USS Enterprise (CVN 65) - Naval Cruise Book

 - Class of 1985

Page 1 of 472

 

USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection, 1985 Edition, Cover
Cover



Page 6, 1985 Edition, USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collectionPage 7, 1985 Edition, USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection
Pages 6 - 7

Page 10, 1985 Edition, USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collectionPage 11, 1985 Edition, USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection
Pages 10 - 11

Page 14, 1985 Edition, USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collectionPage 15, 1985 Edition, USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection
Pages 14 - 15

Page 8, 1985 Edition, USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collectionPage 9, 1985 Edition, USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection
Pages 8 - 9
Page 12, 1985 Edition, USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collectionPage 13, 1985 Edition, USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection
Pages 12 - 13
Page 16, 1985 Edition, USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collectionPage 17, 1985 Edition, USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection
Pages 16 - 17

Text from Pages 1 - 472 of the 1985 volume:

1 I V i 1 b ff 1 A V 1 1, K V- , ,. ,VV ,, ff ,V . K, - VW .. K 4 ,, 'Vf fy, , Vff,1 .V V A V V ,fly ,ff ,VQGQV ,,. .V V,,9,wwyV,.VV,V,,,,W,,f.Vf,VV.V,,V ,-,. V 9 V' K W' " Wi ' ' Vf P' "f" 1f 14" VfVf2vV?6iiuV.V,Wf'14VVb'WZZ?'"Wvifm446?,! .lf , , yi 4. V 1 . V ,fy ff,V69f46f f ,ff V V,f4f.VV1, V, ,VV Vgzw. , 0, M, , 11,4 of ,WV .V , ,VM M ,fha 25,00 ,-,. 9 V fV4V,y,,,, ,fy 40, VV,,5V,0Zg,,1VV,f,,VV,,V,.V V, V V V2-V',f,,'V ,V 'V w 'V Q JV? fff wfff L' f i . . L if V, , 'Vf A ' ' 'yy .-fffs " 'V' '94 VT Wy f . , 1 , - f, V. '4 .,' V ,V , ,V4,"'f?"'VjgV, f: "5-' iff f 9,V ,V V' 'J " VA-fb ,jx Lf' KV fVV",7:a'jfff2'g :'V",f'VfVLV 'V-'xv '11VY,"V6y'1'1,, Nw" Vfpd- V4"gfVr:V"Vlf.'j-J'i,. 72 ff f .fc -V V 1, V 4547, f-uf Vf ,Z V' Vyyfzig-Q -QVVfw1vVVV5.VVVzw'yf'f! 1:1 ,K4ff,4VV,4f4-V411-VV-.,,VVAVf1VX, VVV V V wwf, 5 VV- V 'A V "-' f , V J,-K, f QAy,iw1V,g,frVy29wefvV ,f',V5,,W52W Vfwvvzgyzz., "445y,,,V,, Vf' 1 .Vffff V32 V K lfzwf, fyfyayfgdfw , V . , V, , V1-, .V ,. V V, V, A M V' V' V ' ' 4 V , V Kfyfzragf ' V9 ,, f f V 'GV ' f , .4g?f Vfcwmf, V Qf4V4g9f2,kff-1e,a:vfVfV,1' V 1 V f . K V , f f ffff , ,, -K V ,W f , .4-,,VV,V,V,,, , ,.9?,,,yfVV V,f.,,,V94,yVV, V K 9 V f?-fffffw V fKf27??14?'Vf'9 , 1: . ,, '4 , V V. VV VV ., K V V V VV V . V, Zygyff VV Vy1,4:1Qfzf'vZi j f,,f-nf.Vz'fZ?wi:ffz4pwVQ4fV'V'fV ,, V ,"4a1V.V,g-V1 ff V,Vg.V,y,V-:V-'V V, , V 'VVywVyfC'V4? VVZA-'ff ffffddzd-ff4m,2fA'1,,ffjf5,zV4f65y'Vafef5y4.v,wf2ffV45WWAVV.. V V ,' 1 V -V ' ' yy ,, J, if V 31, ,z2,VfV-my., .f,, g',41i5,Q,: 4V4,V.gVf,.VirM-VV,y:j, V,V,V:455VeM1 Vzfff :gf - 'V'V,LV',j 'fir' ' f--" V iw.-VV ef- ,wa V '. QQ V H671 ?2zffZVff?gf'-V 'VWZ C V' cfVC'w2V'Vff, V"'4zfQ42Vwi7VnzafV4 :MJ 4,',,Q'4ffm,L 40-' QVVp,f4'fVV4,:,-V1V7g,f5-1Vw VfV V-V-VW VV ,JV f ' 1 V , iff V ' J V V f , jL 5 V' ' , ,K " V f V M '1VV'?? - V V Vf?f:f:".'V 4-29 129727 gi V-6-J V'.,ff-f'i'ffVT Vf:V-VVXZW' iw' "Cb7'12?xV5?zQ1fV 'Z,V9Q4fYf5KV!'7fiVfV151" "ff7?ff .fy ' VV-A j1VV VV V'V'ffVK'Lf 21V 41 ,' '5'??W3 VGFCL' 'Jw-172 EV" V '?V':4'j' Q'ff??f?'1 VV ,"24Z2V" Jfffiff' 72?JV,' ffP,'VV,.'if"3 ,VVV",fVV'4"f?"4'VVf",V1fLfi5'- Wfffv-V7f'7f LTVW' L'TVV?,? Zfvkf' V3V'3'f 1'7" VVVV-Vf'ffIZL"f " :VV 'ff V Qi, 'li' . V .V , , V V Q ,,,,,, 1 V ,W ,, ,,,,, ,V .V ,,,, ,,L, ,,f, , ,,,,,, ,,,, ,,,,,,, , , VW ,, V,,,,, , ,,,VVV, .,,, , V V 4,., ,,,f VK V,,K K , ,, , K L V V V a,fW4yfZVy,f7fffffp,aZffWQ24f4fif,ff'Z'ZQziffdwyfQ2f52WW,,VfZ?,fZ22VgMff,f',,, , V .- 2 V 1 1 , VQJVW 1V,VVV VVK1fcVgV9,,,,4G QVKLQV7 .-,-V'LVf:Vf,Q,9 J,Zfgjifyfw5V25yyfwiff-g'g'ff4V:VV.V.,,3Kf,gLV-' if K,3,'V:jQ,'fg1,zW-YVZVVZV-ff 'zV:,9j-136.5 VV Q 'V241K-VQ,,g'yff-sy-V,V,L,.V ' ' - ,, V .Vfgg-45: 145 VV 59,5 +57-.gygwfgfvf V,,,,'5gg'f ,y:K,Vp,!, f,f,K,V5z'W,1 ,3:'V,53ff:,'K,KV'r4,55'A 4ff,,,V'QVV3,K,ff, -Vw,f5KVxV- 'V,,-y',q5j'v,V, K gfgffvf--V,K 1 L A .V . V f Vw' ' V,V.f:'1mfjV5 - ,pf 1+ V:Vf:,,.,:1f af',V'VVV-V14,,w,.,V,wf1VV,i, 4 VK,g"fg:,ffVV4V nm' . V4V1,.L:V+VV- VV'f-5712: ,- ,Vjf V,VV,,VAK "'mKg,.Vf, VVVV4, fgff VV,qqg'O-VV ,gfV'V,,Af2,,1TgVf,, ,k,, K :VV f, ' 'Vxfv V ' ' 1 " V b . i f 71: K E if , '-'.VV ' 0147 f""1 '14254?iL?vf'Qj,Q5'7?5rwwffjieiygiVfgfff-i2aV,,,1' 3423, -QZV,1f',ZZ1,2QVffy fvV1I:,V V.-,5KV?iL,fQiV" 'Mfg AVV'2?Jl,,Vjff'f'ff-AQQ4Qf:-fiflf',.Zz""f'j,f'5f1'fJ!r f 'f,,QV, 'V iff" "ff-VL"'V'1ViV3 ' -' V-:gy " L 1 'fl ' VV , V, x "" VV """ A V 1 -V .V fVV,ff.V4,.,ffVf4Qj, VffV:ay5ZV' , 'ff' ' f"f'fvf-V41 V173 1921: jfzfig ff,1'ff2V5f,f aV',igV4-ff -17 wma ff',V,4V:f:gVV" f V, Vf ., " VVV ,V y I , ' 'wf.','VVg'Lg,-I-,-V., , - , " '41, ' , ' , 1 Q, f f f MV' f V V fVVV,Vy V, ,,,,,,,, V 4, fy. ,,,.,,.K,,,.V ,,,, V., , .V V W , ,, ,V ,V,, -. , , Vf5,f4,1 V?44W,,nw,!- Vff,,,,V147,M,,.,,V, ,,,f4V9ff,VyVV fw,. MV, V44 VV,fn,.A,,.VVy,V-VV 'ffr .V ff,' .V ,, ,,,, ,,V,4yV,V,Vfgf VV, ,,f V V VV ff V , 1 K, f:VqV4,4fQZZsw!!6V 59, 3,LZ??,?1,,,KVK52ZV,fw,Wb!V1V'Vk7Q1.,,25RV,3, K, im I AVF, A ,fV:VVfVVKMVVpV f ff My V A I I E VV "" . if '5'Q,f5fV-rVV1lf,'ViQV141 W " 7'-V-VV,V2f'V1?fW ff V1VTfff?il7,,,V?f ""-"'Wf V'4VQf?. ' P I' J-1 V' YI -1 ii VV V f H If 'f'V -' H"-1V"4JV'VZV "ffl2V1f,V:,V36' "' "f'D3 24 "7f'VVVf77Vj'1?ffff'f'ff,ZV'' f",f'V!7VV'ff' 4,f' V,"if:.'1.V V1'fV- ' "" 7, "" 'Vl V ' 1 V V V- ' V. f"' " ' " -V V- ' 1 3. 3.1, I V,4 ff:-ff ,ggigyVVV--47,3V41y5fgf544K5g,:V.,fVfVV,V"g,-1I Vg-V? q,,'gVV',KV.V,4 2g7.5fVf,,KV:-V ,K, ,Vj,,V',f VV gr yy, 'V ,, V5-VK, gg ,jf ' ,paw U, ' , M Vjff, ,VM,fnjj,VVpVVW.5-VQVVVVMVV Vi,.,,,,4,,,WZgVV,7 fKV 3 , VK, ,VVfVVq,L7 Q Ka W V- , 'V 1 1 11 -V" , ,V .V V' 1 f . V ., ., ,, V ,V fV, V-,V.V,,,V,VV VV,, .- V ., V , V,,V V4VV V V, VLA, V, V ,V VV , V ,, ,, ,V 1 f.- V ., ,, V "-" 174 V. :V 'VWmfyfffmv-Vff'VfyVwc., VV2!f,7'w1VV, f' , .V ,,., yy 'f , , 'VV-- V, 'V V, VV -:V-V,VV,:-Vf,-Vw f .fV,4ffVV-VVVV 2 , ' - R .gl ff' :' wwf -'wiffV:if,ViVg,fn-VV'VpiV'VV' ff :,,.:,,VV,,,f:fK"'VQVzV ,V 1 '- f 1 , V. 4 --,,, Vf f"V I ' V, WI V V, VV ' ' A -iff' ""' "2 1 1 Q31 I AME ' ' ,, V, iff 1 . ff. V' 'M--VV1:5f,,,i?W'f ""- 1' V ' 'fi V V 'ti AA may 793' ' , ' -' 1455,-V:V1,.a'g:,:z-mwgfv, f fs,,:,V V V,VzwvV f ' X - 1311-5-w..,,f V-M530 zg. . i- -VV-Vjt'-1-Vggg VV1,.,,":1ff'2 V1. 1- --'1':p,qg2.g1Qii3E1f11 V KL- fAf'1gQg,g.-351:gg':17VYVVaf,,1QZVQJQ4, ,"-1 1-ug 1 - ,V V V , , , 1111 .wwf-LV , VYVV., -V-Vf --ff+f.,4-Jw:--P-rf-AVV.-,V .V ,,- ,- VMVVV .VJ VV 1-X ' "Y " 'f':::,5. ---V21-44-291,-. . VJ. 1' V' V111 V VVVV 1,. V. ' C'-VV " --VEEV1.. ' " "' 3-2g"'f1,'j:"fY5'2.Vf,fZ:'54413f5ff'9' 1,316 ,Vu I - 'Y "QV:-r ,:v. 3?fV --YY V ,, - 3 .,VfV-4491 ,- - M MV '-,VVVf:-1rf::fV,,,., .V -.sVVV'VK, V I -IfV.m2,a175?,-5f,g9,,,,Y V, -x Vf.5.,1 ,-.,1,1,-f,4'y1,,?1wM,49f,1:-g XV,VVV.V:w-54 ,K ',, f , ,NV 11.1, 'XV--p:4,g,,K,?5fg,- V' S ,A-d,Lfg?7 n V, V,M, ,V ,fam V, - 5, " ATE," "'L .V fi , A JL L 'QZMQIFQEZQV Q 'Q 3111 rl 1- 4- fly, 'M V "ji I -. V, pg -E., hgh- ,K -3,,X--.gl-'QI'VVVV-Ki?--it- K .Ki1:.1fV7,nV.V.K-V-.-'V V .K , 1 "'i-'i'gf2Z,?- DLJ' V. K P W" ggi, A-'1 1-Q:mV1:.-T65,?xH:s113K,,K'iFf-', ma: . ' V - V VV, , 1 113 fR1f.sa5s-we f 5 1 VV 1 .Ju ---fw,3S:iw?3lVVi ' gg VJ-QV'--'Ff?"'ffVYV V - ' V ' 1' xx.. A.-ff '31 . - - VV 5- " -VX ,K 52153-:g5,,,,f:fV,,L V -. '. - 1 - -. K - ' K-xwwymg 1 , .-. ,,,, K , V g .,fVMfgfi2gg3mg,x. Y i . ffxwfy-V., R ' , .1V..,gV255i'7S5111 hx ix 'Q ING " .A 1 1 1 1 I 1 1 1 L I Ju- " .X C,II.IfII,IQsI:.nQ2:-I:5.ILxfLII,gIggIl:,-' ,mIIA21II:Ii,:'. ..:"2"::iCQ9,,,II..'1fI,:,gyf:'.f:,1f.,':.f -,fm-I 4-.II II I - -, K ,I . I ,I ,, - . I I I.-If:IIQIQIIIIIIEIII':.:-':.I1II-II.III:fI'-i54?III,, 4xIswIf- I me -1Ivffv'TIWf2IsIII-I -If-fII,..:,m: I -I ,.I..,. I..,fIII.,',,x1I':I':1IIII I''.'-:-e't2I,I1IIgxlILgZ9-IIIIII' ' Ig-I-IIILQHIIII .III ' '-I. ' ' '-'FI I, ' wie .-1I.,I.+3f're--IHInu-1I,I.I' 1 +I- I 'hfi-I mf, I ,A I III I ,3g,Igfa,:5,5,I,,,I,,i' I,fIi,fI' II'IgIgfI1If1'I ,ar ma, I I QL.-Ii' I If " I .I. ' f if ' II, I ,f.,III,1. ' I I. , ff A I I I"II'f,'II1-ff " in ' Ift' ' 'LLILISE II, r, L I I I. yvy, I I ' I I I I I I I I I I I I I I -, I I I I Is! 1149I,II:f'II I.:-:III I ' - - I :Im-5:1Iaf"mI.:III,, . I ,.I..,1. rflgqg ww'-w IW I I , If,6gf-II.-zwII.I,5.I-'.-:QIAI, I I I , , I I I , 1 , If .I,I, I, , III'I- 'calf' I :.:'1 I ,,,f94.I,q-,I II,-QI, UI, I " I JI,-P?II??Qf ' , ,I,,yIgwI : , ,,,,.. ., I I 'Z47fV2IJW" ' I , III ,, I III: I IIIII I I 1 AT? I ref I ' I-LIQIII' I ,I .. , - VII. II -Img :I I Iz , I III-5 -W. 4321 I Iz,:L.a I. J. IIIQMI I jf I Iv-,, 4 Inu ,Q I If 1 ' f II I 'I I I 3' E2 I I I, I 1 I ,IIE 'gffiffgi ' I I II - .ITZIWZIJ I fy-.Issia I , f I ' :Gif I 1-III: I I ,AIP I ,,-. I ww, : I I I .'I- I I I 4414, 21.135,-I ,I,.,,Ig-I4 I ., ,I,,III,,f,.I -I mn I, , I,-III.-IIZIIWF' WIQII II Q , , A Wg.,,,,- , , -ffj , A' II ,1,:,Iqz:451z , I - - -.II .-W I,4,1mf1iI,q-I3,.4.I,,L,'11I,1.,I'!yL,A .,,. I, ,-I,I,,j,.,f:,4Ig,,IgI. .. I I I , I I I .. ' ' , , , N y , 1 V I I , - 4 ' I I ' Y I I I Y, 1 I V . V I 1 . . I I I I I I II I I ,J ., .I I " 'I I"I ',I . ., 11 "I MINI . ' , II I' ?'i'I'-1? 'Y P' AH' VI' ' I-I I -45"ifIl2I1Is,- f,'F..FI' ,. .I 'I'ff'I"if': if III'-'riwii-f3.' ,lc 1iI:Ilg:S':2'I1w.-IIfIhT:I.ITi11l- Jw 'K I I ' I II. ,QIILIi3IHQ+i:i?'I1,51,-,ILW QI"-Y ., lI1'FHT" .IlqI.f2'q,I ID I 5. Q35 ,Ii"!,347f 1-.ff '5'l,2IfQy:Tffii9 f'iIQ7:I23-i5'3'f?24f2 L:'9i I --EIIQIII .,11",'I-':lI5'IF'j4f79f2 '4'eI'f", II Y 3m.Dfr"f-'Ij"Y' I.-ISfIIQWc'I1I" I -'II' J " ', , ' Ii3'?I5T?L2itI11"::1 If"QQ1fYf555.T?f.',.-gfiT3ttE"'lf'f1ff5,"Q93" f-I7Q3i"971 gif? I I I I I' I ' QQIifjf-IIIJ,ELj',S.III,::" flf'?':Tf'11474.'Qf 31"'II,Qg'Ig'Q',If I I 3 "" I I' ,I I.:-'gg g.5'IiIii! I:iI'1'e,.5QI3"I,,LIjI3q.:Q::g1q5:?2,Ij53j'g::'j-54.IIIQI 19.44 Lg, I jj I ' IIMII I IIIII-.Ir-II-IIwI::12IfII:IIIII.I-.Ii I ' III' I I- If-IQII any-a1IIr:,fII I I I , I ' I I IIN LY II v - III.-I --I Ifg .I'I,II,sw.II ,III Ip :1I,--Im If5nI,4If.-I., 3-W. . If IIIIQIIQIIIIJI ' I .r 'j::5"1I".',-'JI gy, I,gq': H,I5I,I-I,f'I I ,515 f WA I N I I II.I -IIIII,.II1,.,+. ,- , II I .III:,I. i, I I I: ,.f ,I,III,I. I, . :I.:,- I I, -'-:I I IIIIII , II , , I IW-I.. I . Q-I. III. II ,. ,T , ,V ,,,, N, I, ,, I II,I I 1 ,,I,I. .. .I I ry, I , ' I I, -., v9.11 I IIIIyi.-I1.gIIII ,, ,III ,I I,,I1 TI,-kII,,.II I ,IL-.-V, I' MI , W,--51,-m..f fQ.h,,wyvv::',3fr,Pl-v.v.N..,,,,.,,,f,vfmmvyj' . A .1 ., f. wfgc.-'Wg 11.1.11-naww--.,.........,..v...-....,..,,,.a.-Qi.,-.-P..-...4,....-1--,....--yw.f.Q,,.-.....,.,..,.-,.,-,.,,..,,.......-..,,.,..,.....-..,,.,-.,.-....f.,,,,,,,, , ,,. 5 "Af M f H I Lx 1 fm? f2Tlf'f'K'f km up-is -.....1.. wa. X.-as-..... -.v M... iff , 'K -aw vii V' 21-5 ff ' - .- I - 353 e -.gay -E H .,,. ww - 3555+125 .U . . ,. ' -Bitsfilfgf, P - W-Us W... -f -W P-ff ,Y Rf M. ,- 2. , wvn.:,m 5 , , fvwp- t yi , , QA1.-1 35-.4 ,G . -Wi, - -,f -J.-f f,g'f':g. 4 .,:": s',..g, ,..:-, ,, ,ui-. .3--,gr ::, , . . M.. ca., ,,.,f. ..,,- .4 ., ,, -. - ' F 4 -- A14 1-L., L .. ,, - - -- ,.,, f, J U,-.M .PL -mv Y A I ,f -.,.,,, ... , - V ,. 1' 'gl-.:.',,f.V,!3-f F.E.1:Ei.:.-M., 51.35, -5-.-V,-.,' .dw 3 5g'g,i.f..5 J. .wg +- Y, wwf .PWC . L . 532 -51 :SW ., , 114.-fda: ' . . .,., , ,.,',. ?. "-ff ff-f K-9.1.-s. ., . ' '- 1 J: 'va 'I Q?-f'.f'1f"". - . x iam -,n4'.:,,A.L,.. , - ,ff gg. A . 1 ,.N.,,-.J Q.-.VY-. 5 .,.-K. K my-r,.5,3A. .1 .-gk zih X' r A Lf" A -JP.. -,::...-- - . :- -,f ff- -',:.:- zfzff- Jw. -' . yM,,y-Q .0 ' 1' ff J' 'LQ-4' 1' . . 1. ' . zv1..ya.,,.-'eg-' 'V H A., 1 f , 1 . . , .- -N, .,-.-.. - 1- -. . . ,.,- 'fy rf", -ff..-p . f T . '- -. gi. - f-ff.-z... ff-ii1,:Ij.Lj 1' e'F5Q.-- :--.:. . i LE- rE::.ffi".g.jg..15-F E...fsnf-?g'.25f','2.:E-'ffcif Z., 1145"ffiQ1f?i:!2ffqi-:zijfzrffgfji-f5Jf1f1f-9 7 - -. -,.--- . . 1- . . . . 1 . ' - . - ' . - .. . .. - - -- f. T, . 1 .. , --U 1- .14 .:.:-:Q 1 as.. A.,-2,-gm... HL.. ..,,4,-..-,.:. -. g:Q:..a.417-i fvfzz-Y-..-f ,.,.,..,, ,:.,p: .1 .. f - 'wr '-f . - -'h p-4 ,Et-- Ltfi l'--?1 "I' rA,. . "gag" -" 5f:f1.-am -031-3152-'2' v w 31155 -. . '5 . . im. . H'-V",-:.'ixw2LI4E -J.fi.,..,- " fzxgx , . A 1-ppfe. 3 : A -i 4...--.f,.1-:-7.5.',.4315g..fz:g-fnmaj I 1, ii-...,iz Lkg,7,f , .. 7 v .--H -- - -- ' 4-- ft-1 . - H.. .. -- - , . . J.,-...-J. .,.. . -- -r -sam-V+. --'-',:'4:. '- .f ' - - 52 " -- ,- fa w'-Us-f ---f - W- - - ' " - '- , 3' , .,7 -u v 1 A , ,Hf-.,...-1., Q .4-,L ry- 1 nag!-Q.:-1--,'.-z-ny. -N., , , ,K gd, A JJ. A.-. ,- -4.-I-. , . ., .v ,gf--HQ ...- , y-,.,,3 W1 u V -7 . ,.wj,- ,- Q '- .V .lf ,I .V . '.., , - -, f ', ,--.f1yvf:,j,,-xfy ffjh- -1.-.-mf,-, .. . . ,gnu mn' ' 5 ' QF.-7 Yi - f R 1' -f L. 32 ' 544 . -1 3 'S f -T' - 1 x ' f . H 1. 0 1 '-5, :iw-. v' f' -2'--1' .- L K f- ff ,"wrC.'f,2-',',.. , ,nf 1-'-A-1'--N" .af-diff - - - . ' 1- Q ,45 LL ,' , "7 f r 7, Kr. p 5:-ij nf' 4" r X' vi 1-C P ' 'I ,Y ' ' " "'4A 'A 4' 'f Q. ' , , ,. -.1 3- 1 V f- 1 . 1 ,. 4 , '++".-' y--I gf,' ,T. ,' I, ff V4.1 N- ,J 1 .f , X R L ,Y T3-4... N L 3 Ffa! , U , r rv If I ' , if R 1 " gigffl' 1 7, A 1 : ' P 3 , . 'J 1- fa.. ' ' x 9 . -N f ' - ' ' f D rw 'xx If J + 1 X 'S - 1. .vw 1 Y I ' S X W 9' - 4 1 r f 35: Kr 'ff' , 4 1 , pw -wife Q.-612- if 4 19:5 3:1 saggy f 5:12-5 57-7 ' ?9I.'F'-' A 1 !j ff. .4 gf -.2 TTS Eifif fi .13?iX, E1 1,1-...gf - , 1 QEQQQ I7 -...Q .--1? :' r -1 . Q x.. L . Hia- 4 X I-' ,, - - L 1, . E 1 , . i' I 4 .5 2 .Q V . V . E 5 'J . .2 'L ww K , . . ,3 E' i 1 - Q - i 'S , , , , ,. , 4 if' 2 V , . .V ' , .T . 4 L . , 2 JL ,I X 1 f 5. 7 3, in V x ,-. rx ' . iz' Q. , . ff -. .ii ' ., - .-w . , -. 35,jg.,, -555 -:ELL U i lj?--ff. zt:'f:?E? 1-7 4-.3 ,y 3 3' Ly... S49 !I, , SA: .XZ HEL 3.1.31 ay..-1,5-.. Q YZ Z.: 5.9, 4, iJC41:-'Q '25 JCf'l6.' ' 'I is f-222115 13"-g1..z.. af- Y"H :,-1, frrfiiaj L: 4' -'Q -.gqfiv-' , 2 ff--f. P' ' 1'-'50, ge .-. A Q.,-. : - ,e V31-fm? 1 5 Eff L ' f , 21559, V w 4 .- 'f4.1,3-' f ki.. - " 1 .- f 1 f Q . ' ,cf ' ,, 7. O 4. .'12' .,l. x Snu- . ...QM ., ,nn ,X ,, Wm, .. ,, . .-we ' 5 .. .H -xv wf -f"9,fn- M N Q rv W K' H-4 .6 XJ -ir '-' x- 'V ISL. W. . ,-M ,--f .. -- mf W .gf rw. 1,1 M ,. .... 4- . - - Q- X4 .'-. ' I4 , , 1-1 4 1 1 ,xt f " v ,uw Q X .g X E WMTN Um , .-,M x X x W. P QNX , YN-w .m.w"' L-.Mena .-Q x -,W ,ia -0.4431 un- V A ww . .,, , X x 1 fcfaiy , A i, ' JV 'WY if " ' ,gk ajmwulq-M-r KN: 'Hu QQXWLX x., M 4... 1 mga, 'F-wifi .M 4 . N -L -1:3-w -K 1 K - - wus. 4 H-if -we w W., A x U ff-4 , i--FDM. Qifi -x Q, Q, S ig nswvgfqil 'N "'- . -N. 4-,,1 1' N ,H L, A ,gill ,,y:l'gi'!:1.yx 'N A -iw 'W v. X Xu L 3 . w xux wax Y' XFX w K nk ......-. I' .e- w 9. ev af X'-'Hifi ,V f on-Q ,-m,Qg..,, ' 'ff' ' 4 7' if 'W gy? J 945' - .. ff- xf S N 'if" W'.Y1-Q'L"'ffff'- CW , ig 1.35 1. ...Q XQYNK 'std -4 w Q. N K X-.Lx Xv - -X 4: az., - -.3-1, -1. .'PI'f' ' ' 2 35.11. . . 7 1 -.-:Fig-11.-.. ' V ' I rf?" - r- '- F --1-1.fr-'+ .. -, 1 lp 22.'-1:---1.-sf.:-1. . .. , . .. : - - -'I .. : '..1...1f.-.fx wal .. - -. ,f f . f-- --Q ' v f . . . '-f.-"f1..'.'-iff..zz.. -:s'.f-.--f'-...- fr.: .f--5 -:ff fn. nm- fs.:-.fed mf.. 1.--.bf '1-:sr 4 . ' - - .- ' - - 'Zn ,r- '-af'-ff.,4i' 1 . ,vff-..',-1-fi "z'T.!K1. ,'f,-'iw -.1rQ-1,'- ' -g :wks Y.-X . 1 2 IP"--.. .ffl-, 3:-L! --I-.,5f.' 'Vi-Sc: '-"N :sly 11. fwx- Z...q-Qp:f.'.1'!1-.-'- -' iff- -.fne'.1?'w:x,r:?zLfXQ'?!fr:--.-wr-1 1, -X11 -- -. -. - .. . - S - ' -. , 4.1 -1 . ,f ---:-. 1,-ni -G-2:1--h-.. ...J ,- v 1'1--nf ,X -. mf .-..-'nw-.N --,. -- ,- .-Q-4 -nw . ufsf-. , 1-1-0, -x. wr- vw. .--'- ---'.--9 -.--L -. N .u.'..:Q .. --.r...f. - , 5- nifv- M. ,-.K :.- - .V -- ,. X . - ., A . . -.522-1-1-. -,,'.-.,,:,..- 4-..-:-.if-. 3-53-Q,-',.z,,m ,mx-5,,-..--.w.g'..g-..-.-- zp.c..--.-5-'.'- - . w. N...-. --...-gn-:,g,-x.,,,'f-,-.. n,.,-X. ,.y.,--,9f.'. Q-51.,5,...,x .-.1-W-fn... Q-3 . -.Q-.,-,g.1,1:. ,f,,.--.,3-.3u.s,-.5.- 3-,-. .. 5- T , -V .- . .. .X . fm: 'f ' EZ' -" '15-,f'5Tf".'-4 9.-I'-J-4.'-2 -52'wl.J?pG','f1zE:-.:.':ifg':-3-.-. ff" "-,.--.-?.'vi-4:2 711.-g P'j--EM-I-Y -'QWL'-P: .-.VU rf-1--Q3-W:--. 312-QL'-.-f-vg-:li-1:--ilnia-LiP-'xg-'1a,f.':.'7 :si-Q --,'-.g.k.m.g'3-'fri-12,-.V'3,1-N. , ', X'-Tut A-512: 'v-Q-:ru l-..:-'-law. . .Q - If .. .-1 . , L1-fn 7' ng... 1 , 3. ,-11.51. 1-,Q-. .. .. '-. 1'-4.r'ff -'--'+',.-+gs'.v, .mga 1. ,- .11-X r:- QM. 5-1.3 wise-'----Q-3 wftw. 1: -41. if'-I-.5 -2. .-9-.-12,,g'.5Y 2---rf sq 1--u 44.-Q. w-xg-fi'-.'2 Qfgiv.-. Pg.-' - 1: .1 -N, 2. - A- 'S :X-W--'-L - ' 1 13 - ' .,,..v.' - 1,,,..--..,.f -.gf-,-..:., '1 1.,,.-5..g- -5. 3..y..,--.ggi-.'.,' ,f3,- ,- N-..-5,-:gf :,-,::.,.:g -m'gg-f,'- -1455 --xg-f-"'v'.dp,gg-...gm:,m:g-2-.,.-'t 41 ,fn .M . H1 lg?" .1...fs:..::+-.. :ig .. .,--1 --Q 7.-P1 f- n 21-P. f. .:' 4: -. . 'K-. - 1'.rv':-. s - 1- 5- .11 .X "5 4- 'ra-5,2 1. . 5- . V1 ' - I-YJ? .5 ga.-.rwz3,?-,,-q.g.-'eggga.:-. -igggf,-g.,--,-r 121-.1 1:-z: .f-.w.i,s',1.y . nf.. -,-.A.-mgirzzm1?555..,,,.'gQfg'.,y:ef:,3f-a.:.f-.,u,y.5w.gg--a',:1--,ff-gg ,..,g..g-.- - :X-.,w.r:FgJf -.g--:':,Q.'af'..f.5 3zaz.L'i.,vg.-1 vi:-5 1. 1 -L- PM-', , .- ,.,1T3gs.gwfgzr2j3 'Em64:-fi:v,f':ffgQ-, gig.-'gig-Q.gg.314gs-uf-'-if"-5'fA1Q.-.:3x5fg:-1i.:zg-f1y.v.f7Qx- 1-"13f:gS3i-Hig:-1, 1.-1. i. -.551 F, 4 - Rig-LQ3' .-.hcl-ifg .545 jg. f ,nj 2.5453-13:-Q 3,2-p?v4?:?f5au,7w.f, r.b-1.41.-Q--.-fr--L '.'+'f:s.2.-'-PfiiffnzeA,l,5g+.:,.3..T.i'- .g,g:.w- f i, -ff-1-af:-:qs-'-A '1,,f.1-.,+.Q,g,sgf,S.3 K ggi . ,lam.:5.-3-wb.: :-.5-. A . n -."1 ,gi .-3' ,isa-11-g':g "-.2-J' 7.-fl-111-11. Ht. ,'-.4-:bg-I---f..11mLf-1-.g-'--f.-'..q.:f.Lx:.-f .1 sm-'.:f-JL-:ufL-'v-ek-1'-I-Q,fl,a21''SML' :vb " '-'H 0191- -. N- --" "' Mgt-- 1. . ff-f.-.,,."-T ' " 2 . N -x - lr '-'1-.7 1. "3 g rf-11 .V gg. 1... xi. if A . --fi"-I --f -a ' 'fgg-,-gl..-'+,.',. 1-,..1--:,xf.f.- X . Ny -1 V L,.,y,, .L--nf.,-r,-.-,,, gm: 4 -. 1.,: . - B.-4 f, .----A., . , ,---:va-.f..j.,.Qf.w.3m.,q, --xg.--w--..,, '11, ,- x .-, .. ' .. 3 - ,-. A.. -. '-3 ag,-.rw . - J- "'. .,-, M y ,g . , , . ,.. N- ..:.x..:.vp - - 1 - .X - .N--Nb -' fm.-1'-..A ---Q-mv -9 w--9s.-x:x-- . 4 -J--f--ff "E:-,':"-19'T.9Eff4".E5.1.. H- .af 17: wx'---4 r 244' . " f 4 -1.m2?Ef-'i?'M-0:'f1i- u W ' 'ff-L -1 :J ' '- 1 - X 3' '- F- r A Y' ' 15. 7' ' 1- ' -' i"'-'fc-.2 -- 'l f 15137 '11l'."f."'l!--"W "5" " 6-. ' '- . fn 137 . 5 Rh ..-vfigiamlix-. 51-2 5.4.ii-F62HKS?.'-51-Thi-5KQ.1.:pYlf+ 5' "W-.M 4 " 5: ' f Q' '1-.3 5 "1-Eiff-lvgfli. - A Wy-ff." P " -5 I--1: --.-5. -an .i'.1.f4--vw:-1,Q5-.,'-exg..1,' ,. ff--W,-... 3 .1 rf' .-.al .:-fm... W.. -Tip,-:Rai---1-iw-1 Y-..-A-:sg-.amz-"r..:.-2".-5.-sa-1-5"-ff: gnff-t3Aw':.-ff.-'igfmgewiz '-1-':,-f-?:-rlir:'.,'.-iff-r--me-f.f1.. ..m?3f.af.i.'..-:- ' - Nqr.-Q Q 1.1 .V . 5 ' ' -N E--v' ..-f 'Niyw-' - ' ,f4".w - . ' ' f ' '-'ff-LT' "-'-if ':'7'. U Hi wi-'2:'::g--3.f'i-R115Qfgqkm-"2V,-Jm'..3-1fH?'?':u5m'!4E.-L5312's-1'-Ei Zi -7-:.L...g-g,f-J-,:--f-T:'2-v-'-vi.--if- E'If::1:X:3Z'.:-r4r-iw11f-7'- '1 - .5 --Q"-r.fQ."'X-Qvff'1:QzL1f'..PI'f-'-J F-r,. --ir-.LEM +I:w"LP-':'.-:axisE:,4.1L"-iw'J 2--X-is-' 1- .A-. H-,vi'L':. .. -Eff Mi v ' 2 5 .. -. -g',:,g5.-gzu--if-Q". Q.-1.+:f,,.i,:,gg-v51-,,g,.q5.g,gpy,-:3f:4f'4zQ.3,-..!,f..13-.ij ...,...i',-33.32,.,,-lr---1.1: . .. .. . .+.,..-V:z- -.. -1 g:.-.w-'iH,,ii.Z3e5ff':'. . :'::.. - 3 -H if ' 1-1-N n."-.f:gy f-F1-rim 3'-2'--fpvifigf 2b',.f.i':.,.-ga, 5'..1:.,g:fw'5-Tag. 4"ffv-3'-Q51'-,iii--13"EEf-... 'x:1..,..f-firxf - R 5 ,- - , . ., fm- .- -- ,f .- -- 1 :...:.-- 1-XA...-.1--.-Q .,.. gf.-".,-. . .wf,..wA,gfy.,- V ., f 14:-.J , , - . , , +. .M -., vis. .,-.. - -.-.Q N , gk ' -.. .. , ' - "" - f '-- -- -2:7-.f-" q., -- f- . ' ' K ' - -- -4 1- ' . -.44-,Ca .- "W " - ---1, 5-1..: ,V -, . . J .nw ., ,m,,, ., .. - 1 ,. 1 .. v V - - -- .. - ..,.. f-'f - ."1':.-f.'.- .V - .. ' ' Y f . J . - -- ' ' 0 . - - ' "fr .::- '- -' -' - 3 . n rr'-vw :-. 4- --. vf-:V ,. - - . - ' - - Lg- 5 ---- , 7. ' fi" .-.axe-.,S2. . Hp fs. . 'f 'T 1-fl-, - - MT' 'N -.fgfi '- 6 ', ,J - ' 8' JZ' ' W.. , . 1 '47 'f-Ti' 1. -If .-7 ' ' in-A . .FW -T --.f-J' :":".e-1'.:f:S'Ffr?5?u-W6 1-Qfixr 111 -S -. cf'- -. , ., ., K' ' Y A 'Ms A Y- AVI- L ' " . ' "1""" ' " '- V 'EH' 'f' - 1 ---I-9" -X... f-A N-. is . 2145 .-. 1' 1 1 . ' -Q., vw - ' -' , " ,, gigvfgxf.JIT-.'g"v:,'xN'-M ,. :N-.QC " -1 '1S""' ' - -.T 'ff,fl7f-g'jf5Q''?-.1--f'.3f3'ZA "'.'I2i 'g5E".':'3 ff-L23-7"3l-'Li-.1-' '-Q7-'f.iE1'i'i 19 --Ei? 5"f:g1 1:.--2:if-T-f'i5i?3.- Eff.-15 .fi 1: ..11:"-.af--,gLg ...wi 7-7.1.3. 13--11 , . ,111-, ..-. fi.-.1 . ji. A f,, ,,v , X 'K ' ' - - ' ' ' ' x 1 ' --152 -2. 5: 2: .J ..'-'lg LL 1-5 ' -. -2- 713.1 . :if -. es -ffz'--ft. 'J' 2:1 . ff--9 ii., . 1:-.1-: ff .. 2E1'7'J,,'.-12-':'g5'-5':'1l..,iii'-ii:'i"-"A--1.5gi.Q..LLP'ffziiiig fq.-4-sgr:-25.55151-',1:,-11-N1 v-g,,..g-+:x,.....px , Nx- xy R N xbxxf' 'Nm X' V g'm-. , X- A QREFTRA 1 one .. AT7San Diego ....... S. c ARRIER . " 'wa l y As the Big. "E" departed Alameda forlher 11th WESTPAC deployment, the Nation preparedfto ' welcome athletes from all over the-world to the 23rd Olympic Games in Los Angeles. These R competitors train for endless hours, sacrifice precious time with their families, and dedicate - their lives to the pursuit of a lofty goal. Crews of ENTERPRISE . . . past and present, have f demonstrated the same qualities as world class athletes. Without the crews' hard work, sacrifices, and dedication, the Big "E" is just 90,000 tons of cold steel. With it, she is a WORLD CLASS CARRER! AT AB LEf'o Fc 0 NT E T f 'History .... s li Home Port .......... .... g . Delpenldentsf Cruise RIMPAC . . . .... 50 Philippines . . . 60 Hong Kong . til . y.4 70 Indian Qceah OPSZ ...,. is X y-34 . fn A he V. ,X .x .A A S J Philippines.. QCA, . ,v.. 5 lflomecomingf. . . . ..... . .126 Awards . . . y Comm,a'nd. . . . . . ., A E sq Ship's Company . -1- Q----. , -f -. ffm- -. ...VYA Aw-: Wu 'lwf'-A l-- -H'-u... U g.,A .. sf - p. 134,138 .. .154 343 -. - A'fl1 L -'w ,az Fin Li 5, r , .f, Kg. Ari' P wi' -,ra he name ENTERPRISE is inherited from seven former ships ofthe U.S. Navy, including the famous Big 'fE" of World War ll -the indestructible attack carrier that earned 20 battle Stars againt the japanese in the Pacific. The latest Big "E" was commissioned on Nov. 25, 1961. The new carrier went to sea Ian. 12, 1962 for hershakedown cruise, finishing April 15 with the highest score ever attained by a new aircraft carrier. Carrier Air Wing Six came aboard june 22, 1962, to form, along with ENTER- PRISE, the most powerful seaborne unit in existence at that time. ln August, ENTERPRISE joined the Sixth Fleet in the Mediterranean for her first deployment. Following her return to Norfolk on Oct. 11, 1962, she was assigned for a month to the U.S. Navy blockade involved in the Cuban crisis. After returning in September 1963 from a second Sixth Fleet deployment, the Big "E" alternated periods in port with deployments at sea with the Second Fleet until Feb. 8, 1964, when she once again returned to the Sixth Fleet in the Mediterranean. On May 13, the world's first nuclear-powered task force was formed, bringing ENTERPRISE together with the guided missile cruiser USS LONG BEACH and the guided missile frigate USS BAlNBRlDGE.'On july 31 , the three ships were designated Task Force One and sent on "Operation Sea Orbit," a 49,190 kilometer 130,565 milel voyage around the world. ENTERPRISE and 'her nuclear-powered sisters performed a new feat in naval history by steaming 52,465 engine kilometers l32,600 milesl with- out a single replenishment or refueling. In October 1964, ENTERPRISE returned to Newport News Shipbuild- ing and Drydock Company for her first refueling and overhaul. She was ready for sea again the following Spring. The nuclear-powered surface force soon transferred to the U.S. -Pacific Fleet. With Carrier Air Wing Nine reporting aboard in September, the Big "E" joined the Seventh Fleet on Nov. 21, 1965, and became the first nuclear-powered warship to engage in combat. During the next six months, Big "E" plans carried out bombing raids against the enemy military transport and supply areas, bridges and coastal shipping in Vietnam. ENTERPRISE concluded laer first combat cruise, arriving at her home port of Alameda, Calif., on june 21, 1966. ENTERPRISE again left the United States on Nov. 19 to rejoin the Seventh Fleet. Following a brief call at Pearl Harbor, she sailed for her second combat cruise in the Gulf of Tonkin. Air Wing Nine planes were again in the air over North Vietnam by Dec. 18, beginning six months of combat. On March 27, 1967, ENTERPRISE was awarded the battle Efficiency "E,'.' her first award as part of the Pacific Fleet. The Cruise ended in june with 13,400 battle missions flown, and ENTERPRISE returned to Alameda july 6. On Oct. 9, the Secretary of the Navy announced that the Big "E" had won the Navy Unit Commendation during her 1966-67 deployment. After Christmas at Alameda, ENTERPRISE sailed again on Ian. 3, 1968, for her third Western Pacific Cruise. Opposite Page: USS Enterprise, the world's first nuclear powered aircraft carrier, keel laying at Newport News Shipbuilding and Drydock Company, 1958. Clnsetl Completely refurbished Enterprise underway for 1982-83 WESTPAC Cruise. This Page lleftlz Hull No. 546 takes shape, 1958. tkightlz Construction progresses during 7959. I' Wa 'C 'Z' 'WI KA'-it ZW' I J.. V Mu K' ,rg get iff ,N i ,..., 55 .,.,v,,Q,f.1., ff.,--.me ...:....:.:.x ..e,. Q-:1..... -.-15,-1A1.gfE..f--i'i.,Qi.:,?hE3,i+f:. wa-1,, .-f . H, - 3 -1-.4 1 7. .,,. it,u,i Jazzy -,'x,' Qggv. 1',.'w5,3,r12::.1-- 1-,gffjgqwvkm-3 1.3 f -, ,ill 25:-1. , fc ,f 1 . 1 1 , -N " ., f 1 1' Q- , -,. " 1 . 'I .H " A - " 3 " ""' - . " 1. "W : -'A aiw .-f -V A N' Nr, . , e:11"-fe'e"1--ev -:.:ff11e--:fimn-251.21 ef.:-::a1?'i5'5Zf'bf+'.1' 1,4-:Pre-HIL!-5.1-2-10 A V, Af,,:,:qQ.-J,m.d,.ef.. ,i,,f,,,,,,,v,....,,,,,,E A we .V M ,V ,W .M . . f k. W I f ' I ' Y V .., fjx , N , ,E 'vf 1 Q- X e, -H my 1. ,,.,. cf ,cv ff, ff" f f, , Fw.: , .-wp'4v1?Wfwnzgqgw IW," Ji.-.nl 1. . , , ,vi H.-Q-g,1.,1 ,Ll , V5,v,,.-ith ..m,..,,L J .1 ,L 1. , 1 S., ,,, .,. , , ,. A, 1 . 4. Q I A f 5 1 I K I I W A., ., .JA ,, . TERPRISE A 200 Year Heritage J' ,A-f I 1 il if T A 4 X mf: 'V W ,224 M V 1951 F . FIRST ENTERPRISE 42:1 if-1, fy 5 'Q S? 5 sz, w 51 5, it nn if , T fm .QW """"" - 'ai 4-1, fei ,,..-fu 1311: 3253-ein? me fr h"" ' "" 'W W' .9 f Tzu"-6? ' ff Q EFTP4-Eff fi I K ' ,A 5' 1' W- 1' F' TT T75 T . 1 M f ' 1-J , , .121 .aiztfkilffg : '-11111. 1 1 . 1:1aw11 , 1 I 3?1fE?L311?Iff''1i-Wil? ,ff '1 We ' - 11 3 ' 1 - , 1 I fu, 1. ' T 1 f A I 11 ee, 11e11'ei1:a1.wff,1111' 42551 'P We 1 L W" . 5 A- F Q1 '1 1 , :S :IH -y':,:', f' 'TI 1K"jg1' 1 'i 1' Publ Sfxlffv 1 2 'V' fl 1, 1 f ,, ,, - Qwigcqxffedwsifhmr.-fa -,W - f ,1 :11 I 1 1 f 11" 2: :wir J 1ffL11'f'1fi'1:-Qui'?gia",p:g wr. 1 1. 21 112, 1' gn-ff , 11 , 11 1 ' .115 E51 1- ' 1111 1 .5 VPS!!! '-rs J '1v.1r?3L1"wSe:'1- . 1 ' 1f 1'1k,1 1 1 1. 1f - 15 1 1501? F. F "f1f:L.1'5-'71l"1T"fAf12f9s2ii?1if 1 ' 1' ' Er-K, J' 3 :F - ILLL1 :,l11',.1 'f11,,v1'g, 5E PF-111513FiP5i113?33Z?Ff??'3.f1': .' 11 'I 1'Hi' Wi km+e42fVl1:.:" T1 13 4'-' gfffhz.':213Ef3f'15?f'F15'i'iTl1'151 ,1 -11'+:-,'-,11,1'- 11 1.1 1 -wife ' 1 1 , 1242 33551 If 1 Q1 1 X 1 J 11:11, , 'fT'n4.fl71'Ff' L 1 1111 -,1-,.,,1.,,11-.- ' F' 1 X' , , 1 Qwx 1' ff? PM " 'fi' 1 fi 11'11- , 'WQE1 44 1 . X X K 1 .1 ' 1 if 11 1 ""EiI9ffja'l? ' 1 1' ' ' E 1 4 1 ' .WF91 1 . , 'E' 'hw 1 '11 ,5f3,1agfg.q , feih ,Q A 5152fk:v::11fg11-1313211m21111117. 1 1 ,. ,, , .1 ,111 , 11115 13.1, 1 ' ' ' EIL' 5'ff?491'f5':111 W m -" 1' r 1 3'f1f3i'1If'5f'9v'411' Y , ' "I ' " 'fe' 1, 1 , ' -'Y' iifffxggfixxx 1 3 1 5 g i-Lg e, 1N ""' - ' X- ., E . 1 111, .1 , Y 1 - f1 f. 1N1Q Q15 ,. 'm.,.z,. ' ' 1, 1 1 iz: 13 iv , 5 M ' Ie 11 1 15 'f1 T" I '- -' '- tri- 1 L -if? 411 1'1'1'5TFfW?E1? 1'1f'3' 1, md 1, W5 i1 1 fggrqgi Za g, ,'xMZ11,1151:, ff1 41-115 ' 1 WA"-E' f- e 121 2 1 QP JH!! J ,, j J I ,1 2'f'11'1,'f1 5' I ':, 1'9L5,115 - 1 N 4, wg, Q U' 'fi:,35t1f , . ln: if-1 1 1 111-42,111 1, ,1. , 1 111. 12 , 111 11 1 'rl : wlrfu' I ' 5 1? 1' 1, 1. A 531 1- ,l1," :g,,5,11A fi 1 I E jrf. 1 111 ini - Q! 'ir QQ E .1 1 . 11 ,L .-, 15 hi? .-1 : 3.1.13 1 11 ,paw ,111 1 1 Veee 1 rf If 'Rif1NRfi ,TUE 4 ?"'11' I L1ffm'3TI?f' ' 1 X, .. 1 . ,. 41- 11.5.11 2111? 13. in 141' 11151 ,513 ' Y Wz1111111111.111f1 3 3 1 'N Tw ' ' '59r!1'11 " '21 ' I 5WI5'Ic'J5lI5 . '-ll ,QL 511 " 11 13?:iiF1Y?52ff?fQ6E1Wi543i1'3lF" 1 ' T 2: 'I'TE'iI1Fi'I"f'W"fQ1'9" 13 113126517211 W Ij1Sf3f31?,,,1,,, -L. 1 .if HH? 1 M Z, ' 21 11 1' 13 I :wh 211' A 1 21, 11 1 11 1 H1111 '21 -- 1- - 1- 1 N. 1 nf 11..1gi1-- 1 -1,111 7191-n1f'.,,.,,1, 111,-11-1-1Q1:f:1'I1""""" R-,xpv ' A 111 V41 3 'Yi-213-, ,,wn2st1.,1tm1f, 1 ,K I X . 1 1. 1 e , 1 J ,11 1-. V1 ,E-. a 3 1 11325311 V1 11 5: "3 ' M51 , 111 '1 1 11 A - - iq K 5- 1-Y 1 .5 " :11a11,11"7, '. 1 11, U3 ' "" QF " , 1131733 11411 111,11k1" 11'5,,1 1. -s i he -S3 1 X gi X . I 1 - ' ' '.Y'11!,' -.1.-11191-V ,111:,111A1xk1. -fp f' ezfffxe 9v ..11m1 1,1 XS-. 11 1 1 114.1-1' 112121-Qb5i11i1 1 ,'K1'11,,1-ff-2? :"1111."1 N' ,,-WY . 'igfi ' S . 1 I ' 111 , f 1 -11 ' 'ni ., 1, ,, 1a5eQg1' , 1 .9-11-311121111 K1 1. K S 1, ...,x5A1g:f 331, I . ,111 - .- 1 , ip-4 ,E -- -P 1m,-we 1f 111111 3 113g F11- 1 ' gift if 'K is .- 1 1 11' 1 , 1xf' 11'111iN1 v,1,Ti 1 Fi 1 1 I 'f141l15f-.b1.2'12?fi.29"-Qixfl " T5 - V291 Q1 . 1-'11 ' R 9511- FSS 512,11 'F , 1 1111 1 r f 1 1. L ,1:-511Iimxr"" 1wQ5 1 101121 1 '.. 1,1 111 ' .. -Sufi-YN -- 1 ' - 1 11-14111 1' 11?111vbI1'-'iw X .11 I 1r1 1 ' Q V I .T-1 'FU IEWEH .I AFI ' W 'J . 1 1" -A R S ' I .. I ,1rwi151v,v m1 11 v d1,11511U1q:??vvE! ,1,y,d, gh. NNN N511 L. . 35 .N A :Q I 1,3 L. jA,1,1,1X.1, M,,,,M 111 e ., A 1. , Q, . 5 1 L mi " Emi: gm, 1 M ,g 1-.x........., ' "-" '- E' '1- 1 1 ' 1--- 11 ' 1 30591 1:5 WI' W -1 q.-:LL . ' Qt, 1 pdf 'lxfiif CV ',1if3x5" ' Y LA ' ' X F ' ' .. - ' .-,J.fg,. 1f A 1f1Q,5x IQ1 AWN 1 ' 11 -- ' W- --H L- ..-- L. 1. 1 .1 T" V ,, 'I " ' if ,'1I1 'V 1 . I QM, E? . . ... ' 1' WXi ,gxisqrya ,i1:f.,r"1:-1-.SFT I fl T -Vi. 