, 1, 2: I'I'e-Mccllcnl Society, Il. WILLIAM MASON ADAMS, B.C.E. . . . ..... . . . . . . . Brooks Soclcty of Clvll Englnccrs: 'l'I'anslt Staff, 3. PAUL MAXMILIAN ANDRES, B.M.E.. . . . . ROSCOE CONKLIN BACK, LL.B. . GORDON H. BEASLEY, B.C.E. . . . . . . . . . . . 'Brooks Soclcty of Clvll El1IIll10f'l'S. MARIE CAROLINE BECKER, B.S. ........... . . . . Tlnrnco Munn T.lIcI'nry For-lc-ty. S0f'l'l'llll'X 2: Phllnsophlnn l10!'l!ll11llll!l'Y t'ontI-st sophlnn TIlternI'y Snclcty Vlf'C-Pl'0SlLll'l1f Il, lN'l'0Slll0llL 3: Y. XV. C. A. Cablnct 3: Choral Club: Loulsvlllc Club. CARLYLE WILSON BENNETT, B.S.Agr. ...... . . . Alpha Zeta 3: Agl'lf'Lllllll'l1l Soclcty. Liberty Smitlxlancl Flemingsburg . Louisville . Jackson Williamstown . Louisville 21 Phlln- FtI'olleI"12 . Narrows WENDELL H. BERRY, LL.B. ............ . Turner's Station I Knmm Slprmn: l'lIl Alpha Dcltu. CARRIE FRANcEs BLAIR, A.B. . ......... ...... . West Liberty Y. W. C. A.: Sccrctnry Blvflllllllllll Club 1, X'll'C'I'l'E'Sl1lC'l'll 3: l'llllIlSOlllllilll l4ll0l'lll'y Snclcty Trcnsurci' 3. RACHAEL MARIE BOHRER, A.B.E. ..... . .... . . ..... Bellevue Y. W. C. A.: Horace Munn l.lt4-I'ury Such-ty: Plillosuplilxm l1ll0l'llI'y Soc-lcty. LEO STEELE BORDERS, B.M.E. . . ..,......... . Bueehel LAWRENCE ALLEN BRADFORD, BS.Agr. . ............. F lemingsburg Alpha Zeta. 3: Axrrlculturnl Soclc-ty 1, 2, 3, S0l'l'l'lXll'Y Il: Junior EIlltor ot' "lturnl Kon- tucklnn": Republlcnn Club 3. MANFRED V. BUROIN. B.C.E.. ...... . . . . . . . Brooks Engineers' Socloty: Clnss Football 1. . Lexington HELEN PAULINE BURKI-IOLOER, B.S. in Home Economics ....... Ashland City, Tenn. Phllosophlnn Literary Society: Y. W. C. A. Cnblnct 3: Choral Sm-lr-ty: History Club Sec- retary 3: Economies Club: Music Club, EDWIN RATCLIFFE BURNLEY, B.C.E. . . . ........... Pi Kappa Alpha: Brooks Englnccrlng Snch-ty: 'PIIII Beta ,Koko 3. JEROME DEVIZE CHAMBERLAIN, LL.B. ....... .... I . . Kevil Uniontown CLARENCE CLARK, B.S. . .............. .... O wensboro Class President 1: Class Debating Team 1: Class Basketball 1, 2: Unlon I.ltcrury Soclety: President Owcnsboro Club 2. WILLIAM THOMAS CLARKE, B.S.Agr. . ...... Agricultural Soclety. Vanceburg ROY S. CLARKE, B.M.E. .............. . SI. Charles, Mo. Watt Engineering Society: Glee Club. C977 Y 1 ,,,,,w .,.,-M ,,,. L-.- .. .... . Jffvrilzt rl ,. , , h .-1i:,i,g:i5i,- Lezlrl-.lhip if Qyfjkj M-315 gi, Av x X X .' Xi Y? .V v RQ, ,f L ,m , 1. fx? 1 V' 'X 'Y C963 i JUNIOR cLAss Q Q on 73 1916 Q ge -TT' Q59 'kenfu ckian I , Juninr Qllazn llinll F .f . 1 HoIvIER BURKE CoMIaEsT, B.S.Agr. .... . . . . ..... . . . Liberty , Sigma Nu: Keys: Mystic 'l'lIlrtII-II: First. l.l0utt-nunt llntlallon 3: Asslstnnt Football Mun- : nger 3: Rcpubllvun Club. 1: ANTHONY BURNAM COMBS, LL.B. . Hindman l 5 ll MARION URI CONDITT, A.B. . . . . . . . . . .... . . . . . Marion I Pnttcrsoxi l.ltI-rnry Foclc-ty: Y. N. C. A. I'IIbluI-t: Strollers: lllstory Club: lic-onI.Inlc'sI Club. BETTIE LOUISE COONS, B.S. Home Economies . . . . . . . . . . . . Lexington Alphn. Xl Dollu: llome lic-ouomlf-II Club. p WILLARD FREDRICK CRAMER, B.S. Chemistry . . . . . . . . . Lexington 1 FII-'Il't'I:l. Allilm Epsllon: Gmnmn. Alpha Kuppn. 1 VIE CRAMER, B.S. Home Economics . . . . . . . . . . . . . Lexington i Strollers: Cust "CullI-p.:'I- NVlIlow" 1: llomo EI-ouomlt-a-I Club. ALBERT BYRON CRAWFORD, A.B. . . . . . . . . . . Ross Hill W l'I1ttt-rsun llltornry Soc-loty. 3 NELLE FLORENCE CRAwFoRD, A.B. . . . . . . . . . . . . . . . Somerset N Socrclnry Mountain Club 3: lllmllosophlun l.ltoI'rIry Soclt-ty: Chorul Soc-lc-Ly: Iloruce Mann Socloty. THOMAS LINDSAY CREEKMORE, LL.B. . . . . . . . . . . Lexington 1 Luw Dt-bnllnpr 'I'I-Inu 2: Vnrslty Dobutlm.: 'l'onm 3. l ELIZABETH CROW, A.B. . Lexington FRANK MOORE CRuIvI,A.B. . . . . . . . . . . . . . . . . . . . Inez Varsity Bnselmll 1. 2: Cluss l'rI-slclunt 2l:. 1'rt-sltlent Ilorncu Munn 3: Patterson Llterory Society: History Club: Evonomlm-FI Club: Mountnln Club: Kernel Board ol' Control: Choral Club: Y. M. C. A.: ldxt-teutlvu Committee Debating Association: Class Football 1: Wlnner of Barker Prize: Horace Munn Literary Socloty. MORRIE JULIAN CRUTCHER, B.M.E. . . . . . . . . . . . . . . . Louisville Slgmn. Nui Keys: Truck Team 1: Vurslty Football 1, 2, 3: NVutt Society, 1"I'eslIlent 1. CARL ROGERS DAVIDSON, B.M.E.. . ...... ..... . . ARTHUR WAYNE DAVIS, B.M.E.. . . . . . - .... . . . . . . Flgmn. Nu: 'l'uII Beta Pl il: 1'rcsl4leut Wutt Emxluoorlng Socloty 3. JANE KENNEDY DICKEY, A.B. ..... . . - ....... . . . . Alpha. Zl Doltn: 1'lIllf'H0l1hif1H UU'l'l1l'5' SUUll'l5'I Y. NV. C. A. Coblni-t 1, 2, 3: Y. NV. Delegate to Blue Ridge 2. CLIFFORD T. DOTSON. LL.B. . WILLIAM IRA DOTSONt A.B. . ELLIS Ei DRAKE, B.M.E ......... ........ ' Wlnnur InI'llv1IluzIl Cornpotltlvu Drill 2: Wntt Elll,1'lllt!t!l'il1K Sue-ltety. ALBERT LEE EIMER, B.M.E. . . . . . . . . . . Tau Beta 1'l 3. l KIT CARsoN ELSWICK, LL.B. . STANLEY L. ENGLE, B.S. . JAMES HOWARD E.vANs, B.M.E. . ' ............. . . . Lexington Lexington . Richmond C. A. Olmstead Carlisle Lexington Newport Bottsfork McKee Lebanon Slgmn. Alpha Epsilon: Mystic Tlmlrtuen: Glue Club: Prcsldont Watt Englneerlng Society 1. C993 A i I F5 li 3 I lr!! yt I 7 it at li fl 1 SI if l 1 Qt 'E i l ,I S i l Q, 5 3 l ,, I l 4, ,li ll 2, l li 1 It i, VN JU - -... -. .A-A-I' L, - 9 Q fzdenfuclcian fp. 'f s lluninr Clllass itlnll WILLIAM CHRISTOPHER EYLE, B.M.E.. . . . . . . . . . . . . . . .Lexington Kentucky Mlnlng Society Secretary-Treasurer 2: Patterson Literary Society: Catholle Club. HENRY LINCOLN FEARING, B.M.E. . . RUTHEREORD Y. FISHBACK, B.M.E. . . Olympia ICKLDDSL Alpha.. Brooks Engineering Soclety: Pl Kappa Alpha. Pine Grove JESSIE HUNT FLORENCE, B.S. Home Economies . . . . . . . . . . . . . Cynlhiana Phllosophlan Literary Soclety: Y. W. C. A.: Home Economies Club, Secretary 2, Vlce- Presldent 3: Agricultural Society 1: Cynthlana. Club. ORIE LEE FOWLER, LL.B. . . . Cynthiana EDWARD ROWLAND FRAZIER, LL.B. . . Corydon KENNETH CAsTLEIvIAN FRYE, B.C.E. . . . . . . . . . . . Wadcly , N Brooks Society ol' Clvll Engineers. LILLIAN ASKEW GAINEs, A.B. . . . ..............I-Iopklnsvllle Kappa Kappa. Gamma: Pan-Irlcllenlc Councll 2, 3, l'l'0SlllCYll 3: Strollers: Class Secre- tary 2: Y. W. C. A. , CLARENCE RUSSELL GAUGH, B.C.E. . ..............Williamstown , Class Football 1: Class Basketball 1: Vlee-President Brooks Englncerlng Soelcty 3. FRANCES DUDLEY GEIsEL, B.S. Home Economics ............. Maysville Chl Omega: Vlce-President Class 1: Correspondlng Secretary Home Economics Club 1: Y. W. C. A. Cabinet 2, 3: Accompanlst ot' Choral Club 1, 2: Phllosophlan Literary Society: Strollers. DAVID GLIcIcIvIAN,LL.B.. . . . . . . . . . . . . . . . . . . . Pineville Patterson Literary Soclety: Henry Clay Law Society: Mountain Club: Slgma Alpha Nll. THOMAS B. GORDON, B.S.Agr. . . . I . Lexington . A - . . . . . . . . . . . V Agricultural Soelety, Selmroant-at-AI'ms 3. PAUL HOUSTON GOSSAGE, LL.B. . . . . . . . . . . . . Lola Assistant Coach Baseball 2. IVAN CLAY GRADDY, B.S. Agr. . . . . . . . . . . . . Utica M Agricultural Society 1, 2,' 3. RICHARD M. GREENE, B.S.Agr. . . . . . . . . . . . . Georgetown Patterson Llterary Society: Lamed Pe. JESSE FORREST GREGORY, LL.B. . . . . . . . . . . . . Owensboro GEORGE MARTIN GUMBERT, B.S.Agr. . . . . . . . . . . . . . . . . Richmond Alpha Zcta. 3: Agricultural Snclety: Class Football 1: Class Basketball 1: Varsity Basket- ball 1, 2, 3: Varsity Football 3. ' WAYNE WILSON HAFFLER. B.C.E. . . . . . . . . . . . . . . . . La Grange Brooks Englnecrlng Soclety: Strollers: Varslty Cllocr Loader 3: Asslstant Manager Basket- ball 8. ' MARY KATHERINE HAMILTON, A.B. . . . . . . . . . . . '. . . . . . Cynlhiana 1 Alpha Gamma. Delta: Y. W. C. A.: Phllosophlan Literary Society: Choral Society: Cynthlana Club, Vlce-Presldent 3: Pan-Hellenic Council 3. ANDREW HAMON, LL.B. . . . Lexington CLINTON MCCLARTY HARBISON, A.B. journalism ............ Shelbyville ' Kappa Alpha: Alpha Delta Slgma: Mystic Thirteen: Strollers. I C1007 A A A .Qs IQI6 A A ew so e QL, H . L ,... M.. ..-.... N,v,,........-.-.................... , 'D ,Q Effie 7691? fu Ck, rf cr rr I 1 31 ' I ll l umm' G1 ann lRn , ELLA MAUDE HARMON, A.B. . . . . . . . . . . . Perryville Q I-Ilstory Club: Y. NV. C. A. CLARENCE WILBUR HARNEY, A.B. . . . . . . . . . . . . . . . . . Cynlhiana l 1 Class Debating 'Icam 1: Patterson Literary Fotzlety St'Cl'0tlll'y 2: Ullllllll Sm-lvlyg Dv.-mucratlc J Club: Glce Club. ' -.1 W EMMETT PRESLEY HATTER, A.B. . . . . . . . . . . . . . . . . . Franklin Fr Union Literary Socloty: Hnrat-e Mann Society: Strollers: f'll0l'3l Club: Glcc Club: Flrst ,- Lieutenant Battalion 3. N RUTHERFCRD B. HAYS, B.S.Agr. . . ' . . . . . . . . . . . . . . Mayfield - I l Alpha. Zeta. 2: Agrlcultural Foclt-ty 1, 3, C0l'l'DS1l0lltlllllI S'L-on-tnI'y 2: Dmnovrallu Club. I 1 BROADUS EDWARD HICKERSON, LL.B. . . . . . . . . . . . . . . . Bardstown E Class Football 2: Truck 2, Captain 3: D.-InrIcI':Illc Club. Q KATE GRAY HIEATT, A.B. . . . . . . . Lexington l GEORGE HAMMEKEN HILL, B.C.E. . . . . . .... .... B luefreld. W. Va. l , Alpha Tau Omoga: Brooks EIl1Illli'0l'lllg Sm-loiy, :cc-I'vlaI'y ll: Y. Ill. l'. A. Cabinet 2, 3: First Llcutcnunt Company Battalion 3: Assistant Editor ol' 'l'l'HllSlt 3. I JULIAN ADAIR HoDc.Es, B.S.Agr. . . . . . . . . . -. . . . . . . Greensburg I V Alpha Zeta Il: AgI'lcIIltIII'al Sac-lcty Il: Dunocmllc Club: Y. M. C. A. 3 ELMER WOODSON HOPKINS, B.C.E. . . . . . . ...... . . . Henderson I . Class Basketball 1, 2, Captain 2: Class Baseball 1: Assistant lKI.IITa5.r:-I' v1ll'Sll5' Football 3: Brooks Enxrlneerlnp: Society: Alpha Tau Omega. I l HENRY PRICE HDRINE, B.M.E. ..... . . . . Nreholasvrlle XVntt Foclm-ty. MARIAN VIRGINIA HORINE, A.B. . . . . . . . . . . . . I . . . Nicholasville Phllosophian Literary For-loty: Iloracu llfllll1'l.ll0l'!ll'3' For-II-ty, l'I'I-slrlc-Iit ll. I l , LEAH KATHLEEN HOWARD, A.B. . . . . . . . I . . . . . . Owensboro l : Class Secretary 2: Y. NV. C. A. Cablntt 2: History Club. CLYDE MURPHY HUBBLE, B.S.Agr. . . . . . . . . . . . . . . . . . Somerset 'Class Football 1: Class Baslu-tball 1: AHl'lt'llltlll'lll Foe-ll-ty: Y. M. C. A. ll JAMEs J. HuIvIE, B.M.E. . . . . . . . . . . . . . . , Falmouth ' licntIIcky Mining: Society, 1'l'CSlC0lll 3. x I RONALD HUTCHINSON, B.S.Agr. . . . . . . . . . . . . . London, England g I . , l NANCY WEBB INNES, A.B. . . . . . . ..... . . . . . . . . Lexrnglon I Chl Omega: Phllosophlan 1: Choral Fun-lcty 1: Class Vice-1'I'osiIloIIt 2: l'an-llr-llcnlc C4,llll1Cll 2, 3, Tl'0l1SUl'0l' 2: Girls' Varsity Basketball 1. 2, 3, Manager 3: Strollors: Cast ol' "College Widow" 1. GEoRcE LEWIS JACKSON, B.M.E. . . . . '. . . . . . . . . , Franklin I Alpha. Tau t.nIcg'u: llass llnsubnll 1: Mystlc 'l'lIlI'lo0I1. V l . FRANK H. JOHNSON, B.S.Agr. . . . . . . . . . . . . . . . Louisville I Class Football 1: Af-','l'lK'Lllllll'Lll Society: Y. M. C. A. , SAMUEL CAMP JOHNSON, B.S.Agr. . . . . . . . . .'Frankforl ll 1 . Ylgma. Alplxn. Epsllon. I ELMER BURTON JONES. B.M.E. - - . - - - - . . . . Louisville Ztllnlng Sm-lcly, X-ll'0-1'l'CSll10l'lL 3. WILLIAM JOSEPH KALLBRIER, LL.B. . . . . Buckner ' IIOIJ we E of or 1916 .fr--ff-f E E jf 'DI W Q 1 L . 13' . 1. u 'i"""""'TIT1'IlfA-' 3 :IW tis? A I II l uf' 332135 Q Lktgnfrz Clcia fl .NX ,I X I g . 3luninr Qlluna iRn1l l ELIZABETH THANE KASTLE, B.S. Chemistry . . . . . . . . . . . . Lexington V Kappa. Kappa Gamma: Class Secretary 1: Economic Club. V ' ARTHUR SEwELI. KELLEY, A.B. . . . . Whiterville ' , SIDNEY CLAY KINKEAD, B.S.Agr. . . . . . . . . . . . . Lexington , ' Phi Delta Theta: Agricultural Society. OREM LAMASTER, B.S.Agr. . . . . . . . . . . . . . . . . . Campbellsburg -V ,Alpha Tau Omega: Alpha Zeta. 3: Agricultural Society, Correspcndlng Secretary 2. ELMER LEE LAMBERT, B.S.Agr. . . . . . . . . . . . . . . . . Lexington f l t ' . I 'l 2 I CHILTON FRAZIER LEE, B.M.E. . . . . . . . . . . . . . . . Shepherdsvtlle I i I , Class Baseball 1, 2: Lamcd Pe: Nvatt Englneerlng Society. I l I I . l I , ' JUDITH VIRGINIA LYLE, B.S. Home Economtcs . . . . . . . . . Lextnglon 1 I 5 I . I gill BEN MAHONEY, B.S.Agr. . . . . . . . . . . . . . . . . . Lexington II ,I Sigma Chl: Kappa Pl: Dulry Team 2: Captain Battalion il. ' HARTFORD MATHERLY, B.S.Agr. . . . . . . . . . . . . . . . Mookville i ,S Sigma Nu: Mystic Thlrteen. l 3 , , EARL MAYHEW, B.S.Agr. . . . . . . . . . . Barbourville l, i Ag'I'lcultuI'ul Such,-ty. E3 'lt MARGARET MCCARTY, A.B. . . . . . . . . . . Lexington I LUTHER CLEVELAND MCCLANNAHAN. B.M.E. . . . . . . . . Franklin Watt Engineering Soclety 1, 3, President 2. N JAMES H. MCCONNELL, B.S.Agr. . . . . . . . . . . . . . . . . . Arlington 1 Varsity Track 1: Strollers, Cast. 2 and 3: Unlon l.lteI-ary Society: Fat Stock 'l'euIn 3: Agri- cultural Soclety: Y. M. C. A. Cablnet 2: Blologlcal Club: Kappa Pl. THOMAS CHENAULT McCowN, B.S.Agr. . . . . . . . . . . . . . . . Richmond I Kappa Alpha: Agricultural Society: First Lieutenant Band 3: Alpha Nu. 'a I JAMES EDWARD MCMURTREY, B.S.Agr. . . . . . . . . . . . . . Bowling Green ' Agricultural Society: Alpha Zeta 2: Democratlc Club: Y. M. C. A. f S 1 MATTIE BROOKS MCMURTRY, A.B,. . . . . . . . . . . . . . . . Nicholasville 1 9 , JOSEPH EMMET MCNAMARA, B.M.E. . . Germantown A Il GLENN EARL MILLER, LL.B. . . . . . . . . Warmack MURRAY MATHEws MONTGOMERY, B.M.E. . . . . . . . . . . . Madisonville, Tthll. Slgma Nu: Tau Beta Pl 3: Flrst Lieutenant Battalion 3: Prosldent Watt Englneertng Soclety 3. LEE STEPHENS MDORE. LL.B. . . . . . . . . . . . . . . . . Central City ' Mystlc Circle: Phl Alpha Delta: Kappa Pl: Pennyroyul Club. WILLIAM SHULTZ MOORE, B.M.E. . . . . . . . . . . . . . . . Hartford Watt Ettglncerlng Society, PI-ct-Ildent 3. , GORDEN BENNETT NANCE, B.S.Agr. . . . . . . . . . . . . . . . . . Kevil l, I Class Debating Team 1: Unlon l.llet'uI'y Soclcty: Ag'I'lculttIrul Society: Choral Society: l Pennyroyal Club: Democratic Club. WALTER CLEVELAND NEAGLE, B.S.Agr. . . . . . . . . ,. . . . . Smith's Grove Manager of Class Football 1: Secretary-Treusurer Elx-Cne Club Ll: Democratic Club: Y. M. V , C. A.: Agricultural Society. l JOHNST NORTHCUTT, LL.B. . . . . . Burlington ' WARNER WELLMAN OwsLEY, B.S.Agr. -. . . . . . . . . . . . . . Owensboro , Alpha Zeta 3: Agricultural Society 2, CoI'I'cspoItdlng Secretary Sl: Asslstant Baseball I Manager 3. :Q GEORGE VERNON PAGE, B.S.Agr. . . . . . . . . . . . . . Sedalia Agricultural Society: Y. M. C. A.: Detnocratle Club. l I 4102: Q 'l .2 2 I-NMMA:-.Q 1916 of A A ......,...,....,,...:E?2frTlg1t:3t:gi:,'EE A . Gia.-- 1- E L g 44 if IW .9 1. 2. Jluninr Qllazn Bull CURTIS F. PARK, JR., B.S.Agr. . . . . . . . . . . . . . . . . . . Richmono Phl Delta Theta: Keys: Mystic Thirteen: Captain Class Fcotball 1: Agricultural Society: Varslty,Bascbal1 2. Captain 3: Class Treasurer 2: Y. M. C. A. Cabinet 3, J. SANDERS PARKER, B.C.E.. . . . . . . . . . . . . . . Sanders Brooks Englneerlng Society: Six-One Club. BART NIXON PEAK, A.B ........ ............ L aGrange Al ha Tau Omega: Class President 2: Mystic Thirteen: Assistant Edltor "Kentucky Kernel" D 3: Vlce-Prcsldent Y. M, C. A. 3: Strollers: Union Literary Society: Unlon Declamatory I Contest 1. A RI-ZUBEN PEARLMAN, B.S. Chemistry . . . . . . . . . . ..... . Richmond Sigma. Alpha. Nu: Economics Club: Alpha Nu: Pre-Medical Society. . i MORRIS EAD!-ZS PENnLEToN, B.M.E.. . . . . . . . . . . . . . . . . Lexington . l Sigma Nu: Kappa Pl. I 1 EVERETT SLEET PENN, B.M.E. . . . . . . . . . . . . . Georgetown ' Watt Engineering Society: Pl Kappa Alpha. l ELIZABETH HoMER PERRY, B.S.Agr. . . . . . . . . . . . . Lexington i 5 f Agricultural Society, Secretary 2: Y. W. C. A. , I I , . l VIVIAN RICHARD PrINcsTAc, B.S.Agr. . . . . . . . . . . , Newport , I Q Class Baseball 1, 2: Agricultural Society. :I STANLEY PHILLIPS, A.B. . . . . . . . . . . . Narrows A , PHILIP HENRY PoTTER, A.B. . . . . . . . . . Clinton Alpha Tau Omega. FLOYD WELLMAN POTTS, B.S.Agr. . . . . . . . . . . . ..... Owensboro Class Football: Champion Wrestler 2: Unlon Llterary Society, Secretory 2: Agricultural Soclety. 5 Q Amos CHARLES PREsToN. LL.B. . . . . . . Inez lik - . l l F LINDA BERTRAM PURNELL, B.S. Home Economtcs . . . ..... . . . . Mlddlesboro l Q T Kappa Kappa. Gamma: Agricultural Society: Y. W. C. A.: Secretary Home Economics Club, E ' - viee-Preslaenc a. 3 3 I WILLIAM TANDY Rtnronn, B.IvI.E. . . . . . . . . . . . . . . . . Hopkinsville Q 7 ' Sigma Alpha. Epsllon: Keys: Mystic Thlrtccn: Tau Beta. Kakc. 1 i . I ROBERT BRYAN RANKIN, B.S.Agr. . . . . . . . . . . . . . . Monticello 5 H , Agricultural Society: Y. M. C. A.: Demouratlc Club. I l I MARTINE CATHERINE RATICAN, B.S. . . . . . . . . . . . . . . Owensboro Q A Phllosophlan: Y. W. C. A. 3: Vice-Presldent Owensboro Club 2, 3. JOHN THOMAS RAWLINGS, B.C.E. . . . . . . . . . . . . . . . Newport V Varsity Track 1: Four-K Club. HELEN ELIZABETH REcoRD, A.B. . . ..... . . ..... . Pikeville 3 Y. W. C. A.: Mountain Club: Secretary Horace Mann Society. r . H THAN GIVENS RICE, B.M.E.. . . ........ . . ...... Providence l 5 . Alpha Chi Rho: Tau Sigma: Tau Beta. Kakc, Watt Engineering Soclety: Glec Club. j l 1 JOHN PETER RIcKE1'Ts, B.S.Agr. . . . . .... . . . . . . . . Mt. Sterling ' Agricultural Society: Democratic Club: Y. M. C. A. xiii' wil. JOHN HEARST RODMAN, B.S.Agr. . . . . .... . . . . . . Marion l 5 5 Agrlcultural Society. Q f , , . I CHARLES CHRISTOPHER SCHRADER, B.M.E.. . . . . . ..... . Philadelphia, Pa. g.: Sigma Nu: Varsity Baseball 1, 2, 3: Varsity Football 1, 2, Captain 3: Varsity Basketball, l l CAL JOHN SCHIRMER, B.M.E. . . . . . . . . . . . . . Ft. Thomas Kentucky Mlnlng Society, Vlce-President 2. U03 Q' 5 l l l H i S i l 5 I In I 1 l "f 'M '? f' ,jj ,. ? . .rf .. ..,. . , 4... ...F .Q it ftyffgfxg Q .,..r...H., - , H P ,...g . QQ -K- A. ' -'....L. M, ,ga-f wg.: ,.,,......-. ,. E. ,, ff- ,J I A -,--.,... - L, ..., We--- w f' N43 ,AQ ' 'f'- J 'f I f 1 V ,,,,,,,,, QNX ff ...If 53 it et '13 CC i , .. . Km L. f W,,,,.,,.,,,,, , .,,,,,,.- ,,., I .LWMLQ l l 2 ' l l I l . l , , I I IIUIDI' HHH Il lli :II ' cm JK ll 1 E I l f . GRIFF Sco'rT, B.M.E. . . , Nieholaeville I . . l , l 5 Rot' CUNNINGHAM ScoT'r, A.B. . . . . . . . . . . . . . 1 . . . . Lexington Class Debating Team 1: History Club: Economics Club: Union Llterary Soclcty. , I i, J. MORRIS ScoTT, A.B. . . . . . . . . . - .... . . . . Fulton , X l J t WILLIAM SHINNICK, A.B. journaltsm . . . . '. '. . . . . . . . . . Shelbyville fgilf Alpha Delta. Slgma: Canterbury Club: Class Oratrn' 3: Strnllt-rs, Cust 1, 2, Stute Man- - lager 3: Patterson Lltcrary Society: Economlcs Club: "Kernel" Stuff: Cnthollc Club. H. COURTNEY SMISER, B.M.E. . . . . . . . . . . . . . . . . . Cynthiana l Watt Englncerlnp: Society: llnrrlson County Club. 3 2 l lil CHARLES R. SMITH, B.S.Agr. . . . . . . . . . . . . . . . . . . Somerset I l I Agricultural Soclt-ty: Asslstunt liuslness Manager 1916 "Kentucklan." if DAVID SUMNER SPRINGER, B.M.E.. . . . . . . . . . . . . . . . . Corydon l I , Watt Enp:lneerlnIx Society: Alphu. 'l'nu Omega: Tau Beta Pl. ' I I E ll MARY DEDMON STAGG, A.B. . . . . . . . . . . . . . . . . Lexington l I i FRANK TANDY STREET, JR., B.S.Agr. . . . . . . . . . . . ...... Cadiz l l Mystic Circle: Alpha Zn-ta. 2: Agrlculturul Suclcty, Vice-l'I'esltlt-nt 3: Assistant Etlltor 1916 I l "Kentucklnn." Q 3 WALLACE DUNLAP SULLIVAN, B.S.Agr. . . . . . . . . . . . Mt. Sterling l - Alpha. Sigma. l'l: Track Team 2: 1'hl Slgntu. E l Q CHARLES L. TAYLOR, B.S.Agr. . . . . '. . . . . . . . '. . . . . . Prentiss i Vice-President Agrlcultural Soclcty: Assistant Business Manupger "Rural iKcntucklan." k EUGENE AVERY TAYLOR, B.S. Chemistry . . . . . . V. . . . . . . . . Louisville I Q Mystic Circle: Gamma, Alpha Kappa: Keys: Loulsvllle Club: Cntholle Club: Y. MA C. A. 1 . O. B. TAYLOR, B.S.Agr. . . . . . . . . . Prenttss Agrlcultural Soclety. IKE WALLACE, LL.B. . . . . . . . ' . . Nicholasville 1 lst-IMALL H. WALLEN, B.C.E. . . Loekey A l ' l Louts WARE, B.M.E.. . . . . . . . . . . . . . . . Somerset l Kentucky Mlnlng Society, Vlee-Presltlcnt 3. I 2 Q jot-IN NEWLAND WATERS, B.M.E.. . . . . . . . . . . . . Middletown I l l Vai-stty Baseball 1, 2, :Ig 'ron int-tn 1'I. l . . l l JOHN HAL WEBB, LL.B.,. . . . . . . . ..... . Wtlltamstown I l . i JAMES WRIGHT WEssoN, B.S.Agr. . . . . . . . . . . . Wingo i l N A.t3., 1915: Agrlcultural society. I CARL A. WICKLUND, B.S.Agr. . . . . . . . . . . Central City I l I Atrrlculturul Soclcty. I , BLANCHE ANNETTE WIEMAN, A.B .... . . . . . , Lexington Ji VltlC-1'l'BSll10lll Class 3. i I BUFORD WILLIAMS. LLB- ' ' ' ' - - - . Lexington Pl Kappa. Alpha. CLOVIS ROY WILKEY, B.S.Agr. . . . . . . . . . Dixon Agrlculturul Society. ' ESTILL DALE Woons, A.B. . . . . . - - - . - . - . . Pinckard Alnhn. Delta Slums: Track Team 2, 3. I 0041 ll 1 l 1 .QffILlfffQ-,...L--l'f'.Qf',ffl ' ' """"""""' " ' """""""'A' ""A"""""' ' " ' 1916 K- - . 6,-f I I I .J J' E Q7 Q59 tkenfuckian I I 1 1 5 K . ,.,. ,Mm , E H1 W L F E . x ' .A , .... ',.,:,l,..- .s..L.,.L..'al Snphnnunrr Gilman imiiirrrz JAMES SERVER ....................... President CELIA CREGOR ..... . . . Vice-President ANNE ELIZABETH SLOAN . .... Secretary F. O. MAYES . Treasurer, W 11053 Q ig E -91916 asv 'M"'u.:g,ggiifjiiiliiipii ,i1'f5 4' , ' SOPHOMORE CLASS -fviffff--""E,m,,,,.ff-'+,......,,,...,,...,............,,..,..,.... -. ... ,,.,.........,..,.,,...,,,,,,,,.,,,,.,,,4 ,, ,,,,,,,,,m. N ,-,,,,,,,,,u-,,,,-.,, Y V --2, 1-Q--" ...-.f.Q,.m,.,i V, 4 "'- F 51. , , "- . -2- - - -- :Qf f-.-Y - - Y Y ---m-- 1--::nL, - -- f - -- V ...-M,:LV,..., ...-, -Mx ..w......,.-.,....-....,.r- .. ,. -Cx. ...,.. '.l -Ju ,., vxx , up-N . ,fl 5 ' ,.1iZ2j mr... .. if 0 L18 4 DY? W U29 -, -,,...f- tl I 4 i l l d:,,,M , ....,. , . fm ,WA-vmngv bb ,. .- ,,,,.........,,... Svnphnmnrv igizturg Nl fi, ' egg URS has been a remarkable history, and we are forced , to admit it. At the opening of our Freshman year we i X had more enthusiasm and spirit and made more noise 'I W 143 than any Freshman class in years. We licked the Class l of 'I 7 in the tug-of-war so badly that they dared not go through the 3 pond with their end of the cable. i Last October the Freshman class pulled longer and harder on the l big steel string than we did, which was our cue to "duck," and that l we did. It was not so bad after all, and it was our turn to be van- quished. The crowning act of our career, however, was in September, when , we assumed the prerogative of the Seniors and came to the relief of the Freshmen, who were burdened with an overheavy hirsute adorn- ! ment. In this we thought we were doing a humane thing. That is E over now, and we leave the rest in the hands of our successors. We have sent men into every line of endeavor in the University and l have gotten recognition for it. It was our "point-a-minute Freshman l team" that furnished the nucleus of the l9l5 Wildcat eleven. Our i men are also making considerable showing in baseball. Emery Frazier, whom we still claim because of his leadership last year in spite ol claims of the Juniors now, is typical of our class, doing all that he can, y and doing it well. In all, we feel confidence in ourselves because of what we have , clone, and, with two years' experience, we expect to launch on a bigger E and better career next September. I bl l 0071 ' U -,,...,---,--.. .s . as , Yrs-----We Y 9 1916 Qifafgff-eg1,fse1,+3sfQg,, r . ..,. K, s :i , i as e--5 await? Gfiff f e,.'if.L, H 'L:,..p., it Zlhwzhmzrn Qllawa fwirrrz josEPH YONTS8 . . President C. R. LISANBY . . . , , , Pfesidenl Emrn SAcHs ..... , I Vicc,p,e,5,1c,,, Jzsslz CUMMINS .... .... S ecrelary L. B. KELLEY . . Treasurer 'Resigned CIOBJ fs O ND x.z FRESHMAN CLASS ..n:nnn. n Q M V? fu C rica fl Ei:-.:M-'37 Zlireahmam Gilman Qintnrg lLi.. and sought admittance to the University Registration 4 " ,,, H ?I'ARLY in September we gathered, four hundred strong, Day! What memories that brings! Of waiting in line In g in the old Armory, of signing countless cards, of giving up that Hfteen dollars, then out in the air once more with a little blue card that signified we had risen at last to the dignity of a Freshman in the University of Kentucky. From that minute we began to make history. Being a wary, know- ing bunch, only a few quarters were collected from us for campus tickets. We were rather disappointed at first that the Seniors did not indulge in their usual pastime, of being tonsorial artists. But the Soph- omores came to our relief. For the first few weeks we were simply an unorganized mob. Then, on October l l, in a turbulent meeting, we elected officers. Our first President did not return to college after the opening semester, and Mr. Lisanby was elected to serve in his stead. On the fifteenth came that great event, the tug-of-war. Of course, we won, and the Sophomores, like true sportsmen, went through the pond. That evening, while celebrating the victory, Eldridge Griffith, one of the finest boys in the class, was fatally injured and died later. The entire class accompanied his body to the train the next day, to do honor to his memory. Now the year nears a close, and with our " 'l9" in a conspicuous place, our class represented in all activities of the University, religious, athletic, literary and social, we feel that our year has been successful, and we are quite ready to advance one more step and make room for the incoming class, whom we welcome with all sincerity. E. P. C1101 1916 5-W 9729 fkenfuckian -12 5 Q , Xa. , ,V h , M vi EH 1. V Ili? H12 iQ I: If I 5 If ' s P 1 1 L if 'Q .,, :,, 2 5 l I i 11 EI - 3 - i r Q4 I Qs . fi ,Q 52: f1 M ig? El! 3 1 i E Q5 ia ,ln lk 1 in any Q I 5 5 M 5 I f I kk T q 9 1916 Y Q. " v j'T'iLfiff1' gfzflltjggjgg, lggglfi? Q 7? YIM Ck ICZ I' 1: Aihlriir Olnmmittrv PRESIDENT H. S. BARKER . . . . . Member ex-Ohio EZRA L. GILLIS . . . . .... Chairman HERBERT GRAHAM . . . Secretary W. T. LAFFERTY W. E. FREEMAN HENRY E. CURTIS A. R. UNDERWOOD FRANKLIN CORN KARL ZERFoss ED HUNDLEY D. V. TERREI.I.'f 'Appointed to succeed A. R. Underwood UIZJ .... 1916 61-"ff""'5 II3 Oct. 2.-Kentucky Oct. 9.-Kentucky Oct. I6.-Kentucky Oct. 23 -Kentucky Oct. 30 -Kentucky Nov. 6.-Kentucky Nov. 13.-Kentucky Nov. 25.-Kentucky ilinnthall SCHEDULE AND SCORES . Butler College, Stoll Field. . Earlliam, Stoll Field. ........ .. . Miss. A. 81 M., Slarlcsville, Miss... . Sewanee, Stoll Field. .......... . . Cincinnati, Stoll Field ,. .. . Louisville, Louisville.. . . . Purdue, Stoll Field..... . Tennessee, Stoll Field a 5 COACH ES-TIGERT, TUTTLE, PARKS 0141 Opponents 0 I3 I2 7 6 0 0 0 u. U 41 4 ,, 7 'I 4 6 D 5 ? ,. , 51 :TV "Y I-Tfiffk 1 , ' I 'q " 5: gs 45 fp' pi j ' Y,-' J :ww f-, t ,f l 1 "-,. . 'km 4" f H , -if F 4, 1 Q DR. J. J. TIGERT, DIRECTOR OF ATHLETICS Br. 3. 31. Efigvrt URELY no other University in America has the distinction of having their athletics under as versatile a figure as Dr. Tigert. Prominent as an educator, possessing a practical turn of mind and rare insight, Dr. Tigert's nature combines qualities which could hardly fail to make him a successful leader of men. An athlete himself while in college at Vanderbilt and later at Oxford, "Tigo" has an interest in things athletic only equalled by his love for deep learning. Since his arrival at State in I9I2, to fill the Chair of Philosophy, the force of Dr. Tigert's personality has been felt very strongly in Wildcat athletics. He served as Assistant Coach under E. R. Sweetland. He coached the girls' basketball team in l9l4-l9l5, but il remained for the Freshman team of I9I5 to demonstrate fully his ability. Chosen as Director of Athletics, he, with the able assistance of William Tuttle and James Park. heroes of many Wildcat battles, proceeded to develop a team of which State might be justly proud. Results of the I9I5 football season in the heaviest schedule ever tackled by the Wildcats, or probably any team in the South, show conclusively "Tige's" merit as a coach. Always a favorite with the student body, inspiring a confidence which makes provision for nothing except success, Dr. Tigert has won for himself a place in the hearts of all State people which shall cause them to remember long the "philosophical" coach. 