'l - ' 1 1 N -F 11. "W'1Q., 1if1'E"1W"1'1"U'1111GI.1f 11 1111'1-111Nv1- N 193 1 - - 1 I 4--f'Q?'1'?3-5-P F' iff-.1-:' ' Cx ff-v?'9 'T 'vw ' ' - 11 1' 1 -1 . - .. -A .:,,..1fg:e. 1--1-1---1 T-S , g f ' S ,N m,M,, , W -- ei. F - 1 11111. 1-- ., ' 11 , ,111 . w'f2':1w-?+12R1 'S J ' 1 1 1 .f11m111,11::-., 1111111111-11-111, .1 W ' ,,1,M 5.M, " 11 V-N ,M,Mlm-V ,.,L'2"" Q L-'QQ' Lf' gf. P' 1 - .-1 41, .g ' I I I 1-mu. -an .9- SECOND ENTERPRISE ig YYFYXI ,nigga iw " 5 , 1 1 MF' 1 '1w11w"F"'b 1 -L M 3iIi3'9:k3Ia ru' A X I ff xi TK 1 1 1111,. 1, M5511 L vi ff we 1 .J-I' t i 11 13 11, 1 ,, 1 xi . N 1 I+ 'Nga Q5 if 319:19 1 T +1 I 1MQ51UXIv M1 X1 11,1111 K 1.11 -1Th,,,v. wav I- f"" WW "" me W eww Mn THIRD ENTERPRISE FOURTH ENTERPRISE xx xi xx Nisx g XX XXX-9 xix XXQ ak X 'T K 'Rm Y 2 Ny R X , S Q f WN ,AL ,..f .-... g V., N X Sf.: Qsixixx X55 ,N -J.. w N FIFTH ENTERPRISE Left: Enterprise launching at Newport News Ship- he name ENTERPRISE has been part of Naval history since its beginning in 1775. Eight ships have carried the name into battle, from the first ENTERPRISE, a 70-ton sloop captured from the British in 1775, to the nuclear powered attack air- craft carrier commissioned in 1961. The latest EN- TERPRISE takes up a proud tradition set forth by her seven illustrious predecessors. The first ENTERPRISE was captured by Benedict Arnold from the British and was used to patrol the igaters of Lake Chaplain and the Saint Lawrence Iver. The first ENTERPRISE, a 70-ton sloop, was re- placed by an eight-gun schooner, the second EN- TERPRISE. She senled the Navy briefly, however, and mainly as a cargo ship. The third ENTERPRISE was a 12-gun schooner built at Baltimore, Md., From December 1799 to February 1801 , with a frigate CONSTELLATION, she patrolled the West Indies, capturing and destroying several French ships which were threatening Ameri- can commercial shipping. The third ENTERPRISE spent the restof her ca- reer in equally successful deployment, for six years in the Mediteranean, again protecting American commercial ships, and in 'me War of 1812, patrolling the United States' east coast for invading British ships. After two other deployments, one in the Mediterranean and one inthe Caribbean, her career came to an end in 1823. . The fourth ENTERPRISE, builtin 1831, spent the majority of her commission protecting North Ameri- can interests off the troubled shores of South Amer- ica. During her active days, she also traveled from South America's east coast to herwest coast by way of Japan and the Pacific Ocean while carrying the honorable Edmund Roberts, who was negotiating treaties with countries in the Far East. From 1874-1909, the fifth ENTERPRISE was commissioned and decommissioned three times. During this time she made cruises to Europe, South America, Japan, and Australia. Her last 17 years were spent as a training ship for the Public Marine School in Massachusetts, taking summer cruises to England and Portugal. The sixth ENTERPRISE, in the service of the Second Naval district, performed harbor tug duties at Newport, Rhode Island. The seventh ENTERPRISE, an 827-foot 4-inch aircraft carrier, avoided destruction early in her career at Pearl Harbor when she was delayed at Wake Island by bad weather. building and Drydock Company, 24 September, 1960. Above: Mrs. William B. Frank, wife of the Honorable William B. Frank, former Secretary of the Navy, christening Enterprise during launching Ceremonies, 24 September 1960. Following the December 7th raid by the Japanese, the seventh ENTERPRISE took up patrol I off Hawaii, and her planes sank a Japanese sub- marine on December 10th. Throughout the rest of World War ll, with occa- sional time out for repairs, the Seventh ENTER- PRISE was engaged in many major battles and played a definite part in the United States? eventual victory in the Pacific. Serving as a flagship for Admiral Halsey, and engaging in such well known major battles as the raid on Tokyo and the Battle of Midway where many Japanese ships were lost, including four carriers, the seventh ENTERPRISE continued her career as a distinguished and formidable American warship. She also instigated a new type of carrier warfare -- night fighting. For the rest of her operations for the last years of war, the seventh ENTERPRISE used this method effectively. On May 14, 1945, a Japanese suicideplane dove into ENTERPRlSE's forward elevator destroying it and starting fires. After repairs in Puget Sound, she returned veterans to New York from the European Theatre from September 1945 to January 1946, and was decommissioned on February 17, 1947. jlXll-I IQNIIQKI-'Klblj .Jiivcivrrr r.rvrr.rxr mot. HISTORY! 7 .E ENTERPRISE left Alameda July 30- 1976 on her eighth Western Pacific deployment. The ship arrived in the Philippines Sept. 6. Operation Kangaroo II in the Coral and Tasman Seas with ships of the Australian and HIS-I-GRY a In March 1973, ENTERPRISE earned her second Battle Efficiency E for attack aircraft carriers of the Pacific Fleet. The ship left Subic Bay May 30 to return to her home port of Alameda. On july 30, ENTERPRISE sailed from Alameda to Bremerton, WA, and Puget Sound Naval Shipyard, for a six-month shipyard period of altera- tions and refitting in preparation for taking on the Navy's newest fighter aircraft, the F-14A Tomcat. Returning to Alameda in early February 1974, ENTERPRISE began refresher training, carrier qualifications and air wing operations in Au- gust. ENTERPRISE won her third Battle Efficiency "E" for Pacific Fleet aircraft carriers. On Sept. 17, ENTERPRISE departed Alameda for her seventh deploy- ment to the Western Pacific and the first operational deployment overseas for the Tomcat. ' Between October and December, ENTERPRISE conducted routine operations in the South China Sea. After spending Christmas and New Years at Subic Bay, ENTERPRISE got underway on lan. 7, 1975 to begin herfourth cruise in the Indian Ocean. A four-day visitto Mombasa, Kenya in-early February was followed by disaster relief operations at Mauritius, a tiny island nation in the Indian Ocean that had been struck by a devastat- ing cyclone. The 40-day excursion into the Indian Ocean ended with a four-day visit to Singapore in February while en route to Subic Bay. On April 29, ENTERPRISE aircraft flew 95 sorties in support of opera- tion Frequent Wind, the evacuation of Saigon. After a 15-day transit from Subic Bay, the Big "E" arrived at Alameda on May 20, 1975. New Zealand navies followed. ENTERPRISE visited Hobart, Tasmania from Oct. 29 to Nov. 5. ' - A On Ian. 15, ENTERPRISE left Subic for the first all-nuclear-powered excursion into the Indian Ocean since 1964. The ship was joined' by the guided missile cruisers LONG BEACH and TRUXTUN, and the sub- marine TAUTOG. The long at-sea period was broken by a visit to Mom- basa, Kenya Feb. 19-23. Following the Indian Ocean cruise, ENTERPRISE made a final stop in Subic before leaving for Alameda March 17. She arrived in Alameda March 28, 1977. On April 4, 1978, Enterprise departed Alameda for her ninth Western Pacific deployment. From April 4 to May 4, ENTERPRISE participated in RIMPAC-78, a four nation naval exercise involving 42 ships, 225 aircraft and about 22,00 men. Maritime forces from the United States, Canada, Australia and New Zealand participated in the exercise. After a short visit to Pearl Harbor, ENTERPRISE entered Subic Bay, R.P. for the first-of-four visits on 17 May. Following a 16-day operational period the ship was bound for Hong King. During this period, a group of 13 Vietnamese refugees were picked up from a sinking sampan about 90 miles west of Luzon, R. P. They were fed, clothed, and then transferred to USS HULL for further transit to Subic. On july 5, ENTERPRISE left Subic Bay en route to the Indian Ocean with a three-ship task group to conduct training operations. The 33-day excursion was broken by a port visit to Perth, Australia. After leaving Perth on Aug. 12, ENTERPRISE participated in the two-day Beacon South exercise conducted with units of the Royal Australian Air Force and the HMAS STUART. Leaving the Indian Ocean, via the Sunda Strait, ENTER- PRISE proceeded to Singapore, participating in MERLIN VI against Singa- pore Navy patrol craft and their Air Force Hunters and A-4's. After a three-week stay in Subic, ENTERPRISE headed north towards Okinawa' on 16 September for the first phase of Readiex 1-79.- Returning to Subic, CTF-77 and Staff disembarked. After two days of storm evasion in the-South China Sea, ENTERPRISE commenced the return transit to CONUS on October 12. ENTERPRISE arrived at Pearl Harboron October 22, where the ship embarked 200 "Tigers", participating sons of crewmembers, for the transit to its homeport at Alameda. , After a stand-down period, ENTERPRISE proceeded to the SOCAL operating area, where she conducted carrier qualifications through De- cember. On December 4, Air Wing Eleven was embarked and the ship 'sailed for a 10-day operation period. During thi-s at-sea period, Air Wing Eleven conducted refresher air operations, cyclic operations and a suc- cessful Mine Warfare certification. The Air Wing flew off on December 15 and the ship returned tolAlameda for the holidays. When the Big "E" set sail again from Alameda on january 9, 1979 it was.for her 30-month temporary berth at the Puget Sound Naval Shipyard in Bremerton, Wash., to undergo a comprehensive overhaul, the first since the ship was launched. The unique feature about the two-day cruise was that approximately 500 families of ship's company were aboard with their crewman sponsors. This wasthe third time in ENTERPRISE's 17-year history that dependents of the crew were embarked for an excursion between Alameda and Bremerton. During this,COH period, ENTERPRISE undertook the largest habitabil- ity Self-Help Program ever attempted by a Navy ship and established a Habitability Division in the Ship's Force Management Overhaul System, comprised of approximately 300 men. During the overhaul period, the ENTERPRISE crew refurbished every enlisted berthing space and head facility - a total of 5,200 berths. . A few of the improvements that resulted from this program were: new modular berths, redesigned lounges, additional partitions in sanitary spaces, refurbished lockers and better lighting and ventilation. From mast to keel, ENTERPRISE was completely' refurbished. All sys- tems were checked, overhauled and restored to full operational statue. As a result, the ship was like new when it departed Puget Sound Naval Shipyard and returned to the fleet on Feb. 11, 1982. ENTERPRISE de- parted Alameda on Sept. 1, 1982, to begin her 10th cruise. During this very successful deployment, she exercised on three occasions in the Sea of japan as well as displayed versatility by twice operating in the North- west Pacific Ocean. She first went into the Northwest Pacific Ocean in a two-carrier battle force and then returned as part of a three-carrier force. ENTERPRISE's capability to conduct prompt and sustained operations against threats from the air, surface and subsurface while maintaining presence in any designated area of the world makes her a formidable foe for those who seek to restrict freedom. ENTERPRISE carries on the proud tradition of her predecessors while earning fame in contemporary naval history. For, wherever she goes, ENTERPRISE is looked upon with awe as she remains always vigilant in service to the United States of America. . I . . ,. 1: ..c-gr-LN .-lm., ' ff lr'rW r , 1 ' 1 1 1 - 1 , . www- 1 -famau .- ,V Y -am., l' 15. Above AtAlameda early 70 5 from left USS Coral5ealCV-432, Vx 'WMW' USS Hancock ICV 791 USS Orlskany KCV-341, U55 Enterprise A" 'ff Q V KCVN 651 Right Enterprise sailors make E: MC2 on flight deck "" Q X K 'L during Sea Orbit 7964 ,, P 4 ,.c.lr b""' say' :nwA:ff?fQif' :Q ' :Leif 70 l HISTORY ARL! , . , V ,.. ., . Above: Enterprise enters port at Hobart, Tasma- nia, 1976. Left: Enterprise participates in RIMPAC '78 during 9th deployment with naval units of U.S., Canada, Australia and New Zealand. Below: Big E's "beehive" island structure becomes scrap during the comprehensive overhaul at Puget Sound Naval Shipyard, 1979. HISTORY Above: Enterprise as she appears before major revisions to the "beehive" island structure. Right: The Big "E" returning to Puget Sound Naval Shipyard, Bremerton Washington during sea trials sporting her new island structure after a yard period of over three years. The ship, during this overhaul period, was completely refur- bished and entered a new era when she returned to the ,fleet on I I February, 1982. 7 W M4 6043041 k fwxf ff aff f W 1wWfffW ,f 4,1717 ff ff wif' MJ ff if fafffwfvw Wwfff ff! ymf f Wyyffff ffffff f f ,wwf yfff ff! , ' , ,4,,W,,,,,f ,f f fu , , ,fm 'fZ7?'iffWffWWMZ , Kyo , M!" I , www ff f , 'f gig XY, ,rf , ,Max , J, ,f ' WWI' 'X Qffff ,fff in gf ,g ,L f, ,,,,,,w gywfff I fyf ,W ,ff V ffff' ,,,,,,, ,X ,, ,H MM, fw. f Q f fkkkf 1 yma XXMW hw I ' MQVQMZ X " , ' f M 'nf iff", , wilfff f " l,f,y,f,f,'f,,, J mf, ,' ' ghfmff , fv ',7,uf,f,'W5' , ,,f,,,!j6f 7 ,fyfgw , yf, V 7 ,WW W f Q f , yy ff X4 ,...,.,.,. ,, ,.f4,,-:X .-,-A-- M, -, ,I Y , M A f,, " fgw f f,, g,,n W If, , , ,Q ,,, f ZWZ? 1 CVW-1 1 The nine squadrons which comprise Carrier Air Wing Eleven provide the main offensive and defensive capabil- ity of ENTERPRISE. The seven types of aircraft utilized provide ASW, strike, and air defense capabilities. The squadrons embarked in ENTERPRISE during training op- erations and deployment periods are permanetly home ported at various Naval Air Stations on the West Coast. The A-7E Corsair Il is a single engine jet light attack strike bomber and close air support aircraft. The A-7E is flown by a single pilot and is capable of carrying air-to-air and air-to-ground missiles, general purpose bombs, and a Vulcan MK-61-Al 20 mm cannon. The jet uses a sophisticated digital computer for both weapons delivery and navigation. Flying the A-7E from ENTERPRISE are Attack Squadrons 22 and 94, based at Naval Air Station, Lemoore, California. EMB RKE The E-2C Hawkeye is a carrier airborne early warning all-weather defensive aircraft with a distinctive rotating radar dome. Specialized computers, radar and communications equipment in the E-2C are used to provide strike and traffic control, area surveillance, search and rescue guidance, navigational assistance and communications relay. The E-ZC, nicknamed the "Hummer", is powered by two 4,600 hp Allison turboprop engines, which drive two four-blade fully- feathering reversible constant-speed propellers. Flying the E-2C from ENTERPRISE is Airborne Early Warning Squadron I 17, based at Naval Air Station, Miramar, San Diego, California. The SH-3H Sea King is a gas turbine-powered helicopter used for anti- submarine warfare, rescue and assistance missions, and transfer of cargo and personnel between ships at sea. Capable of staying airborne for more than five hours, the Sea King is equipped with sonar, magnetic anomaly detection, sonobouys, and multi-channel relay equipment. Sea King helicopters are airborne during all flight operations from the ship. Flying the SH-3H Sea King is HS-6, based at Naval Air Station North Island, San Diego, California. The A-6E- Intruder is a carrier-borne low-level attack bomber specifically de- signed to deliver a variety of ordinance on targets completely obscured by inclement weather or darkness. Flown by a crew of two and powered by two jet engines, the A-6E is equipped with a sophisticated weapons system and can carry five 2,000 pound general purpose bombs or a maximum of twenty-eight 500 pound bombs. The KA-6D tanker version has a 26,000 pound refueling capabili- ty. Flying the A-6E from ENTERPRISE is Attack Squadron 95, based at Naval Air Station, Whidbey Island, Washington. The F-14A Tomcat' is the Navy's newest fighter-interceptor. The Tomcat is a two-seat, twin engine all-weather aircraft capable of flying twice the speed of sound. It also features a variable sweep wing for increased maneuverability. The Tomcat can carry long-ranged Phoenix missles in addition to Sparrow and Side- winder missiles. Flying the F-14A from ENTERPRISE are Fighter Squadrons I I4 and 213, based at Naval Air Station, Miramar, California. 1. l IR FT The S-3A Viking, the Na vy's newest carrier-based antisubmarine warfare aircraft, provides an ideal balance of ASW systems integration and computer technology to enable it to collect, process, interpret and store data. A jet-powered, twin oengine aircraft, the Viking carries surface and subsurface search equipment including sonobuoys, high-resolution radar, infrared and magnetic anomaly detector. With a crew of four, and an endurance time of more than seven hours, the Viking is used primarily for search missions in the vicinity of the carrier task force. Flying the S-3A from Enterprise is VS-21 basedat Naval Air Station, North Island, San Diego, California. The EA-6B Prowler is a four-seat all-weather jet designed specifically for use in tactical electronic warfare. Powered by two Pratt 81 Whitney l52-P-408 turboiet engines and having a ,level flying speed in excess of 500 knots, the Prowler uses sensitive receivers and high power jammers as an effective combination to deny the enemy use of much of his radar and radio equipment. The sophisticated, complex electronic systems of the EA-6B make the Prowler one of the most expensive aircraft in the Air Wing. Flying the EA-6B from ENTERPRISE is Tatical Electronic Warfare Squadron 133, based at Naval Air Station, Whidbey Island, Washington. , ?CiQl fling W-',1t n. .if 1 Elm in ' O 1 IIIQQ N ' I . n if 9. , 4 QI, -ei :gui ...ill E' " .., V WU"Km AJ M. u 'E 'Nun,'jF 0 cu. 'gl gm ,glluaf vl si ' U ftgmgig' ...I 1 Al 7 ' :I ' Ill 6 'EM W., "' 'lun """" -0 in .Q V 3 5' ' V .ll l Q.. ' 'rn 'A ' ' ' nm' I 0 lvl! ni 5. ' ' 0 H ' IQ ' F 'vm:,llm "U an "-'N ' ""' Evil! 'hyd tin big' uni' l .. gm 'gmc 1 ilvmg 556:75 ng 2 uni ' ' 3 , ' Q up , - f 'L . S 5 1 ' . - . 51.4 QQ. M , .. , svilfqi jig, ' .. . O ., , . Enjgvgahv 'L V--"" ., ., ,, J lv' 'x ' 0' IA Q, . ' ' ' -- """' " " ' ' 3- . ?::""-un, . -em - - . H "' ' 'F' '50 -8, Z' . - ' ' ' ' . ., - ' ' a .5 0' ' """"""- ' - '. - - nl an an ' 'Rf """""'-"' " 0 .0 " W ' 245 . 5 0 1 Gallon-fn. -Q .. ' , .nn ' g . , . . . DHI" Y "' llama 0 0 - 4 "' 3 a 4 ' Q """- nu was-ax: ng Q" 1 J U Q , . Qugggn - .- Q ' . . Q . . ' of to lib , "We 1 I ' Q 'tp '. n , - ..- ' . on ' 0. I s 61 ' 8 N " ,3 n I f 1 - I ' A ,l O V, K .. Q at ' "1 " was 2 '- 9- vl 0 ' -o -o g j',' 90 04. K 0 0, . Ml ,. , . Q Q Q. . ,1 GQ '. D D . .. ,' 1 I ICR . nv 0 r v --0 , . ' V Q, 'itnwp A 1' , , Q , P . gigm Kang. -, . . 6. ' .1 , D .. 4 1 O :r 0 'i it : i I i , . A . ., . , ,. , , I. """tm "'f'm. m an-""""... .' 1- -" - -' . ' z' - . L ro I OO . U 0 l Nm I I ' . , ' , , ', 0 g .jg .' AH. 'i O ' . I , 2 . 1 f W V il .J'a.1l Ol T 'h ' , ' - U. ' C 1' . . . ' f' 5 Q. .Q u . I 1 VI . 1- Qlllnwduiigi M Q , zlf. l O UI Q' gg .'9ue 'Of . , . .at o"..1 I iz . . , I .. i A 2 Q ' ' hw . . I Q ' . . . . 0 - .' ' D G I 'wif 5 O l .og . . . . .' ' ' dz ' ' s 4 1 ' ...1lQ.g., 5 0, ",,'. . 'Willow 4 .. l ' . Q . .I , , . A , ff -0' '51 I-l sq ' j..!. . gt, 3 Q - ' as V' BIG "E"'s HOME PORT: ALAMEDA San Mateop San Leandro OAKLANDQ SAN FRANCISCOQ Berkeleyp x - , V r V J . L f mm V f. - f.4,q'.- X N A 1.,,...J'l"- H V f-', -.-.-. .- ' "4-v ' ""'-'51---' 1-f 'sa..,N,.., . ',' Y . - ,,-...,., f .1-.--He., -,--Y 4-1 - - -A ' ' - .. . 5 5. y -Fe? , ..,.3::3i?,- Y A f :,g,4. - 4 l V . Us vt, ' "W: an f 4' f . I-1 1-in A- -. .4f,w.-L, 3 ,. - V ,- .1 .,t:.:22F'f'W - f- I ,- ff '--f , fuu1:3i'gm,-4 5,5 r,'.A:,.,." L-, y , Arg: gig-qv 5, v -1.115-,if5:f"!f"' " . 72, 3 -'-5'A"1'--' , .l,,,,. . :Jr 13 5 , " kv N iw., fix ,5x ,, -jr ,WMF ,Li li :1 .-s M . A A 1'-'52.,ifEfwf'w-v,'-Mi 4 . :wwf 4 ' A ' Q L f , , I'-fg -sv'-4 46, .-- -, ' F JY , j 3 x ' ,,,,,,. . , . ,A ,J ,,,,' ,I w J L4A.:.Q,,N,-.X ', , , ' 1 4 wwf H -' . ,, ,, Z' ' 1, ' 3 .Qgfg A.5,,,. , , ?f134,,'v, - " 1 v ' 1 L " ' 4. , b "" ' "J W f M, 1"-"Af afylv' wx- 'Of , - ,.-f ' -'- , , 4 gf - in .w l " . , 1 if E .:f,1vif X ' , giyyf-' 'gif "way 11 M t I , ,VL my A, ii, Aqmlhk 43i.,tF,.G F' .L Qwy it fy, 244 L , ' 1 ' ' F! I8 ,J BAY 1.-tai -VV' ' 1 f 4 ' 419 ' V V V' , . Vip. 4, -nag-31 W9 Vw fx V V f V , , V ,V V YJ z-4 cf- YW, V "f ' m e 4 'K 1.1 6 ws Q40 W ' K .. , ,. . V V - V ws . V V - V . f 'fFVx1'zwnV... Q, ..,,,.w. g I, V V. 1 V V. .--msn, , VV . V V vw, .wg M. V, .mii- ,...x V SV V VR. 'UH ' ff, 1V,f Q' J., V V1.4 I 4 - L Qu-.V . ' Wfwf. -rw ' ' V ' A ,X 4 Vx Q 1 Q ,VVVV 1 V .f . V - :mx V- ..,. X.,., ' V: ,-" 'M ,V, ' 27 ""f'-246 y six yi- 1... 4 ,Vi -.E 7' v, .4 VV . V935,VV4A,:.i4-I .VV ' 'J . - a fin'-'Vg ,JIV V W -uf' f 4 A' I if' f VM V- 4 ,,A-V!.4VV,f,- 5, W .q,. V.V.VV.,VV.,VVVV 1.2. VV-V,..V.,, V, ,, vis 1 14 1" 9 A' M V... -Q 'S ,,. Vgzagrw.-1 j. Vg., V V V , H . .A V Q3 -1:1 1- :VJ f-V V V ,,VV V.,,.y VNV, ..,,V,,,zV,,ng.,,,VV,V,V,, ,WV 'ESI' MV, V . .V ,,,, ,V , ,,V..,. , , . ,VfVfV ggV,zVrf7VV V , ge. .5 ,V. A , ,, VV ' V a,Vq.fVxqVV'.V.5V-, vw' ' "fr VV..,.x,.,,q, ,QV vp. V ' V f-'Vi zeVwVrf2-Valff-"sw 'affimyxifa1V'H2M'-'Vf:fffff?f4yg'VZf5A' " V ff Vg .1 '-::MgVVVV,,w'f:e-z:V.V,gzV.rV3.fV.,'a-zqgwgf f-+V-fVuzyuV4,,,Qw V WV... -MV:.vyf?1,:Vfrgg4.,4yfVw fV:Vg,Vm,,.w,..,yo' .,,V ,.f?'gWgg:Vg V . ,Vww V-V:Vf:-VVV-MVWVMVVM.6riVVV: V-fa"-Vf" ,g5fX'V.-rwzwlzgy Vfmf --1Vw"1mV'Qf21':'::a:,Vw-l'5V'v::V4MQg44wi,-v1w5::'5.VV4 vyf,.gVV,Q, V K "7f2k1VVry1,V V -5 V .V VQV.MV.,V,.fVf-:Vm5,1aVVVV..VV.V VV,:m'-,ming ,, me-f..3.,,f -+5951 V..,VV:VfnV VV. 1 V V wa.,-V :VmV54:-,Vm,1o..,4V,Vw-:g.,.,VV-VVf.f V. Vw, 'nga VN Vf,7f5A',, ., OV Vhwwn UV V:5Q?fzf4f-"?VV f-- .Q 1- ww j,V.f-'Vj,'f'73:' WK-7x3XV9i?5i'g'V--'ygybq"'7JQ.V-k"'fffp':il,4d .1 V', ' H71gV 'fV Vff '4fW.7f2Y2i2ff-25.1. -Vinzivi 'ffiwwwt if V5 A , M AVVV QV , 0 ,V VV. -'af'VzVV:1V.V".fV,:"f-' 'V'V:QVfV -'Vfm4ff"V'f'V .1-1f " ' - V A N V, V V ofx V. , , .V V..-.f y Vfqgw-553,-.Awf:' af i,1..,, VW ii 'V-f::fe?w,gV V .V V V gv V11V.f',V::VVf:f',,,f:Vf M ' V V, ' A-1 V fin ma y M wi-'1 1 .91 1 Q VV!-V.'f-'fvwzwwf 1 V .W V-VV V ' V V. A W A ,QA ,W RW, ' 4 ' V-1VV,g.g. "f1lf:.:..' .V w'1'. .VmYvgQ?,V:+ -mi firm 1 .V V f5'3f'iV:V'V '?'?V'4q5 ., ,, V V V A V .,,.,A V M t fyVV4J5X,- 'VNV 4,,3Z.V4m V- .VM'ff:V,V.3.f:,,5l,5'VV.,4,QW Vr V, '1,j'L '12gf."1,V ff ",:fm,y v VVVVV-NVQV5g.,VggmVV,5fMn,,,Q7jV'VMViqswff .5 , Vjfmxffz w ,-.-Jw 'ff ' I V ,XAIVLJTN MV- N, V V A "WV 'V .V 7. .VAv.,V,.v,A.vf V,34f,V,V VM-V: V . -V " ' V -"Q ww,i?'f?i,5f,VV V: ' "'4MVj VV. ,, V,.V ,V,fV,v,VVV,.-V, ,VV ,V MV. V , V ,V Q Vi, VV., ,Q F, V., .V HVEWVV . V. . 19,4 M, . "Wu 'VMV'4'WV"1ff'."lif' 'S ,, Vw .- 4,3 ,,wm.,V ,.V,,VVV.V,,,. 1, . in V , ' ' cw-V4,kjA..fVn.VV.V4 gn- F, .V VV-:,V . V, ,V V ,V ww 5 16 Walk' I . . ,,V.4.7.V,,V, ,W ,V ,V , , . f i A'Jf'x1iifAjj-'fy -T " v:1'l7'Vfnv,1'jL 1 'iz'-VQZVNCQS 13411, -- .39 ,' V , 1 j , V ,., ,,1.-,fan,,,.,V..,V.fK,,q,V.QVV,., ., .Z , , V ,VV f f f .. -V V V V f- -,.:'-+V-..'V,qV.:v.f1-.ff lg. ,,.,+f.,,-V Y, , .. -: ' , - V , V ,, V, V..fVVV,M,gV.,w,p,,V1..:1-.CV .VV V342 V. .V ., , - 'QV , f:Vs,..:7 gf , . QV V ,I Q.. -FEV V f- V -.V'N,,, 13,111 Vi.-.If-VM, w7yuw-m. "".V ,ru MEL .wg f:.,V'V, VV VVV1- QV. . V K., V . - . -V V, 1 V V, ' - : :H A--if 5.-':r111??S-'Gas' V3"?37':1:m'1'?'V-V-"KQV V"F"V-V fn -:Vw .151 - V -f ' 'V V., . -1571 +V ' ' , "' ' - N -g 11,5 V ,F ,Nf,,,,wzQ,,rFx 5 f.5,'jV,ff2ff:,.fV:,, '.g.V15.:,f C: V V' V V, JA., VV, E' "ff1-?wVV.VL ,., Vs V .. R V.V .V-V is V.:+f,,,,,VEfQ, B V .,., -V V, H ' ' .212 '.VQ:V, ' -5 . VV ...V V , 'fw Y ., VWV5 VVVV . . N . ,. V V M ' ' 1 ,Viqigbyp iVV,,,, ,rkl 4L7V.V,,,,V,m, vVl,V5mtk . V. 'VfV. V .9 . .,5V.. V., WV .V.iVLfi'f' 'VV " '- Wi' - ' v5y,jkV V V.. VZ, ' . '.1q'Q-MV,-+::,f-, V: ' V V QV 'wf,,V:QfP V 1' V, qi., 'Wh V,'f5g,- .una :VV A . ,, V VV, ,.,V,. . ,, ,N V t' 'V x V kj V . .V.,,V.V,V k ' .V .V Vw VV . V w. U I .5 V H in U V ' '., ,.,,"Fx' V :M f J 'T Z" ' J' QVVW ' - V,T5V,.JMk V .V,gV,,w -Mm?-V i V, K " J,-:Vf ' H 'VVVV I Vf- A7kf?f.VVIVzgi' X 56 g , 4, , V- ,V MQ, ' ' Vwgf,VV 3 .72'fi'-,fi ' V V,,.V:,:V .,,,.Fin-:Vg.Q..,xm,.,,-.,. .VV.,,V-, VV. .V V , VV V V V V Y , V V , , it,552..gV,-T'qyn,xV,,'g.j5,:5517Q.:1:5 j, :X ,- A N .few , -. ,Diva in, gk ff-ff' ji' 'f f V V - V VV VV V - - V, ,,,,.V.f.,.,.,V V --x.---V...,V,V,,V,4, -,c1VV,V,,x,,.,. , ML VV.VA,,, . .V V. , , , V .V V .V V, V vs.-VVVVW V V, k K 1 ,K , 'mL:.g..4,..'......- ....--aa1V.h......V.VV,V'-S., ,, 77 4. V V,,Vr+" V - ' , WY, ' ,, ' ' ' ' - V-- . VV ' - VVV- . ,-- VA -f " A ' K ' . , 1 V Y , ' . VV V V , ,A ., " QV-. - - g-V-.V - ,.-' V V 3, A, .- ..: :-,-Q '-'Q --M -.J we , - .:QrV,.- ' -'V -V ' VV . .-- . - V V V ' V V. V ,'.V1.V ......-- .-,...VV...,,..:f:-,--.,Q,-...- H., .1-ie.-f. 4-Luv,-4 -- - - -V V- V f V - . - .llfjffu g,. -,rally-44, j- Y ,V , 1-g 1 Y. ' V . V 2 V V N V. 5, -:..'- X --:QV-VV,-.:.v gj . -' -L ,LV .1 3--f .,.:.--'.:,V,j:5fggWag:-Vg, V 5 -. fg.sff:.jg,V35-,J-:'V-.gi - VV . V V- V' -- -V - VA V ' V.-- VV :- . V - 7 - f '- L-VV . V- 1- ' nr--g 7 ',.Vg.'-f, :JV Wy., V 1 - 1 'gllzitjg-V35 , V ' ','3,E?.IZi,-Y 'V ' - -:1F'3 .. i1.bf.,, iq., ,, wwa 1 ,Q , X :JMX I ifng.. DEPEN DE CR IE What's it like to go to sea aboard the world's longest aircraft carrier? A group of 3,779 family members and friends of Enterprise crewmen had that question answered March 3, 1984, during the Dependents Cruise. It was an eye-opening experience for the dependents from the time they embarked at 0400 until the voyage was over when the "Big E" returned to its Alameda home port and docked at 1900. "lt's awesome, just totally awesome," is how one teen-aged girl described her experience of standing on the flight deck to view Alcatraz and the San Francisco skyline as Enterprise glided beneath the Golden Gate Bridge. For others, the excitement mounted as the ship charted a course that took it 50 miles out into the blue, choppy Pacific Ocean - out' of sight of any land. . Then the highlight of the cruise: a dazzling air show by Carrier Air Wing Eleven pilots that displayed the capabilities of a variety of aircraft and left not only the guests spellbound, but the crewmembers too. In between thejourney out to sea, the air show and the return trip, the dependents had plenty to eat and drink as well as entertainment. For most, it was an opportunity to get a firsthand glimpse of how the crew lives and works in their floating "home away from home." The many letters written to the ship to praise the teamwork, friendli- ness and helpfulness of the crew in making the Dependents Cruise a memorable experience is testimony enough that Enterprise is indeed "the carrier with class." 20 X DEPENDENTS CRUISE swf- 9 ifrs- , f , .u V 4 I I l 1 w 1 V l , ,I , 11 Q f I W I 1 i l 1 ff I j n W M ,H 3 ,l H li L i r Y W w w 1 I 3 z I 1 F 5 1 l r I I R 1 1 4 5 z A 1? 3 ll,!""?!Y"'FW' P NDENTS AY 22 f DEPENDENTS DAY CRUISE , "Q 12.77, "' 1 Q . E 'f11 151, ,T P ,A 5 , f I ii' NV 3 4" 'Wm t 'wwf . AW Lf' ,Lf we DEPENDENTS DAY CRUISE ! 23 ' 3-1.yy,g,7:5' ' 4 TQ- Q ' "f'ff"zf'13 A ww' wiv"swwfgwffwwfivgqfmwugfwrvmffrfffhw 19" V p -r,z, V 2' X J f W ,ff 7 Precfepfoymenf Picnic 24 X PREDEPLOYMENT PICNIC Q-11.57 --w'-1 iw' .--4 -Q ,--f-4- xp- -- v ' fc 2+,VN5-v3--4.f.sgEgKvfiq'-:- -e V ' ,, me -- fi Us M' -41-ww-Aa fr ' . , - V' -1 K 'Six-,.'?4,j'-Vti E35 ggi'4'x?g5s:g:,fpxf',-g":'-'M -gy., -. - ' ,tv-IQMANS ?i3y,f1o4AKg:Jliiig4gT,:3f-:QWQ 'lzggmf-ks JS. Qaxa f -55, W A: - . ., , Vggiulqt- fx ,ggi-:f154g,f' AQES,-.. M5393 M 3 1- -, aj V--.-.Yr A 1.1-. . lsr ',m x'N',.qx Q.-3'1i4'5ff l'x'.5fI?"'1'L1QT21'hfFwf-' P - -fi , f - ' '1 , 4y.,:7J"': " " Yllfr .'v.'QT'1 3"-11,3 w2F'f'11. J f-,al -ff ' Rl' l5f:- H -C, 'VN .- '3f4f.m. zZ'ff"" . fiffry l -f -I: 'f 5 2 ""!lg'1,'f4 if 1' W 1' ' -"52,'M ' Me.: 1 ,,,, g , 2 I ' , "? ,' ,iF,,l- ,,pt ? f53M sv 1 4, ' hfu ip-1 , Nui? 2 5' QQCWF-' Q 41 725 , ur i? ' lx A lf' 1 E '-i'W., f14,qkp?x1,v 1 4. V -j. QV 1. Fi' 'V-1-.x u 4' ' , nf- .-',!'L, U. l-4"b:,QfN is . .N 1+ -'Af f' "fi " -"Pig-xv" -"QF Ng' 3' -'fs' "-Wx? 544 ' N 5 .3551 - - . Q'N5 '- 4, 5"-N 'K 2 1-'W' In I ' 9341, x V v .. . gn. Q I . in 1 ,N r 4. ,, U - , -- ,.s .,,.75,L V,s,,1.f- , J ,M ' f':'a 'f".A3ri7. 'f gi w V ' 'U' 'A 6351-4 '- " f N -1' ' .- A" iz X Q 43,1 .... ,S-21'-'Lia Hy- L ,. l N , I A v1 m ,bsgjx H x .vi Afigvm Na g, , . . qv gy: , . - 3-amp: fs., Anhui, , . .A A V , ' was 2 .M . f- Wg-, -,,, a ..w,gx:. 3535? V43 Ky-' q"fa.r5- r 'Q'- ,' v -,-K'f,g', .J--' fn. 4 6525-f..'Q':??2f3'ff 2N5QMH1' 'l 5" 12: 'f ' 'h x Aga?-1 ffisfz-A"f-FS. .,z 1F+, ?QYf 2M1: f ' 452. M. ,' A X.1T7'V' 1, I 1 , 1 w i U 'Y 5 x 5 V 1 L I 5 W w , w b Elf 1 -ggqfxgkg. 55+-W -as Ng'-,g,-,,.93Q53LA -no-,apfmwa 1-va gawk ,uh -. X 1,-H233 mor -V G ,,P5,,g9.54--v Aff: 5. fy-1,1 949,154 1 1 ', ff X N ,Q f .,,,,,, ,f , ,. qua! ae-L far- an ,-,vu 3-9-v-,V ,asus 15. J Jn- """'45'W'?"'?2'f!?""" .gi f rf , n -nv.--,, ' Q 1- Q 339: 31 R555 3 9 550 4 4. Q 4 Q Q fi! ' ' qbiko'-.1 is s',41 .4 Q -Q 600'-o fs? o Q Q . 454 . 550. 539 2 3254 fo? I I Q- qhq 4. - pf' ,f ' 'Vis 4 ."' 1 0 0 .9 0 0 0 0 I , - 5 0 1 v X f 11,4 f, 1 fi I ' 1 fu JJM, ' 4 f f ff-A 1 ,A 4' 'xx sm' -ffsr' . 4 I xw' """"-fvwlfiw 'W-4 'ow 51 im 'bk I -A-1 1 1 281 ORE , .. ,, JM. 415-...."5f2f42i4a23 sf - --11-',-T-a?r21'5?e2sl-1,5-15 1- ff, gif 'gb , fs W A f . ,A L 1 r - Q ' -Q ,-134. if - ..:-A . -1- .1 is'::::-Qg:,i.:-.-:'1-:PS-elsefi-2 223 M V-,.., . ,- - ,.-......v f. f .b - f - - - . - . . -. .- --:-- V -vfkz' -if -.::- 2: . . Lf 1 9'-,f,'?,-f.i'2C:l':TR-gf3iIZ1'..'-'Z-:if-iii151-f:E':i'5'.-N '- . . f L. H.-. .rf --I-:nw 1--4 ' b-- --.., .. . , . . , . , V . . . , ENN lm, .,.: H.J,.x..4.,,,,,..1.,, f,, .Q-a:a4,.W,-,J,,.- ,, . .. , 1 , f::A,.f.7LLlVL -Emi :,:l1:-P:,N.L,nuwg1.M V " ,F-Z 2"-F115 ff' J ' " K' x ' -v, -- ff.--.v-,Y-:1 mt' . - - --.'.' c M10 - f- - .- r 1. 'N ., -' ,.'--"' 5455 sg- .31 p:Nx:x:':-53u?::1,.- ' ' .. - , , , 'Lf 5 el-,snr-g. 3 -m:4f- -:I:1'g:,, wig- 2 Nfi N" W2 , f ,11 I , :wwe , Q A .L',Y?Sf -' -- -' A A- 'm f 2-.. -4f,,J-.