41 usp 5 as IQICZE 1 'rssae' ' rce'c a 4 VARSTY THE PLAY may l n I 1 F i l il 2 li s . V 'F .,. 3 l 2 5 -li i r Ill ix Q v. Q Fm' . --9 Q 17663 fl fll Ck, Cl ifl f illruiem nf the Zlinntlmll Svvawnn BY E. A. B. NTHUSIASM was high among Varsity ad- herents when, early in September, the gates of Stoll Field were thrown open and the l9l5 squad of football artists presented themselves for the season's campaign. With an optimism based upon the return of most of the members of the l9l4 "point-a-minute" Freshman team, coaches and squad worked hard in anticipation of a schedule which promised to present some of the fiercest battles ever fought by a Blue and White Varsity. The extreme heat of September brought the men out, for the most part, in track suits, and early practice consisted of passing the ball and running down punts. By the first of October, Captain Schrader, Thompson, Crutcher, Hedges, Corn, Zerfoss and other veterans of previous seasons had reported, and another Wildcat team began to evolve. For a while there was some uncertainty as to whether or not Doc Rodes would fall in line, but ere long the call of the blood brought him back from the Southland. His reappearance in a Blue and White uniform was the cue for much rejoicing in the local camp. Never before had such a large number of as- pirants for football honors appeared on Stoll Field. Among this number were Freshmen who had al- ready attracted attention in their respective high schools by stellar work on the gridiron. Foremost among these were Poindexter and Mcllvain of Cynthiana, Heick of Louisville, and Davidson of Covington. To Coach Tigert and his assistants, Tuttle and Park, the outlook was highly gratifying, and Wild- cat followers shared their enthusiasm. Bill Tuttle and Jim Park, making their initial bow as graduate coaches, were not long in inspiring their charges with the spirit which kept them in the limelight of State's athletics during the last four years. But the eyes of Coach Tigert sought out the members of his victorious l9l4 Freshman team, who, fum r IiE1Qf,.,.435 1916 I 5 Ss I 2 , -C .- A l . I li" 1 Vg? 31 If . Es t ,ag tr If . lal li ' lil gli ii 3. B .l 5. W lf, . li Q nl l i' 5 5 li 1 l fl .r , i I - 2 ' 5 I i r l i l l E . . . a . t Q i i 1 l E 5 K I equipped with the training of the previous year's campaign, in addition to more weight, were to be relied upon largely to fill up the' gaps in the Wild- cat machine made vacant by the graduation of Park, Tuttle, Hite, Scott, Downing, Bailey, and others. He was not disappointed, for Server's punts were longer, Haydon's tackling was per- fect, Doc Rodes was running through the line as of yore, and the long "Logician" smiled and worked harder than ever. On October 2 the season opened with Butler College on Stoll Field. The new stadium in its gala attire of blue and white presented a scene which enthused the most lethargic. Here was a gridiron of which State might be justly proud, de- clared by the delegates to the S. I. A. A. and visiting coaches to be the best in the South. The game with Butler was a rather poor exhi- bition, but served to show up the strong and weak points in the Wildcat line-up. Spectacular runs and tackles by Haydon convinced the spectators that he was one of the finds of the season. State's heavy line demonstrated to all that any handicap which might have been suffered by previous Var- sity aggregations, as far as a light line was con- cerned, would be removed this year. As a whole. team work was woefully lacking, but stellar indi- vidual playing gave conclusive proof of the possi- bilities of the material. The second game resulted in a 54 to I3 victory over Earlham. Straight football was the order of the day, and in this Schrader, Haydon, Rodes, and Grabfelder featured. State showed strong on offense, but was a little off color on the defense. However, the Hoosiers were unable to score until the second quarter, when the Freshman team re- placed Varsity. During this period the visitors accumulated their thirteen points. For the F resh- men, Captain Poindexter, Mcllvain, and Davidson carried off the honors. Assistant Coach Tuttle handled the teams on this occasion, in the absence of Dr. Tigert. October I6 found the Pride of the Bluegrass at Starkville, in what promised to be the first real test of their strength. Excessive heat and a foreign field proved fatal to the hopes of the Wildcats. Under a broiling sun, which registered 93 degrees in the shade, State battled to the final acceptance of a I2 to 0 defeat. may ' ' " ggi. Q.TQf'f2"vLP"fLff',Lf' 'TT f ' 1 .f X ,M-,pr-t,.r1XM,,,,,.,.,.,.... Every man fought gamely, in spite of the ad- verse conditions, and strengthened every time the goal line was threatened. Doc Rodes' fame as an open-field runner had preceded him, and he seemed to be watched by every member of the A. 8: M. team. The tackling of Nobles in mid-field by Schrader after he had intercepted a forward pass was one of the features of the game. Kinne played a wonderful defensive game, as did Haydon until he was overcome by the excessive heat. The A. 8: M. team was at its best in this game. Con- cerning Varsity, the Memphis Commercial Appeal said: "Kentucky State has a fast and well- coached team and made an excellent showing." During the week preceding the Sewanee game the Blue and White aggregation practiced behind closed gates. Then, following a lapse of several years, the University of the South again placed n team on Stoll Field. The game ended in a 7 to 7 "victory" for State. Overanxiety on the part of the Wildcats prevented State from winning by one point. Following a touchdown, Clark of Sewanee punted out and the ball was fumbled, but a "K" man was off-side. The next try was successful. Fast and aggressive line work was largely responsi- ble for State's touchdown. "Fats" Thompson blocked a punt on the visitors' 25-yard line and recovered the ball. Successive plunges by Schra- der, Rodes, and Grabfelder carried the ball to the one-yard line, and Kinne bucked it over. Schrader kicked a perfect goal from a difficult angle. Hay- don saved a touchdown when Quarterback Sellers of Sewanee received a kick-off and rushed 55 yards through the entire State team, to be overtaken and downed by the featherweight halfback. Doc Rodes dislocated his shoulder early in the game, and Kinne replaced him at quarter, Kelly going to end. Two attempted Held goals by Captain Schrader failed to increase "State's" score, and the game ended with the honors evenly divided. Server, Thompson, and Brittain played great ball. The "K" blanket offered by Frank Battaile to the first State man to cross Sewanee's goal was awarded to Doc Rodes by vote of the team. Cincinnati, with a badly crippled team and lacking the services of Captain Montgomery, next invaded the lair of the Wildcats, accompanied by 200 loyal rooters. The game furnished but few thrills, the U. of C. pigskinners being far out- C1191 . r""'+ .' af classed by the Wildcats. Haydon's spectacular twisting runs through the Cincinnati team was a feature of the game. Thompson's prowess in buck- ing the line was employed from time to time when the husky tackle was called back to annex extra yardage. Brilliant work on the part of Crutcher brought him into the limelight at many critical points during the game. Cincinnati's only score came during the last few minutes of play. From behind his own goal posts Palmer punted out, and the ball was fumbled by a Kentucky man. Trav- eling at full speed, Richards of Cincinnati grabbed the oval and galloped over for the score. On November 6 a special train carrying the entire squad, in addition to a large retinue of rooters, journeyed to Louisville. With two of the hardest games on the schedule still to be played, Coach Tigert was taking no chances of injuring the men holding the regular berths on the Varsity. Hard campaigning had put them in tiptop condi- tion, and, while the prowess of the Louisville aggre- gation was not underestimated, all thoughts were centered on the Purdue and Tennessee games to come: With a team superior to any ever produced by the "Falls City" University and a determina- tion to wipe out the stain of defeats suffered the previous two years, Louisville put up a great game, but the doughty Wildcats refused to weaken and finally carried away the long end of a I5 to 0 score. The playing of the entire "State" team left nothing to be desired. Kinne, Thompson, Server, and Zerfoss gained additional laurels through brilliant individual work. Shortly after the beginning of the game, Kinne brought the stands to their feet with a 45-yard run. Again in the fourth quarter he raced 80 yards through the entire Louisville defense for a touchdown. With Captain Schrader out of the game on account of injuries, Brittain returned to his old position at fullback and gave a good account of himself at all times. Thompson acted as Captain, and Jimmy Server took care of the booting. Zerfoss featured when he blocked a Louisville punt on the one-yard line and threw the man, recovering the ball on a safety. With the end of the second quarter, "State" was safely out of danger, and a number of second-string men were substituted for the rc- mainder of the game. "Do Purdue," a slogan adopted by Blue and uzoy 1916 -'gggf t IQ 75C-Brzfuckian ff, 282 3 . ff- , r ff-Q,-1-,H 316:19 C769 756311 fu clcz an W White followers, well expressed their determina- tion to wrest a victory from one of the strongest teams which had ever appeared on a local gridiron, and for the first time in the history of the sport a Western Conference team was defeated by a Southern university. I-leralded 3 to l favorites, Purdue was humiliated by a 7 to 0 defeat. The "Boilermakers" expected a hard game and got it. Our lone touchdown was scored by Kinne, playing end. A misunderstood signal at the beginning of the second quarter resulted in Quarterback Olm- stead passing the ball, but the three backs were charging the line, and the oval rolled upon the sod. Kinne, ever on the alert, picked up the ball on the 42-yard line and stopped running only after he had placed it between the goal posts. Schrader kicked a perfect goal, and the scoring ended. The game was a beautiful exhibition of football, a breathless struggle throughout. Varsity was out- weighed ten pounds to the man, but in the pink of condition. Official information shows that "State" advanced the ball 6.9 yards a play, and Pur- due, 4.8 yards. "State's" kicks were longer, and they returned punts further. Shortly after the beginning of the game, Doc Rodes, who had been out of the game for some time on account of in- juries, was sent in at quarter. After several unsuc- cessful attempts to score a field goal, he was re- moved, following an injury to his shoulder. Throughout this game Varsity showed All- American form-in fact, to such an extent that brilliant individual playing gave way to team work, which was beautiful to behold. ln the last quarter Purdue rallied in a vain attempt to score. Within 20 yards of their goal a series of forward passes were attempted, which kept Kentucky followers in suspense until the final whistle, when the stands poured forth a mighty multitude of fans thrilled with the joy of one of the greatest victories ever won by a Kentucky team. Thanksgiving, the "Homecoming Day" for the University alumni, found universal interest centered in the final contest of the season. While elaborate preparations were in progress among the alumni and students for a tremendous demonstration on Stoll Field, Coach Tigert's proteges were safely encamped at the Country Club, awaiting the call to battle. Coach Clevenger and twenty battle- stained warriors arrived on the eve 'of the conflict, 41215 - G Qi - J F , i Q I . ,,.,...,..s,,. fi ff F I ?!cf.l CHIC ff fl fi. 'fjj'-1jQ"1, confident in their determination to make it three straight victories against the Blue and White. The Volunteers had been showing remarkable improve- ment from week to week, while "State" had begun to show signs of relaxation and staleness. Tactics adopted by Tennessee early in the fray made it evident that their intention was to play a defensive game to wear out the Wildcats before they resorted to rushes by their massive backfield for scores. Their style of play, however, was met by the Blue and White, and a more or less unin- teresting game resulted. Tennessee opened up their only dangerous offense in the last quarter, when bucks through the line netted heavy gains. By sheer will power and grit "State's" line held when- ever their goal was threatened. Doc Rodes seemed to be all over the field, breaking up attempted forward passes, returning punts, and tackling run- ners when he was needed most. At one time Quar- terback May of Tennessee slipped through the entire "State" team and ran 35 yards, to be inter- cepted, tackled and downed by Doc Rodes. After three failures, the mighty toe of Rodes booted two goals from placement from the 45-yard line, and the game closed with no more scoring. All regu- lars, in addition to Kelly, Zerfoss, and Gumbert, played well, conclusively convincing the several thousand spectators in the enclosure that the past season had seen "Old State" represented by one of the best teams in the South. To Coaches Tigert, Tuttle, and Park a debt of gratitude is owed by all whose interests abide with the fortunes of Blue and White athletics: also to William "Doc" Rodes, whose love for his Alma Mater prompted him to devote much of his time and talent in helping to coach the backfleld. May the Scrubs enjoy the gratification which comes to those whose work is well done, knowing that their efforts are appreciated. F. O. Townes, man- ager of the team, handled his duties like a veteran and contributed much toward the success of the season. The graduation of 'Captain Schrader deprives Kentucky of one of her foremost athletes, a man who distinguished himself by his perfect poise, gameness and reliability under all circumstances in piling up honors for the .Blue and White. "Fats" Thompson, a tower of strength to the team, will go down in Wildcat history as one of fuzzy ' will 1 il I l ir V+ ltr' in W1 i I W. T, 1 Q A ' l X 31 ' l if I P w I: Fl w ll I t l x ,y fa Y: :J .1 16 Il g l A 1 1 l fi fe 5 I+, ll , I I : i " ' tilt tg: UA if 1 ll tk il' xl' WE tll lil if l'i f i i :lf 'a ip, tri I ll 1 HE i ' a .V ff is l X. lil ,gr l ". t,1"3,f tv wr .v,'E 4 i'l l A l ,, A . s C, ,,, , t - ,, 1 .. ,,,l7, ' ,,, - .U f A-" A"' "' IV 2ifl!l.wQ M..lt'f,4l ffl Q15 .,., is the most dependable wearers of the Blue and White. Rodes, Haydon, and Grabfelder, whose spectacular performances have elicited cheer after cheer from the sidelines, impart a confidence to all "State" followers which assures them of future success on the gridiron as long as the trio shall appear in the Varsity line-up. Great was the gratification of fans in Crutcher's return to form this season. Always in the game and going at full speed, Maury exhibited a spirit that will long be remem- bered. Kinne, quiet and unassuming, but a terror to the opposition, played his position like an "All-American," and all Kentucky is looking forward to the coming season, when great things are expected of this fair-haired youth. Dempsey, Simpson, Brittain, and Server clearly demonstrated what first-class lines can clo to help win games. The work of these men filled the hearts of Kentuckiana with great pride when they were seen, time after time, holding their ground, breaking up plays or tearing great gaps in the lines of some of the best teams which had ever appeared on the local gridiron. The other "K" men, Zerfoss, Corn, Kelly, and Gumbert, responded to every opportunity offered them to break into the game and gave a good account of themselves. Whatever the future may hold in the way of honor and glory for Wildcat teams, the Class of l9l6 and others departing can look back upon the past season thrilled with the knowledge that "Old State" has covered herself with glory in one of the most brilliant seasons in the calendar of Kentucky athletics. ff X ig? CI23j Mr, ,,.-- .-.- W ,,,,,,,,,,,- ,,, ,,,, . ,, . , t , . - ,. V ,1f+53Sl++f382f3e15s-'Web 1916 f K 1 P, ,f 1 ' KENTUCKY VS. LOUISVILLE ,, . .,,,, .n,..., ..,,.. .... ...,,.. . .....,..- . -,,,..,,,..,.X,..,.,, KENTUCKY VS. TENNESSEE C1241 4 N 1 1 I9 4 39 75er2fuckz'arz "V" N 4 w THANKSGIVING GAME - I , ' .Lk X"Li THAN KSC-IVING GAME 1 i 41259 1916 6Lf: :1ti'...... , --S 4 FRESHMAN SQUAD CAPTAIN POINDEXTER ,f ,,-. AJ f v iw J .1 fax-,J 9 759 tkenfuckian 29? C1271 391916 as 33g if C-" 1Q5-113 9759 'kenfuckian j,,.45q , I iliaakvthall SCHEDULE AND ScoRE.s I9l6 Opponents Jan. 14.-Kentucky Cincinnati, at Cincinnati .. 24 ' jan. l8.-Kentucky Georgetown, at Georgetown .. 22 Jan. 3l.-Kentucky Georgetown, at Lexington .. . . 22 Feb. 4.-Kentucky Vanclerbilt, at Lexington .. 39 Feb. 5.--Kentucky Vanderbilt, at Lexington 23 Feb. 12.-Kentucky Louisville, at Lexington .. 28 Feb. l5.--Kentucky Centre, at Danville ..... 5 Feb. l9.-Kentucky Cincinnati, at Lexington . I0 Feb. 22.--Kentucky Louisville, at Louisville . . . 24 Feb. 23.-Kentucky Tennessee, at Lexington 28 Feb. 26.-Kentucky Maryville, at Lexington .. 25 Feb. 29.-Kentucky Centre, at Lexington.. . . I4 Mch. 3.-Kentucky Marietta, at Lexington .. 27 Mah. 4.-Kentucky Marietta, at Lexington .. 27 l , l l l l UZSQ Q 582 at 1916 er 333 2 9 T L ' 1 s I i i I -4 l 2 a l l 1 1 1 l 1 4 l l l l 1 S l .'l 1 E L Q 9 l l Q i l 9759 ttkenfuckian ii Eames Hath, Qlnarh To Assistant Coach James Park, one of "State's" premier athletes, was allotted the diflicult task of developing the basketball Varsity of l9l6. With characteristic Wildcat spirit, jim responded and worlced hard to build a new machine around the nucleus remaining from l9l5. Himself an all-around athlete and able lield general, Parlt undoubtedly got the best possible results out of the available material. The hard schedule faced by the Wildcats called for superior judgment on the part of the coach in handling the team, and Park met every contingency in a way that inspired additional confidence in the abilities of "Our Jim." C1291 Q 12: 1916 sei a J H Qeuirm nf the Basketball Seaman 19115 t T was the opinion of many that the season l9I5 marked the culmination of "State's" basketball l glory for years to come. True, the wonderful ma- fl chine of l9l5 had been disrupted by the graduation l of three stars-Morgan, Tuttle, .and Scott-and l Wildcat followers, with few exceptions, seemed to be reconciled to a rather dismal outlook. But, with the keen foresight for which he is noted, Dr. Tigert had been instrumental in arranging a schedule which was . probably the most difficult ever attempted by a Blue and White five, and promised local fans a treat in the way of masterly exhibitions. Shortly after practice began it became apparent that "State" would again place a team in the field which . would be equal, if not superior, to any in the state. The return to the ranks of Derrel Hart, veteran of the l9l2 quintet and a star in the true sense of the term, revived local hopes considerably. Victorious over the University of Cincinnati and Beorgetown College in the early games, Varsity was going good when stopped by Vanderbilt. Although apparently outclassed in the first half of the initial game, "State" came back strong and kept the decision doubtful until the end of each contest. The un- paralleled team work and fast individual playing of the Commodores made them seem invulnerableg yet only a turn in luck prevented the Wildcats from L winning the second game. Derrell Hart sustained the hopes of the "Blues" until the last whistle by register- ing occasional goals. Tom Zerfoss, a former Wild- cat, appeared in the Vanderbilt line-up and played . brilliantly. Two games were played with the University of r Louisville, resulting in an even division of honors. i V Since both teams were otherwise undefeated by 1 Kentucky contenders, the result of these games il at C1301 XI is E l 5, ll I i l l 1 1 I 1 P l .., ., .J f 'K U! .5538-a5iTQggi5f rrratlfsiev 1916 Fillliifl-if Y . ..,f' .TYQZQX QZKZQ 75ers fu Clcicrn N l ,W Y jf-' QHQ Wenfuckzan Q, left the championship of the state undecided. On the night following the Louisville game, Kentucky suffered defeat at the hands of the University of Tennessee after a hard-fought battle. Athletic relations with. Centre College were re- sumed this year, two games being played, and easily won by Kentucky. Maryville College played a surprisingly brilliant game, but went down to defeat before the "Cats." A double bill with Marietta'College, closing the season, presented two of the best games seen in Lexington in years. "State" was at her best in these games and put up remarkable exhibi- tions, but lost both games by narrow margins. The Marietta team, champions of Ohio, defeated the Buffalo Germans just a week before they played Kentucky, and claimed the championship of the world. Under the circumstances, it may be said that the past season was successful. All "State" peo- ple enjoyed the struggles, in every one of which the Blue and White team gave a creditable ac- count of themselves. Hart, playing at forward and at center, was unquestionably the mainstay of the squad, playing a brilliantly consistent game at all times. l-le was generally selected for forward on the mythical All-Kentucky five. Captain Zerfoss played, more or less erratic, at forward early in the season, but when shifted to guard, played superbly. Whiting, who averaged tenbaskets a game for the season, considered him the best guard he had ever played against. Gumbert played his usual consistent game throughout the season, now and then showing flashes of championship form. Server, at center, outplayed every center he opposed, and is one of the men around whom hopes for the coming year are centered. Ireland and Zerfoss, playing their first season in the Varsity line-up, handled them- selves well, and all indications point to stellar per- formance in the future on the part of both. Man- ager Carman discharged his duties efficiently and was awarded a "K" by the Athletic Committee. um Q E 91916 as J I ET M-,121 ff.. ..- .--..,,.,.- , l 9769 759 nm clcian fs,,,,, ,,,,,,,q 4 THE SQUAD I P 0327 1 5i2,, J w'E,fE-::""" ' """"""'Iff,g,, .1916 QE. .,,. A 9 M- 1- . :. .f 9 AJ f f . ,, ,MJ ,b fi V ' g. ..ux X . P wx.. ': - Q, , W ff-. Qwqqgf Lf -. 341' .xh'.! r-' ,1'.j!jf'-'ggi' 'A , - wh, . 2. .W X-.F '.w-f.,, x. . 'V v 'N ,r g . -.JT , M. K - . .. ' I . l Mvifgzsg H 'lg'-s 'IL 5 xw'5,rf+i1 . di fm . . N134 -V-'1a',5'.,f,. . 23 f':'v,?'f-' : 7. K ' 351' 'ff 4" "-Q1 , f. b . XM ' Lgirmvi H - 'Mm 5. R' - .' ,If A . l. If ' N NIJ. 'uf 'A-f, W- 1,1m',: ..1,al'.,,,-V4 ".'Zx'l1""' 1 .ej.s1 Lf,Sffl,x! ,I 4. ,1-,,, 1"-. Q: YI iff'-' 'WP' -,,..-an " ft? 'AI' ,s."ffL. i.5f.i'?:?rQ -XML ' 1, wggg. . M...- , , . v 4-...'1, ' "NA 2 K v.X,..., 4 'K Inu. v NDN, 5 ,315 '- -', :jd wi: 'vi -4. A . 4,1,N,, - 'fm- 'fini . ,.,,,.g1 .'h.-fiif' , -. "x'. . ,.,g5,3'3 Ky ,J .' 12. AFI '4rJ.Y',lf'L ' 1.5'.1,x .L I, 6: fi' 1 I Rza- -1.1:"1:5Nf' J'.'. ffgir-1? ,, y A .. 4,'5y5.,' V . ,N 1" '- . -Q' 'f,,.v,?mj xv -'-Nr, V X .. . .. ',.." ,F ' Z .1 - ..., ,.3, .-4. ., v ,Jw J - mm, ' , ---'f,,,,, A4157 ' w HJ.. .ig U33j , Lf-si:-11 , " 'TT-Q ,fqi ' "4""" ,rffff '31,-f - 41 1. .4 ,N -M.,-1 h 'pw T A '-T ' if fi w'-D... iw-, p Q , . ,, n f ,, , , , X 4 .... .- . - -,, f- . f , .,.-. , ,A --.f ,fm , ' ' Q L' ' ' 1' J' 5.11 'ffff I V14 57 fi' ff fp QQ Gr K, THE SQUAD 1 l J. J. TIGERT, JR. n 4 Ma 'M in iii 2. Sl F, 293 Ps? QU Tm 518 55 F52 HI iii 553 QV wi LZ? we wi ri 42: Vs sis EM Q2 gm Ml si nw iw gf! W fp ! l M .L EU 5, FQ 1 N fllfyf N Vi H' lx' 'N M ,f-Q A w ,ZQX6 W? as 2 gnc? 'kenfuckian fE4...: if Girlz' Zfiawkrthall I 9 I 6 RETROSPECT ROM the first blast of Coach William Tuttle's histle, early in December, it was apparent that more interest than ever would be manifested in the feminine presentation of the art of "basketbalIing." The situation confronting Coach Tuttle was similar to that in the Varsity ranks in that only 'two of the previous season's team had returned. The loss of Misses Hughes, Wood and Taul was considered almost fatal to championship possibilities, but the spirit of the newcomers went far toward restoring confidence in a successful outcome of the season. About twenty candidates reported for practice, in- cluding Misses Heller, Captain: Innes, Manager: Bastin, Hayden, Cregor, Flanery, Piggott, Geisel, Harbison, Woodruff, Highfield, Burkholder and Smith. Miss Eliza Piggott, a strong aspirant for first team honors, was forced to retire from practice early on account of an injury to her hand. The entire squad practiced faithfully, but inadequate training quarters just before the opening of the season was responsible for the poor showing made by the team upon their initial appearance. ' . The first game was staged at Winchester with Ken- tucky Wesleyan College, and resulted in a 23 to I2 victory for the Wesleyan maids. Two games were played with Louisville, the first, at Lexington being won by the visitors, I2 to IO: the second, at Louis- ville, going to our own co-eds by the score of I9 to I7. In the return game with Wesleyan, Coach Tuttle's proteges triumphed, accumulating I3 points to their opponent's IO. I It was evident, not only from the improvement dis- played by the team in the latter games, but also by the scores, that the "State" team was making rapid strides toward championship form as the season pro- 0355 W Q31 9 1916 af, a I I I V 929 'kenfuckian Q. a a 382 Q W. ...