- 1.4 4. ,,4,.:S.,.g.3,.g 44g--4.1 ,gg . Q, - - -, - . A - - - -, - V N- , ,. , ,., . ,. , . . .. , 4 - - --us: -x ,eq :Rf - ., .. .. , -L-,J Mr-' , .w,X.J.m,,,ix, A, 1 . A , h - ...,. 1, ,, , , , Y,Ay,,,egA -L.,..-:A-V .-,L-3. ,xv - . R. 1 A V, ' A L . N' ' A' J-L ' ,' 1 fy, X ' r x xg , K , W wa ' P . U X ' R W x x Vx X f Q , A2235 i- X Sr f M51 1 f- .15 ' "V A : akin: ug " , pixfsgr ' 5, gym . , 7 -f f- ,,x ,J,,,,,,,V,., ij,d Z-wi V: '7J"2,..- M ' -'v .54-5- -.X -7, . i W I I v 1-,-'-.1 7:-Y-.ri LF! 2-'S 1,354.1 A. t, V. fi- 5, '39 N , , ff' , . -fr . ,,., I 1 'awaits A 1 44: V , . .. , , ,- h ,V -. fRmEFTRA, f27 f , W, ZW, .Q . , , , 1 iaiigfzfiiwg, F1 ,,,N.,..... ww., . ,wr fa,-,, .-sf J-V A - . f .ff f'f"-fr' Q ff up an ,Jr ff, ,,,,iP,fim., 355,- .- Q-N f ,Y yr-:Sl 4 ,r .J 'L' V- 'X A .. z'--1 -f X -f . Q' '31'25Li653'215i5:zgai.g.'5,figfli i":-1,-WXQ:'s"f?I-"gif, A w ., ff : , , - . , ' ,, , qN,,-'gpg-,Q-Xw"f1,,14.fi3-,3,1f::3,gV,.1,.q, 1 , 3. ., , 4 ' ,f - , ,. A - ' ' - . k .nn 'Ji'4- n.-TLS'1?31Le.Jf'I6T22'air 42:2'zl-'prir 111 V ' , ' 1- -' ' ' ' 1' ' f --'IA - . ' f' Q-H-.33fxzfiwfr-:f-31529-lm1-A 4+,:f11:1i1iifyrszgff:i2f.'f-far.:-,aj lr.. 7 -f , ' .1 Q 4 gp 1 v - ' V . , -- , - , , -. 1 3.1-,-K 3 ,LW?Jff,f15g9f,j:g5g:g.-:jgki-, M zg,,,g,1,gg15,:'113:y jf, 5' Qi V , .- ',"- 9 . f A .,,, , 5 ,Ay-'i.5:,:, L- -y :L f ff: ,Q ' 'nm ff. .".:'1LL' ?f'7'?5-V15 ' .gff 'f k V 4:f:Zw.'.nP-f- tix-1,1'Lfy-fi? uf -' , 'fg , ,, A 1' ' - .,.,i,' ,II .1 -' -W - 4 . -' I :Ei-..'. . ,. X. A , .- - , f- . - H, . A ,. U , ".-'-,Q-.,,:'f?fi,,ff5-f11z?iS'iS'5:,f,.:ii:4 'fri5sji5f,a1-.aff"ffffL"f3j?-.5wf3fIif.:g.-.3-37, M ., " jf145':- , ' -jgjil f W' ' " , ' . ' ' . , . , ' f , ' 1 ' f V-ff ," - '- HMT" -vfJf,fx:iQQ 2LQTZ:.:?'iff5:1'3?n'f Q't1L144S2"': V? 7I3x5?f?i'ff:r7Viflfilkf -if T' ff 4-L " 1 " '49 -'-' 1 L-fi .-1-fi' W ,. - , -- f 21"- ,4 Y I 71,0 Q . , , 1 . , , ,K 4 I -N,v,,v5v,',,LM.k UVAVA W-fa , ,.,, ,. ,A...,,. . . , ,. . . . . , ., ., . I , , V, ,:,,,,: -- "'f"'1---eafL5- , , ,, , V , , , , ,. , , . . '-- " -' f . ., - - t . , .A ' 'L " "1"'-f"':-"f'f---f'-:"7v'r-'vff cw- , . ..1.-, , -f-fs, ' , I "j:a:..-,fn-1:1-3. W . -Q't:.L--',,g-s,:f'g.,g-'fL-fgQ-vi --..., 5 - 1, X -t A ' V , , ' ' .A - V . , KL , ' , .- . v, V g '- .- - ' , A 1 A , -4-'5,'-5f'.A'gj'r.:g':1g .Ji 1-4,.h,,,q -,--xv: " L' -gf' f:?,'f:fj.:'::.' f-1-'nfv--5--.,i,19 il,-5: ,, 7 , 3 .4 r - A - f 1 ' -- - - A ' : - -- 1 -1 - 3,1 f'i'2iJ, ,,.tff-.- 'W' ' ' 1-hw ---,L-N, ,,,1'.g.-:f-g,'yx- -f:,,..r: :X , - ,j j , - . f g . f- , -- ., V , - , . A - - , - -' if .g- H- '- -,: V Q. ,. Q- ,-4 -xr-.-. ':,.g -.,,,j.:,1v.-. .- '-gy A W -, 1 --gig-A. ,- 2 1 T. 2--:fu-xpxtrilsrya ,Q-.h:a:.1g, 1g.-f1:'-QQ?-P' p ,fs-:W . ,- ,L-..i. . A. f, mf .- . "-Elf-l' , 1 f.9a-'Q ' ' -1'-2?-ef--'-.Q-1-':4.-A:-f?r.:H5:: iff,-. -4 ,...-..A:13' ---- ..v-A .. ., ,...f5. ..,,- , W., 1 in 4.45.4 Afylkvrvli-av.-. OREXZQ N , ,S A - .fi-, . T 'f' " w ,YZ'T4sZ"1-agxy' "lbQ':f'.1i-I RS' ... ""-.f-2,,,,-axx . .. .' 4 ,.,,.5f..-5 Af- X 5:74,-1,-p,3g. --j 4 1-,Egg 2 '..9' . :M-Tak ' , . ' . ff, f, -- ,lx,.-N-:jtgtxggqf-L-'-,,,,,f-,N 7, r .args -. f. , ,f-.NA ,g1'L,X.'. -ff' J,-V, . - ' -- - - ,Y ,:..,.:+ 'z wg- '-ff ' sh..-: -. -,--:J-. .-- f, .--.-gf"-.N as--f. -. I.. ,532 5. f1f,,.1-x, . .1 Q-- ,Mx .U ,fa ,MN . , ,N f .. . ybvk ,X ,Q 52.1, 9, . .66 - 6 ---.--qv-:-9 1- .- .f f:....,-.y,xQ--- N-,-.,,.. -.., -. f ,N ..... ..+f.,.,.,-.3,T JA, ,S5g5. .-,,,...,....,M.-3,5-3 , 1 ... J-'X .,, - faxfql. 'hiulf-,Ss-:J::t Q-5eG:,f.4,,.gL?' qzfgv Lzzgffafzg igif' - 4:1jafi:31fgf.iq:g9 A:-fi:-: R, .Lgg -,arf-,,Q.:g. - '- ,, , " 'Y -A'-' . , .ELQAEQEV - -e4:Az:::L4:f:L:J1a:Q. -fwiz-iw.:-::::1Q.A:::5x -:M "?'wsf x-- e.. . 2 V.. LB 4 -x l ltzqs-mba ' A-V -- N ,-sara ,J N - - nw v V-.-Ai., ,J-,,-.. A... X - - 1 4 ...,, . ,.. ,,, V- - .' -.-fr-:.f',f- ,-.nm Lg., ,,.:.. mv- 1, .J-4 , w - 3 '-fn-rf:.,,e,e+fQbgrs-9.vw.: 1: .' x ML,.'.1. w- ,:-.-73g::a2-gg, .c-'M 5'-41.13 J: 552.-w1F"f-'-'fx .f1,,vZ1,fSfmV-cfm -N-1. 44,-.1-+ 1-4-.1-.-. -. ' -'---- - -,J 3O!ORE 0-:f":,,f.Lzwfv-rw,f.m1f.1',-.eff +41-1: --1-1 ,L -.-My-.-f. fum. I-L .'-2-,Cp -. ., ..-., ,--,..--,- .., , , ,.,,, , . , 1 .-, -x--, . -- .- -f M. ,- --' -,- '-,rv - V. ,M-p.,1q1-. .L -1' -,-.f- 1.r..vff,,.'w.1 .f.1.-fm, .-J:-L.,-A. fi. .. vw ',f.vM..- rn. . VM., ,,. W' -, . -. . - . , , ' "" f1"':f.,,,4 f.:z:z1' .Q:ff-- wax?-'-.-1-r-i.efz:4a:..'.2.1.1-'.:-Ffa wg.:-ve-4 'favfwq-.fs-f'-:" 'L'-1':::'w -adv'-1.:1. '-f,"'ff?: '11151-1raE1'?'1i:'E---'l.L:f1'2T1,J .ir Aga'-:.1',:M:, :gg-.f2r,Tf,',if11-r:QA - ,.: --vu Vg,-rg' ',:w.-5:-4.--. X - . , , ., . . - f. - - 1 V .- , L i V- , V ., . . N . 4,,,. 4' .,, I -gf: ,4.H.,.:,, 3: ,,.:kv. ,.,k :Ar, :u.,,,,..x.,g.-,U1EWyhT,,-VER:-,x:T,f53! 'WOSIT 'W '1'Q:. 1.1. -. ' .-c.. -. "-54.ge',:'f -rg - Hnvvavzi--4'-'ggr-'.4w an-4:4 V 4 V ' ' - 'Y " ' ' 4' fm. 1--W.,--..,.4,a..,Y.. V-.,,,, ,..,,gN.. SECRETARY OF THE NAVY Many aircraft carrying VIPs land aboard Enterprise, but seldom does a VIP trap onto the flight deck of the "Big E" as an active crewman in that aircraft. When an A-6 Intruder landed aboard Enterprise on March 30 as the ship went through its work-up paces off the coast of Southern California, a familiar figure climbed out of the bombardier!navigator's seat. It was none other than Secretary of the Navy john F. Lehman jr. Secretary Lehman is a Commander in the Naval Reserve and he was getting in some flight time during his annual active duty for training assignment. However, he made good use of his time by assuming the title and role of Secretary of the Navy during the couple of hours he spent in an orientation visit aboard Enterprise. Still wearing his flight suit, Secretary Lehman held an interview with Captain Leuschner on KENT-TV. He ex- plained and clarified several Navy policies. He noted the long, dedicated hours that Enterprise crewmen put in to keep the Big E on the line and related the effort by Navy officials to boost pay. ARRIVING SECNAV VISIT! 37 wvyqonqwu mn-fn-1 ,aw mug: 1. qy ,gvmyn-Nm,-,fv Qc:-.L :nw-qw 1,03-ma -1-mfs..-1. ..-Q-uf-sv--H-.-V,-. vn- , X, ,,,, , ,, ,rf , L WJ. ,, A , ' ' 'volvwvfwoyq-mm'4f,v:zg4 ,f ,, f7,,f,,. , I, , - fn., ,f,,,,,, f A ,wfffzf ' A I .,,, H717 f ' .,,,,,,,u ,,,..,M,,,,, J, A M , J '- f -ff I A if 4' ' .' f , ' , "Hr ,1 , ' ' " ' -P - X , .,, , , 4' , I "'w1wgff-,,.4f X ' I !.f,." .'V"" 'f""', , , 4, ' I L.. .W , ' :- . ,fgmy 1 7 ', M 'Lg ,V I Vi 4 TM.: J, .,a-QA . , , ,im - 1 ,, I - LVM Q , ...,gg,,,f Q ' ,"' fjxf, f " ,Q-Q ,M 5 J. . M WA M M- 32 X SAN DIEGO nf-4:-5:-In-V t V HV v -nf A uwfuvnztrffn 4-.1.1.n:-4...nu.-flaw..-.-nr-4.1140- Q-...--...... ........ ....k.x-..-.1u,w..am............ ,- .- ... -.-.,..,- R I ,f If ,X fr fkf- I ff V. ,, ,I , ,A ff '.,j f ,,,, f XM-f..yjl::,.., . , X, ,,... N ,.,,, , X, , Y...--.- ,.,- , M.. f f y . ,, , ,,, , , ,. 'Y :fxlixliiififh 2, ,, ,.W--...,.n.--......,.4::7:::.:ZLi,Q iff-51 L' 'ff A z M Mf1VQ7:ZT:,..-..---..-.,, .....,. 1 V,,,fL,..n-,,f L Q ''"""""""'t7L:::::::::i2, fLf""7"' . ..,.. ..f:::,:'::.:'::r"'-"-'-W'--"M 'f7 f X , ,,A, W .....,.-.,,,.,- , ,.,.,,,. .,,..:-.-.M::1::f.,.L:.::::r:5 2 Gil--fd'--gg: fi XX ...... ..,. ..,......-M..,,.,.-..,..,, . 7 -.- .-.ufL.,.-g4Q-f--0Q,--f----W , 1 ., ., if xx f f,-, f ,, ,,,, Mxzirlz- A-v gin- in mm-.mmWWMLW ',,, f' X X ,V ,,,, ,f rv , 1.1 ,I ,...,,j,V, W X f , 4, :cf-',! ,ww " X f--XX f-'ff -fA:,y,f..,, 1 f' ff' ,, N,---.N.,.Xw,f-f----jj--3,.,,,,,L -, --Nf, f, , ff . XM,,,,,.,,.,,f'.-ff-Mg,-7,--ffkfQ-4-4.4,N MA '. f,f K .-.,.....--.-,.WMW.. rg N..,...f ' ,3 ff --. ff 1-lN..1N...,,...2,,,,f' 'J I X ,::g1.11-i-.3gf A Q ,,,, V- 4,1 ff- ---. , , , -y,,,54f,,A ff 4.4. .. I ..,,..-.-.,...,.,.M1--- 52, fpiidp4:3,z1,,Q5g:5:9yyQ3Q7 f ., ,, 'M 5 ffjfax-"'i':f',.f4z5if,ff",f' f f ,f ,,-f f ,V-rffzlff 'xyiff31",dl'1f?,z4ef1LMf,ff2f729f '9 2 E x E Az: 'f1" x L, ,,,, , ,, . ,, ,,, f , ,, , , f , .,,7, , ,V,V I , X ,, ,, .....,, -.,, .,.,, ,, ,, .M .1 A , X W , ' I ,-.,. , iE73:?3EE:1f4i1E1i5.3mm, Q f SAN DIEGO X 33 "i'J!"'i9P'3"""'I'?l'Y 34 X FIRE A 1, F' Y 1 A .I 1 ' 1 f 4 1 , - A 'K 1 XX ,I F 'N 1 1 1 SA f A' ' XM X-A f A -X 1 1 1 M f 1 X 'A' 2 AA S 1 Ap 1 X, 1 g 1 A-A AA AA if A A A M 'Q T1i121A111Q1111'Q if 141: 312 img EEF. ET-12 E Q 3125- f?'11f1'1'112 !0r1111110111111 A, A My 5lil:,'5 a1:K7J1:1x'5,'g1: A' ,Q iM'.25.zz1 , ,,5,4 5 34111: 17',,f1Ilj- jU,'lr1,g ff 1.xA 1 A1411 1.11A'e:f1'-A1 1-A 'w- IL T -AA AA1 A AAA, A AA A AAAA A AAA gfxxff- -AAA A.. O11 111i 111111 11J1IU 1110 1' I 1 1 1 .fl ' I 1 , . . , . . , 1 A A . . A-:Q A AA AAA- AA AAA., AA,.A-AA AA.A AAA AAAAAAA .AAA AAA AAA- AAA ,,.A,-- AA.. U Qf'5'1lf3 17Eil5flfl5JI gf 1, . ,VA A -A T Li . im PA --..-..-an .mn -5f.1fd'?1'7"W ' :-.pf ' r' "- ,f" 4 1 ..Ti:?f' 1--2' , f N "T Qif7f-Lf:?. '... NTff-QL., Q - - A ,uf . . .-as .1 ' --Y ' f 1 :?,g',:-.5-gf"-,j .,..fi1 serif: 'J' ., - 'af ,. ., ,L - -:A ,. ' 'V Qi""'L' " 'I-" '---rn '- Q-. . ....-'IQ mf-..?'-f' ":Sx'?"-"' ' ' ., -1,-3 fx- -la .-,- ' -.Q-.x.f-fxm -,f.u..,,- E- . . x -x -.- 1" 'vw -..--- ' -. x. . X ,J f Q9 i 'ef -1 'QW' ,ffifhsff r W V Y ., -- Q . Qlgfllfbi-M ruth ,Tj i '-'T ..1 . , - ' Q 1- ,- .A ,.. . -1. , ,A . ' h p x ' - -1 fii- N f.:.-55g.,.5f"-T375-: .-gf:-,.L,'z: -, ,. .V:,3::..::7 N...Ng . ...V-1 LML 5 ' 1 Vf',v gg FlRE!35 'l ' .. .-, 2 .IN ,,, ... L....hL,,,.,,. .- if jf Y I J gy gy iy, ' rw' 1 Q' gif D Q iv! fe ' ,:-5 . 1' J I Q--Q' "ff Z-., K v W d M--H gi 1 36 2, ,gw L , 'IFEQSVQ UKSM7 l "sawn I l A-Pk FQ S :Ss 1:13 L A . 5,5 ff f-:Ag-13.35--1".5"f" , ' ' - :- ,312 ,.-.-',.41Q- - -,,-,, 1' ' ' ' W '- ' if .-"-',:?5:f."fi...'5'- -2' 5,2-f 'f.:':QQ11::-gf --f , , -,f -P-A 14' . - .A gr. .i1::,I'f.77.'4:':E5-3--'N-57 sf, 'F' L-a."' 'M-P - -'Z 4'-,,4r.-: ' ' ' ' 7-Y ' A. L,.N1f'.fa'-QN "A --fs v- - , Y pr. 1 3, il ,r '--'Tv .- ,WY-.,,,-, , 5, ,,. 'F ,.,.-f -12" .af-fr ,'.f-M,-,lg Z , wa f ff-4 Q, ,. i, H I --4 E ,. K, i F . 1, ff , 1 " ww , fn Q, rf A 4 " .5 'mgzh 2 , s P- iii .antimi- li fl?" ff? - -Y I ns' V5- V, M ii H, f Q , -M. .1-'ity 'ff.4,,,,7ifi.3w -..: ,.,.....-A-- 7"' f .f 15 C ,DK S S .-u-rW1-p- rl ffff' f Jf1i,4f,:1Q1,f.111frf1,z:fL-1',f2f fn: 4 1 T-" 1 Q gui 4111 mf Q TN. "i -fl' L we 1 ' 1 " IJ Tx' 17- .'fi'1'f, . 'WIW 211' 111 7 '1 ml Htfwf VSQNf'?i:3'f'Wil f f V 31 '1 2 IW XX! H1l1 ,i4W: 1' Ui' '!rll""Ei1f 1 L-1 'H' ' EQ' '1 ,' 'V ffl I Hia xl - -if Ii lf E I' U 1'1X7fl1 i H191 1,Ii: E11 ' 111 12-1 1 1 1 1 - - f .fa 1 15..i'li1Lf1'Wa1f11' IWW: II ' 1 1 I1W1Q'1 ! 1 WIA1 lj ' 111' ' ' 1' , 1 ' 113 411 1 Q 1 15 11 Y . l '11, 11 1, wi '11 ij 1 1 ...mn Ill , 1 1 :1,L,'J 1 'ity H M YH NM! W3 1 ..., ,1 Q11 1. F11'111'lu 1I1i.11'!f,"1 I1 ' A .:::::::5555f 1 , , ,117 1:1 "kg 1- M-'1 11111'Jf T1111,,11 ,.H 111111 1 ' 155 72 "N Q w1151"' If X 3 LZ? H HT 1 Ji '7?f5:::::::':" E P .f Y?f1C1 1. I' M1 'A ' f , f1,2'1Z1!':' lwi 1 li W'1m1 'qf L lg 1 ,1q ffl ff! 11,111 1 1QQ2 iuF2Eg11W1' ' 7 . 111101 wiyyf- 1+ .1 - . .,+c1gQ1w. W1 . 111 A ff: 1r1:,:, 1. 1 - ff 1 XMI .4 ' .1 1 'W 115 '. HL' X Q4 K f 1 171 7' .1 -111111111 1 1 X11 - 111 1' 11 ff. ' 22? ffiiix 1 'A fi EE -illllfm .'f1a'11!f,I,1,-31 ?f?QJQz2Zf2fMf11!1l ' ' -1 11 fx.:-Q2efxf7.:1II1111 PQ 4: M15 V N X 1 11 Q. -415411 11 ,W .1zzz21VUU11 XS? ic J --111 217:-if! ali 1 '1"'l Wh' "'1 if 15 I 1,1 IIIMU1 HW W111 M1hlN.lH11x-b 1 x"'l1'-Eliw? W 1 u1111H'?111'W111 1 " 'ax mm i1X11:i1NfXIk My M X? 1 1f 'M' 1,1 ,..,. .,, . .' 311' '1f"'2q.jf,. ' 1' '.-:J'E?f1f1i11ea1 1 :'111111 Xiffgqli. 'fa' 1' 1 1' ' M.: '-lv' A ,111 Y? 11 1 11. N2 X X1 1 1 1 J 1 1 QU L W1 M - L 1 1 11 1-M1 WGWQX Q1 Vu 1' 1 11 1 W2 VN W1 if W We 1,5 1 x', 1 ,A 1 9 11 jf?-1 W1 1 1 1 K w 1 11. M 11 ,1 1 X64 M K ,1 ,1 111 N. W , , K X U 1 -I Lf ,.-f.- +ve? Q, T -"I u27": -U, ,,, MN 'Q .,1:f.5f-,1u,.qgi5-"FV?7 T '.E-A'-"wi-.4"1r 124-Z--1+-feaw5.'r1'DQ"f1z1v 54'-A '-f"rfP-3?-15: ? i,'.31EKLfJi1':2fiza-,zn-ii:'Q'v!ivC37':i-uf::f55f1:3i.ZE1i?fZf?,,7f'E3:fz-.7 'Af'-r '?H4"1- -41-,s3.x.ms - vi' i ximitsmimf ' X Lu:hsEf5" "- fQ,g-s:- rpabzrz- ':miriamsity.acgssmmgvgzf145141-Q.-ggff-.,Qz.Q,.f f - -' 1- -1-my - V' 4 0 - . K . , .. . ,V , , I 1 I .. . , . - '-- -omnzyr fl,- .' 71- - -f f -Q, 4 ' ' XJ- .A - f. , ' - fe-. ,.. x -- - ' K A 4--'M ' ' ' '- :,1,g,,...-.-an .4-My-..'.1,.-1g..':e,, -4 -.,f.. .'4.f,,,,..m . 1- , , ,. . .. EP RT RE -I Cf ..,.444.. --.. Dui Nm: Q ff" K 3 ,afzixr F K- ,- .f-"" 40 X DEPARTURE f xux -X4 1 .-.1 -c, ,N-Q' Hu www -v- N ....sm.s.!! .mg-51. ,efmizefsm '-Qggmasfa-4:12.,ff-4,-:exifwww 1: -eras?-4:q,,m '.-'VY 1nzmuem,i+as2:zf',:frJ1xfwww 'fd fr'-1: 'iff 11" V. :A U Y 30 M Y, 1984 - N'-ff-v-M... If-1 'k', X Q A' 'T x . DEPARTURE ! 47 f'4'f'3'LTffi:,i3E-'135-it'ie-24'f'2La:5'H':n1,:. 2:12 ..-XM-1. vqff.-.:...--fm. ..,. -... , - .. . -47 .A V. 4-..M----N -.-,c--:1.- 1.,:.-- -,m1...f .f,f..-.Lffww-4,11 ,-.1-. gn,-5,-.:--2-p:'-. W--, ,-,,..-,. - f-.,,, . V. , .,. .. . H" '-" -:P gf::s-gums'-f"I-TPS:N-Rf-ffilvvgiPf'w:ra-:-Qfa.-:?.gu5,2i2:5Jei5J32by --k5,43fg57,5fx-353-g..4 j,:3y.-:q5v1fr1Q'-,1-Qgpzf-Q:,J-gq5.y:,13f-51..,,.,L-1 ,L ,N ., I. ., ,, A ' ' ' 'W' 4'-f "f-f V-1-f V -A-- --wf-if-.' 'fi-gf-44-1.12 ,:::::"a5:i:sf:f-21:.q24f:g'1:5153z:g:L.:g,J.,::,g-: L fr V' 2 . V WL Kg-QQ. zqgizgrggg- ' 1-2014-:s""i.zf'iisief-'1':P2i:"::41rf"'--0:7--ef: Je--.',H - .,, ,, , . " ' ' -V -v '- -- - - ......' ...a....i,.. , an-so-m-nuvurlnfw fhriffgqv-,yawqgg-fy-.,f-. K ,, , ' N A 'Lx x N ' 5 , I , ,, .A , ,+-- ' - ..V ,- ., ..- . , . . 1- f .1 Q.: lf--7275""e1f:f?'f-- -' 'f '-.hi ,z-f: -ff' .mn a 'r ,-:f.:m'.. ef -, .- - - A - , , " J ' " " " V P-" '- U' "ff Y P --'N-1.:':1.1c..1-f-'Ev ,--I " - .,', - 1-. - ..b .,, - M ' A' ' ,ly l 11 H IL 1, I X 1 42 X DEPARTURE 1 , 1 ff Mm Q -'M ' 4-41 M... +-, .auauu V 01127, .. i X 1 x A 5 in f--- B..- ,A 'Ya +2 ' S N1 5 1 ! 4 4 ', i r 'I r u Z DEPARTURE X 43 -- IE f II I 5 ,I II I 5 I, ,I I . 5 Q-Q..-gl N .. ,MN ---- ....,.., I. .4 A-,j9,1,...,v M,q,-,Tpw AM , :Ng t-M L4 ymwdywZmyygqsgjwlA??mm?,2bffmygzgq,,f,f5.i,xqPf..4,.qy.97a0:3.n.3t5...f44.q,-u-Q-n-env:-fp-Q , Y ,. . ,, .w,1,.,.,,,,,r v ,v , ,W I V.T.i:fT.,Lg,,4,5,i,,I-v::A!.-up I - u Y ,-,,.,,, Y ,. ,, . . ,, , .. .-My , 'FALIUT' X, 4, If N w 1,58fzs,gf. 5-:fSsgi1vf,: 47' -vf if If-ff, f 4 7 ff, fffff? lfy6 24 :wfmzf .-:saw-ix.: ff--Qsgz' f:1wffz:,' ,f f Iv-fm ,U 144657 qwfw ,.,W-1,f,,.,,-If I '-1::. f ff., YV f muff -f W A: , fwwf I .g+.,R6 -'IA Nm vp x-,mf ,J cf ,,,f, W ,, f, f-ff, - .f, ' fh-f f 4 fmyff Y M., , , , f, , f, ,,f,,,,Q fwy ft., -pf' 'I , I fnyyf xy I I I I I' :aw-5::I yn- ,,1:,gf -45:42-t I , I -Emmy I 553 J I , f, 1, ,f M3410 Wifi' I' I ,I I ' f I-?',:'ff ' , -. ' I ,. ' f, I Ifwff I' iff? ff ,ff Z I 9222? I' I' QT- U sf fiiizff " ' , X W I -' I 'ffiafflf ' 4ff5"?' ' I, Q. Ir' f , I , 'I wr,-1-fr' 1 ,I 'I fi, I ,wwf 110, I- ' " " .,,-:Af ' ,-L gi1f.6f'54i , ,' y?f'ji5,' ' X 'W "IH-.V 2457 ' 'K 1, I ' 'lgw ' I' QI I "I 'I , Q 'fi ' ' W 535 f N ' A ' I ' f-'IV I ' FI' I I f:Qs"', i I - 5' 'K Y, 1 fJ?if?k I 1 , I, " ' I I '3M':'g1"'?Z " H -' .4 I I -' JI I I' ,J2--.?i:. I I I 2f',f3,'f" ' wiwfy' W wffizf Mia I I' ' ,I I 1 I A-WA-Y' - I I I I ' , fff I Y I ,Ziff 1 , ' J T' - I If ' I' 0 ' ' ,,- - 'I I I , QM. -- " ' I I ,,f,ff5'Z f I I' 'I IN4 If W I! 5552? 9 ' ' 1' 'V' ' ' I' I If' 6 ' 4 f I' V. qf N I , Ig' " ," I I ' 'I I I' , I , I ' I V1 f I ,, ,' I, I I I I I J 'I I I ' , I- f, 1 I I , ' I ' I ' 'I I I I, - I. I-. v I I I I .I I I N I I ,I I , I I "ii ,Q '-YQ , M 1 ' ,J ' ,' 1- 'X-A' " . . ,..-1. va, ,, VW wA,,,MM,,-,,.qm,,V,. ,Q wslgmauw 'Jigga'-Jmgim-iAL.:.A.,y.4u1v.1hq 5 sg I Molohzz I. ,f I 3 'Il I KQZIHZ I ' Akmaz' 5' jwl af I I O ,,,. I, I 9 -1 f ' Gb I ' 5 Q A 457: -I Xi., if ,,, , . I fn' KRW ix, N I KQV - 5 1. .X V wb ., , . --' ' I -I ' ., I ' J Q ' 'IJ i '--'E I IV g 52 I ff., .,1,-.wav -..,-'nn-Nye.,-vo-v I I I I I , I I i I II, EI Z Z li U 7 I Ii? If Z I I 4 19 june, 19 v I -I 5' 'fvy ,. V -I , e : f '7 "M2.4,' 5 -V ,- ' 5' N 7 ,Jil ' XI fl xv K .-nv' I . .f I f Q , -4- ' .4-- I . If " " 3 ,ww W,,,: 'I I Y fl ,,4wifrwf"' I T JI . ,' ,,,,,,,,,A 457' I If I 5 , I I 44 I HAWAII . I , I IE 3 xv Hawaii, the "vacationer's' paradise,'f beckoned the men of Enterprise to her shores for rest and relaxation on lune 15-19 and lune 29-luly 2 at the end of the first leg of the deployment, The crossroads of the Pacific, Hawaii is a string of more than 130 volcanic islands, islets and atolls extending from the northwest to southeast for more than 1,500 miles. ' No one knows when these islands were first inhabited. It was long 'believed that Polynesians first reached Hawaii from Tahitiin their double-hulled canoes around 1000 A.D., but recent discoveries suggest that the real date may be closer to the 6th century A.D. - Hawaii was "discovered" by the western world in 1778 when the English explorer , Captain lames Cook sighted Oahu and landed to find a group of independent kingdoms. Cook named his discovery the Sandwich Islands after the Earl of Sandwich. Between 1790 and 1810, King Kamehameha united the islands. Development of the Hawaiian Islands began in 1898, with a territorial government being established two years later. As tensions in the Far East grew in the 19305, Hawaii became a bastion of American naval and military power. Following the December 7, 1941, attack on Pear Harbor, Hawaii quickly became the hub of America's Pacific effort, which it remains today with the Commander in Chief, U.S. Pacific Fleet, headquartered there along with other major commands. y After the Korean conflict of the early 1950s, Hawaii experienced tremendous economic growth-and population expansion, eventually U becoming the 50th state. , Oahu, the "gathering place," is where the men of Enterprise went ashore. With famous Diamond Head towering in the background, the "Big E" sailed into Pearl Harbor and tied up a y short distance from the Arizona Memorial. A - short bus trip away was Honolulu and Waikiki, with its hotel-lined beaches that are ideal for swimming and sunning by day and nearby shopping district that makes for pleasant outings to buy souvenirs, dine out or go - in the k us an to all parts of th scenery and visit such points of interest as ' sugar cane and pineapple plantations, surfing the Polynesian Cultural Center. . . . 9 - r..., !:lAJWA!l-ff45g " f'7""ff' ' ' f -f 1 A, -f 1 .5 1 A V-4,1 . , - " . ,,. . J . , . , - ,,.- . A---H fl- W -H -f -- ' -A -- - ' """"?"" 1 """"H""5f 5:,,,..:g:r-14. ,, ,.,.,,., ,,,. , .f M- . ,. . . .,. ., . . A, , 1 , V I- ,.,,,,4,,,W, V. ,KL 5 Y., X- Ajgwin 5 i ' f -- -'T , 1,-,.-'fry ' ' ,,fy.1HA , N: .- f ,.Q:-,-:7fr'x-V-w3g5f':, 'Affz':f"gf 71: Y-"xi 7-513 -"F"'ff"4j"f3"f-"Y'5'--'7- 55 'gv-...qt T 'f-'L 1.31.4 .w.f:n-:.Ti':'L' rc.".L.x-L-14,1-D'-v: ,., . . . GNL, 4 .T " '5gg,--,fflhm L:-s. ......1,.-..p:4,....2.a: 'f ..- 2' 'A-I.,...n Q and if i i ui .1 V ,Q W! 1 H". ".,..4- 51: ,, . Q ' ' 'JL f if 4-V 'W .pry . , , nf' nf fill' A - 9 5:3 , Q 53 A -'W 4 K" W 4 ff ww,.,f ,img --1-N' ,,v,.m-ww M ,Q ,glnwhn Mft ""3vWv'1 ,W f.-qY!', J M, -md' gmvvf' Z Wm, fwfr ff ,f,,,.,.,,,1,, , fmmrw fwwfwvw Qfgww ,.,M.ze-vQ,wiA2,gg1fgLg,4539 41 ,-1, - :f4a,,,,, Vzirfmz, .. W .M,,,,x,,1,, ,L ?w,,,,,,,,,X,,,,, ,Nikita ,. ,. QL U f . --'- . - , V- A g , u-in-lwf -1 V- .-.1 .. - Q 'fg .. ' ,520 ,V-:, .,,-M -Q' A , sf g ggpfmvvv-lgg .-I GQ4.-,r,,,M,,3.,,,,,r5v "' +- 'ff f'.!:'.m. 'f"QeJ'l- J' 75.6. ,ff ws , M 1 , wwf, M fmvffr f of-W wivf-Zh "7v3fQfMf, !5'f55'f'f4W f P! f rf frff ' p,1'w:JL-ww. nn:'7ff4 Iggy-f3if7ff-U ,5i:,'e1,Lg-:y,74f,q .gi-W1- f,:i.f:., 'i -fm? KSN ' " f, 14755 'LKZW fmgfwgfwcy,-3,14,Winn Wxrgiff ' 725' W ' ffff, wwf ,Www 1 v,,.1,ff ffm, J umm f, 4'-ff ' f ,M .,f.f,,,,,n--qwzifff , f,, m .Q fff',ifixL:LLi1l5zfw wwfi,-mf,,z,fQ f'.ffyfw,3f" f.-,mcxw :f lax Q, W' zzz 7,3 5i.,?2 ,,,f,, ' 'f ' f 1 'U' , MW, ff ff yi, . ,, , ,, .,,, , , ,KW ,M I ,jjyyi . f X. iff' ,, j'1" ,, , g,,..,-,,Q,f:'.f., -- ' ' ' V7firLi,pvf"'y7f.fIt , " ' I ,73,,5?,f,5wpIfyy,?Q4fg' ,-rf W,r.,,f: .fa-.-.....,.,.,,...,,.,fZ1..LL. 1 ,af , MV. W, - , M 'bkmhm , . . ,,,, ,, 3.,,L w.cg.jgl- ff 'f I fzffgfffwmf'wiztiwgfffh-'7f,,m""'QW3 A gg ,ff73f' "Mft ,ff?'f".' kj 'f,, ,',-af. 4:e3M,-,vmkzf-Q, f ,L ,Qf:f,,. 7iZ5,7.,,44rQ,NH ,.,"jxl1f, X ,fx-a.4,f.3:fi1 -1 f I jfyj' ". -L J "'-'S fiaww.hezfafz-f5f,P5"si3' ' M'w'v,..""' MA-if 1,5-gm' .gfffw L7 N: JM ww '-+L 'W L ,si WWg,g"f.,HQ wi, M W, ,H W r ,M ,N,H,5wh,fgt4,Jig,meLQ,,, Aww Afighw fffz'2Z127?f+7f5ffff'2W9fWWFW Q17-544: 'mf ww W ,.mffi-f-f-ffi1Pf"''wwf-pm,-.,ww,f M MW, mm., ,A .,,,,,f,4 ..,,.,., ,,,.,w, ., ,J ,,,., ,X . f, , M, ,ff . , , f W M... , A W ,. , M ,, M ,. Y, ,,, .-,..,...,..4f.-. wwfuwww J :fWV,,,,,icg,g,xg-, ,4Q4fgy M,, . M ,W ,WM ,f ,. ,. ,MM ff-'ff U ,f ,WNW ynzfwmcd fw'y'f,,f uri ,LUX ,,,,e':,'4 "ue ,Z ,,44..,4-,,,f,,,,,,f,A ,,,j,,,,4,,,,2?f ,,,.,mff,,M,,.,,,.,,,,,W,,Z,,,,,,,,,ffM ,,,fk,,fff f - f v HX, rw , ,, f amWM,,,2gq3rM?Zw1,,,7 M f, fffffvfwygfrx,wwf'ffw,,: ,W ,. , :ff ,-1 ., , f-- Nwf 'W SWF W' ' " , " zzfwfwryffff "1 J ' .m.,,.,..M...,.,...w'-f'-2 I " .....--,-.4M...131 A ' f 'f'i.1,, 5-- V"!x,Y9ffl-'ZLT-ff 1f5f""'75 ' '1fjg'7':f Eire! AW '21, :1'ZCZ..,....-b-...,..a.' 'U A rf' " aw ff! ""' AM My M W, ww, , .M ff ,Q ' "",,,fLy Y' w,..., WWA A JI' V ? 4-Avw . A 1.,::.:. -.,,:Lf,-L: 1 f-we nw H ""? . .W. A1 " VV ,. ,.,jg,g,,.hg,4,4,W.m,,,,:,l'yy,i1? L.,,5-95,-afT,,.+-ffjvff ...-+L., ,x ,W .. ,, --...I . ,HW VW",,::fi'Tf4ffifziwMZWjzPf,ff'ff',-, -if, fy, J, , , f,- . ,, ,,,,Wfgff,gJ, .... . ,V f W , ,, f ,, V Y, M f , ,, V. , I - W N ,M W, .,,k ? ,bhvbV:,,6,1i,,,,,fsk WT' 'f' ham' fff"1,firW2+'f"",,fff f, ,-mf ., ,,,,,1z,'? ' ' ,f.,, 4, ',,,,:'-A, M. - f 'few pw?-Yff,fz,f" 4 f-ww ,xr fQ1,,,, Yr icy: W 22:11 Wfty, Lv Wx, , ,, f' r'ff.,f': A .,.,....,Lf f Mm ..-.4Lfu,::L,.g..g.-.',.."W f', " , .' ge:-...4Zl,.g1,.,1,..g2,,L'.g,' ,W '- f57ff'f':4fW"'-X4-'Pfx-',.Qs'7...,, f V- , .,,,,,.,.N,A..f ,,,.M,,,, ,.,.M,E. .,-,. . ,.,,,,., W. ,W ,, A ,. -.--X ,,.,,,,.4, , ,f5':".,fff+',f.-..,WJ'Q7 -14-af' .Q --N ,i5f5g,g3,-lag.,,wsg:j,l,m,w- ' -at 3-f,,L,..f-,,1f----b :g.4.f,'ff1? I ,. 'wygfqfg- V.. K Nw JM., W- N.. ,,,.- w www ww --1' .K-A -vg, 39,1-,-Q-.',f,,,,,.,,33,L im. . , , ,g,.4Q....-,, -f ' 'M Q we -M, M ww' MEAL-4.54, M f, xpjfj -as-M. W M bww N-1 "M" W 7 L W-Qwxw A J-ML ,VA-+334'1r -w 'mfflv ,rdf W vyww ...wg-vs-,V -,G M I, MH " Q "':+.. 1 41- vf' 4 'f vw-w ,M 4 ...,,fz:x-wx ,B ...A -1-N wx-rf Q .fgyr Q vw' WMM .Ma nw :emi MNMQMW,-J-m,,.f.,,, s.....,N,-1.-W, .v-f,,.,,w-.qw -N' Ar' Q-M wr.. M......W,..--5 fxzdwwmh "' ..,.,..wzw-5,1 A-mx ' A .K ,WA ...N " W'-M 123 fr. Q.. M ,W ,H if ,fw,..Vw+'A 1 H QR' A wg-yy' Vw ffsvp:-f my K M.. .avr A ,M 'WY ""'M" gf'-vu. 4 .Jw ww. NW am mf- v WW fl""55aQ wfwwwx-vga, v 4UL,5,,f.':'.... 9.-gg ,,, ff Aww Inf?" el-nv ..:..1-...www ww ,J 1- 'RQ 3 '4 N. ,nv M' gf' w fm W, wf J., Wm."",..".f.n-n--fl ,..,. 'M w....f NM ,h,,,,,. ff- Q-.Nfl 1 NB- M W N Y-:KM f-are-" P A Www, ,W-A A v-'-Qu..,,f. z'r....y A , -f-ff ,- 7 f-9.0 wf"9""" 'W 1 v W ...A V, .W MWA.-ugfgglh nw' -M ,mm +,,,,, ,...,:n -M-,+..4., -..,, www N, Y., Q Ny W z ww! 'wx WNH 1 A 'Amr Y JK Q' Wyf,-mfg Uv Q, N W- fam My MM M M-Q .MQ ff HAWAII ! 49 , , 1 'af f 'MW' ,-wfw.,,' 1 ,,, vm me ,ywf ff" , ' W, Jw f 'iq' " ' J W ,p V, ',-- ' " , V P 9 . , ,, ,., - f ",.V 1 . ,, A hw , K on .V . . 1., A , Q. :- , -'H my ' .., -f '.v :nv 'fgr- 'Q ...v A' Q,-j:MiQ,. ' a ' 4 111.9 0,-fu '- . 5, 1. , - f-. K-',,,?...- - 1' N, -., F.: A' ., U ,.A' -.- , 'Sf W "' -' I my frm ZW-f' , 1- . V A , ,,,,. f ' "M, j 'fy' W..," 4 , ' W hgglifij, ,,.1-,V-. , - I L vpn' 2 ' . ,za ' 1 W f-, I v-.its-, a. .Bi '-I N1 , 1 ...F ...Q , -QQ.. ' Y 1 .- NP I ,. -ii.. -'f .:f.: q f""4y .,, 1 - 5, 4 ,, H 'vu Wg v S-. E f Q .- a ' -4 , 13,11-'5?2'.f w I ' -4' K' ' 'w-,zur 'H ' 4 -'Qi?WVf??45,,f ,,,f1,. Q. - 'I ' ,::zGWfme.?' Eff, A -r ' Fi .4 Q fwfr' x gi' g ,Ga v Q .- -mv W. H., . '1 'fi -in 1-r. . -0' T4-1-,., .!f" I nf' V. f f . ,zip ' 1 Q93 6., . qu, 3 . O , 1 Q ' Y , . C '- ' ll E . S+, N , - f ' 'NWN K I x .. . 5 :- .ff , Q , 5 9 .1 x ,. '-M. 'I ' , , ,.,.... V--' E 3- nw. .-,..,..-.m......' -f-- I 1 E ,:.M,.ge...4N ':-x E . gs-fd ar- aww-Qlffg -sie . ..,, ,Q is ,wg - X L-' g l. 52 f ' K hfffixflizffr y .,,,, ,.1:b- X931 13. f , X.. Ur N '- wx. 1 ,K -, , .., ,,. Q xgw- LM- A--Q-421' 3 1 . ' k xi 'X K lm, 44' R ir ww fa J' ff ' FW -1, , WM - f 9' x ,gm - f-Afywaf.. , - MMM wg., 3 "Q 'fm YUYA M'm.v?'- 'fa-ftniz wg Mx., 1'-ii ,g., f ff. fmf Rh qw 1 J.:-..-..J1.1A4 'li Q -1 Fr' Y . '. ' . gi vw N. we -. , x 5- f 'N XA In XM fx A ., 11 ggi, Ng. . f1!V,F,XQA I- ' ,i, fs. IX :SFR .- K N w ' R Z 'ff 'z,Z,' N K ...X ' ,V ,. 'mu -w S 1 , j , 'M , . +'. W 1 In me ' A-5 " ' , ' .Qi , 1 ,V . I h QQ K ,. ' , .f . W ., ' - I ' : n 1 ' ' . 1 1 , , ' . " .V - Q I y ,. . - . . ' ' .n " s , '53, . . A 1 , . V 3 - I - . - , wg' '-,,. ' 1"Qaaf,," . ' . , A if .,.:. -. K 'Q I ,f,,,,, f . ' X . w 02 1, . 2442 'W ' "3 ' N ' f' ff'-ffffww --Q. H ,-1 . ' , sf ' K . J-V ' fef, " f 1 K x f MQ , ' ' - . f an ' , f fi ' N -WJLQXG, . ' 1 ' P i ' g,, "' LQ K-f2,' ' Lmfl , ' , v ff: swf ' ' I ' - - K' g k:5z:,j,5,qaly,-1 ,- , . 1 . - V - " 25:12, " -V ' iq ' . + X 'wT"f--.."lf'K 12:21, ,,:iZfij11"J" , " ,. ' " x jf- 1- x-ii.: ,g5fW',"f' men, f' Jn 'df 1, X-f ,fw . A f I , . ,ff , vw , V ff v .L ' I L .V gl 'Aff' lvglg V-zftw 3' 7' ' Qyrfr' , ., x-xif' ' 5 I . 75f73"xf'u'f f' V '15 f' A' f,.,3ff?7w,' , Y V fm 'f ,' f,, f -. Ja ' . . 'f Rf-W ., - ., - . , 7 , .2 - - . . 3,Q , J-' , " 211. 4.45 ., . - f,.asfM,,m ' x 'W-,:w,,,1Q,,A SX 'VQWQK RIIVIPAC 1- -d ,. A 52 X RIMPAC 16-NEHG ,fir K' XQX X K1 HI' ye? ' RIMPAC ! 53 nf-. ' .-. wir-v-mf-"ff--1: ,1 ' Y , ,-.,,.,.A..fr- . , . W -A-":':""'F f'5,Y-'Tix'-'fifglg-1 975V f'?'KT7V' 'A 4 ,. 3 ' - Sapa P11 'vgsgf-va 1...-, :ff f ' .1 f, - X Q., .ir 5, -, -.Q 5.9! ff .-:,vxxq-X.,-,.y-3: - - , f f f . , , ' '-,w '- f, ,-,v,f,f!zw fy. y,+.,., MQ 'gg A-'rg X . rg- fm. v-:N-M - i' uggw - mi A. . " L -V J-V, f X-. , ,wmv "-fx! - my .M .4 I ft: .- , , gf, -XXV. N., -.--Si Lkikykl 133.572-,,.. 23755. if - if 4 Ffiii--4' 9 'i'Qgf?g4"7. ffrfiif A f 9k'1f.qf Q-gif 5 ' R Z " " -, f'f"r":"'.wf X 2-ffkpr' 'f 1'kL9'ff"g7 " Q ly. 'A F VL',r-'56 ?,f,4g. :,.-v"v,m,:jF..,f2.L3 . Y .,' A 4,5 Q T, .yr , ,-,rfjl 'I'-ff-4-1f"TX"- 7',.l'f' AQ' K, . if 'Q' A-'ig f' ,ffbgfli esfg.-'gif .' . , , .4.-1.,Q...,. .,r N-,L , iw' ,?x'r1f ,Xi.+-5.x I ff ,Q wfgfzfad ' 'fwfsfl-i,tf-11'Fife?9,135 3- ' fy' 3- ,-1' - fi. , - ---.-- ' f W.-wg -A 'r X -. f.-um: 5.1 - .. 1 fw,,,f-f- ,g1r i ?5li-'-igxiilfgkfgff K- , 3'-'.,5j?3 i'5,,' f.-3-g !:T.Q13 37 ' Jfmflsffi' '.,j,:L5 Kung-1.:'gvLj!f1f,.' .- -1251 Qffgx - .13jgigfQf1g,1ui wif K a- -: - ef 963. 5' fvi Q by' A-NKLx.QYj1Q. , paw .V- Y ' -' Lwr' ' f -Jef. ff '--:X-.mb ' W - w. - K ,-.V gf ' r-..N- .K ,z -' ,. al - ,..-A .1-gi ,,, -,g.5-sw E, , f-A..Nx,, ,d yk.. X M , rr' Q- rjf... 0.x ,. x4,.,.Q-...e. A A HX-12iiif.f'f4q' r - -rf f , A - -fm-' 2 , " Q .Xxxg5x:,5,g -yggffijfi. s N . K . A-:. X 'v"' -. ,J 1. 1, .f:Xx5'Qm2Q5fi,'vqQ:f1 X . rj A N H ln X ' - -V - . 4 fs v l 5? . 99 Gwy -iihi :V -if RQXR5 4 - X , V ,,.g,4QAi e ..-Q-Na-Lanosuuanxxi ---"' ' f.,f x51-v.A2'f'-, .ff wt., , Wa, X, ,M VW, ,,L,,, , Twm., ., X., M.,.,., ,W " x -sm , , .ww-' Afkwm . A -..,:x.a,-W J?-, l m L saf- ,wx 14 1, -w i v-wi, IN"'fK"2Z??7'vs:41?"f'HE , '3-"-'tick -?2'-:S0?'- fs.f4f-':T1'a2'a2,u:2"'m'Ef- .?-.4-.'fi.5"15-if"-.2 , , , , , X I, V, V, , ' I' ' 1 X If - 'I fQ""9'5fl!fj:V"hf',Q"!M:'5' ' lf-fi, '14 W 'X , '.' V' V, -VN ,'.-N 1 V 1 , X If ,I gwff r J, gg: ', .Ar - ,. If If-,,f, ,,,, Xfvff, fr, 4' 5 X ,X X, , A, I, ,fy fl, , X -X , . I. x f fn ' 'r ' V , 1 4 my , ,V 's 3' fe ' fx f , pf 3 3 - fy A k Q uw ' """"w"'A "H, , , ..,, , Y-,.-,. -Wx, ,:,.,T', 4 , I I .71 ,i, ,WMA r 5 f" f ,4 ,:!, ,yvra :J l .1 Q wx. vf P . . .Amy I A f X ,Q 1-f .Q 'rx' Q -A L 56 X HAWAII R' xr- 'f ,,- ,4., ' . -'Pwf --f3:.""-A "'f I 1 ' - -.,-H, - - fr- --,M-.-. , ,'--..' Q. -.wfv-.-sw .,::- 41 -,, .'- . fic'-19:-?yg4g5 .':- 5,2-it-'.zp , wgv f: - .ki rg-T-a',5:-,.,:,, ' ' ., .- --1f2:g1:.Qf,1f fgilrigu Qi-gSEfg,:11rfg3P:"-:.--'i'sa,r'1? - " 5' .,,. ,s,,.. , .... .' .",,.g ,J -, ,W --..-., .-f,'- . A - L- -,' ng . - ' , , 1-. -' ......:,--..- ',,f.,,, '.... ,:..,.,,,., ...-,: .Q . - f, - f...,c , . .--, ,. Y Ag- :As - ,,ys-V, F . ,4 . ,dy . - f ' - Y Q -x ...fx ...H -4 .. , . .. .-,- . ,. , , , ,, , ,, , . 4 . A X I H A K ..- F J. ,.-,. .--,- , , ,f.,.-44vr f.." ,3g,,- .J . . -..- -,M ,-- ,F ' - - W f,.-,,.vI,-, , ?r' K ' www-...... ' f HAWAII f 57 -r-1xvsfn..-funn xn.q.n-uznr, '21 ' fff xii? A ,aff 5 772 ff f fffaf--f wif hcffrf' ':f.2'f:f,.:.f,yff-4' 4, 72'-pf ffff- W, ,U pf , fn em'-1 f 'f ' - '- ' 'f - , ,-, -y -M-N AT- ,-V-1,frr.veez'.Wg"'-gjyzlrfaz-nr-'+ I V , I ' I 1 I I T :fr , . , Hifi 1 ffl I 4 J ! A 1 l 1 , v 1 f 2 1 i. V 5 Hg ,A ff 2 I 3 FACES DF 1 Q, ,, ,V-fx' k,, fix , -ng, ,f W, "f, M, - ,..,......-....'.--. .-...,.---A - - t Nav,-i.--u LQ .gnlwfff M ' lf'Y?', uw-3, V A" " ""zi' .f Uv" - f 1 LLM ' A Y . M 9' 4' 1 7, 4 . .,. ,,,.1 y-N bmi? ,W-' 'E 1' fefa?f 'W' f-f 4 ,P , WC' ' ,st nf' f 4 g4a,?.ff,. .ew , " ff?f'i2ff:w fwfr: , JT, . 57 f2fw.. ,e2?1 'mr 1 V, f v " , I ' 1' f ,ff 1 1 45,1 f If 71 I I ik. 'iff'- 122,117 WW'9.,455x, 1 ,-va 11141-: - - - ar-:nv..fz.4m'g.wr 4:,.,f.f:2 ,'f1:,qg..g, iygfq-,,-..,,-,,,.',.f ,mage-,.-,,-h3,,,,,,-1 -:1...,q.., l:.,q5,, ,,,.1....l,,51 f.- . , ' . . .-1-1--.wav-' -11,,v:zf:ff-4:1141 Q:-:Jn .gar 17 E279i:?,Pf-'Fifi2'??:4:'g.-4212591211 -jx IIL IHPPE E fl 5-R , 'SN . -. .-nn., ,ff . ., ., fe ...Nm-nm -.- .W-oxb.. ,,,....-,I -f -, .fn -' - war U.-I 'I LQA--...J ...,.' ....,,.,:f'fR' ,Lf- 60 I PHILIPPINES 1..-mmnv ..4. 4' x .. . . ,L M Q Q 'ff' llgp A ,xl I Lid? r, Q I- rA-el-Axiwlkwsvagi I f P Entergr-ise cruised through palm tree-lined Philippine islands, out intot e blue South China Sea and north past the mouth of Manila Bay on the western side of Luzon to arrive at its first Western Pacific port call- Subic Bay. From luly 20 to August 2 and again from November 12-18 the men of the "Big E" were able to experience a variety of recreation and the hospitality ofthe friend- ly Filipino people while the ship was readied for its long Indian Ocean stay and then the voyage home. Many crewmen took liberty boats to Grande Island atthe mouth of Subic Bay, where they enjoyed such aquatic activities as snorkeling and scuba diving, individual and team sports on land and gigantic ship's party that was held for three days running. Back on the mainland side of the sprawling Subic Bay Naval Base our crew had an almost endless list of recreational opportuni- ties including go-carting, skeet shooting and horseback riding on trails leading into dense green jungle. Some of our shipmates invested a portion of their hard-earned sea pay in stereos and cameras purchased in the Far East Trader Navy Exchange store at bargain prices. When the sun went down, the action shifted to Olongapo City right outside the base gate. Amid hustle and bustle under a long stream of neon lights, sailors strolling along Magsaysay Drive and Rizal Avenue could sample the delicious Filipino cuisine in res- taurants, buy hand-crafted souvenirs in gift shops and join the musical beat emanating from the many nightclubs that beckoned men seeking to be entertained. Other shipmates ventured beyond Olongapo, taking a bus trip past rice paddies where humble people living in bamboo and nipa huts worked with water buffalo called carabao. They traveled alongthe route ofthe Bataan death march, visited Corregidor with its gun emplagements that guarded Manila Bay, the metropolis of Manila with historic sights reached in multi-colored jeepneys and farther south the picturesque Taal volcano. For the real adventure- some, there was a thrilling ride in a "banca" boat shooting the rapids at Pagsanjan Falls. And, for those seeking peace and quiet in a cool atmosphere away from the humid, tropical valleys, there was a tri up north to the mountain city of Baguio. This island paradise will likely be remembered by the crew of Enterprise as a port that had nearly something for everyone. Q PHILIPPINES X 61 P -. - K - - I. v -.- --W. .. ...-.- . f.-A -A-V. . ,--..,-,1,ff.f- P. .we-I-A''.::.-151:5-:IFJ-fi1:-?b117'?:"-'ffiigfi-'If-f"iJf"f63 l'Pf1r ' , . ., .. . , . Y A, . Irv. 3- I, .-,w-va-f1,u.11:xAf.Lx'-fa--51:4-wfaxgerizulrg,qP:e:.--fr zazzf-pfv:1fw.5?n1f.Ia as--nvf1:fnv-.rifeslifffiffgff-4'vs:4Lx,Iw-- 53:--af 'nuff-f::s:I.7:f-fur.-.121 -M .rm ffs: I . I 5 1 -1-... P we-Pg, .,-. '11,-r-,,,.--.-1 ,' .QT-,L--I : ,,1gp,.::.3-Q.-.1-,::,v'.f: .-P-'I-:gg-fb-, 5v'.'4,g : 1,-,fa-- .1 ,F:v.+.:-A 1:-f.-gf.-+3-.1-,, ,1f..,-ff-21 I-QP.-cv-v-. 1-sw f. , . ,.+-:.-u1,a-.-:'- -,4J44v,w,- -If-re-u-55.1 -:I-:1 'G-4' '-,..- -I.ffwf,',g. -.-,.L : .:.,,11Lg-.. z -J f,.u - :A-I Q-.ef ,c:1'45'4- .nyf f -. , f, f 4 , Y , 4 ,P,-,-fy.-:.I,. 4.0.1. -P.-A,.1,,L.vv.,..-..,-'J,,-.I..f,-rf,-: --.. Q., Q., in--4. -.-.- ,-.I-1.:-.,-1. .,-1:.-.-.-YM.-E.-I..,JN.-L..,--.-Q,-,q.f.,.:qw.,, 4. ,IQ..,., ...-.q..,n:A,..,.fff-,.:.1,.-.-:IQ-W -- yzw.,.,1,,.,.,- .,,, , -,...,,.-,,,,, ,W . ,, . . -,,A,r1:3,,:j 13.1-grlgi...-.:f,1-- ..L,3,.:, , ff-1-5-1--Lg-Pa-' 4-r.,-6-' :g-5.1-ri.-1'11.-2,-:ggf.: A-.:''i1g1f,:,1v3-ft:,211-nf:-fsa-zgzal2E::Q'I-I.--er:r:.I:'::+35:5f:m411r.:mm-.11-, M., hmig.. 1-A-Q, fy,-.0-1--.-NP-A f-5-'fr - I--f - - .4 ,wp in -1- -1, ,, I f , 0 .A f , 'J 1 f 1. X Y. X I f y N f f f A " N 1 Q 1 R X f 1' X -L. ' ' " I , WW MW .V . .,,,. . If ,-4,-n,""' . , . , , ' ' , T - I ' , - 41 -'fr -I.. -Y' I 'I "' "" -,Qi -43 P ,. . . .,... .. .,. .MM ,. N . -I M, WA- -- . , in' .. . , , . AA . W P N f . ,..... 'III , , 4 'la xx? I 62 I PHILIPPINES "' .f.,...K,y-fha Hum, P- 'W 'P' X-N ff 0 Jr-ffm In AI- M ' H I I I I 4 I I 4 1 I I I E I I I I I I I I I 4 I I I fi' f ll ' Lrg , 2, QN fv SI 'NI 1 f ,. .I 'ui '- ii :5 1,1 I1,I LI, ,Ia Ia. - W 253 "WU 7 'lI4j, '. fl!! f ' V1 ', .fri 1, ffl If! 'EI iff: 5 II: I. . ' I-1-1 ' QQ . 4-7 .III Q,- vrl III A. 93: 55 'Ev 795 +9 3312 if I -. xg-. .Qi N :- I :W ,W QQ: If E19 I' ,QQ Lf, 'Iii 'Fi Hg fb: sl ix I! I-"K 1 If If "1 QU. NVQ fn 6,4 5 11" II' LIE 'W in 'ff fi -4 'fl rf IP if .I -. i '. SI E3 17 :"' 'ii 5.1 15 S4 Q. , -'Z I PW f P cg . I, -511-, I,, It 5 Z'-" 'ILA iff ,I I . ,I I ii Q - if II X 4- A mx xl I .M W'-WVMMFZY PHILIPPINES I 63 h, 4 1 1 ffv :N 1,5 -'10-xx 'Q I we 'nf rggu-si,-Ag, 'Wx ,ff -W E r "' NI. ...ev ,v 21:12, 4 ffl' 4,1 ,. xfjllfv- ,,. if ff f ffl 4 vim '9",, -In f 5 Ja ,f f Av f' '-1: 'N' N fb., rf,-. , 5 x Q I ' if!-z'::-'f,+ , , - 3 , 1 ,, -A-fu-' ' 1 -- I - Zffwhbffig f - V' W"'P'f',. , L' A wh!!! 'yY'3v23w,",Q.,:,5g4.L T , My ,, ,, ,Fx f' - . , V wifififf ,,. f , , -gf MW' L if ' . , ff! ' 1 avg - . ""' S-J., - V . x . , T' WYE? - ' VV? ' ' ' " "VF" -kiw- . "ff, ' , A 132511:-Exif! pg -,rw Mfg- '.'w.,-w+-wif,-5,5--':3i4,eg4-...M . .. f . N'-:ff2ffzv-ff,qs.:f,Qing-Q.. .1 ' K "4'.f1ff'f'. iff'-1'-if.!f:5vSf.,-I-N4-1''.'py'.,fg 3 - -1 42i:fvEJ'Ka" gf 1 :Z if?---.zfnfegjsif4gfgfff2'55i5.,, , ..,. . . , 1 - ' 'K wwurzi 11121--66,1 ., Q I 'X 1 W 4 . . sw. W -Q , 1 . ul m1 1- J Q4 if 5 -I ' Q ,4 1 4 1 ie w 2? n l 2 I I I I I SHIP S PICNIC S I GRA DE ISLAND SUBIC 4, gjQ fm-, 1 IW ,. 1-Ann. 'th .vnu- l i 1 66 I PHILIPPINES ----1----Q...-M-w -1auh:m -"-H4"'9- N? -s-Na-anno-..a.snh.,.., .Q ..-4' nm, e fi' vw ' . 315. Mweifr' 0 N. W' w , 'CWC I, .,f,:, i I I ,f 49' 1 1 1 111 1 f' 1 1 11 111 1 11111 1 111 1 1-1 1 ,V 111 11 1 11 11 .1 1 1 11 ' 1 112 11 .I is 1 5 '11111 1 1,11 1 1 115 1t 1 11 11 1 11 'L 1 ' 11 1 ' 1 111 111 1 1 511 1 '51 Q 1 11 ' 1 5 1 11 fl: 1 1: 1' 1, 16 -71111 .. ,Q 111 ' 11 1 31 1 1 f 111 1115l,51",: U3 11 we 1111 1 SfQ?Ef i f vzfigf' 121 1 1 1 11 1151 ,1 1 ,af 1 1 1 1 11 11,1441 1 14 1 1 111 1 1 1 1 E1 1 1 1 1 1 13 1 3 1 1 1 1 121 1" ' 1 1 1 1 1 11' 1 111 1 '11 111 11 1: 1 1 .121 1 111 1- 1 11 1 1 11 1 111 1 13 11 111 1 , 111 1 11 1 5: 1 ' F1 1 . 111 11 1 1 13 1 1 11 ' 1111 . ij ,1 V1 1 1 1 ff gl1 V' 1 1 1-1. 1 N 111 p 1 1 1.1 , 1,51 r 1,-QV.: 1 ,...1 WW.. uw' I --.Yi E E ,,,,,,,.,,-, ri-1 ' 1 1 1 1 1 1 1 1 1 111 1111, 1 1 1 1 1 1 1' w.1W:4M, ,ff-f "" 1575, WT! wS'Wf'1"',1,3' 1 dwvfwf' W ,,, , 1, 1 w 1 , ,A , 1 W2 1 1 ,V ,, M., ,,,,11 1 ,f ww -., 1:11. " ' p, 11 ,W 5' J MW L1 1 1 1 L r flu 14 ea f MAN OVERBOARD ...af- -fz "' ' Y' ' V-" 'N 4 1, ,, -'ff sf K -1.5 . k,f".., M ' 'A 455'f7?1"' tw' 4 fx ,.- rw ,.,,..,,'n ff-'f4,,,i.m Q' ,, J , ' lu, we MSL.. . , ,, , -4 ,iii " S 412' f ,455-1--f1m.,..g.m. ,, , - ' ni- .qs -' ,, ,, - 'Q - -' ,. "' f ' , ,,.,, xx , W ' "" , Ar f-51,1 4 ..4Ov',, . 'f ,1rv1-g'v-'.'-.,,g,4M,--, ' , ' , -gf,:,,M',..- 2-..,,g: "'f:a5,,.. 'Ev 4, ,, "'-ffi,1,-y":s-f- 'iff'-H , , 'iff'-f-4" " f , X" .-r"':"'-l"' JSP' .. ' A f LS,,,,,.,.fQ.ff.'b1fQ,M,:sf-,QL S , -,ff,., . ,fy-S :"Q,gI,g Q L..,Z4f-W , , "',g3Sc:.,:r' 1.-Q' Q if " ' V f'W"Qia'y44"'ffvl'li,w-if"' , , '7""'4f'-.v ' +1 "f , M' , ,, W W .45 ,,, A L M M A .N-'.-,fin 'N'--'M-P, V+ ff'-mf -v .. ,1,3y Qffwvw LA-i,f,, , '1 - -'Q 4 4 ' ..-,. '7'1f'f'N"f ' "' ' ff' ' '--,:" T?"': . ' .,,. ,L ' LX,,,,g7,.,, ff ,,J 4 - 1 ww..-M-nz N Wx4f",",'iqgv'f" f 'HW ,A " s0f,f4,i.,.19N3" 'Ani-gf-JFMW My 592. ,-. ,.:i,,"?'!F"" M -wv.s..g.,,-, hw, -,,f-y-5:,'.1"'7 ...-5-...JM V , , , ' Nav " ', w , '- .,..,.f ' ..-W.. .,,., ,. AGA M A - .-.-m,..'- F. ..-4 , me Q V If , ,1 J, 4, 7,1 Zn, ,K LVIV V , ' Ln' 72A-F-Mg ' rs- 5 wwgrwbf. , . 5 . 1 H? " ,Mmm M19- 'f www' .mm "NN W-,WY N' M .M-, "N -'a-'s.w""?fz,v ,-in-v"f.'-f-a--' M-H ff N N-'M---" ---' 2- W" 'T' """""" .g-:- v-wg,-4,1 .-SU, if f"'.Jf.g-' 'H-"j, " ,LL-Z":' iff.. "".'-.l' " --Q' 0 g,.,,..,1r. .MW . - WJ M W. M, N., J.. W-'zzz' W1 F .w.h,, , -t ' ' -' .. Nh A ' f ."'11f-4r"N-'::,,'arf?54' r. gg3,.aAf.r,.1:-Lf' 'i:1,q"'i"1w-- ' H" W.,--V .,,,. .42 31s- zz..-V4 -. .- ,e ... - 'Q-V'-' - - - -.. af' 'ff "' Nw-f --'fnf --, ryan: I A 5.61.-?45.,t,,,. ,f.,.. ,,.,,.,,.u m..,,,.,,JwAL-e,,,'54 K. lp Nw, 'Mg . .,... ,.- .J I ,, ., A, V J.: V A, It 1. A12 ,,,, 1-1w.:YF ,:,,4,lnixv' -f3g.:.,,wP',..,,.L.,g7., .f,ff,"A.,.,KgL . , 4 fx h 'lv " v W ' w f , .4 " M , , F' V , '- , y .., 3,4 -A1 - 1 " A , mf' , ,. . X. 4 -, . V V" , - .t ' , 1 ,. 'f ." 'vf -' 1 - MI-- f . , f . fn, , , , W- V, - , .u ...fA,.,. -ff , S. ,-f W, ' .Mm -M .W-tf 57427594 I ,, 2- f - ' ' J' '- ' -. ':""Z. 1 - " , ' M1 , 4' , X M, H .V , , fb I Q ini- P ,..,,,. , m a . f f - ff 1 -Y' 4 ,L ' U t I' ,- P an , ' A M 5' H 5, .4 W 4 A W l ,Amy , f .z:,,,, . .ne V A . .. ' f v 4 " mu '5iV0' ,,f f I 4 ,, f 4 , , 1 W V 'f -ff - W ,, f " w' ' f L ' 13' wv. W, MQ- n " --fr LW' '..-f-"'r"fT ,. 1 1"xr""'11f' -""" fi" ' "' 'Li SUCCESS ,fgky .. - .fuk 1, rx i:7, f 451 - 3.P'if,y' ua' 1 . MH -, 1 A ' Q? Q 3 , Mg., . 149' ef' 69 01 ,-4.....a--- .L i fl ., . Q, r ,hqp M . 1 T5 f 1 A s k . xkfxgm 4 'Q -,ju i fig f-p.,:--,+- NTQZQZW ' Q1 'fi .pw . X JW- f jay, 1. ag,-5, imQN.,k,waMQf-tm Y .V N. ' f2: , . ,,,-. ,JA 55 't nw, ,,,. f .fww :f . f' ...-,-g, X. "MQ 'fb -X ., 'N x X-Q S KX .1 4 z X ix' no , 'lf' X 1.5: 7: 4' 4 5' fs mm., - TQQQ., , New-wa' sw , ,M-be .V rijgffg4-.- . 4 ,, 'iw 1. iw,,,,,,w 1 W ,, , gh ,,,,,,,,,...-f-F, ,,,., , .n,.,, g ' '!'f '! Z A i 'i :Pu d QI- I il F i I , A il x u 3 1 l 1 1 z , I V I' U 3 , U gfiijfg .ff 5 Q Z- W. V-: 1 E, ,.,, N25 ' -tru? ' - .-. W., ' Y LL! F ,Q A5 fpqpuevazgplgyn Q' ' i 'fplffipy :AQ zz, , ' 1' 9, 11 I v 1, A , , , "Q I f ,,,.-4---"1 "V - , ,,...f-" "- .r"""'M4'4- 6 A ' 'V l ,, ' Ja' ,,f ""4 Aff? - ,Z ,fs - , Z f I X , -3-rf" . f i 1151! A H j.,.-'2x A ' azgiflf X!! 5 , I f ' 1 1 If 1 , u I 1 I I I Xa. 11451 I . I 3 V rl it ,zlrl--752' 'tif'-l-3fn.!i1',Ls ., . ' Q ww V-- -W -W 2.2 e.-.4 ev! QM. . , Q 1 - x, . . """ :ff .,,f ...' . h 13 Cyp xl 2 2 - ' -. Q : .,g, - v wwgwa4V v A , , F' A Q 4, k .TJ 74' 'Ruff- L , ', 'G ' . 4 QI A-I.. nnnm mana -VfQff,:f'.-'Qa!y,'?'1"l2L ' I l ' 31,95 58, fig' I I W - . 3 I ,. ur 9 ,fault 3 I I 1 'LJLJ 1 l EW' -' 'J-'iff' ' f-"-' MEF 'LL' f' Sifw,w'gi'z'i"i'?15g' N.. 2 . x , "gi ':'g'i'f'l! N!-Scfm i. 'I ol. AH W, 1 2'- x 1 Q Q 1 I 9 1 I i M i. N 1 . , ,N 4 Q 3 - 44 1 E 'Q :Q 1' 4 X.. N .-I -f .14- 2 4 ' f Q swf ' e ! , , 1 i ii I 4 -W... 'iw . -4 , f .u."'i1 .2-E Q 4 V , , J 4 1 sl I Ii I l 1 wi 15 ' . . ff , .. Qi ' J Fx lx '. lu 4 9? ' 1 - 5' , Y ' A , ' ,. , , . f , : - " x ' lv- fiLig+?1fi, , " f' T in 'X 2' 25 ,. .Q5f:5'c'1' v1gf2.,- 1 ff' i ' . . ngzzw gf, Q ' :fri 'f Juzyjis Z erin- Q3 yf,'f"- 51 ef: .I ',z.y:g I yi .W ,Zi , f--f4,41,fgf g ,fwgzv ., ' x: ,,,,,m' ' ,ff fn - rd-' 1,-,'..fff xp,-, .- . 4.4 -fi -321. 4,,, :1,,f3.1,,..z,g.f,, 1 L UX, . -,, aff '-1-ffj H.'.f' --Mfr Q 1 '21 - , -ffwg, ,WZ . . ,fwfr-,-, ,, A K N' 'W ' f lv 1 ' li' ' 1. J Q,ffm:,72+2+w m .V , , i , , Q .M ,M,,W,,,,.A .. , ,.,, .... , I V , """'f . - ,V L 3,33 ,Af .41 ' ,, . fr- ' 4 ' 'Q ., en, ikwnw w. 1' ' ' If 'vlitrrz 11:11 - L A 4 fi? 122 '1 ,f--X.'1'zg1':f:'1gg,.E2zw:g I Li. , I, K. gh: yfgw-viii - Aa - A smug!! f 1 1 . .V x 4 r 1, 5 .jj ,fi , 0 o ' f 2-V--film .L ..:....f . ff "MY-f . X b ,,-P - V 'lg Aw- Y I I ,.7.,..,.,.,, W' 4, . A' , ff' ' V , M ,,N,g:W M ,,, .,.f"""' ' ., EVM? 'naw A , 4 dxf . , , fZi'11Tf"" - ' Q.,-11-'. ' x 43. aff".-f".,-' 4, 'W' 4" 4,.f1,4-' ,, '- M,,1fy,.,f V I ,- :L, 0MM4 qw- , - MW! " ff"" ff' . V N , 4 .. , .I Lf i 9 V V ' -1. S I L , . if - 5? ' . ,' X -2f"fAi1f'-Wei , W ' , K 15 f W3ifif4a???fQP::H:' K ,A 1 A2 VZ: Z iam! , ' Av f y, 2: , 5.5:-Mfg,-1. , , ' F yisvfwfmp , ' " ,4..,.--"W-mm, f If x , fg ff f v ' X f 1 ' 3' , Y . 1 gm-' - di- ! .L '- H ' g, 'Q 4 . , - t M .,........,...g.-f,AL.L...,4......,.4L.f..4,,L A S14 , K . , X. my , . 5 . 1 ig fi xi W6 6fnXxf3 'ff ,J f ff L, L, fz OD! N 2 L O J XXX 'W xxjffxfjj LZ! lffmxy Cx '--- ,"'1,f"'N ,f -f ,fjjf , if Q ,111 ff C, X 1 ,f ,kb ,G H ,1 1 X' pf if" ff! 1-sf 1 f f I Xl' f ff 3 1 1 i 1 1 1 1 1 X X 1 1 1 X I 1 X 1 1 X 1 1 1 1 1 1 1 1 d' I YY- ""Q'4fG xx af """ "p -:u G. "4-Alb' -mfg' w 'A- '56 ,ni 4-4 1 1' , 3 ' Q-.,,T,,f-r - .141 31-Ig., - Q .-,-.....-..- A - ff f---f"-" H- ff-f- ------- ' --" ff"" ' ' W1 I8 an.-4 mi 'si -,fi rl 1 g k F 'S K at 1 1 ' v' 1 ' - 1 1 'W .1 ,f A 1 1 1 "" ' f I 1 , .4 41? W IHYQXNXG KUNG 'YJK 1, M. nf--:rbi as lx , ,J 1 ss? I V , , . WWW vi, . . pm-, ff vw 5123? f fr ,,,, 'P . L ,A,' rf wwf: ,,,,,, ,gugn 'V 1 I r ! w I, ll 42'?jfg42f' - I I l x 4 I I L i F 9 1 1 .. -.- x ,Vg 1:5 , . ,,,, , V,. ,g A if ifidff., any-.,, ,N . '-""". .A .4 'Ap' x 1 ?. V .i. i' 45: . - - I .x 1 i 'A E . 1' -1 x . XA -f 11 xl .-g x f, l . E S K. 5 Xx . X xxx NX 1 X, ,X X VE FQ N ff !',44 X rf - H IJ 1' 'il N QW Y 1 if L W ml 3 , 9 1 66 6 25 1 Ti 16'21 IULI 5116 37 V52 68 10 20 7'f2ml714515?179 7 2340 1NN1a'f53 632 644 fp." " U", ' ""' if 8 155,951 7 25Lg5i50'71E .3 .16 37 59 73. 10 28 38f48166 . -f,-17 T11 3120415771. 14.19 44.65174 K., ,-J?153P-819 74 F501 47 65.1 1l,,, . fx,-i-771'-1.f""-M - -1' ' ' ' 15121"34'5N575 ?6122444 53 65' 5 12A1g41'5265- .3,.22,,, 1, 1. , ' 1 2 7127 5,59 6 2125 40 48 er 755 '4 0' 9 25444964 5364 30 2A5 6 9 12622437 52 73 lT11i7734 5.32721f9f30f243f48. 2 42543148165 1 65527 14 7.457 ,gr ' 12228 6l19 717 4766 fjlff 7 9 420 35 57 69 'i.QQ2513,Z151,75y -L' 6 593042 60.62 48 61 15f19,35f46564 606 55 70 47 63 315 17 32,56 62 18 15.053 64 631.5168 38 54 69 12 7.392539 32 52 1.3 133-91155 ,Q f?25 39153.63 ' '!1E!'.1A1f17 375 AE'14,Ql 16532. 7 . 3 418 38,491 120,550.67 4M24,33A54A75 7 126 40 56 68 1'164058 61 if- 31 ' 5 5 3043 5967 12'30'32 57571 3O'42 59 4 211,11 7 924,41 59 10 17 36 5476? W4 22 55-' 50 731 1516 44 52 69 8 21 31.58 76 55 70 44 56 64 ,Q a 27 3356 1529.42,5Q9! 7 30 376671 4 428 ii' 58 7: ' ' 1452034249563 Zi 21141566 76 '1b'3o'40760'73 125622. 5155 6753575561 9 f17l31l58I732 5 17 39 48 661..1' 2 13724 33 50-744 5130145153 7-if '10j21l35:53'A5f l3129?39l55681 lf23.-'ll,?929,4. 155440157172 21?3.il19E53'4 22 36456- 48 127 32'54f6f-ix' 713-215,597 9 528145 50,28 f'..5g17.41f48f51 If 23 43 47 662 9 27133149 68 11912 55,63 13.2,6,3l.5317Q7 64 4 19 40 60 64 I935 78 f BIC "E" BINGO 2 26,361 48.75 1 k'Zw27f39 58 6 1 29 37 47 6 22 40 18 , 58 67 '47 63 1142 60 23 A 57 13 30 38 ss 62 5 2 5 1 20 44,54 67 N731 46 70 IP? iff' Fff?:T::. ,-,32:',2.,f:- :.-:Pj ,ifQ1':1:1 1 ::.,:1X Lg'-1-3 ' ,, 5:23- sv' ' X. 1" l 91:-.-iii iL5ff.1"'jf:?XQz "5-tl Qi ,I '.g1?5g1gv3-:fi ,Eigf i-Q'2T?:'Li:'-'qflp QE 3:9154 A .--.'FfC?f2'1I-1: 2221-Sexes? -pg-gg 'fiE:2I'E:?x'Qw,16P1: s mir, W -" Efj-ziigiguw G55,133-,p-5:g:g.'.f, 'i in r.il?,-2-2,2521.3112 :,ff',-'gQif.','- 52 V: f' Ziff Eff- T: EE "fi I ' ff : rm. .. . 1. YF '1 ' J-., T X -14" M, pg LJ V, BIC "E" BINGO X 79 X -was v " 5731: Q I .I-mg, x ,, is wal' f ' Qx- F' ag- , GL .K i ,gl -.11 MH., . 1 fix .JJ 1.11. . . . X A Q y 'figs ul' X3 an Q .A :""T?r-1 -. X Qibfls. X SX S X X 9, 1 ,g g ,Xml f L X ' 25' " ',"" L"L"'5f' 'W - --" - 1' f- - . -. ,. .- ,,, J- z 113. fi .-,.1f-,h,-,,u 4,1 .,Ar.,i,,.,f:,-YL , :L I- V . . Y H, N-m ?vl,SL: It ,Y -'J N-qniklx, .1-P 3 F -- Y A44..,.. .... ,, ,-s. . . Y , , , , . 4 h '4-- -'fi rl 4c'l"-91,15 -,.:'-H., '- ' - .ff ... A-,-,J ,.,,1r ' ' " ' '-' 'W' " F' " -' '- ' f -- r- -,f , HA --- . W I PASTIMES X 81 x ,,, na-as-1 4 dzrq. .... Mus., "' ' W 'T Mui? -di QITCPD: 91191 f 1 87 f UNREPS' iff! ,-.4 53" A 4 E H iv' 55? '-220 nn, ri: s tsl 1 'If .w V' fl A II 9 I ,J , I .. 1 nk hr - ' .ri 4. an 4 w . 3, I ,f Q , kd .1 gh ' 1 ,.5.H.g,1: Nix , ' X 2, UN1R'EPS :i 85 1, 'S Q-135231Tj'fwfg1Yf1,i' 51 W ' fi".Q'-'f"'5?5,122,-.?fI,If1Z5iigL'ziff' ' f K qijzd:-,. L 4 Af .pw :-- -'. Q 1 X' " ' 1' ' . - - r,,- . .,5'.-,A-:-.wif seg. "1 T- 'Q V ,B e fd- Yl-- .. f-- -.-iq nv.-,. g f.. -r 1 'L a - 1 X ' ' . , -. " - -V -Y -f L--w--A -..-1 ff-.-.14 V' . A - ' ' ' ..g'f':J4-':k:5v3Z'Q-EJ". 1 JS V , A ,, . .. H ,..,.-,-,,,.,1,,. ,R.fv,:,.-v-fp.,-1.,.,. 1-A-,,,:f.Lf-'r1'.2q:-'L '-:vu-1.11 ' ff-T 'I '-5. if , ' H f ' 4. .-n....., -v' .. -..-M. .. ........ .-,,1..A..... .. ......x.n,...,...u.... - ...W ly, v 1-w,,.,.-,,,, 4, I .J n N ,. .451 kiu x .Y 1 Lz' .""'7 , -14 4 n "' A f. , In J H II K ,V I xi." .f-,4.fr.- ' 1 A .L -'-, aw A W x. ,,, -.. -- ...-...g ... . .... .-....1., 6 if T-if sv. NF l.O. OPS .1,,,, qu.. . , ,, - A IL bak ,im 7 . . ....'f,,., -,. V, . .--. . . ,. - , -V ,. ax: -Muff -- .. .,X?.,..Y.,..,-.. A, ,,,,L,....,-,,,,..-.f.r-.,-.- L... Q,-,----M-W-.Tl -T--,f. X.-. Y-,: .f,.. -,,-1 ---. y,:,,:v-f- --3:3-vpn-'Af ygr-51 www .wzfrfwr gzzfx-1-4-0 "S" s'H+-r':n:fg::y: 1 ' '-'nof-,fear-'wr .5-11 ,avr-x. Qu q--14 -:,: -A:-cv,-f.'::3g2 fiL?Ifff,1Q4:,,1g-35251-fm:sir-ff':tf:::'2,-i-1gf- -fy.S:.11.'-4-V:vnu-f-rf fi-,vw,-,5-.-f.1:-fum:3-.nz.64E:ZQ.5,wiv3-,ifiail-:'sia?4?E5z'ZE::f T -'--S133 '-s mflaw-v:-A Q K gig.-',,.,,,,,,...,-, -..-.,1..f.,-.-uV---:x-n-f-- A-'-F' .v--1--. .-- rf, 1-Y, , -1 --- 1- f. . ., n.. .Y ,y-,nf-1-,,f--,.-f.V.-.--5-Af,-..1w.'4.. -fs . -M . 1- , A- - .-J - -W A H W., .,..- .. 1 ,. .. . , V , . V gv, .--. -c..4.,, 41 .r:,4,,. ' ,T 'Dwi . T 9 -v M- ' , 'LAR' s 9 -F-"':p. 4 A -gy.: . h. . Q, U ,M ' ,- -'- 'fvafwz , - f .... .N . . 1 y -Q. Lg, ,V B ., -w 1 , - 1' . V5 1 . , 15' - 4 3, V, - ' "' ' " -,, . I 11 ... ,-- m ' g 'Q --' - A .Wy-'BP' fa -- Q .- g, ' ,ef 1 r I Am '14-. . ' t nfifiw Q' V - ,,,, f12A,'vZ1,:,,"7, gxlwllfcg 4, ., wld , , ' y-c.., fc 551357 4' -' . ,.,.f-II 1 W HQQ GDS 51' 1. -4 ff' 7 Ailfg 5" x, V f E 41 X, ,-,N lf' r -W ' 1- f' ".I'zf..fT3I ,r,"' f' C ' . -If - VKQ1:-4' -an M lg' lxa'-V 86!l.O. OPS 1 sr zu .,r . , 'Q .. . . ,W- i if iv S 1 l.O. OPS X 87 .,,,,,-,,-, -.. -..n.., ,, ,...f-N. ...,.., , . ,. --- - . ---- - , -7- -- - . 7- -, ,. . U ... ,, -11-.,k,,L,....A. -., ,wg-f. ,:.f..-,,,f,,,.,m. .,..v.sL-My .'-.-..,. x,-,gr,., ,, Q ggmawg,-,-..f.v,r M-m g.-gg-, ,,.,1,,, - .43 :,C,?.Jg5-..,1:., :Sgr-P:Tam-1:-xii:x1Q3111Q?w-2f::.f:rfxuriixsrJciffsieifiziwczkfffy zffiff fn-a-4:-haw-,-r' ' 1- 2: J5'm'1'3' ' V ,:1.E.3h,.,5,1:6. ,--+n.,3-Q4n,,Q.1,,,,.5,-,. YN -.,,,3At,:,,.v.,,Q,,,, ,,.,.,5,.fL...-,xf..,,., f, .-,'.-Ni, E ,.,,- - -+,,,,,,,..',f,., .,.f,f . ., .uf- Q X X 5 , N-ff yr , , 1 f A , 1 f...mwf:,,V. ,.,z,. y,.k.,L,,3,,,4L.,f- 1 ,.... Jaw.. gltmp- W A- .J .... I .Y1, r - V 111 88 X l.O. OPS Lf. ,.,.-l,g-v7,..73,, ,A .xx .An--1 yu 5 I 4 - Af M. 4, V ffv. 5 m, f www WJGWQ 4 ' 2 .17 ' 'U 5 ' mu , , f ,,,,, V V , 1. I ll H 4 VVw:+.,, V ,V EW, 3, ,Q ,544 V f' gm :VV4-'24, ag 2? 27 , V . f-Vw . , ef W ' , ,Vytflfzw-":'V' ,Vw .4 M 1 G ff 4 132 4, 'f,, fb 4: lv ex ' , Jw ' 5, VV, V f .1 , X ' I 1 fu- K- . wif? fl" If f 'I ,Q 1, f X 5 VV ,,., A . A V f M. . ff' mf? ' M114 M Q, ' ' ,EV A, ' " Q' ' V V I, gf,54U ,V , 4 1, , la, V 251. iv: ' Z, '45 V V 1 ' V ,V WV, 1 V , Rx' fx X ' rf J HV : ' - P5 VV" , - ' 'fl ' , v. , V' 'V Vffizfmg-5' f Vw? W1 fi' 'jf' f A ' ' :3 . VVV . W 1 -V - ' f ' ' ' V V , V' z- 14- ff 'V ' mf' 1 " ' ' "N il 4 ,-'?::'11:9,fi'f P- N42- , ' '. 'f V V . , , 14"-Jah , VV , . ,:y,:Vgf: . " SV y f .f,V1ex 1- V V ' .- ' V V 4 5 VV ,,, V vf. f' - -2 ? K V . ' L V -, ' A 1 6 in M Q, AVMIQLAMQ ' MA.. 'V J, ,. , 5 E 3 -f1aiz,,wf.vmw , ' . . I 1 V I . A , ' 'L , V ,,Qg,54,,,. 5 WM .-- - -H f - 5 I R - , ' VV-V V ,, ..4 , AV M - A' M k ' z Fi " 1: ,, , - VZ' 1 - 'f'7"'h3"' 'p,4,E.V ff' if ' A . fV - . M' V ,..,,,y WM..,, . N A- V W ,Ln , +V V-W .. I -V:-I ,Th , , 4 . , Q Q V25zfVV,:: ,- 4 :Q , ,V 1 , , , .. 1 y Vr . . , , .-'A'w.:' ' - 55 V 1-V V l x.,- f'W"!if'a W ' . " A . -fm ,- W pff cf I '4 1 x xy K i ? ii . V .- 5 x '14 V V' S uv .,,, -y- Q., yrxfp ' ' VV . A . , 1 . 1 M ' 1SS'ELi42?fS5'555i '21 x .r- 1' as V V? V ff ' 1 R X 2f?122V4'9:1-?i?fZ.- ' ' I " ' A V' If ' V ?1?2iffif2Zlvih? V V 519 V V , -Z4 V ' MQW A 'lfiiipziiii' gl! VV Ki ' : gf 'x 1 V- 'V E '-1,1431 V ' flfw, Q' K if V ' f m , - 1 vggghxy 2 'zigizgf' Ez? V V, 2 in M? V Vg QZEX 5 . V V V M,-.VV mv -VVN. r.,f4,,V . yu ' '. f Q , V ffigik ' X YZ? 5' A- ZVV, 'gi' A 1 -v '?' .K V . a ' X, , ' H' if ' If L V fm E51 5 :W ' ' L V,qV.1..A.., ,X x ,X V 'V , - J, 1:1 wwf'-.V . , V f V 4 " 5"e:1:55.-Vt ,, :X , 4-'K 1',r20,1 A V-ox f V ,Y V-X 'V f V -V L V- ' , V. VV ,V . , , V V - gfx. f f V A M ,,' V45 ...Q V VV f' V M, ,Q WV 1' , I '- I k . ' X W .,,V..,.,.V,. . W-V a f f ' JF 1142, ,' , 5 V wr f '- . .Vibh 6' A .W V V :A vw-ai V4 Ji - 'V . mv-. 'fp ' V - ' 33 2' ' V ,':5?l , e Q . , K V' . .V 2:1 X, V V V -4? I' "" g EQ ' ,gzff IQ V Wy - QVV V , "j 'Vzzzfaf' ,. , Wh IVV, . -., ' . V1 VV .nas ,,,-few . ,fe-v A .2 , V-' 7 V' 'SV fix V Vw'+f:g,V'fgVQ:f4w,: , fe:-515, V : V , . W. -wg? 55'Qi.1:V7,',.:mx lf: V x M - I3 3. gg, e 4. , , -1 .V ww M rf' W5 iw: .V 4-.Q x.-mu, 9 , , K L ' "3,vrwZ417Aa::,V-9 I 55' ' 3 ' 'VQVU -11 :ix-' . X 'V fs V, V QV v,. 4VV,,p...:V2 D , , .,, , . , a , 5-il - L, ,V V? V - 7 ' ' ' bbw' ' F'5?- ' , ,, AIR. A 1 VVVW , .Vm ,1 ,'Vg4,,Vf,,L .. .VV.V2+' , f,113,:z f . . ,,?, :, 1 I , , , , 1 A r I .A A k i....,.,-44 X .L , vw , A .Liu- 9O X l.O. OPS ,. 1-ifzgff: 'S' "" 'YW ' "'2':fr'1":z:1,af:.-: f- - Y b . ' ,if ft"'-'----- ""'-- ' PGS iz.:-2.-"" .-,511-.-"'J"?3I'TN"""'7" - ' -' - .'v.",--5'1" 1 - 1 5 F it 1. R 1 W , V, 1 L 391 lk 1 , 1' vu. 1 ,vw ww 5 1 W, 4 ' .M y 4 f 8 ' , A V,,,,,W N 9- , ,, lf- , ' , . Ji' 'ff "' 1 , L I W an V4 'H W 'X , f , f -ffm , "' W 1, 3, ,, , .. '- 1, W5 ff" I Wy, 'N N4 N " 1 'VV 'FH ' K , A. 4 ' 'W' ,, ' ' f 'W v. lx, xfiiiig Q mx Ll' 0--pf -Q afdi' .bww sr W" A 1 dl 43 E l 'x ff ,. il LN Mfg, V Q .,4f'4'. ., We 3 "inf 'ff ' 4 41" in . --q.......,. N ' " " "1- ,- ,,.-. New -:-1-.am Y Q , xr:,-1---gvff-if -7-'A Os- U1-lll-'. .'-'.'-'v'1,1f- I:- 7' hw . 1 s var-2'-uw sv- Q '71, 4 -.- - .ieuqigyw---' --'-'- -4-'A-1ncA--A' W A' ' ASKLHH ff W 5 1 W New W G1 ,V -az. f., -' , ,, ww , ff fl .3427 3 - A ,dx K' if ,f,..,Mj ,-q:'g9f1f4f,Wp'- 25,3355byyr.L41g,z5',fE,1V47,,v,iffy? qfA5',,7,,'ffqgf,4,f,33, , ,T Ayyb N L, QWM ,W,fW,, 7, 6,g,,,,,.,,,4fg,!,,y,.?,,,Q,, ' 1 , f'x'W9"ff5f f Z wvif 2317 JMU, ' ff, f mfg wa WJ-,W M wfff ., 4 4 'f 4 H' W4 f f' ' E , ' ga s-k,'f 4 , 5 ., 4 5134,w4,2,4:,5!.z25,g,,g,f9 if Ju, .1,.,,,,wf , I +3 Jaan! ,f gm H ,una 44 4 1 ff ff, , , af 1- fmw ,154 J' "' 1"'3-,fm C ff ff ff 'fl "mf, f 1 W J V ff? 55524244'Si2JZvzfWfwff'f-2,1 : ,J"4"J5 1.f' f" 99 The men of the Enterprise!Carrier Air Wing Eleven team have a reputation for being generous in contributing to worthy charitable rojects. They showed their generosity early in the 1084 deployment by raising funds to purchase two computers for Miller.Elementary School in Alameda and to fully equip a 10-team junior baseball organization for children at Alameda Naval Air Station. Later in the deployment following a port call at.Subic.Bay Naval Base, Enterprisemen demonstrated they were friends in deed to Filipino friends in need by donating more than 56,000 to aid in disaster recovery operations after deadly typhoons ripped through the Philipine Islands. . Then, during their 93-day voyage in thelndian Ocean., the men of the "Big E"!CVW-1 1 team once again displayed generosity when the call for their support came. This time, however, t e cause was bigger in scope and the challenge much greater. The 5,400 men -of the Enterprise!CVM-11 team were challengmed to pledge contributions to reach a S200,000 shipboard goal fort e annual Combined Federal Sampaign - and they had just 10 days, October 15-25, in which to o it. But, the men of the Big EICVW-11 team were more than equal to the challenge. They not only reached their CFC goal, but went on to amass more than a quarter of a million dollars - S240,000 to be exact- in contributions to aid the many CFC agencies that serve the needs of and provide benefits to people in a variety of situations. What is almost as significant as the amount oflmoney raised and short time it took to do it, is the fact that Enterprisemen actually enjoyed doing their part to give a "fair share" in the campaign. The idea was to have fun with CFC aswell as raise money, according to CDR lim Griffin of VAQ-133, the overall shipboard coordinator for the Big EICVW-11 effort. The fund-raising drive was planned as a diversion from the hectic daily routine of normal under- way operations. r 1 1 Enterprise Commanding Officer, CAPT R.L. Leuschnerlr., set 100 percent crew Earticipation as the main goalin the campaign. The fund-raising e ort began on Oct. 15 with a kickoff ceremony and a cake cutting. During the ceremony CAPT Leuschner, the Executive Officer, CAPTj.j. Dantonelr., Commander Carrier Air Wing Eleven, CDR D.L. Carroll, and Big E Command Master Chief, AFCM M.W. Weaver, made their CFC contributions to LT Loren Brooks, Ship's Company Keyman for the campaign. A , A T jj On Oct. 17, a special bingo game televised live over Enterprise TV to raise money for CFC unexpectedly became a "media happening" when viewers called the studio to bid with donations for the "Aard- vark orange" bow tie worn by NC1 Vince Shay of VF-1 14, the show's Squad, discovered a unique way to beat the drum .for CFC. Don- ning children's fireman hats and "breaking.out" hammers, saws, 3 harmonica, cassette tape player and other instruments," the Flying Squad resembled a displace Fishermans Wharf street band as they gathered on the mess decks one day during lunch hour to "serenade" their shipmates..Of course, the roving Flying Squadtroubadoufs ensured that their midday concert did not go unrewarded-as they circulated a tin cup in which diners placed "pocket change" offer- ings for CFC. ln the days following the telethon, officers, chiefs and leading petty officers could be seen about the ship swabbing decks washing dishes in the sculleries and "taking a turn" on the field day ill a head - apparently carrying out their end of the deal in exchange gor the Hclgallenge contributiocgmsn made to CFC by members Oftheir ivision, epartment or squa ron. . j A T T On Oct. 18, the air wing and ship's company held a bake sale and flea market to provide ad itional cash to the CFC fund. Later in the day, VAW-1 17 sponsored 5- and 10-kilometerfoot races on the flight deck, with entry fees being donated-to CFC. the various events that were beginning to become commonplace on the ship were not only garnering more money in the campaign but were also rovidin a i . the same t'me entertainment for the crew A p g t "Our approach wasn't so much a 'campaignf as it was a celebra- Hog," CDR Glriifin explained. 'iWe wanted sfmmething fun, active an quic to e p us meet our 200,000 goa ." 1 lt wasn't all fun and games. Behind the scenes, LT Brooks, Ship's Company Keyman, and CWO2 Charles Gower, CFC Treasurer, juggled the routine in their normal Operations Department jobsto aid CDR Griffin. "We sometimes worked 'round the clock keeping track of the donations flooding in and coordinating the different events with the ship's schedule," LT Brooks related. "The whole thing could never have come off as well as itdid withoutthe excellent sup ort we receive rom everyone." A A The CFC drive was togped off with a benefit carnival on Oct. 25. All hands pitched in wit innovative and creative ideas to transform the aft end of Enterprise's 4V2-acre flight deck into the midway of a carnival, complete with booths offering hamburgers, hot dogs, chili, popcorn and soft drinks. And, there were a variety of game and other activity booths. One of the most popular activity booths was En- gineering Department's "Delbert Dunker." The dunker featured a small seat suspended over a tank of water. Chiefs and officers took turns sitting in the seat. For a dollar, a "customer" had three throws with a softball to hit a small target next to the dunker. When the target whas struckathi occupant of tlhe scaat was iunked in the wgter. Many o icers an c ie s got wet t at ay T or t ee cause o CF . Comedians, singers and instrumentalists had an opportunity to emcee. Petty Officer Shay agreed to sell his tie to the highest bidder with proceeds going to CFC. The bidding went higher and hi her as viewing crewman after crewman called in their offers. Finally, VF- 114 Commanding Officer, CDR Lyle Bien, and the men of the squadron bought the flashy tie for i131,000. With the completion ofthe bingo game and the sale ofthe bow tie, the program spontaneously turned into a telethon as Enterprisemen sudden y started appearing in the TV studio to present CFC "chal- lenges" Laying cash on the "barrel head," they challenged their officers, chiefs and leading petty officers to trade places in their jobs in return for generous CFC pledges. When all the donations were counted up at the conclusion of the impromptu telethon, a total of 510,000 was added to the growing CFC fund. The telethon, attracting the attention and stirring the interest of a majority of the Enterprise community via TV, played a big role in getting the campaggn rolling. Though the CFC drive was approached In earnest, the e orts to collect money sometimes evolved into lighthearted, comic scenarios. For example, CWO2 Ken Stone, Big E's fire marshal, and his group of shipboard firefighters, the Flying 94 entertain their shipmates at the carnival talent show held on 8 makeshift stage on the flight deck in the late afternoon. The Executive Officer, CAPT Dantone, even got into the act, dazzling the audience with his yo-yo magic tricks. The highlightof the carnival -for alle-H51 a lucky few - was a raffle drawing at the end of the day. The Commanding Officer, CAPT Leuschner, and Command MasterCl1lef Weaver drew tickets from a revolving barrel specially built by the Ships AIMD. The raffle included a grand prize of a new pICl4UP truck QF 55000, two second prizes of round trip airline tickets to anywhere in the U.S.A. or S1,000, four third prizes of video cassette record2f5 OrIS500 and numerous lesser prizes. . The figures show the drive was a tremendous success for the ship and air wing," CDR Griffin commented. "But, the real success WHS the way in which the ship and air wing worked togetherto exceed the goal. lt was the way countless individuals stepped forward to take 'e5D00SIbllity for making the drive into a truly enjoyable event fotg 9YefYQne aboard Enterprise. And it was the way the entire Big E an A" Wmg Eleven crew pitched in selflessly to help CFC." n 1 l E 1 E A - is U Y E I r. r i ji 1. 5, in 1 Av . . I ' f f V V J ' 1 5 ,MM-W...--W. -W... ,,.,..,.,,,., .W-f, zi fyww "359"3i fi : . M, W ., -f x :answer 1-W- L1- .fra-L eg.,-wa' Awammmmg, may il 5 -' Zlffii -Q V "W" WM' ' , 4 ' " f ,, A 3 l i-NWZWU? "n""Sm' VAVV - -"-- mm- - - , A V- 'ff-'Q EH., v 4 "G m"""Wi ' 3. -9 . as-1 . 