- Q! . W ' g , I E 3 ' 1 Lu -- el ,,,.,,,......................,...............,...4. l 5 gressed. Miss Elsie Heller, as Captain, deserves much credit for the manner in which she led her team. A star in her position, she set a pace which, under more favorable circumstances, would have placed "State" easily in the lead of all other Kentucky girls' teams. Miss Heller has the faculty of being able to encourage and direct her teammates in addition to playing a more brilliant game than anyone else on the floor. Local exponents of the game greatly regret the loss of Miss Heller's services to the team, fully aware that her graduation this year leaves a vacancy which will be difficult to fill. Another member of the team who has appeared for the last time under the Blue and White banner is Miss Pearl Bastin. Possessing a clear head and a sure eye under the most trying circumstances, Miss Bastin's services to the team have been of inestimable value. Always in motion, from the first to the last whistle and right on the spot where needed most, Miss Bastin has been a general favorite with fans. Miss Nancy Innes, Captain-elect for next year, has added laurels to her already enviable record as a guard. A game fighter and a good loser, a fast, consistent player from start to finish summarizes the secrets of Miss Innes' success. Much of the credit for the victorious season of l9l5, as well as I9I6, may be attributed to the efforts of this congenial miss. The other recipients of the "K," Misses Hayden, Flanery and Cregor appeared in the line-up for the first time this season. Miss Hayden's previous ex- perience on the Lexington High School team, in ad- dition to her natural ability, made her selection for the first team an easy matter for Coach Tuttle, who considered her the find of the year. Misses Cregor and Flanery were recognized early as valuable addi- tions to the team, and their playing throughout the season fully justified this opinion. may a 31916 s A a 1 YY" i Aga f"-" j'l?g2?ZIi?Qf. T50 cf Q22 fu clit ian Q-:f,f'T-SSREE: 1' i : 5, k I y. 5 3 1 .fm i ll In 9' ! I 5 3 E I I 1 i 1: E X PS E P R E E C1372 1916 4552561 E n i J ,,, , Baseball sst, p , , , COACH mm OUR years in the limelight at "State" obviates the necessity of an introduction for William Tuttle. The fact that he is the holder of ten "K's" earned in football, basketball and baseball places his name in large type in the history of Kentucky's ath- letics. ln baseball, as well as other forms of athletics in which he took part, no one on the team was more dependable than Tuttle. Playing practically a faultless game at first base and always hitting among the leaders, his services were almost invaluable to the team. As Coach of the l9l6 Varsity, Tuttle has evinced a quality of his nature latent here- tofore. The perfect understanding which ex- ists between Coach Tuttle and his former teammate, Captain Park, is showing splendid results, evident in the well-balanced unity of the team. Whatever may be the outcome of the pres- ent season, sympathizers of the Blue and White will feel the assurance that the destiny of the l9l6 Wildcat ball tossers was in ca- pable hands when directed by Coach Tuttle. I9 I 6 PROSPECTUS S the Kentuckian goes to press the season is far enough advanced to permit of conservative speculation 'as to the ultimate success of the team. Inclement weather necessitated calling off the game with Michigan, first on the schedule. The opening game, played with Ohio Wesleyan, was won by Varsity, the following line-up being presented: Schrader, third baseg Waters, shortstop: C. Park, first baseg Crum, catcher: Spaulding, left field: Mcllvain, right field, Frazier, center fieldg Roark, second base, McClellan, pitcher. "State" was defeated in the second game with Ohio Wes- leyan, and lost both games to Ohio State the following week. The game with George- town College was won by a narrow margin. V ' In the opening game of the season, McClellan, who bid fair to top the pitching staff, suffered a severe injury, which will keep him out of the game for the rest of the season. Cooper, Malone, Server, G. Park, and Crrubbs have all had a turn on the mound, but none of them seem to have hit the stride necessary to win games. Aside from a troublesome pitching staff, Coach Tuttle's selections are giving a good account of themselves and will doubtlessly take care of the remaining games in the manner which gave' Kentucky athletes their name. may If W W W -MQ ui' if VARSITY NINE . Itlruivm nf the Swann 1515 FTER several weeks of preliminary training, a Wildcat team had been developed by Coach Brummage and Assistant Coach Paul Gosage which gave every indi- cation of being one of the most formidable that had ever represented this institu- tion. While there were not many particularly brilliant substitutes on the roster, the Varsity line-up was composed of seasoned men and seemed to present no weak spots, except perhaps in the pitching department. Captain James Park, recognized as one of the best college pitchers in the country, far outclassed any of his understudies. Thomas, Server, McClellan, Flynn, Ireland, and Grubbs completed the personnel of the hurling staff, and while all are slab artists of no mean ability, some jinx seemed to prevent them from consistently pitching the team to victory. The opening game, played on Stoll Field with Ohio University, was hotly contested, but the "Cats" lacked the punch necessary to prevent the decision from going to the visitors by a narrow margin. Three days later Michigan won the second game by the score of 8 to 2. The game was slow and aboundecl in errors, especially on the part of the locals. Schrader, at short, was the shining light, handling eight chances without a bobble. Waters, Reed, and Hager each got two hits. At Knoxville, "State" divided honors with Tennessee in a two-game series. In the first game the team backed up Park efficiently, but the following day played rather unsteadily behind Server. 0391 - -- -V -- i , .. .. i f' Tv' ,, Tg.'gjQ1Tlg1Qf2i 41-1 fl 'YZD .Zi fig , ,,,,Qf ,,,,,,. ,, ,,, Q a fry, H Q5-fr-g13'.53k' w--- e- -I---9 She' ,'ft,e?'f.'f.f-.rie.+e,ft,.4fs QL.- . , , H gffgsqsi I ,,, I This courtesy was duplicated in the games with Miami one week later on Stoll Field, . "State" winning the first 7 to 6 and losing the second 2 to I. Kentucky showed her superiority over the "Volunteers" by winning the next two games from them by decisive scores. Thomas, on the firing line for Varsity, was almost "unhitable." Heavy slugging , I I! and fast fielding by Kentucky were features of the game. I Y, The outcome of the games with Cumberland University and Southern Presbyterian ll! i University, played on the Southern trip early in May, was more or less disastrous. Two won, three lost, and one tied tells the story. Errors, on unfamiliar ground, by the Blue ' and White, were largely responsible for the defeats. The game with the University of Hawaii, as usual, was a first-class exhibition, in tl li spite of the fact that the "Cats".were not victorious. The schedule closed with a 3 to 2 I I A victory over De Pauw on Stoll Field. The season of I9I5 was satisfactory to the students as spectators, if not from the i xp viewpoint of games won. Seven games were won, eight lost, and one tied. Varsity E I scored 78 points to their opponents' 60. Captain james Park led the team in batting 3 I , with an average of .323. W'aters was a close second, while Wright and Crum were I tied for third place. The fact that four members of the I9I5 team have made good in professional ranks demonstrates the caliber of the material which is rapidly placing Kentucky in the I front rank of Southern university athletic teams. BASEBALL SCHEDULE. AND SCORES, l9I5 I I I April 7--Kentucky April I0-Kentucky April I6-Kentucky April I7-Kentucky April 23-Kentucky April 24-Kentucky April 30-Kentucky May I-Kentucky lVlay 3-Kentucky Ik May 4-Kentucky May 5--Kentucky May 6-Kentucky I qi' May 7--Kentucky May 8-Kentucky May I4-Kentucky W May 2I--Kentucky I x t li .,,, ... . - X ,.,...., ,.,..... ..,...,,.,.,., ,, .,,....,.. ,..-, Ky. Opponent Ohio University, at Lexington.. .. 5 7 Michigan, at Lexington ...... .... 2 8 Tennessee, at Knoxville. . . . . . . I2 0 Tennessee, at Knoxville. . . . . 7 8 Miami, at Lexington .... .. 7 6 lVliami, at Lexington .... .. I 2 Tennessee, at Lexington ............. .. 7 4 Tennessee, at Lexington ................. I5 2 Cumberland University, at Lebanon, Tenn.. 2 2 Cumberland University, at Lebanon.. , .. 6 7 Cumberland University, at Lebanon. .. 4 0 S. P. U., at Clarksville, Tenn .... .. 2 3 S. P. U., at Clarksville .... .... . . 0 3 S. P. U., at Clarksville ............ I 0 University of Hawaii, at Lexington .... 4 6 De Pauw, at Lexington ............ .. 3 2 CI40J VV?5'P9 1916 cg it . L... .....-... L. ..,.., -, .--ng I I , , I I 1 Al T Y. ,f,, 6f "'f'33gTf'M""'f9 7612 7Qfer1fuclcz'c:zn 0419 Qgffy-V--fv -M-4fM,, 3825, 1916 . J I ,V V V.V ' V 7 , A' pmilf V? www .,,VV- ap ,AVKZA , V ki 'ffMf1VVVf45:V1 ply M45 'f w ia VfV W V ,'vz,,' 29574 MV 235-V44 Vw vV,.5 fg "an, VP1?Vf23fVf?f2f: :?1',ef iz' k, Y-l 'M W-Q V LV,zl'ff rv W ,VV " 'V V,f1f..Vg,, V AV Lv Mm V wg I , Mix? -ff V 4355 7,6283 V, 'A "nw ,gf 14 mwfffi We ff 'VV97 Va 'LLVK V, .n 1 iVff,, " fa' V 'K 4 ,,,, ., Vmgq mViJ5E,g!ig M WV: 2 1 'V., gV V .VVf?,?f f M25 V rw V,VVe ,V W4 VVVJZV .V.V ,VVVVL ' V .' in 7VuQVf.1i!" ' " T' VVV ffiti'ffi'V1 V1-222 i' 1 'QQWQ V V Tv - Z5 4 'CV f ,W 4 li VvV5V V . "Tlx f MV .M VW .V V527 Jw V V VV-if 'V W' YV.. AVL! 9 V5 aa V VV WSH 'V-MMV - '1 VV1fV wi V gijgiiffiiwixijggifizi? V V V 4 AV ,If -7 f 'x' V ,,44'Vg',::VV.,,mVv Hf:r+eVf " ffQ4iQV '45 ii'QV1V fV4'T'jf Qfq ' 'Vy ZVV- 1 1 V - . .Vu-WV'-,V VV.-V.fVV V. 'V .3 . V 'qw ' 4, 5 j"', md, A 'fgr- Aff :mf V Milf. V' "" wks? 'V . "wsu M VmnV.fV,1'- '35 ,VJ 3531: . mfiradl' V VV Jyfuwqw' I ' Ls M3 " 'z 'Vis VQQWM Qi ' .fif ' V W 'z-ra V 34' Vi" ' V: V, V' V5 gg fwgw, 'V V-f U95 ' ' "' V1 V! V V, ' ,QQ ':f,f?i'5T55', ff.,k':fQT33'V'?f " V245 Y V 57 14' 4' VuVVmvV 33 Qgzqg uf QI V fa Vf 4 V 11' V 'I V V V A 75? I tv M r- ff twig? .qM,.,' V K V426 v,'33'g:,Q! V Q fm '5'fff1V7'V' WW "Wx, . 7 V I - V .V , i?W'3?'2i" U 1gV.'M my 'MV ,Vw-VVf1VV 1,f.Vg,"+53Fa. g inf ' ,V, . -'I,,gj,V, - V':yV7'-,QJVL ff ,K V, ,A 'V QV' S - ,V gVVA:gfVVV:aVVVVfV,14VVVf,a-VjwQ, 'XVcVMV,V,,,4'i5,VV hw V , N - ,., ,. V V wr'w::V1Vs:Vgsm2a2fa9fim .fn WV - V' 1 i'V4gVfwAi'.,'f,Qp,lV'f"V',,1i , AVWV54 mV.,4,fp,,.V3 . , I ,V .vwVV,gVVy.,,VL1 "Tig'53if?'3Z!fSV1fii?2fV.f.1Vfl' V' V ""' 7'I"V:wV1ZfjLP V ,V V w, 1 ff. f 'v mf we Jw 42:31 V- ,V C' 'I L'r3,4if4VVVVV V! 'L V,Vw' !Vw 'V VV,"15 I'fVgiKVV"'5VVY'V'1 V ' 61:4 Wipfy ' ':V c V 4 ','Z'W,f'+ v .Vw ',g.,w, 'V ,Vg ww -V V .V ,Vw -V G'Vm5,i1 ' A VV 'VV-'MI' "Vg9g,4Jg'f5k5'f53ZfY1,ff, ,Vw I ' iwiiff Q, x?Kllf.VfnM1f,L..LLVgYl' : ' HT W? ' Lf,gjZfiV iVV,VtfVg,,g 1 IF, V,q1,"'1qV' V' , I3'V Y ' A ......... '. 5 V , r V ff ,,',,' 1' , Q ' ' V 'V ' V y s LVV 'f . g V 'U V if 1' Y ' "fi V Q i 5 - V, ' ' VV V I V V 'V Y '11 'QV 'M Mr- A , I V 'ff 7'E4f4fz2'g1 V V V, yr . , ' V V' V V V , I '1 , A-V V3 QV, f 'VV 1 V ,V .mp Vw '- -V ml ' V' K V' gin' J li V V 'ffifif xi V' V V- ' 1 V 'f -V M rw-'fV'i2VV wfnfzffzi V,-'mV V' nl in '- V Qjfq. V,VV-'uf,:H:s2f4?,iVf.5V 1 f V Zig? J Y?-1 ,sunk 'S V V " -J, 'g 'ttf .' ' -4- 4, V ' -' Z' frN,'.' 'QV ' ' V::,iQ'Vf?"?' ,ii f, V 'f' H M nr' :V 4 QM .,' 4 VV. VM-fqg'.'Vw V-V,VVw",, 'V ,VI ,. ' IV- I V V ,,. gp, .55 'iw V, ' ,gg Ku 5 di-N fly " -'ff .,fffVV'f1m!?6i?'f1bV r-'V' V fi .lk , "LL-f? ,7tf"w H 4 4- '9' ' ,'.V'f'Zx:F'Vf'ifLffVy' fv' ww .11 Vx V -V V , LN. ,vw V ,VQWV w i'figL3 f ' -' V ' ' 'Y ' ' z - ' 'n' K-V QW Vwgffg " " 1 ' ' 4fV V V . . Qummg V, , ,V VW.. V , V-. 2-d1w5w9:'32. 2M...V"-1'.V..4V-M A VV .f,,,w..V ,V MMV.- VVV W I .VV-..,,,.,,,, ,, ql42pV. l Yi Wife' 'Ifenm clcian s fi'7ixlF r t ,l il lil ' :ij :li :H lli li! Yzf ll .fl :'l mls M if tr' WSP f H 19? ri ilivuiem nf Thr Efrark Svvamnn 1915 gg 1 y HE one branch of athletics in which "State" has never been able to corral , 3 , f a 1 I k . a,team of world-beaters, even in their own estimation, is track. Needless to say, the season of I9I5 was no exception. Dr. William Anderson Y' of Yale track fame developed several good men from the large squad ' which reported for practice, but the inexperience of the Blue and White youngsters made Q l 'Q them easy prey for their older and more seasoned opponents. i In the first and only local meet of the season Vanderbilt won a decisive victory over the "State" team. Varsity was more or less handicapped by the absence of Captain I Roth, who, on' account of injuries received in football, was forced to see his team go I down to defeat. from the sidelines. -Only one event was won by Kentucky, the hammer t , throw, in which Hickerson finished first and Whaley second. Grabfelder led his team- gg l mates in the scoring, accumulating 6 of the 20 points. l 5 No world records were broken in the Georgetown meet, which occurred a few weeks l J later. Winning of the final event, therelay race, by Georgetown gave them the long l 3 end of the score. "Ks" were- awarded to B. I-lickerson, E. L. Frazier, E. Grabfelcler. lg E.. D. Wood, and W. Linsay, all of whom are capable men and did good work. Hickerson was elected Captain for l9l6. i I l I gi 5 mi fi ll 5 i Q l, if Yi r lr wg if wg um i f .I I is i fx 1 1916 -..v.....--...-JJ,1 K' G5 1530 -113 Zz 0 ,H ilflf ruff in M 'FFF ' 'A fif1ffRZ'ff'a5fi73'i'i "'b i , , l , . I , 1.1 Glnarh Stark AROLD G. STACK of Brooklyn, N. Y., who has assumed charge of the track team for this season, is undoubtedly one of the best qualified men that has ever held the position in this institution. Well known as one of the foremost athletes of the Irish-American Athletic Club of New York, and having served as assistant coach at Colby College, Mr. Stack's advent at "State" has reawakened widespread interest in the fleet-footed wearers of the Blue and White. Under the capable direction of the new coach, prospects for 1916 loom brighter than they have for many seasons past. Anticipation of future victories is bringing out the best efforts of the entire squad, who, under the-leadership of Captain I-lickerson, are presenting a fine example of the true Wildcat spirit by the earnestness of their efforts. l ' l I C1441 4 ' I I ' nv H 'Www-F "-V ' ' A Q ,Q?'?Tf..!A1TAf! fQx N3 fTfQfI."'A 'FZ s., , g, x.. K J .................-............. ... f E ' a 5 1 a i E , . C 1 s ? WA 4 2 X. . 4 I A I 5 ff fm, 55 f 4 :J 11 LE zz fl A Jlmmmn-H' z A AI ,ie ,i aa E2 12 wi A , x A 2 J Q 4 aadfllu Af? :lf we Vi 'wx --M-:.m,,w. Q W Lf? , I 0451 .- 112 142 51: E zlj .ff I h W9 916 QQ, , -M ,g:1:3::g:Tj.g,i.:g,, -.,..--m........ XX Q 5 w F l l I Y Y , 5 fx . N.: Li ,I 1 3 I Q 3 1 2 l 2 a 3 2 2 S 5. ,. E 1 1 l l . x A . Han-ijrllvnir Glnunril MEMBERS C. N. PEDLLY . . . . Kappa Alpha E. A, BLACKBURN . .... Sigma Chi R. F. ALBERT . . . Sigma Alpha Epsilon H. F. CROMWELL . . . Phi Della Theta C. H. MATHERLY . . .U . Sigma Nu W. J. COLLINS . . . . Pi Kappa Alpha W. L. MCKEE . . . . . Kappa Sigma T. C. TAYLOR . . Alpha Tau Omega 0471 ' ...., 4 G fqi 41489 .9 mf- -WW,--.. .h ..,.., 15316 .,k. 45 f"1i?'W" M "gf-5 WIT-'r L fm. 5 -' 'A"'Mjjj""'- H M'-"""' A'-' ' "JW A -.u . .... , GI 4 ,- E 5769 75Qnfuckiczn 6.,.-,.fE,.-., x x KU XR V Kappa Alpha Founded Washington and Lee University 1865 THETA CHAPTER Established February 2I, H593 Colors: Crimson and Gold Flowers: American Beauty and Magnolia i Publications: "Journal" and "Messenger" CHAPTER ROLL H. Wonsr-IAM G. M. PEDLEY G. N. MCCARTNEY W. P. WALTON, ja. j. T. CAMPBELL R. M. IGLEHEART WM. M. GLENN B. C. Fonn M. J. CLARKE S. A. WRIGHT MCCLARTY HARBISON WM. PETTIT T. C. MCCOWN H. L. FEARING J. T. Cassini' GAINES jAsPER PLEDc.Es R. T. MOORE J. M. PURSIFULL CHAS. KERR, ja. C. P. MABRY SAM. MORTON Cl49j Q l l . s 4 rl H r I 9 Ga - 9 1916 G9 . 335 if - A -. 4 "l J: pf 5' -'N fp ia, '- f VVWX fQ x kid fwf.-v., . N- x . I6 X wx 'Wwf.1Mmu9' iw ,f Q 1 'SMU ' ,,5.,,.. f. !f...,14,5x C1501 in 1916 Gi2? f1f-33.151 Ll 'of .... .rf ,- VA ,I I If I L., ,fx fu , , P, I 1 I s . I I I 1 1 l I ,5- gal 513 i I5 Il III I gl Ai rl Ti IYI . I ii! I l l 'S Iii iff V! Ig, 'I lin Mm HEI gl? Us 1 ,N i ll I IH I V P' ......... . ,... v.,,.f ,Nw 1, I- .A J If Q, M VN.. ,- A 4K h, M If-1-fx Q 1, uf ,F A., ,, I m., x,. 9 Sigma CMU Founded Mmmi University IS55 Flower: While Rose , Colors: Blue and Cold DERRELL HART E. A. BLACKBURN j. DOUGLAS GARRETT HERBERT GRAHAM OWEN LEE H. CLAY SIMPSON R. LAMBDA LAMBDA CHAPTER Estblishecl l893 ACTIVE CHAPTER MORTIMER MULLER j. DOUGLAS GIVENS BEN MAHONEY E. A. LILLARD W. TATE BIRD EMERY FRAZIER j. SMITH HAYS, JR. CLINTON H. GERNERT J. MARLIN MCCREIGHT F. PAUL ANDERSON, JR. GEORGE ORME WILLIAM W. ROBINSON jo MORRIS PLEDGES GAYLEN POINDEXTER HARVEY STEDMAN USD 'E RRI R' I 19,16 Q3gi33?f3-ffi5ELiQfg3'.fiEfEgTLi1: CISZJ A f r , fi! 4 ,x fi 5 4 , ' 'f f f f . 'KVV 'N'WF'N1""W -Q U F l "1 I .fig il 'T EIER ., .E 1 L El , , l l l l I ' Iv' li fi 'I L I 5 1 I ul I l ll , . I l I I I i 3 l 5 5 i Q f I , l Z 2 . Sigma Alpha lipnilnn I Founded University of Alabama 1856 Colors Royal Purple and Old Gold Publicalion: The Record I I I Q l KENTUCKY EPSILON CHAPTER Established 1900 l I 2 ACTIVE CHAPTER l E. S. PENICK A. G. FOSTER l W. J. HARRIS J. M. SERVER Q j. F. CoRN W. F. DEMPSEY Z l R. F. ALBERT H. S. RUSSELL P l W. F. CRAMER F. W. SMITH 'T S. C. joLINsoN W. B. CONLEY I l W. T. RADFORD A. G. WooD J. H. EVANS A. D. HALL V. STRAI-IM W. O. Focc I F. L. RICE C. C. EARLY J. W. HOWARD JOHN SALLEE if M I 5' I 0531 Il . lx I I f 5 , N ,.,,,, L ,.,,,....--, ,.... fl N If C5433 TTY' "'l i"i"f1.i.L-g:.g I"l 11 'F 'iff'ff'f'Affff.l' - F- . ' 1 J ff H??!i1l Clcmzn 14 wil' A In - JV: vyavtgywm 4 -,fi U09 A M , " x '96 41545 1916 -EL -,,--f-,.,-.Q-nu--- i 1 I 1 I .......-- I l 5 EI? lil ll A ,fy iff it l l xl Il Il I Il ,, 'l Il IIl Q I I . . i . 5, II , . 1 I l If :rl I-. .255 I '. g' Itl I: If. ll l. ll? f E l tgl tl it I. It fl ll ,I 'I . I 11' . It II. ., III . igf PI '. :I X433 'ff ,,f ,,,X , fi? .fl fwfr nj J x IL fc j it., ,. .I If 1 0 - ., liappa Sigma BETA .NU CI-IAPTER Founded at University of Virginia IS67 Established at University of Kentucky l90l Colors: Scarlet, VVl'1ite ancl Green Flower: Lily of the Valley Publications: "Caduceus," "Star and Crescent" ACTIVE CHAPTER W. L. McKEE E. H. CLARK M. G. MARTIN J. P. HILL W. H. BERRY R. I... SAUER 9 j. A. BRITTAIN O. K. MCADAMS H. T. POWELL G. W. Bmccs L. W. HERNDON PLEDGES F. H. THOMPSON H. W. WILLIAMS E. D. Woons B. Doss 0553 ' filggrgiefgjggg'229 ,IQ,i'fIif3 cs.. ,- V' r if ,,, If . 1 ii ' 1 ' F if qi af' ' 6 ' by K if 1?-lf ,. f Q , , A ,JN J f N Q 9: '4 Q' 'Y .1 X E' f . 'Y L A , ..... ,,,,. . .,,m,,,,L ., , 5 ,V . VV. 1 1 ':,, K ,Y 1' 1 V A ' . - , V, .f,...-. , .1 f,.,,. .L K ,. - , T fb . v x'.4,..' -5 4 NTSYW4 A fi ' af 4- ' y X - 2 , fx X 5 L ' X ., A . N-,-,Nu . ju? . , 4'-w..a?f,, i F I 3 X I I X E 9 ' 5 i , 1 ' A H ,Y 2 1 6 9 fl56J 1511i Brita Gfhvia Founded Miami University l848 Established University of Kentucky 1901 Flower: White Carnation Colors: Azure and Argent Publicalions: Scroll and Palladium fsecretj CLASS OF l9I6 K. P. ZERFOSS W. W. CLARKE j. E. TORRENCE H. E. MELTON H. F. CRCMWELL K. SWOPE CLAss OF I9I7 C. F. PARK T. D. Cnumas ' F. Y. HUTCHISON H. D. ABELL CLASS OF l9I8 T. T. RICHARDS R H. ROMLINSON D. S. TURNER J. W. WELCH E C. LAwsoN W. P. CRENSHAW E.. M. Cosa S. B. HuosoN FRANK R. GRAINGER CLASS OF l9I9 T. H. UNDERWOOD L. THOMPSON S. FLDURNOY P. H. GASSER R. S. PARK R. H. NOEL H. SHousE F. SHOUSE PLEDGES G. E. ZERFOSS G. E. PARK C1571 I X AS E? EEfff1f'fb 92529 F Qi? fu Ciiiwtdfl J f , , fl, Sf: ' fussy 1916 Q53 q E551 ix I l I k...,...L 959 7fQnfu clczan I I I 43 II, l l ,I I l I 4 . - I 151 Mappa Alpha X Founded University of Virginia l86S Flower: Lily of the Valley Colors: Garnet ancl Colcl Publications: "Shield and Diamonds," "Dagger and Keys" , l i OMEGA CHAPTER Established 1901 W ACTIVE CHAPTER Fl E.. R. BUIINLEY K- R. NESBIT I I W. J. COLLINS R. P. HUGHES I I V. A. DINKLE E. C. KIRTLEY , J j. M. HEncEs FRANK BUTTON I ll I L. P. YOUNG C. K. DUNN l3 Q G. W. WARWICK B. WILLIAMS '1 X B. F. LAMASTER E. P. TURLI-:Y E. S. PENN L. G. HAYES 3. I V R. Y. FISHBACK C. R. BOURLAND .l GAY DRAKE A W. L. PAYNE l PLEDGES l Q H. JENNINCS W. BAILEY J. DOWNING GEO. CLEMMONS I P. SLADE JOHN HERNDON ll H. j. CHILTON I fl59j I K , ,L A -f. -.., W - - Q io 1916 - L A , ..-if Q ,i XXX f'74'7" 0603 i I I v l ffff 3 l I I ' I I 3 l l l l I I 5 2 4 ,..,. . lf I 'Il l I 1 l 5 I, III Yl I l i f 1 I 5 ' 5 5 I I I , I . . I I I , i Q ' l I 5 I I l 1 , 395 Svtgnm Nu 5 5 Q 4 Founded at Virginia Military Institute January l, I869 I 2 Colors: Black, White and Cold Flower: White Rose I 5 E 5 GAMMA IOTA CHAPTER I Established at University of Kentucky February I2, l902 ACTIVE CHAPTER ' I G. D. AARON j. M. GIBSON M. M. MONTGOMERY I D. P. CAMPBELL E. H. HACKNEY M. E. PENDLETON ' l H. B. COMBEST C. j. HAYDQN H. A. PULLIAM ll M. j. CRUTCHER C. H. MATHERLY K. G. PULLIAM l,..I A. W. DAVII-:s j. W. MARII C. C. SCHRADER Q5 P. DAvIIzs O. L. MCCLURF. J. S. WATKINS ,tif G. H. CnI:IacI-I T. L. WILSON I I PLEDGES F. F. KREMER S. D. j. SULLIVAN 0613 ,-"v W. '05 .5i'K!"i- w- ff X- i-.P"'lHX'fV . 'fi 3' "B-fi-8' T I ... , - f 94 , U' u.-rw: E37 ' W ani . , ff' 'fx v. JT ' A - 7' ffiiiili: N A Y """", ' if ow - N xv - 4 Q x. I! 1 96 f Y 5 I L y Y 9 'v W' r lik 0621 , J' 'Sf'f"T " .A H, ...J-OC.. -.- , ' af I4 X 9 Alpha Eau flbmvga Founded V. M. I. I865 Colors: Sky Blue and Old Cold FIOWBFI Whilc Tea Rose MU IOTA CHAPTER Established I909 ACTIvE CHAPTER T. C. TAYLOR J. W. THOMPSON R. A. WALLACE D. S. SPRINCER G. L. JACKSON j. F. DELANEY L. T. WHEELER F. M. HEICK . H. MCILVAIN W. C. MARTIN B. N. PEAK S. WHALEY E.. W. HOPKINS H. L. MILWARD . L. DUNCAN G. H. HILL T. E.. PEAK . F. BESSEY F. O. LAMASTER H. I. KINNE . A. RIvEs P. H. PORTER . D. MosELY PLEDGES RICHARD IRELAND RUSSELL TRAVIS LAWRENCE LONGSWORTH may " C49 I C31-f "" 3 "ff D EDU005 0641 X ' I ff? Q59 ekenfuckian 5 Hllgatir Glirrlr Founded at University of Kentucky, l9I0 Colors: Cardinal and White Flower: Carnation FRATRES IN FACULTATE HoNoRARY ' DR. JAS. K. PATTERSON DR. ROBERT GRAHAM DR. JOSEPH H. KASTLE DR. JOSEPH W. PRYOR ALDEN H. WAITTE' FRATRES IN FACULTATE DR. E. S. Goon WALLACE V. SMITH ACTIVE CHAPTER LOGAN NOZJRSE GREEN EUGENE AVERY TAYLOR YOUNGER E. O'NEIL ' WALLACE W. WARE O. PAUL GERHARD WILLIAM R. GABBERT LEE S. MOORE LEONARD D. TAYLOR FRANK T. STREET CARL A. TIMMER CHARLES WALTER CRowDER PLEDGES J. BRANCH TABER GEORGE A. HILLSMAN JAMES H. MCCONNELL WALTER M. JARVIS ARTHUR J. SI-IAw ROBERT M. DAVIS C1651 . ' .........N 7 53 U I I. II I Q . I N I 4 J J V .if R G' -L QL v I K X If a'f-e , .. , 0 , P Q fg 35 an FJAQXQK,-,..,, qv-,GJ .N w X . 647 53 X Q 9, mx F ,X 4 2 R X .-,Q 1 I .H ,,, f' ,, m f it A ' A E 2 S W 2 1 Q 33415 Q' .- . iw -1 ., AA . gym X qleep X 4 ,...,. E '9 759 ckenfuckian 1. Colors: Buff and Red Byelta Glhi Founded Cornell University, lB90 Publication: "Delta Chi Quarterly" KENTUCKY CHAPTER Established l9l3 'Chapter House: 4ll East Maxwell Street W. E. DRAFFEN B. R. Cisco R. W. HANSON J. P. Goonsow REYNOLDS TENNYSON- REDWINE Q C 3827 T ACTIVE CHAPTER I9I6 W. LEE SMTTH A l9l7 ALLEN R. WATKINS- 1918 J. W. SwoPE, ja. G., V. Bnooxs j. P. CHERRY . .l920 S. C. Glsl-1, JR. POST-GRADUATE j. B. N1c1-xoLs PLEDGES Louis WARE G. C. GARTIN C1671 Flower : White Carnation JAMES N. FARMER W. T. KENDRICK, JR. j. J. MCBRAYER P. S. CARTER HERBERT MAXEY C 319166 , 232 1 - i r f, 1 I , c ,. f 1 9 fm.: Sf 1 u -, ,7 , Y f if N f ff--- ,.... V' J' cl 'ag' if -Vg, 1 5 : c.,L if Lf! J' L C,,,W,v,,, EI! . i I r 5 0 g ai, M A , , , UQ., , V FV ,V K , . If .:, .,,, 5 i uw? X1 5 X fvy x 'wc , K Nm J r :Sew 4 . f Q iv 32' y 1133! B 4 i 5 -mgxxigid I J :J m, Q 1 Y f , T E-Ii frtilzifv x . U.-Q g -mm X W .1 . Q .P 3 . l fa C1681 v 1 4 1 1 V ! V I w i I n 1 I J i , A i I 5 I 5 W 4 gl: I I al W il . 2' Q li. gif Ggn im im ' Ai' ! fl! 3 V! i L I 's if H2 ,,,f ' , 5,1 Q. , A2 'l i 1 ' 2f,v 19235 , 9.59 'llenfu ckian ,yy ,n., WL., L, Eau Tania 1Hi Founded at Lehigh University June, 1865 Publication: "The Bent" Colors: Seal Brown and White KENTUCKY CHAPTER ' Established April, 1902 ACTIVE CHAPTER J. WOLF M. M. MONTGOMERY G. L. CHERRY A. W. DAVIES C. W. LOVELL A. J. RANKIN R. F. MACLEAN W. W. CLARKE R. F. ALBERT R. E. HUNDLEY S. J. CAUDILL . M. S. SULLIVAN J. N. WATERS W. M. ADAMS A A. L. EIMER D. S. SPRINGER FRATER IN URBE ' C. C. HARP FRATRES IN FACULTATE F. PAUL ANDERSON L. E.. NOLLAU W. E. RowE A. L. WILHOIT C. J. Nonwoon J. J. CURTIS W. E.. FREEMAN J. R. DUNCAN L. K. FRANKEL P. R. CASSIDY C. L. REEs M. J. KELLY NATIONAL CI-IAPTER Lehigh University Michigan Agricultural College Purdue University Stevens Institute of Technology University of Illinois University of Wisconsin Case School of Applied Science University of Kentucky Columbia University University of Missouri Michigan College of Mines Colorado School of Mines University of Colorado Armour Institute of Technology Syracuse University '593 RoLL University of Michigan Missouri School of Mines University of California Iowa State College University of Iowa University of Minnesota Cornell University Worcester Polytechnic Institute University of Maine Pennsylvania State College University of Washington University of Arkansas University of Kansas University of Cincinnati F REX 'I li 'n I I lt I I I ll I I I I ll Il J .I li l l l 9 ii fn-A' f C 'J 1' A mop , 4 V if f' . MW., -- J X -J 6 I I of-nj 7-"T Q59 'kfenfuckian fff"..,QE,4 qt I i ll I l Alpha Zeta . Founded at Ohio State University November 4, 1897 l l l Colors: Mode and Sky Blue Flower: Pink Carnation I Publication: "The Quarterly" 1 I SCOVELL CHAPTER I t I Established November s, 1912 l QQ ACTIVE CHAPTER l I l l l M. L. MCCRACKEN l I L. H. NELSON R. S. THOMAS i A. CARMAN F. O. LAMASTER S If I F. T. STREET W. W. OwsLEY l I R. B. HAYES C. W. BENNETT l 4 B. H. MITCHELL G. M. GUMBERT ' I R. W. SEAIzcE J. A. HoncEs ' , D. P. CAMPBELL L. A. BRADFORD J. E. MCMURTREY I . E. A. BLACKBURN C. L. MORGAN NATIONAL CHAPTER ROLL Townshend-Ohio Stale University l Centennial-University of Colorado Morrill-Pennsylvania State College Maine-Orono, Me. Morrow-University of Illinois Missouri-University of Missouri 'Cornell-Cornell University Ellioll-Pullman, Wash. Kedzie-Michigan Agricultural College California-Oakland, Cal. l X Cranile-New Hampshire College of Agriculture Purdue--Purdue University I Nebraska-University of Nebraska Kansas-University of Kansas Y if l North Carolina-West Raleigh, N. C. Dacolah-Agricultural College, N. D. l I La Grange-St. Paul, Minn. Scovell-State University of Kentucky I l Green Mounlain-Burlington, Vt. Morgan-University of Tennessee l W. I , Wilson-University of lowa Ceorgia-College of Agriculture, Ca. I l Babcock--University of Wisconsin l ' l A l l . um T . I l il I l t l lk L A A -A A I ,EQ f Q Q3 ao 1916 cf , 3321, - .J l72 ..,.....,-.....,, J 759 Wenfuckian 1Hhi Alpha Belts Founded Kent College of Law, Chicago Colors: Old Gold and Purple Flower: Red C8Fl'lBii0n CLAY CHAPTER l Established University of Kentucky, l9l4 ACTIVE CHAPTER J. E. TORRENCE L. N. GREEN W. H. BERRY F. S. GINOCCHIO V. A. DINKLE A L. S. MooRE. F. H. RICKETSON, JR. Q A. G. FOSTER NATIONAL CHAPTER ROLL ' J. M. MORRIS l Y. E. O'NElL X Kent College of Law' De Pauw University Northwestern University Chicago Law School University of Chicago University of Wisconsin University of Illinois University of Michigan University of Arkansas Western Reserve University Kansas City Law School illinois Wesleyan University University of Iowa Cincinnati Law School Northwestern College of Law New York University University of Missouri Georgetown University Yale University University University University University University University of Kansas of Virginia of Colorado of Maine of South Dakota of Southern California Leland Stanford, Jr., University University of California Washington and Lee University Denver University University University University University of Kentucky of Idaho of Washington of Nebraska John B. Stetson University may A E 291916 ear X l l 3 I I. E llc Til 1 V X .L Q, A i ff' 'ff' s , A , 4' Q, ik X -.,,,"n,np ' A , mx X xx Qqphnasglh Ag, ' ,,', xp' ' - I' .'-, 1' .H 3 TJ " "' f M 1 ,E he 1 Q C1743 Q 382 Ea 729 Wenfuckian liempa 1Hi ART FRATERNITY 4 Founded University of Kentucky, l9ll Colors: Lavender and Old Gold Flower: Pansy Publication: "Quill and Inkl1orn" HONORARY MEMBERS DR. ALEXANDER ST. CLATR MACKENZIE H. C. Nonwoon ACTIVE CHAPTER O. PAUL GERHARD MORRIS E. PENDLETQN JAMES H. McCoNNELL BEN MAHONEY j. FRANKLIN CORN HERBERT FEux KEELING G. PULLIAM, JR. LocAN N. GREEN LEE S. MOORE MORRIS L. MCCRACKEN E. L, GRIEEEN ROBERT Ric:-:EY N. C. WOOTEN 'NATIONAL CHAPTER ROLL A ' ' Alpha-University of Kentucky Camma-Columbia University - Bela-Centre College Epsilon-Purdue University findctivej Della-Vanderbilt University finactivej Phi-Ohio State University V 1 l C1752 E 1319166 ' .332 on 9 Vfr I p 1 Q i v , I2 e If Y , Z 1 5 N 5 5 5 g E AAWFBF. M l , , M 2 Q3 4 7 5 7 ,f' S J iii sig + A J ffl G? 6 Q igf , f ' Q 5' ling" ff 1 3 , f .,,, ? I, .,, R K? .ig Q,1.,f ,. 273 :gif 3-1 495 25 ,, 5, me vi 0765 ai? .v' 5? 1. 1 its x . . I in V 2 ! 6 - f'-'sv Q59 'kenfuckian J I I Alpha Evita Sigma National Fraternity in journalism and Advertising Founded University of Missouri . ACTIVE CHAPTER ALEXANDER ST. CLAIR MAcIcENzIE ENOCH GREI-IAN HERBERT GRAHAM ALLEN FOSTER J. H. COLEMAN W. L. MCKEE OWEN LE A JoI-IN MARSH MCCLARTY HARBISON A WILLIAM SI-IINNICK HERNDON EVANS ESTILL Woons I F. H. RICKETSON, JR PLEDGES PAUL GAssER FRANKLIN CORN 0772 Q gas? 3 1916 is E285 1 4 X K , ,-pq-L, , ,.,.,,l.-..,, YQ... -. may f NMIWQ X 'Wuluw , :SSM y 3----'ff-9 Q59 ckenfuckian f Eameh 152 Founded at University of Kentucky February 15. l9l0 - Flower: The Acacia G. P. NEAGLE .... . j. S. OWENS . Rorrr. NIITCI' A. L. COLE, 563 Ky. H. K. COMES, 464 Ky. T S. F. GRUBBS, 573 Ky. O. P. GERI-IARD, I09 Ky. 5 W. S. HEIRONYMUS, 840 Ky. L. M. HAMMoNDs, 679 Ky. A. S. MAcIcENzIE H. S. BARKER M. L. PENCE j. T. C. Non LYMAN CI-IAI.I4I.EY . L. E.. Colors: Blue and White . OFFICERS ...............PresfJenl . . . . . . . . . . Vice-Presideul IEI.I., jR. . . . Sccrclcry-Treasurer ROLL L. J. HEYMAN, I Ky. j. B. NICHOLS C. F. LEE, 155 Ky. j. S. OwENs, 648 Ky. E.. D. MASON, Ill Ky. C. C. PORTER, 204 Ga. E. M. MCGUFFEY, 825 Ky. C. L. TAYLOR, 648 Ky. ROBT. MITcI-IEI.I., JR., 127 Ky. j. H. WILLIAMS, 837 Ky. G. P. NEAGLE, 355 Ky. R. M. GREENE, 704 Ky. FRATRES IN FACULTATE Roar. GRAHAM W. H. SIMMONS C. J. NORWOOD L. K. FRANKEL R. L. PONTIUS NOLLAU P. P. Bovn O. S. CRISLER P. R. CASSIDY W. G. TERREI.I. R. W. JONES L. R. HIMMELBERGER I W. T. LAFFERTY M. H. BEDFORD CI-IAs. KERR ' A. M. PETER C. R. MEI.cI-IER T. R. BRYANT L. A. BROWN O. S. LABACI-I T. T. JONES QI 793 Q 541916 Q. . ng- LJ -+....... ,gy ffjijm Q 769 tkenfuckian V I , ' l V 1 3 r ,w fjfffz ,X w min' 1 -R Q -wg ,ff .N , 5 f1'4f,' I -. l 'N yy "nf xx ' 409-f " Xa I 4-fff.-A-EV ' ,wifi-3, 1 X gf-JM W'5.o,:3x fl: 'fa . . Q :w-V V ,. nu- 5, 7 ' -9 ..',1'ff4l' jbyxx f J. " - ' ' :L 1 2 L -afv 1 E rf Am. A ,,?1d,DUT.' 1' 1 w f ' ' "" ,' ,fm " 9 4. ..f-'N' if 'uf Y Y I yn ,My A I .lu new QQ '14 f MQ ' ' 5, 'Q I -bi ' Ss -W. fm my L . V A lik - ff , , - 4'PL'1' 7 N5 , .S VZ :WW f , , f -x , x, . , ,.,, 1' ',,f5f6,,, , Jlx 1, I A 4 . ',,, W ' , H X I A v ,. I ' W --.QQ iw! I ueoy 4 I Q- 332 '9 i,,g.., .gg1g gf38E,.g..,..- .,g.p 1916 ig --"Hx, .,' M- J 4 . f fr .f I 45' V- r A K Y. A f .. .. . ,, ff - ,- r H f -1 xi 4' f' if Q " i A Af-9 ff-' 53 ,il -F 51,7 iff F' ffm' f' ' 1HHnmm'n Han-Qellrnir Glnunril MEMBERS LAURA LEE JAMISON AND MARY HAMILTON . . . Alpha Gamma Della LILLIAN GAINES AND MILDRED TAYLOR . . Kappa Kappa Gamma JANE Dlclcl-:Y AND STELLA PENNINGTON . . . . Alpha Xi Della VIRGINIA STou'r AND Lois POWELL . . . Kappa Delta MARY PARKER AND NANCY INNIS . . Chi Omega USD A .. A, ffxipf ,Y.. w.,,,..-.- P M - ,. A .9 Cl: LZ? fc ,.., ,g. DLLg.L'Yi,,D,gL.LQj3,,-?'?f-C4,,p I :e5f+p C769 tkenfuckian W x x x 1 1 Q 0323 . KS ,ao 1916 Q-++-Mf l Il V 77' V l I f , v I Q enfuc lan ' 975 76 lc ' r f I I Alpha Gamma Evita W Founded Syracuse University l904 Colors: Red, Buff and Green Flowers: Red and Buff Roses In Publication: Alpha Gamma Della Quarterly It EPSILON CHAPTER 3 Established 1908 ll ACTIVE CHAPTER 'f ' ANNIE LEWIS WHITWORTH MARY OcLEsEY PEARL BASTIN LAURA LEE JAMISON R MARIE BARKLEY MYRTLE SMITH ,V MARY HAMILTON ALIENE KAVANAUGH CLARA DONALD VVI-IITwoRTI-I MARY GREY ASHBROOK MARY GRUBER LILLIAN HAYDEN I NATIONAL ROLL Alpha-Syracuse University lola-University of Washington l ' Bela-University of Wisconsin Kappa-Allegheny College ll i Della-University of Minnesota Lambda-Northwestern University L Epsilon-University of Kentucky Mu-Brenan College Zeta-Ohio University Nu-Boston University Eta-DePauw University Xi--Illinois, Wesleyan University Theta-Couclmer College Omicron-University of California I if F' I 3 0831 R Iv l we A A TIOI6 A T g X1 at I3 L. 6 A R l g, 6 i 4 n P 1 I 1 1 I 1 K i a 1 J, f 4 I i 1 V 5 I w 1 i 4 I 1 i I E 1 1 I I F 2 ? E , 1 i 1 5 I X X x tm xv, f-f V I J, 1 . 'K I 'J 1' f ' V, n, ,. .. W x 0843 r' ' - ,, " , ff 5 5' .f"'-,f-1,-A A JD Q 3 1 .-1 ' 1 2- 1 ,. - -, . ,, M 1 A K X Bela Wiz:-' 3-Y- 9 S759 'kenfuckian Kalppafliappa Mamma ACTIVE CHAPTER Founded Monmouth, Ill., 1870 l Flower: Fleur cle Lis Colors: Light and Dark Blue KATHERINE MITCHELL EDITH DEAN ' CARLETON BREWER NATA LEE WOODRUFF ELIZABETH CAREY ELIZABETH THANE KASTLE LINDA PURNELL LILLIAN GAINES ALICE GREGORY LAVINIA MCDANELL ANITA CRABBE CATHERINE SNYIJER MILDRED TAYLOR MARY TURNER ANNE CROMWELL MARGARET GoRE CHARLOTTE WILLIS MILDRED COLLINS NATIONAL CHAPTER ROLL Flu-Boston University Bela Bela Bela Epsilon-Barnard College Sigma-Adelphi College Alpha-University of Pennsylvania Bela Iota-Swarthmore College Psi-Cornell University . Bela Tau-Syracuse University Bela Psi--Victoria College Bela-St. Lawrence University Xi-Adrian College Kappa-Hillsdale College Chi-University of Minnesota P Ela-University of Wisconsin Upsilon-Northwestern University Epsilon-Illinois Wesleyan Bela Lambda-University of lllinois Beta Zela-Iowa State University Thcla-Missouri State University Gamma Rho-Allegheny College Bela Upsilon-West Virginia University Lambda-Municipal University of Akron Bela Nu-Ohio State University Bela Rho-University of Cincinnati lata-De Pauw University Mu-Butler College Della-Indiana State University Bela Chi-University of Kentucky Bela Delta-University of Michigan Bela Eta-Leland Stanford, Jr., University Omega-Kansas State University Sigma-Nebraska State University Bela Mu-Colorado State University Bela Theta-Oklahoma State University Bela Xi--Texas State University Beta Omicron-Tulane University Bela Phi-University of Montana Bela Pi-University of Montana Bela Omega-University of Oregon Pi--University of California ussp Your at L L 9 1916 ce A C3321 92 l A 4,,,,..:,ff ff .-. K I W.--Jzrfgoqr,---k ,. , .--,. . 9 . A ,,, , 4, , . V H'-"H" , Q ..,+M-f S---4-H , f , , ,gf , 9 ,V I . ff fx....,---f-----K W 1-'-- ---- -. , -,.Qm... ,.-A..H-..7 Q!!! , A , A - ., 4, ...M 4- N., ---- ' ' f X1 ff?-33 I l 1 N 1 w + w W i 1 I C1862 1 KS,,1- lg1v,4ig Q33gg,4,1ff , Q 7 I , ........-f K J 0 K 1. Kappa Brita Founded Virginia State Normal IS97 Colors: Olive Green and White Flower: While Rogg Publications: The Angelosg Ta Talcta fSecretJ EPSILON OMEGA CHAPTER Established l9l0 ACTIVE CHAPTER REBECCA WASHINGTON SMITH ANNETTE MARTIN VIRGINIA DARE STOUT EMMA GLADYS HOLTON LOIS POWELL LoIs BRowN LOUISE RAMSEY ELIZA KAYE SPURRIER PLEDGE ELIZABETH CHAPTER Camma--Hollins College Theta-Randolph-Macon Woman's Sigma Della-Trinity College Col lege Eta-Hunter College Phi Tau-Buclcnell University Zeta-University of Alabama - Rho Omega Phi-Judson College Kappa Alpha--State College for Women, Florida Epsilon-University of Louisiana Mu-Millsaps College msn OIJEN ROLL Lambda-Northwestern University Omega Xi-University of Cincinnati Omicron-Illinois Wesleyan University Epsilon Omega-University of Kentucky Sigma Sigma-Iowa State College Alpha Camma-Coe College Chi-University of Denver Rho-University of Wyoming Phi Epsilon-Colorado Agricultural College Sigma Alpha-Southern Methodist University . . .. M2 ff" 'f -LJ ,'-ff, ff ' VM v if -J A' Lk, 1' "--f'-f' '- 0533 r wa'- w , A 3 5 i 5 I .V W . xl, f a 5 ff! Pi 1' Y ' x . , . 1 I . Thu QR Jfizktx sg' 1 , Ext? ' M E f 'A Z 5 . ax X, K , Q a i L 1 r .4 I H 4' 4 v A j 9 Q59 ikenfuckian I Alpha Xi Brita l Founded at Lombard College, Galesburg, lll., l893 Colors: Double Blue and Gold Flower: Pink Rose KATHLEEN SULLIVAN LILA ESTES JANE DICREY BETTIE COONS Della-Bethany College Eta-Syracuse University Iota-University of West Virginia Lambda-jackson College Tau-New Hampshire College Upsilon--University of Vermont Gamma-Mt. Vernon College Zcla-Wittenberg College Xi-University of Kentucky Pi-Ohio University Phi-Albion College Psi-Ohio State University ACTIVE CHAPTER CARRIE LEE JONES STELLA PENNINCTON AUSTIN LILLY MARGARET TUTTLE RUTH WEATHERS MILDRED GRAHAM ZULA FERGUSON ROBBIE DOUGLAS WILSON NATIONAL ROLL 0891 Alpha-Lombard College Bela-Iowa Wesleyan University Epsilon-University of South Dakota Kappa-University of Illinois Theta-University of Wisconsin Mu-University of Minnesota Rho-University of Nebraska Sigma--Iowa State University Chi-University of Kansas Nu-University of Washington Omicron-University of California Q' eelmjmairf-Lfffws 1916 ae 2327 9 1 f ,,,.,, ..,. ., . uwf"m+.,.1,' S 1 lp Q. 1. -4? - we 'N Lfuggf' :WNV .il 3,..,.. , ,lf mop Glhi Gbmega Founded Fayetteville, Arkansas, 1895 Colors: Cardinal and Straw LAMB l FRANCES GEISEL NANCY INNES HELEN MORRIS Flower: White Carnation Publication: The Eleusis DA ALPHA CHAPTER Established l9l4 ACTIVE CHAPTER ELOISE ALLEN M Psi-University of Arkansas Chi-Transylvania College Sigma--Randolph-Macon Woman's College Rho-Tulane University Pi-University of Tennessee Omicron-University of Illinois Xi-Northwestern University Nu-University of Wisconsin Mu-University of California Lambda-University of Kansas Kappa--University of Nebraska Iola-University of Texas Theta-West Virginia University Eta-University of Michigan Zeta-University of Colorado Epsilon--Columbia University Della-Dickinson College ARY PARKER ELIZA PIccoTT MARIE YOUNG SARAH HARRISON ELIZABETH PETTY LOUISE TURNER PLEDGES MAY BARNES BROWNING NEIDA RAsco ROLL OF CHAPTERS Comma-Florida Woman's College Bela-Colby College Alpha-University of Washington Psi Alpha-University of Oregon Chi Alpha-Jackson College Phi Alpha-George Washington University Upsilon Alpha-Syracuse University Tau Alpha-Ohio University Sigma Alpha-Miami University Rho Alpha-University of Missouri Pi Alpha-University of Cincinnati Omicron Alpha-Coe College Xi Alpha-University of Utah Nu Alpha-Leland Stanford, Jr., University Mu Alpha-New Hampshire College Lambda Alpha-University of Kentucky 091, I 9759 tkenfuckzfan. I ii' 3 h I Organizations - .--.1 WFS4.: fa? J. Q :fl W Q We 2Q5MZ3?,, 'git f V ffm' WV 6 4 ,, A . 'PEL 5 - 5 an n t-H . - - ' . - -Q.. . U Y 11 I - -ran., - xx: Si! 53 1 i V vm Nw' 1 ' ca I nah., W, Eg I 111 U 25 . 38? . ,sv 1916 . f 9 . . .r-.. P OFFICERS OF THE STROLLERS 0931 ' ID C76 FATHER AND THE BOYS f - 4- s y,,,,,,f'-... I' ., ..,. , , F 5 :fp ft., . .L f , Ellie Svirullmi HE Strollers is undoubtedly the strongest young organization in the University from many viewpoints, and is on a sounder fmancial basis than almost any similar organization in the country. The first play, "Richeliu," was presented in l9l0. Since that time "Brown of Harvard," "The Virginian," "The Lost Paridisef' "The College Widow," "Charley's Aunt," and "Father and the Boys," have been presented with ever-increasing success. The Club has gained a following among the people of Lexington and Central Kentucky that assures them a great future. The officers of the club have performed their duties earnestly and faithfully, con- tributing largely thereby to the success of the organization, causing membership in it to sought for and considered an honor. The flrst great spreading of influence of the Strollers was during the season of l9l5, when the annual play was presented in two towns other than Lexington. Various diffi- culties were in the way of carrying "Father and the Boys" out on the road. This policy will certainly be continued in the future, making a tour of perhaps half a dozen towns of the Blue Grass an annual feature. The officers of the club are: Herbert Graham, President: Katherine Mitchell, Vice- ent: John Marsh, Secretary-Treasurerg William Shinnick, Stage Manager: James McConnell, Business Manager: Enoch Grehan, Faculty Adviser. Presid CAST OF "FATHER AND THE BoYs" . . EMERY FRAZIER WAVERLEY Bmccs LEONARD TAYLOR Lemuel Morewood, a wool broker ............ William Rufus Morewood, his elder son . . . Thomas jefferson Morewood, his second son . I ll ll i. ll li In Major Bellamy Didsworth, man about town . . . Tobias Ford, Morewood's lawyer ..... "Tuck" Bartholemew, apostle of manly sport . - Cal Higbee, a miner ........ William Holton, offtce man .... Evans, a butler ...... Clerk at the Eldorado Hotel ..... Bessie Brayton, a western product . . . Emily Donelson, living at the Morewood home . Frances Berkeley, living next door .... Mrs. Bruce-Guilford, an important matron . . Mrs. Preston Tromley, second important matron . Mrs. Peasley, the housekeeper ...... Ql95J E I. , ,L 5. ,., ,, :L L, V ., .,.. .. JAMES N. FARMER . HERBERT GRAHAM . . W. LEE SMITH j. FRANKLIN CORN . . . TATE BIRD . PRESTON CHERRY . . ECTOR LAWSON . . REBECCA SMITH . . MARY TURNER . . ALICE GREGORY VIRGINIA DARE STOUT . . ELIZA SPURRIER . JOHNNIE CRAMER X I f . :?"N.."X., LL, 'E ' N X. ,,,f' .5 '-'s.,,' sfww, , JI' Vi, if I ? I ' I E t .Nl l 'II ' I- I I i ! 'S It i 6 s I . I 3 i S Z l l I 3 Z I 1 'R 1. 3 ...,.....s..-.....,--.,.a.4-.f,e.L,.,.s.,,,,. . ,, - X x 4 1 1 I ! A I 3 i , EAW-, W, ,V,, , W.- 1 W 5 - A 4 ji 1-Q EQ? N V 1 ll algae! . E i P is A 7.,ifQ'E.'X9i4lG J P -..fa3czy,.,.,,.,,4 . liega f , Founded at University of Kentucky April, I906' W ACTIVE CHAPTER A. N. BRITTAIN M. G. MULLER T. T. RICHARDS ' R. M. IGLEHART K. NESBIT j. M. SERVER R. V. IRELAND H. A. PULLIAM L. D. TAYi.oR i P. CHAPPELL Mlssmc K ii ' " Q "M" ""'M"q,fi -1 l I ...V ,, f. .X ,.................... ,.,.-. ...., .. Founded B. N. PEAK j. H. EVANS F. Y. HUTCHISON MCCLARTY HARBISON illllgatir Glhirieen at University of Kentucky Apr Colors: Black, Green and Red ACTIVE CHAPTER C. P. SANDEFER G. L. JACKSON W. T. RADFORD T. D. Gnuaas H. C. THoMPsoN Cl97J il 5, l905 H. B. COMBEST j. M. HEDCES, JR. C. F. PARK, ja. C. H. MATHERLY , I. ' 5 I X Staff smh Qlrnum REBECCA SMITH LILA ESTES ELIZABETH CARY ELSIE HELLER BETTY FARRA ANNIE LEWIS WHITWORTH NATA LEE Woonnurx-' MARGARET INGELS KATHERINE MITCHELL INA DARNALL C1983 ., . , ,, I Y it ,I A A4,w U N NME I, ,,,. . , - X -r - ', I' f .,.,.,,...,,-. 3, L ,. .. ,. , Eanm sinh Glrnza PEDLEY CORN THoMPsoN GRAHAM MCCARTY McKEE CLARK HARRIS CROMWELL Zsnross Gantrrhurg Qlluh The Canterbury Club is the honorary literary o:ganization of the University. Its membership is necessarily limited, being based on creative literary ability. Weekly meetings arc held at which there are discussions of literary productions of professional men and of the club members. Any student in the University is permitted to submit original work, for consideration by the club, to any member. MEMBERS J. T. C. NoE JULIUS WOLF E. F. FARQUHAR FRANKLIN CORN CI-IAs. P. WEAVER HERBERT GRAHAM R. T. TAYLOR ALLEN Fos'rER DERRELL HART WILLIAM SHINNICI4 HERNDON EVANS JOHN MARSH C2009 t I I I Hninn Eitrrarg Svnrivtg Chartered by the State Legislature in l87Z, formed by a consolidation of the Yost Club and Ashland lnstilute, the Union Literary Society is the oldest literary so- ciely connected with the University. Contests are held annually in oratory and de- claiming, in which the winner receives a gold medal. Several of the prominent men of the State were members of this society while students in the University, including Governor Augustus Owsley Stanley. FIRST SEMESTER J. THOMAS GOOCH L . H. NELSON . . T. L. CREEKMORE . J. V. CI-IAMBERLAIN J. M. ROBINSON . J. H. WILLIAMS . C . W. BAILEY . F. W. Po'r1's . OFFICERS . . Presiclcnl . . . Viceqlgresidcnl . Corresponding Secretary . Recording Secrelary . . . Treasurer . . Prosecuting Allorncy . . Librarian . . . fanilor qzonp J. SECOND SEMESTER . . HERBERT FELIX . . . W. D. ILER . J. B. Hu'rsoN J. V. CI-IAMBERLAIN . . J. V. SELLARS . HERBERT SCHABER . . C. O. CLARK T. GOOCH fHonoraryJ O. M. EDWARDS . E.. P. WILKERSON F. O. MAYES . . L. W. GRADDY . C. P. NICHOLSON Hommz REED . A. B. CRAWFORD J. W. O'DEL1. . igattvrann Eitvrarg Snrirtg FIRST TERM SECOND TERM qzozp . Prcsfdenl Vice-Prcsfdenl . Sccreiary . Treasurer . Presfzlcnl Vice-President . Secretary . Treasurer 1 I I 9 K 5 D. L. MCNEILL . R. E. CULLEN . E. C. PRESTON . F. A. HARRISON J. H. COLEMAN . R. E. CULLEN . D. GLICKMAN . J. V. CHAMBERLAIN Menrg Gllag Svnrivtg FIRST TERM SECOND TERM qzoap . Presfrlenl Vice-Presfdenl . Secrelary . Treasurer . President Vice-President . Secretary . Treasurer , .,,,,A,,.,,,, .,.,.,.,......... .W ....,..,. 1- .....,.,.4,..-.,................ .....w.-.----:rn -----' Y - - ' V i Nfmfw . ' guy . 'f q- .127 x-'Jg'3LrH ,. Q 77 1. , X' Y X! Q .O z ff .m?, if 3 rx K, :sf ' R 5'4r .6 A 5, I ..s .TM 'Q fg - pix! f . - ,I rf 4 Qi ' mth all 41 1, F ,nf 8w,f Wxx Q5 x I g pmun ' , ., gpm? . wq C2041 I i H It I 'I I I II t I I 'E lr li fr tl l , L ,1 - LL... fu? 7CQrz1fu cfczan -A A I f---M -1-53, I l it Eau 1Kappa Alpha I 1 Founded Butler College, l908 i Colors: Light and Dark Purple Flower: Lily of the Valley if Publication: "Tau Kappa Alpha Speaker" ' KENTUCKY CHAPTER f Established l9I3 ACTIVE CHAPTER juuus WOLF C. P. NICHOLSON C. W. BAILEY j. N. FARMER i F. A. HARRISON J. H. COLEMAN " J. V. CHAMBERLMN T. L. CREEIcMoRE Z' HONORARY MEMBERS CI-IAs. P. WEAVER J. T. C. NOE i Q- P PLEDGES F. H. RICKETSON, JR. , W. J. KALLBREIER l HARRY MILLER D. L. MCNEILL , G. C. WILSON C. T. Do'rsoN lt ip ' NATIONAL CHAPTER ROLL ,V I University of Alabama University of Montana University of Arkansas Muskingum College Butler College New York University University of Cincinnati University of North Carolina Columbia University ' University of Oregon 3 University of Denver Randolph-Macon College Dickinson College University of Southern California Harvard University Trinity College Indiana University University of Utah it I W University of Kentuqky Vanderbilt University I 4 V Lawrence College University of Vermont Louisiana State University Wabash College Miami University University of Washington I QZOSJ l I... L -, .L .. . ,,..., .,... - Q A.--..., L t L liarzitg Behaiing Umm HE. Blue and White defenders lost to Center College in the Kentucky Intercol- legiate Debate in the University Chapel March I7, when they upheld the negative side of the question: "Resolved, That the United States should propose the Taft plan of international peace to other nations for adoption." G. C. Wilson, F. A. Harrison and V. Chamberlain, all capable debaters, repre- sented the University of Kentucky. V. I. Chebithes, Thos. H. Lockett and Robert Dunn represented Center. Both teams acquitted themselves well. There was consider- able interest in the debate, which offered some encouragement to the advocates of oratory and debate in the University. C2063 4 ,yr I ' K A ffT...,,, ---13 QIQQ t7dQ7Z?l."LlCfCl.flil1 fi?-jififfff Emu Erhaiing Gram at Erxingtnn W. Kallbreier, D. L. McNeill and F. H. Ricketson, Jr., sur- prised even their backers by defeating the Cincinnati representatives in the University Chapel. 'lhe team had never taken part in an inter- collegiate debate before, but their masterful work on this occasion won applause from everyone. qzon Qi it imiffii i 37 1916 i i Emu Brhaiing Timm at Cninrinnaii N the evening of February ll, while our boys were defeating the aggregation from Cincinnati at Lexington, the team from Kentucky, composed of Messrs. Clifford T. Dotson and T. Lindsay Creekmore, met their opponents of the Cin- cinnati Law School at Cincinnati, upon the question, "Resolved, That the United States Encourage an American Merchant Marine Through a Discriminatory Tariff in Favor of Goods shipped in American Bottoms." The negative of this question was ably upheld by these men, who viciously assaulted' the positions taken by the affirmative. Basic arguments were mercilessly hammered into the opposing team, and until the decision was announced it was the current opinion that Kentucky had scored another victory. On recount of the vote, however, it was found that Cincinnati had won the decision by a small margin. 0081 1 E. ii' 1 i ivqfsyf M f I elf ilf ill lgi ii? 3, i, .J til l 3 ' . . sv fa G 4 'F l Q Hlyilnnnphian Eitvrarg Svnrirtg The society for young women of the University. Weekly meetings are helcl at Patterson Hall. , OFFICERS FIRST TERM INA M. DARNALL ..... ..... ..... P r csidenl MARIE BECKER ....... . . . Vice-President MARY HAMILTON ..... .... S ecretary JOSIE LACER HAYES . . . . Treasurer SECOND TERM MARIE BECKER ...... ..... P resident VIVIAN DELAINE .... . . . Vice-President MARY HAMILTON . . ..... Secretary CARRIE BLAIR . . . Treasurer f209J fe.-E ganfcm. 1012314 QOCIETY' A., MX OFFICERS FIRST SEMESTER L. H. NELSON .... ....... .... P r esidenl F. T. STR:-:ET . . . . . Vice-Presidenl L. A. BRADFORD . . . ..... Secrelary A. CARMAN ...... ....... T reasurcr F. O. LAMASTER . . . . Corresponding Secretary E. T. MCCLURE . . . Sergeant-al-Arms SECOND SEMESTER R. S. THOMAS ...... ....... .... F' r esidenl C. I... TAYLOR .... . . Vice-Presfdcnl RUTH M. DUCKWALL . ........ Secretary C. L. MORGAN .... ....... T reasurcr W. W. Owsuav . . . . Corresponding Secrelary T. B. GORDON . . . Sergeant-al-Arms CZIOJ I 0 v W ! 4 T I ll ! J 1. I I 6 I r ! I I ll ! I I I . Dlihrarg Qlluh OFFICERS MARIE LOUISE MICI-IoT . ..... ..... P resident PEARL BASTIN ..... . . Vice-Presfdenl VIVIAN DELAINE . . . . . . Secrclary G. C. WILSON ..... . Treasurer MEMBERS JUDITH BEARD GRACE SNODGRASS JEAN FIELD ANNA LEWIS WHITWORTH INA DARNALL MINNIE NEVILLE HAzEI. BROWN A. L. JOHNSON FRANCES DAwEs MISS MARGARET I. KING MARY HOWARD JOSIE LACER HAYES ANNA LEWIS R. A. FOSTER DEAN ANNA j. HAMILTON QZIIJ I -1 Harare itlllann Svnririg Established for the benefit of students in the Department of Education. Weekly meetings are held, which are said to he the most enthusi- astic of any on the campus OFFICERS FIRST TERM FRANK CRUM ...... . Prcsfclcnl MARY Howfmn . . . . , Vice-President SUE HUNT Fnosr .....,. . ....... Secretary CHESLEY W. BAILEY .... ....... C ritic PROF. T. C. NOE . . Sergeant-al-Arms SECOND TERM Mmmivi HORINE ...... . President JUDITH BEARD .... . . Vice-President HELEN RECORD ....... ....., S ecrelary HERBERT FELIX .... ....... C rilic PRESLEY TIPION . . Sergeant-at-Arms C2121 r : 3 i i I I i J xx: WJ if I? 1 i Y Cs uvx Eiainrg Cllluh Established with a view to fostering a deeper interest in history. Membership is limited to those whose major study is history. OFFICERS KARL P. Zsnross . . . ..... President SUE HUNT FROST . . . . . Vice-President 1 HELEN Bum-:HOLDER . . . . Secretary BART N. PEAK . . . Treasurer V N 1 C2l3J U- ,E , .-. M T7 Q , - ' - .rs' pT1:.:1e:"g1:g1jp23.Q ,Vrr H . ,MN45r.f ,E Ernnkn Enginmering Svnrietg OFFICERS B D HowE ...... ....., ...... P r esulcnl C. R. GAUGH ..... .... . . . Vice-Prcsidurzl ' R. F ALBERT . . . . . . Treasurer G. H. HILL .... . Secretary SENIORS R. F. ALBERT B. D. HowE J. RANKIN Special W. W. CLARKE C. W. LOVELL B. SHOUSE S. E. HAMILTON T. H. CODY R. F. MACLEAN F. WILLIAMS J. H. HocREIfE D. M. PHELPS M. FERRIS JUNIORS W. M. ADAMS R. Y. FISHBACK W. HOPKINS W. W. HAFFLER M. V. BURGIN E. R. BURNLEY G. H. BEASLEY j. C. FUSS H. I. KINNE R. W. HAGER H. B. CLARK G. L. CHILTON B. Doss L. HAYES F. JOHNSON H. FRIED H. HILL K. C. FRYE J. S. PARKER C. R. GAUGH j. T. RAWLINGS SOPHOMORES ' H. T. POWELL R. IRELAND E. G. DRAKE H. C. FOREMAN R. W. HANSON E.. CAVALLO L. F. BESSEY C. R. BOURLAND F RESHMEN j. M. LAND . SMITH H. G. LITTRELL . SMITH W. F. MARSHALL W. SMITH j. M. PURSIFULL W. E. RowE CZl4J SPARKS I. H. WALLEN J. G. RONEY H. GRossMAN L. T. WHEELER S. HUDSON J. KAPE H. E. GLENN H. E. ROBERTSON R. K. DIAMOND ilhinturkg mining Svnrirtg Student Branch Kentucky Mining Institute OFFICERS jmvms J. HUME . . . ' .... ..... P resident CAL Sci-HRMER ..... ..... V ice-President FRANK R. GRAINGER . . Secretary-Tr easu rer O. G. Sci-iwAN'r . . Sergeant-al-Arms E. B. JONES ..... . . . Chief Molorman J. J. FLOCKEN . . .... Cob Inspector f2I5J f- u., . ,..,. ,ty-...- .l..1---q iirnnnmirn Qlluh GLOVER BIRK . ........ . . President E. j. EIMER . . . . Secretary C. E. RUBY . . . . Treasurer 1 4+ l W. K. C2163 . F -Q an f "f I - ,,,,. , f A . .4 U , I Ir- -... ..,1,, ,I A I Q-fffrffffcf, rein ,il I I I I I s 1 I i I I Q 1 1 F E -? Iii iii fi il YM If III -I5 Ili ,EE Ei 51 I? 13? fi? ffl fi I is I I III II IE, EU IE WI Hg t.!'::,- UF! I IT? If' li I I ll E UI Is I, W K Ui 15111112 ilirnnnnuiru Glluh OFFICERS FIRST TERM BETTY FARRA ...... . Presidenl LINDA PURNELI. . . . . . Vice-President KATHLEEN GARROW ..... . . ..... Secretary CAROLYN LUTKEMEILR . . ........ Treasurer ELOISE ALLEN . . Corrcspomling Sccrclary SECOND TERM JULIA VANARSDALE ...... . President JESSIE FLORENCE .... . . Vice-President LOIS BROWN ..... ..... S ccrclary ANNETTE MARTIN .............. Treasurer LELAH GAULT ..... Corresponding Sccrclary Rum! Kcnluclffan Rcpresenlalfve BETTY F ARRA qzwy "iw: EII- A in f.QI7T6 GT'-AT--TTT 1-f:,,.e E Zi 1 ' ! I J u ,,,.,,f..' QZISJ "n NK ....,--W. .. ,,,,,' i 1 r 5 , . , i 6 I 1 W 9 4 L 1 1 Q I 1 1? 1 I 1 4 s I 3 I i 1Qfff:azuxfm h uwQM' X' ' 225uer,w.mgamc.,-n ......, Y I K K A, fn! ,,.. - M ,,,, A , M! h...f . 4 Sigma Alpha 111511 Founded at College of the C' Ily of New York, l909 Colors: Purple and White Fublicalion: "The Oclogonian' KENTUCKY CHAPTER Established University of Kentucky, l9l5 'RY ,MY 5, t E xx 'i--: E 5 Niitli'-I X Ss C X I ., IX .X .. , , N 3 AAQA lliiiill ACTIVE CHAPTER H. GROSSMAN R. PEARLMAN H. FRIED A. D. GALANTY M. FORMAN B. W. ROTH D. GLICKMAN PLEDGES J. S. MISRACH R. K. DIAMOND J. LEMAN H. R. GREENBAUM f2l91 Flower: Violet Z! I L ! tt E M2531--fy A 'twffligp' Q H7662 rz fu C165 cz iz Eau Svignm Founded at University of Kentucky April, l9l3 Colors: Lavender and Straw MEMBERS GRACIAN PEDLEY FRANKLIN CORN TOM RICHARDS THAN RICE EVERETT PEN1cK X HORART RUSSELL LOGAN GREEN JAMES DELANQY QZZOJ 1 . '-.4 'f v -.... ., xx 4552--Z,.w.----.y. I Q I 1 T L T '-"TTA A T ,.'t SV U1 i 5 1 R4 I 1 I I I ' 5 I IE it L4 Qi ,js 3 T 1 . I ? . I I 2 . I E4 I Y l C5122 Qlluh .Q Q OFFICERS Ii CHAS. LEWIS BENNETT . . . ...... . . ..... Director THAN G. RICE .... ...... P resident j. HowARD EVANS . . . Secretory-Treasurer E MEMBERS i I I J. F. DAHRINGER First Tenor A. R. MCCONNELL . . Second Tenor DAN ROBERTS . First Tenor E. S. PENICK . . First Bass O'REAR Focc . First Tenor W. L. SMITH . . First Boss C. W. HARNEY First Tenor D. GI.IcKIvIAN . . First Boss ig? HENRY CROMWELL First Tenor J. IRVING . . . First Bass IH JOHN MARKING First Tenor R. S. CLARKE . . First Bass j. H. EVANS . Second Tenor J. F. DELANEY . . Second Bass 'i E. P. l'lATTER , Second Tenor F. B. ANDERSON . Second Bass If I C, CREECI-I , , Second Tenor T. GOOCH . . Second Bass R. K. DIAMOND . Second Tenor E. LIKENS . . . Second Bass C. E.. PLANCK . Second Tenor j. E.. MATTHEWS . Second Boss fl' T. T. RICHARDS Second Tenor T. G. RICE . . . Second Bass I , 3 Hr ' 1 L I I C2219 . T 5 I . 5 Q 3 , II. P-.K V , ,WSC ,... .. .,... .. , ,.... ...4,1,1 S ,x V TI' ,.. ..,..... ,, ..,. W .. . -' 5,4-2.5. H M--- - 2 fl I ,.. , , ,.,,---sTPT,TA:,,.,- ....,,. - ...., ..-,-.,.,.,. MQ: t. .5 ig fi eil A ,gf Q:,l.lf.:'Qifvr-ill,fLQQ1:fQQ1N,,A tg E ' 1 l I ? l i e as W- as e f iw 1 , . it tl it I 2 Q I, lx l if,- 1' E 1 li 1 i i , 5 - i l t , s i I 1 4 I 1 ' l . 