2 3 w w- Kamik may :LA 1 1 1 . 'f , ,K x '. ff .. gi i l.O. OPS X 95 2 al 1 Q11 fi H is 'tx if 252 V' M: 1,1 ,i gui lifj , 1.1 , ff L EJ El 33 ik 1 N iz. 1 1' 'HQ .X nf IC I, x f I U . i L E 4: gf :Fl . a ii 4 fin f' 2 i If 1 4 V . y . , , 1 .1 . 1 , , . 5 fl 55 ai ,M 1, HQ Wi? qgf " H 'ic :1' R A as Q '32 j., 12'-' li K ., .v, . I Lf' Q. R. 3 2 iji II V1 xx 3 k , 1 ,. EI, 3 - J p 1 w , ' 96!I.O. OPS 'HE 7 7' vmwy 'MEX ! 'swxawq 1.17 i K 5 A K F! n , f Q1 , ,,..,,,, . , , ,N ' K N 9 1 I ' 4 X -, Q 'Li f- Alrfixx' . fx' ' pw? Y D 'UN MLW N........A---.,14- 17 ,E 1 L, Lv -,MA ,. ,, .,,,, , ,I ,I Y, .., ,Y x. , Q , - , Ex .. , Y 1 . -.,. '4 Y. Q- V-' J' f ,J ,.. -- rf .Y :,,,,,.- ,T-, - -- . - ..1 -. -. ,, ,W ..-- -- -,.. qs.-'fy-x,,-. x - W ,. , , -, .-,.,x.x 5,.,.-kg . ,-: Y '- --,..-4 - - ' ' - . . . ,. A y... g , .. - , f-.5-Q.. ,.-- .ff . - ...- -.-. -.,- 'fu-J.. V- , V,-. ,- p 1 ' .- f .. ,-. , ,-, .Y -.. , .., , ., . , . ,, ,, 'n.. -f-.-1. phlrv3N" .,.-,gru-'Q' 9 - .P A , ,A-V., - ,A 5 113419 .ai '-' ' A"'-I 'Z 'I'-. l"'7:I'-, :IL 71-X-,'. .w.- -Z"' 'fin' Qrvfvf 'QT xi. .., - 1'1" V'WE!W '11 'V' IO OPSIQ7 L W n ,gazzwf X132 gf UK F MIt0llS 011 fm My X ummf. 1,15 YWX V JNO I YX6' U INUIIXN 0CEAN 10 ,L-4-X l- ,,-------, V 1' 'N-.1 L F L-4 -- -.P vm, ,A -A Y an H-MP NMMA g ,, Mfg: , , X 1A,: ,- Lk Y - , lj M 98 !l.O. OPS """ :'?T:Q2'jif?j-. f-f'f5 -- , :AQ -. . 5- ,1..f --r.'..X1-1 -1- X ' I s A 43,31 M44 WL. ,p,gg.LAff-,LZLQLLQM ff-55I".-'T-:g.i75'l3xf 1.5, - rn 'X K. X ,XR XX X HA! ,ggi X ff !X"X KX 1 X XXXXXX 1' frfx X fl! X 1 X X 1.1 X rxx JK X' 'X," H f'X'X?!""'ii ' XX 1 X ' 1 XX J X X X . X XX XXXXX X XX K . 4-'22-Q ,Z- ,-, 5., X " 4 J! , 414 5 . . W X X X X Xl X K , , l.O. OPS! 99 3 X N u i 6 I V ,Q H 5. W 4. . Ti 1 4. . , ,1 5 W W N , L 5 -: ' y, .sc- ge N www! se Mig X' was 4 f -. -- .' aff . -1 : -f - ff-1: -' .a"""" . -wh H - rf? . ru... 5 EN N, 9. 2 5 ,f G 3 1 A 1: 2 f v 1. il Ei ii V ,. 13 .H Ji 'N 1, 1 r ii ri H H 17 1: . 5 5 Q 5 , . N W N 5 ,A4 5 'i . 5 Q77 r 111' uf V5 r 4 nn. F J SUBPOENA AND summons EXTRAORDINARY TH E TRUSTY SHELLBACKS l X venus 1' "A' A'--.- .,.. - ...,., u,5,N. X ROYAL mon COURT' -i of the RACING MAIN County of Equatus Vale gf Pacman X Domain of Neprunus Rex W -, 1 ACTION ON CASE : Ordinary. CHECK H Serious , - ' ig T Y ' ' i . N o be Confined Awaiting Adina U , N Double Irons Awaiting Action WK , Straight Jacket Awaiting Amon i 'gg coffin Awaiting ,Winn , si ,M D ' 1 ' 2 1' ig-ir J avril The Royal High Court of the Raging Main County of EQUATIS, J Vale of Puclficus, 7 e. s. Domain of Neptunus Rex. J To Whom May Come These Presents: GREETINGS AND BEWARE wi-iianms, The good ship U55 ENTFBPRISE fCVN'555 bound .-..W.D.iLI.Bi1i..E A ' ' is about to enter our domain, and the aforesaid ship carries a large and slimy cargo o land-lubbers, beach-combere, cargo-rats , sea-lawyers, lounge-lizards, parlor dunnigans, plow-deeerters, park-bench warmers, chicken- chasers, hay-tossers, sand-crabs, four-flushers, cross-word puzzle bugs and all other living creatures of the land, and last but not least, he-vamps, liberty-hounds and Drug Store cow-boys falsely masquerading as seamen and man-o'-warsmen of which you are a member, having never appeared before usp and WHEREAS, the Royal High Court of the Raging Muin has been convened by us on board ofthe . good ship USS IENIIE PPRISE on the 9th day gf Fbvember 3934 at Longitude.,-.i......and latitude 0 'O' 0" , and an inspection of our Royal High Roster shows that it is high time the sad and wandering nautical soul of that much abused body of yours appeared before the High Tribunal of Neptune: and BE IT KNOWN, That we hereby summons and command you DOW a 12911 vuigrr i , U. S. N. , to appear before the Royal High Court and Our August Presence on the ajoresaid date at such time as may best suit our pleasure, and to accept most heartily and with a good grace the pains and pen' ulties of the avdul tortures that will be inflicted upon you for daring to enter our aqueous and equi- noctial regions without due and aubmissive ceremony to be examined as to fitness to become one of our Trusty Shellbacks , and a worthy Son of the Sea and answer to the following charges: CHARGE 1. In that Y new 3, Slirfxv Pollvwos , u.s.N., has hitherto willfully and maliciously failed to show reverence and allegiance to our Royal Person, and is therein and thereby a vile land-luhber and pollywog. CHARGE H, Made light of the initiation into the fleeing Main 'bv saving he will .1E:1nin.a,1:oeeeven-afre1lze Hoes 'CD1'O1lEh.lh6 YiI1iti2l.11jQIl- CHARGE III. 5 .-fe... -- , - he , DISOBEY THIS SUMMONS UNDER PAIN OF OUR SWIFT AND TERRIBLE DISPLEASURE. OUR VIGILANCE IS EVER WAKEFUL, OUR VENGEANCE IS JUST AND SURE I I ! I Given under our hand and seal. NEPTUNUS REXQ I.O. OPS! 103 Q , . fa .k..,, 01 rf may mai. Wx ,zrgmg -5-.-3,..::f,,r1 Ass. ww """' 'Wk W Q 31 wg sf' A ' I , --mr:-:s:'.e.m xx V f -Q 14+ -vv X ,,., Nh , A , . .. x x- X - , V W V . -Q - f2,5Q1:i f'gf"fff35'fii:pfig:Z-579.1 :El - Z ' ' l.O. OPS! 705 WBA 'N-Q' V475 .. 4,-" 2,1 "ff .-ma ,,.,j:,, 'TQVL1 if-2" . .f uf. K .. .-yn, J-: .,.2,,f:.fg1',g.:, MW F"., L nf' .i 'mfr 5- 'f-71? ,qs -i 11 1 . x 5'- ff, ivy s. ' Q hw. 4- 'JA- HW' " , 4 HXSQ Qu 1" ' 'x v 1 F t Q K "Z ,vi . -,E ff , 1' ,f ff: Y Xllll ima- f:3553fz2f2,fZ5'4W"f any - we NJ. .11 V ' 'V H", . , 424451 M, - wig, 1 M- 1439: 4- .1,g4,:4vf AWN ,A 's?2w::gMc"'?4v5,-v : EW, 'kfoziliiifigfygfiff ffff2sfimf:1z Jwfgzwgw f 44 wr. A , .V ,f.,. V .. My mg 354' 25252 ,Q . if-,VQQ ' ,665 V mpeg, - ' 554515, ,, ' 1 ,K+ ,-awmfvyfn, .w,f...,W.h,,,,, .W.,4.....m, ,.,.,.,,mm+ j Hd I -f Sf? 555535 ' i 7 1 . 5 , H 33.31 G Qc' ,,f?1,:':Ef, if v5gfo4:4:3' .Q' 5 A' Ai 73 5 f Hi A157 f fx Y W vi ' '43 4 ,4 MW , A M455 fx ' ffm? m , f 9' 1 -4 ' 1 . Vj f Y , 'N 0 dvi-'. 014,511 Qi ,- za Y. n ,'1 ,, 1 9 rf 1 f A v rg 5 1'l wf , y 26 E k . law ,J ,, UT w ,- , ,, ' w '3 ,x , V I F 5 rf 'Z - LRE- 'via 1, SWT' . -- 1 -vu . f..f-M, , , ,, ,, , ,,,,,, ,,,, ,,,, , ,,,, ,, , ,, , nm, , H ,, ,,,, , ,, , , ,,,,,,,,,,,, , , ,, ,, ,,,,, ,, , ,, , , , ,, ,,,,,,, , , , , - -Q,,,,w,,.x:w'., f Nw:-Y -fx? ii' X-iv Q. f aff- ,-:ww fi? 'g .. ff fr dw f w on mmf k 5 , ww!- f 5 .147 v ' 1.-' Qbw xpJQi .gvi .X '22 622:37 55911 3 flu 4 fa fpffz WI: E . , 5, f? 4 -,Egg ., MIM rf fm ' ei V AY: .. I by ,y - , , . ff'.fl'47x' . . 4: QW V. Rm' 33", 254 , W, ,gfriwzma -,,,. M54 IX - .af f , 554 ff fa , I QE J? -'. Y .MI 'JY ,, gg, " I -xl I Q ifaf g fi f ' . . 5 'rf ,- ' If I X f f V 1 i . f U?Q 7 , 1 'ffl fffwf ,M ff? W 5 0 Q fi ,J , f 1 fx., ff, VW,, fy' 7' ' ' 5 M Q, ,jf ,ff f 1 ' 9 . U :,3'g.,, - a -an , 1 1 1' X if f' I Y , . f ' , , ,...., Q f 4 VK A- ' 4 J , , 170 I PHILIPPINES L. 1 ', - , -,-A---,- - . ,-,.,, Y 1 - W --Q ---f-+- -- -f.-' ffl- .-Y-Z ., - " " .. j A .. . Y A., , A . , ' f - ,-'----f""'1- 31 .A- - - - ---v, -. -.n-.V, -, -Q,-. -5- ...W-fw-H r , I f , ,,L,. ,x WE ,.,, ,I , ,2,..,.,f1, -.f,,,, -4-If.-,'. .:.,,.-.,-.m V. . f - , .fn -. . ,.'?5E- 'Lf sf.-171.- fag.-r: - . ,.,, ,1 ,-.V..,.1.5-f fe-' -.-fi"7"--' "' "??f2?S.':fE-'i53fL-:i4" " ' 'i ff I I- ww v --" ,,..,,,-T,-x Ziff I ., I-z3fa3lHi1,':fX I?5tfl1Q'i Ylw--fig I ,I If . Iiffiifw ,, ,X ffi1'7'rA, Y"'7I1T'If'P,'gf I if fi '9Nfl!j,f 'F LA"AI'M ' f IM 'Q 'g 51 ,II I' Z 'j'f1Ig'f'f'..,wffz7f' ' Q A K I I I ' FM Qffwwv-"+R fi Ii:-I 'Z xi":yi'w, QM. 3, , Q If 1 I If gy , , ,,,k,,L ,, .,,., f I ,., ,A f, I ,,., 5, I ,, ., ,,,.,,f x ., 4 , ., ., Ermfi.-,M--Q4'1,,f,,-tw Iwf' ,Z vfpfag Inf' 1 I' wif, '1 'w,C',4 YI, fyx f ffm XW4 ik- 'ffwf I , A V - xi Lfifkli ITMJ' Ivjfiffl IMZI Ijtwtfx 2!J"f'f1'f,fx ' f' N. I If N5 V-.""1-Y,-ffm Vw. lf, rfflffq ,, M f, .4 ,-aww lw I f, X41 'f' u yf f ,f I f,f' f I ,,,,..f, '-2' v, 4 4 ' 1 , I L' ,,,f f',"' I I -. I,L,,.4-My F, ,1.,,.f,.V 9- Q, ,X y ,,- f,,f, 4.4-.a,,f-f ,A , x, ., I 4 E , ,I ,,W,.f- ffl IIIII I I" Iv'affjI" XII:-,M I r ..,' 1-ff: if LW' fr f:-KW, 53:-522, 5,451 ff,' A zfvyff. ,G,31i:', I :,u.f,f:,i1 ,,.- I '- ..-.....,.. I ' ,I hm tug Wivfv fa, PHILIPPINES! III PHILIPPINES THE PI ES CITY .1-I.-. '-I' -'-----1"1-abzsgg-T:-.ff,A:f-' - fi' --s-2-af 2zf1:i-q-1- - YA,,-'Q-42:5 E:-,a-.1-:V -:m1.g:z -4 .Inf-.,,v.-, ..:,., . ,, -- -- -v-Y '-'--- - -v-. -:----w-f- ff- V' --- --5"'f7'!'?'5""fib1'-- 'I I 'EN V ' I V B ' ..v1seea.., , .nQ9u.l.1i'.null. Elin!!-' 35 gmfgligizri 3 nziixpz ' M . "1" 'X Sf PHILIPPINES! II3 f'i1,'Zfi?3uf -E' xg "swf , , fknf' ' 2.5 5, Jr f1,g,,5,, 1" ' if' 1 ?Ew.:::,1:.z::1 :1g5'.'a5.1-Q-. . fyffffz A ' ,frpzfif if mifgf f'fJ,'iw9fgfr'f f f ' .", ':f"'4?eiL-:H-'EHMF fffff -' V f Aff if My rf y f 1? -s f 'af ?ugx-A r Ia, ff 1? '1"' f V X ' f LM J , .wi me -' ap-ucv .Wm " '74feff "'m.2 y:f - f f. ' fw75.,v.2v' -ff5f,:k, 'V f' QQ 951 . ,4,wf,ff,-,3 f.Myff,-,f,W41,f7f,,''fn 4,5 . W4 ,,5:.,'2XX?E2?:n,,, 7, ff,,,,,, . .iff ,fax ,,:-3? -. 'nfl -9 X-fx - A bra.. , J nn fng-4-fff.f,f,f,,ffff'ffwf4,g,1g ,,l1.,:g5f---1-f-yang:-:'f-gliiisw. -wi., 1 Y ' -' wav Y - 4..,:f,--1 .7 ff"ff.2.fJwf-Q' gf "4 Vs 1,35--1 ' f. . . " ' , f ,, Aff, ' ,1- 'ffizkmr 4 , f ,w i Hy: -J,,'Q5Af1a3,f,-fi 5 Tfffzzf M512-n,f:. ' ' Y I-1w,s.".f'r., -f , ,- , Mn -575 -ww '--A iff- 7ff7f A 'f'7-15'f-"'-.f-r.-f- JL.. - .-.::u:1-1.1-1: . 4 f -S. A, ff, , , , - -,v ,ffm 'Em-v.-.f,-.2.1.:,......h ...- ,LK-,,,-, , ' , if ,gr "FN P- El'5F-.lif ,Q XC f 5z55n?ff"2,'fA'i nf 1' ' ' 'L ff ' f' UT' ' "fin iff, 'eff-fff.T".' " - 5 ' ,lf-mzfisfszfanz-1-2: f :fm 61l'l'f3',f nz" .?5zvz:4mvgwefLar'.,r 1-Z. . - - QP'rf5wf1,za'L.-if an 'area-.rfrv --ff ,f ez,Qqg.gg,:,qg-4.fq,4r',gp ':.:s. ..:--am, 11 fff-uf-fff1y,4wfffffw,f.f.m fwfffa ".-,mv A4-Jg.-fa.:-.1-.'-,1-1, . . ,Q--Q - Jfifff -md Bug- -ffpy- 'f iff 'ff C-f.ff,n-f.f ww-f,'ff--,, -gy: ,ff ef, ::?2.-..,- 1 f-4:--u-wg---, f-1, ., gy gig., am ,x, -f Z?-flwa-1 , P 1P.?gE+1 '5,'A:w:La'52Z'5f X X Q . V -ve---z, x.: J qwffg' 5-:h...' :ngfj V f ,1:. ,-.pf Y ., ---., .,.p1.:-Lx. .x X -r B' ws 0 244254 Q:f'eipy.X Ml- 2' v ?""5g,1x15J4f1 X .- ' '15 -f. 3 'f n " 'iiizaliff .z fzgif-Q.-2, - ' -,ef ?55,g4if"',- - , 'S 1 - 'Z 'TQ 'H y' f :-5-'if5'i1i:,w,,...,4,..-,4 f 5, .. wx- f 2.3 , ah.2f,3Sf:Q1125".i-?.:-2.-Taffy :ff 1, -1-1' 1-,w9'S.'--V' 'L-Ci'ff1f - L- -f --f-.,. -1"- s':n.-3z+.w-4,-J-1fiff-uf fav' - f Q .7-.zz 11' - '- ,, ?- 7:-u:,z,5z?w 5.-'1 ,. -,S -W' -i' '1 ' 1-. 4'-ww.-'Q--. .., .- .1-MW' X f 'fL2,.,,JH,f:m:ff'f71aii5z'2 +W Q1-ET., rw-11?-ffvy-ffifff-U7 Y-'F-ffivg.-jp-, 4 1-nv-'J-:, X '-.-,.. vs?" - - f 12:4 1'?'3 '15l:??im-if-"4 N 1 hu 'Q , '. -5 " ' 4. rf- '-'-' "rii:::.frft wffii'-"L, 9-:sei " X ' ' -A.-'sf.-WsA - . :w' 9-55, ff? -f"6:?r?i??? X ' . 1: F J f-"-' AM' ' '--- ' "H 17 -- -'uf rf-a ' b , X 2. " 5 .ZZ--1 " 'W ' - ' , - . '-N PM f. " ' " -' ff-. ,. ,., ma.. - -J 1 .- - - i, -. ,-y --x " YM' -'1 'Chg' 'NR . I - X -Q F Qs. - - x R ' , P- .S 4 XX I W SX'- '-- -- --H X--x , J X' " L' f --.My- '1'hANk5c1,iviNC, v 115 uw: f f scef:gspwJ:Ja . 'Y f - , ' ., 1 ' gil-,,,..n'l-7 fr' ' FL E E TEX Ate' 93 days fir Cat? llf'tEi'S ft'f3.:0.siff::,,:!:.f2:t:.'.af Ltsoiist Arabian Sea, six ays o I 6 Y In . - sailing beneath the Golden Gate for a happy ltOlldaY liomigovlvlgg several weeks awaY, yvOl::lflEEl?fEXUgg?Enlefpflwfcarfler be read or . , EleFvl?ElFl'T5Crlf35 challerllged the men of.Enterprise and.CVWAl to bfe 32 their very best in the demanding environment of Shlpa an, 323-50- three carrier battle groups operating in winter weat er in a ea. frlftnlflzllssno easy exercise, coming as it did near the end of a longg arduous deployment. Opposition was provlded by Other NFIVY Sm' I and elements of the Air Force and Marine Corps, plus an occaslonaf Soviet 'eavesdropper" - all eager to test the . inter-operabl ity o the battle groups in a simulated 7th Fleet tactical scenario. I h d As soon as it got underway from the Philippines, the Enterprrseb ak to make an "end run" to the south to evade a typhoon. Turning ac north, the "Big E" faced icy winds, high se-25, and airborne, Suffatie and subsurface threats 24 hours a day as it maneuvered through t e Philippine Sea and into the northwest Pacific Ocean off the east coast of ja an. . . . . Bdfh the operational and logistical coordination involved in an exercise of such magnitude required extreme attention to detail, flexibility and cooperation by all ahnds. The men of the Big EICVW-11 team were more than equal to the task. They showed that even after a long deployment they still had the hysical and emotional stamina to compete extremely well - and Better than most- in the demanding FLEETEX environment. They demonstrated the same very finely tuned operation that had become commonplace during the long line period in the North Arabian Sea. The Big EXCVW-ll team kept the simulated enemy forces from penetrating the battle group and stayed well ahead of ever-changing situations and taskings throughout the exercise. RADMjohn R. Batz- ler, Commander Carrier Group Three, noted that, in FLEETEX 85, Battle Flex Deck- the capability of launching a variety of aircraft for different missions to meet changing situations at a moment's notice - came of age. "This innovative concept," said RADM Batzler, "which you fEnterprise!CVW-11 teaml pioneered, refined and de- monstrated, will influence the way the Navy does business for years to come." VADM LR. Hogg, Commander Seventh Fleet, extended his per- sonal appreciation tothe Big EICVW-11 team for its performance in FLEETEX. VADM Hogg said: "The thorough planning, innovative thinking and precise execution were key in demonstrating our Navy's capability to carry out a large-scale sustained maritime operation in the Seventh Fleet. To accomplish an exercise of this magnitude required stressing the entire fleet infrastructure for logistics, repair, tech assist and environmental support. The enthusiasm and persist- ance exhibited by each command both ashore and at sea made this exercise a most noteworthy success." Enterprise not only took care of its own in outstanding fashion during FLEETEX, but also made crucial contributions to enable the carriers USS Carl Vinson and USS Midway to succeed in the exercise. The two ships sent Bravo Zulus after receivin vital aircraft U . g repair palrtts from tihe Big E. The Carl Vinson said: "Received a total of 133 a s p I ' rom nterprise during FLEETEX. Will enjoy the effects of their positive support for days to come. Many thanks." The Midway said: Should be able to get hummer in air Working with Enterprise is almostas good as being parkedlnextt IS I D S b' Thanksamillion." O ava uppy epot U lc' VADM Hogg further added: "Your achievements during FLEETEX 85 have resulted in numerous accolades, especially those made by the Commander in Chief Pacific Fleet, ADM Foley to the highest levels of N l d - l avy ea ership. lquote: 'The performance of all FLEETEX 85 participants was outstanding. I believe the last three weeks tof the Erxerclsel have convincingly demonstrated that the Pacific Fleet is Ull?'AHi51lYRffEsagIILntc1 harm's way."' . . c ou tz, Deputy Chief of Na l O t' ' Warfarel, concluded: "Your standout perform Va 'Dem 'Ons lAlr . . . typifies the consummate professionalism ofatlhteelgg team. Well Done!" 716 ! FLEETEX M c4""-'I X 1 'x 'vn- X -Lf' S NQQ 1 i , i , 1 X. -X 4: ,1 Xw. X. 7 a . 'Exim A A tf X 1 - X , Lx K 5 ,ixskgg A 1 AMQ' 1 . , 'S f"I,,.a .7 57"- .3 .x , . xi Q x. x.. V MN x m. . FF'- K.- ti . x n 1 Q X fe,-5 , .. , w . i. L X' 5.5 W, 1 X4 x L fxvf v M fn IGER UISE The "Tigers" came two-by-two, ages 8 to 80, some small and others big, from all walks of life and from all corners of America for a special ride aboard Enterprise. The thrill of a lifetime -for both crewman and his Tiger relative orfriend -to share life on the "Big E" during the final seven-day leg of the 1984 cruise. "Operation Tiger" is the code-name for the Navy program that embarks male relatives and friends of crewmen on board ships in Pearl Harbor, Hawaii, for the return trip to the West Coast at the end of a major deployment. Some 935 fathers, sons, borthers, uncles, cousins and friends of Enterprisemen "signed on" for the 1984 cruise. During the cruise, Tigers viewed an air show by Carrier Air Wing Eleven squadrons and a sea power demonstration by the cruisers, destroyers and frigates of Battle Group Foxtrot. They toured work centers from stem to stern and perhaps, in the seven short days they were aboard. as our shipmates, learned more about the inner workings of the world's first and longest nuclear-powered aircraft carrier than we already knew and gained an insight into the spirit of Enterprise. Our Tigers shared the pride we felt as we stood shoulder-to- shoulder on the flight deck to watch the Enterprise glide be- neath the Golden Gate. Home at last from the sea in time for Christmas and family reunions came the magnificent Big E after a highly successful voyage. The Tigers had plenty of sea tales to tell, some of which are related herewith. They are representative, perhaps, of impress- Ions experienced by other Tiger shipmates. 2- XY ki .41 si n, . 1 f 1 I UN " 'W-1-:Q--'z 'f11"::'A 1QT'.J"1': 11-1-'13-,' . f 1 , W K Y I K '5T'f?., ff .I 4, , Q. , 55, 5? KQV. 3 I . 9 !' , K .U , 5 ., ,,, I L L ,M Q k . nf N ,, , ,L ,4W,q, 1-, V ' Q' H 'r ,. 1 , Q . 1 1 w v l 4 4 V W 1 I i 1 ,, 1 41 1 1 1 J 1 i Jw ff' TIGER CRUISE! 119 , ' ,, ,Q fn., f ' , ,L f-A. M ' V ,,"' 'full ,,,., 120 X TIGER CRUISE Bm., if 'Sui- Qmzfa-.zvaff-.L-.4 :-- HJ -Fx-we news:-Q-:-f .:L.-fr'-:P U.:-rg-: -: -q. .--2 :.f.f1--rf fn: - ' .- - :-:.i:11::-'-+- - -: f. -ar-.-:rf .:f- -41 , '- ---aw ,:--f f-. -' , Q .ff 1 1- ,.' .1 -Q.:-A 42.1.-f ff '11--f-.-':.: Ja- A-,:-,,.:-2:-Q :z:f-::1-:L:f-rf-'.,v Lf.:-2 Q: f uf- 1 -- ff.: .L ' ,. ,.,.u fqz.1gQ:-J TIGER CRUISE TIGER CRUISE! 127 l .i c-av - A ' So far the Tiger Cruise on the USS Enterprise has So far the Tiger Cruise has been very intere t' been great. The air show was exciting to watch. The The men aboard have taughtus howto do man thing' tours I've gone to were interesting. The sea power on the ship. We have done things that man, rings demonstration was exciting. CDC was exciting and fun couidn't dream to do. y I S when I worked on the console. By the time we get into ort we ' The crew of the Enterprise can't wait to get to 1,800 miles. All ofthe Tiggrs flewmtlollllvjwgiiraelfled Alameda, but I want to stay on the Enterprise. there we take a week to get to Alameda X by Jw I think Tiger Cruise "84" is very exciting! - By Jett Draime ' Highfill On the Tiger Cruise so far we have ' So far I have had a good time. All the people have planes. We have also heard a sonic begin? Tgekprgiyg been nice. And I learned a lot in the Combat Room. I on the Tiger Cruise are very nice. Some of the people know how to see how far ships are from us, and how have given tours. I think the Tiger Cruise is very good fast they are going. I can not wait until tomorrow And if you havea chance, Iwould take it. l'llguaranre5 because we get to shoot an M-16. that you'll like it. N By Chris Hemmefich The air show was exciting. I liked when the F-14 made the sound barrier and the sonic boom. My dad is ar lieutenant. His name is LT Dohm. And my name is loshua Dohm. I think this is very fun. THE END. TIGER CRUISE 122 I TIGER CRUISE tt was a thntt to me and a great suronse An rnvrtatron to Enteronse Nty reoty was gurck so no doubt there would be That as a Trger t wetcomed gomg to sea Ptans were started on att to be done The Trger Crurse oromrsed educatron and tun A trme to be wrth our men ot the crew To see them at work and att that they do Earty Chnstmas shooorng tor the ones tett behrnd No trme on return tor that soecrat grtt to trnd Then oh to t-tawau the shro there to meet d brothers we d tondty greet d Att went wett the otannrng The boardrng went smooth otenty ot heto on What an exoenence tor a tandtubber hke me The thntt ot the shro outtrng out to sea Earty rn the crurse much to the Trgers dehght A super arr show that was a tantastrc srght Educatronat tours to att tunctrons ot the crew Ptanes ooeratrons and support servrces too ttes trom the tantart one day t away Mere WO Include fds CDU 5162351 ndt SJZIIEUISICL 1158152 express m declsfgnequlpmevgfll of Us Tlgfulse V feelings of Other Wa does morgnd manpsrs to See 6 ultlmatgratltude f fheghe D576 I f for PR Ofwlig bogglgnmch less 3i2tuE tlclgzglbe n to seizure seenegl "Qht,,OW Vyfclvlllang mind Italic" arouahi Th msezeglle to tggegn the ygzgmy count an could bethlfg' THAT keeiugelyfhe what Uxgftgples Sgggces Ofrgo all fellow Sh d any state Cgnffee IleSrTr?Q?7gij0UrtE2Lor,1rgjtlS a?lfa?aZ'entg?m'gl Sljfergfagzi and es" "t'0f' knew rn Unselflshlyogg e c Vffl' ClfIZe,f7eate ln its e to k V D60 Ge ple what p U3 Stro IS must c ng that ng Ifcennve to Ot I ate Se IS differ Ctof now at the Can ent HOW I learn g0V6r gm Ogtgrggsmyilzifl 1951 l1lg2algxe'gJgrcsgt,SCgfld learn m each and e IS lnuffllvln My Dra Uess 'fl suyou aff 3 deso true' M uch from Week 9 as fuuy arligf IS that epp0l'f,ng mb? I can Heli, Whole Ouughe pf0d ach and y C0Unr erfepa Ok Wand Mer 'V Ch u nsfmas and Cnvely as has beefy mal? on b ll demonstragafd WIN by B Urt 3 G HI Od b nh sP0n less you re ed 30r 3' 90001 here ed by MM2 There was trnng ot n we att shot the garbage go there s no trme tor rest Rand Y M DF'sh6r But the way Navy wortong s the best 'vlSl0n We ve seen the rance our detense r They gave us assu The sornt ot the shro rs easy to see Everybody rs tond and as hetotut as can be I-ttter trve days aboard att Trgers agree That no servrce rs better than our Navy tt s the best rn the wortd and that s no suronse And the best ot the best rs our own Enteronse by Ken Nrebauer, tather ot DSG Nhke Nrebauer . . : ll 'lo B ' ' . I I v I ' , . . I I ' - I '. ' . " 1, l g I I I I 7 , . l I ' . . nn n - e . ' Sons, dads an ' - , ' , . ' , ' was tust gran 3 A H' ' . , O ' - ' , hand. I ' ' ' , ' . - priv e always felt th . ' ' ' l l . - - - I - m Withj 3 lfariar, . ' . . ' y I5 , ' . n . - ' - ' I , ' ' I TIGER CRUISE! 723 'W TCYN-. ,vL..A-1...,-?.I-2:4 V Cg,g.gg7g4gA ' -'.w77:-w- L-, ',x'i5iZf . K, . f iifigxff Q, f .1 1 may k .mt , ,fx Q-x'.f4 4 - ' I, f. x'.e'.' .fn- I - . Q 4 Kr'-iw' 9 ,- - ffl -rl y A 7 za-""' ,Ms g 1 Q. . . ., th A vm ,af . M. 4 w,?i,5w1'Bf , ,V . It L4 xv . . ff, x -V 'K -5 .,Vm. V -e...,ffs5,.,w, :jx MQ 'bu f' "'37QR4T51 ' ' .5 Am ykpw,,,f' ' f , V e.1e1:im,Vw. A Q ' f' 1 ' Q"-7 1 5, 2 L 5 Fix ' "V I? pf :Ji-Wi fs 91 if if 4 N' J 4? U .' 5 ' B .- ' ' 77' 3,1 V fu I H161 4 sn- ,, x , ,, , -'PW 1, fr Y, wwf I ay wi g2"'Ks'.' 'H 1 'iz Af, f' ,V . ' jqvh 4 'L 'lo.f""'-x ight " V' 1 . " f'1, 1 '- Q! -'--' 1 T V5-Q , ,wif-1.5 if-Q -QS I l U ,,,, .-4 il, Q' f HJ, ,,,,, V V .f - ' ggazgvg' vi 5 I Lx' f, mv .-K. Q Q'3'.'f.-' 3 2 35 1 "J fi fu gf!! . 74 -4 f 564, S273 M ' 'vuwkzi ,, . my f ,4 f , A .1,g:f, V I , ,A, Vyx--'Qi 1 VV4 4 Y! L -'I M, 4.. V. V . , ,Z LY, . XF N' 'wmfri , .V vwswf' "Nb V x ,Y ',X, X ,i ,, ..,V Q, W, f.-, VVQM -. ,W , ,,, ,, V, V. ,,- V 4 - .g-ng -qafsw , '1 .. - . V- M19 I -T '13-iff' '-fT'75?fT'TLf' . .v-W ff ww gm.-M.. aw, K. 1. Q X ,. QV W. Q ns.. . , , . ,, .,-411zaa.fsal6za.xaQF:'rg-.1 ' - ww 0-4,414 U...-I . ,. ' .Ay . . X X ,.' If B 12: S Y f ff" f" - P xii, . if - I '. . . .. V .. H -3..v,w+..a- 1 'few 9 , L.-Y--'.,i',... f,.,-new-""-""' ., 1 '3gi gi: x ysffiii :bu-1 A . .. ,f "A' -Alxw-'WM-WM-jpi x , W .. .Q,,,x i xx X . 'V , - Xe --xuviisfggg, Q ' 'fr-vi. ,Q N N w-...,,,., W sta, 1 U97 , , f--2-' .af ifflflggz' , 1 -of . J "' ' N --.fTT?7"'?"5',, .,-L, 1 DNIVVODEWOI-l f QZI 5117 I ? 2, V ff 5' i ix 5 X' f X. amecoming K Nxg'1X,,v Ng :lx ., X X iXX X X . L . SS Yv x Ml .. X A ,, , W , -,,,,,.,,,w iiwrrc ' ,zWff,,,,.f,.,,, V, , W -4 s' v -'Q , ' ,, -mW,,M5,4,Zf,5,fQfm7?ff77"a,,kN ,VIZ , ,f. , ' ' ' , 1' X Mi, ' I V! f f,, - ""---1- . ,. ' 4 ,, 7, ' QwpC,f,,f,yff4qwgff f , - W, " , , , fffcfhg , "4,,gfLf,f.gfZ7f,jwf 0 3? f, , Us 2 ' ' ffff' ' ' -4, "f ,A ' ' ' ff fyfwfw,Vw,ff,pfMWff'27,, f. f 'H-V ., .. . 3 H V M 5 ' iffffffww W - " W , ' ff -,,,4,,,,7:'w 'f':gf,f7 f ... ' - ' V '4fffzw,fwcfmfj N , v f74f72ffif'9ff,,0y ' ' f, f L , f zffwfwa, ' V " , ,Q ' -, - ' "' M HGMECOMINCX 729 1 E we gl :mms mm n li H 9 E N I W! w 1' W 1 N ,ini W, lm EH , K, 1: Ti Qi :M w 1 , A w w 0111800111 130 f HOMECQMINQ ing 732 X HOMECOMINC A, , , . ,, af:-Q Q- ' ,- rv F--V 1--f-----in x ,..-... 4. , H 7: -g.v-1 c Q.-.-..-. amecanung 0 , , ,,,,7,,7,,,,,,,, - ' Wf.iJM.f.,r L'agiiiif3v Hi HP 55651179555 fQfaiQw -1f U'w 19' limi fmg15gja5gQ XQw:T1'jwi'Qspg?:yjq img, 5545 ii WQ'!ykW1Wi T5 2bQ1i3:Fi: E1 M f 21' 'N . Wm aizgmgwbgiig img Mwquff QM y,mg ? 1Q+mvg gf mmm wee Ha i"C-WN? H 1 1 C L v x Gx 1,1 'HU W wwf Q1IQW5,HQ'i?3i11519551i14W1'3i?1fi1?' '+MJ f W5 iiE1Q U QWi UEA3 f7f-f 'V5 ? S 2 Vi My Q WQMQQ1tQgEg.Jg,Em35S mgigwwmfggedf Mal? rME:xg2r:145'Q: QQ151,Q:?3q:gF1,Qgif"Q 'rw iii' 71 w'x,w:4idxwHm:61Qg l?gsQNlwXf Qkwiuiugg Qgimgliwajhivi' Agv3Qv5:?Qiw1i5Qi'5f5 f'f"?:Q11!11QiVSQW 71 fl2i?QiQ1ia3:Ni SJAQQ WQAQQ VQQ1'Q1Q1imi3iQxQ? ii:11f1Qii1Q'Q.Q ,QWQSWQ.jVI1?1Q1I51 Vf?W?3'5"5Q"'!55"m u'-' N l' Q-91?-33 xiigngigsffmg sgwgxxigf 5QQW1:'mjsmg:h:lg Tf3?i1eE1Q,:Ng5g3Es ifggvfliw 'QQJJW1 1??v2:1f1'f'H N ' ii' wAE:mQ15wY,Yfjr5545151613 zgqgg 'mzwgwQqqgzhix4Qwi1fif51,QQ3 Qf5?Q1N?19z-Ag55'1.3N2fQ51:f5:Q3 NQ3?7'E'!QXE" W ,jsx?YELjlQ. QE? wariiiilgriimilfjlxxwzgii ij:Q1:HQsfgJ9HQQMIE Lf"71QuQu Nmgix H'N QQ 'f'fW51??N39-Ei! EN ff"5Qi W fQfi51HEf33!!f-.mgfg mwiiliim QW :W:1514?1Q'gg,W3 1Txgw.5Q':E'Q1 Q45 Qiaixpsifviqifiifg5?uiiwEw?:5E ilmjf misiffifiiig Huff: EESQEEWEFZV WHQ1 5fi'f!W315?5 5f55f'? WiV?'!W'f?3"?"5' EE iQ?Qvy4M !1 1m snggmfa+ Wgsu iQwgmgH HYMMLTI 5Q?iNli?fKf1Hfi fEifSi w2w 215ffmgw + -aw f i " w QQ1Q,i6vg5f?griinyqlgwifgaigmg Wx? !E1isii1g31fyQfw?1s5:g2f'5Q'f?Wf1f?fN wgsnih: wi, 'maf2'QL2'CN -miriiaiii, i5AfQmg15Qg -ia Hmfiii ?5-lgngizqgggiiwyeib 1QwQ1Q1EV1QWfugfxv Wing N5'v1,-QWWQ? fii5siri?Vl9EKQESS, 1315? 81511125 iQ?1gS1rQ1? vQ'ZiQ:5 55, Q12Q1IQw?fQ', F1?1Qffvm E3flliM?:?!'fQ fbi' 531 EE if E A3 'SAQFQQIQFUEEQHY 5QrQ1HiQi?1Wj+iMIQ2 WAEQEQ MQ-iii Q'T!?'kQm'5Sfk! QHW :M 'ifaslli YWF: f NWEUH tifgumg iivlmfi Jimi ,iii !1i,5uQ u9i , 'QRQWdmjcziimikgri +g,gmg a 1Um 2 g4 A Wwgmifi,fillyaakwlfiwgMyfgfgmhQ,gafsmgmj mgfizgmfv 'E m23Ng:fgQ:12r 5g 1 ,. , ,im QQ 46isgQ3nME1fQ1E45'ris Qi1Q16 12kQKgf156K3eiui 1515113 1?WdQri7lQmiiQ'f!5PQW51Q13Y E!if1l,gv?QQ'X?-595'N313 jpg 5Q1?QWB1W5CyvIEmYIQ25 WfzrwjKQv1grQ1Si'r1,MiE iffiilglki5Q1lgW!qQeQl, QR?QUf?ilQfE1WlQr1f? MQNLff1fi' wffgf,' ,355 5' WSAEEJ VMQHE WYE fEiEKi5lE4f5aQi?lHf1E, 1953 ?iffFifE !E1613EE?Jf:Mr5.5 X,Xf' v1ew,fwf wif? ' 5 ma5xQQi1WWQHiWimwfQ23LiHhE'1Qki f W5iP5haema 5J5 vmaifnugw?mgf f g, m ff ff m my g f -gm WKQIINIIEMQ QW EEIFFHJJFLQEQEQ QEMQI :QLQKQEKMLQL7 QE2'Q5f'H:iv:Q qfigxgqpwrhQw5FinxgL1n:QiQ. ,, IFWQIQ ' 5EiiH5iW2 QFUEH 5EiEiQif :QQHWE TWH? 1H5w'ixQm"3'j?1fFw5 Q1Q,"51'ELl?'i5'?I f,'fi::+CiF ,w Vu, fimmrmmififais vw!! fmiEm91mgg LxH',4iW w:iwQf firm igmgm 1g 5e5 lm A fy Hgwwiei Qxiimiiwhj gjgrg1iEfQmmgmg1 g mm ljijrg vQ 1iE-:QE fmfgggfp Q, a ,fW mgg E w : WEnQl!1iiiUi1 xm1 Sgwgwmg img 1511513757 mpgfgzi my lff 5H51g :Mg Vngm , Q IQJKEWQWWEHNEIQ liuicih SEKECEW wglliirmiiiiiiffgwjf My ,irw wi Eigxwg x','f'1S!g1Ngi,Q.gzQ5 in Q 'ix 5,1 IW? QE- NQQLEERQ iQ1HQAQi1Ey fQig3jrW111ELQ1?s45Sgv1? Q w53w?fgfQu :?1g'Q,:w,i13!:: ,gm X w,', gg gf. EQ1QIQHi 1il3Afl5mrIMinas i'k+w fixgxwfg Jgfgmgrgi mm-1 irfilmmmgwgm mm f1gfg g ,w W -XKYIQMKIKHQ US wimifiuwii xgmQ4i,ii1'AQn6w giiggw 334551 wgwQw1uQ !E mgfg y 31 ggm af1 QW 5E'HHNQfH5JVnAr5Q15mQ!im Ew14iRYA1Tfl wg f3ngwg m1gf.f ,gl1l1Ql!5?X7,,VQ"?1W ,img ,f,3 q , , WQWKLEKQJ :QQ 16,Lgu?QE my gfqujfgijcgqij ' A lQKQi iii f lE1I93:5,, aizgmfmgrmmgf: Q,xgg f3 f Qqgm Q Wg+ 5r e,qw .M 4 'EQ-iQMMff il ifgim H MQW H152 E xfEQw Qf5Q mm Qy6,'bw?XsxEq5::'1 Y W54511 W:-Z'if EM? U55fE511fE1?5Y91ffY '515 :Lg+ f me gmmaf sw ,fs h5Q 5, ff, f m 5 mm1ffaffaaffmwwfei was my W ' J Wl+?fivf1ixEwii MQHFEfS15 wmni1Uf v5 ii 'ima i??ib!QE!LQ:5kQ2 mga mg g ,, i : a 5 mm jjf iQ15l9WiE1iVQl?1Ei? WMI? 'iiiirfiimg iw? f.Efh9f.ff5 f,wgffg im K wJfA gW gw,5m,g Qf fe mf fQEMm ff: Qeffb iQi115ffH3 'Gm5 wVQ' W5l.Qw:dEe?1Qw ingrmgQfzfgQQi mm igwmgl axgeiwk mfm1Q ? 1ifiWL' Qi1Wi+Qh2 i 2lf+ fQWff Qi21QUi'Q3Mrk i1 5 i f mf Q 5Q mg f Qu M me f QEIQIQ' 6i'XSxY4Y7 fi1Q1af5ilQ 1ma cwmi 1E Hajmg+nmseg imm mmQ.5mi3i2 M mizggsil W3 594f:Q,P?W1ilGVE?FQMS QM J.f1fQi'f1U5! iG:QkQ?Q1QQ, qbW1?xQ5ffiaeQLivQ! -zwxdiifpm 5m,,f,5gg 5,,f,,5, ,EW V A 5 ' 7172 I I'SX 5,3 iifrygz ff. Sri :'y"f,Z Flffw. 1,x: 1"1Z 2 Aff :Af . . T , -.,,.,'1-3 wg Q ,Wh-1.1,-7 ,, W ,,w'Q,i,1,- 14' 1.-L-, gh g,,,w..,i: w: L. -,' y,,w,:, , "-""'Y fv:- 5,21 ff iifrilifzf -7-, ff V 1: -ff --:rw ff,fA-vf-wif 4-ff' .-V-f-, ,li'VgW'3'Nqv1uL- .9 P1 Www im Jklq Jw -.,j'311w ..H,1 uf',':i:,:1m,, :JUN mm 1,i3m1,I5!J:4i!f' 5' Q L- wr iSI'LII'l?Z, TWT: 3-4 ,fx-:,g,v f:.1'I1:,'-'fiilzc -:x,Q gfg - - yr-,T --., - .,,. , , fY,,,., wc 5 's , ,Ny-'N -wil: fg1fmw,:..: 1 :,1,, ms, Q, 1,1411 :Lew 1 e 'TTQ 41122? 'Im 3T:1?"w fx, W 'SMS-Z wx P, ,: ,pq 1:21 .2 1' 3 2 1,a,1f:f: ,, a mr A fr rw: :rw 9 .Q . gym .M 1:-wqrw' XJ, uw Q' 7,1 ,wwf-l!.,,',1,1w':' ., "U',b:J .nigh wxuxwi , W 'bw I I girl 36,3 Ffh y,H,,.j 155,531 ,fm '-f,5',7f wifi 3Yf5f1,f"F 2-22,317-!:,,1 z'f,1,:.' Q '.L:-,fgffjz 'f , 1:-z 4' , Q L Q .,,,b-.,C LN, . W4 ,M .mr ,Q,Lg,1'x35,,4yJ3c uf, wc- wxmg, Qywfw. Q C .1 gg, Hi .-' H2-'iw LA. NET' 513,32 -' fi.: af liiirlli iw? 3 D13 lfzwnm A'e 1 ,Q 'Sf " , Q' 'AS' ,fi f ' 'mv H1 'uw QQ J,',11yx!'y limi w- NM Wg, 12 31.1-g Lfqwwixv Vu-r -gy.w1Q,1J.-1 ,, 'LEM f5,q,,"51'-!wF"'x"l Qw!:"L:: ' 3, 5433 lu 'g:gv1'wg,Q:::'1 gwg 3:,1,q'gxgQ3N,Ug:f 1: 'xgsgmw 'QSM gg!wgN1A:gw ' Q wgwg' 'mu :2f:':'wNs' ,V 'ww Yfrzzl wzgl, 5fg:'1,:, P.: T. -ff.?N."f -fmwrfz M-2 la ".1.,i..f3 321: 'swfff j1f1":vT:' Q-"Lg if , 'g '7 W 5-mgvlyx. Q.: -gg: 'yy 'rw-wQ1ww,.g,Q,-.fww ,, 1111-'--q' 'L1,Q,-'wc 1, 'V 5:!"d,,-,3V:!.N,: l.,.,',G 1 mi Q11 ,Mi .,y,p5!sl,1f1'L V W.