1 5 f Munir Glnh 3 ga E ii OFFICERS 1 Q E 1 SUSANNA VALERIA Benz .... .... . ..... P resident I i C-zones Slum-:Y Seamus . . . Vice-President Nl-:LLB CRAWFORD . . Secrelgry i fe 1 f HE Music Club was organized in january, I9l6, and has been encouraged to i K a great extent by Dean Anna J. Hamilton, with a view to arousing an appreciative , 5 l interest in music among the students. It has been pointed out that Kentucky , students do not give the proper attention to music, and as a means for building up interest J 3 this organization ought to do much good in the University. i Semi-monthly meetings at which there have been programs of striking. merit, revealing I some real artists, have insured the success of this organization. Its membership is not P l limited to musicians, but includes ,those who take an interest in music and wish to culti- I l vate a taste and appreciation of real art. :tiff i flint X 1 1 Sz! 5 5 l 1 lit I l 2 C2223 l l l ll 1 i , F I7 ' ' e- e,s so e ,1 J ze. T11 ,,g.--e.,-.,.,eg ' 1 cgi Y.,,.z4gifg1i11iQ, ,.,g.,..s ' l mvrlganiraln nf 'IE OFFICERS T. C. TAYLOR ....... l. Prcsfdcnl C. K. DUNN . . Sccrclary and Treasurer C. W. WARWICK .......... Vice-Presfdcnl AMERICAN SOCIETY OF MECHANICAL ENGINEERS GARRETT ....... Chairman H. WORSHAM ..... Vice-Chairman AMERICAN INSTITUTE OF ELECTRICAL ENGINEERS MELTON . . . . . . . Chairman E. H. CLARK ..... Vice-Chairman MARGARET lNGLEs ............ Secnlary ROLL E. H. CLARK R. E. HUNDLEY T. C. TAYLOR W. H. DIx C. K. DUNN j. D. GARRETT W. M. GLENN M. G. HORTON A. B. HUFF MISS MARGARET INGLES W. LAII. j. M. MAY H. E. MELTON H. P. PARRICIN E. R. PURSLEY M. S. SULLIVAN C2233 J. W. THOMPSON G. W. WARWICK C. C. WATSON F. WHITELY J. WOLF H. WORSHAM 'ff ' -AM- - -A-W A I --.-,..,,. , ., fwfr! , f I I 5 I Y I I l . I I i I fl 1 1Hre-illllvhtral Svnrwtg OFFICERS H. D. MCINTYRE ...... .......... P resrdenl L. E. PAYTON ..... ..... V ice-President 1 W. C. MARTIN . . . Secretary-Treasurer MEMBERS DR. J. XV. PRYOR C. F. STILES G. H. VANSELI. H. G. STACK CLASS or l9I 5 X D. T. ROBERTS 3 CLASS OF 1916 H. D. MCINTYRE W. C. MARTIN N L.. E.. PAYTON G. S. SPRAGUE I A. L. JOHNSON D CLASS or I9I7 H. D. ABELL R. PEARLMAN I 1 CLASS or I9l8 I G. R. ORME H. A. PuI.I.IAIvI L. C. RECTOR E. A. BEATTY R. C. MONROE 12243 I Mk -- .--- fk.......... . .. -.i,w.,-.fflT:Q f'fT,'Q"""' ' ' '79, K , O. K. MCADAMS H. C. WOOTEN A. S. TREADWAY Ti.. DAQCT . .-. J' FJ., I , I 1 4 w Q l 1 '? ,ff:,,s:'fzf ,A ,, . .,,f' L'-,ninqj ' V. , ..,. ,,..-Q,-r-,. . . .V I K.. . .N L, Jnh.'7qq :dwarf Q THoP7jf- ' 4. r, 'xx Al l .Qu-. .- 5 Q 4 s I 'srmnwbmmnoo-rm' ' oo' 'nm-Y' 'mp' fnsnf . A . . A W x 5 1 K via . .E i in qi - "-lx? Q ui ' V 'wmmf "HaRc Las as oa 'Q'sm: s' .nw 1 , 'yy l. Y, A , 4 . I GFX l w , X " '77 'i' 1 ' 4 : -H .NMMA-A , 3 f 'ig5EiE2? ' V vL qE?ef ' 5 CQVILQ' 5 i'I r 1 i 1 4 I 9 i I 4 v 5 3 --.- ,..,.., , ...v .,,,-,.-......, PEEDy HTHy A9 f225J g, 5 H19 1, 6 fig ., fl-Kimi V S ,- QXN G5 2 iIIllLAas,lIIn. "' llll lli IIIIII Ill A QV OFFICERS FIRST TERM D. HALL ...... ..... ...., P r csfdenl F. PAUL AND:-:RsoN, JR. . . . . . Vice-President j. S. WALLINGFORD . . . .... Secretary J. F. Snousa . . . Treasurer F. C. STARKEY . . . . . Reporler L. C. DAVIDSON . . . . Sergeanl-al-Arms F. MARSHALL . . . . . . . . . . . . Librarian SECOND TERM D. HALL ...... .... ....... P r csfclenl J. F. SHOUSE ...... . , Vice-Presfdenl j. S. WALLINGFORD ........ Secretary N. T. PUCKETT . . Treasurer F. C. STARKLY ...... ' .... Reporter L. C. DAvlDsoN . . . Sergeant-al-Arms F. MARSHALL . . . ..... . . Librarian 12271 Y 1 4, I I F ,ff 1' f lfihiznn-Qnulr Smrirtg OFFICERS FIRST TERM C. W. GORDON . . . ..... President 'R. M. DAv1s ..... . . Vice-President T. E. MCCLELLAN . .... Secretary T. E. PEAK . .... Treasurer SECOND TERM R. S. SAUER ..... .... . President Q J. D. MADDOX ...... . . . Vice-President D R. M. DAvls .... ...... S ecrelary R. S. CLAYTON . . . . . Treasurer 1228, 1 L. N, f-, af . 1 1 M A , 5 sq-0.--NN-A P227 3 ,f:'fT' 'r"' Wrrii.. .gfqrfj , j fi? iff? FW Ai7f4iiL-5 If matt ifmrirtg JUNIOR CLASS IN MECHANICAL AND ELECTRICAL ENGINEERING W. S. MooRE ....................... President M. M. MONTGOMERY . . . . . Vice-President W. T. RADFORD . . Secrclary E. E. DRAKE .... . . . Treasurer D. S, SPRINGER . . .... Reporler 12295 L' F. O. TOWNES A. CARMAN . NANCY INN:-Ls j. H. Moonz . W. j. HARRIS H. FRIED . . A. j. RANKIDJ L. LEONIAN . R. E.. CULLEN W. F. CODY . j. H. MCCONNELL . flllanagrrn Qlluh . . Foollrall . . . Baslfcllmall . Girls' Baslfcllvall . . . Baseball . . . . . Kernel . Transit, Kenluclflun . . . . . Transit Rural Kcnluclfian Law journal, Kenluclfian ......Banzl . . . Slrollers T. G. RICE . . . . Clee Club UMD 1 ,Y -.. fllllu Alpha illllu Founded University of Kentucky, l9I5 OFFICERS T. C. MCCOWN .... ..... ...... P r esfdenl E. L. GRIBBEN . . . . . . Vice-Prexidenl W. F. CODY . . Treasurer MEMBERS H. H. CHANCELLOR T. BOSTON L. F. RUSH J. F. CLARK A. j. RANKIN H. P. MCGREGOR A. R. DEARBORN R. PEARKMAN R. C. MONROE D. GLICKMAN E.. H. CREECH A. M. Woons J. E. MATHEWS' CARL BERNHARDT C. TEMPLIN W. J. FOSTER H. A. SADDLER H. FRIED C. RUBY , H. E.. ROBERTSON C2311 759 Cffenfu ckian Minh Ernttyera Founded at University of Kentucky April 5, I9I5 Color: Real Motto: Safety First Song: That Old Girl of Mine OFFICERS Crand Senior Mogul . . . . . Cranzl junior Mogul .... Grand Scribe and Fifnjancefrj . . Bouncer ........ ' Chairman Poultry Committee . Chairman Old Maid Committee . Right fHanclj Bower . . Left CHHIIIIJ Bower . . X-King of Hearts . . . . . Flower: Sunflower . ROBT. MITCHELL, JR. . CLIFFORD T. DoTsoN LEE THORNTON RECTOR SAMUEL HARRELD BROWN . jAs. HENRY COLEMAN . JOHN PETER RIcI4ETTs . ELMER ROBERTSON . . VIZE CHAMBERLAIN . . CHARLEY SCHABER Deuces . . . . RALEIGH MONROE AND THEO. BURTON BEACK 42325 1 l X v l l 3 l 4E-fm --5"'-ix' 1916 QTL.: T' Glatlynlir Qlluh Esaablished April, I9I4 OFFICERS A E.. A. TAYLOR . . . .... President jon-:N RODMAN . . . .... Vice-President L. D. TAYLOR . . . Secretary-Treasurer PAUL GASSER . . . . . Sergeant-al-Arms Rav. FATHER W. T. PUNCH . . . Adviser T C2337 IYX , v" nc. Qxcaffw, , ,,A, s H 563 ,-' , . ' ., -,.,f' 1 We 7denfu ckian lil l x ll W 5 3 Vt all li l 1 F l lg il fi? pt l 5 ll lr ll 1 . I l l l l l n l "Emu Hear Aga W 1 l X Molto: Survival of the fittest .... We make way for the man who pushes boldly past us. 1 l ,x 1 Two years ago we were fifty-nine strong, a mighty hand in the eyes of our fellows. Behold us now. l l MEMBERS 4 , l, l , , l 1 HILTON I-IAYDEN ELLIS .... . . ...... . . Falmouth l X . "The higher we rise the more isolated we become." ' 1 g WILIAM TAYLOR ADAMS .... . . . ..... . Mumfordsville l E ' "Care to our coffin adds a nail no doubtg l And every grin so many draws out." 3 1 EDGAR HOMER RAMSEY . . . ........ ...... S laughters g ' l l ly "Vim and Vigor -1- Persistency X Efficiency - ldleness -1 Victory." il 1 V "When shall we three meet again?" V ffl 5 u l C2342 l l +R e 1916 x - .-- ,L L-.-- I 1'-Q91 I ORIE LEE FowLER . . MARY HAMILTON mgnthiana Olluh OFFICERS ANNA CROMWELL. . . . LEONARD RousE . . JUDGE W. T. LAFFERTY MARY GRAY ASHBROOK CLARENCE HARNEY ELBERT DEARBORN COURTNEY SMIZER GAYLI-:N POINDEXTER JOE TORRENCE MEMBERS HENRY CRoMwELL LEONARD RoUsE ANNA CROMWELL ALVIN RORER JESSEE FLORENCE LAURA LEE JAMESON C2351 . . . Prcsidenl . . Vice-Presfdenl . . .Secretary Treasurer ERNEST MCILVAIN JAMES SANDERS WIIALEY KEEVIL WALLINGFORD CLYDE BLAND JOHN SHERWOOD MARY HAMILTON ORIE LEE FowLER .Six-flbnr Qlluh OFFICERS H. F. FELIX . . . ..... President J. M. SERVER . . . .... Vice-President W. C. NEAGLE . .... ., Secretary-Treasurer MEMBERS J. M. SERVER C. A. WICKLUND H. G. LUTTRELL A. B. CRAWFORD W. S. ELSTON R. S. CLAYTON RUSSELL A. HUNT W. C. NEAGLE B. G. MARSH GEo. SPALDING U. V. CARRED L. C. DAVIDSON GEO. E. PARK C. R. L1sANsY S. T. WHEELER WENDELL BERRY E. A. BLACKBURN A. L. EUBANKS L. W. HERNDON F. M. HEICK U. L. PAYNE H. PARKS H. F. FELIX L. G. Hfws DR. R. N. MAXSON qzaey 1 , T u P V K I I i Benxnrratir Glluh Established at the University of Kentucky with a view to binding closer together those men who are governed by Democratic principles in all matters of partisanship OFFICERS D. L. MCNEILL . . President J. C. KELLY .... . Vice-President A. L. EUBANK . . X . . . . Secretary A. L. joHNsoN . . . Tr easur er C2371 f9SZJ X N 5 Ai 39759 cfdenfucfcian Q Q f , - 9111212111 Swnatrf MEMpERs Enwums Cnum . , ' Ssnvsn QLISANBY MAYo CAUDILI, HARNEY Dnnnom Pon' Nmcnn H ROLLINGS V . CLAYTON ' , Hlcxsnson ' A Zsnross WILLIAMS ' Fndsr Fumsn C2399 L V . A V - Q 9 1916 cf 332 9 , u i 'N 'Q P I' pr b x '1 ,w 5 GRADUATE CLUB ,L fr' K. . . ,Nf- " .Q Grahnaie 0111111 N April, l9l4, at the suggestion of Dean Mackenzie, the Graduate Club was organ- ized by advanced students of the University who had received their Baccalaureate Degrees at this institution, or some other college of equal standing. The first President of the Club was Lieutenant A. W. Gullion, who is now in the 20th Infantry, a regiment which is in active service south of the Mexican border. Under the care of M. H. Judd, President, and Miss Mary H. Piper, Secretary, the Club has promoted the spirit of fraternity and research among its members, and it hopes eventually to co-operate toward a national movement involving federation of all American graduate clubs. The membership of the Graduate Club comprises all resident students connected with the Graduate School, as well as the Five faculty members of the Graduate School Committee. No similar organization in the University has had such a vigorous growth since it was founded. Last year there were twenty resident students, compared with thirty-four this year. Last year the total enrollment of the Graduate School was hfty-six, compared with eighty-three this year. It seems then that there is no reason why, with the proper support and encouragement, the Graduate School of Kentucky should not become the chief factor in research work of the entire South. 42415 gg 1-m rt ' The-1ff1f1fa gfht-9 We mir wk ian rf? l f l l l t i v lit fl N K, r ll li li I 1 l l I ii ,, avi.. x L- -1 Q W 5 tiki Sn? rw, Ir? ? f l lu se: lls xl. ist Ll eg. I 1 4 , 5 1 'l is ,. ii ,. 12 ,. Et 1 6 1 i , t 1 l V l i l ,ll 1, :H 5 s Zi .1 tl ill 3 i 1 r E is ! tj. V li lli wi l t i 'English Cllluh REBECCA WASHINGTON SMITH ..... . . Chairman MEMBERS FACULTY L. L. DANTZLER I E. F. FARQUHAR C. P. WEAVER ANNA J. HAMILTON R. T. TAYLOR FELLOWS DERRELL HART FRANCES JEWELL GRADUATE CHRISTINE HOPKINS SENIORS REBECCA W. SMITH MARIE LOUISE MICHOT J. F. CORN NATA LEE WOODRUFF CI. C. WILSON R. A. FOSTER HERBERT FELIX J. R. MARSH JEAN FIELD LEROY BOWERS JUNIORS NANCY INNIS ELIZABETH CRow ESTILL Woon PHILIP PORTER SOPHUMORES F. O. MAYES RUTH MATHEWS J. W. WELCH WILLIAM SALLEE 1242, HERBERT GRAHAM JANE DICKEY 7- J ' 'I OLLEG E PUBIIQQUOUS 12441 1 J o I i I , I A P. Q lg 2: Q59 ikenfuckian A A I W Ehrtnrtal Stat? HERBERT GRAHAM . . . Editor-in-Chief E. A. BLACKBURN . . . . . Associate Editor JOHN R. MARSH . . . . . Associate Editor J. FRANKLIN CORN . . . . . . Associate 'Editor NATA LEE WOODRUFF . . .... Associate Editor REBECCA SMITH . . . . . . Associate Editor R. A. FOSTER . . . . . . Associate Editor G. C. WILSON .... . . Associate Editor L. HEYMAN ..... . . . Associate Editor JAMES MXCCONNELL . . ..... Artist FRANK STREET . . junior Editor 1 I C2452 L E E A . E A J Q 582 E 9 1916 Q: A J Q C2461 .L . Q B B582 2 Q 'kenfuckian AN 1, Euninrma 51:15 Roamu' EMMET1' CULLEN .... Business Manager A A FREDERICKHAMBROSE HARRISON . . . . Assistant Business Manager ' INA MARIAN DARNALL . . . . . Subscription Manager HYMAN FRIED . , . ' . . . -.... AdvertisingWManager. Q CHARLES R. SMITH . . . , junior Business Manager ' Y 1 P C2471 N s s19I6e fisszi 9 gfi ,JJ Vyy Lx., W' ,J , ft --M- ..,. --e.-.-,.. .... ' jiff, 'filkllf MC 'mi Q, ., ,...... ,,......,....1..-.......w....,..,......,H..,.,- ......... THE KENTUCKY KERNEL Formerly Tl-QE IDEA ' State University of Kentucky 1 r ell PUHUUEWP' 'Qnsm lmvmns QlUlllSVIllElf"'9WlH damn snnnfumnfn Q ax r 'AH iss! wg Pnlzfgsxqswwlsvlllf uv swf QSQQQS NNN ,W Q5 AJQFAIRQCU-EDSWANT ru ggsegegg QQ Aff' SWUWS UQ ,WELEVAIE mg Mnssfs ymmnus ur swf nsli,5,vgL,-we ,r.r,,,, r r A S' 'H 2 mum AT IJAHllANEllESf wziiiiem2:32, '- 'eg Im. . , xixwmwxm nvfn vms nrsuus mum A QL . it - Q onls num PMEEMEN NSW? Q 'Sl 223.6 F - 'x afwwgw Six WZ 'gi' ee 5 TWU Ii eivsefwftt Q W ff -S Mlfffa Wm 4 ww fimfffw PRES F A N UHNE INPAHMIE ,-cz - 1 'QM 4 ' 121 ' gxmxxyxx-' us? Ss 5' Q VXQQQW we x ,flfmdfrq '-S' X 4' K ' X, , N eSwSg.,,ffff 4 '0 wwf we fd' Q we Q Q3 fo ww 3:VSff1f1Ff4QS .914 t "" Yi NSS Plfk1Sf0W0WMl'W 5-3 QV .rg"fH'f,:gq LZ.3A,r "KPN xg 4. QRS gfffww Mfffs1A11a,,5"-fe, " 't'f' N- -91" K' ff? Sf safffaWfff7ff1fff ?'i?jQ t ,!fff,,,,fzy2Hmfuulxv uuum Ve Z2 Fl flffwf fmfJ'lll1yfEf-"5-'Q'Q.1':-Q W WW, aumsfu nv "mum, 4 IIIHHJIIIS Xff!i'.fIff717 'A,. '22 , 4,2 f ,I 'XX-Ziff! A ,.,, ,QI 1 "fm, :fm,:r:V'fg:f,I:.::gQ..,:.l " r J? 5011041 Xefif We Can Beat Purdue .r 12481 V 1916 cfffw-M-.... 4, t I M i is - 1 n , e 'N 1 1 ,-,N.g, 5 5 r S H 2 e I E 4 a 4 1, Q Sf? fu I... ...... .,-,.:.,. ....,,.... L ,,.. ........ .....,. ..... .,...., .........- .... ... ,......, , ,,,. ..,. . . ., ..,,, . ., . ,,.... ...... - .,.,,-.,..,. . , ,. .-.. ....,.. . ..o.....,,.,,I.o..d I ,I IEFQ I? 75927 fat CIf'f.1z'ct fl fEiETgiffri1f"i" ii?fE ' ,E l P I 1 1 v wi l iii l li I W I Q33 i ii.. I I I ill 2 -gf gl fit i I . I I ' ii? 5, I fig I Yf. l Q25 , .ig K I E I il? 5 I V? l I I I I 1 .ga if' :Ii 'I if 2:5 II lil ft? EH 3 I I I 3 I 1 I lirniurhg livrnrl Stat? ' WILLIAM SHINNICK . "Squirrel Food" Editor g I Q REBECCA SMITH . . . . . "Co-ed" Editor MCCLARTY HARBISON . . . . Athletic Editor I jol-IN R. MARSH . . . . . .Exchange Editor HERBERT GRAHAM . . . .Fraternities J. T. GoocH .... . . . ......... Law HARRY MELTON . . . ................ Mechanical II 3 S. J. CAUDILL ..... Mining ANNA LEWIS WHITWORTI-I . . Sororities 3 ELSIE HELLER ..... Education JAMES MCCONNELL . . . Agriculture JULIA VAN ARSDALE . Home Economics ELIZABETH DUNCAN . . Patterson Hall I REPORTERS . 5 H. j. EVANS ESTILL Woons W. T. EOTTINGHAM M. C. FINNEY MILDRED TAYLOR f249j it . l I I I f T'.7 , f, - ,, Ar rv gfrwwfww Publ F. A. HARRISON . j. V. CI-IAMBILRLAIN R. E. CULLEN . J. W. MORRIS . . F. H. RICKETSON, J Uhr iirnturkian Emu Elnurnul ishecl Monthly by the Students of the College of Law EDITORIAL STAFF . ....... . . Editor-in-Chief . . Associate Editor BUSINESS STAFF . . . . . . . . . . Business Manager . . Assistant Business Manager R. . . funior Business Manager 12501 'fm 'eff 3 - .-.. H? B-..,.. .A , -1 3..- 'fiiigl AflQ:j?5,tf?j CEEaiQ:jQ::::::::QQE?IE:5g:Ei?22TF?i Elrmwit Staff Published monthly during Ihe collegiale year lay Ihe sluclenls of Ilue College of Civil Engineering EDITORIAL STAFF CHAS. W. LOVELL . . .......... .... E dilor-in-Chief R. F. ALBERT .... ..... A ssociatc Editor G. H. HILL ..... . junior Associate Editor JAMES G. RONEY . . . . . Exchange Editor R. F. MACLEAN . . .... Local Editor B. D. HOWE , . . Athletic Editor CLASS REPRESENTATIVES BURTON WILLIAMS .... Senior Class l... T. WHEELER .... Sophomore Class W. M. ADAMS ..... funior Class R. K. DIAMOND .... Freshman Class S. CAUDILL . . . . . Mining Deparlment BUSINESS STAFF A. RANKIN .... Business Mariagcr H. FRIED . Assistant Business Mazinger f25Ij NN A In ffjvmnriam MRS. JAMES HILARY MULLIGAN JUNE TWENTY-FIRST, NINETEEN I'JUNDRED FIFTEEN JAMES HILARY MULLIGAN JULY SEcoND, NINETEEN HUNDRED FIFTEEN MRS. JAMES KENNEDY PATTERSON SEPTEMBER TENTH, NINETEEN HUNDRED FIFTEEN ELDRIDGE GRIFFITH OCTOBER TWENTY-FIRST NINETEEN HUNDRED FIFTEEN FRANK COFFEE DARDANELLES NOVEMBER EIGHTEENTH, NINETEEN HUNDRED FIFTEEN RICHARD HENRY BARKER MRS. JENNY HANSON HELM FEBRUARY TWENTY-EIGHTH, NINETEEN HUNDRED Slx'rEEN 'I ROBERT SINGLETON HART, M.D. MARCH TWENTY-THIRD, NINETEEN PIUNDRED SIXTEEN 1 FEBRUARY TWELFTH, NINETEEN HUNDRED SIXTEEN I 12521 131112 llihge Aaauriettinn ELMER K. ROBERTSON ..................... President JANE DICKEY .... . . . . Vice-President LoUIs REUSCH . . . .... Secretary FRANCES GEISEL ...... Treasurer "The purpose of this association is to interest and aid a delegation to attend the Southern Student Conference at Blue Ridge, North Carolina." Those who have attended the conference from Kentucky are: Y. W. C. A. I907 l9l3 I9I5 FLORENCE MADDOX ANNABEL GRAINGER INA DARNALL l909 Lols BARTLETT FRANCES GEISEL ANNE SIMRALL ANNIE HODGES MARY HOWARD l9Il I9l4 JUDITI-I BEARD VIRGINIA MCCLURE REBECCA SMITH JANE DICKEY 1912 ANNIE LEwIs WHITWORTH JULIETTE GAINES ELIZABETH FARRA Y. M. C. A. I9I3 JNo. J. TICERT C. T. DOTSON C. E.. BLEVINS E. WILKERSON J. W. LINDSAY 1914 FRANK KENNEDY LEo STEINI-IAusER E. L. HALL I9I5 HARRY MILWARD Louis REUscI-I ELMER ROBERTSON C2531 FRED HUMMEL KARL ZERFOSS E.. L. HALL J. W. LINDSAY JoE M. ROBINSON NY 4 1 .W-...M ,,, .-......4, KQV f ff 9 1 J H ---- .-..... -1-X.. f s AQAU J C'!?i,Q tif Cf YE Uhr Eine filings Aaanriaiinn The Blue Ridge Association owns about one thousand acres of land, and equipment valued at Sl25,000. Ten Southern States and eighty-five Southern colleges are repre- sented at Blue Ridge, bringing together four or five hundred students for a ten-days conference under the direction of some of the greatest student leaders in the United States. The delegates devote their mornings to Bible study and conferences, with an inspira- tional address at the close. The entire afternoon of each day is given over to athletics and recreation, such as mountain climbing, swimming, tennis, baseball, volley ball, basket- ball, and other sports. Those who have attended conferences endorse the movement heartily, speaking of it as the place to find enjoyment, education, inspiration, and good fellowship . . . to learn how to put ideals of religion and social service into practice. OPrNroNs or 1915 DELrzc.ATr5s A The atmosphere at Blue Ridge is filled with the germ of enthusiasm.-JUDITH BEARD. If you are looking for enjoyment, education, inspiration, and good fellowship, go to Blue Ridge for ten days.-ELizAaiz1'r-1 FARM. Blue Ridge is the college girl's best oppor- tunity to learn how to put her ideals of religion and social service into practice.-REBECCA W. SMITH. For inspiration, spiritual uplift, comradeship with great minds and keen enjoyment, go to Blue Ridge.--MARY Howmzn. There in the heart of the Blue Ridge is a growth of leaders radiating to all, the inspiration and spirit of the Master.-INA M. DARNALL. Blue Ridge is an opportunity which no man or woman of "State" can afford to miss.--JNO. J. TIGERT. After attending the conference, a student will be ashamed of doing less than he is capable of doing for the cause of Christian living in his college.-J. W. LINDSAY. C2510 Life is better nowhere than at Blue Ridge.- E. P. WILKERSON. The fellowship there of college boys from all over the South is the greatest thing that can come into a man's life.--jo: M. RoaiNsoN. Blue Ridge is a wonderful place. Every "State" student should g0.1KARL ZERFOSS. At Blue Ridge you find out the things you ought to do, and you resolve to do them.-C. T. DoTsoN. l cannot urge too strongly that every student. who wants a larger vision if usefulness and the strength and courage to realize that vision, to go to Blue Ridge-LOUIS REUSCH, JR. There you obtain a world vision by coming in close contact with the student leaders of this day.-ELMER ROBERTSON. To mingle with students representing all the colleges of the South is only a small part of the Blue Ridge Conference, but it alone is worth the trip.-HARRY MILWARD. 1916 I Huang illilvrfn 0llI1'intia11 Ammriatinn CABINET JOSEPH E. TORRENCE . . Presulcnl BART N, PEAK . . VICC Presulenl LouIs REUSCH . . Recorder KARL P. ZERIfoss . . . . General Secrelary DEPARTMENTAL CHAIRMEN GEORGE H. HILL HARRY MILWARD J. W. LINDSEY JOE ROBINSON C. T. DOTSON EI.IvIER ROBERTSON EDWIN H. KOLB CURTIS PARK MARION CONDITT HERBERT GRAHAM . ...... .... E drfor Handbook E. A. BLACKBURN . . . Business Manager Hamlboolf Y qzssy I' Q 5 Q ,, W ff f if L, , f I if 1 I K 'v 3 L 4 3 1 1 1 1 1 , 5 X lt' 5 v.: i ZH I If 1 isf 1 fb' it , ,V 1 + he I L" :'1 4 15, , ., Q l' 1 522 235 I iii ' lg: ,,. I 'gf ' 595 i ii? 1-I 3 'Q f 35? M . 1 . 15: . i MQ f Mi gs I! + IL Ml Q2 C2567 2 . 5 I 5 H , . W 'lfzfk' n fl?-ff'K 'T """"'fffff AM' 4 Q t""""3C W Q L-K8 I? TIL! ck CZ fl -f...."':.qX Quang lmnmrxfa Glhrintian Aaanriatinn 1 P OFFICERS ELIZABETH FARRA . . . . . . . President , MARY HOWARD .... . Vice-President L KATHLEEN C-ARROW . . . Secretary Q I I ll REBECCA W. SMITH . . . . Treasurer 3 1 l MAEEL POLITT ..... . . . . General Seen.-tary 1 1 CABINET VIVIAN DELAINE FRANCES DAwEs l HELEN BURKHOLDER ELSIE HELLER i X FRANCES GEISEL ANNIE LEWIS WHITWORTH 3 MARIE BECKER ,IUDITH BEARD JANE DICKEY SuzANNE BEITZ CI-:LIA CREcoR LELAI-I GAULT s INA DARNALL Much has been accomplished in the University during the past few months by the Christian associations, due to a closer co-operation and more unified interest. A spirit of enthusiasm has characterized every movement undertaken separately or jointly by l the Y. W. C. A. and Y. M. C. A. 1 It is believed that through this means the Christian associations on the campus will become one of the most powerful and far-reaching influences on student life. l X A I l I l . C2579 E Q 2321 sa 1916 a , itieigmnnh iKnhi11'a Glampaign AYMOND ROBINS came to the University March 28 for a four-days cam- paign, the object of which was to present to the students the Christian life and have them accept it. Those who heard him will not forget him soon, nor lose the power of his influence. The heartbeats of many men were quickened and made stronger by Mr. Robins' sane and forceful appeal. Mr. Robins is himself well acquainted with life, and because of that he was able to reach many students hitherto untouched by religious meetings on the campus. Typifying the ideal of many a strong, red-blooded Kentucky youth, Mr. Robins got results as no other worker here has done. Two hundred students in the University signified to him that they had determined to live the real life. There were about one hundred students on the campaign committee, who deserve much credit for the success of the meetings. They were led by Karl Zerfoss, General Secretary, successor to James Park, who resigned February 28. Assisting also were C. E.. "Chief" Blevins, W. Bergthold, State Student Secretary, and others. Through this campaign the Christian Associations of the University gained credit in the eyes of the student body that will have considerable bearing on the future welfare and influence of these organizations. 12581 . A- ---A-if .A..f-e-r----- ' ' '-W r-""D'frf"M' ' AA QQ V jf--1-eglgggc --33 gh Q 788 77 fl! Cklr C1 fl 'f1'1.Q- Z 1"i,4gs-4wsggg1'T.1. 'Q . ift ff 'M' .2 r X Q l l l it l l .. i Itlieutrmmi Arthur TK. ilnhmnnnh IEUTENANT UNDERWOOD increased considerably numbers and ellici- I ency of the student battalion during his brief stay. A capable executive and Q! Q earnest worker, he accomplished unusual things for a Commandant. When he was called to join his regiment on the Mexican border the battalion was so well organized that everything continued the same under the direction of R. F. Albert, t Student Major. Much credit also is due Major Albert for his handling of the cadets and their good showing on lnspection Day. f259J K.,,,,,,y-,,-W..--,,, s, A , ., , ,- -H M, , W ..-ff ' k:::iT,.-, ?...-g .... ,Q3 Q16 Z:gg:,og1TT'ri":L"t'lf' N 1 It 15" f" 2 5 Q M i i I iiatallinn Sstaif RUSSELL F. ALBERT ..... ......... M ajor L. HEYMAN .... ..... A djulanl J. H. COLEMAN . . Quartermaster Company A-BEN MAHONEY, Captain: E. P. HATTER, First Lieul.,' O. C. WALKER, Second Lieat. Company B-W. C. MARTIN, Captain: C. H. HILL, First Lieul.f E. M. COBB, Second Lieut. Company C-L. E. PAYTON, Captain: H. B. COMBEST, First Lieut.f E.. E. DRAKE, Second Lieut. Company D-H. F. CROMWELL, Captain: M. M. MONTGOMERY, First Lieut.f E. E.. DRAKE, Second Lieul. Company E--EMERY L. FRAZIER, First Lieutenant. 12601 1, ...W 1, WN... x "'M2f4"wf' ' x L N t it i 1 I 1 I t i V I M 5 .I 3 , ii' ' iff it '11 1 . s R I . . f 1 vi ' . " gif I ij? A tif li' i 522 ttf ii' P B, i r A i .Vu 4:1 P! ,-,- Lk . . , TZ16. Z Kevitgw' Hskei N A 5 C260 2 ff I ff? i v I . Y -,,,, , ,ng , H' ,VT ,L 'Q f ,-,,., , 44' - A ,V -V J , , ,-... .. r 3 i 4" V , l yb I 121 si A Q4 +: 'fl f: WL 54? H1 fig nf! lm , FI ',! '51 U: ii fle g'v l fl! :gl 54 iii fs 5: . W, if! 1 12621 , , , , ' ,A,V gfa 1'Q!6 61 f? gf 3g55 3.'SQQ 12632 eeea ff: gzecifenfuclcian R J A S mhmfns mlm in Amnrira was ilihitinn EDITED BY REBECCA W. SMITH This volume is prepared in an attempt to inform the public about the well-known persons of the Nation, and to furnish an up-to-date guide book of famous people. The editor has endeavored to make the record exact, and solicits further information and corrections. ALBERT, R. F.-Major-General U. S. A. Author of pamphlets on "Why I Think All 'Folks' Need Good Soldiers." ANDERSON, VIRGINIA-Artist. Especially known lor lifelike portraits of farmers. BARKER C. R.-Special instructor in flute playing to the young gentlemen of the New Dorm. BASTIN, PEARL-Ex-champion women's basketball player. Compelled to abandon the sport on account of "Hart" disease. BEARD, .IUDITH-Principal of the High School at Central City. BETTINGER, CARL-Pitcher for the New York Nationals. BIRK, GLOVER-Insurance agent. Special salesman of Twenty-Year Endowment policies to Senior classes. BOWERS, LEROY--Professor of English at "Brown" University. BREWER, CARLETON-Prominent club woman. Present address Earlington, Ky. BROWN, HAZEL-Author of book for college girls on "How to Captivate the Men." BROWNINC., ILEY-State geologist of Hindoostan. Author of treatise on "How I Know I Am Descended From a Monkey." BERNHARDT, CARL--Musician. Relative of Sara Bernhardt. BLACKBURN, E.. A.-Recently elected for life as Grand High Mogul-in-Chief of the Sigma Chi fraternity. BOSLEY, ALFRED D.-Farmer. Expert authority on raising small red mustaches. CARY, ELIZABETH-Writer. Conducts column in daily paper on "Why Girls Are Popular." 42643 L A 64 . A Eg! - -L-Qmrw:-4'-:ef-.1 .r.za::::fa:1:-2-sr-1: "f ' ' CORN, F.-Editor. Now serving a life sentence in the penitentiary for libel pub- lished in Squirrel Food. CROMWELL, HENRY-Captain U. S. A. In command of the troops pursuing Villa in Mexico. CARMAN, ARMIEL-Millionaire. Bought Bluegrass farm with the profits from box seats at basketball games. CLARKE, M. J.-Dancing master. Proprietor of "Clarke's Terpsichorean School for Young Ladies." CREIGOR, MINTON--Automobile racer. Began his career by driving a Ford at 60 miles an hour out South Lime. CRUIKSHANK, LUCILLE-Practical agriculturist. Has proved that when the men are "Scearce," women make good farmers. CHERRY, GEORGE-Cotillon leader for the New York smart set. CLARK, HAROLD-Mechanical draftsman. Engaged in drawing all his Senior designs for the fifth time. CULLEN, E.--Deceased. Tried to stop the proceedings of a buzz saw on a point of order, and was ruled out. CLARKE, WILLIAM-Address, Salt Lake City, Utah. Recently engaged in contro- versy with the government as to whether or not he could "Marie" twice. CODY, ToM H.-Artist's model. Poses for reproductions of Van Dyke beards. CAUDILL, S. J.-Engineer. Made highest record of all Senior Miners in I9-I6 Class. DARNALL, INA-See MOORE.. DEAN, EDITH-Social worker. Now sewing as "Park" inspector of Richmond, Ky. Douci-mary, Louisa-School teacher. Principal of ward school at Stamping Ground. DIX, WILLIAM H.-Engineer. Engaged now in finishing his Senior design work at U. of K. DUNN, C. K.--Matrimonial agent. Guarantees to marry off any girl he brings to a Junior Prom. DEERING, JOHN S.-Professor. Successor to Hutchcraft in the Kentucky Law De- partment. EDWARDS, O. M.-Statesman. Member of the Kentucky Legislature. EIMER, E. J.-Deceased. Drank potassium cynanide by mistake. C2651 if ' C,,it'Ccu:s Janne WIIBV Q -:YW x 3 Ning V, S S . f .-f"ff w fexffeuahf ' A a Mhaswwrmd' Q I, Q I 1? ', , lb A A 5 f P 1 f . ' xi I 'J V . . xv .QFA 'N' '-- A X m r G ' 1 l 1 , 4 J A W ,,,.. A , ,h ?la,:, - , A,.,',g, 1 ? Z V f ' N, f w.Mf NX: 1 '1 1 , .J 1 i ' ff! Q , z 4 1 I ' qzeep I ly L. 4 ESTES, LILA-Assistant manager of a modern dairy farm. Faux, HERBERT-Farmer. FIELD, JEAN-Kindergarten teacher at Lincoln School. FROST, SUE HUNT-Missionary to the African Congo. Address unknown. FOSTER, ALLEN-Barber. Specialist in expert facial massage, eradication of wrinkles, and all other devices for beautifying young men's faces. A FARRA, ELIZABETH-Canning club agent. Co-operates with the Poultry Club special- ist of the Experiment Station. E FOGG, R. J.-Champion pool player of Kentucky. GALANTY, ABE-Assistant to "Insect" Daniels in the Chemistry Department of the U. of K. GRAHAM, HERBERT-Lawyer. Located in Wyoming. GoocH, J. T.-Student in Senior Class of U. of K. Will receive X.Y.Z. degree in '26. GARRETT, J. D.-Formerly foundry foreman with the American Brakeshoe Co. Now farmer near Pisgah, Ky. GLENN, W. M.-Automobile inspector for the Ford factory. GINNOCHIO, F. S.--Lawyer. Now engaging in prosecuting a suit to obtain a vote in class elections. GREEN, LOGAN-Attorney. Practicing in Kansas. HAYS, JOSIE LACER-Lecturer. Makes records for the Victor Talking Machine Co. HELLER, ELSIE-Social service worker. Interested in reforming penitentiaries. HEYMAN, L. J.-Field marshal of the Limburger Division of the German army. HOWARD, MARY--Librarian. Has spent the last ten years in classifying Professor Noe's library for the valuable experience. HOWARD, KATHLEEN-Member of the firm of Howard 8: Mills, Conductors of Up-to- Date Geology Excursions. HARRIS, JEFF-Millionaire. Head of florist concern which makes huge profits selling flowers to Kentucky students. l"lE.ATH, ROBERT M.-Inmate of the Eastern Kentucky Asylum for the Insane. Lost his reason after talking on the Old Dorm phone for 49 hours without stopping. f267J to HORTON, M. G.-Machinist. At work building Dean Anderson's l904 model auto over again. HUFF, A. B.--Model. Poses for St. Louis Post-Dispatch cartoons of "Daddy and Snookumsf' HUNDLEY, R. E.-Mechanical inventor. Has patented machine for controlling class meetings which renders Roberts' Rules of Order unnecessary. HARRISON, F. A.-In prison for debts incurred while editor of the Kentucky Law journal. HAYES, SMITH-Killed in a C. Sz O. wreck. Was coming from Winchester when he met himself going back. HOWE, BEN D.-Baseball player. Star on Chicago Cubs. HOGREFE, J. H.-Runner. Employed in the Fayette National Bank. ILER, WAYNE-Silver-tongued orator in Congress. INGLES, MARGARET--Architect of homes. Especially noted for a recent design of a "Dutch" bungalow. JOHNSON, A. L.-Author of new edition of Roberts' Rules of Order. JOHNSTONE, W. C.--Sheriff. Engaged in serving "Warren-ts." KUMLI, C. F.-Demonstrator for McClure's Anti-Fat Compound. LEWIS, ANNA E.-Permanently located at Franklin, Ky. LEONIAN, LEON-Poet who writes love lyrics in four languages. LUTKEIMEIER, CAROLYN-Dressmaker. Designs styles which rival those of Miss Buckman. LOVELL, C. W.-Song writer. Latest hit is "The Ladies-What Makes Lovell Love-all?" MARSH, JOHN--Proofreader on the "Bowling Green Suffrage journal." MCKEE, LINDSAY-Fashionable "Taylor" of Lexington. MICI-IOT, MARIE LOUISE-Married. Address is Paris, lf' MCCARTY, GAMBREL-Zoologist. Author of "Studies in the Heart of A. Crabbe." MCCLURE, EUGENE--Movie actor. Only man who combines talents of John Bunnie and Charlie Chaplin. 12681 ,.-..NN., I . -.,,,f , I .. -..-. ......,..-,....- . ..,.-..,.. .A , ,..,....-, .... ....i....A-. F ff 'Aw A' 1 i Y 1 P r J ! MCCRACKEN, M. L.-Restaurant keeper. Runs the University lunchstand as Mrs. Barnett's successor. MCMURTREY, S.-Doorkeeper at Miss Spurr's dancing school. MITCHELL, W. C.-Dean of Men at U. of K. Special supervisor of the Old Dorm. MOORE, JAMES I-I.-Politician. Leader of Tammany Hall in Greater New York. MARTIN, ANNETTE-Hairdresser. Designer of elaborate coilfures. MITCHELL, KATHERINE-Suffragist lecturer. Tour includes Shelbyville, Maysville, and Lancaster. MAY, JOSEPH K.-Tennis professional. Also known for his enthusiastic study of "Browning" MELTON, HARRY-Agent for Danderine Hair Tonic. MCDONALD, JOHN W.-Politician. Running for Congress from Mayfield on the Prohibition ticket. MCNEILL, DEE-Musician. Best known as a "Harper." MAYO, W. P.-Whereabouts unknown. Absconded some years ago with the funds of the Class of 'l6. MOBLEY, W. E..-Corporation lawyer. Defends the athletic association of U. of K. against charges of being a trust. MACLEAN, R. F.-Oflicial rifle cleaner for the entire Russian army. NAEGLE, G. P.-Heavyweight pugilist. Received training in class scraps. NELSON, L. H.-Deceased. The poker which he habitually wore down his back finally choked him. H ODELL, JAMES W.-Lyceum leeturer on "How to Be Happy Even If Married." OWEN, C. S.-Public official. Coroner of Mayfield, Ky. PAYTON, L. E.-Retired army officer. Shot in the retreat from Mexico. PEDLEY, GRACEAN MCGOODWIN-Recently died from the effects of too much pink tea. PURSLEY, E.. R.-Author. Has written authoritative volume on "Sanitation and Hygiene." PENICK, E.. S.--Lawyer. Address, 903 East Main, Lexington, Ky. PHELPS, D. M.-Sportsman. Writer of "Ways to Win Wiley Creatures." 12705 REID, HOMER-Book agent. RECORD, HELEN-Fortune teller. RUBY, CHARLES-Style show model. Winner of last national beauty contest. REYNOLDS, C.-Prohibition judge of Nicholasville. RANKIN, A. J.-Blows his own horn in Webber's Band. SPRAGUE, GEORGE-Physician. Specializes on "Beitz." SCEARCE, RICHARD-Married. SULLIVAN, KATHLEEN-Actress. Starring in Shakespearean roles. SULLIVAN, M. S.-Track coach at Yale. SMITH, WILLIE LEE-Mayor of Sebree, Ky. SPENCER, CARLISLE-Explorer. Has located Catoosa, Tenn., in the jungles. Sl-IOUSE, G. B.-Pugilist. Considered the "white hope" since his bout with Bill Clarke. TIPTON, P. H.-Minister of the gospel. Prize eater of the profession. TERRY, NORMAN-Politician. Assistant to the leader of Tammany Hall. THOMAS, R. S.-County agent, now engaged in organizing chicken clubs. TOWNES, FAY-Truck farmer near Louisville. Married. TAYLOR, T. C.-Capitalist. Made his fortune on long shots at the races. THOMPSON, W.-Professor of Public Oratory at U. of K. TORRENCE, JOSEPH-Revivalist. Now assisting Billy Sunday. VAN ARSDALE, JULIA--Assistant to Miss Nellie Reynolds in the Home Economics Department. WHITWORTH, ANNIE LEWIS-School teacher in Shelbyville, Ky. Spends summers in Cadiz. WILKERSON, EUGENE-Proprietor of Cassidy's Pool Parlor. WILSON, G. C.--State agent for pickles and "Garrow's" chocolates. WOODRUFF, NATA LEE-Traveler. Spends most of her time between Colorado and Great "Brittain." WALLACE, R. A.-Professor of Chemistry at U. of K. WARWICK, G. W.--Model. Demonstrates Society Brand clothes. 42719 7 f--N ,fr , be in n I I ,K .afx-lzxxacx ,- H K lv ' ..1Ifflf'ffl,-,,v'f1Q?""f.. 7 f w 1-1' wer i ,,.,,.., ,, ...M I I 1 l RQ- f 1 f----ew - . . WATSON, C. C.-Engineer. Located permanently at Frankfort. VVI-IITLEY, FRED-Vaudeville actor. Holds national endurance record for foxtrotting. WOLFF, JULIUS-Poet. Author of celebrated "Mechanical Verse." WORSHAM, I-IERMANN--Comedian. Best role is that of "Dolly." WILLIAMS, H.--Pawnbroker. Deals in second-hand law books. WILLIAMS, B. F.--Assistant to Dean Rowe in Engineering College. ZERFOSS, KARL-Missionary. Now assisting E.. L. Hall in raising money for Y. M. C. A. barber shops in China. iiunlutinn nf the Snuinr I fConsider the high school student and the uneducated man and woman. How proud are they of their ignorance and how content with their conditionlj Deep in the dark, night ruled. Silence and chaos was in the world and was the world. The Creatures some day to be Man dwelt in cosmic chaos- Content, for they knew not light: proud of the night because it was theirs. fBut to some few comes the desire to study and to know., And in the night came the morning dawn, And the Creatures saw the dawn of the morning in the east: "Behold, what a curious sight! How strange that there should be anything which is not already known to us I " fThe Freshman's life-what a round of pleasures it isg what delight in the thousand new things to be discovered and experiencedlj Strange, formless masses were the Creatures when they sought the Light. And, though they had once been .content with Darkness, they now romped and frolicked in the Sun's bright glow. They rejoiced in their new pleasure, and it was good. And the Creatures took Form. fFirst to the Sophomore comes the realization that he really has a place in the world that he cannot always play.j Now, once it happened that the Forms dared to look into the Sun. And, dazzled by its brilliance, they could not much look, but must turn away. But again they looked into the bright Sun, and again, until they feared not its brilliance, rejoicing in their new found power. And the Forms became The Proud. C2721 N.-.........L-,. . me ,W I i " 1916 2 959 tkenfuckian 919166 382 9 X 9259 7CQn1'1,z ck ian : . C'All knowledge is mine," sayeth the Juniorg "1 have conquered the world."J Now, The Proud lived many years content and happy, and they said: "Lo, this is our Sung it shineth for us alone." fDoubts and perplexities trouble the proud soul of every Senior, and even some Juniors., But once in the latter days behold one looked and trembling saw the Sun grow dim. "Awake," he cried, "for our Sun departethg it vanisheth over the hills: already doth the air grow cold at its departure." Then there arose a great lamentation. And one cried, "What shall we do?" Another, "We must all surely perish, for we have lost the light." And still a third, "O woe is mel For the light of the Sun, which I thought was in me and was mine forever, moves ever onward and away." fFortunate is the man who before ending his college life again learns his true place in the world. Unhappy is the lot of the one who has not an humble determination when he enters upon life., And then there arose one who cried aloud, and The Proud Ones hushed their weepings. "Behold, our Sun which came to us from behind yonder hills has passed on its irresistible journey by us where we sit supine. It came not through desire of ours, and it departs against our will. The Sun which sets on our lives as Proud Ones will be our rising Sun if we pursue it. Arise for the pursuit: not for us alone does it shineg we must ever follow to attain." Eine! Fine girls and fine boys We have at dear old Stateg A fue school and fine profs Make life here simply greatl A fine team and fine field In athletics do shine, And Fearing with his auto Was also classed as "fine." 12741 1? , an 1916 es 382 e Q69 ckenfuckian Q l Helium' 3551 l The suffrage crank with features wild May stamp and scream and rant And let no one his mighty gestures stave: The fool who rocks the boat with glee May have his pleasant play And not a one of hapless victims save The man who has the motor craze And speaks in terms of gas, We can, by use of will, sometimes forget: But save us from the wiles Of the boob who sweetly smiles And butts in upon the male quartet. Hara Eihre When we Can't Make our rusty Brain perform Or ln any Way answer our Desire This kind Of stuff is Fine For filling Space. 0757 W t l 1 l J, .Z Q 01916 e 1 Wx if I ., 0, M4575 7 l r, ,f ff 1' if fwfr f . , m .Int js fd SHE: HE.: SHE: HE.: fl911lPh ,. i ,..,,,--- Q4 If f .4-T L Tr, L.T 4 '. V' I ! . 1 I y ,,. . ,. , i A l A ""Qf?'w'f' li I. ,I You say Brown is out for the team? Yep. I-low is he showing up? Seldom. tn filllg Efwrntg-ZHirzt Eirihimg A A A A A A A A A A sense of manhood! mighty joysg' pair of dirty corduroys: Senior cane: a Senior ring: Freshman girl swung on my wing: lordly walk: a lordly airy hatful of conceit to spare: timid underclassman's goat: right lo buy and sell a vote: void to put some knowledge in: scraggly mustache--D--N THIN C2763 W L , V E ' V ln' -wg qv' -- ,K x ' 1 N V, sxi 17!.WJYXM ,b .. ' ' , X ,Q J I wa 4--M X y . r, - . ww. 4 .1 QA. Ju-,, 6y M ww ' ff! ws . A 'X K. 1 , '. " VT 1- ' 4 ,4 R WP43Q f'2 A -S V, H 4 gwil .115 H.. 9 H W Y qgxxmrf. l!"', Q3 IX gxuxu I , 1 , l i s i 1 l , ..,,, . 1.5 4' Rt! rv 'st ML I' PM x SM S9gUl1l'GKdf'Y' .I H- I ............,....,,,.. ,... ...,...-,,.,. n,,. Nw.. A--g,......A...., -H M- A' 4- W...-g -1 ...Y - , Mm.,-, - C2771 M ,w. fs Rf 1 'K "',,, I ' . 5, 44 'V !1Wf, e 'wkf 1 t l r P E 1 l ls ll i 5 ?'T'f"' ' ff, , ,. i I . l l 3 S, E. r l 5 l l 4 , . A i 1 l i I I 4 it w l ? l w....-................. ... ,,,..,v, . J A M FN gi ,, A rc N J W V . .MM ,M Wx, .. ,,q-M 1 f-4 ' Q9 tf35".VF.f !7f.4l4ff'!f7fll tilt' F2 "linux" Auto Efuurn LL aboard for the .famous "Knox" Auto Tours to all the attractive spots !'f!l,tiks..,xNfl, around the noted little town of Leiungton, including a visit to the campus of the University of Kentucky. Fifty cents for the round trip and knocks A ggfitg- for everybody taking the tour. Even the engine knocks. The first historic point to be visited on the "Knox" Auto Tour is the University of Kentucky, located on the site of the old city park. 'This university was established here about forty years ago by an act of the State Legislature. Since then it has been neg- lected, suspected, distrusted and investigated fby that same body of patriotsl. At this school Henry Clay CSimpsonJ received his early education and Stonewall Jackson fought his first famous fights. The Old Dorm was "Home, Sweet Home" to John Howard Payne for a year. John Adams and james Monroe fMorrisJ, both call "State" their Alma Mater, and Rutherford B. Hayes and Grover Cleveland CWilsonQ hail from these historic halls. The students here know William F. Cody, personally, to be a good scout. Jeffer- son Davis fClarkD first learned here how to run on the Wildcat cinder paths. It is the home of the MINT JULEP and the habitat of Virginia Dare fStoutxJ. Patterson Hall! Ladies and gentlemen! The large building before us in the young ladies' dormitory, the happy hunting ground of the "Dear Dean." When the fair co-eds can think of nothing else to do they return to Patt Hall to feast upon the furtive prune and partake of the ever-Howing "zip." In the distance you may perceive the University of Kentucky, pride of the Blue Grass and fair stepchild of Kentucky. We are now passing through the historic old stone gates. It has been estimated that enough students pass through these gates in one week to reach around the world five and one-seventh times, if they were to travel in a straight line. a The building before us now is the Education Building, where those students go who want to "Noe." The rooms on the top fioor are occupied by the Home Economics Department. Laboratory work for the young ladies of this department consists in serv- ing dinner to members of the State Legislature, the Board of Trustees, and the Sheep Breeders' Association on their annual visits, and other brave and venluresome persons. So far no fatalities have been reported. For the benefit of some of their guests THE DEPARTMENT is thoroughly equipped with Maxim silencers on the spoons and throat protectors on the knives. We are now passing the hall where the local branch of the Association of Advocates of Preparedness has its quarters. Here the students assemble to drill under the direc- tion of the "Commy." This historic structure is the scene of the battle of 'I6 vs. 'l5, four years ago, when the belaguered band of a dozen Freshmen delivered blows heard A C2781 H " 1916 sg-, J -. r , , 5, EM' rrfj gf f around the world upon the heads of the five and seventy Sophs who protested against the 'I6 pennant that flew from the top of the tour. The Y. M. C. A. also hibernates in this building and here the gymnasium classes are held. These are the three best-loved departments of the University-drill, gym and Y. M. C. A. The classic structure we are now approaching is a combined dormitory and museum of battle trophies appropriately called the Old Dorm. Sudden and unexpected showers frequently occur in this vicinity. fSpeed up, driverlj This building is equipped with all the conveniences of the year IS73. During its long life it has served as a dormi- tory, a Federal prison during the Civil War, a stock barn, and as a blockhouse for the early settlers. It was occupied the first time shortly after Columbus landed on American soil. Its history before that time is for the most part unknown, but when first discovered it was believed to have been part of an old Indian Mound, or the remains of a Roman camp. We are now in the heart of the campus. Behind us is the rear of the Main Building. In the distance, on the left, is "State Hall," and the Library. fLet the little Ford rest for a moment.j "State Hall," or the Mess Hall, as it is better known, is a magnificently furnished and equipped structure, erected by assessing each one of the l,2O0 students 35.00, which was spent on its erection and equipment. Here the students may get meals at cost price and may get indigestion free of charge. The Library, one of the smallest, but one of the most beautiful buildings on the campus. It was erected through the munificence of the great American Library Builder, Mr. Carnegie, who intended this building for the edification and instruction of the Anglo-Saxon students who frequent the UK. S. U." Campus. It serves also as the trysting place for the love-sick Freshman, and as a shelter when it rains during Chapel hour. To the right is the New Dorm, new in name and by comparison only. In this building one may ascend to "Heaven" by the grace of the Seniors, but woe to the underclassman who aspires to this honor, for "great will be the fall thereof." ln the distance and to the right beyond the Dorm, a part of the cluster of buildings which make up the College of Mechanical and Electrical Engineering may be seen. Here the galley slaves toil day and night under the lash of the Director and his assist- ants. In order to be a Senior in this department one must take 263 hours a week and average 27 and 3-4 hours a day, when working. Before us now, ladies and gentlemen, is the Natural Science Building, containing many different forms of animal life, from the earliest pre-historic animals to the latest modern "bugs," the lawyers. It contains an extensive collection of fossils. Professor Miller, Dr. Pryor and Judge Lafferty have their offices here. We are now passing along one of the most beautiful drives on the campus. On the right we may see the home of the President Emeritus, Dr. Jas. K. Patterson, the C2791 a. J., sim ,W I, .M L.. . ,X,,. tn, ,W , A If I. KJ " r N 4 -'ik ,rw -Vw 'if , rr ,- - . "' ' """h" W' -N gf W yi , ,,f'-f tw .,,.. ., . -5 f--M, ..., ., 1,1 Q C, nj, ,:ffH.,fV.L 3' i A' ba. C if 'emi ff 'fi ,WM ,.,,,,--M,a1-L5..gjf-MA, .,,,-.-.., . ,,, fp 0, Amwfnznzsiuhi F' qzsoy 6 ,'.W . , i s i In E i F Q 1 v A I A A P 5 I i w ? 1 I 4 w , i I J . Ks 51 Y X u 1 1 I 4 I if Q55 f Z 5 Q W Q Q f lg Q --QuREcTQmr-- 5 iflxiiik ,MVN 'N1- if U1-iqqz S-Q-.bmw tn..L.,n- Gtisel ur ina mf., I3lX.,E.W JOM, an n.1a.,.L ' ' , U . MUTUAL TRUST BUILDING pf 9 Z, i - I A-ao:-27 X 1 '9'8' 4. 3- ...J THERE IS A DESTINY THAT SHAPES OUR ENDS, ROUGH HEW THEM THOUGH WE MAY 12811 -.,g: W2-.Z g ,JW- ,M.,.SQ'!'AQ: ff - f X A -,M Yvxl ,I .,. fem' or Q- .h ., f is ,, t r . ,,, 4 ' ,. -e--W-A , 9 Qffgae ystjrrtiliikfldlie Qiijtfiggie Grand Old Man of the Campus: on the right is the home of the Commandant, --- young man of the University. The buildings we are passing now belong to the College of Mines and Metallurgy, where one may learn the best ways to blow up a mine or set fire to it. On the left, just beyond the campus, may be seen "Maxwellton," home of the late Judge Mulligan. Here the famous poem, "In Kentucky," was written, and it was a look across the University Campus that inspired Judge Mulligan to add the lines: "And politics the damndest in Kentucky." This abbreviated stretch of road, known as the "E.ngineer's Short Course," is the best constructed road on the campus, having been built by the Civil Engineers in front of whose home we are now passing. This building, which is the largest and best equipped on the campus, is occupied also by the Department of Physics, the French classes, part of the Department of Mathematics, and contains the office of the Transit and storage rooms for the road building machinery, scenery of THE. STROLLERS and various other things. The loud roars and peculiar animal-like sound that we have been hearing for some time come form the building we are now approaching, the New Chemistry Building, where Dr. Maxson is now giving a lecture. By special request of Dr. Kastle, all of Dr. Maxson's lectures are carefully preserved and are carried out and spread on the Experiment Station Farm. The Ag Building, ladies and gentlemen, home of the College of Agriculture, pride of "Little Joe" and loafing place for the Two-Year Ags. The white--coated youths we see through the window working away at their tasks are learning the best way to do humble Bossy out of her milk and how to make two eggs grow where one grew before. We are now back on the main drive, where we can see the famous Blue Grass Campus at its best. The building we are now approaching is the old Chemistry Build- ing, which has acquired during its long life, a complete collection of choice smells and original odors. The number "l 7" painted on the tower is the one "magnanimously" granted by the class of 'l6 to the class of 'l 7 after they had pulled the latter through Clifton Pond in the first annual Tug-of-War. We now see the Main Building, another relic of the Miocene Age, containing a complete collection of old furniture and equipment. On the second floor is the Chapel, where the students do NOT assemble each Tuesday morning. Strangers visiting the campus, who see the campus covered with students strolling about in groups and couples, visiting the lunch stands and frollicking on the green, may know that Chapel is going on. Now we must take a last look at the University and campus. Its aisles of shady trees, the velvety and gently sloping blue grass lawn, the white drive encircling it and the cannon placed on its crest create a bit of natural beauty that cannot be surpassed in the United States. Next we will visit the largest tobacco selling district- qzszy lli 1916 ragga, ssry Q59 ckenfuckian f2'1i'."-i1,'ETEg,--..:--.g'Q l mlm? T "What makes her walk so haughtily?" The eager Freshie said. "She's of Alpha Gam sorority," Replied the wise old head. "ln basketball they have the dope: Two on the team-that's all, I hope! ' Which fact gives them the 'inside rope'- While rushing season's on." "What makes her walk so haughtily?" "What makes her walk so haughtily?" The eager Freshie said. The eager Freshie said. "Because she is an Alpha Xi," "Because she wears a Kappa key," S Replied the wise old head. Replied the wise old head. "A real fral house they have possessed, "They are so old nationally The only bunch here so much blessed, And proud of their antiquity, E Which should cause you to be impressed- They think they have supremacy- I While rushing season's on." While rushing season's on." F l l oe What makes her walk so haughtily?" . The eager Freshie said. "Why, that's because she's a K. D.," Replied the wise old head. "They won the scholarship cup here, And lhinfg they'll get it sure this yearg Of that they say they feel no fear- While rushing season's on." "What makes her walk so haughtily?" 1 The eager Freshie said. "My dear, a Chi Omega's she," Replied the wise old head. "Of lawn alumnac they've ten score, Who give them prestige more and more, il And entertain them o'er and o'er- il While rushing season's on " 1 I 1 C2831 lt i 5 4 e e e9 1916 gg' rw ....,, M, ,Y If I o V ' MIVWQ fqkllzcna. Vxwus V vX'X'v9QSY- A QKXLL ' H' Y A". . M. 2 .qu , . 'dh' 1+ , YF, fu--'V 9 - 5. ,mf , .- . ' 32:13, '-, ,V ,Q .X , f f ' 'P I 1-n -,ruff - Y'4,ho5f V ' f284J X, . 1fw,,ifl,.,f,., 1 ., mf T0 U GE ' rIeir " ,7FnEsHrv1EN ,gh .JOURNALISTS BY THE EDITOR I. Use the Hunt 6: Pick System. 2 Hit each key with sufficient force to drive it through the paper. 3 Use only first fingers of each hand. 4. Keep up a IiveIy conversation with your neig nt also makes these suggestions to young reporters: hbor who is working. The Departme I. Write as rapidly and iIIegibIy as possible. Get as few important facts in the lead as you can. I riting weddings, always leave out the bridegroom. n w In accident stories, never mention the names of the victims. 5. Never stop to spell or punctuate properly: it is not lmportant. 2. 3. 4. C2853 Qffllgjgizgfflf-'f-159 QIQQ ikenfu cki an g Z if 5 HIHEIIT-illgltllll gl l ' CJR l "A MEETING OF THE SORE.-ORITIES AT 'STATE' " President--"Order! Who called this meeting?" fSilence.D I Delegate From Whoop Si ftimidlyl-"I did." I President-"What is the business for which it was called?" Delegate From Ki Yi-"The rushing rules-" Delegate From Fee Fo Fum-"I do not think we should question each other's honor about rushing." i Delegate From Wlioop Si-"I-lonor! Some people don't seem to have much idea wha' it is!" Delegate From Fee Fo Fum--"Do you mean me?" President-"Order ! " Delegate From Slambda Hoo-"I should think some of us had better not get too personal." Delegate From Ranlgy Tanlfa-"I can certainly vouch for all our girls!" Delegate From Slambda Hoo-"So can Il" Delegate From Fee Fo Fum-"Well, I should say." Delegate Fromylflfhoop .Si-"We certainly can." Delegate From Ki Yi-"We always have played fair." X President--"Do I hear a motion?" Delegate From Wlioop Si-"I don't want to make any particular motion, but I certainly do think some people better-" Delegate From Fee Fo Fum--"I absolutely will not be insulted by any insinuations. We know a good deal on some other people, too, not only this year, but-" Delegate From Ki Yi-"Let's not drag up those old questions about last year." Delegate From Fee Fo Fum-"I can understand why you don't want to." I President-"Order! Do I hear a motion?" ' l Delegate From Whoop Si--"I move that we adjourn." l 42363 L...-.---... or 1 Aa k 382m "2 1916 Qi---M e , A t 1 kt 9959 Wenfuckian L.M l -as ' ' ' WI' lt P - lp" 1 Q -so cO - x it ' J K .A 3 ' ' 1 U X - 'E ' 1 . x Q 'H C0 'Q . 'O 3 'zo 9 C0 2 IL I xxx I ,t If ? W 2 l f JI r '5 2 4- I 'u W 3 I? N H-Fettx' W CO-ED: "Then you cannot go to the game with me?" ED: "No, I can't. But I'll get Spinks to go in my place. He will do anything for me C2871 Q t e t 1916 a+ A t X 9 e zzz- 9 My I I I 1 , 75 fi? 75g M1111 clcian 5 QF Q IN U I '. W 1 , 1 qzesp A 6 282 4 Wf,.g.,,QfQfffl , 1916 Q59 'kenfuckian ,....w Glhe iflnntlight Qbuven Twinkle, twinkle, little starg How I wonder what you areg 'Neath the powder and the paint What is "is" and what is "ain't"? You look better from afar: Twinkle, twinkle, little star. Ahuire Now, girls, don't you sec, Co-operation there must bel Do not stand at the doorg 'Good-night' once, but no more. "Dates leave at eleven, No more taste of heaven "Parlor doors leave ajar, Lest your character you mar. "Don't complain at the feedg You get all you really need. "lf for mail you wait a week, Smile, be patient, and be meek! "When at night the door they lock, Never ring: mildly knock. "Be respectful, grateful, too. Remember what is done for you!" 12891 K eo 1916 - J l I lil Elf El- 15: li ill I5 i I l!f rf! 1 l i lt g, . , , z E W, ,ri lil lea L ,V ,V I I l I P ll -..........,.. A, I2 7T . X ff'5' f Eg RTL is "J .5w,fE'-AW W1-- QSQsh5a X'M E , + np "film s S 3 if s5vMQjQNH'iN sq -, XXL 4f'sR.L L Q, wf 5. fr ' Q S m x xii r gx: ' N Q QV Q Hs Dao' sees I M 45 5965 COLLEGE UFE 'nik W? x ' 1 . 