-L .wt-' "4,::,w,' fr ' ,-rffl .,: ,:, W7 ::lt,,,,',: Elrn, ,Q 7 ,Jw wgwu'Ni-.,:N .91 Xvgtfm !15'.!,1-J' pwiw'-Hu gm: w"f:?"F,1 xq1,v,,1:,z, ::,:,2z:,,:g:' ,waz llfif 731,5'V'X,T7y"1',fy1V3',C1T 3s v7-1uf1",1'f '7 ?g,F7w?3i'ip7 71117- 'F'-2:2 31,1 iw, N? t .. .5,,v.qfW5,f ,wr W w.,n..,n Mg iq. ,f W. wUL.g4.g- W, 1,,m,..,b, V.. ,Y ,f ,. X wwf: 3. .5-LN, F"?'5 zz gE,,5,,d:ugwk1? f 7-1 TFNBN7 up ,A -+r,,g- F :, 15513 ET :,:,-f.24.'- iwmiwlxcvf pw-IQQQW ulwv-lug, f f1"'.QNgkV11S--Ml? fs, W ,,,wiwfW. 55?"QQ,1QG: ,gn r'w,w',' !.w.,qX pg nr,f,,qf-N, 5 1,213-MF! FRG?" .AQ ,TG y'vH,ffN ,W SHR F if 2.2251--M TJ? 2 2 X W,,':.-- H21 ML 5. In ,:,g.',g g :,,: if-, ,Q r,-4:,75w'm,':-3"-mx 2 :gm W? 2. gvfggpwlv,-MW!-w W. W,,s,, 133 ,, 9 319,915-Yi ,Wu ,qi 1,3 , ,wfgwgw-Q 11,,J'gh,:J W ying gm wig- ggwqg-, .ixwmqvlw--N Q ,Q gqvg. of-7 12'-F--N..: 1:-Q: -'y ,ff ' -. -f 1-1" W:-1:52112 U rr :F ,Q N2 ,- ,,: W we ' ,f,f,:'g-Th:-,. 5 21' 1 7,, HT? T zrni r 2.1! 1: 'fX3g5.ggQwfng ,wgxgyz 51633 g,gggQ,ggvpw11 5-wQ!1w, wy,N:,: THQ! W M ,guy Nmjugizy gl, HJ' Qw,,9,w1-1gJ35l-,Ng,.3.1N-U,QM um W Qri1Nj'wwg,,,?'1 "Ur-q,.: ' 'fm Fai' l7ifC"'?1'I 'r ,':".,'F 'l"?fQ" Qfifji, ff: ran- ff:,1',f 12:1 'E",1':rmz": P G" '--4121,-IX W""""'C 3' 'We' ""'E'f ' "f51-NEWS U' 'U-im' 'ffW2'U 5 sM5'V'S Q" EV? 'U'?NJA'X 'W 5E"vEF"fv' 152 2' 1"W5'f9a'f'v "F Qugw'v'Q:wnfwzgnmmez gg 'Jimi2g':j-wgxzf 'gvgw'51'NQw3 QMN'GIQ':Ny21QwQZ1:MQ5 gyn'3wgl'f2 W 105. aj' ',N,':yy,"q, mg 1fN'gr1':'Qu:11 Elin? ifilaiiiwi Q3iwQ:51Ex,mgQ2 1i,q'iwEi1gQQuW, ,QEQQ QV v.-wiizgg 1Q,uwg?'g,wQfm'Esi?i M3313w!x?fif:F3,i1',wE::?jfii'E15E12'FW51NEi5FMFQ 5,gQ:Q'5E.3 iExU13Jf'?1i Zvi W WE' w fQw if5 wi1Q1Qfwa+mi1w Mviffi we we M 1 wif: fswrf w wia fg'w N QMS' 'EXMMQWEQwg1aE1:fiFyY N151 gilfzysiiwg' yffljfw 'ywjrigji a53Ww51'g-m?'E, 36:53 'ggfiw Qxiwgmw mit? fiiiyiwik 1u'FwE:uwiN 2342333 Sw?-?i112fEEi WfiQ3'f15:1Fsf? ?5L:5WF:f'Q' 23,63 1'1i.g1'mg153fg qw mg 'EHi5M 5:g s f!vii1 gQ 5:Q l35 1Q 3 152v 6 w fggmy L e w5 ,upg ng mg F6552qEi1,lgjfEN5L,ENjEQ? gQyQp,Qz,Ef Q'f,j1y,g1Q5f3f5! 'EW' 415119 3K5y g15! Eff SEMQe9?!Q1E':1S1g ,5P,yq1?3i,?wjf v,'wiw:Q,,Qw JJ? fiqeig , TW? 5sgyQ:1Qx:Q.ii 515153 1QQ,fgqQg'?i,P:mFa iiiiiwg ,QMMQQ1 151,313 gn-,vfNfg1?m EW? 5 x1Q35E!i3::'E:Q FgllfivilwgwQHZIEYE. Z?1g1?1'E1Q ww? 1?12'fw3Ffii gw 5u g1iH ii:?QxF:5R?Q:? mg mvgm m g Qiigmi' wmv?gikm-Q2m:E1Qg qiiwiv Q f Qmm51g gEuy3f g1F Q f31A m gs5 153 Em, im Y- gf mg,g Q m g ,,f5Q H 'IEWiiwlfiiegrigwirilEJI-QW1l?1'rQ,2xi"11'g Zhi! sem 5gg g2g'Qaf g1 E gviwmg vm Mfilgxr? 5tyf5'?fQ'W1 319-'f?F1 wi, ii Waiziilzii 1511 mif1?'lQfW? 'Zg?E:g,f3 WZ' iQw1y'wS111Qw'iii 1?fIx?EH?'5W?'1'Qi JQQm:fQ3v1ij+fj,:3N M Jingqli f61g'gf,v,i?3gf jL1j,yQuQqQr?kv?Ql i:isr?!f1TQf,FVi Wir? QSM-ggiiggf QQ-QQ1aFi,?E1y3:5gEj 151113 1QfTw:Q'Qi!l54Qw5E wi: 'E"i?yQPQQNf:::iwQE W5 6-1YfQ!VE1?w1F1:Qg QQEHIQ riixgfir-',yfQ:ivj,fQ13 wsiiirv xQ,2.Fi,5. Tiff? M6 11313 iailgiaiif :Ex6z1Q'gQwS:'QViN1w.f12 31252 ziiigzilfg il:f5,5Q1EY'yF gig 1513-Q' wef gm? A: wwf me imiwg Wag-ggigiww EfWEsE1 E E QWLiv 'f 5335 11:52 i,:jij:uQv?: Tfisifbizfi' gfjfig fyiiw? WM? E:Q:QgQ5Wii WMS Qjwgmlhii NETQQEQ 5E1,i1M"'5' 6115+519 wil n?,'i1iQ1?3Q5f'Uf 'Iv '-"' Q 15: ' QQ?9f472!EQ:xQ55i15wQ!1Es5 Qui? :E3v:Q7'Q' "i!5Xiq'F1 151- 351113 WQw?15E:a'E-x? 1Qii1'i3QWlh?1il5f'QE WEN -QHQ1 Zig-13i'gQMQvQ115x lQi11E,QSf1f?!7 '?'QWQ2f QQwg 2gm5 m 3 M235 ,g g Qgw wjm YEWSJQ E :igxiiflcgx 2ifim w5g i W g :hM E f5 i?iu3imQW liim WF 3 1i '?f if?F+f1 "QSC-15EQL:j1:Q'eJF Effie'Qif5fEbiEx'QNfjwf f?vg5?k::gEffM13wQE '15, Q !?:g1iQ3iwQ:?1Q',-j-Qkxigjbilwl' MM? lgiixjfniwl?i13U51Qi'?Ql 55xQ1'?iff2Qi1I?H-3135: :xQw?3::Efi?: :iw Yjliig 2? 1EMgF'gQwT':m'3:Q ,imjf Qg:?Jwg1F 'xwiiuji E11+?vYJQ'EH YZEHQANF 5533525655 ,gygxiyfgwf1Q5,hi5i-Qf QWFNQ 'QLQW'QXiFfS.ij:ki:LQeQ. Mv133i:"1?:Qi15wS55 2315: WQSEQH Qvgmi F1:3i:wQx1:?21Q 5'i1VifQi2wQ?5 ,MQ Lmi:f?Fw3M2:FYQi,i4iivi1:2 555151 351235 ily? 'ESQ 151W si, liiyg' E1EgQi3:Q1Q,4q:E1g1Ei 13 Ngyyigugqfxyil Eflfiuixiglg 'EWS' 'WQH51 QL:i':FTq,g,.1 fizlzw lifviiivimia lE Hif2iw2 i Q5U'i5?V?i mf Q s2 1we fEm z f ae2 we wm il fxQHEF1Q3E7!ik5i1Q'Qifiyfffx 1F?:'?'Q'5i,Qgr5 QERQWZ-ZQ"'E5fxizfgg Giang i'5'5W:3im1mQ'fQi iE1QfE'l9?i:lz Qf,Q1F?yQjmYENQsiw ' 715:15 Wixgllifii EN me Viflf QEgi,,vf1?QgQ3E3ug WW- ,ixlijrg-E:Qf::Q'ELV fijgimif, i.rj1,QgE1 4EwHQ, EERE,1QfQj':W1fQ:i1'Q,iNZifuivflf3f151j:fi N-SEQ 'SgQ"l172!3Q ,QWQ eg wf3 i,g a mg+f g mamg ISMf? vm Q 5Ag1 gfC595 fil W Wi2 5f2 M'H W 1-16'-"N V' 'w,w.u:'lF1wU' 'V U: ,. N? M6271 g, A:-,f.g.7m fr," ww wiv fL q us1Jf w fw il f m A ' " "Tv '1 'hyffkfkxvy 1 2,1 "'T1T1f 'y!',O-WUHT 1f,UI5'N,1Q1 m?,:-arf.-ry wild gyguw ,,,-f-T- 3 X X x , 1 1 1 , 1 ZX' gix xf 4 J , ,.,1 - -Y. ,Y YV XXXX Irxf ff' fl!! W,-bi --,777 V X !VV,, , F Y, XX V, ,V X ,f , ' f -H r' 1 X. ' , xx IQ' K ' ' ig, w 'gm 'X ,fff K , 1 1' x f 5,4 W ,N if 'YYY i 1 X Q-2 u ff- Qaff' K sg 9 ,-,fxa fff 'V ' ' xXx ' V ' ,fi g 1 f I ,gf N , 'j -' , N Qf , 1 Q ""f 'Af W" ' -ff 4- -f'f -W-1 1 fx f -4 ,f Y, ,WYVX , , Qffxxx f 'ZQI-24VxX.J FR f 5 ' V, 5' " 'I QL 9 C5 H' 117 VK' X ,X 1 LK, X L 'X f V 7 f ' W V1 pf, , V1 1 ' ., 1 Y, ' fx ,rf , J, 3 " , 1 K K ' ,x ,Q 1 , , 'U , W NL,R......,g.4,,fa I X ' ' . 'Y 6 '5 nwmfffwu V"""iV N , , MQ ,V Wx , -AT - ,- K-M-W, X XJ' If 'ld ' 14,42 .ff L1 V ' V' :CTi5XXj, ' 1 'Y - if Y , gf 1 ' Lev ug L L-QM Q XLJV gx x I Q P+ f F fi? 3 L..,' Q . - .4..,f,fQf 'xt xl , If X i M, fy, ,. 1 ,f K," KC 5 , yi M K xg L..4 Nil ..f f5 .., . Kr 0 ff J ,f ,I ', " 1 , 4 U. 1 1 ,Q f -' 1 ' f ,,,-Q,f f-, f r X F fz X if "ff 1 E X in 4i" +04 X M A fifgifffjjff' ,WW---7F F e 9 x 'X 2,7 ff ffw I 1 fy G I x XXX -f' 'hx 1 rf' , 1 xf , qv , 15 1 1 .N xx w ' 1 1 lf' L-J' -1 U -sf' 41 xx 1 x ,' ' . T f-ff -,V--X Q ' X ,XX Z 'N 6 51. L Ji gm ,' K 1 1 1 ' L' 5 ' N ' ,,,, U Q X x w VTUVTQ T 'N ff, X ,xxx LxvXJw W d , UN: ! ' X ' '-X rw", x , 1 xx ' N X KX X 1 J Y I X, x mx ' f ' 1 4 f A X 3 .i?.,?l.....L. Q U Q CD ,CL " rf," R X S K X -xx 1 y xx -TYQM-?f"""' ""' W' "" """""' Q9 f X ' N ff' f X R X64 f I X , 4 , X '-f-xx Z V' OQAX f, X ,f ,fi N, LX! X ' f "A I f' K 1 1' 1. l I M 5 ff ff" 1 . . XXX Y px X X! J xx 4 J Mx' if! fy X , n xx ,f x L 3 XY 1 fn , Q 5 '-4' ,ff X Xf 2 1-V ? LJ - ,,A f X , . , 4, . x YN i , XL, X 4,11 d W r Va mf- ff-V .m VV .VVV V. . il2Vfg2AAfwVA?2-'VA.E'Af'f!AQ.A?VVVj IAAAAVVA' -ff'f-4 'V V 1 A V2 '- ,VV ,V-V,,V:g-V-rg..-V-11 if AW' V, ,VV V,-V1,VQQc VVV.VV2VV ' V 5 -V Vinny ' V' Vf 'G 4 , '- V VV .. V , V - . ' V , V ' 'SV 5 -VV VV VV, V,. VfgfA3VVVV--fV,,?Q A 1-Vrr.-V VV .fu V - AW V FW -W f' V -V ' A . ' .V ' i VM V-W V V -"1-.Vw,Vl'-VTf'W-an, 5: VVV, .V V. .V g., V V R1Z.?.V,, ,.,, V .,., V, , , VV V, a ,VVV , V V , VV! , VV . V V ,VV pf V Tliwif f-:Q-5113+ VV!-V V A V - ,VVWVA V 2 TV- V V' VAL! ' AA V 'A WV ""'W ' ' 'ff 3- V V-5 V5 f '-VQVX' ViggigiijA-uL"VAfj-'33 VA--.Ag KQVVV' j 3 'z:5s.V5EVV ,f V ' A A -v ' A , -2 .V,,f V ' A 5 N Aj' "V"1 1fV'f2,yj,'2fg,'VVg X YVZVAQVV-KWQK,-A-,4-V F.43VVQ'fff:'!5Q-'2A'fw.?Mv221.rf-T?-2VV-f6gVxAV?VPVVV?f---Vi AVV V.--V wif -V.-VVAVVAVV 1-ff-'EV--g,VVAVYA'AVA"-:'V: 0 -- '- - 'Vi---Az: V V, V . V -V :VV V V f VV A V f f f Vr W V mv VV,-I 4,3-zfVA af' V - VV- Jm5'V.--.VSVW-P . V A A- H "A 'ff f'5i'i1f2gfAA'f5?"f-A'Aff' A .rifeV7AiVAVZVf-'V'i'ZV'1'i ' 2' V'A, 2' V' VV 'A L ,WAV V "Af V 'A fi " ' ?'AiiHW'A ' V' f-..TfA+V-'A-AVVVVV.-VfAV1.,1 ,V '--VVV--, -- '-p -7f':V,VV - -' V,'VV-f .V . ff' VV '- -V A v-1 - V VJ.. , -A, ww-VV, .Wi A 1 5.1.2, im. VV, K - ' 4,3 ' 5 WAT- YM, if , 5 .V VV VA' 'V 21 2+ V- V V -V V lr - ' Af-A A2 A .V 3 VV A V V V -555154. .-VV?.VQV"-'AA VA H? -:VV VV 'ff V' A V .ff 'PVVV I '-i n V ' '- V -0 3 A he ' A' -VAfmiVi1fAVViAVVZ- VG-VV Vf V' ?.VVV'V 4111 ' 1 V A- -fm 1""'4'fL-'if' 'A VVfV' VV-V V ,,.f V V' Vu: 4' wi' A A- A - V, ,.4yVL'Z-"' - V, 4 4 , .yn ,Vw .f.VV-.V-V--fms2?fVVwVff:V,jim-VV-'tyV-J ,VV V,VV'Vi.VVfV..V'7::vgg-V- ,-.p,V,gV- ,,fV ' VVQQ V ffl V- V VL v V V-H 5 A fy ,IVV ,754--pV, f:V,p'V V, -3 A pf' V V- . VA' ye. . Vyf,-5 V, 1-1..V I ' -V --1. "'- VVVQAAVV-,ggggf-:,VQfA?'A-VV1fi:AV1V 5VQJVV-,HTQSQQ-1--.33.VVQQQV3-AV13V1:V-Ao,wVV,,.'-Vg-'f,ga VV - 4 j f Vw -gmff V wi V- wif V,-'Q VVSV V2 , VVVQ, fa -z.r'g,gqg,v VVWVVVVQVVV ffff V, V, 'V5.q.qV,!,, .+v' ' ww' 'Vg,AAAV -V' , VVzVfVV :Ve-fi V-:V fi'-f V-AVV4ifZVVV.VVfV-A' -V V-VV, ?'fV .. V V :V Maf---A -iff? V- V VVV -- 5.-v?5,1,V1.VVSVV-4.-VVVV-VV',wVV--,- --fr 4,,VV.V,V:,fVV.-V-V ,V-V-VVVVV ,:. Vw - V V A V- V, ,Vi-M2 'V V VV -V ,- , VV., V:V ,V V .-,JVM fV.VV Vfwyfb f,,qlfrfVf" V VS A V V V 'MQW V ,Q A -. V 1 A 3 - 'V -A 3 ff? Af V V4 - 5 'fi' QA 3 A' f'7'AAVMVV,VfA- A 'Ven-,Vt"VV.f"'V-ZA-fai"AV"VV.f . ,f5.7V,V?A 'Aff V AV . 'A ' 4'-' Vv'31if V-AV Xfy-VVSAQVA-A' nf' 3 ' A ff 6 A17 V V7 V V VV Vw VV V25 if--7 ""AW2-'A' Vffw 'ff ""'?flfV'7VVVV f A- -AV ' .., '12' -A 'A ff? qA9fV1fz'V'x 'AC V.Va2-Af' ' ' -A A g V , V iiifllf .JV Vjiff? 'V - V VV -J A VV7' VA VVVHVVV V -A . - VA Vai' "AVV4AAf -'-mf'-i':aVVV-',.--AAAVQV' s-fV.--VrfwfVV.V- V A V V V-A -V v 1 -- V VV' V 1. V-4 V--ii VV " A A 4' 'w'.'i- -4 V' 'AV A A - A-'Awm 'AV -V AV Aff' -AW!! - .. V. VV.. ,., .V, .MV ,.y,g,, VV. VV VM , V , Vw.. 4, V ,V, , V ,V VSV.. ,JV V V. V, VV Q .f if , V I V f f if ,VV V VV ,4V.+n,, V V L V, V V ,Vi V. VK, ,VV J! J ,Vida Z xml V L ESVVMVV J y it VZ, My, 2,4 V K ,, V1.7 , , Ay! I I, W1 Jfgayig , V LVCV --V -.vu qV:gi'SfVA- fV,"Vfj-5- V f'21V.'7A 'k" ,'fjVvg,,2:,VQfVfA -,'j'Vfx'-fl.-zVzV.g-if -' , X' A 3 ,V..f:-VL' g .' Wfz-'AV,'VVZiV'VVVV-.1 , NV 2'VV!' 4, 1' V' A W Q ' -' -1' W-'9 .,V V4y"gV- V ' 4 V, V V , 'lil U ,,, AQ" ' .' V W, 5 Va- f 'Vg' Vf ' 1 - V4 V - A V ff 3 V f? HV. , V: VVV- VVVVV-z,V:VV V' f ' ' VV 1-V ,V V-' QV V' - , AV-V: - V -V ' V -' 2 V AV f -' gVAV1,gVy.5 VVV V ' 4- 'A V VV f -1fji. fV6V-gif A' if 'ff 'QVV-,MV V-,. ., ff- ,,.Af,,g.gV,V 'V V1 1' 'A - ' A1 VV9 VVV5A,-f fi4V.V-VVVG,A.V,A',VV -VffAJ?2 -55: VAVVA,VV',V11V'-2.3, :V-VV' g -A ,VV,i An, A, Q V, V 'A V Afffflig-5 jf- -' V' f -- 4V V -- A WV-A,-a-' ,A ff Vg 11, 55, V UAV, V,gV'wV1VV 'Qi A If g .V 1 34' ff.-V-'V1'J44f 'AV-VA 'VV' K 'VVWEZV' V V' 'V "il-if ' 'fgfiff' V A V 'VY V V K ' ' - A' f 1 G Q! V 'W Vf! 'V 'ww 'tiff V VV: fl" 1 'Vw :Vfif A' f'f V7 'A ' V 'VH 4 77 FV f f' 3 V V V VVV',41' 74m-f-A-2-1'-'-AA? VVVf-V- VA.-VVVA -A V A' V'6-V1y'1-- IS . '."1?,V' V. 1 V A -' -V V ,VV 1 V .wr A' f -wh V' lf' ww-I H "VW V l 'Q ' Va'AA'VVf'f'i?,V 5. V 3 Ml c..v .' -,V-ATR' V' QV' V, A A ,A 1 2, VA WV' ,V VjVAAf-'af V V2 V,gf5'gV V1 -g Ve. gif. V,,,g.V - n,.VV -, -V.L-,- -VV 1V1gVV..A-1-V V..VV"1':-'V V-'V- V A V ff- V fvf 147- V' 1 -' 'K Y AV AA if V -V A" iw A V' 974-f -19,1 'V fV' l' A2 -' V?,yA.9fff-fVf',Vf' QV:-f A -- 'A V.VV---, S' VV-fyV9:gV jgAfagff'A.iAV'fff1vh1'L-Aff-VVVAAV" Ji' 4766 AA,-, AV Sz Q- -V Af V 5 j ,V2A- V VV. ,VV ,vga VV, VAVV xr' ,,VVg Vg IVV W5 5 ZAAQQVQ A""'Z94 - . . ,VV V V V V.V,V,-V, V VV,-W ,VV VH .V VVVV,f 5. .Vy 1 I VV,,,VV,VV, ,VV,VV ,VV V V V ,VVV,Y ,rl5,VV,, ,V , V ,,,..-,,,,. 4 ,, V. V- V: 1? V .gf -,VWMV V V V-.Vg VV VV- -V ,QV g-VVV V r3V'4,,Zf VVVQZV f- VV ': -'VVA VV". WV V V V -my V. 9 '-V - --5. ,- an V1 VV- VV V ZVVVV,-. W .7 Vx VV ,4-,Q V V. -V V i ,f , V VV, 4. .4 ,fy V, V - ,VV -f VVVVVVV ,V -,.VV4U VV VV-V4 -,VV V yf4VVVVVV4 .MJ 9 ,, V V V ' if -:Vw my :V V-1. V V 2 1 1 V -f A- V Vf VM-QV -ffV,,VJVfVw -V K VV- -A VVVf--V 4 V in qs?-VV- A?VV".VVffe VV '4,4YVVfrffif,-.V .fV!V:V. V V ' A'V- V1 1 .V V -V7 1- A' 1 VV - AVVVLV A.Vff-gi7VV"f-iwi- 1.-AV.: - V V. - A 4 AV V' "" V VA A - o1V.V'4f AV - -:VVVV'V2- A V1 V V A V: uVA':V1x:yVV- VV'-,V-Vg - v V KV' ff. V- wifi.,-VV '-V V:-V- 4'-'ff 'VVVV V V -gf nf VHQWVV Im V13 -.-V'M-,fa-V V I 5,3554 WV 'jf V3,+,V-,rVVV - VV- V VVV-. QV, X, VV , V f V , ,v -VV V - V, V4 V V, , V VVV, V V ,,, -f-154,V45VV,V-,,-Vw,,'1VV,V-2V - gpifyv. qg Q .-V-VV-V:-'A -V VVVV--'V V-V V 'VVVVVQVV : - - VV 5 ' AV- V4 - VVA VVV A V A -- V-'AAL -VV. 4 f :.g'-IVV f-:V-V: V - V .,Vr'V. f . V1-',VVV'-AViLV VVx11 -' .VVHAgaVy:-iff.'AVV42'1f-Ap? ,V,Vf3C-f,,V:i. xi, A A 'A V, V, VV,V'V 1 Q - s ', ff VVVVVV-Aff 4, V- Ay V -' , V5 ' 51, 'gf V -ffzqm A,e'wV- ,Q MV V-'-VVVV VVVVV V,VVV,.WV-VQVVVVVV--QV-V-.,-A V- VV--VVV-.VVV5 VV V VVfV V-46.3-VA.--V '2 VMVVVVVVVV VV f V :VVVVV -VVV V- fr V V V V ff.V VV rf V V-K-YVZVV VfAVVf--'V-sV-V'-'V-,949-' VcfVVrAfV 'VVH .V V392-V:4AsVfMf V- 1-A-'VfA: V' -V ..., - V-.ws-VA . VVV-,VMVVA -V VV V 1. M VV 'V V- -f - V- '-4' ' AL' "M V -' 44. V:'A',:f f- 1 AV V' 4 4 " 'wwf ff-V V-V. -'A1-1-VV-A-V'V1': L V y A 'tim ' 3-9 V:f?fVV,1V-1f-f--'- VV V V Vf:V--Vw VV V V-V VV V 5 ,V 2 ,Vf-V-V va. V V my V 1-A V. ,,f:VfVf V1 -z5?g1VVVVVfV:'fAVz1vVV -VVV -ge A--W lg 'W' V' Vfff' AZi'VVAVVfAA V 6 4 -VV., A fV 54-f6QA'V VVV-HV' Auf?-ffwff A i"T V VV VAZQQMV V AW! 2 V. V- V V - V -V 2 A ra V ,A V AA J, , V A- VV .A E xrhkr VV. VV! .VV ,V V 5- ,I V VV V V. , E i I -flfifidg I .VVV-?V,.. VZ?g,:Vf'4gVfV,,,2,V ,f ww- ' A' ' - f V 5 V - XA VV 'A V , ' V-A AAi"1fl21'iVfV'7 A VV WWE VZVV VSA-,lim AAA I - V' A VN VV -f Q .VMI-V-VV .V - V V' V V g VV 2 V' 1 ,Jw 1 -.Ls-' M1 4igfiALf7A, 12 ,12 -L --14- V45Jf1?Wa'jV', V - ViAVVV.V AAf'V'VA., V' .. A. V - '-' AAVV' V ' V:VVgVn-V V1 A' -V MVVVVV . . f if f V .A --V A A -, f' V 279' V- " V V VV 2 V V VA 'fi I. -V y - 'noun f V Vie, - Fr A. ,.V " H--1 V -- V,VVVVV:VVV, 55:61 VVVVVV-34395. V1.V,V V,gAVV'AV,ggg,: ,V .X 5- V V V V j t ' ,V V 'V-,-V I V-,V ,Jf ,ly ,' V - , . 4 -1-43-. - V A', ' GA 1, - .- -A 3 if :VV L . NFA' f V - V, V., A MIWKQMKAYAIV A- V' L5 VT if 'V' .np VV AA , 1 ,V " A ze- - ' 1 i.AV?1'7".'I'V-' Ag: -'V2- , V if -V " .V ' A VQVAV V' T fpVz'1i,f A V V 'FV' IVA-AAWV A V i.V A VQIAVVVVV' MA- .5 V'i.'A-Al-.V-V-VVAV f' rf V 73' Vffizz-Vffzzf--Vi'V,Wa-A+ -fx V- V: 5-A'A'yVVf'Z f ---V VV'-' VVVVVVVVzV'.V-1--VZV-V'VVVV-VVVV.VV.--V VV- VV!-V-VV. VVV- . ,VV-V., VV V Vf VV-A V- VV,-VV-15. V1 VV V I, .V,V, . V V-V -V V V, V V- 4, -V -VV -V., ',, er, VVf- V V , V VV V M,V..V,.V, f. . V, V, V Vu..-,Val-.V -f,' -A 4 '4 -45, X :I I V K+ -fl gy MV "'V- 3,91 V ',y,.Vg 5,5 3, ,fVl,,VV,Vg.5-,j-A ,VSV IV- "Q: IVV-A. V VVV A Ag'V,Vf V ,VVVLVVVVV - AVVVGVVQV 2. Q2 V V -V V-4 .12-7 -V'rV. V V V -1- V. VV-V."-.1 VVV:'AVVffww1v::A .A -:y:1V,ff,'w -4'-VVAVV -V-V' 2 A- V' V- fr! V 'V A ,V .' Z. , V. V f ' V A: '- '41 V2 fm-VVAA V A V VV:--'VM-'3V A - .V 45 Vi- 7 ' A ' VV1' f . V . S- -V- ' 1' ffl?'ZQV-5f,gZAV'fiVV'V'Qi532fVf5'A.VgVLfVT , 'Q X 'V A--VV'Vjc'VZV!'v'4,fAy3fQf'V, 'V ia'-QLJVA ,VJ'yj'- 442-511 ' V V " ff? 5A-if A ' I EV' 6 , 1 ,-L , .vm V' 'V'V an AAAf"'i'A:--13.15-za3 b"ZVV- AA A V fVA1 ifVAV:zA'-- ffm 'V 'J Af-AA'V A- V3ml'V'zA:A AV : VVV 1. ff VV -VV 'V--V1 ' 'V V A, -A 1' A ' V ' -A V V V -- VV V.V:.V-V VV ff,-VffV-1-49--VVV'fVg -4. V----:J V- Q V' AVGVVV -V V44 - 1 1 -VV - . V: - :QV w?'VVV VV V- V ,.VV.:.Vff' ,VV A7VA1f. :V VV-1,5 M '.V,',- .5 W V V! - V . V V , gp , ,QV V. , IQ4 VVgV5g.,V7V V5V-7 lx " V I , V 5, ,VV K ,. 'fj'15,,QVe'5 X VV V,,gV4ggwV V' g,VV,6A'!V,g,,,V.gq4:.5f5 Vlfvgv V Q , V" :v,3s,f? V V. - A - V11 VVf1JfV?7Af VVFVAQVVQAW ' VV. 'Vg Q- VfV 'W V V-V-J-f'fV'V A A 'f',f,g-22145 -f"V-if-7fV2VAVVVf 9 -- " p4fjif7"""'A"A"' - V V V 'IV V V A- V, V"V . ' JV, fV'i7fQ.V7l.A g,V 5 , VVAV-427. ' zf"E'.,1fVV,f-AVVVV' VQQAVZVV-V:VV gf,fg,VV1 g,:VV, ' -', ,V V 4 V,.V, f f1VfqVVrf ,V - V .f-V f.,l5,g7,:-,, f'V-uf.,-ff A -K! A' VVV V -'VK 2, ,, A I '- , ,rf wif , VV Vf,,- ,V-A-1 -' V.,,+- ,V A' V' MV I V'-A ,I VV.-VAYSGA' VVVVV QAQVAVVVV-TVVfAVVVVVVAVVA- VA- ww wr - V 12-' Vfg' A '-.VV-Af"V , -'V-4-'Q A, , ,A . ,VV A' gf" AV ' " ' ' V V Q4-V V,,V,,,,e,V VV,:V A AV A,gV.a?-?'f. 5 V V ,V7AVf ts,-:'2'.V-V-'Z'-'f,' VQ'VVVV5QVTVV.VVVV,j1:-1,5 'Q-Q, ' -,yV,zj,4w:VVgVVV- Vqq-V,,zV-'VJ VQVAVZ- 'gV.V1i .V I '.V!-- f A3 ' , 'mf .V ,,.f 5V "5 :V,-- V'fV 5 VW, -Vw 'K' . yy 'V-ga V Ay ' .Vg ." ju V 1391, '-,,. 1. lv -,. . ' V V "AAA A'iiZVwaQVVV.A4Vf'VV-fifaffi' Q -Affxfg-fgV1Q,fQhLV V "5'7f- V A'4fVA3 3Af31f!il'!9f AV 'V' Ai V'f ' ?21A'!-i'A IV- N Vffy-,IVA f" V, -,V. W V. AZ tVVf4Ai?fzbf:ids1f1,, JAN" VA' A f,f"'., A V VV A 'Vg ,V 'A' ' 'PV,- '-fVZj2Af- f . 4115" Q-?cV- 'T -fje-JV V". 3. -.fy -V WV VV: 'X -.V ,MV M V U -, , y i mg, . 1 - ,V,VV'VV2', 2-gy.-r-V.f6':V V,.VV-RVEJVZWVZQSVQ V VV V1-VV!" V. A V Q, wx-VVVV--VefffVVV,a1V.fV2V - Q' ' 1 V- .VV V AAVVVVV' W' --V'-ff' "QA, .V-WA 1 -'V f V. - Q 1 L V'Af AA x-V'-91-.VV ---liifv iV'VVVz.' 1' f '-,a,f1Vfy4'Vfgyf, V-V3hVg1,,wgVg ,-VfAVf-AVz VV-:Vgm ,VV VV V ,V V. QV.-,VVfVV::Af'V73', 'Q'-V:4V'115"A Af'-F-V1gaf,4V,:,g .V ,, , V V 1- 1 V A V V5fV.'tV Vcf , 'V-:V - .,V, ' 4 Pnl fa , j'fVf2LfcV:V:y V..zV.5!. -A-31... .AV-A-'au - V '--4? wh 35. V- igv ', AA .A ,S Wfvivz Af 43:-'V-GV'-V V, A VV AV 'V V-V 'AA VV Vw' 12,9 'V 'V5 MU.,-M ,TV A-23V-HVVJAA ft! ' li - V ,V V- .. , .-'V .V ww ' ,V -52ggvVA--AAVVVJV--5V-V-Ay,V,VVAVafV. VV ,V 'V .ff V, V, ,V,VV1,,' ,, fVwg.VfC-K.V.VV5V ,V 3 1, -'V.T7?V'!'f'f"A"V-G--,yf-vffVV- -V Zn 'VV-1 ,f , -VAVVA VfA,'V1 f'iKf'ff,: '- ing' -ff "f-z z 'fl' V.iAA??f,14VA V U11--VQ?fw"AVzV,.J' W9-':f,?V V-YAA-f-V-fs. 15,7 ..VV V f 7. V V?Z?7AAf'5!fiMrai1CJVp . ""' V.. 'fff55'A' .9552 ' A""' A-Q, ,V V AV VV V ',,g,VVV:n2A V Ing, ,--,Vi -V ff. may MAVH ,Vi 55651, I -54,51-VV yaV:'V-HVVVV, 'V -A V ,,VV::l,V--VVgVV64V,,g3?-Z,-VVV5-V VV .AV , V 4, ju F-:V -km... V211 Aw f w -Va -A i-,VNV VV2 fV'VV,r-VH .AV -- A -VV,,VJVVV.gf'2fLff5fwEGgV' VfA V V .f A sf----Ap 'gf A ' 1,4-' .JVV:fAVf-re-',Vi . VV -A V- 'AAf -1211-' HHS? .A - 4V-V V-V 1 V- V ,V V V -V -V V- A+, ,V1,,,f: -A r ,- Vs. V f QVVV4- x V-vV4:VVxVV,VzV-Vw :VVV -'V' V VV :VV V-Vg Y ,V ,4,,.V VV V . .V ,VV .'V-V em -, VJ ,V ,- V ' V 1 , lr V -. --QV-V51--V - .-VVV-Vfw VV: V VVV H .m-Jw f,V V 4-,pf ,VV -. CV' ,Vw -V ,V V . 1 VIVVVV-.,V.V,, ,V V,,,.V. V -4 VV .- VV-.Ve -V NV. :WV ,V VVVVf, V V V ,, .. VV V ,, VV,V,V4 ,VVVcV, .V y , . N. VVVVVV-2 , 1, V w V 1 -Afwipf.,-11,1VV.wQywA--2V--' ' V , -f:VjfcfAVyV.go AV-,V'VV5',fA,1V , - VVA' A firff' VV yn- 'A1'."' V Vg..,V, -.gi ,, AV G ,wh- V-ftwf'A VW- V-WVVV ff. ff V11--A VV:-W V V 'Agfa' -A 'VV'-A-L f-'Vf'- AA V V 22'-f V----if ' V f'fV."L' V A2 """ iii-iAVVLVAV'QVfV' AV'?33?' A ff QV-?25""'IV'?'JV4 A "A' AMA Q v '-VV- A V! '51 .1-'Vful'-A 37-1 'f7A!lrfWfEA' A"f"W VC fsfif ' -V71 -V gm- QQVVWQJZQ V .MK V VVV VV -,VNV V- -4-A' VVAAV-f 1 SV- I .XV A- , Vs. VV guy: VV V V .V-J QV-1V36V.VV Vi. 1 - -5,3 :z,2V:1Vz. - . - , Vw. . fi V Vw-AV .- A, VV, A . ,V . ,551 fV4W"V -i V -.V g,4VWfT' V31.V-,"', ,.," ggfyx -' J A! ,VV Vff-ii-Z1--V5 .555-' -AAAALQQWAV I 35692 -Mf-V-V'AVVVVVV-.f-V'VV -' VVVVV-p'Vi2AfV--'hay 4-www' ' f- -wmnW,.,,,,- ':'Af -f V V. V V A,-A . 'V V VV QVVVAAV-if! Aan--!VA'Ay'++ .A -V.-QMVQ if-fav -'Aim V w ,W ,..- V,g 'A ff ga VjVgVy,V'1'VVVV,:-ILVQVM,-V44 ,g,V, -,V 1, , V ,,,VV-ff-'AVI V 4-,jj V'AVd, 'EJVVA-V A-VfAVg QV 'V-AV' - L .-11.-3... V A -f V V' A V -J! V, u-pfV.eVAfV--A-41" ' Vw g,,,,,.VV-V- ,VV V: VV- ,wlfw -Vx. V VV lv- A 'Wig 'f .Vg-1-1'f's:AV-A41-QV-A.AV-, V AA -VfT?Vq--Xi" Z- -V-'C rw, -fy: VV-:V-A-2,6-:VVWW-- VVVV 33,232-'V--fVV' VA 5fAA'A-.Y .A -V,V..V', - VA --164 1 ' ' 'A ' A' A VE 'K 'A A' '- V4 -' V ff V.,-gig- A. ' Winn !VV1f4?!'1a- 'W'- VJ? ' 1'-WAV -V ' Y -,V,1 - I' 4' fr- f 'VQAwzVA.Hyfys"22"-'Va 1 Val. V , 45' 11,2 rw AW- " V-V' "AV'H.'-A9 ' A,VV-'V 1 , -V:-G' VAV V-uf. , ,yr 113, .. " .V,4 VV rfb- -fam A, ' 'V 'A ,gVVfL,-fc ' V95 ,df .V V V , VA V .Ar fArA' A -,ff fr -V ,sn -. .V V-,' -AVVL. QV- A V- --CV 'V -fa. - - V - V V V74 H AN .V 'A -" 3 -1 VV "V, " A VV V Vw,-gggmww - V ' 'Ali ,,,., -4- -,M 5-- VV-sw.,,,,,', VVVVQKV, V,, ',?g,,VVV.VV A VV V 1-gn V V V ,VYV.gV,1,g3A My ?,7?f,,V VV U JV 13.3 J,.V.:74g:,, f H, f V: QV2, ,.4,, V A - ,Q ' " S T im A . A ' A,V,A.iA' . V ,"Vf!g1,. ff, 4VAgf,,5..i,x,4A I Vg EV M ,L V VV ,PLLVVgwgV5V,Qi-V2-ggkgp I -Vw . V- Wni,,,VVjVV , QV MQV V 119 x525-,V -V X 'gil' .Mn V V. - 5 V VA --V4.6,f!:,V33,,SVx.V33V,VfV,,V!,VuyVV-1-.A-V -MVVMQ V7 -Vg, 55.25. ,..-V A V V MVQQVK L , ..h.H U 1.-A VvQgVf.gfV V-Q35 -i',VV-VV' 1, -' ,wV':.V-AWKQVQVVWV - ,V ng., V 5, 'a4V:A' 4 ffm: ' ' .V 41 , A A-WW' .-V4P1y,y,,,,VVVv-f,:,VV . V ,V f"g,,gV-S fy.. AV V :V V .Vi ,V 'V 1' ' 2153-V-' V V, ff fff- A-kV.u1Vv.AV,V VM., V ,Aa F1 -'V'-. 1' - up-AV5z:AAVf,Vs .QgVgar'A-,yg,2yV ,. 22- 3VVVV-W4-5-V ,,V.w3ffVV2?A :WV-m:'f2g224f: ,.-my, 5-335-V,.V . cm,-+V ' Jews, MAI .3 - A: A V 1,,,LV,, .,,,V V V V -- 5. V-- A, Q 4 JV' - -'r -I ' 'J f-VV- f 1'-ki-.'4.VgV:rV:4.VL-QMA 'V' VV.: 'M 4-V' :- z- QA V-Jlywfggaga-VV-z-Vw Vifp VVV1:,V-ze VVAfeff?'AV' A. 'V V' ,AA .V 1 V V 3, V :,,V A Xu fAA-,QM "- -'.VfV5!iV. V-V Vw- V- ,VVQVWVQQ-V.,gfV , V.,,:fA-VA VA gg-11 .V Vw-VVQVVA V V- V g , , ,VW Wm, - fi! , V. V !VA V1.4-img... - 'JA' :Vp f - J Vmifq l if WAA+'Vi2QVV4i5-gf-u,f41,544gf 1-V VWVVVV V1.4 .4-V-MV V 4--V V fl t V W - f V -, ei-. 55, ,.V,,9,V VVV, V X 17193-fwg,,V ,. -,mg , , ,,y,,,, V w-V Vw. 'W-,,V. whiff V-VVV.'-'ravAy2S2?9--VfV-VVgfV-2'V1fVAv4'-2- V xggwf vcf ' jqff V' 91' V: IV , - N an ' V hx 1"V.' pw 1 V 1 AV"'w's 'VVV4- 5VVVV:VV:V4 V: -V V ' V V' ' f-iffwg:-:AV .AV'5,V --,V AA1 .Vyw-VV VJ . ,V V VVVV 'V di. V y nv in 4.1.1 '-U -V --Vu-.rf V- V -V,-VPSAV. sf!-V VVVVVVV -V-.9-QQ.: i-fy ,,V V--f-VVV fVV.VV Vt'-Vw VVV:-',AAA.Vfi:V 'Vvw---VVAVV- -A :-1i' ,.V V' V V' VVV-M-V--'VV .V V V:VVVv4g? f ,J -' V ,VVV,V fw V ,V Jug., V yi .V VV by V V- ' V V. Y, -, V - 5' V--.,V V. Vp V P, .1 V-:fb L!-1,-5-fVVfV1VVVf1.1,Q'y rw . Vw!! "wmv- 'f4VfAV1ff-ZVVVA Vein-VV .Vw- ff - 9?-!5vA4'7V,1iV.5VV -WV-fi- -wi-145-2361 AA.-V-n1A2ViiZV-1' Q ' ' . V ' A ' V V V V A f, V' V ,f 'f -+A W- ' A V-f-4ff'gffA-:A1z'V--VA V.A ', '24Af5:wfVAf3fV 'A NWA 0 1 V il- f V ' V- . A ' AV V V. 'Q . -f:.VVVVf1A?99'V VVVAf.3VfV:VzV15V4?-,VF 2 AWVC V JV - V ' k VV-Vg-V:-,,V AV-VV , -ff-WT?-if A- QA E' OA' Vf,V--V-:VV uf-- , V VVV. VV, V V ,V A' --V A V A--iff ..:1V V A 5 V ,V ' -V 4, ' V -V A' - 'V -wha T -ff gf-'AV 0- V Vu c VJ " af 4V-VV. VV V AAVV- . V V -1. 5 A A-ff-"V.Vf. V - MJ-V VVAVVAV ,-,4 - 7:g?fEf.V ,aw -WV -V aff..-V . , www- Aw- V. ,V V Vz54.1VV,VV:aAV- -Awsrw-,Q V 'V .V ig-f?ffVA-4-mf VA: VV V V VV--wif' V f AV- V. 'V V 4 -A A A Ve- .A .muff-wf"A' A 2 ' '-.fl 4' KQV J -V bf Y - 'VVVVJQMAQ' Xfijfvf f ,Qg4VfqLy+V ,Vyirf i:-V12.y?, ' 32.-V ,A J 3 fi-V VA' A SAV ,KV . , V , 5 - VV, V , .C 'A -VV V V J, -- .- 1, ' ' V .,4gg.5?.6'fi' VVVUZV,--4 ,y:.V,'?, -,V lr ,V Af- f"'1:VViVr5B94 ,V VV,, -V V ',,23V:-,M-V ,:V-- A V5 V, V V- - V J V., 5, ,V f.V,,-, 4,pgf.V45y.fy-QV-QV. -ua. Vw-VfVVV if A A 'QM A -- fy -AW-.VVV-VV' 'V ef. VV H V -. 4'-V Vzfff '- Q .Vf V, 2ef.V.af:AffVVQA-TMVV.3 V F-VV:- ' . Zfpq' V -VV1-fZma,f V-.f. ...fVf 1- .aff V V wav Vw- ,,-54, VQVVMV, A,VV--V4,VVV,vaV-gfgg, ,,-V 3 'V VV -f fff'fV,wV VV.r,eVV- VV -S? -A 5. 410 ffg ,V , 4 U. 4:5V447.VVV-i7Q3Vfg'bgf,wVV. ,Q-,1 A Vw- . - . 2' V' AA fV A V!y2',mVV'V4ff2AVVAVfrV-2V , A--A' 'A-VJVAV 1-?,,Rf1 , -V? ,- V'Af V .VV '- -' V f V. Qui- .aff f . 'V ' '1 9 -' M92 4' VV- .Vfa-EM-1-Waxi"'hMa-fw V-V- -V 'fix'-11V'EV f'1.V-2"Lf- 'V -'k,rVAf21e ' ---"FV A' 592--1 .2 V . - - .Af'T"'.- V A . ,Aww-,.m,zriV Vw.. .,- .V .VMS-li 154.-4-.-'-'V'fM! A -V-V - Vg' VVfV ,V -VVV.-.'VVV-.VV-ZW. VVVVA. V V -V V . V - VV 'V'-VVV V'V Vv V-VV., V534 V- A, VV VVV V. +V -VV- - V,.V,VV H VV' V V426 .iVVg,Vg,yv,z,,4VV:VV4f,VVgg,,f VV,,,VV4V --VQVVVKVVV, -,,VVVV ,V -wp, ,, ,V ,xv -V .V VV VVV,.V.iqfy 1. VV. 54 , V. A .V -V1 -f,V,,fVw Vu. ,. -VV,-.Vx ag. VZVVVVV-VV,.VVV-f,VVVVV.Vg.Ql-,d-- ,mm V77 f aVgQfi2e'V,w?A'5:7'f-Q -'PVfm,V- "T-' ya- K44"xY9A'18f?gAf?A?Z'51A1E-5ifff-VA2f'iiL5V4lZ'-5'V Uv' P f:f31VQ21VV'ffy 'L VJ-"VA 1-1 I-1 A V 'AV lies. 3 ' Ag Q V- tif" V . V? -V A-VV VA A' V 'fb -V5 -'W4"..3 ' 3 ' VVS. 3-1 V V?vV2VA Af' V 1-.ff Vp- V.. 'VV'A,V:,VV".fV3V -AVA-9f"'.A.f --VV.---.V VA-AVP: .V - -VgzVVggjV. V -AV., hm AA ---.VVV Vx V A V A' ,e- . V A 1. JT32234FVAf4':iV1ZV-V A f" Yeif3 'A V-A-s?"A1 A5 A- V- "IV 7 15, . Wifi" E231fi?Iffivijlga,-a?'1S77AiTQ'35315 'Ve ,fpivjr , " ff? A1V1f-fx -',-i5V,-- ff-V ":V.'V V .. A - V -+V A. ,-, - V. I-VV jim- '-1 Qin g? -j,,4:5p'5j, b V. V- . AV .. A- VV,gQVfZzV?V 1--1- IV V -A -'f .V .A QV . vVVV- A ---wit-V-'Vw -- -. 41- 'A A A -"-A' Mf-- -rr-wi! We AfQ,Vi::63.VAAfZ5VA1f ff? fi?"-Q-Al' Li:'iV??V.v?Fyfrifi'7.52-Lg!'VV?r'Q2f12g?1VVifV2512ffgvg.Vzp: Alijvwii- IV-2-'?ifV'.V. . .A Y 'A AA fi 'ill QA A V , VV A -N'-V - 'T,Vf- V11-g-V VV VVV -A- A -A-A - --V' ' -V VV - V. V V V: A7-VV V-fyVg1:rVVVVA-ggV "-AffVzw,?iVVfgVV- 1-fzVeV'V?V, V V.-21 - . - f- V ' vii , g,V .VVV-VV,f,,,g V: vi VEV-V1.,:V..f'g VVV5-V..VQVifV.3,VAAf1-Vg-,VsVf,A - ., V -A -3' A V VV,-'A 'Vw ' V- A , . V.,V, A, VV VVVV VVVV ,V4,V,- ,VV-V -V V - ,,,.,jV , , -,,V,V . pg VJ,-VVV, VV- ga .-gpM,V?:,iw VVV2?-VXT:,QVq'V-V, Vai.,-V ' ,. - AV V VVVVVVVVU: ' ,V , 'VT'-V, . . . - i. ' ,' ,fb VV. -A, 1-Vw!'-f:f25A-fV'iVV- 'V 'Ulf ' RA' -V VV2.-.QQ---f-H V4 .ff-iVV1-VVA A . V V+ ' . V ' .A '- V. A V VV VWVVQV - f A Vw ---fVV2,'pVV - ' A' 9'- M'V AfZ"1v 4- ' f A .VV-'VVVVVMmVVe4i:V4'f'V V141-fvVffzwfiwfkgf-1-4V-a4f'ffA2fffz-mlMyVVV.'--A , AVZ-'?z,V,.V3- V Vg :',-.V1:,V.,f.f-:yn f.:.-,,fV,VVg1,V.AVVA-Pg-qi, AA VV.3z,Ag?VV :V 1, -1. .V 4 1 5 " rf' -J ' VV ' '-"'Vf3f- ,::rf+f-iEV'f A ?A13'VVTiVL' 'Vh' -' 9 ff 'ff ' i7 ,V.3,V.VVVV,gg ' 5 V .,V gV?b5:. V V,f , C V gq-if ,Aff V -V.V.,Y3VV,-A-VZMJV Q, V ,-V.,-,.VVV,-s-,L .A XV H P A V LH VH W g fr-:-5-sVyVVVsVxV:AV?ifi-VV - V.,:. A VVV. V V V ,. A'1V V -V Ai! ViAyV-'A-V-V-52-V V .:Vfi."AVVd i-gm VU, .4 H t, 1 Aw- -A V .V- Af'-VV-ffV'fVf .VA :VVf.r-x:ViggfV:--. V AJ- V V- -VV V VVVVVVV :Q --.Vmf ,ws V Sw V V .,- Jw W?'5ffI'?Vf3V .- nm- 4' VV?-5 A1Af V ' A 5- VV V.V 5 qs? 31 . -r'-AAA AAA' A .V A' " .ASW Q 'wg VV ,,,V1VV ,A .T5:V.Vf -, 'jf VfiZVV,V,l.V:. ,ff-R52 KV... VVV'VqVuV.5IVfx:. -5:33-g , , W K-,, , ,VV1 dy 4, HVQVVQ , V, 5 Aggie: 'A gg! 143- 1 - Azz AV -ueftf 'Qi-234. VV 3V',g7?yjV V??V1'VgV1:4 mfrfedw-yf?'iVwn,V71-95,2-cylVQQWVQ- Vw.. V,M?w:'wpg,E4z,,W,1' V'-4 Vw fj1VV:VV':f V 'ff VV'VA?,21-VVQV--5-.-Lam.-f'V -.Vw-1n1V?s-AQAVLA-Af A V4, V A VSA- .V V.AVf,VV.V.V - ,iff 1V' 1---"1 V A fg- .VA .ew .auf-, J VVVW V. V,,w,,3. Vw VV VV,,,gW4,,1,,f4VV,V5-VVV,VVVy,.-VV.,,V-MV.,..V.w.VVWVV4,.V.V,4f-Vi-VV..-:VMgVVV,V,zVV ,gi 1,1 V,V,.,V,,VV,,v 5,,V,V ,'V,,.,,.V,,.. .V,V.,V,,,VV,VVVV.:VVq,,,:VV.VV, ,V ,gi , V V- ,MVV ., , ,I -Q'-'S ,-Q I MV,-, V.V,V.- V.V I ,H 4534.1 ,. ,A VA- 1- 3' A-VfVVVi Af, fm'-H Q2-Aff-I -A A VV HP V- A A m: -V... V V -f Vnfffjg A . ef , gf:.5--ilgmfi-if1PAf4f21'5:Yl'- fA'fxfV -V gg: VJ 4V..,-VVV,V .- - ---"ffm: ,VVf,fff,yz.V -13194, VVvq',4Vzf37-- Vp,-VJ.Vg-,GVAVVWVVVV-KVVf',,-VV1fag,gV ',zv,,.:zr-VV-3VV.V.Va, gg :Vo ,-9,:A-V-Vg-1: VV, ,V---3.1.,4,5fVVVV..V-,n,51,,V,,.-,1-Vim-VVVVVVV::VV.-41.-,V, ,. ,V 0 , V -V -- , A V -V, . V V- -,V wif,-V. , ..,,,,,,- -V.-,J - .V H Vjsdfpg-,,,J V:A'?'2f 1 Zfffiffb -f4fWW-7Af?4f9Z5,i- f-5ftiiffiffiVQ'A-4ZV1f19:V?f'6fVifVf-z643322ff3f4QfQfQVMQVAZVfx5fAz1eai.VwVV2.affV212-Em?V,:z1,M6f-fy-iw-TVV-AVVV- 3 VVV--:V-VVwV.i.Vf,'f?WiV1'2v1-'V5-VV:-:z1-VVe-V -in V151 --Vw 'Ai . Q gf rf- Viv VfS5gVf'7f':f1LfLV,.ff11.Vz1z:-. PM34. .ffff 4A AAYA' V ?3f1fW-'AW Av ,VV ' 1Vv2z-'ASVV Qi-.QA QQ QI ' " ' A' I A - 'AAAA yt-WA .V'Vg.:.V..VV -. V:VV'fVwf1: 'J ff'-VMA-VggwgeMS-Lcaf'1-QV'2w4A4-'V fl' V?-W-PKMVXVqua:.31154fVweg:Vi,4V',i-withg:3AVgVg:fV5A4gVQQQ'-3263-2-V,V VVV-A.f13-VV 131135 Qff-,V-vf-V--gf.Vf.Vf1VaV'44-QVVVVVAV-.VVgay., was K- - V-:A . ' A 'A V VV V- -' QA ,f'V- YV' V -V-sf J'7'f J 75 ww 0 -.W c,'V4VA'.rA' MWVVV Vwf.-Va:1!WV-'Z . PQVTV '95--fff.VwAV+yiCa'-+ KV-fp4:234VWAhlf-VVCVQ' rAv:V.u-vf P 'AA-A'4.xVfV,-VV:VVV-VV- -7A---vVAr'Vw fm-V,4VV'l.'--V.V ' V ' V 1- Vf w !S11a.3V!E: -4. . V-2? lifw.:-'----A'V1 V J 4 V21 V.'-2 -'3 V Va-VVVVVVLV-Gaim'--:VVfV1-6141 VV um-171-QQVQV-imVV5424 141:-4--VVQVZQV' -V--4'-iavVi-.Z-AV:-TV:--:VVVLA1A.VSVz.V2iA.VVfV-'A1- A V A A -'VV V, 4:2 .A -' M'-fr ' A"'35W3""-'-f2'fA- ' A-V' gli! VVVW V- . 1 AV,-'V-'AV-fs. .V-V-Vmfwaea-AArVAf2:VVTV:m,Vw-:VVV V. VV.-AVA' -V V- A 4 -1-,MAA V 11.-ff-'A-i M V- VV 2:22 AV .- V V V A ' VV V S1 , V A I F' . V V 'ff-.A"" " 1 VV A A . A' -- ,2ffVV VA- 'A Y -'A- r- V. V11- ' f-'VV AV'ffV .-A V3-, Q - V Khf-k?'5"'Lii'i'.' V V an-Vg V, .-W, - .V -V --V gy A I ,, ,VVQ -V,g"V,V - V V- ,, V QVVV V'V-yV3VV,zA.V.V-x::,.:V1,,1jVVVA ,QVVAGV-.VVQ gufp51,1'V.,V:g, V -V1A: ,Vjg-f.VVVAXLVV-AVLVVQZV7 35:11 153,31grggizjfg,-'5VA gf-H-V' -1rxVf5V-Vfygfrnz . V- , A' A' ,.. s.QVVv 54. ifezh V-QQ: x. A , pg ...., , J V A - aV ,. ,A-yrg , V .1 F, V1 1- V ,:,V,4fV-A ,WV V VV - 5 V , V- ff'+Vf-VM---AA ,5Vf"VV'V4F44-A1fVVV 'VC-fV:'4VV3551,--.V-VQV,-qcVVVQVV .f,yV.V6:.1.. , V ,, , ,.V.VV,VVV-Vf.,,VVVV,Vg,-weV,-Vw, ,,,.,.,VVVVg...aV. V , -, VVNV -hs.Vv,VV.VVf,4-.:qA.G- .V-,AQVVAVVVMVVQFQ-'A . V. ,5-' ,yi .N V Vf . . -:'- , , 4 Vg,-fn - my u V - - , 5 V V - V. -4'--I-V" VVV Vf-Q' V WW, fy' -f VV,,1myx+-f3V:Vj,VVZfV,V,Vf1'i-G-2Www5k2,g,4eyzVg333g'1f5fA'::VfVf2V--V-VwVf.':'VVVV.:+VeV::VV-:V.V54--JV 'VVA A V"f3zSf2jrYfA5ix.::vVAi1 Vgg-VV..-V V:VV::.x:5VVV5VV5'gV-Egv,-'?wV:VV:VSV-9,--V-gVgVVVVVVgy3 -fax . V'.+T-:if f5g,VVs,,.1-1:5555 V 'uf .. V 'A - - w',Y4fVV 5- 1 fV1Vf..A. ' " 'A ' 'A A' 1-,V1VVVVV.ZV-fV,.VV -A I " ff-' A' 'yi-y 3- ' ge V ' -f -A FV- ,, V Q-A 'AV Vw VV .- V fVz'VAf-VVVA, ,V -'V -'N--V--VV-gVr, .V-fp i4?'2 ' 0." . V .dh 5 1 M ' 1 iggg, ,,-Vinnie., fif, ' V. ,:,VTVf::m :?AV,:Vrf.Af'5V2V,M,4-V, 'V'j' Z1'Ag,,5VViV-A7,-555332,-VV6-f5LiVg'fV.VQ-fy.:fiVVygV'Vf5fKigq 5gjgVf-Fifi, VV,--,.,V . ,'V,:3?LifA.j-- 1-11. g-3i.v'gggQgg3gg--'- 1 - 52:--V.1q5.V. , iw ,- '-.u,1'-"'.-45' Q 4-af" A- V-24' . IV'-V mf -4 -VWVuVV1.!MQ - VV - Vi '.1 V -'A -4f,f,fVzfVfV'!VV?AW-IQAVVV5-,f4M:'uVVVVw!-V14--ig,cQfzV1fi-V-V.g::w,.V-VV'-Vw'SA gf!-1?-V-V'-.,vqVV 'Vw-Vvf Sz9VVVVVV.V-AV--VVV V-gn. Vg Vg- -.VVV-V, k-,VVV VVfV,V,V- w.:V.:.V:,V,V.3G122S'SI.'Vv.V- :"WVV,zQ-.Vw-v. ' A - V-" -f J., ga , V--V VWPAAAE QNV V V Aw-V" VV-M-W'-ff'ff'-AfQZ5KV?Vf'4fn-VfVVV-2? if A' V V641 :yi VV .y44Vw1VifVV4,' -ffffi'-2ij2Nz4v?fAV yi.whqwzfvr.V::Vg7:V-i-VVfVzf-Vyy-,V V-gig.-yVVV1V,V ..fV,1gV4V1VV,VQgVV.',AVVQV-'zgxsq-V'V,gVf-V-,VV-AVAVVVVVVQJV-A 21- 'V-Fgswzwgy. -s':Vx:rg-iafygg-SVgMV2:Vrg,-, yV5,Vp-mimi PQ-IH 1 1244 Vmitia. ' had-A.. VV V.V V VV -Af VVAVc.-ff -A V :rw--4'5f VVfV- V V fV.- 'V"2-gmKV--VVV-Af--VW-'VM---Vf 'A QWWV-AVVVVifvi.VVf.-Vm-Vwwz-VVrVLVfe,3V.1V:Qf-CVT ..W-e6VV'At2VVVfV-V,VV-VVf'q,. VV V,-5:-'-2 My 1'-vars t1V-..A'!a1riiA?3PV--qt:V-AV1A ?V-if ::fe:x1+--N'APag:VV- wxV?x-1-few---JAAFAQVV :Vf me-SP if 1'!v 3 V,- 3- VV gf -ima 'f':f?M?2Y:V1M'y-xy, . . 'VV wV5I:'VVz- .V4'Vg:Vf:V::- gf VMQHVV-frVpfa.V,v?l0 -HVVVV VV V. -VV-.VVNVVQVVVmy-.VQVVV5. ,,V1--Vw-VV. V V----VV-,VVV VeV,V,VVxV VVQVsV.,,V,VgmwVVk,,,MV,,,f.,rV,,9VVVV,VeF2r,g. 5,1-,VV ,,.,:,Ae,,. .Vg . -,Vi ,, VV -Eff Z, 1-V V V 1 'AA 6'-2Pi?9AA1Af?5Af:??'U iA-QA5f'.V-fl-Vs' EW V1'A .f.fEA'S-- ifigff'-A' A VA A' A A V A V V "Tw, AW? VV AEI' -AV' li-5-gf-AAA , A " .: 5. " A A451 VV A V .- - AV V w- - mVV-'::-- 41- mfr AV yi .L VV,VVfVVVz ,Vi-V VV "Av -,Vac-'vCV'VVV1 V,'f:fV:-'VVG-V-Emi?.7Qi,-VVfAgpz3eV'? 1AfgV,V--Va-1,4 -Vu. , , ' a'V:gVVV: V V-'QQ1512-ff i---Qt.-1-A,i' QA. 1 A V: V s s'..1A-- V -A 'A ,V V K V ,, , l- 'WVLQV-1 ' - i A :f:lAAZf'Z1fViV!ii'g .VQVVVVC V,:z1V.AV , ,V ,VjAAA ' V,V1V,-VV:XV-Vg -3V-VG. V-,V jr--5-gg V-VV,-, xg: .V V' AA f -1,5133-V-lgxf-V-AV,V14-Vgggi.-,Vi-gy VP ,. VAA3 , KV ' :.- A QHVVVA-"A if fy . -A , , V .:, V - -...f -Va" .2Z:6VkfTz4VAV .V Vai:V7a'24?iV'f'l2:-:-ffcffwff'einem V. VVVVV.-fmVVS---Wflz-5V'f6VVe-.21Vff,VQ'V.-QVC'V'f'-1,4-+'V-fVV'V.fV'gVVVCVi1'z-V'.,.VVV . 4ffgV+'2-sx1.5VV.,,MV,.V'-VV-V V- - -V VVVVV.VxDa1llrgggd.gV.V9Vx V - , , .V V A -,,' 5. -4 'A . .VM VV,Q55-yp,g2V",2f4WtV4VWA-pEf?'VeMVf:V25V4rAf2V..45V2yQQV651-V-VVVf':2'4gfVaiCMVV3-V'Vqffn 7-VV"V::VVs.VVy4V-VWQV ,VV-AVVA-Age:.VA:.V'.:: Vfgerul -MM 1. VV V1- - 4,-Vix4,g.-V--:V-.VVVVQ,X V.. u- - V f fm' V. ,Vg AV, ,.:V4 4 gm - AA -'-913: ' A -22-VV.AA:2'.1W.Ar3f'VV!'F'fVf' r'VV?V'7w-QV-V 144 wV'5i':Vf'- V-'-7V'V:46V4--551zTVfx+f4Vi Tape-Gai -.pc-LQVQVAV yVyV'6VVVV..,w:-:ff-fV.'Asf 5:1 :gf V'A'V VV-V-5,5 MV. -' -V'--,VV-VV -A ,--VfVV-Sgf1V1EVV- -A -TSS: VH 5? 4 :A - ,V V:- :,s ,Q A "- 1 : -J A 'A'A 'V S3'fTAAfA3i VV - -fx-FM -'Axis' . ... VW .VVVV V . V . V.VgzVV,.,VVVr,-W-VVVVV..V,QV,V,...,V,MVy.?4V -J-V,VVV VVVVVVV,.,VVVV,V.V-VVVVVVVV-VVVV - -V-.. VgVVe .,,,VVV,VV,.-VV--VVVVV VV V- -V, -V V: .wig y6VV.5-- Q V -.. VV 1 V. V54 VV- VV . -AA V-am-V-A ff11iV4Vw-. A A V V - A V VV AA A f A ' V, -' V: ,151 -VV-V, ,'fVig , V -VVVgfVV5Vf,,,5ggV-:V'rAVA W . A.. - e., V -V W , fb , V- vi A V 'V 7j,,fVzf?:'.:V?LV-3455.5-QVVJ--ig-VVVV5Vgf92Vzw'-QAVVAQQJ -iz- VVVVVVV-VViVVVvy , V -- V- A'5VAAV5gx:A-A A ,.VVV'.mV ,AAQ n V V. ,Vi ,V V p fa3?ma865-'J VV V' '-V-V. V . V A - ,. -1-2 Vw 7. VV-V2VVVfV:: Vpfwf V--'V me-V.V2V'---Vf -V2V'V-AfV- -'VVVVV-.V VV A'-V A AV A V 1 V-- iVVV,V'v15AV?f' jf A ,Vf 1- f- QV, -- V. V-A E LQAA M 1 1 4 ' ' A A - Q w - V- ' , V 1 5, sjg 'va-V41 231V4'zVVV,gVVV:55iVx'f?VVGV2VfVV.A1VGV:'V:Ai V f is VV -' -V-V-A2-TAA: - A-11: AA AV AVAA. V ' Z2 Vwxnffa V--'D VVzi1AVw:0,- 'Qir'VV2V:V"AVzz.AV-Vw-AM'4:..V,'fv-mi-V-.VV-xf'VVf'VV-g4'iVfr.7114 -f'V-4V.V'gmVVA4w,-ff'CV'7-fVVc'V1.VV'-life?my ,V ,V . ,mv :L 5' .ta A V VV.A , -H 1 V VV: , tm R--iff-VGV7-VGVV-'f3fr25!?5WA7-XT"-V'1fGVVLVVA:V2V-V'VA1''ZJQVQVWkwa?"-'Vi4l7Vi.4-VV:V':HVV af-iV'eVVA. f':2iifVfVV2VV -'Q-4-VV:.fe5 VVff5V-2ZAVzfff9Afc:- VV pf? PA :V mf? 'V 'Vi A A- A - A A V" 5'-if Vi- ' J' :'V1"k9VV V L12 2V1'.V'4kX-fr-WW-A'LQ-'ViVfl4'.AVVV'f""fJ'V- 'V7Vf"5J'WfV-'-?4'O'9'5 5, 4 55274, LV Vfff-Lf."',-V,46VVV VZTZVAVV-94" J,4Vf+V"v'V wv AV V " ' V " A Q V V 1 QV--V 'S kV-VV..-4Q,V.VV2fVVVVVM ,A,VVV-4-!iV--VVV.V.,V-VV-VVVV-VVV- 9,4V-VVV-fmVV-VV-,VJVMVZMA VVV5VVVfVeVwg4VVQVWVVVVw,VVz,fV ff VVVVVVVQVVVVV V VVVV VWLVV , 'VVV-.VVV A: -' -9 A - A --- V V 1 qv? "A' ' 1 V V' - A 2QTY,:jV!icA,'5.?!.Vi'?fa'-Vij5Vfff'A7VA?f"V'i"A P" VW- 5757-1:'lQ2?Afk?MVfzVVf,fV.f7ZAfiVy'iffV'ffg' K' Q1A"Zj" " V ,TVX TLA' -' A , 7'A',',- AA A Vrxgf, 5, IAA Q? -QE, , V a--H 'f A -1 1 5'2?f3V'5"AV.'VAV-VA'r35'V'if-fVV'-'-?5z"fff5ifV 1 f3i'V'7-T2-,"'V"fAf2' 'VYXV-V 'kc VV-Vifi VAT- ' 1 V V ViV-'lPifQ?fiXSA- -'T5xfAfV 5 H'VL--VVV.:-11.112-g'V,.aV:,'V A' V-V41 V-zeV,,V,,..V'v24QV-QV,..VVVggVzV-V.--,,VV.Vy1VV-V,V ,VV VV--.V,VV, VVV1 2,VVV"4-VV?WN f V f- :AAA V VV VA A A'-V-Q-1wsVAlV1VV -A V- 1. QA--V'--Q--V VAVfA1ifV VVV- VVVVVVVVV-iAfTVA " - V -AV ffefixf.-V.-V VI - ---- V A - :V V.,.VV,.VV.iVVffggiVV,?2JVQV!yVCiV ' 'Q ' V- I V V ,V A -V AfA3Vi S: gEi:AVgVAVAVj-V5 5 AV 1 ' -V V: V. , V ,AA . , V , - V , i if 'il VAAV2f-VfAi5??AfTgA A 1 V 1 V,AVVA:VzfVA- Vi-AAQTAEXVE5 AVQF53fi?Q4AiL?A:Af2:f VVVVV .,-V A .x N.. f -N .ff- ', ',4.fs,4:-ax C. 6, ,1- X 1 . ' '?55jf':5Li?:E25?'?' ' " " " ' 7 1 1 ,f.--5 , 4'-9 ,gIL..,f7,.,N A1-fi.-'g.g..,,--.'Y-,-.,f.',,:.'1 1 . ,,, . . ,-, , . .-1.-Sf'-ww -- - A'1YL',, , TI' '- ,1..-1, -,- - l 1 k - -- - --f -5--.--gfe.:1--.1-:- --.,g,.'-- -.,,L4-,g ,- ,- K' - ,-, 4 f f.. g, -, 5. .j,"- K ,-"' - -11 A ,V:i, . -:Z-1 .,,, 1. L.:1'gr--j.-5 7' ' . ., , . -- ' - ' . .f 1 fbi' 'AWA -4- '-' A-':i"fi?r-1-2f,f---11-w,v-117-2-vi' 5- ' ,,,, lf... Yi' "J ' L',' " "-"-'- -H "M fi- -- -- 12"'lLgif:.,b,:1L , --.. , . - Q- 1 - '3----- -- 11. ' - .-1 V ,. ,.1 g -- lim . N1 .:,, ,, V- -' ying- -7-1-I 115, - -Q. .L .,,, -. . , . . :Ni ! -R ' I . "I-Qi-f vi"1-Ti?-FT?91213-fi?-.-711: '-ffI1'li-'flff':-Tfbfif'- 1. 42" P15111 .H "Vw ffv21U"?'l?1JV2wV2ffe' .1---1132w12'i2f"" 41?V71"'p11f-lf2'.f?i 23PP3.11lW2T?2?2f217115-'P 15574!1.,,1f.?114, f f 2 2935ff"5:Pff3'1'1?if-TLLZZW' W -r:.....--1 1 -' X- ' .1m-.-- 1.:-1Q1'-:- 1 1 ff 9. : . 1- 1111....f -1 51 '- 1 .fff 141,11-1-32. :zz-efyfn-11.5 1.11-1 '4 f1 ff 1111- f .11.11-Q11-1:f1.--91 .. ff.-1Qrf121 .:.f'..11 -' ' 1. .11-pi' ,.-, ,.11.,.f'1- 1 12 .. ,wg 'X . 5 fn ff- '1 1 1 i f fl f- 1, -X -'W .eviw-.uf 1' iz.:x..- .111-1 2 . 1.1-1-1...-.-1-11-'1'y.f:. 225 31.1 1 '...1v'1r1,11. - .11"'4:1. ..fp.,1 ' 11,1-1 f"' - Q- '1.1j+f.ia"f 1, 11-V411 L121-,J-11'1,.f1f1-,aw-.'f:.-y.w".1,.1f-JHfr.'.1f1f"5Lwiv- 1. -2f.f:72111f 1:1 1?-:fag-1? 1a-yzzfmz fwfr: 'fwfr 1v . ' :f1-1 ':z1..'1,f1 .- 14.11155-1-x:1g- .Mg-3 .1 - -. A 11121'.f1.mff.gf,115.1-,fg11,11,..1f1,g1.1411.111-zz-..2115g.g2e22.5-311-1-Q --'-f ggffggf9,.jgf.g.z,,-.,f,4f,f111.Q , , f21':2a..e1,1.f .1,.c-fgf.-,.1. 2.2.51 .......,. ..,. 1 .11 1.,1 1 , ..11 .,.1,f11.11,1, 1.. .1 .,1 1.1 , ... ,. 1. 1 1 . 11 ...1, . 1.., ,11. .. 1r.,1.,..11.. .1fig-.wli-fg-'.-...ffs .fi 'X " ff-'.'ff.1f. 11f:ff aifzw- -w1:1'-'-12'!g?11,1.a:--Crm:15151'1P1f1fjEfp'a'1'"1 '1114'-f.l1f.1v1?iwf-ffwyffjgiw'-f'11azwyffi'-ZH-1' '2'f-'viifff-'L'-1':L41 Gy A-1-1'f1W'f1f2f?f'f1-ffu- 14.31-.51f-J--:2'114,,2w3-? 1.-a:11f1zf1-,.1w 'wi11.r-1-ff..vgsVf11.,e'f.g 5' A x rg. ',: .1i'1'k.'.:41i "-i':1w!E.1f.sw - .fa f-Ff1?'1gif'.1.. "" Wffirf- 'Qwf ,1kf.1.15f:xa"ff241-,M-fffvff, 'gf:',f.11.Lfizq4f -f"-44 'ls w- f,,' 4 111-'1,:-gr.1,.fy.,:,.j ,,f-1'f1g1,3'gi1.f,p335-1-4. 5 , Q1-,41y:,11.1.,',1yfy',j -1 - - .X1 4 Qfgfy-Ig-fg 4. ,.. 4.jeff?-vg3?15111if.-f-19.2.-Pm --+1 11411ff?w1.94fhQz.1g1g1511112:-1259.111'w7-12i42.zf 11?,f1..,..1.11.11f7.1-11.11-125-.a,zf:.2.fz-1f'f.1 411.15fg1g19?12zg:4.1,1f11 1.-..fl.,-1Q1'.1f':.11w ,-ivffif.f?.4,giif55gf!-1?..w:1e- -wi 3 --we ,-:,,fg,ff1,..:f1,1.-.a1.-age. fa-.qw-f'aafa-1- 451-i-' Web'-11.--e fglff.-1.11w114y-if1mv,?1f11' "-' 21-m?z:11.1117g's.:1-11-fisff-294.-Lim-il.1fza'1'.-'22.'f--1.1,3512ffff-fwgany-'.-.y.f1.. .if ', if Ami,-li.-s.4,1f2v3:f'1L-21255.1. "ff-.zPrfr4'n'g:'g-gl-'1'ff"1.,1 ff "f'L4Q15L4w 'iii-T23.lf1f1c'211i1f2111.,u11Qwfyi1'f1v'-j5..,,1,1.1f.11ff,.141'---WW-J1f!1:a2ap1."fq1-'2f1rfw."1f-1-2111'j1:mLf'f'. ?f'1,--cgi-23f1gvg...i2i21r2f4r,,.-2L.1'1E'f'L.- 1: ,,,,,,, " cf .1 1 - iw 'i - -2 efif?--'ig 11Wliiffi"wifi1f?13gTf151LX:..1i5i2-.2:J.1iffEiSiQ'2.Lf?-1 .ffiwi 1291 "'K3zi2gf?i'ff3f?114Ifff'f 1 if -3.1 ' 1 -Pg 1 ' ' ' ff K - ff.-5if-E-2f1f:9l'zf11"3i2'-- 1fi?'flff2'f' 1- -'?l?"7291x 11 11 1 -65.32592 '5"ff3'2QP3f1- 3312 ,f1fSi'f'?'-'Cf ' J? f'Wl.21'-'J 552: 81 -'-Uaiflfi. 1-, . , LW Af f. iw .- A -.ggifqgg-11..'-ff'?fZ'.gZf1g,f.1-Q--1.fi'.f.ii'?igdg72 ffxwz- fv5giujg1g3::11i.1zk?2fif.1ijar:134.134-1.i4fg14'.'1I'c.Qc.111-i?QF31'Lfeiff,f-121 .:1Z1fQ1.?.if.f2f' ""- , zih:,.141'f.211',f2ff. .1'-2924+211-25.,fxff'1f'v.Z5f1731f1.-4311-wf11iZf1.Q1111971114-11,1 .f f2Z.:3i1lyf2i 3 1' ' 1-Qffa .kf11fQ2r1Z1ZWi1 - , - . ,. - .1 yn, . 14... . ejm-.,11g ,-.,11.1,f1 nf.-1.1.'1-1 m11.,...11 f, .11,,1., ,11..I1,, 1.1.1.1,.,4 1 .4111 1 We. 1f15f,1114g,,,f -1,1.1,11w1...14,-,..,.,f1m,,m11f,1.14.. 11,,f 111.11,,1.111,. 1.1.1, 11 1, .1 1.4. 1,31-.-11,1 41.31. 1 , ,wffw . . Q . .-gg. -1 .. f- im. .1 .I -1 ,m...4.1 1- 11: 1,,.4,1m. 1111,f1-,..f,?,1111- ' 11.60. -.11 A-.11f11:v My f14f,1+1.4-f f 141.1 11- -1.-'1-?e'f'141'Z-,if9112-11-i1J.w .f-111-.-Q1-ff -22,-,,.1.,..1-1.5 zfyfQ,,f11,.1 .1 ,. 4 1. 1. -1 .Y V 44- 16"q,,..1sg41:f r . - .- 1 1111.-4,991-f 115.3-Q.:.,W15,gg.--,f..,?11', ::-a1e:,y.1,g-g31iywg,,1'"- X- eff.-H1727-ft11,r.1..f.. 1g'f1451'.z-1wzf+r:i:'Q1 . kafffpf 41-.7 Qgfgwgw-'q114.1Q11,wg1f.1.1'..n2--p?,45vf5'gf 4f1f:'-f.,':.fJ,14,, ,A '- ' 11-1:-.J fu ' -f' ' . 1. -. .1 - . 1 fa. - - 1 -2641511 9981-1 11... fa-f,ff1..f.1.5,.1 1.111 .1411 ,mf-117.11-y.1,.f, 14. .f., 11,.1111.'.1.. ,..,-11.-fy., f.1f1,1..1.,,11, ff4.1.1,.f1.e-57.11-,f11g, ft.. , 1 gm., .. .-.1.:...,f,.1f4,1,.H, 1...,,,.,,,g.h1, f9,,i,,?4Ei , 1,,,,,. .Q ,.,.,.., K 1iK?f.3.s5if. - -- 5 1 ..11??Y?:3w5g.,f-Q,-glzfj.-rm,-.,1 11:11- gf , .wh 115 1, if 472 ,.fw5gm1114ga.15.1'.' 71,3-1gfg1g,.141jz,1+4wi-1-1.41, 1f11'1, .f1q'1f-vga.gg.?f,11.f1 ,Gdy1ffI1.v2g2'.ff1, fy -'Q 1-1: i:yc1.f,1 141.7 '5-...-21' f --f1i,11'3qg5-1.154115. '4 Q . ,LM ..g,7-11:1L:g.-118,11 ,:.11Q1z,g-1jQ.,?,V .epffaggff-.f .17 L 1 - - 1 - 1- -- .2-.."gf' 11s.1i1.p...' 'ge,1.ie.'1-if-5:2-' -g.f1 .. .1 Q f' ,Q '11, 1 1' 'I ', 1 f , v'.':-,.QQ:'1g-1-Z iiwfz'P'Lff"' 141'-f, wh- 7211 911 4 if f""f 4- ..-fa..:- ', ' ' ,. 51- 1.1-Y f ,.1x.:,j.' f'1.1f11f1 'Hifi "WC '.'fi,.g 14. 11 , - 1" :Z -I .. 14 F1-Asfilf' 1-5575? fg3lr7k:Ai-'X??iTSxf1.'1Vf'f-Wi: . Q 1 1' K 1 L ,I 'f f' 'Q f My 411511 al JJ 1 4 , 151- 5:1 4 ' ' nf , , 455132.f'fz3.QgfLWi..1?955g' .X'6z,e59fj4ipf:7?:1 -,Lff 157+ J gf' if f fjilggi . .I 1 Q V, ng -1 -' . .f 1 ' ' - ' f- A- 2.1! Q. +-1-mr MY .. .411-111' 16151: -f .. 1 -1 1. -81. 1 '9-11 1 W.fQ.z.fy46111,.-'L. , 1.fm:Z4y H .31 1 ,...1f,g, , 1- 5 1 .. ' H .11f'. 1.14 11,11 114. 1- 4.1 1,7f1p,.1.1,11-wr..'Q1.1K 1' f,,g4v1-,-,mfw 1- -"C 4.1-f.. if . Y.-21- -ry-f:f.gQ1iw.. 1-1-11.1.1-...ffge-.-2 11' 1 .m .df 01 . ..1 i' .1 -sf A .,,,-111.111p.1..,11 1.1 1,,1g,,1.1,s.g1..f11. A11 .- . ..-111 4.41.-4, 1, A, ..1,1-.e..,,111 ,,,, , 1, .,. 1,. 1 ., Q 'x-M 2171-wr-K-.1 if-f?4'1G iw-'.1+'!1r' -115511, 121925 .111 3' 1- ff !- WW cm '14-2e.f7ff41mf'w 11- M,-4' 121 , 1 - 'g1 . 11'ff 'c,11.1' fy-1f.4.x,'t.ef 1 xfyff 1 1g'1f:1f'1U1Hfwffcfnfawk4.-wwf. ,5- 'my M-f14Q" C11-'R uf ' ' 2 "3r..""?QfL2-4954 "WI -1- 1 f f 1' 1-U 1 '1+rfdf-244 146. -f 1 . .Q-W ' ' f f:-W 1+ 11 w.f1'yf1.,c-'i,,1r.HwfL."aux- 1w'.1.:1y-a-1.11.16w.1.,,1-1+ 1.-4 ng, -,-1 A- -,3.12f.,f1,ggg,2 -' - -- .. - 1-' .', . . -f . -. . . . .-1 -41 ' - 1' ,J :1 1134 11 01.111,1,1ff-2'v.:'.MfQy1 J9...y1-f-11 .,11.,Y-. 4 1 '27 A u 1-1: 1, e '- - v1 cf 1, 1 1,...q,,b1. 'Z ' 'WM'-My1.-':1..w1ffa1---4W.- -zfyaff,-4, f , 4,1-1f,.f" .1 . .5 ,V f .l . Q H., .Er , V ew -1 . Q.. 1 1 51,31 41.17. r , 3 6, 5 . gtg ,I 4.1 5 1 ,,.f1g,11,,.111 ,g.,1-qygf,11.A1.gygA,f , 13, f 1g . ... , 11 . 13. 5.2110 ,,, ,.., 2 ,,1.,1,1,, wa, wr. c.. 13 .. af' W- .. 13' - 'M ff-1 1 W1 we 2 J . 02" 11.1111 fmt 42'-:ff 'f 11 459 2 . 'f ff. 5 1- M .. favff 11'14fv-f6:f?ff'L ' -eff iq-f.-1.e-11. Lf . ww ' .' ' A .1 . ,. W. .fs fy , ,,..1.. 1 1. , .1,,1,,.., . . ,,... .. ,W .. , .,,, 1 11 ,.. . fr .. gf. by . . ,411 .,,a1.,. 1..f5a1.11,f.1,1+..,... . 4 11. . . ,,,, ' 93 Q .1 if 5 i -11 .gf 5 'gsgzgri .' '- ff' 111 1 12!f1'viAM-'Mz,'M1 - 'ef .- fetf m 11 'f .1-11 15-411-ff. 1 ffhf-f.i.1'f 131 36' WICMA' 1 1.11.1g1Qf.,-if M241-g..,11.1,-i 1f, ,,..,, , ' .- 1, .. Ng1 -: . fQ11 ,5 , V 4, Q 444. ' , 4 5 4 M F? 1-K111l2f wi':?1 .2 53 wr t? if i M . ix L kkih M H, ! ,,i.',..v 7, nw... 112 . 4gW,g.Hg4,:,, W.,g54 l , , ,. rv ,J :m 1,,.1fJ qw, 50 .1 , 725 M9141 .rvr 4141 My Q ...M -. y1'1xLf1.7?3 .1 V1 EW51.,,Lxf7,!4-,-.zyygy .345 mf s.. .n sie- aff' -4 f 1' 'e 1 f wr ' - 1 -'Q Vw- 'M'e1'f4i--Y2:1'fff -I f Vw" 1 ' iw is 'sf UF' gfngy 1 'L-. 1 'Wi'?,.':1',4115.'MWfgff1'-2011115-114.111' -2"-'1'QQ.f1'f 3f':'? 2 . 1 5 3115? -5,-. i f ' i,1,ggg,??"3g . , ,..1fff, f z ,,1.1L 1, . ff ' - Y . .pf 1 -- x .11 1 " -, 1.1zf21.1mfwf.wW- -' -psf '41 A 1' wwf! ' 1. 1.43195-..'-,,1'g,.,f.4a wg:f.1,f ,' 4- 'fz I f 5 ,1451 -qw ,y - My ..vi:f1:,. --:Zin if .. pf' .113:4:Q3g211?11yy,4f7-f?f1.wz5.w,i4'7f".f .1-WQtmw.a17f4!W-:jwmfz-fu:-fx' 'ef' .1 -'Q . .1251mfe1j7L, 1,- 1.1 145 . ' kg nf -1.1-,W-151g:,,,ai11.1-1--if ,1. . ...15,fif.,q11.f1.-1fpfff4,g -41-ff-.,Crg.f1111,-.1-.y.1g,1 .,1,-f,,51f1:rxf 1, ,,-.g 5 -- ,H '- 'Aw ' 11 . 1. Y- '4 - :iv -W.. . -1- .4-5-19 1- .4 if 111:-fiwffvf 1151EEZ:-,f.1c-JVx'14ZLlZ!93' .1315-2w114+-4444.11-new'ff' 'wi' 11 -, ff .- f 1 4 f-ff":f.-11-11.1 1' M QW- ' -. 'fm 1' -' 92311 'g:f'1,.I ' 119115501 1-f.-'iym QL-A 91111-1 41:44-4f'. 1 : .1 ' - 11w4,uilv H 11if"gw" 5.4 11 " ' 4' U9-yy-1:-Lfhr-1121!-'M ' af 1 11 1. ' wt ' 1 1-v. .MM14-11' - 5111? . mg,-av' 'Y-'-'2 1 3 5, 1 . . ' '- .,, 1 , . , ' M 'fi f',1'J--- pw ' ' ' gQ.72'53f"'jiy .f1, ' yiflifflif f' ff 1 -ff 1' W- 'www :f 1 f 1. 214gZH,h1W1if'1.:xL1'f fgzf' gr'-' 'I Q" 7-1611.-1-.- .14 .1 L . 1111 - if - 4 .1 1. - . 1- 51.11 . an---'C3' 'I-J'-ff f , va- 1 .,,1--1,'flg6v gwiinfffa-as-41'-1 1 ,lv-'w1--W1 -ww-1 '. f 1-MH' 1. 'T +L 1? J? 'D mf Y?-WA . 'WV ' - 9.'W5c-1r1:'jAQff1:1. . .93 ww, .' L.1f.1-...L . wi - . .4 5- ' 1 1 . 11' - 2. .-u,Wpi'11 . jig!-1.-11'-41.11 f4?fW' ' 1 52.1 . - 1- ff'--:1-N' -.w1lfzfm.-A11 ,.f 1 --www-111-2 wi ...11ww. - . 1 .. 11 r -f 1 1-.-4.-1 f -1 - 4111. . f-1:1-fm 1. My, 1- .. 1- ,.-..1.-.4 11141-1 1q1...f..1f1f-.11 . Q. , fn 1 , .1 .- . 1,1 1 1 .1 Q... ... . 1441.1 11111.-17, 1.1 . - 111.1-,1 11.4.1-1fe,....,.w. mn ,- , ,f,f.v11f1419, . ,,1L1. ..11 11 -151514, -1 ,1 41wA,f.111,m11f11.1,-4 11.551 1.W1.1...1.w.1,,.z1. .1-.1..,...,.,. 1. ,.L Qi, ...1, 1- ff -,. M..--.,5.1 f2J - 4,-1,5 ,,4,1,f -f-f-gm 1- g 1w1g1,m-451. .- .31,121-1-4f9.n,..1M.-11f1111,21 -.14 1-141, 19.941 .,1.,,.e'- 1, 11 g1,.1.g,4,,',g-.1 .ffn.:+y1Wef.11emQ1c1 1.46315 www.-111,-,1-1.-.1-1,.156-.,11,111,, 1j,,q,,1 ,,, ,1,1f1,y.-Lfyfg , 11 21 1:7 f 1.161 1- 1 ..,v,.1iF. 3271 ff--' - C 1 ?' 'K,.gf.M,yif2"1:'--1, " .111 ..z57zk474fi'f3WvWfr-?2f'- -Vw if l :H-tj -4 1 411- 4142? ,-. ua fi1QW?'fi'-1-?G4zf.-QQ4-524' 51,1-' 1:55911--'7 H115 .1 61: ,,,. gf 1 715 + .iff W -ffm- 1 -.fr 1 , 1f3..,,.-I. ,49,11w,y.41f1f+f:wf' . y 1.1m.1g'z412.1'w2f . -f1gg,v'.m :,4,4.gg,-,1 .1 , P 1. 1 41' , - f, 4261 .' 1. ,.-111'-1 gf. f-W2 f5f1z01mf1,ff.,,4,' .1 pwyh' 1114.1-141 .1 '.v,f-- 161 wh u' ' -L Mi "9-"1'. 62-11-'si-1-2-f'f1f,+f1,12-ff 1.:zff.ff,11ww1'sg' M 6' " " ff' - 1 '1 1, :'ff ff ff fldf 1- .. ff A:--1' fa111-v1.1::.1..n- 1f yi 11 1.-'1.z".11117f '- 1. K-aim '52 '1 51 ' 95159131 11 fu.. .1 5 0 .H ' ' 41 .sffffwff-.11 f1z'1f.6z12:f' 1 4 ? . 1, . '- ff1..1' f -Y1-M12 ' -ff"-1 1-1f-41-14. -11211 .5- 1 ffm- -+.f.U?"fi1'1P1- I s? 5 1 1 1. .. . - 1 . 1. ,-, .. .1 11.1 . , . .. , ,V . ., ' 9 . 15.151 1224! 1.,1gz1iJ..2 ' W "CJ,-' 2 11 .5 f HW1 11 '. .. J '195z41m,f,f,,,,, f lg-yy? 11 1 -" -"' 1 ' , '- " . ' gg ,Q 5? ,H Q ' 1,-21 11wm-Qjffp' ,.f 5 1 2.. mm..1g.'V1ff-W4-' .11 iw M1 1-21 M2 -fffff-ya-gf-1: ., 4 wx 1 y 12-c':.3,:Q y '1 ..4'-max-fz1-,1fp:16w-2.-1,.f.----4KQ111-1.1f-1fy,mXg?'1 .1-4.1 gg W -1.112.111-3m34Gm .gywywvf 11' 1-b..v1141mffzffryzmffniifyw 4.1g..1h,Wz121.f,15 14,11 14, - -,A M Milf-1Yaf1-ffwf f4,1i6'.-f15f14.'9f2f 5-y151f2zy.1f -1--1 1 ..f1:-11ff?w1- 4-.M .1 -wuz.-1, 1 . ff. -f1if123ffP1Jw"1195w-wif!fzffr-Zyfw iw? 4511.51 .4211 14fs1f21w44f11,r-:141 pwfe1f'.a:1e .www zifq1:64mf41f141ym1Sfgze-azWf4!Ey11fQ11.f1a1WMZ-ze '11n,1. . 11 11fgy,c.,1,w.1...11,11.14 1. ,gf Q. fair.,-...L 4 11, N141 1.:f,.1w...:1f:. .- . 1 1 58' ' -' -1 0 ln - .1 '11111-12591-111-A2ef1:1:1w-11-.sg-f1Qf?w15fg4zL ' . 1 4.151 - ws l J., ,www .1M5,w'1g51f1,,1g2mgf11s1 2 -- .fa.ff.1.f 'Z1ti1Zw:1 W.--71, ,411 .111f1::1f-..-111"11-f-11-if :err fi ff-Q' 1 9.11i1qf.4,9.vf14g1.11gw1'35.?11f.2ygrMs4,..- f-f.'1v-M111-. 1 1,-,1,f-.dw 1135211 4'-kf'ww'h1-Mzyfz-44:542.2 - ww 1, 1' K 1. -. 120511. !,rAfjff4.9.445W3,:p..,-W...13 ,,Qg.g,ff,g,. ,,,..: ,HA 3 51, K .1 - 'L 11 Q1 H"W'?'51 .- Q. ,Q 1 ff- '- 1'1:'..1 r 11- wii!51fi-"3r'?'4- .1-W we f J' 91412494 fm-W1 1 -'sf1,2?v? ..1'f' 12w1:!Q5,-M ' K .f'f7?flw.'61f ww f" .fifffff wfhf-ff.21-:Fm .1ff'f19Qf??4'f-f1,ff-Wm"f'i'wif?1'f'' -f V 'ta' Jw: f,p1- '-V 1 f 'P ' 151.?ww."-Axfwf-H1144 -mp?-51 51-.ww -1 5114111 -1:'f1yf r-.'-444 1 -121 1Ew??zffZ3Q:1S135e:...mf-m.142'was1 ,f '1f1-Q-M 1- gi'-fitei-1 "" f -Q 4wW2z1fwy-1w11za1.w.1.1W-fwf-:fm,Q-fr-. .. .111g41w:1911z191f,1w.111A'+y,fcf1'-1151132.41 11 'wmv ff -1,1 -1 .. -111-1 1.1-4111. I ' - - . . ,. awry-wc M252 ff . 55,-f-5 .. 1.1111111112 .W 1- ,gfgy-1915? -Q,gM1y1m1f,fw51--5131-9-ff-2,. ,., .gb 11.11124-,fnf-b4,A?a1yQw.M11.-1,,4111.4.1iAM,,y .A ,,r1., .., .14 11.4. .1141 W, 1.,..11,1m. 1. .,?j11fsv41, ., gf... 'w:1..111A--v.Qv, 1-,...:.--11: 1,,.1-Q'-. ,1 - 1 , - .... 1 1.4 mf , -if 11- Qi.-'ff gy., ,r1.,.-v1 1' Aw-f--.. ..-41.1. . J. . 1-.-,111 ,- 4 .-,,1.1w1., . -31 4- ,1.p:5fpI.5a ,f,gf,1.f,k1..gg1f,,A,ff.f11,,,,4w.,.1,Z. .g,-1,,11,.,6,.,11.1,.,1.1. 952, '- MQW1'-4..1fQ..Wf11.,-01.155.x-,gfgka-1 .- 11 E. 1 g f. ., gn .p,1,x11g,1.,,fgf4..5112Agmiymifgg2f45'iwiQigfQegMf12w 4115- , digg ' 11g,,,.g,f1g!47f,e':QY,4.f..1f21f-1.52. '11 1- 31-Mft, ff,.16115-.,11.,,1ggg,1,.1,.11fa,1f'g,1.,1,1..1.,1.1.f- ,Q 1' , :-4 1. - I ,. A "M-S.:.1f-"lff'1:z eff: .. -' n r'l-'WQ11 'K H" ""' " 11' .:w2w'f'5.i+-KNf4Cn4f"f9KZf1'L'2PM18'1 WAf724fffz'f-.2fw51'f"fW MW ' 1 1 Weir! .,ffA,1f:4f-4'11.zf'fzw2yZ?u6fyzl4Qf214.fW?5rf4gw1 '-MPM. . 2,11 po''.f1ff,.4.z'-ffza-111.1--442. M-4 fn- 1-ff'.y'1i- . 2:ff'a1c,d?4Xy--1--,mf-'11'-em-fn +11-7 f w--32155- .-2111-11 1. 1,111 :-cuff351gq+ff1-1:44 x.f.,11V1f,1fLwfz+z-mwwamwfwfzf' - f . .1,,..1.,,f1m-1 ,wgffm1f11,.1!1f1f14W12,21154,94.wyfb..14.-g.1Mf,1.1g15 .f,1,v..gw,.cm11f1.1+ mr wfqfg.- 119.1 .11-Q1-11-145x513 .,1A1-411111.11,17,,.7W,g,1.,1...,.,. 1 3,11 14. - ':?-11-W1-:PJ 1w'f'1f.- wzfffvifx-S21 -1. 15 f..--V54 111414- ' 14-f1f'n? fw.+1.1 .14 '-QZQQS' sis 4512.54 5vi1's.sf1w1-, -YM1-y:1.h'."-ff-.YQ41 ' Mfrw-Q-161.gf' vp,ff-:z15mf1Mf75o114-as V11z,X6157Qf,s,342'i.'y:u1v'.mfyf,-'fm: fm'-W1 W . 9' 1fX.1ff5 Zqwdf . ' ff. ..2:.-11g.51f1,,-.way 1.131249-1f 111, 11.44, adm- 1.1.f1f.11..11, 11 .1 A.. .15 1. 1--1f.1m11q3111- -1. - .14 .114fw'1,11.1wQ 14-1 - 11 1vf1,5-af-4 1111 Maw-111-11111.11-.111111-ZW, ,fn !w1f+11 .1414-14,151+ .1 13. - 1 ,fc . 11.4.1 .11-.. 1 . -.f.'1-.1..1.m- 2.4-gf 5,11 .- -1 ,-.we , we qi.7f7"' ,-11127171-4513! '31 .,11,,1a7.,z17 .17f4g.f1.-g 12.17.-. 91-.1 ' M111 .,x1Q,.,1:1A11,11-54.1g511,14wy.,3.-fm1e-4--.1-11,A1141,'v.1fq,f..1y'z.4441yf4g.7mf.111.,,1121g2.1y, 19- . ,1g,.. -11 W, f. .fe1,.f111 ,,,, .1M,,..11,.41W,qaEf4.f. ,,,, ' ''1-f-:jk.gwmrU13fM.11-m1.'-5-"wwf y11'!w 1 -1 . .fi-3,4-11.54 . . -, .ww 'rff-+ 'sw-ge,-411-,f.1,::.rf ,.11:,g-1 ., 5 ,1,1.f1:,w1' naggfwg.-4W1.ffn1QAi,..f.:g.-f4,11-3133441-71w1pcf',4Q,41sgf. . , 4? 1 ,f 11.1 ,111-4. ' A -.ff ,gif-49.13 159-1b-3-w:pfa:if4f-2-Nw'f11Z?a?9Q-35,4291f. 1 -4.. ' . . -- aw .gn WM1- N fs ..'-W gf' :7 A 12'-1-,f-f S. Zv ,..1-1-. 1 '.--wtf-wx-f42ff'1f7?11f" -a.f:fwe1fie2f2-42.155 few-fA,v.y .111-2Gwf.-, 1-' 41.11-1 '1'-" fI5Wf9Z'4fc7 - iq, 4-11 1-.1151--1:1f'2W me - mc. - .v'?11v+f,1V: -1 fa mf P f -121 wwf-2 'z112fA11fm1f-nf?'6-1.:,f-Q-4ff57w12.1w4'v1S4-ffwc-in-f '.1b'ff11m1.- - 1. 125 12 . .J z11i1411f11f.-1.1.11,.-1-1141.1 .1f1f1m1v1f-.1 1 w ., 14.1 .1 . .1 11: Q.. 12 cf 112-.1f.f:4,e-1 -.21 H' 1 ..1..- 1 . .111 v.c1g1Qf.1.-f. 1f,.11.w1.1-141-f1,.1..1.,1.11f1..4.,1.11,vA1 ,W ,z.1 ,,4?451sy1 111, 1.-v,.111..11.1. ,. .41 . 1 ,.... 1. . , .,w.1,1...11 1.,,A.,.,.1 J... . Q., -If . ihfgff 11 . 1. 7. 111211.11 ...1 ..f. . , fm . . . 121 .1. 1. .1f,11.1..1. ..,.,.,m1 M. 1141,,..1,, ..1.. ,, , . .,.1, ,1 1. ,.. .,, M. 4 - ' H -11' 1 Q-RWM' 1 - ,wx :jaw - ff 1-yggpgi 'Spy'-GG' .'AQt..-ey -1 -1? ff. 1-1 gb' 1- -21. , , .. 1 'a?g!111fg'z'511j2,9fA2y'ffwfimfe.621,151-frf-704-Qf,:-1-Fi?-W1g1:.-wig? QEAM-14spf-mwffwvf.1,ww-r.g- cf" 11.1 . 1 if '1 . 'A1-f'1.,1-ff....1f.11w1143.-141' 1.11103--1-pfyifw, - 1' ' ff 1 1 f..--1. .11 ..,..1 . G. 1 ,Q ,dw vw s,w11.1,f?v?1'Wf- .g- am 11 1 1111.11,.1fM11,41.71i-4.11-.1,1,-1,q',-11-.-15.63.-111,111.14 fM.11.,1,W1111.4..f..11Q.11.1.1g,,f4.4,,..1f,1.,f,A.f41.1-,Q ,11.1.41.,1.11..1411.5..11,4, 1,4 -. .1.1f ,4 Q: 3 li .1 1431.114 1..,f.,1.44-...fn-1f 1 NP1f3y1 -51,-f655!..1i F i - 1. ,g w- wwf- -qw ,-131' . .. 111. . .141 mgqfgwf,f1.1.1w..,4wfyi5..,,,y..Jw11.1141.1.,2.Wfg,,,.11W-1,4 .m4..11..f..,1,,f1 ,,e11f.w11f,,,..f1 ,,,v.,11,1,,1,M.41.14,4 f,.11,4,,.,11,,, 11 . ,Mn11q, 11 .1,,.M..1,.1...,1....,1.11f1Q6 ' .ge-1.:w , ' .1,1-My my z.wzf1WaSlf-f-1fL2fv'.1 91311121-iryf-11--111-1-ff1.w,aw.1.tf-f,51-f515yf:A'w:'.fwf wif!1:,25Mp..1awww1,1',11.mg1+6:,z,levy-affJ.:-Z. 1: y.f1yf,11yQ.,-..y4,,11Z,..,,M ,1 .::1.,,,1 4,5 4 . - f- ..,,,41f7, .1 ,M ,Vg,,f,,,,4A,, ,1..,.,,.,.,, - -52, 9511 w.f1g,gj4f,+a1?.11ygAi.w1 . 1.1 3 Qa1Q52,,-3,53-18.5.23 milf! 1.119211-2355... -1 -kf?1fzk.55w'vww1S':11yg.Wag , f:wQ,fc92.wg155ww1 .1-mm -11Q1azr.1..1,g?1z 541-111711,-Lax -fy-.-1.:..111z11-1,1-mf p gyiif-' 4 .fm--'ff '-..f - ' 2 1f'1AV2ff1x-'ffl-:iw--14f.f14k Ifffwfzwyz -pf-5:11 -' 9 1' 1 zG"f2Q13?'-V--i QXMJ-aff 5- . -mg-.w 13,1 9212 Z'v2f?"W39M 21.-,ff zycjfuf' 13- -1-.yfYif7,v,QuQ . 2Z1'325425iW.-f'.' wwf u,a4Afn1i1f'1f.f10 jfwllffgmfgz-of-:CQMZXWQ6W9,5fv47a-:f-1211-WPGM-ff f',z4z4"4aW1ff+1f".ff1-KW 'caglg-12-1141--y?'fi -3411 1--', 14- . ' 14" -I - 4 .ml 1.141-111W-2.1,1-,WW1-fg,f11'f:1c1..,.,-11 - aw -1 Af 17-.3'7?X"-'f" 5'-1 1faf'.Sgs5Z" 1.'f1-MQQ9, faiigfwx 5 " 1 1ff45.f2iww1f21z1Hm. - 1. ' H M . . " -H ff! .WW .fm-ff. if' f "urge .wwmnpf-' "f"'f'P'w 4"' W' We. W ,gy 4,14 ....11,....,,..11 1 1.1-7 '1.1-115:93 -f'-: f- gy- H911 y.x?'g?4'X .. me MQW 1.4 sgveu--M-v4,ffmq0 "2 4.12191 yd--'-4--wi-f1W..f v.:.4e1.W11J1.y,,554.-1911115471mam: 11 51821.-M11 1.1.f ZAp51,w,J1,Zvffm+g,.1wwwf-fz41fv.fn,fw15w1y f.w.1! 'f 2' 111 ' 11 ,41, 1f4w1.1,,1a,3-' f14541.Mug-wuzg,f-2.1112 --1 541111 X. wie -' . 'Xvff Www 1-21 ex W- '-if 2 :Q-wgrfwf 4 if iffifff fav.-211721111-1:-127ff-191w1:1f..f1m+f'11ff21-1-ffiswfwwf-'W --fw':11fifcfQ:1.w-few.. fh 114.11-1+-1 'QM M fy w-1.1fw1-.11.'.21,..C1211-if-fwfwm. Je. ', 1. q49?w.f'1.r f-7f'1i'- f My? ,iw f- V-Y' 'pV?zft"??'1?w QS . -151 ,gg-klkm3?:,i'fl' 1 Lyggiifffifffzgf 'f1f?v+gf12f11zf..v fvsmflw-15114--ia-44.4 1xfff2EJffK14Z3mg1151212-1v'f1f41.--Jf.'.qMQ149xf-.wav:ww-1-Q-711.9-43151,vw.w,:fry1Il112-ff71iMIZ'f.11ff:2zzfyj5:.z1 1'--. 1 41.,'.f-!wJ19 ',1 fl? Ji'-?W'j411'f'z6'f1w .. 1.614-.1:f1i.1f:-.-'-04 , 1 .g- ff -1 11 yQ9, - .11 .11 " f1y+ ,. vg11.3a1w-.zyq-41'fqf,1pf1fg11,1.1-.1 1 -'fswf M1-wi? ' 4' iffiilgm 1 5.1 1541-' 'kigii-.Q55j?fffg45,.gsf24 ffiw'gg91f.zww.z',,yzff1g? .3511-11,5-'Q-.ff 1 214- , . ?.',-,y,gq11.4g,1 ,way ...F - wx ' 1 wb- ' 1 - 1. . f '- . . .1 -P . .' .1 9 - -11+ 111- '1 1121, 1-1 J--L ff'1 1 ff 111 '-0111 .ff 1-1. -"11.ffwzw L1 f112.'ws:1wy'z5v:mf.:v"Z'f- -KaiL-'JSVGQ-1Z'2f4w.'M7ff .410 151:11-zwffwffv 1fwZMf1fwA1f.:.4-1- ,-az-1m- - f-11:9 . . . -1 4 '. mf- '- -iff 4 w.a"i1 w..f 3 ff.-w 1 .ASK-w f 1 --1.4! - - - -ff i f ev - --is 113414. ff. mm? 1f-- .ZS f:1!1m541Z ylfyfffvf 451-4.,.fygff.1s-Wf11.-.--.544-W1?f111,..4-1 1a.1,y1-,1.1Myn1114111.41111ff f.fg,.41,.y.4,f4f1..2,1,114 149,-111.f1.,,1.,wz4y1,.1::1114 -11 , 1,1 , . 141 A 1 14, 1111114-1.1.4111 uf, ' 1 -'1 .-W ' 'IWY1 f '. f SM' fmz'-lf' 152- 3 'W :fe 125' uw? ff--1.'fP2J."f1W?ff -'.ff".E-1.141422-sd'W'W1-1'1a'1w.'M2-'f+ff? 1'W1fYWW13W1-1-ff51--!'mff'11? "ff 'ff 7'7-BWZVX 1 -' 1 Y 'Wi 1f -M51114. ff 4-1:1-41 ,gf b , ' 1 f . . :: ' 1 -'- Ag? 'X L ' I - -' .5 1 if 1,,,f1V '-" . . 5111. 1 . . .,,- 'Q' 12 . -ffwfivzgiff QW -'fi ,'Q1f'4fS ,f . Q.-' .xv 1..,. 1. f 4 f 1 v. '. 1. ' , 4. ...' 11 P v'g4M?'w1?f-W6 ?'ff1v.r,1w.-fe-.16f1.'r,-QM 4.11111-14.14-ff1'-zwwwwf-,Q,4114411.15.1.M1..111.m-14,11.R,.gy.1i...f1..1M-1-2:Wfw-,ffmnz..,1.'AQ..111,.1.g1,,4.1.4!.1...f,1.M,4 , 114651. 1.1441 1,-,ff qv n.. 1- 1.1.5. 1 J,-,. ' X -- .r1. .1r -Wy . A ff ' f -.v ,gds,P25,,5154 1 5. wf 1 1 2264-1 44-nf1.f1.4.g . 112.1414 1124111411-1.ps.1-,A1:Mfr?1v.f,1f1-ffAw.f'f9f,.-,1-1.1.-Jr, 1111-ff-1,.1f.v,1.1111-.4..1f,f,11,fVw17,1411-1,-,111.4f.,..z1-,ZW1,1...1,..1g1,:,.4,n,1f ,, 435114114 1114 251.-414.1 . ,,, -A 1.,z4y 4, ,, .1 ,,1.. 1 . -f..,.pif1f1Af '.e41 :QM -511 .- 41' Ziq. f-3 51111 QC.. fefrygfg 'ff ff-mf 7.11, 1104? ffwiymy .4gff.w4, Q5fG,fvfJ.f-zwf11-mm: -M911-wp..f1.-.mmzyg1las:-,iwgzg-1:z.4g1wf4114ff11f,g34ff.f4.4fyw1f-1:1fp1f::1i14:mzv.foz16491.1fg:,gfff2f-QU 444 4,91 -,1... jfa.., 1 . .swf--1: fwQ.,4:1:i-1 L f .1 m QQ 1 - g..yf.f4figg.1s,.faf , .23 .14 iyx...ff1g .. .f ,.1g4v,f'-11.545 .:,-1.1554151y.apm.m1:,gj wm.f,.f4gWMg1'g'g ,jmfgfy?-fn-v.1a4.1..?191.1.-1151z.kQ,11yfg11-2fQw.ez.y..zcwy: 7-,5f.,,y4.4:1g,11:f.q.f,m91gy.,'41141.1 1f11.1:' 162 17. -,, 1fc f:Q5Qz,,.1--,,, ,,, .-1.-NWQQM -,--,,, -11, J 'M as .1 1 . . 1Mg?iig,1g . .. fd ' -1. 11 " NZ-9.-grxmgvzwfwf wr gig. 1f'1 22125799 Q. if W5-J2y?"iJf jaw?':fiwmv5Qiww.1z1+:311w,w.f:1-5-ageww:.ge-zfffmfffwfz,-1:fs'-fs-wwf'12- :1,,.1,1wy4f'gfg,Qy ' w- . ' ff 2 ' fr'-' - '71 .1.w ,202 wg9?'1.?1W,'m4 wwf . ,,,. 5 1- ff ' f r. wfgw-1+f.21m.Q,1 .. .11?f?- 1- MI- QW if. -141-.L12151-243111112.21.-we-131ww v 1 11 3 5: 'f 1- wi? 42.11-131111 -4.-11.111 . 3 1. 1 7.1 nj, 251.35 ', . ,,, . .,yw'.'c-61.35.-wf..gw1z11w 1f1w?w4wf- ?Y1,15,.ff126:71.161m2f,.,mwfwizw-55: -' -. 1- 1 .. 1' 4 u -1-11 ' V-ff11w23,1. .1 1 f-Qi?-W."-fw?-wwe-fa-'f. ff hzwfW14e?f" iya aww :Q.f2WZWG?2?'wf' ffwwa.1z-1tQy1m,g4,- -11:Qz.'-.f,w1.y.mg-3111.1Wm....,mm1fz1p1marab-msfbif 1, , 1y ' Z--1.313111-f , 1- ,f-,,1,.1..4-.11-fffmw pg.,-..g-,5.1 K- .ziggy 5 g:2f2P.P9'1?v'5w,QgD6f11X 51141. www 'ri Wg, Mfjggfggi-yy. Q21-ws-ffLiam?-13,51?1F14,9F1w:Q:-. .new-1 gggwfffgpzffgfwwgf ',ff-.f1.gw.4cqf,Qpfw em.-1wfzzfa-ffvivwhfmzf. -1 f' f '1 ' ., ' f .1-11...-11-.-My-pr:f.:11f1 g Q: --. - . . . 1 1 1--1- .M .-1- . M.. -1.-1 Hz.. .-.. 1. -.'.1f.1, --pw .2.1'w.f. f-,-..- 11 11...-i-.1 f,.,.1411,,f1111-.1 '- -1.1.4.-, ,f:f'71,4??4-mf-111-,f1c44.1.1M115-y-fn11.-ay..-Az..,.W1111f1.1 -f M. '55 11- 1 L 41 .ww-:.x1.11 . - Q. 1111 ... .. 1 IW-..,.v41g-,W1i?1-Mam2fpf1pf.-mv?-1-112112123326..1..4g..1f. 1.1, '.-12-my11,'m.f11jW1w1f1fW1gf.11,151M,f1.,m-.112.-e.9.f,13mg-.fW1.m,ggmff 1..1,1fwm..1-1.7 ..1.f.f.-1ff11.111.1..1.z1...11..1.1.1111.f1.f.1W.1115.-1. 51 1- e . Q 111 1'-1. 1 , .11-1.1.1. 2..q.,.f1-ww, . 1 . ,S . -5zzf.'1gx114.w 4gw1!?.wf'-kgfdfi .,f2-4.2-.Q -vf:mf,,gz+-1122112-14.47.4...-wa.11-2,1-wan..-5414-?:ff1.,f.11Q9411,w,1f1.1gfi11-.:..Q1'f1yr11,.g ml. 22,11 ., 1 1 . '- Z: 113115114.11-14..1,ff411.4 -ff-,3 12-wwfsz-Sfgwv . 4 -1- 4 -11's . Wm. mai 'wwf-QMQZYH'ef.2-1"2s?esw1.1f-w.-44f7w.1-r2f+?1f -1.1.4y."'wv11f11-'fff-M141:1-1 1 if 'ff 1. 11f.w11e11af.w31w 1.1:1ai1-sz1w1:-11: mfg- :fwfffvk-f- . 19 . ' W -W 1 -WWW if 4551- 3612, fi -W afar- - 111-ww 111474 --Wwif fiif-MGM yfffi-fyakvf' 52449502-11 vawfaiw1efys4S:s2fw7443w-41feJp.1.w4mfaz11 yf1.m!f6.w.AfWf1..f'?w1.-'ff11:1..114.1,.V.1-. 114y1.f,w41,4.f1,41,12.1fKfp-1-A 445 14 Q 4 f , qA.Aw41'4411.f, -1' 141 45- 14.51.51--c...fv,S?M4:A,i'7 21.111-4 2 - - v'.1'41' ,f.,.-544.1111 ,,i1:1'-wL1?'?"', .1 1? W1 1151 xAm...47.-f.1,2:a2:m.-w,-f1f.1?,2-z-+11-wg-11-211.'11.ff-1-.fiQeff.11fw1zf-101---1,611.11-af-ff1f ffw-f ff 11 'Qf 1 -' nf 1' 11.9-r 1 ov- - .Q:e1Ww54w.1.-f1.- .fr P- , .qw - -1 .7-9:1 '-fiwyk. -f'411vQ.-'QM vfwfWhf1s1ffe,w?f3.14:-NW .wif-'11111..1m-ff1.1-41,-111--61?--1111.1m1zr411.41.-f11-111,111:ww-12.111w.1111f1a114,4--12-1.1m-11'1z1111.-ff-1f1...-..1.11,11f1m1v11-1414-1m1wAn. 141 H1 'Wf71l11zm'f21 74 -1-4:1-' S? M2 -'ffg11:2.ff' v .,Q.g.3,. ..1 , -1 .. ,4s3.224na,1.W5, ,Q-gQEf'2.f5af1fgg.Qfy83igg5ig:-1 .159x,,,1-,fgffc jggzwfggfgggifz,-,yt,m,. v1.,gf54yfi,g5-Qyfwmfgfggyf-fm?-fffff-:fm 111,115 wef1,pM'R.-41A'1f,Za-.21:1g54g6w1y52..151'. Aww 1-1 .151 :.1:.1.:g.6,,11:g?1-911151,1., f -I .5 ,,,,,1,.,,.v'!4 1,11 1.71 fm I ,-,g15., .1 1 . Qgfi 1 mf. 'ma f-Agem:-Mvixiwmy! ., f fffi 1fffi1QwgQ?asa Q' 11-ww1ff41-X: .1-2'-.Q W1ww-ffzW':f24fw1H4212fvsffia-.1yf121wW1-:mgW1411:-1161f1,.e1vL-1wwf-"e1f-1:11.iff'-'f1'1-M32a-1f1f4m-14z41f.ff:ff:1zfzzg-1 111121.4-'fy-Q14-?e11f.p1c1 -'zz --ff f--1. -A 1-4114 1-C11-Q1 112110-1,.zf1:1. am:-1 .1 f iw-..,g41 111.1111.-5. 11 wz- wft -' 'Af wwf - 4f'.?f.yx41?-ww. GZ-wwfm-.fff:far'-114-1.1x.e1f.f.,:11.Zwmk .s1,1.wswf51.ff2-1:11wwf. -Sw-H.-1- 14fff4y,A 1. 21,5 1 -19 1. f- .' .4',p.1f63.114161fr ff1.f,4-m,f..f1-had 1 - ' e'?W-05: MM-11f?wffff,6f1.4L,j-W-nxjzs. V- --.111-,pw X2-J -55Qwf,dm11-'w?f4f2?....Wf.:1Ys113?:2'N6x29-ew Y1:aiwY'241'.13?ffi:1-eww-wz.f6'Mwww.Pr:-111414:42Kmf-fffhL1f11Ms2-:QM2131?fzymf.flfi-'zpvfnfpm1:ffw111-fflrrfwfyyzaw1.9wfp11ff'1--15:z.1ff1,f.f.:yy41a.111-1ffvfy111' 1 'ffaf-'?fg5' ,9F..4f12-,:5w?g4f1-111y4 :1'1-:rw f92y?yfs1fm?fg1-.Ny-Yrf'-.igxa -. Q. yfff, .1-A . 3' My-E3f.1zf:v.11z9gv ,,,-.gram-ac121gQ41y?6Qz.fQf 1 ,,.,,1.5,4w.f,,-.?g145. H . 1. Q.. .g.W14.1q1-3.515 -15,15 .,q, 1 --wwf -ff" 152' L1fJif-W1-11 1 -. iz-my .aw ' f1- br: - N ew-fy1fw4f :ff -1,111fMf:-W .11::,1-4m 'W' . 1- . 14 21-11 Q, ' -' r 4 wwf- . 1 f- ..,... -1. - -. .,m1.f,1.1 , W. bffmifff-..1, .. .M-.1f,11 . .v1. ,1 11.1111-1-QW: .1 f1.,m.111,41A11. ..,.414,114-em.1w144+. 1,1.1g,1.f,-1ffy1.1f..f11-1.,4,1.11f1ff.f2 ,1-1.-.f111,,Z,m+ M . , 14,11-1f. M1-0,...f. p ,,z24,W.,,5,5,4Q:.515',i5,,1,,,5g2g1.1,..1g1ygLf11 .awk,g'!wff44.g3WQ3.,., ..,1,,5K11M,W3,,M,,,,.1.M.,.b,1.1,.,1g.11M..,,...,4J.7,,,.,1,,,.,.1,,,M, 1,.1gV1m.,1,,,..,..,.,,,,k,V15H.vf4',47.,4,.,1Q 1.... U. .,,,1..,,1f,, , Q 1 . A, . ,.W1,1. ,1 ,,,4,,f 1 1:-1 a:--.1,.1.- - - . . ZH-1 4 aw- 1 1 za'--ff - . 1-1.11,1.-15. .1 . -M f1.f1-15.4.111.41-f1.1r1f4-.-1 -12115.19 w11.1,l11-.ww1f1111..,.11.f11-1 1- 11-1111.11-ecw1.4g11142--111:11.1fw1'i.1fzn-.11f.f11.1 . f 11 . 1 '21 '1 1. +L' -11,-."-1we 1, 1-K 14.f..m1.1.11-14f1.1'.zb,-l".?fff.Aff wig-A f?-41'M'w5yiwuf,5sEw-:121iW"'f K-fQf1v.-wff'.1f-y3- 4734315-lf? -ff?'gfmi.IF.wwNf11:f1X1'-www-151-' A121111-11:-...-f1.-11.zw1..f11.1zf-.3-,4.11-Q1f1w'.2e,-114-117-'.1..f.,.11+m,W41.zfWf.zQ,111m. 1 1 - 4 . ffm..