1 X f Q 'Q I 4 N av l ,, , N 1 xfixb is V mx T 111: , f N.-+4 I W awvw 1,4 ' -n, X K -XXXL fe X U! 14 ' X E w F an F X xj ' Wi. rv I X 1 Ram X 'RUE' KEN ETGWWW J M 1 9 ' Xu , Xxx 2w'2m., I ff My J X1qZjZX6fXfQ V f 4' S1 !L Mmikyxfav ' Y 'T f 1 THE ENTOMOLOGBT3 C290J DREAM C29I K 3' r"" Q f"' H.FeHX"6 'C sid? IPMRDWIE 09 UBEAT PURDUEH A ffm L9 1 AA.. l NJ! x E f ' K: 1 V M I .V -A XXNMMXNXXMLJX T L5-LINVY--"'95'N SHE FELL INTO HIS ARMS C2925 ,T f I 'AX ,f"'W ,,, -,, T27 . L ffQ?? V LTLML ftrb ' 4X iifiwf S3524Qiizheiflfiiifiiii fS.fii2f'1-EU M N H I 1 31 1 ' E .,ff4'?:2if5i',gw!W M fif 3 , i 51.7 if ,xv .,,: , ' gg- 11 4, fy ali? gig, 21 fwzz?v4 iQ5Q32 sas 53 5gHEgiEg22EgyQi4L f 'wxgEiif, :IF fV1Vf+Q2mQrQ,gg3ffigi.fJ?gaf1 Q. fri Q .Llfgzfi - Jim it nil :I mzfikiu f. : Q 'Q iigihiafi- Q 1 ' ffanw , N - 15 ffhfa , Niue- Cn- . 2? m O fi T23 Hgh 'D if ' g -1 'U '11 C .- l5'iIlm:f- "' 2 ffl? ... I FU 'S fsfsf2Fg E g gm- 5 -5 3 CI L51 5 ffiger. E: ' , .. -' 1JQ4Q - gh .J ,E 55 Q 1 , Z rf, 'af:2Ef2'i::1 A 2 ' S11 N' b Egisfifi E ' Q ' "' 91 U -I PU 'Sify if ,1I,.uEf - n-1 , 'U -1- m I If ., - x Q X .D o C- gg fn cg- 51 z 5 S Q :J T' WT' f f fix! . EN 12 91 'S , 5 -4 Z A J '- "J 'E EW-sfe. Q K :if '- gp 1: 1355554354 LE 'Q 'f - I axek Q!.:51'0 ' 5 Zgisfffsy 5Q142aa.:2u:a2'f-22225QufaseQ.5ggmEsf5geg:1s? 'Ili m 'wk rw.:- -"- --HA "2f2'fZT'2SQsa'Lnxwigfg,L, ,' ??x,'fs5i5 L5 51 Y, . . E71 if 1-W 5551.7 4- fifl i55iwJf??f? .'em'N?E' i25m4?zffi 5?D2fFL5, 522 5 QEELFQE , Q , " 5 mfatw4s2wxraQifffwfmia!x2axvQx4Qf::if5Ef4fSQX A .2 1 mf fvibafxfffmfh ,ff 2:23 -4 f5.QZ,f fg,Z6,!iy,,,3g2-'H gs55Qsgvg52:'i Fl- 'i:rQx:w.,S1 fri' XA! ? 'A -"' sf f 3851 Ea Q59 tkenfuckian fs G N .....,.,.,. .,.,,, .,.. ,....,,..,,. .,,. .,., ..,,.-...-..,-.um n...........-.... .. g"""' N""""""' "":.""' ,,......,.,,.,,..,........ . .,,, 7-'U-'i'11-713-':'-4'13:-"'-'::-M5-3?'W:'-Z:-7':7-'-Y'A4:5'4f?5?'-?I'1:...fI., ":r:Tf:::r,,:'::H::.t'-zrmrzr ---- vxlv -1-M ------ ---f ... ,......... -......... .-..,.. .....'s..--.... -..,. -.-- .-- ..... ........,.. ...... 1... . ....... Q ..- -.... ..,. Wi l , :.1r., -W--4"-'l L-7 """4'3-W' uw'Vm7'1'u":'11111"""'W"":7:3:7757':::3fV:5:5: fra.:-:..::1:. :.11' :zu ::. 'TIIM:g:':L2:4up3:':11:12'u:::::11:1:Q:1::'xx:12:ww17::L'Q:.7:,':'::rL'Ff'N52EZiwg:1-lm:':::.,:g::1:::L:.::: :N::1..:f: .1-373. 3:1 :znrruml 3:33.1.1u:1:.mc:-:::::'crawl:L:21:zu::21:11:1211:31w::::r::::w.::::"::'u::11:j':gL.1:::7 M.,:,Nk:,::M:m,-5- L:,,:,,lu:,m L-Z:-K, ,.:.-rc:zzrxfurz-:u:v:::':::x:::::"L:::,:'z::::::'2:::'::::h':11'c:.::::g::Q:::1:1:qi.x:: -m:m....1.' 2, .1 H l.: 5 ,,,1:m:x,.,. 7mi1.lrgj5r::'c::,::4 'Q::::w:..::::21.w::L:'::::::w,L::'.,. """" ,:::':u::g:::' gi::Q:::::L'::p1:x.p....1":..2::x..." "":'1:::n1'.A ". .::7.1r.7,:.::mwn I V ..g::- , ---' wx gy 'sim-.:r-rfEfm:::::,xr::EbE?5L:E7EE'.7E5-25?5W55:5'545::1c:T-37 :4?3'i3'7l3Y"-'Zim'if-1::'Um'UY45:' 'V-24?3fi'V53222:32E-IH'E."?IiE?i,'vIt.::1:..:m: : i?f'Z.5L!fWg :J . - -A:-5.1M ...- M..-...... ,...,, .,.:.2 "'1-:.::::..-rssxzzzg :::::':L.:.:......,. ....,. . ,... ,...... Y, .5 I m,r.....L.:m- . C2939 Q Q go 1916 cf 3535? For Sale Cheap 19iC3?IifLlll1YeEiDTx,11E.fllIE, Three shares of first-class stock in Patterson Hall for sale after June I5, I9I6. Pays large dividends. Must leave town is cause for selling. Very low price. See JIM MOORE, J. F. CORN, . E. T. PROCTOR. Miss Lillian Gaines AND IVIr. E. B. Webb In Their Original Sketch, entitled' "Why Girls Leave Pat Hall" Startling skit written by Dean Hamilton, and a sparkling interpre- ,A 7 ",, - V Q -I 1 ' tation by the clashing couple. TAXI LINE I FROM SIGIVIA NU HOUSE TO TI-IE UNIVERSITY PULLIAIVI BROTHERS nfffii rre 132 F9565 K I ible treachery, and re "INDESTRUCTO" PENCILS THE KIND PROFESSOR NOE CHEWS! GUARANTEED TWENTY YEARS Boss jim Moore MODERN POLITICS, or HOW TO GET AWAY WITH IT" Old Dorm, tragi t I f t Dean I'IamiIton's Matf1m0mal Plain cnini Rings Bureau Furnished FREE BY EATING AT Y Q U R PATTERSON HALL F L E S H . Rates by Week or .lSlizcll1l93llaction Guaranteed C "Art for Art's Salcel' BY R. A. FOSTER Illustrated with brilliant bits from all the erudite essays he has ever read, and colored with the opin- ions and extensive travels of the lecturer. Qi GILLIS'S SALVE ??'E'ELE Relieves all slights, overcharges, wounded feelings, and student disorders ---l-SAMPLE FRE1:l-- K A SURE CURE FOR INSOMNIA TWO TREATMENTS A WEEK GIVEN FREE CHAPEL EXERCISES COMPANY D I I 4 s I MISS FRANCES GEISEL A ' "' 'it'I'S5i"f'J5Q51' 6. ' I l' I I-Iow I Made Chl 37' 4 I What It Is Today" I ' 7 I I I "Shorty" has a classy line of talk, I catchy musical numbers, and all that I f it takes to make her sketch get across. me I rut ., . N hbqg I , 'ROUND THE WORLD IN TI-IIRTY MINUTES GREECE TO CALIFORNIA IN DOCTOR TERRELL'S GREEK CLASS .J r r .-4 -J ' --I fn., ffm , IVIELCHER'S COLD STORAGE OPEN EVERY TUESDAY MORNING GUARANTEED TO KEEP ANYTHING IN A PERFECT STATE OF EXASPERATION Prayers, Announcements, Scripture Readings and Talks Kept at a Low Temperature ' 1 I E 1 as f P :SX - ' ' I. YQ 5 I 'I , . I ' ,V . ' Alpha Gamma Della and Sigma 1- I, Cf1'Pf 'I T 'gl WHITWORTHMBLACKBURN I I I I tI" 7 I In Umon There Is ' ,II - T ' Qrli by p Strength F "'A ff t"' PY ve ' 5 77 LN X X e nte i A XX' K6 .. Q' 4-A :IT.I2f' several years before the - 'f n I State audlence. l 3 I Rooms I:OI' YOl1I'1g Maffied Couples QUIET NEIGHBORHOOD GOOD LOCATION Apply at K. 5. U. LIBRARY I MS A j SII. ,3fiif?,Qtgg4g Z A ! I S ffs X ff , 1 escnl fl, ' 4 A 1'-1. III KJ, 1" 'A ff 3 f' 4 ax r ,QL 4 xy 3 m A 'X A 14" I QB X . - I at 1, ff ' H IL V ,I-N xv? fl 1, P If ,, . if , pg x . 1, X XD I ff J ' 'fi Snap con rsatlon, cIassy A dancing, and wide adver- - y A 1 I I- ' I fe N 3-jj tlcement make thus act o f' , I be I It of the most ffective prese CI 'pr kthtk AGENCY FOR ALL KINDS OF FRAT JEWELRY H. GRAHAM will ZERFOSS AND PARK "BrotI1erIy Love in the Y. IVI. C. A." Sleight of hancI performance, using a silver cI I Iar, a Y. IVI. C. A.. handbook, and a Phi Delt SERVICE DAY AND NIGHT State University IVIess I-IaII Cafeteria SANITARY QUICK APPETIZING Learn To Be A Re orter ln P Sixty Days! By lVlcLauglilin,s Modern Method Miss Marie Louise Micliot ln a Modern Pantomime "Whyl left the Ranks of the Suffra-jestsn e ys e . e e e mmpubic. JUST oUTu TIGERTS New Logic Text Totally Different from all other Logics y requested by the audience, this gifted performer leads his well- trained company in an effective act. WANTED:-A Class Qflfice F. CORN and R. SMITH Candidates for Four Years That Merry Musical Monologue PARLIAMENTARY LAW IN Q i CLASS MEETINGS" 1 WITH R. E. Cullen 8: Co. Blowing his horn to an tune LATEST NOVELTIES IN MILLINERY and BOOTS FLANERY SISTERS Take a Course in 1cH F1NANcE EI Wall Street Methods Used Exclusively lil Thorough Instruction in Book Stuffing, Account Padding and General Alterations EI Let Us Fit You for a Higher Position El estimonials from s men , Zerfoss, Graham lil UNIVERSITY of KENTUCKY ATHLETIC CGIVIIVIITTEE T ,I ,-,X , .. I I ,I , . ,, 5 if 1ffl7T,15! H 7 ' Q19 'kenfuckian fi 582, N Q,--C i I if I I fl I X - 4, Q. 7 I, 2 ,I f 4 xx I x ,,, A 55? - X Q X X A ..... - k A-C N ., N z P i f g "' h ' Asa' x , Y I 4 I 'Getting the fJltIail" A TRAGEDY lN FIVE ACTS Scene, Patterson Hall. Time, The Present ACT I, 9:30 A.M.--"No, the mail isn't in yet." ACT 2, lI:30 A.M.-No one in the office. ACT 3, l2:3O P.M.-"Yes, I'll see if there is anything for you Continues writing checlcsl. ACT 4, l2:45 P.M.-Cwithout looking up., "ls your name on the list out there?" ACT 5, I P.M.-UI believe so. No, I am sorry. There isnt any mail for you to-day." CURTAIN A L. U. K. MILITARY SENTINEL. "Hz-Iltl Who goes there?" STRANGER: "A friend." SENTINEL: "Advance and give the countersign STRANGER: "CHEMISTRY." SENTINEL: "You can't Pass." OH, THOSE DAUGHTERSI DAD: "Did you tell that young man of yours that I'm going to switch off the l lights at ten? MARY: "Yes, Dad." , DAD: "Well, then?" MARY: "He said to thank you, and that he will wait until ten to call hereafter C5031 L A -- L , , Q C82 9 1916 as L Al 911'-1 K-'L 7: 2 f- 'WF . .5 f 'NX A ICN - L2 I xy qbfyf -ff ,g K, Q x ,fy ' WI' ff'II'I. - v ev A I I I Nygxeyw' I ' fl , Q' M IIIIII I IH - I ,LQ- I A I S li aug , HOUSE MEETING X IVIIIINIJ II- V, IIIIIIIIII Awww' I lu I IIIIIIIII N a IIII I ,,+., 5. f . M 3 I M I W ,,-..mbg' 'HI I 4', IIWN II HI X W IINN X I I4 fl X Eg-, , I - 'X Ii Q' Jeff I AS IT LOOKS TO THE TOWNSMEN 13041 . v I. K, ..- 'f.' "- 13' ,Q ffjyj if 5 ,P , , . 1-. -...r I f I A , v I 5 '-1'i-n.m.,.,.- . 141. m.,..-,..-.i.-.L-Z.. ,, . V C ff' fy' ,J A ' "fx 'gl if w fb ew m '5 ' V Q .v L 1 I M' 1 1 1 ,- MW- Q . v ! 3 x r , t 5-wgligw. S R r I Q I I Q I i I 5 A r S .1 .. 4 V' B-9--28-9, qw' .u'L,- - ' V Y at x K i E I 6- 4, A A 7 s C3051 , , -fy-"L ....1Q.,,QQ,g M M fiffib - Q1Tg4g1. .,..' 1., ?3,.Qg4,.t,J -fa U- if fn- Mum tn Make EI Snrreaa nf at Glnllegr Nrwapaprr BY J. FRANKLIN CORN I. Never neglect your paper for your studies. You can study at any time, but you can only work on a college newspaper while in college. 2. Praise the students frequently for their loyalty, industry, and high moral tone. 3. Roast the faculty upon every occasion. Leave the impression that they are only parasites on the student body and in general constitute a nuisance. 4. Always give pre--eminence to athletics. What space is left can be utilized for matters of less importance. . . 5. Pick at least five men from your football team as "All-American" material. 6. Use the following words and expressions frequently and plentifully: Our clear old Alma Mater, The Varsity, Our student body, Within these hallowed walls, Each and every student, These halls of learning, etc., etc. 7. Attribute all mistakes to the printer. Elinrgiur 155, Kip A fool there was and he paid his fare, Even as you and I, On a South Lime street car, standing there. We call it l- Cto tell you we do not darej, But the fool he thought it would get him somewhere, Even as you and I. i Uhr lingrammatiral Kin "Why do you go with jack?" asked Mayme, "You know he smokes and boozes." Thus Tessie spoke, the bold words came, "I goes with who I chooses." 43069 sf M,- - J 2 0' 3 ,j 5 -f' ff' ,f -.f ra N L , -log M f.,,. .. .. .f ,,f' W' .H . N4 ,,,.M,d,sf l A l l t 1 i l 3 1 l l . fb- r in A7 in an wTgF1f1WmTHe mu 8 , -Magi gm- Emxx igJfw111al 'f""" "f ""v1f!QQ,f b ' l """" ' gil, Y . . . .QM 1 QA 9 2 . . --Mi... '-L+?m51rff. f 1' X -- A jr' . W iffjy Q- 4, QV... ' fb ww ,. T- , al 1 595 '- -.....,. .. .,.... . -' " , ess: l T ,T If mln + 44 lggnullllllllll-SX" I--ulllllllly-gli, E Smal :V inmlm, 'WWC WN 430V KOZ 0 0 No m 0 - -V A ' RDEJ-x.----l9lB THE MINT .IULEP STAFF HAS THE ABOV ORDERS SOLICITED 13071 V E CUTS IN STOCK. ,Y I 'Vs .fv .fff fr! pw. -- , ,,-. f - ' , f, Q' 4' 91,1 if If . cosy 43 If TIE-3 5769 'Venfuckian iw' il I 3 Menu Hattrrann Hall 1515-1515 MONDAY Breakfast-FRIED APPLES, ONE SLICE BAcoN. ONE BISCUIT Lunch-GIBLETS, DUMPLINcs I JI I Dinner-ToIvIAToEs, ROAST BEEF I I TUESDAY ' BfCGkfG3l-HASH AND CAKES 1 Lunch-TOMATO SOUP. SALAD ' Dinner-CoIIN, STEAK CSQUARE lNCH,, CHocoLATE PIE I 1 P WEDNESDAY E15 I Breakfast-FRIED Eco, SLICED BACON, TOAST I x 3 LUNCh-MACARONI, CHEESE AND LETTUCE L V1 Dinner--PDRK CHoPs, SWEET PoTAToE ll I f I THURSDAY Breakfast-SLIcE BACON, MUFFIN Lunch-CDRNEREAD, GIzEENs. HARD BOILED Ecc Dinner-STEWED TOMATO, MASHED PoTAToEs, ROAST PORK FRIDAY BfCdkfG3l1SLlCE 'BACON, TOAST Lunch-OYsTEII STEW, SALAD, HoT CHocoLATE Dinner-CoRN, STEAK, CHOCOLATE PIE SATURDAY Breakfast-E.cc SANDWICH AT uBRlTT'Sn LUHCh-MACARONI, CHEESE AND LETTUCE Dinner--PEAs, PORK CHOPS, MASHED POTATOES SUNDAY Breakfast-QTI-IEY DoN'T EAT ITJ Dinner-CHICKEN, MAsHED POTATOES, ASPARAGUS, GRAVY, BEATEN BISCUITS, ICE CREAM 4 TC01CRACKERS, GJ, CHEEsE BALL, JAM C3095 E E 1916 ,QE J f""' J ' 1' , I I If I , W V W .iff fi? 1, QM! Ig, VIH, fr 4 SI Jf"7f lf . 4 1 - -. ., 1 .. ,....,....... I .u.,.. .,,,, . , ,, ..M. W. .,.,.,,. W., I K mb -H K ,,..,. . ....,,..,,.. .,.. ......... W . ,i K,,,. , I ni I 4 Y I W V WV lwylui .J MV' Abgg,1':.!.,eE.c1, '- - I ,i,A,I..1wL,.m:vffa,L4.Q:,M:,n'f.f4,1:-.,AI .... .-4"?MA-"f'I"' ' I .mg I I I , fi I I 1 I I l ivwwx V Shay, , t' '.' , I I I I , I . -4 f V .- 1 , 5 , I. .'- .. I .'dY13,g,d ,'i..QgM l - . I I , wp . j,I-1952 4595, " """" ' N: . . I H 4+ Q I f X Liff 1 A Vw 1 1? fffiLiEW'f-Lge: ' I , I V I fgvqwvlimlhzf' f ' " :A .we 1-24,-.A .ggi if itiiq .Wai I , WS IM IIQKJQQ I nf.,a+af,M ,Wgu ,cage Hu :wif ' . ggfjmui I: 9,,f.1pr31 ,ji W Y V 1Q:Q,Q,.:-'x53ag:, QISW, . jf'-Sify-'ff1'5?'ffQa H I VT I I iwfiwtf -, ul wf:':.s- ,. 'f ft- I ,f :I .ffxili galil' I ww J UQ, ija'afm,.',,,3g . I . I yy ,-W . I ,XQ,:.g:'- 5 I I 1 ,I I I ,II fi: M EH - I . f .I.I 4 ' . ' ., I I..,, R 9 2 I CIO? I I Q I I I I I I I 2 I 1 I I I 1 6 ..i1,,, IfE?Tf3T???5E? 7?iFQ" I 7, , I Q , 1 5 fn, 1 'ff 1 4l"4'l 1 nf.. 1 F Q 1 I 3 ' p I I 5 . I I 5 E3 uEVERYMAN,S PIPE ORGANH GOING HER ONE BETTER MRS. JONES fwho has arrived at the finish of a suffrage speechlz "Mrs. Raver I think your speech was wonderful. I can never tell you how much I enjoyed it." MRS. RAVER: "I am so glad you came up to speak to me. Your face was an inspiration to me during my whole address." HOW TO WRITE JOKES Never cast a joke away. File it for future use. You can then make it fit another season. For instance: WIFEY: HUBBY:. WIFEY: I-IUBBY: WIFEY: HUBBY: FALL Won't you put on your red Hannels, dear, just to please me?" "I'll he tickled to death." WINTER How do you like your red flannels this cold weather?" "Just tickled to death with them." SPRING What did the chauffeur say when you gave him your red flannels? "Oh, he was tickled to death." fam I R.. I la., f 71... ' '-.az-P WW W ,wnqqqwh E ? .f ' u g ? 1 nf v If f 1, Y - -Wa,-you-Q10-V AWAITINC FURTH ER DEVELOPMENTS Il . 1 , iff 1 r ni 1 f-1 .r , Q 'A . sys qx' 0 wx, u 4 1 4? Q o , ,K , V. 4, 'll 5' ' , 'A he 0 "' ' .. , A A 'lo Q, ao. ff ID 1 so 1 no 1 JI: 5. ', 41 -nv' 1 U an 1 011 3 n 1 -. B :V .I f, A rp wiv U. '1 l A XL' Us if - if K 1 L. oH, mfs THE cRANDEsT MAN! 63123 . 'P fi hi- .4 La 1: 97142 1554 nm f5gf 1 E I if lp QQ EM W., 4. , My xi A ,I ll-4.yP!ip-W ff" it E 2 ,' , ,:Q.'f vw" T' "Ek , .PI--S f , ' Q ' i nw? N 1 x Q 2 , 1 A a, . : A g g J 'fr an if T, if 13, , .I R F! 1 -' .J 'Cl 4 1 M: , I X :la , , N ii 1 5: if k 3 sv LW ' I-. , r. , N 5 1 94-.iq,.,p..Q wr., 'Lu QM., K 3 1 1 I--hltvtistityn 5 5 5 1 , 1 3 1 5 i ' 1 . i i 4 , J x 1 , 1 ,W 2 , . 'N 3 , 1 ' V Q 1 ' 4 1 R 4 w V P '. , , .Vi If -sg 4 A f M ef' Qu. SH VZ QQ a if 1 iii f' , 1 N3 U' 2 1 5 1 1 lt 14: F wji W igz 333 1 , sw fam iz? 235 551 Siif-W.--:...:f'-Q 1916 ' 5 E15 , lr ' lf I iillllllwl lllli l ll "l'll'lf1tnt1!flllfllllllll' is 1 . . as dl , lllll l lnl lij lyyr FARQUHAR: "What're ye standing up for, Felix?" "SLIM" FELIX ffrom back of room, : "I'm-I'm sitting clown, sir F SYMPATHETIC FRIEND: "What was your worst exam, Lelah?" LELAH: "Josie Lacer Hayes' geology!!!" DICTIONARY Spring Poetry-Tragedy put on by one bad actor. Love-Same with two in the cast: lots of unconscious comedy interspersed. Movies-Wonder of the age. Shows with women, but no conversation. Movie Heroine-The doll that gets kissed last. Movie Villain--The dude that stands in front of the saloon and winks at friend heroine. Movie Hero-The guy that does the kissing. THE BRIGHT STUDE ANSWERS PROF.: "Can character be read from the handwriting?" STUDE: "It all depends, sir, upon what is written." HEXS OUT AGAIN William Kitchen, the young son of W. N. King, has been dangerously ill with gastistic, but is out again and growing fat. He is a lively and attractive boy when well.-The Mountaineer flVIoreheadD. ' C3141 :"'i' tv' M' -, :iv f- -. ,- ,. ,-- N. ,. ,M ' .,. . i ,V VM -MM ,,,,1-aww W. Y A ,, ..r, M, gv--2,.,',,,,, . ,. .,., M,, if jedi iff 5--Q4..-M-1-,. -,,-.....,Q- U 12 L M f A- ' ' Q3I5J , Iawfffi. 4 ,. A -.Qf1l-MEQQ V 5 W I I w"'-+'M1""'1 J ' fn "fr ff"'?fjf"'Pi,'4 fv N ' J x J' VT' J' 1 Kwai Wie 'Kenra clcian i I i s ll 2 4, ti i 5, tlbnlg a Zliathvr E fDon't read this when about to write for another ' check., it. Only a father, with a tired face, 1 Coming home after the daily race, Bringing little of gold or fame l E To show how well he has played the game, l But glad in his heart that his own rejoice To see him come and to hear his voice. Only the father of a brood of four, One of ten million men or more, Plodding along in the daily strife, Bearing the whips and scorns of life, With never a cry of pain or hate For the sake of those who at home await. Only a father, not rich or proud, Merely one of the surging crowd, Toiling, striving from day to day, Bearing whatever may come his wayg Silent whenever the harsh condemn, And bearing it all for the love of them. Only a father, but he gives his all To smooth the way for his children small, Doing, with courage stern and grim, The deeds that his father did for him. This is the line for him l pen- Only a father, but the best of men. 1 I may a a f egg 9 1916 -,,, , ,...1...i-f ......i...xx i i l I I e Q 382 .J 1 :iiiiyau pf .4 ,.,-. ww - g 4 fi ff . . ii g Q . 5 WJ l 1 if A UT' N afxfii E1 ' 'g ,L'.V , , Wm , Wflw . 1 N21 1 , ' wuz' , , I ' at va f f .mix 1 fu , 4. f. , C3l7 P, ' 'V . Qbxl I.. 1 v M A C! ,, ,. , K -. Uhr Eternal Erama TRAGEDY IN ONE ACT The Place. . . . . .Room in "Senior Heaven" The Time. . . ........... ............ A ny evening THE PLAYERS . . . . .Editor Kentucky Kernel J. Franklin Corn .... ........... Bill Shinnick ...... ..... ' 'Squirrel Food." . . .Deep-dyed Villain R. A. Foster .... . ......... . Sitting-Combination of sleeping chamber and smoker, tastefully furnished with one chair and double decker. Sign over bed reads, HALLIGATOR, donated by W. U. Yeagyf' sign above mantel reads, "BAR UPSTAIRSI' One book in dilapidated condition on mantelg the other book has been torn up for cigarette lighters, and only the cover remains. At curtain Corn is discovered seated in the chair reading editorial in back number of Kentucky Kernel. Has a pleased expression on his face. CA knock is heard at the door. Corn rises leisurely and looks through peep-hole in door. Evidently satisfied with scrutiny.J Corn-Come in. flinter Shinnick, carrying clippings of "squirrel food." Has pleased expression on face. Has been reading clippings.j Shinnick-Franklin, I just came over to compliment you on your last editorial. Corn-Sit down, Bill, make yourself at homeg have a smoke fwith exaggerated indifferencel. I didn't think that editorial amounted to much. But, boy, you certainly slung some line "squirrel food" this week. Shinnick-fwith wavy motion of hand, indicating "a mere trifle.", It's not nearly as good as it would have been if I had more time. Corn-Bill, you know I believe that we have the best humorous column of any college newspaper in the country. ' Shinnick-Franklin, far be it from me to flatter anyone, but really I was just think- ing the same thing about your editorial column. Corn-Well, if I do say it myself, the paper as a whole is about the best I ever saw. Shinnick-Undoubtedly, and let me tell you what makes it so good. It's- fE.nter Foster, fresh from telephone tete-a-tete with his beloved. Singing in tenor, "Tm-la, tra-la." OISJ ir 3 J , ,Vuwirx A .7 ,-MI, Af n- sa Cya, - A 'M'-M-A0f.r.k,r!-N i VGQ 7fenfLzC!c.iall1 if Foster-Hello, Bill, glad to see you. i Corn-We were just talking about the debate this week. Bill thinks we'll win. l Foster-Why, there ain't any debate this week. Corn-Er, I meant the basketball game. Shinnick feagerlyl-Foster, going to see-her to-night? Foster-No, I'm going to stay in and study to-night. Shinnick fdisappointedl-Well, I'll have to be going. So long. fExits after furtively placing "squirrel food" clippings in his cuff., Corn fas S. exits,-Come back to-morrow night, Bill. Business: Foster goes to mirror and brushes hair carefully. Corn picks up paper again and sits. fl-leaves a deep sigh.J CURTAIN. ' 2 2 cl . l IMPRESSIONS f Wedding-S200 worth of flowers: one bride, either beautiful and popular or tal- it ented and accomplishedg shivery musicg one preacher, one sacrificial lamb. l l Proposal-The cause of it all. U 1 1 4 l i "Will you marry me?"-What he clidn't mean to say. fBut he did.j 5 5 . 5 Cook-What she doesn't mean to do. fBut she will., Q 2 Honeymoon-Why boys leave home. Armed Neutrality-The result of it all. ' ii 1 i TO A DAMSEL DANCING 2 You've got the looks, you've got the "pep"g Your cheeks the rose outbloom. But tell me true, can you massage The back porch with a broom? ' ? l 2 2 EDlTOR'S NOTE: Pictures of "Babe" Lawson, Waverly Briggs and Lee Smith are absent from the group of Strollers in "Father and the Boys" because they were "borrowed" l by admirers. H l all I if lx fr r l. l- . ii C3191 fi Q B '9 I 6 42Eg.QQg... i.,. .-.f':71E?55:54-77 . giff.-f5'gj23 :gf 'liiiemfu clcian Ghz Maman Hain' We sit Alone in the Student office. The rest of the staff and the visitors Have gone to dinner. We would like to smoke, but- Dr. Fink says, "The only thing to remove cigarette stains is am- putation," And Prexy has forbidden it. IA shameless breeze comes Gamboling wantonly through the open window, Bringing sad thoughts Of a sweetheartless spring that is coming. The Sigs are giving a dinner party, We suppose- Anyhow Bill Miller just went past With a girl ln a white coat, And, If we loolc out of the window, We can see other Sigs Conveying co-eds into their spacious domicile. Noble Sigsl The girls are glad of the diversion, in all prob- ability. We wish we had a girl A To take to dinner and walking. But alasl i We have none, and so, With a heart turned to wormwood within us We pretend we are a woman hater. -Miami Sludenl. Corrections: Fink should read, Pryor. Bill Miller should read, Herbert Graham. 13209 lik jii1T'M'fff,I1f9 'ir J 'rb..'r,. Q NMTHFKE! 70,3 THE NOCTURNAL WATCH L My W5 XJR v - 2 Sv k . Q4 AN ORDINARY TERM UBUSTEDH 43219 THE DREAM OF A Mass HALL BOARDER DOESN'T THIS SOUND FAMILIAR? The Umpty-Umph Fraternity entertained with a banquet last night, and the fol lowing clever and original toasts were given: "To Umpty-Umphf' "Why I Joined Umpty-Umphf' "Our Fraternity." "The Future of Umpty-Umphf' "Umpty-Umph Ideals." "Umpty-Umph Forever!" CAMPUS CHATTER BILL: "Is Wllie Lee Smith making any speed with his new girl?" PHIL: "Fat chance!" DICTIONARY Food-Stuff the boarders read about, but seldom see. Cabbage-The Irish watermelon. Sauer Kraut--Same, but pickled. Navy Bean-The staff of life. Kidney Bean-Same in a blushing conclition. Zip-Why boys go home. C3221 . 4, 1' 0 ,N-.. P, I' 1 Ll I f , A., ,I cg Q '3315 3 ghe 'kenfuckian A MWA l l Ahuire in they CD11-iEha Girls, be purel 1 l Behind each corner Satan waits To fast impale you on his skewer: Girls, be purel Girls, be purel When cruel man says, "Have a 'dope'," just tell the brute you'll never do'erg ' Girls, be purel Girls, be purel Don't ever wear a fellow's ping 'Twill almost always be a lure, Girls, be purel Girls, be purel - Whenever callers come your way, just set the door ajar, make sure. Girls, be purel Girls, be purel Old-fashioned men could trusted be, But not the generation newer. Girls, he purel Girls, be purel Don't mind if all men show disdain, Don't mind if dates are fewer. Girls, be purel , r 1 ' I l C3231 L A A - W G or A ry Q e e 9 1916 fs s 333 G J 3? 7 A Wmunmfgww W Wx ms 1,1 Wg . , , f 4 N xi X ' umizg 65557 Y yzgblf yi Q Aww AgWwvfff9QZZ lam 1 YQQ YXQWXMWWDE ww NWNX f lqflf mw bxhk f aww' f YM W I W A-, S I Alu Mini Q16 ff' 'iff WW H H 1 N W I NA X KWWL W, ,WW f GW? if p Wx Aff! M WW 5 I 7111457 gf? 'X X" ERKM wwf Wm JL- f ' 'N W e. 56 if X Mi 'Q' NE Qi!-bl f '51 ,S 33 , q, , . ZW 713' 'W' rfsi ' N W' ' irq' . w nl" 1 ,CJ ,gm liS?m',5lq:? X 1 I f. , ffl ,Qs N Q Mf 15 j,-' 'LM' M55 I ' . :K , f 1 fl .UF , , .fm...'-gymry " :Wy-" Nth di? , '-' w gx'X:. 1 ' ' mt.. V , 1 ' 1., ' , .0 ffgyvv I ly' ,Ex VM A Mmliilslx J if I , 'Q' ,W 43 I:-'F X 'lm MXN ny . Lf!! , '1f,,f Q .' F1 Mg' M 1 , x. A., , W f" . Mgr' ' ff ' I" ' ', ,fx ' 11, N 'RQ l, YQ ' f !3,5:,,, 5 H Z.. 1 ' ' 11'-,.5.5.,n -.gg f ' ' , U. . , ., x fx.. -X - ng' W I 'fwfr wif ymfz I ff ! Mitzi! 1-NA. film.. ' If Hwy . 7525 5 Wx .igivgrxm IN' .Q .xgiwvmx A 1' .---4.-. f f' f ' ...Avi ' 1 ' '65 ' XX- If ' Q?--: ' ' v X f rw' Iifff f ?r' "ff 1' NY - Nm" 4 FHQMHF-, ' - A' 1 Zfiffm' Q X ' fu 2Q'P'1.:-g,:,.M 1.1 .-H11 9 ' . N 1: NHS MQ' f ,1'Kfv1f" 'ff' , "MA . f :i1fE 'X W, X UA X ' 1 W 2 . f yw. If-1..lfg 51 it ggi xtxgwl 5' X! If .Ll .X . - QQ? K Pi-.g jf,krk,:r -'5-5kWg1.m.?wrgQgi,.fS I fy ZW?-23 X Q ' 14 I 23-Myra! ,y y!,,5,'-t I X My wif: , 5 f 'f 1. X X... . x V nm .' 91,21 Z ' Y LZ E X I-.7-,' ' ' ,Wrxfhgf 'fl 7' zf :"1N-qi "4fff-Milf. L ' ,' . W 'M ff 1 f Y? Mx' f 7,17 I -' 1' X QE., fx: Q1 N nfl! 4' If 11 f f f f f 1'-w 'H I liz, 'Q f 1 I 41 XICVM, fg 1' f I, f h ,iff wZgQ . N -mg f,,wf Q4 v' '- 954,j ' 1 ' " ,uf if v1,Q,,f'A, N. , . Q HDMI? - P21 51 148-pi .ig 1-n-g.3-- Q 'R F 1: .- , 4'- - V, ' A ff 4- ' - , A. Va: . ,-'1-535 NN Y Q"'+-, 4' I ffl 12,64 ,- iff.. L-.ikfigfg Q 'W rl f '11, ,-,jgjfisf-Hfffi.-L15 if-' lgutiiffi ' I ' .' ' Y H ,Q Th-4 f fE?2gT:f'R-3, .L-,L - , -- -' I.- , , Wh ' - ,f -35. -S5231 X Ljgld '-w,,L-ff:? '-"ffaggfpv .ggi ?Z2g3,- 1fEif?i , g 4 - uf 1 K Vfjfmlf. S5132 fi' v' . Q- 'wif :, ' xl. " M L - , IL 12'-iii C3241 . ',g. qfu Wu figkig? 5u79um"m!4v3?xw1 51 I iggggfv 1:rlHlllH:Ql1l!!Q!f5?f i gziahgx 4 i,,. :"l.' 'Ill .lulul , A JW.. ki 5-T':e........!!!s . .4 , , 'EUUW ni: ' In , N L J. 15?E 4 . W., VE 5 :ij Lf , ' all 2 '74 Y - A 'B 4 u, .Q ,gs 7 ill:-s-"' ' ' Q.. llllzt M' V lI lIINI!IIlllI """""'"""""""""""" ' "" "' "" 'llllIlllI LIIUEWHT n ll Ill., I Y H w .1 meuN ll Il I' A - n 1 I v.:: 4 'c' , IIIlI!.:-.1mzll,.l. w .::::':::::1-r.. 1 'Q 'Ein Isl fu' N rs .- 1 -' , 14,4 'za ,4 lp ' Illlllllthl. 5 , D .5'ul:v:u'::::l:u'::".f yllhk I 4, llllllllllllln Ihb 4 vnu! u lll ll' ,. 0 , lllllllllllllllllllllkl ,blah llllll llnl' , I :l'lll'll.n'H, C3251 gihggkn liqsiaatdamaisatafadsatsmmataizatgmatsaisat Uhr Elimvlighi Mau turnvh nn the aHnr while hr was speak- ing nn the nlh ntagv aixtg gram agn may 1 f77fWNWW ff 1 f f X 0' Z W Q49 W ! , X f W IMA AQ: H v E Q- E? f f J W W 4 2 fl QM A . 10 ' 05. mf .l ,A - if 7 Qffvf . l , ' f ' 0 f ' ' ZZZK X36 f f W f LS 0 E 9 .im .,,,. V,-,.,-,.,.-,.-.f ..,, neil! Q '1:5:I:ruff!Effiirfwfriigizffirfj Q D 4!QigEev6:':f,:f:rifg CS: i. ,1fuJ1.I:.:," JJ' I.: 4,112 ' , "' " YLFQIVA l6..? PROF. WALTER K. PATTERSON ELIZABETH ALEXANDER G. C. WILSON E. M. MCGUFFEY HERBERT GRAHAM W. H. DIX JAMES MCCONNELL "GMD iH1'P1JK,, 13281 JOE MAY W. C. MITCHELL E.. T. MCCLURE G. P. NEAGLE O. M. EDWARDS j. T. GoocH GILBERT SHOUSE QA sfklg 'H S 6 S 1 . 1 1 4 I W if LL 43 is il i? 5, 5m , 1 j . M YQ 5 6 Z ri' S2 is fi fi if 5: it 3! ga E 'E A M il L 1 , , 1 , M Q1x f f A L 4 FACULTY GYM CLASS THE. YELL LEADERS C3291 Yfxk if . , , ,.-...- - -"N -,. """"--A-A 'F Os f M, 3, 5- L,,.. ,L N. J My : k.,' -4 43303 ,M ,M N .. 5' V 31 Byfi- 5 x ff' 9 I' N fs..7u, ....... .-f'---' ww' f 1 -f . .. f ghjy Cf 'fynfrgrf x I - .-.lm , Y,-lu . ,,. FQ L X A I, 2' X W r f ,,, A - if 'ipfif a ml iff hi L9 Q f f! i ll E' 'l WWI, WH r 'L lx lsfll -'I'-fi. X MN I .r QQ, ggi.-ss, , is Q 1 H.Fe x ,,, PICTURE PUZZLE-HWHAT is sms SAYING?" The Mint Julep staff submitted this puzzle to Kentucky students, offering S50 in prizes. The following were the winning answers: First prize: Silly lights have just now winkedg Pat Hall parlor is the scene. l She cries: "Dearest, won't you leave? I think I hear the Dean!" Second prize: A Home Ee. Co-ed was named Flo, And in Leap Year she cornered her beau. "Besides scrubbing," she said, "I can cook and make bread. For you, dearest, I'm longing to sew!" GET THIS DEEP ONE FIRST Doc: "I have something to spring on you." SECOND Doc: "No, you don't. My hair is full of insect powder now." may H 1 57' lv 1 V s N n H 'R U l , L cma T "H 'r ' if ,Q if W .A.., ..1. ,.K. P ,, I C ',,...,- ,,,,,,,9 ji li! Q14 4.. -f1i1::. 1j. ".' 1QQ,fb-Mvvgg S . K , KK, VT" I , ,. 1 1 2 S K E I. Q E 5 1 1 .- 1 , .Q yi fi f '!l a 1 1 f ' 1 i . 1 ' Q 6 1 W Y l n , i 'Yhg Cnnncq ' Qqda L, ai vane-n!s'iovT A Annu. . ,. . fwWL'iq"l . 1 w . . 1. N V 1 i, 12,41 ., il Vx L ,J -1 's 4 S ,yrkr-Ati X v 1 . . . E N ' ' n Qcorexet' - ' ' A ,f E . ' 1 ' i L, i K 8335 , 2 , , I 2 . 1 ' 1 , - , 4 x ,v. .X y ' , . I-f' M--' ,g X. ,f --,,,r-1. --um " f I Fighting Svquah There are few persons in the University who remember the great H8111 of 16 versus '15 in the tower of the Gym, in September, 1912, and only a few remam who wIe1ded brg sticks against the Sophomores, seventy-five sirong, whu assaulted the dozen young d fenders. They were: G. R. SMITHA' E. M. MCGUFFEYM B. D. HowE j. S. MCMURTREY G. P. NEAGLE W. M. SALLEE ,'Retirec1 C3341 W. I. WEBB'5 HERBERT GRAHAM FRANKLIN CORN W. C. MITCHELL PHILIP SALLEEQ JOHN ADAMSM Is. . E Faesu ami: DOO? BT4.--L-U -- Dlrvo- fv-,-:- I -r. Iosrrmpgd- II w E 'N op! -7: I ,HI t Il 1 sri F312 IIE? --- Z'f""I""5 IN HHQ.-- - - - om-o-1-C - -Q 'KT Z ' Al! A I 5 II , Z I - f"" nb, AF B I Z "SHE'S comin " ', Wi, I 7 gf X I X IILQ v NSY' -- STILL VVRlTING--- --WRITING STILL - -- EQ ? Y num I, Q A Ii' TRIESONE CHHIR -"" ' ...Q -' -UI' 'F- I q It -- 1-new R sroon.. ' asm r INU ES LETER!! Es' O . I M II If f K f 1 ff Q - S it I R.Sm hx-'f6 v i Halma Rod-E-5 IIFEIIX-X6 L, 43353 ff' 'QS N1 Qi i 1 5 i I Ii I A 7'f' U K l X' care - '. Q 4 + S f 5 we i, C336J ': e U Flax fffx rn N H ,..,, ,, N z- -, ' vgrx, - gf ' - fyff h 5.-IlIi'lII!!., A ' with-55 2 . . A1i-1-- f1"g.AgV L' .,., A 2 2-'f,,,-1:?:.zi-'1-"2 qi. 4,411 .. 5 A ,Y.f'f:"f-MAA,,.'I5:,,-fbi, ,J-Y?-' - N I I 4. R 1 '1 W I -w ggi,- T19 759 75912 fu Ckian V If sw j 'fff ' fi 9 W Ty ! fu ff X f WV I! J , Q, 1 3 ya W f W W W A'n0cK YSHOPH TERM. ! Ar n' A GRIPPING Tifalspe--'gnal C3375 Q jgzgfw' go 1916 N u I V . I l W E? iw-.1 1 WM: -- Y 4,.M .,..lv....,..--..... .,1 -,. . ,... - .. ff' l 2. an QFQCAW nn I SEPTEMBER 30-Juniors elect officers. Miss McLaughIin's I3-Monday. Registration. I4-Ditto. CRAFT thrives at University Book Store. I5-Y. W. C. A. Tea. Class work begun. First chapel. I6-First issue eight-page Kentucky Kernel. I7-Y. W.-Y. M. party. Phoenix dance. I8-"Morning after." I9-E.. T. BI Moore open season at Pall I-IaII. Miss McLaughlin entertains journalism stu- dance. OCTOBER I--Friday. Football rally. First "K" dance. 2-State, 33g Butler, 0. Y. W. C. A. recep- tion for new students. 3-SHE took you to church. 4-Trois begin-empty classrooms. "Bill" Shin- nick and james McConnell "eIected." 5--Ags attend trois en masse. 6-Seniors elect officers? P P ? ? P? 7-More greenness showing every day. Idents. 20-H, Graham gets a "K" 8-Football rally. Sophs elect ofhcera. 2I-22-23-The new wearing off. 9-Eariham, I31 State, 54. Whole Freshman 24-Rally in chapel and three cheer leaders team. chosen. I0-Part Hall pe-rades. Sophs relieve Freshies of "capituIary" adorn- ll-Freshies elect, ment. I2-I3-Dull. 25--"Daddy LOHZICSS-H I4-Parade to see the team off to Mississippi 26-Sophs continue good work. I5-Freshmen win tug-of-war. 27-Senior meeting. Billy Wallace arrives. I6-Miggiggippi' l25 Stale' 0, Hear did ig, 28-Four Sophs hned for HAIR-CUTTING. I7-Church. Xcitement. I8 29-Mass meeting of students. Why? -Half Senior class protest former electionl II Women's Pan-I-Ieilenic banquet. IDE L Service VIA VIA TO ASHEVILLE JACKSONVILLE ATLANTA KNOXVILLE BIRMINGHAM MAGON CHARLESTON MOBILE CHATTANOOGA NEW ORLEANS CHICAGO SI-IREVEPORT COLUMBIA VICKSBURG INDIANAPOLIS TRAVEL VIA QUEEN 8: CRESCENT ROUTE. THE EQUIPMENT SERVICE AND SCENERY ARE UNSURPASSED For full information, apply to nearest Ticket Agent or write H. C. KING, PASSENGER AND TICKET AGENT lOl East Main Street Phone 49 LEXINGTON, KY. I I II V II II Il If II II HI I,,I.I 93 I. K I, Ii I III II I' I I EI I, I I II 'I I I I I I I II I. II ,WI II II II II II II EI II .I TI II II EI Ii III Il- IIN I 1. I I .I I I I I I II JI I 'H' Tj "'.j Q25 III -"T 'T' ' f N I9 f ,- -20-Nothing doing. 21-J. Franklin Corn calls at Patt Hall. 22-Football rally in chapel. Bonfire on Stoll Field. ' 23-State ties up with Sewanee. 24-Y. M. and Y. W. 25 I i i 1 F l l Y I I i l l ll I, -Old girls of THE department entertain new girls of THE department with tea. 26-President Canfield of Centre College in chapel. 27-28-SCHOOL. 29-Tau Beta Pi's tap in chapel. 30-Two hundred come over from Cinci to see ' State put one over, 27-6. Hallowe'en i dance. 3l-Services at all churches. Q NOVEMBER l I-Monday. Blue Monday. ' 2-Dr. Porter of First Baptist Church in chapel. t 5 3 Q 4 I 5 5 I I I -Ralph anl Lila attend Ada Meade. - -First meeting of Kentuulfian staff. -Football rally for Louisville game. Are you going? Amateur night. 6-Five hundred students go to Falls City to help fupjhold the banner. 7-Make anything? 8-Herbert Felix wears Senior corduroys. 9-H. D. takes fair co-ed to Ben Ali. I0-Team practices behind closed gates. l I- l2-Some more. Xcitement growing. I3-Wildcats DO Purdue. What did you say? PERADE.. -Rejoicing. -Maude Adams in "Little Minister." l6-George W. speaks to everybody-most po- litely. -George W. scen, paper in hand. Nuf ced. i8-Jes rain. -T. U. wins K. I. A. A. championship from Georgetown. -Cadet hop. Zl-joint Y. M.-Y. W. meeting at Patt Hall. -Alpha Gamma Delta tea for Pan-Hellenic. -Turkey with homefolks or see State win. which? I , . 5 I l Y 1 1 5 t ! l J 1 S 1 I l l J The Young Menis Clothes Shop LEXINC-TON'S BIGGER AND BETTER MEN's STORE Hart Schafliner 8: Marx AND OTHER HIGH-GRADE CLOTHES Dunlap and Stetson Hats ALWAYS NEWEST STYLES IN FURNISHINGS FEATURING YOUNG MEN'S THINGS Kaufman Clothing Company tklifflf'-lima-S 'f2?'ef-L'fT'i'-3 IQ! fr 24-Rally. Old Grads back. "A Democratic Mother." Phoenix dance. 25-Food, football, etc. "Doc" stars. 26-A. T. O. Conclave dance. 27-Two more days. I0-Student welfare in chapel. ll-Glooml Rain, sleet, snow, hail, etc. I2-Are they married? I3-Deans grant petition for early holiday. Bless their hearts. ,i '1 .J ll! ll? ll 2 2 L4 I Z I. 7:2 i t 28-Hgzgli l1l:,:mfiv:orLlE" men on All-Kentucky. I4-Chapel. . 29 W. . i . I5-Eight more shopping days till Xmas. QI, ... inter arrives, accompanied by snow. H b f fy 30-Furs and earmugs in order. I6-Lai edition of Kenluclfy Kernel e ore mas. DECEMBER l7-Much hasty shopping. Pan-Hellenic dance. 1 . l-Wednesday. Basketball practice begins. IB-Evcryolfe' guns om' h V 2-Wait: I can-I walk so fan. I9-Ceel aint it grand to be omel I 3-"Fats" Thompson elected Captain next year's 20'2I'23"PerfecI blm' Wildcats. 24-"It was the night before Christmas." 3 4-Few "do Xmas shopping early." 25-Xmas gift! A 5-Just fight IOP 8 walk. 26-Everybody likes to go to church at home. S p 6-NO' 50 blue 27-28-29-30-Eats, sleep, dances, parties, and a f L With prospects of a holiday in view. rousing good time all round. l 7-Lieut. Underwood and cadets go to Frank- -il,---Off with the old"-, 3 fort to inaugurate! the Hon. MA. O." I 8-Back to work. 9-Basketball practice progresses under "Tur- JANUARY key" and "Squirrelly-H I-Saturday. "On with the new"- l ii l I ' V I , K k T ' T ' l li ll I entuc y radtion 8: ermlna .g il 2 Company , FAST INTERURBAN PASSENGER SERVICE BETWEEN I ll , , LEXINGTON, VERSAILLES X 1 I FRANKFORT, PARIS I GEORGETOWN, NICHOLASVILLE. , I ' l 1 l il SPECIAL CAR SERVICE ARRANGED ON APPLICATION ll 5 l FOR EXCURSION PARTIES ll ll, City and lnterurban Cars Pass University of Kentucky fl For further information apply to il HENRY BUSH 1 SUPERINTENDENT OF TRANSPORTATION I R -buff--sk iff,-' U 4. -Ay-WMWWKWKA 4-A-'MM--AM H I 1 J gi - M7 iaav I 45, be a's'j 'Q i 2--"Easier to say than do." Resolutions are cheap, But Hard to keep. 3-Cheer upt The worst is yet to come! 4-School opens at 8 A.M. with full chorus of roosters crowing. 5-Rubes and Home Ecs in full possession 6-Kentucky Kernel. 7-Six inches of the beautiful to plow through. 8--Some very enthusiastic ones give up the Ben Ali for B. B. practice. 9-Y. W. and Y. M. I0-Another blue un. ll--Ben Ali fire. 12-Staff and Crown tea for Junior girls. 3-School keeps. I4--39-24 at Cinci. We did, of course I5-No Logic! l l I6-Sleep or Sunday School? I7-Classes meet in all departments. I8-Here's where we put one over the Tigers. I9-Lieut. Gullion here for short visit. 20-Co-eds drop game to Wesleyanitcs. Stroller tea. -No chapel. Uninterrupted strolling. 22-Cadet hop. 23-To cram or to trust to luck? That's the 21 question. 24-29-HELP! It 30-Jubilation. 3l-Registration. State gives Georgetown an other dose. FEBRUARY l-Tuesday. "You made 'D' on your exam." 2-Did he see it or not? 3-He did. 4-Vandy shows Wildcats how it's done. "K" dance. 5-Vandy gives State a second lesson in tossing. Co-eds lose overtime game to Louisville. 6-The weatherman frowns. 7-Yes, it's just been one week. 8-Laymen at chapel. 9-Rebecca Smigr elected Prophetess. l0-The usual Squirrel Food. to the West Direct Service Double Daily Service to Louisville, St. Louis AND ALL POINTS IN THE WEST AND SOUTHWEST PULLMAN SLEEPING CARS-DINING CARS l souryq .-,o 4 'tr avr-v 1-444 ui -Z- Q' Sa nts TNT- SOUTI-IERN RAILWAY For complete information, communicate with any agent or address F. N. WESTERMAN B. H. Toon H. C. KING Asst. Cen. Pass. Agt. Dist. Pass. Agt. City Ticket Agent St. Louis, Mo. Louisville, Ky. Lexington, Ky. -English Club organizes. -Cardinals snatch Ky. championship from Wildcats-MAYBE. -Marie and E. T. return to Paris. -Did you get yours? -Wildcats have walk-o':cr at Danville. I 7- I 8-DULL. -State outplays Cinci. -The usual services-Franklin and Elsie go walking. -"Bored to death." -Hurray for George! Wildcats tie champion- ship with Louisville. -"State" defeated by Tennessee. -"Every dog has his day." So do poets in Ky. Kernel. -Y. W. C. A. Iassies jubilate in chapel. -Maryville goes down before teamwork of Wildcats. -Joint Y. W. and Y. M. meeting. "jim" Park leaves for Texas. -See last Monday. -Wildcats, 38: Centre, I5. Tabbics, I3g Wesleyan, IO. 'S MARCH I-Lilce a lion. 2-Still a lion. 3-Only living woman Senator in chapel. Ad- ' 4 mission free. Everybody come. Mari etta, 27g State, 22. 4-Marietta repeats. 5-Chronic couples stroll. 6-Classes in all departments. 7-Old-time chapel. Clapping and yells- Is, Where's Melcher? 8-9-Some windl I0-Y. W. C. A. in chapel. II-"Nemo" takes UD to picture show. I2-Y. W. C. A. election of officers. I3-"Big" and Clara go walking. I4-Typical March. I5-Patt Hall sees Arliss from Roast. I6-Winter blows in for a visit. I7-Sandy in chapel. "My dear friends-" IS-Work on Annual proceeds. I9-Patt Hall and Co. stroll. hoenix otel SPECIAL PRICES FOR DINNER PARTIES BANQUETS ETC. FOR STUDENTS C. D. CALLOWAY 8: COMPANY SPORTING coops HEADQUARTERS Bicycles, Motor Cycles, Pennants and Posters. Complete line of Athletic Goods. Eastman Kodalcs I46-I48 West Main Street LEXINGTON, KENTUCKY LET Us MAKE YOUR FRATERNITY PIN This is one of our specialties -Fralerflal and Emblem jewelry. Experienced workman, mod- ern tools and appliances, honest quality, good weight, handsome appearance, clear cut, dis- tinct Iettera and fine .Finish has given us a peer- less position In this line of work. A TRIAL WILL CONVINCE MILLER JEWELRY CO. Greenwood Bldg., Sixth and Vine Street CINCINNATI. OHIO WE MAKE A Flowers SPECIALTY or I-Iigh-Grade CUT FLOWERS FOR ALI.. OCCASIONS Try us for your next Corsage Boquet or Box of Cut Flowers We Guarantee Satisfaction KELLER, Florist 236 W. Main Street Phone 354 E. A. BLACKBURN, College Representative J, 2 .K N ,.. 1 fe ff ., ., I f ,mv rx., ,,w,,,,,, .,,,.,.. ,.,,. 4 W, , . If ,,., ' ' "'TNoe gg,11-g.1j,,Q3-Eif, I I I I I I I I 4 Q QMQ 'Zfenm C!CfCZl1 ffiiiif 'A A l l 20-Political meeting in chapel. Seniors meet in chapel. 2l-Juniors try their hand at running chapel. 22-Old Main sways in the breezes. l 23-Editor of Kernel springs his Spring edi- i torial. la 24-25-Salvation for the illiterate! Prof. Crois- 'B' sant. 26-27--We are praying for a change. E 28-"Remember Raymond Robins." 29-Everybody goes to the Tobacco Warehouse 4 -to the Style Show. 30-"Squirrel Food" pulls an ancient one! Not l that it's unusual. l 3l-"Chief" in chapel. A sample of what he W gives the Techs. 1 2 APRIL l ij l-Who got you? W' 2-Margaret lngel's view on marriage and men 1 in general published in Leader. 6.- 7- "Firecracker" tells ignorant "studes" a little about the Bible. Bart walks to class with This week O. K., but next week. BE- WAREI Men. take notice. Strollers announce in chapel that "Father and the Boys" will be presented soon. King Winter again. 9-Many Seniors clanclestinely hunt the "mys- terious man." Those class dues must be paid, and, besides, SHE likes to go to the movies. I I0-Corn tells Harrodsburg High School students why they should go to State. We won- der what reason he gave. ll-That feeling is coming. I2-It is here. l3-At last they have happened-the girls' issue of the Kernel and "Father and the Boys." -Patt Hall tragedyl Thrilling incident at the dormitory. Miss Heller attempts sui- 3-'nDulChn l7U5Y receiving notes of 9YmP5ll"Y cide after "Father and the Boys." Friends 3 and C0nCl0lCnC0- rush to her aid. It is hoped she will live. 1 Y Y i Y 'A Y vvfli il Y S A F f W A A l s l V Qt This Space is Reserved for . S, l 254 l 4" C F B 5 C ' S 0 o on i x! 1 la' , H - ln Appreciation of las 32, Courtesies l, i ii 9 All ' v v ls: ul -A 4 ' 4 Y -' Y ' ' ' ' lv 6222-ff-' 2. , s - , . . Kiegijjgrs,-,.-g28E1...,3gg..g..3 1916 l f 1: fj7'ff'E1 ef 'Zia Editor-in-Chief of Kentuclgian "balls out" staff. Domestic worries. . "Mysterious Ten" and their wrangles. "K" sweaters hurt the eyes with their new- ness. K. A. meeting at cannon. R. B. Taylor hauls his machine out of the shop. Even at the present price S50 will buy some gasolene. Plenty of last weelc's Kernels left. fThe men are afraid to read them., Empty classrooms - everybody teaching. Wildcats lose game to Winter and Ohio. 22-Ohio takes another game-still cold. Sophs foxtrot with honored few. 23-Every 'little chicken wears flowers. -Terrell shows how Shaxpere is related to Greeks. -Roy and Hazel attend chapel. -Hamilton Holt brings message of piece. ---- hoclc their watches. .f'??!t'f.t'C1tiif1icflM' af-ggjfiiif 1 ggi??'fi"? 28-Flowers, taxis and "open-faced" clothes. 29-Track meet with Georgetown. 30-All Seniors go to church. Next week will be other things to do. MAY I-Monday. Mad rush to finish theses. 2-The faculty as others see them. there 3-Judith and Angus have mid-week confab at library. 4--lohn Marsh with another Spring editorial. 5-Tap Day. Lamp and Cross, Staff and Crown. Did you picl: the winners? 6-Seniors do term's work in a day. 7-Studying like -. S-Senior exams begin. 9-Twice in the same place. l0-Thelworst is not yet. ll-Once more. l2-Killed himl l tt I3-I4-I5-l6-l7-I8-l9-Rest to avoid nervous collapse. The LEXINGTON COLLEGE - OF MUSIC fElevenlh Year of the Organization? LaxiNc'roN, KENTUCKY MISS ANNA CHANDLER GOFF Director and Business Manager Complete courses in Pianoforte, Pipe Organ, Voice, Violin, other string instruments, brass instruments, theoretical music, Public School Music, Dramatic Art, Portrait Painting. Teachers' Training Course, Pianoforte Nor- mal Department, Artist and Student Recital Advantages DIPLOMAS GRANTED HOME DEPARTMENT FOR STUDENTS Very strong corps of teachers. Each one an artist in his or her line. Exceptional advan- tages at moderate prices. Fall Term Begins September the Eleventh Write for Year Book T 1916 6514. .,. L.ggg.gg'l.3'eZ?fQl1.g..3jg I if f . --------0----.. tif ltr 'Ii .T 1.5 Ii: ll 5 I i I a l 3 uf , I ,Y ti 1: Qi KNX xt I lx? l u I I l 1 3 I l I 2 E l A , Q. l. ,, ...LEA-'-C ' . W I I t il l l :la 'li l lr ,l k ts' I I' lt T -A gh Q 76,9 VI fu Ck ia re THE STUDE T 'LI E S , .C Q THE ONLY THROUGH SERVICE TO AND FROM THE EAST WITH THROUGH DINING CARS I LIGHTED AND COOLED WITH ELECTRICITY Two Soup VESTIBULED TRAINS DAILY EACH WAY BETWEEN LEXINGTON AND ALL EASTERN POINTS The only line from Lexington to New York without change of cars, arriving in New York City at the Pennsylvania Depot, 7th Ave. and 32ncl St. SHORTEST LINE BETWEEN LEXINGTON AND LOUISVILLE CINCINNATI AND'CHICAGO All Through Tickets Permit Stopover at White Sulphur, W. Va., and Hot Springs, Va. ONLY STEEL SLEEPERS USED ON THIS LINE City Ticket Oflice in Phoenix Hotel Block, Adjacent to Union Depot JOHN D. POTTS, General Passenger Agent, Richmond, Va. A. L. ELLETT, Assistant General Passenger Agent, Cincinnati, O. JOHN KURVY, Ticket Agent, New York, N. Y. WM. M. YENT, District Passenger Agent, Lexington Ky. A. MITCHELL, JR., General Agent, Lexington, Ky. 1916 Y x BIRD'S-EYE VIEW OF THE. UNIVERSITY niversity of entucky Lexington, Kentucky I865-I878-I9I6 ORGANIZATION: COLLEGE OF ARTS AND SCIENCE COLLEGE OF AGRICULTURE I COLLEGE OF CIVIL ENGINEERING COLLEGE OF MECHANICAL AND ELECTRICAL ENGINEERING COLLEGE OF MINES AND METALLURGY COLLEGE or LAW 'sfo ADDITIONAL GENERAL DEPARTMENTS: PHYSICAL EDUCATION FOR MEN PHYSICAL EDUCATION FOR WOMEN MILITARY SCIENCE GRADUATE SCHOOL For Further Information Address Henry S. Barker, President Lexington, Kentucky fi , i , 3 f- if ' ,J J ' , -- if 'Q' icfiifl' 153' ig YEL! Cifii--1' fi 'iif'A'i'M" Hsu, .t'i,t:ii5lF5lil" H3 3 'gi on 1 z...O.0OlGQ00CG.Q09O0::zz::g11i?Q9?0LU UWGGGWQGGGOGGQQGGQOQQbiafii00445505121 3 E 2 55Q:55'EEE'E5E5E':5E::::::::::::::::::::::::::-.:: ---'---5. .5EEEEEEiiiEiiiiliiiiisiinlnuiiiiiliiiiilu'E::555555555g Q :QOOO '00GOOOOOOQQOOQOCQQWUWUWQ 009600000001696190-0090004109960S 9 4 3333- 4 0 EEEEEEEEE ' 0 EEE! 4 ' ::::::::: ' 0 :::m::: at u QQ Q ::::::::2 ' Hill!!! O 4 ::::::::: o ' :'.:'.:::: o . , ::::::::: 0 ' :::::::: o Q ::::::::: 0 ' 2:-1:22 4 V re NCC Commands l'X'l'lOl'X 0 212222222 ' Q nnnanu O nnnnn 0 Q E552-E555 Q 2 ::::::::: o 0 :::::::: , , ::::::::: o . nu-nn lnunn 4 , 55555555 0 G ::::::::: Q 4 :::::::: I EEEEEEEEE o ::::::::: --::::::: EEEEEEE5 OOK back over the past years and ask yourself' what other 555555555 2 5 Engraving lnstitution, specializing in college annuals, has 2 2 I 5 wielded so wide an Influence over the College Annual Field? 5 S 0 :-':::::: , , ::::::::: ' siitsassa ' Ask ourself' if-' Colle e and Universtt Annuals are not better to' 3 555555555 5 . "" """' . y g y O lllllllll 0 2 day because of' BUREAU PROGRESSIVENESS and BUREAU S 3 X lNrriAT1vE2 5 5 0 EEEEEEi" 0 . ::::::::: You know that the BUREAU OF ENGRAVING, Inc. inaugf 555555555 I 2 urated the system of Closer Cofoperation with college annual 555555555 2 E I boards in planning and constructing books from cover to cover. 2 :E:EE5EEE ' , . . 1' ::::EE::: I I Our marked progress in this field commands attention. Our 2 5555555555 i f establishment is one of' the largest of' its kind in this country. E 1 5 Q Our Modern Art Department of' noted Commercial Art Experts g f 3 I is developing Artistic Features that are making "Bureau" Annuals 0 555555555 ' Famous for Originality and Beauty. Q ::::.:::: o 0 ::::::::: O 0 EIIIIIIII Q 222252222 V . . ' -5:35355 E Q And again, the help of our experienced College Annual Depart- : E z Q ment is of' invaluable aid. Our upftofthefminute system, which we E 2 3 E give you, and our lnstructive Books will surely lighten your Burden. 5 S 2 A proposition from the Natural Leaders in the College Annual E 4 EEEEEEEEE Q Engraving field from an organization of' over 150 people, founded ' EEEEEEEEE 0 0 ::::::::: o ' - . 2 ::::::::: v 3 over I7 years ago, and enyoytng the Confidence and Good Will 5 552555555 2 3 of' the foremost Universities of this country, is certainly worth 5 2 tssasaasssg your while. g 5 0 EEEEEEEEE . , 0 ::E:::::: 2 2 ls not the BUREAU OF ENGRAVING, lnc., Deserving of' 1, 3 E the Opportunity of' showing what it can do for 4 YOU? 2 5 , ::::::::: , at ::::::::: 5, ' 555555555 0 0 EEEEEEEEE 6 Zssaasssssg BUREAU of ENCIRAVHXIG, lNC. 3555555553 Q ::::::::: 0 IIIHEEI Q ::::::::: 0 0 EEiEEi::5 55555 MINNEAPOLIS 5 MINNESOTA 55555 ' .voooooooo-uname aoooouooooooooo 064-6060 ooooooooo-o-9-so a 490 oo 0 '99 2 z 55555555555555555Eiii555555E55555E!555i555i5""'::::""'""""':':"""":""mm '53:55i5i55i555555555E555555555i555i5555E55!5'5555 o 0 HIIIIIIIIIIEIISIIII!!!IIIIIIIIIIIIIIIIIIIII 'T Z! - , fy ' ' f' 355,555.3 ngggggg, ggggg g 5 gE,5l,! I ta zsseasssasssstssassaasasassassssasssssssssssa.......... ... . .. ... ... .ssssaassssssasssaasassatssasiaitiiatatia tp. 3 . nunuq- nnunnuuuunuun nnununnun unuuunnun 3'-u nnunnunnluuuunn an uunnnuu- u-nn-n-nn-uuuu unnnuuuunuununn nunuunnu-uuuun uuuuu 1 -.-..-..------ n nunlv- 1-' 'I QGOOOOOOOOQOOQOOOQO0000100004OOQQQOQQQQQOWOOOQOOOOQOQGODODQOGQOQGQQQQQQW, lp 1A?1iJi. .... 5 ,,,,,, ,,,,5,. 5.... ,..-. f ig I ,5v, hug,-M,-,,,,,,. MQ-5,,.,..,. , -..-...5wf.f-C15 "'.,.'---.,t:::::'-W-13 A X 5 5 QZLZ-l:::::fiX:iLi,,1,i:,E 1 J l '.. 5. ni F RANZ JOSEPH SPENGLER QUALITY PHOTQGRAPHER Proprietor of Spenglefs Art Galleries 31 I West Main Street T Phone 1092-Y I 45 C, , X-, Recognized Leading I Photographer of W Central Ken- fls tucky Our Record ls Clean Our Prices Arc Right Our Worlg ls the Best Seven Prizes, Gold Medals, Bronzes A and Diplomas for Superior Work 85 PER CENT OF THE STUDENT WORK OF LEXINGTON DONE IN LAST SIXTEEN YEARS "'.?"' ' J" fi in Jw' .5 'tilt aff if tuclent upplies Kodaks : Books : Stationery College Jewelry : Pennants and Banners : Fountain Pens 0 v I , A ,J 4 "" ' W .-as ,-in-Q li IM, g mt 'Q ALL THE WANTS OF A COLLEGE MAN CAN BE HAD AT UNIVERSITY BOOK STORE 233 West Short Street J. F. BATTAILE., '08, MANAGER "THE COLLEGE STORE Fon COLLEGE PEOPLE --Q T 'T "--N- .1 , 1llNNHHNNWIHNIHU!HHNN5VWWWNHUNl1HVWHW1UW1l1HNH!NHHHWHHIHNH!HHi'1RHMHHHSHHUHHH'3HNN12NNNNNHNNHHHNNr?NHHMHMHNHENHHNHNHHHNNPHNHHHWiHUll!Hl'iHHHHNVHNHNHNNNNENNNNNP'NNHI3HNNHNHHHNNNi3NNNN12NNHHHNNHNHNiilNNNIfNNNNV!NNHIfHNHJNHNNHNNNN!ENNNWNHiNHNKNNNHHHNNHNHNiiiNHNHNHWWHFHHl!lHlHMH HHN WH V 4 ALWAYS LOOK TOTHIS STORE fd' FOR THE -'NEW THINGS." AND WE'VE NEVER DISAPPOINTED ' l 2' THEM CH' AEOOE Y "Smart" O? Clothmg -fs' pt Hats 3 5 f j Shoes and 1 xx - . . Qwfif' Y Furn1sh1ngs EVERY ARTICLE OF MERCHANDISE WITH THE GRAVE5, COX QUALITY LABEL GRAVES, COX 8: CO, YOUNG IVIEN'S OUTFITTERS WNNPNI!NNNNIllNNNUNNNNNHNNNNHNNNNElWNNHUNNIHNNKIUNNNWNWVIHWNUNNNNNIl'iWNNNNiINNNNHNWNNWNNNN11NNNN1INNNNHNNNHNNNNNENNNNPilNNNNI1NNNIHWNNN51WWNNUNNNNUWWWWHNNNW1J!HHdWH5lHHifHH!.flllllflllliilllliuWNHNNNNHNNNHNNNNH1NNNNHINNNHNNNNKHNNNMNNNNHNNNNHNNNIHNNNNIHNNNFHNNIHNNNIHNNNNHNHHHNHIHWIHWIHNHIMNVHHNNIHNNNHHNNHHNNHHHHJHHIJEHHJHWH -n ,ff-v-.A .1 ,ff- '. x,:.- A M,-" " If N , -..,.,-, , . , ff- -, , .. 76,912 fu ckiam N N . ' v tg. '1' 1. . -vit , .- 1.f,',r :,,f I., I. ...., , I ,, IIII.I . 4 W 4 ,I' I w-I, I, ,Q 4 ... ,, ,- .Iii , .. ..pgI 3- . u RI f fb' E1 ,' J ,,II . I ., Booklets Catalogs Programs xv ' ENSO PRINTING co. THIS BOOK IS A SAMPLE OF OUR WORK THE HOUSE. OF BENSON is a printing plant specially equipped -a complete organization artists cle signers and workmen-whose thought and inspiration is concentrated in the production of college annuals and school literature. Each year annuals are printed for such institutions as N ASHVI LLE. College E N N. Annual Experts I X .- JK :I XIITILA' 'fyliw-A 'Xxx , IWW: xi I IIIWIIIII, ,- f. Limit' H 1 ' ifvplllfi . ,ft ',g.f"v1Q:' 1QAQ:jfi11'i..:Ig . f 5 1, it I ,gift 'USZH 5' g 1 ,, SI- ,g,,gfxIIg,.I,flfgQI,,, ,I .lf 5 ' l . ,fffipwwfitf . - A: . ,:' fr, , 'kj , '. 41 to ff 1 I b ji 1 ' 1" fs: H' . " rv. 1, 21 fggi.tyf3w . 3 X j . Nl it u ll ffl E s' J X X K KT E 3 1 . . - ' 1 H - - - - , I 4 I I 1 s I I LR JAIII , II. II, ill Wit A M I 15: 1 1 1 a n f QI " ' L lib IuIi1Iil l I ,Iam I1 r Fil' WE M, Wil , ft 4 V if ' , V.f'1n-A 'IJ I . t 5.5, .ll it ,I Vanderbilt, Tulane, Alabama, Sewa- .. I ' . . l"74 '. ,if - 'E -.yt lii nee, Cumberland, Trinity College, We f'.fiefagIgIlIQQQ ' ti :Lt - 1 - 0 . Q 1"s" ',, 1' ,'.' , 1 III Mississippi A. 6: M., Louisiana State iEI + IIfqil15,f45l,fmI I1I,I , , . . . ,,,',f ,.- .I 13 "vt: II5. I 2. University Kentucky State, Transyl- 1fI x?iffiIl?lfjgiI. ,.I II,fII, .1 :fit vania Marietta Colle e Louisiana iii 'gliilwllirl 3" ' g ' f f l, lwll ,,f State Normal, and many others. II, ItIIx5m11wI3Q,iI,5l I ,I t 1. ly Samples and Prices Cheerfully tj w tf . . 5 gi? W M Hg. uf ,js , Furnished Upon Request " 49 :55 ',,, ,.'f,g7:?- ,. A' W I' 1 ., Sf sl 11171 , -C5l5?l'?,fj.1ff"' af? , ' "" Y" '--1s5'if'. f ,N -. -' . , H, - . f V. 4,41 ,.,f, Jitiifllxi 'LU' was ia' " ie,4fE,gE:--f-fwlifsgf f ' Iggiifffp V, :11:'.:1f,I,s.'5g.g.5Q" ,.' 11.5 f, ,- ' 511,41 4 ,, f ,, 1 "Z:-. 1 1 'wwf .1 , , If" Q H p Q 225 U' F pi---pref:---ff ff ' .. 1 rf - . f. ,,,,' I , -,1,,,-,, II .,'E'-nf .- . III' ff--" J, C' I ,. VV' '1,,' '...,... . . tt! " - I - fm ',,.q1,. ...,- i ' - M- -",, I- 1--- 13':'f-.-:--gg5q.L2jff-fH-- 4043" i J ,ll' -t-tt' , ' 'f--is-f4,'1g ' g:w,l......- ' :n f-f-13. ' I jg: Q, A I ? wi il. l':571"., 11 r"' 1' . f :W ' ' 'AA-1. 'l -,wi ,.,.. ..-- .... ....ww'?""'i ,...wt'ti l O" M., mlW""""'-wZl,if15fZ'f,',Il,Q,.,n1i'.......,...............1-..'-C-isX-u-s4M""'t"T.Il.."i.'l..-Q-t--'-""""' I , ffm-nm, ff.f,'---' . .... ....., ,,,,,,,.,,, , , ,, ,,, Watts www-"""""" ' II-,,,,--"" - tixuro... ---- --- 'M 1916 eigesffeaeef, of-f+'f" g 759 7Zen1'u ck ian I i I ix P L g ., 7 W ...,,, ......,,g W, l l W ' I io 'lliilli I yi.. "X i ' A Q I. lmhllll" E X i 'H - re f' ' K,-V .2-I-' ' The taslf here endelh. The song is sung, And may it bring pleasure to the hearts of those X Who lurn these pages in after years , ln search for a forgotten face ' Or a shady scene, where memories sweet Often linger. The candle non: will be extinguished, Which canst its flickering light Along lhe pathway of my pen. -' Would that its glow had been shed Upon a worthier execution Which might find a place among cherished things. l i r . Q QQ27e so 1916 is V +-24' A 4 Y ',1..f'i. ,,,5a,Uie..,..-L


Suggestions in the University of Kentucky - Kentuckian Yearbook (Lexington, KY) collection:

University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection, 1910 Edition, Page 1

1910

University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection, 1911 Edition, Page 1

1911

University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection, 1912 Edition, Page 1

1912

University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection, 1920 Edition, Page 1

1920

University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection, 1926 Edition, Page 1

1926

University of Kentucky - Kentuckian Yearbook (Lexington, KY) online yearbook collection, 1928 Edition, Page 1

1928

1985 Edition, online yearbooks, online annuals 1970 Edition, online yearbooks, online annuals 1972 Edition, online yearbooks, online annuals 1965 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.