-1,, 1, 1 .1 1m411.,11,-,W1 1M-fx 4 1 ':.2-fifxfw 1: ' 12127 .11-ff mga. Wfwwif iv-.59 fiwsyfff. iff-5414-PQ H 1035-r.+f'w .-1-- wiv-',f9WW'-1'.-V 241-Q-savfwf-4,1411-1g1M .ff3'?3'+1f4j:.-flz:21,!41.1. W.g1:1141 1: fm .1w,w1f1. !14f1.M4g4.-1-1 11,-41 1 " ' ' '- . .. my ,,11.f..uf1-1..4w,..,-1-,w'5'4 fb 1 ., 1 1- . :ff 11 -fw--f-- ' .1 - - 1 A - . ' s - Z 22-' 1 1- .w 61 iff. 1' -' - . dxf-.afixpgzwfvff -52'43f1'T' 'mf' 'f"?f"1 .weeE1fzQ1-::wmz1,fQ-41?-wsj,29-111 .2 "wmiw'l?f .MM g'ffff1z1' 1591: .my gr.f,1.gf-.rMp'fif41,. 1.1-f2S:11fz4Q!a,fZQm1 ,-'.11vv,f:v1-551.11311141117.-41-'.A-Many .1fyr'zL.-fy--Q41Mfewif .V-v1 gf Q11-M. .1 ff" ,371 Z, 4711.454-f,?ff'.1w,w 1-fs' .1 '.'25g5?z? .,Z14'Z-yfgfqmwy 1-' 1,f"Q--i?:.14'-p7?4ff.C14W hQ5i?Z'IffIvM'z?i 4 57f54grft!1..1w"1Jv . i.,4.mv 4315122fffffiyjvig-.2fzQ1,541ig:' .1W:Tzyyxg2.y6-13,4-fag4.114659:92124755.14fvfz??f2L21QH61,4.a2g'2767- "1g1,1 .,:', 2k'gmG" 1- -fe 111:v1.fyj.',,11fP3-.Wy. .en-3w1.z,m:. -,11.-a1ms,1,,f11w1g.Q41 f ,f9,4.g1Q,11,.1.g5. - -,gymmf.f.f1z.m,11ax1m,,..114s1. .,,, .1,1,1,.,1,,1.1,1,,1.,,1.,g3.,f...411,..W 31 11. ,. 71,11 ,4 11 ,wg Mb, www-zwgaae.1'.Sf:s,11f1fffzwwffxs.w11fw2s1 f ww, '--f.,..af1z411- Mya-riagf4mm1?1'1emf-11.f1':f1:1a11--1 .11.:f.-f.:-1f?w 1- 11' '1-M1 . -. '- ' 14 1f Qiyw--zifff w w f . ,,.. 1.1-wi-2-2 .1. x1f2. 1W,wm21f.--wr-ff - 1fff'11' , X24 ..7f'f13w 1 1 ' 'Wi 11:11 - . - -Q 4 - 1265? a.ugef1+fz4c1z: ww12Q:4f1:1.:f1'?Afwzf1-ff' ""' 1.1g....?-nf" .eff-4-211f:wfw4 if 1 11 x .1 -1 1 f 11- 1 12 .vz1w1f-1 - -4 4 1e1ff21-1qg52.1wyff.4---1v-.11--..w.1..-.w11. Kfzw-411-1 -111. 1111.151 , 11111. - 1 - 1.. -,Q 11.411...1-.1i,'r,4..1fsq..f4 9Q..f1+5A,1,1f4.141.1f..,1.11111.W.-.1411..m11.f1.1, ff,, .,f.:-1,4ff1....41Q1- 1. .1 1-g..1.1 , .1111 .1 f -. .. 1, . 1, 1... -.-1-w-ffwmfff-'1f1mf.11111a1111g1.1f.1f11:,M,111,11f,4y-.1...,.,.1f,fy31.-13.1-f-ww..1-wmfQ41s11-A-1.1 - - --1 -1... ' ,-m,4f1fA..h.1-mmeif-KWQ11,111f,z.1-M...ww..12.Q1.1my1f1W.11111..w1.11f,.2:-11.1 W-.Wim--,.f11w4w1m.f--17511111- 'I 1.41- 111 . . - A' 2-mXf:z.?G'-Qffynff .f'J-.J-4-19'1Yf1wz4 6124.1-1--. 11.-A-145-'11.-1"11'---1 - f . 1,11-71, fm' 1 yy 11 Mez.:.42f1f1121f!f1ea-1331111-:1ff-1i1w.m-4.1! WG:121-1.1.1-:ffm-11f--'.wWf?w.41-e-My11'fzl1fz'f4:fazvid-1.-1ff'v24:!-ffkfwrff-v'.yfy.616':fx - . ff ' L -ff-'flff 1 ffffw' 2Ws7dff?v4 g 1 3 91hf3?f19rv "- uv 4:-1. f' ' ' . , ,.- 11,1111w1:4g1rf:,1.1mfw 1,1 .1231 f-Q1,,..1.11 ...N-,'2f., .14111?i:g119::1g,:1.-W.yf1u1'41z44gf,-1.-15q1f,:,4.fm45154141-.5-.my-.1.54rf11ygi14wgyM.:,ffQ11 :1f1'.,,1'mf,11,,. ,. 1 . . ,-an gym. -Yi-M1521-56,5 .nf .y,,f549f3z1,f9gfm44,7:Ga2f4w.1 ,,+Q1-.,,.-. ..mifq - gin'.-a1--gf??z',-4Z222+2f-H-N-ff f f ' ' ,1 ...wa-g1,wg.44 f5141z,gy1-11431154 -11 1' -11"-M.1-52431,7515.g15:9xW.154a134f-'dwG1gie:?.14mf,1l-ingffffaffy911.-zfigyzzfawwnfwkf'fi'-ad-1zwy4136Z"' -K 'f 'w?2f-fK12lgsWS2gz:-'.- .-, 13593553-.?fnf1 Q., H --7:11. -sex-1i.'5d3zQ . 1:m5ww'--'f ,.1.11 W.1y.1.'Q9mz11:x?.- .111-ww.1224f-H ff'-fwfwff M11 ' 1 z5.f..:w1pgi4--14u16Kf,Qz-eamzfiwmezpm.efe1iyyzq,fg111smf 1,14p.11,myg1?mJ-fm-of-M11111-ffvwme W f!w:..,1.,,,f-1.5 Y . 4,3 .W "52i:..4-fz2iMf 1211.1 .w N . HWX 41?-213+ -f-2'f1':fG1- WWC 1111 1 -1-.1 1 . 1 :a11..1'1.fZ23r41ff -1- - 4 - wf-g,1111,1,,1z1-... 11-mguvsfy mf-mg f-1155? mm-W " . v-wffz-eff-'..2:1111--a.-QM is 1 9' 1 .ia.M1f.1.1I " . . ...gk-1,1 1 1 f- .. , 1 .- ' -ffswyzhii,1,m!-1msw1f:51.v' - , V1fzmb,m1vH'fffq?f1w1 M1225 A323 -. ' ' 3231571-h? '1f1ee'?2f'wwf'.zi'.' qwmwiyf , 11 11 55214611:m1ae-2na2s14'?f'm3r2-wx-'ff-p".':-Q-:wx1wffadffnffywyfvilwxaczwfgw ' -'--T 1 -41441-1.41 fi.w1f'41f 611:11f517,7g1--1fw1f1SiZ6wA,:.w4 Ka' wmv.-mf 11' 1-51 M1421 1 Ziff.-.1 0,1 1441- fi? rim W-+1 A 1 - Q 1 -4-fw111w,112,1.11.mp1.2f:.f,,f..ff.111 .1,.1.,-1.21, .,.,,.g..,j...f.W,-m,11.,f.,1.,. ,1. A. 4,,,M.. ,,,, ,,1,4,1z,4 1 911159245111--21f'?5ivwQ11-115,53 . .- :eff :. . A ' . f - . - " 1 e1zf-new 1 :2zww1,gw62'?Zf Q 1 1 fi1-2-'Q-1'-fn' , . ,ix . 1 wx w'v?4:51 wf . .6 , . - ' . - - M1 . 1. I f -1 f 1- 1 5-21 1-" -' . . c WL..P:f .mf -.. 1: w 4' '- -., .1- 9.1-' cp.: 111 .1 .--.1 .,.1 'fu .11..1..f.,'-1--41M 1 ..11-'-h,-1 my-1'f1w.':1 -11f11f-1ff.:f+.,.a-.cw -1. ,fr - 1. 1. .111,-1 -. -1. - ng 1 Q 1,4 .fagyww wr 1' 1 . 1151141141411 -1 W --5?1i4wff. M.-Mzffm gyacw12+-w1m1:1.fa1'rvzffQ41?2'wf4Qas-21-..211s?11c2.11-111:'4f1-wr-w.m341w-111:-1.1a5g,,-11-N-f1fwf,if1.111v,111:sf:141.fq:.1f-Qfmq.-.4fgr1Wy:fgg,g1111.1421-, -714591, ,fy.W,,.2Q1,1f- .wiw2Q'- eff' '1 'A-44:53 :v.1f41e"4fx 51.411-w . " me.fffvY1Mwffrm: ffzfiiwz.-'16---1-1.14.,-.wmv1-1.4.-'Gww-'ffff-fieffmfwpm'-M25112111Jfa'Eg:2:1.1:-v'Em?f-9'szfm-19114M: simfrf2454114-1s1Lf5Z1f'ff"'-fgs Aqwiw-iff11'11 f'4 1 ',11p,i1fI?4g4q-' '5WfNff" -W T "1M:242311'1 A wi!" - M -' f 'V 1 1- 72554-7-' :f'5i7fVwflXf?'?F 41 ..4211f'1fff?' . 4941144'-:iw-1.f'fV'Mfw:?94f'A'fZkiivimrayy iv'1s41A:p4.-12- Qi?,-11Ma?f'-1'3:-if:wwf-1-fm,z.-.1-111'111454-7:?.17f.,C1z4g..4f1,-W7z4.95f.--chew :.feQ1ff.f1-Q ra21:rx+,f1-'fy1l?1?'5w-my f.f1-,ZH 1- - Q: -fzmaf .gjgrf 1. ..1'1m,-,.'f.- 'f' -X'-. -fm ff.f5'11. 'zu' ' .1-.M-iris Q1-wx-:any 4.2641-ws:m,wf ,1, -1 ,,4.-f-1,.4af51A1f1:cw41g-wemh431,ay94-,ff-1ewwg,,f71,4m-01-11W'Q.f..ff.11..1 .14. f4',.1z,ap.gZ.-Q 5 n Wf.,fzp11w -11-11312 .,,,. WMS jgw.. 13,1591 psig? 1515-161 , 1 gxg.-QW.and-f-Q,!Zgf,f1m .wzf,,zwf -my-1-2-,mf1117.,4f1f1wwe-.111.11,-..4g11R11.2114211.em-z,11.e1..mf+z11:.11mQ11.f1.-1w:1,11,WNg14.1.y1W:.1e1-1111.11:m114,.11g,-fM,...w,,fm 4? zffmf W41 1, . .fig-'qfyf 1 4- 4 www 43111 p1i+.f1zzig2-9g.y1- Q -C. 57 , ' ,-412- 'ww.-143- .4 s.','?g'vf,azf,4-61" -afwfii m.,Q.gw,1gwi123m1gg?ff "-?5Qr-1.6 -1 .gramw!A'21f2'1?gi4Q:vyW1.14xm?Q1i:mfnf'4,53fgfwfzpwrp-f.vfs1--w.Z-:wa-xyfwaimwsf1f'1773'19x:.1f.fvS-m:gw.Q2Lfifwmzfff.5vf':::wy.m.yy.1ff.4.zf'1Q.Wk .,v1.q4:w. .11hQ,.:,f,!Z.y25Q,11.-,'. ' -QW -f"4YWT ' 1--W--ff .1 wb!--f 11wwfy, '1-P x 22. 1 1-zwwvffwffiaii9-w1K2:1ism?fzM3g1s1gffmZf:i+Jw?1-1.21-ww2-14:1fm.ff:-2114aQ.fafff?4wma21-11-11:-1411Wf9fr'-zzsfwff-QQ-12aQ2,w1g'2 1-1ew-1cQ:--12522-f1-91:1 - -...fr 'gf Ag. M-Affw .2f1'ff1z1 fwwfzy f1'4.-54?-my-f1-12aw,'4fiW .1mw.',y!i2fvm1. 4 .1 ww.-111-1 Q,-Pfwffwzlfiafw-41-1-Efqigww ,111-.11111.1ffs111g.f-1-.1fg..1,q-11.,.,1.,g,m.1ggM1 11,.1..1,1-.1W,f,4 119331111-if rf--,175-"11J5f3f11f fgbipgwfaif- vw-12-,1i,0fw,m1Q -fwe: ww. M f waqwgy- . 44.41 . 1gg.f5mefz2mgdqf 2114164-'-'Sffw-fZ+zf1w1.fnA.:1..-:.n.1m.1-ayffQ.g41.ww-f.em-, ,-if111.412.4514-,rxfyw-f-yg,1.,.1.1111:y4y4-mf p,r,4,1q:.-gzpwgpm 11.41,-1 .iam gy. Q ,t,,11gE..g:fQg1ff1JM1y1g4c54 wyriigwf 1317 ye, 4343134.15 41.12 .-1:42-2 11- - f,gfz,5g4:W,- .,:e15,1-111:,4,-55.344155-zfmg ,1yggzg.1-gW5Afz4g1.172f My-,g 41.11321 ' .f f ' - 11 1 J' +V - 4: f..f1v1.., 1 " ' . 1 1.1, . ,. . ---.92 -fn- M1-'f-2-115751-, --271,411-1 iff ff -221,1.14..w:f-1---1:5-we-.1...,:,,1.-1:-1.-.zgimvlgfz Q My-.2,apQ.,,f.1.,1-Q19-f6'--M-1.14,1.:a2l1514f11.,gc-.11.1z:1-1'-14:14.15-11.-Zfgfgfmsffqyw--w.QQ-an-1511-,1.,,1.1,eyg.,.11415, 1 j,W.Jfiif?fg1.1.f'-1' ?-g1 .' .1,,z?5?f,wA'ff .if 2,24 G- ,.1..,.11 J 1. M , . 122' -.ff iw ff ff1.J.,,v,:..4Qg,,K.,1.,.,1..c1ffffmm.1 1..-,MA.M-.zz-.mxiffv-1139,-11,110451. -.-...:.-34.1.1,1,.1,11,.Q111--,114,11.w.1.W111.1f-w,11.14.41,fm114f0-1.-A11-ml.:-y.fW1wg-ww fe, 11,.1.111,,f,a..11,,11111111z54..-- un .1 .1-'wwf . . 11 - '. .1 -J 1- 2 H96 12 1 -ff . -11: f,w22'i- Aff wMv'fm11w--2M- ww' 1 w ' .A -,11.v:1'1a.1f-if -52531-,ifsffw-445214 1-1.-.4.1.e-.111:f1m-1-ff-br.:-iffmem,,e41wf..f.-+f,11.1f1..q11.1-4,4 1.2iv1..w4g4gw1191z,m.f111x11.1 MM.. M1 . 1 , .. . . .,, .. . .. . . . ... .. . s wff11'2!n4w.w: fi- , 5-1' if "' 154 . M5 -2-'fi-23362191 1-913' ,1p.,4,,Q' ef. , - : .1- f. 31..-11,1 111m2-g?e.f,.mg.1.15:f3iv1.,i.1111,-XM21-f,m?,i,4n W .. - .- 1f.f-1:1224fa,1:wfMZ'N5m.1-4,11-1.1.y,.y'f11',:y:f4-,11.yf,.1,..q?1Qw.-.mfgf,z11gf15Q1.:mg-f1w111z',-.f7ziy1.,..1 141 -fv-1g.-m,-..4-1::,ar-dylanr,1f+n,.a51f-fn,.,f1,1144f- ' - ,wb .110 ,11f1z4f-nz. ., 1-f 41- f if-':Wg41vs1jfg,,vf1ff'fiV'-2?2g4'.'??r'.!fi-'YY'A ffnailufz-wi wwf - 1'-4-fckpwx -1 w1!Me:,f-1 .3 ,fgyw 4 yff1d.11+wf.1 11.2.1-11 11-w,5fr:.1.Q1n in -f.yf9.,Q.1 1- '1-2 Qeq1,.4.f-' -f,.-1.wf1mq- M551 1 -f-'f-41-fwg.15f411. fffywpswszww.wlwr-fvffgg,G14425362-5iac.,4-f.:.-.r.111.s:2261f41ezgf+:4ef.fi1f12+i1f34f4gwedew-1:f'2..w1My--fArf,3f1r-11-1i-1511:f,4ws,z1f4.,2.,1.a.1-.w,gm1g1.f?,z:., Wi'-A1211 1f,W1f-'znf 4 gf. 1,1 ff 1 .AWN 'y 1 f9.2ipywi5Wy-in 4 34.11 Qn,w4afw,,,fw1q W1 MM.Q-w,.ew,A'?1q..11.2--,f1iefa.w p1f9g,,1ffs1191-,qw-4:.f. 1- aff.111.14.,1z:f1-.wr...1gm1f,wf1.11-wu.11...,-.1-X'f.-..f44wwmsy111we,.wz-1zf4--41.-1w6w1.f.-1117.1-1f4fx1.141-1.1.-11:.114.1w1.M4.41xf.x':.1!-11191 f 41 .. ..q.- 1 3 . Jie-1 1 -5 . ,. r ,, .,1--W' 45.115 ,,1,,:1,f,- f fy-5 . 'f wr., .5-. ..wg- ,. ..11 .1.. 1...15111- 'AK-.1-qsf 1-km,-4211.4:51gp2,,. ,fe--f 1: .9141 1,1-..m.1gvg,y:. my rf -ir13.1'1.-1.-QM:-..2-.4164.15.-.-g-.14. 111.311 1,:pf.-114.1,ffm.-1,'g1.151,-.-13 f-15A-1. 71 11-15-LW -f-19.52-1 M1431-M M 155 5.fiQ--'f1LQ.7,..1"- . 1' 4 " -ef-Hi.-if .., . .: ., ' d f' 7 . . 1 ' 1 " sn Q ' 1 aw. 1 --1--' 1: -L '- " Q1 H'-'f' 1 " f e-1 YY ' 1 '- 1 '-'1.f 1 f -f'- -W4 I'-4 . "iv - 'K 1- H-",P.z'1f93,2 1i1:"". iw- 4. '-1?11fXi1i.'3-15-1.Q23:51 125,111.5,-:..,.3yg..,:4f .Jfagq:-f.2g.y4.4iif'-Cramggggi-I.fm,f1f1,,qxfn-1,,5fL1:,1.13f5.,-i.,LggffA.-,ygkq ,.f-,5p,gg.1,,-1g.- 2 A ,EEZ gf A gig 1 1' QE ' 1 111' - .- ' 1 151' "' fi' ' 5 1 ffa.. -2- 1141 - 'wwf' 'G-14 -0 11-5fVWP '11!ff'k'5f"f'i9 1 X ' fxmn1Nf5Za fU"1W4.ff-0,11 W9Jw-ff1ww.,.3'?f22' 1?i?4fsf'-.1v2v?.7wP-Q.f1Q1f'x Gi?zfQ.f'ffi-.54TLff2'1-I-vLJff1-52132111gzmggygz.5i?it3i..".1411357315136ft5521-'vi--5Q.f'fjfk-Z.Qv2PsImWQQZZQKAZ.-C1211jwwrmffiivyfs +122 lf? f . 1 1 ...Aff ,1v.gg?1.1+f'21? 'Hwy 1:f5fQ?in .1 . . f--1 1.111 14 1- A 1 1' " J - " f WZ. - 1 '- 15119-f11MW1ff2 f1..11mv'11Zfv2 He -4fM- iff"- " ' 36 'f"" W" ' " 1 'wi-wi' 11: . . -1y:...iw. 1 1 fff'f'2'-JY' -ff .1 ?, 1z,f- . JW'-10 'i-wfygv-'1.-. .1 - 1,1 - -- 11 'W w J 'ff-11-..:,1. "f' -.'f-fg36y41wf:11,z1'4f4slKpai6v-25'am mEvSmy7EaLs5'111-is--'-M --I-mf...1':1mf?YwQew4--f1--:awwf10':..yA11,.Qf1.-1vw-1-QM.m1aa,c.1mwamfg.- -1415-1e.1gfgjf,.S-,rl 'J'-4' 1 1 H fi 1 -1 f ,Q1 M-1-?Yfaz'1. -2" 1' - .pffwivy-M22-11:2 1m..,e...... . 1 -.-f . -Min--nf .u 1 - . 1 ,,,-.-,11 wf1,1,11f,L11f,. 11-J,,w11-btwf.--if!-f11.E.rf .Ik .2011 ' 1 .- -- 411,25-we..1,,4,1. 11 -,w.1114..1s1f ,ff-1wf1...,.!'1.1y-1. 1. 2.1.-5.mffwwq.-4J1..zmmf-pw.1.1.1.-1.4-.v.,..1..-1111-...,,..1..-wwf1:-f,,+v.4f.1Qg11...f1.-fm 11.11141-411-.7-11-:Q .,11fw,Q9-.f1..f1, 1.1.,.m.1f.,y.1Q.w:f-3411. J Ffway.--11. Jesviiaf i 11 ,2293 45' M--2?f+5.f5gG315:Wp:WfK3f-''f ' lf ' ',e1i24Za3ff'ffQf'1Tf1-ff 14. Jf-m24YffsfLyW?vpf:w:2v1.-ff':-11511-y-1-f1:42wwf1cwrsifiiW-fxg.-119555-lfgx11,1?3.cA91r:af11w12M-:aH..42zaayfefy-...zu--1-ff.,.1121.415-1..:7Mw+w-M3 1.13251-1.1.3,-1,11 . if 'ff' + 1 - 1.51 1 1 - ' 45 ' 1 - " 1' , - -1 5 . 1. . V I xv., -1. ,,1..7f4gg4g.' .Q ,Vg ':.L , . my . rj... -.5-1,1 cgi.. 35.231, 1,4, 7,Q 134g'5??1,3,gq,ggy, mpcgw Vaggggr 4' .7411 - - 1 , 1- 1:f- wflifw 'f-1.f 1.,Qf1 1.-'-1 .11-'14 4211- f v 'f,vr31z f -7 1w11w'-W-M14 .dw . M'-Jfdfgfwf 1-.gm 11--11 -,Mm 14:1,.ym-.111'Q-f!,.7:.1..a,1,v.,,v.,,:.q..-3,1-.11.1.1,11,-.., m1,4.k1f,1p:2.101.1-.-A4-,,fwaf.-fqg,:Nyw4.1,,.-Q,.-4.34. ,MgfQ:C351f:1,4.11,,Qg,-.11 A 'A 19 ' 1 wifi?-1? 211-1-9422 . 1:1 2-.41 -xg .1 ...f 92991 1' w arymv '22 :aghwnwJesu-335.-,.1g1g:5111w 11,-w:w11?g,1::f.-...11:e11fy1f.z'z ' ' f1 1' 'f,v?5n' 5f551.f-1521"f?fr:1w'z1e . - ' .1f 1-f f-Nw - :w.gg,fs,s-1 -fwfr '55 . -1 ' ' wf 41 -- I' --ex 1 .1 F 'ff' " W" '121"f'ff-ff, 1111! - 1 . .gfffiXEL1i.1 ' ni 1 :-:EW if-1' .- 1 - TE "'3i1:1:11.1'1?f.1-.1"N.f1-vf1rt4if1:'-34a5ag-1-Gfffwf.:wr-41-2"-ffvvff12iz?-M14mf?'W2S21S1-+Wr'w-f'f1- --'vw' '- - 1 1. . . 1 gf1f1a1 51 L1 -f-1 14- sg11.1f,g: ',y, 11- gf 52.1. 1-.12f,,41.1a111,,7. 1'--,ggi-iigzzff -2- 171 MW 7 211.15 kgs. --- -1 -. JWL1 'f 121.1-. ., " f .. 1 wif .2Qa?j,Ef4z 'ff2i' .af if1. .HW ff? "W x.. 1 -"X 2, .,. -'S!?""11- - 4.5 1 - . ., ly , . - . .. x " ' '- -' " ' 11 1' 1"f24?1".'v5' ' 2" Q: ' MN -1 uv ' -- if .- ug- HP-.223 fs-'5?-3.--'r'fa3Qfs?"121iff?4-L57 551115.-UQK. ..-4111 . -5e1.11ff.'1112 'ff11-b g-1s:gf.1l?-' 21.1--.taxi-3:.f:?L1.gff3-ffvwf . .- 'T ii? 1 .g r fp W-22.5.7-11 gg 5 4: , 51' f 1,10 11- . 1.,.,4Cg.'-' 16211 " Q1...-33,1-35, M Xg.A,f34533:...1:Jgr-ggu,,3.133g5g53jQjjj ' ' " ,-5.15.1 'fg.1-f.'fwg- .. 1 K. r. fa. 1.1, 1+' -gf-3 K- kj 1' .Jpj V- ,-1 .,,, V135 - . M' away- Jw- P- 1.1-.' 1- 1i11114,y:.f' ff 1 fd' '1f ' Mgfy- 13'Af.1.w:..1.. Gif' 1..sf,41 1qw:m.14,..11-12.3-11.,....11..-1-ff.qN,. Wi., .. ..g1.,Q.,,1..gQ-.f+2,'a., 1 .. ... X . 1. . A 1.1 . .. , K t .. 4. 1. I Y. V.. 1. .11 ... f- 1:.11w-Q3 -41 .--.. .rwa.,4gwza -nf 'Q 'ef ,-5. ' ' v.:..... ww 111. -1-1- L ezvagpig.-'-'.'-1i:'y'1L5gg,y --1- W f wqf.f,,.f:-. ,-.1 - , - , . - - . . 1. .,, 1- . ---1.., V, M . 1, .qf,,,1-.141-1, f ,.: A 1- 1. W, , .W .nail -,,, N ifpmiigk gafwwgwkw. , . . , . . K . . I K . , v . ,,kv, - ,. -1 1.2 - .1 -1. if ' : ' . " 1 51216, :,4x.-..v..1ai- - 1 . k ' v - ' 1-'1r1w -- 1 41 . .1 .1 ' -Q.. - .114 ,if . . if 'K 1 wg. 11w31-'.1p:1mifr1 - . 1 ' ' .1 ' - 1 1 ' 43-:LE If-74-Vf f - wr f f' 74 2' 1-yy?-.1-.. 5:21 2-11 iw: .Q.g1Q5+:.11z y,,q1fs?,4-.wa.ma-se:-vb..fee.fQ3:.f1g..--1.f53ifpy.a.ggg:mg-,.1-,ga1,7131-,fm ,- ,. - - 1. - . . .4 ' 1 421 , 14,521 . 1-M ff- 1111 -W ' 1' -r A i.. ' .. .1. k. ' 1 ' 'f-4: 1 -434 1 111011111 11. 1-ft'.::1rw 5313 ff 1:-mga. y13y'.5L'- - . . 1 . - 1 1 . . 1 1 . I - -.Q .11 .3 I ' W". ff 1- ' D' - -1 -3 .. - if . . 1 1, . . . .1 . .Hema .H.mfi.1.: . . 1:21535 .i w1,g1' 5, Q.-f,..,:j11,1,. 1, K . A 1- -.wf 1 w.-.11 1.svv'.. 3, -1-f-'1f1w.1-- -1.,-av. 1-0:1 I . ' -- ,- - - x' . ,,,, ,.,1.-. -. 1. , 11 - .. . . . ' .MK1Qi2hfCS!i'???f3ff+?5.7?f3F"-f.l-' . , . " 1 - - ' ' , .. , . ' ' - 'ff . , 1 . . -M. .. 5 gm r 1. .511 - f'1f'1 V .. H .af 4 . . W" ' 9 WEZHFL' . K 15 '- .' .5 X I -ff In 1.1 " f- .1 1T I. '- .gil " .gfff 'f x .ff 412 if - 1. L A ' . .. .. 11 ' .4 ..,.,4,,,.1 ' ' . We . ' A 1 1 - f' - '--w.,1 A ., .:+.g.f41.?-612511 Zu., 41' mu ..,:1.:kg-.mf i.1wf.f1'1 5:1-Lfiefjf-I k21y.1f:rgfvff4a .?21.1Aj3S'z.P12fifP4.Qfm-.Eur '- - K "wp, 'T-1:1' 'Fa J ' .1 ' . .1 11-- ' 1 - 1 17:1 A. . 'WG f' 533,111 run N'3v.......- vm.. .5 1- - . 1- A LV s ,mwf fgfifi .1 9311- .gig 2+ H A 1 " 2" I-' 1 1 XA 1 1 f".'lI. li." ff- -. ' 15" . 1 5 11-111-11. . f 1 1 1 1 - af . .3 11g3.:.1z.,,. ..--:11 Q-.L gfgg-.Q-. 1-2112fsifgqgiggggsgigfg-5 1 1 , . . A. 1 1 -1 - ' 1. PMMH M WWW 1"H" ""W'.19".1 315 11-1 .1 .. . . M.A-..A...1 1-.. 1...-. V 4,..A gag, ... W- f-S+ 2 -.ji-f?.v""1 'SEM' ax-'igw , ,wgfvr A r-,ex ...-1 -:fr + RACK C .,- , V A V - 1 , 1, . 1 if :gl.--.in-11-'15-,.Q:-.QV,nl , -f :R 4 i . A A . - . ' . . ' . - -- .f"-.-'--:LI-r 't7":.:L,.':'11:i-f"'f'' " I , - . ' ' ' ' . - ' gf - ' ' - . " - 1 7' 1:4-c-g--.-2.11-23'3f,ggi:-:Q-2.11-eq... 11:4 'f'-'Q -'-. . - , -- -- 1 1' - . . ' ' V . " 1' 1 W-EQ'-2'ff.- fif-nzga:'::t-1-s .-:f:..1ff1f - ' . " ' . 1 ' A ' , gi ' . . ' 1- .. .-.-J-:....,,,.g -H' -5 a- - JF - .. Qiggg -1ggg-,f:,2:-g,:--.- - -Q , . , , -. -.. ,- . 1 , . 1 . , 1 - A .- - .. ..'.:L1 - 11,--f.......-..f1..ff1f-111-A --1.1-1-. .1 . . .- A 1. 11' . f . 11 -ff f: .-.:'f'- fi 'ii-2-21:-.--.rxSf1-xx-a.'- - ' - . '--M-A--'. .. 'e1,.::.1--.:-fga..-:-1--1--1. . 1-1- M-T " ' .1-.-13 -- .- --r A- -- --,Y A , . : ' ' - ,Q - ' . . 3 -b ' 1j-.,','- ' rig- -.1--1... -141, ---,ff -. fv.. '- 7,':yr1.-Q.,-1. I Vx MERITORIOUS U IT C0 At the conclusion of a de loyment, it is time to hand out awards, kudos, Bravo Zuliis and pats onthe backs. With- out a doubt, the men of the Enterprise!Carrier Air Wing Eleven team are in line for their share of recognition for jobs well done in a highly successful deployment. U Battle Group Foxtrot received a Seventh Fleet Unit Letter of Commendation, the "Big E"!CVW-I1 team was nominated for a Meritorious Unit Commendation and Enterprise was a strong contender for the Battle "E" on the strength of our consistently outstanding perfor- mance. As the Enterprise neared the end of its cruise, the Commanding Officer, CAPT Robert L. Leuschner lr., had a message for the crew: ' . "You are about to conclude one of the most successful Eeacetime cruises an aircraft carrier and battle., group ave ever made. Because of our superb achievements during this deployment, you have been commended by every level of command within the United States Pacific Fleet and each of you will become eligible to wear the Meritorious Unit Commendation ribbon when that pres- tigious award is approved. You should feel very proud o what you have accomplished as part of the ENTER- PRISE-Air Wing 11-Battle Group FOXTROT team, no matter what your job has been this cruise. As you make your plans to return home to your families over the olidays, I encourage you not to forget that you are a representative of the United States Navy and a part of the -most powerful peacekeeping team that has gone to sea ln many Leafs. You are a professional Navy man! You are one of t e elite! Take pride in that!" ll! ll! ll! Il! Il! Ik ill ill ll! lk Ill Il Ill On 8 january 1985, Enterprise received a message that VADM l.R. Hogg, Commander Seventh Fleet, had signed ua Seventh Fleet Unit Letter of Commendation recognizing Battle Group Foxtrot's performance during the deployment to Seventh Fleet. VADM Hogg noted that the award "recognizes the sustained superior performance andexceptlonal dedica- tion to duty demonstrated by Battle Group Foxtrot. Through teamwork, professionalism and dedication to excellence, Battle Group Foxtrot has more than suc- ceeded in successfully accomplishing our Seventh Fleet mission and the attainment of vital national objectives in the Western Pacific and Indian Oceans. Well Done!" Battle Group Foxtrot received a message from VADM Hogg when it departed Seventh Fleet on 5 December 1984. The Seventh Fleet Commander said then: "I salute each- individual for his superlative performance and dedi- cation to duty during a very arduous deployment. The strong determination displayed by all to achieve and maintain a high state of material and operational readi- ness is a standard by which future deploying battle groups will be measured. Since your arrival, you have continuousl distinguished yourself in all facets of war fighting both in the I.O. by your most impressive Anti- Air Warfare and Anti-Submarine Warfare erformance, and by your very aggressive Anti-Air Warfare and Anti- Surface Warfare performance during FLEETEX. Each in- dividual on board every ship can be justifiably proud of the contribution they have made in supporting our na- tional objectives. Your performance throughout your entire Seventh Fleet deployment has been absolutely outstanding, and I note that this is the fourth commenda- tory message that I have sent to ENTERPRISE Battle Group during your deployment. All have been well earned, and t e achievements which they recognize set you apart from others as an exceptionally fine battle gnmup and team. Please extend my personal well done to a ll 'll Ill Il! ll! lk Ik Ill lk lk Ill lk ll lk x ........,..-- ,gff I 5 I E 4. I 1' i ll r I 0 Q3 IJ A 5 5... 'l It 'fi I, 1 ,- l 6 5 , ., ,..,,, . , Vddxirz I o w 11851:-rr l ' J 'W . I V x Y, 1 5 i 5 f ne 4. it F- ' u A a..1L,. fa 1-Arm I . .M A 33553 -.:...9Z,' -. , E E 'J Nr. .,f . . I 3 .ff -- '.-'Fw . T-rv . :??,- f-,- M- -3.14: ,M EE? COMMANDER CARRIER GROUP THREE, Uctober 1982 - 25 june 1984 emf Admim! dwin R. Kohn 14, U.S. aw Anative ofSmethport, Pa., Rear Admiral E.R. "Rudy" Kohn graduated from Pennsylvania State University and was commissioned an Ensign in january 1955. He attended flight training and was designated a Naval Aviator in june 1956. His first assignment as an aviator was with Attack Squadron NINE FIVE flying Douglass Skyraiders aboard USS TICONDEROGA. After a tour in the Advanced Flight Training Command, Rear Admiral Kohn served as Assistant Combat Information Center Officer and Assistant Operations Officer on the aircraft carrier USS HANCOCK during 1964-65. He served with Attack Squadron FIVE FIVE in 1966 and 1967, aboard USS RANGER and USS CONSTELLATION with combat cruises off Vietnam. His next assignment was in the Corsair II Replace- ment Air Wing Attack Squadron 122, Naval Air Station Lemoore, Calif., as Operations Officer. Rear Admiral Kohn was Executive Officer and then Commanding Officer of Attack Squadron NINE THREE in 1970 and 1971 with Vietnam combat deployments aboard USS RANGER and USS MID- WAY. He then attended the Naval War College in Newport, R.I. After War College he commanded Attack Carrier Airwing ONE aboard USS IOHN F. KENNEDY. Upon completion of his tour as Air Wing Commander, he served in the Bureau of Naval Personnel, first as head Air Combat Placement Branch and then as Executive Assistant to the Assistant Chief of Naval Personnel for Officer Deployment and Distribution. Rear Admiral Kohn commanded the replenishment oiler USS KALAMAZOO from August 1976 until December 1977. He assumed command of the aircraft carrier USS FORRESTAL in March 1979. In September 1980 Rear Admiral Kohn became the Chief, Current Operations Division, Commander in Chief Pacific. In Iuly 1981 he assumed the duty as Director, Logistics-Security Assistance Directo- rate also on the staff of the Commander in Chief Pacific. Rear Admiral Kohn was assigned as Commander Carrier Group THREE in October 1982. Rear Admiral Kohn has been awarded the Legion of Merit, Defense Superior Service Medal, the Distinguished Flying Cross, the Bronze Star, two individual Air Medals, thirty Strike!Flight Air Medals for over 300 missions in Vietnam, the Navy Commendation and Achievement Medals with Combat "V", three Navy Unit Commendations, the Vietnam Government Gallantry Cross, and the Vietnam Service Medal with nine campaign stars. Rear Admiral Kohn and his wife Marilyn have four children: jenni- fer, Peter, Thomas and Edwin. -A-'vk..'1f':l.':'1 " COMCARCRU 3f 141 .275-i 313.2 , :'11:4'I' , H H H 1 1 5 li lu 5 vi W , 1 VH 1 1'1 N l I Q4 z X l 1 '1 1 i ri? 'E l 4 N 1, 14 ' ll: . M W N W N Wm -VM 142 f COMCARCRU 3 :1-zQewJ,cc4-iQss,:-i::.u-f4:--:Q-' :fc:,.5-:sf-lv52'-L.:-11-Y-:.:f::XS:-'span:gb fg,:.:1.1- :Q -rx -: xg,,--.34-.gp,.g.ff:4uq: f.5-:p',v- -23.45-wx vgavgr-is rbggfyz,-Ls: 1,-,pf+16.:-gv.,-,.g-J-:Lv1,, whgrg.--'lf - - : - r-1 " ft,-.-L.,-,M-.,1.g.-,, .-:,-A 3. 5,-,J -v 1: k , . , ew?-mx.- - ,.,..,,. - -....-lf: Lf .-N., -N .,-22-N-93-1.1:--, f--.-.QL-41-.sew -Q-, :-..-A---: va1-N-...- ..-- --w -if ,f:,.,v...-N -vffg-.. ,.,4.'-5:--.nfqzv 'D .0-W, -QMQ4. ,,w,g.wfX..1-,,f--no-., . J 1- .rv -P g . A J. WQJM:-,-, --.,-,f .1 : - -- QT- ,H-.-, -1 -, 4 , "'5N1"'. -Efrfmwf ' 2-J-F111-'-.avi-,4:4.1'f13,t:,:f-:La-'far-1Q:51.11---:Q-:-xg.faggx-wi.:-K 'x.::,:'hi::f,m-Qiqf,L:5-,-,Lin--,3:g,Q,.:-z:Q'f-X--ak.. 'J 14-Giwrv 'age-.fflvfx 'Af' f ' , ...rqg .1s,1b-2,1-','1-yrisis!--"-1-11' 1-A '21 -Ufxh 1 5,1w,3g:'5f',r,Mi--1n.k.- gk? ..x.f,1Q,.,Q,..::1-av.5,.-vt, :JS QQ-ff .wwf-,.,1,,3,x,:,,,5:55,,ggQ2'aE.--a:sa11e5ga4:m'Q..- Lag-has-f,.,x2..,4:.,-a-d:.,.,., ,Y A- .. .M-..f..f.,,,,.,.,,l-T,,,1,U.,:: ,. -. .. V .-P -".f,:PEI?i25'3IL. 'lf .x-1-'li i :- -:'i1'i?,i'Z:? E' Q-453. 522 J'-:S Q 17 F. ?- ri :'73:'?-ii: 511'L2'I1'F'L?J4f:" -31fgv,':v-"xa'. ii 5' 2171 igf- vi' :Z Y ' :ii :EL ':': .iff-'izi 4- -T 5 COMMANDER CARRIER GROUP THREE, 25 june 1984-Present, mr Aclmim! ohm R. Batzler, U.S. Navy Rear Admiral john Richard Batzler, son of Mr. and Mrs. William E. Batzler, was born in Battle Creek, Michigan, December 9, 1932. A raduate of Lajolla High School, Lajolla, California, he also attended ghe University of California at Berkeley, receiving a Bachelor of Arts degree in Mathematics. Commissioned an Ensign in the U.S. Navy in june of 1955, RADM Batzler reported for flight training in Pensacola, Florida, and received his wings in january 1957. As a photo reconnaissance pilotwith VFP-63, he completed deployments to the Western Pacific aboard USS BON HOMME RICHARD CCVA 311 and USS ORISKANY CCVA 341. During his first tour of shore duty, RADM Batzler served for one year at the U.S. Naval Academy as a mathematics instructor and three years at the Naval Air Test Center, Patuxent River, Maryland, as a graduate Navy Test Pilot and Project Pilot in the Weapon Systems Test Division. Reporting to Fighter Squadron 31 in November 1965, he served as Maintenance and then Operations Officer during one and one-half deployments to the Mediterranean aboard USS SARATOGA CCVA 601. Awest coast tour with Fighter Squadron 96 followed, where RADM Batzler served as the squadron's Operations Officer while completing his first combat tour to Southeast Asia in USS ENTERPRISE fCVAN 651. U.S. Naval Postgraduate school followed, culminating in a Master's Degree in Computer Systems Management in 1969. In 1970 he reported to Fi hter Squadron 24 as Executive Officer and became Commanding Officer in july 1971. With the "Flying Red Checkertails" RADM Batzler made two com- bat deployments to Southeast Asia in USS HANCOCK CCVA 191. Following one full year of nuclear propulsion en ineering training in june 1973, RADM Batzler served a short tour on tie staff of Comman- der Naval Air Forces Pacific Fleet. He then reported to USS ENTER- PRISE ICVAN 651 as Executive Officer in january 1975. During this tour, the ship conducted Indian Ocean operations and was a major supporting force in the evacuation of Saigon. Selected for major command at sea in 1976, RADM Batzler took over the Pearl Harbor based USS ASHTABULA CAO 511 in january 1977, completing that tour in August 1978. In February 1979, RADM Batzler became Commanding Officer of USS NIMITZ QCVN 681. Dur- ing this tour USS NIMITZ made two Mediterranean deployments, one to the North Atlantic, and a record setting 144 continuous days at sea in the indian Ocean. The highlight of RADM Batzler's tour was the shooting down of two Libyan SU-17 Fitter aircraft by NIMITZ-based VF-41 Tomcats. He was selected for Flag rank in February 1981 after having completed two of his three years as skipper of NIMITZ. On February 24, 1982, the then Captain Batzler was relieved as Comman- ding Officer, USS NIMITZ, in a ceremony at which the CNO, then Admiral Thomas B. Hayward, gave a major address on U.S. Naval Aircraft Carriers. Upon his promotion to Flag rank, he was assigned to the Organization of the joint Chiefs of Staff as the Deput Director for Operations iReconnaissance, Space, Electronic Wargzre, and C3 Countermeasures1 where he is currently serving. ln RADM Batzler's flying career he has flown more than 50 different Navy aircraft, including fighters from the F9F Panther and Cougar thru the current F-14 Tomcat. His combat experience includes more than 270 missions in Viet Nam. RADM Batzler's awards include the Legion of Merit, Distinguished Flying Cross, Bronze Star, numerous Air Med- als, Navy Commendation and various service and campai n ribbons for participation in the Viet Nam Conflict. He is a memier of the Society of Experimental Test Pi lots, the Association of Naval Aviation, the U.S. Hang Glider Association, and the Cousteau Society. RADM Batzler is married to the former Carolyn Wright of Exeter, Clalifornia. They have three children, Michael, Karen, and Gregory S ane. COMCARCJRU 3 ! 143 SVI X E HEIDEIVD Z IUPJD 'TO DLL1 QUMH 'l'd DIN 5U!33!H 'V'D 11 SVWCI 'W"I .l'I Y7I3!ZnH 'W'H H031 IYLI9ld 'Nl 11 Sn'-IUBX 'M'l HCD1 rw' ,Lf '4v0MS5U!ll0H 'v 21031 A 1 5 K!f ! 4-an , ,......J ff"' ' Z E555 f --1 f 1, f 'HF IIYH 'ITS H031 U939H 'Tl H031 I-I3!J9'-P99 "I H031 PI9!J5UH 'H UCD1 'MT Vw Vw TT I1 V2 ,fw W-w I i LJ 1 i Q ef X 5 i Q! i f y + 1 1 .5 xx Nw, X l 1 1 1 x 3 I X , I 3 5 1 N V, X Y 4 1 ,-1 1 I 1 n X N' u 1 7 f' ,A J I i 3 V ff Nj in I H l i ff Elini pq 4 l L' ' .....An,..-, -,WM ,' ..,,,,f I 4 fm , W W T7 ,fy ,ffw 1 1 ,f g X , :X K N. ji, Q iL.1 1if 1?Vm'!L, l Va 2 gag 1 L 'ww 1 m 3 ' 4 L fq 2 X, xr f 5 4 4r'1 fz54mwf,fmM 3 R ,xvy ', K .VN-E i H n J, X AV I , J . K .E -1.-ash I 1, J X! UOWE 'N'd UCD f 5 y K 5 ,, Kalnvvw 'v'l mvo m f 5 -uma "Il-'OM-'91-W8 'M UCD '43 wus 'fo lava N Gi' .. ' 1 T' mb. , , 2 , A ,,, ,U ,ML ,,,,,,., , 1.1:-,-,,., - ,. 1 ,f 1 . - -' - Q 6-1 - :ser 'Z-'P-'f'+?'-F1 1 A , ff- ,, -..L-Q-2--.-.1-1-3,-,-1 :4.1f.-fk. r- .-',.- . -,.1,. ..1. ' 1 -- - A h --was-fs-ww--v-Q l 'ua1p1gLp aa1q1 J!9l1l1 'M ,e,u,g,,A 'Lpeag e1u1811A ug sap1sa1 A11ua11n0 0qM u1su00s1M Hgbedne 15 AWQM Mew 1au1101 aq1 O1 p9!JJI?LLI sg 1aze11 U!E1dED 'SUOQQQJ aagfuas pue LIg!I?dUJED SHOQJEA 1eaM O1 P9211 -owne S, pug Iepaw 1uau1aAa1q3V AAEN Sql 'slepaw u011epua1uLu03 MW Om qpaw 10 u0gSa'1 aql pap1eMe uaaq seq 1aze1:1 U!E1dE'3 '17951 1sn'BnV ug 3331.11 dn01g 1a111e3 ,lapuewwog O1 11915 10 1a1q3 se 1U3LLIU8!SSE 1ua11n3 sgq O1 8u1110da1 Olloud 11.1313 dn013 JSQJJEQ 'JBQUBLLIUJOD 101 JGDQHQ sueld se pafuas 191112114 'Z96l lvdv 01 0961 ludv LU011 1990 1,111 A212119 '9 QVIVNOG Sm 10 PUELULUOD ug paA1as JSZEJJ U!91dEj puelsq apoqg 110dMaN 19331103 19M IBAQN aq1 10 A11n0e:1 aq1 10 J9qllJ9U..I 9 se 1n01 9 Bug -1101101 '1a314JO 9A!1n39X3 59 C998 GCD EINOD SSH 01'5!9PJ0 P9A!939J pug 1,151 A1en1qa:1 ug BSJSSQ Su11aau1Bu3 1e31113a13 10 s1a1seW e paA1a9a1 aq a1aqM e1u10111e3 'A9J91UOW 1001135 a1enpe131s0d 1eAeN 9q1'papua11e uaql 192913 U!91d'?3 'CS6 Dc!! EDNVHEICJ SSH P9PU'3U! JJVLS :IO :HIHJ I 1717! -11.103 A11eu0111ppe aq 'p011ad s1q18u11nQ 'A11211 'sa1deN ug pa110dau10q pure ueaue11a11paW aq101paA01dap p1eM101s1e0qun3 1011ed 101s1su0a 01 LZ uogsgfxpq 1o11ed LLIJO1 O1 pa13a1as sew! aq 'OLGL 1aq1ua1da5 UI 'su011e1adQ IQAQN 10 1a1q3 aq110 111215, aq1 uo dn013 Apmg SLIO!1 '9J9dO SL!! 01 P9U'3!5SP f!gl9!Jq UGU1 SPM SH 'H76 Od! SVIVHEI!-D SSH 10 1a31110 SUQQUELULUOD uguogssguuuuoo aq1seM 1aze11 u1e1de3 'ZOZ uogsgfxgq 1aA011sag '1apueLuLu031011e1g aq1u0 pue 4959 QQ, 11333 'd 5511212911-13 5511 ug s1uaLuu81sse pure 100095 1aA011saC1 801111101101 'fl LL 0011N11210 'v 1611001 S50 01P9U3!9SE SPM PUB E961 aunt U1 H318 -ug ue pauogssguuwoa sem 1aze11 U!E1dEfj 'looqag a1ep1pue3 1a:J111Q Sugpuane pue aa18ap 8u11aau13u3 1e:11113a1310 JOISLIJPQ 12 q1gM u011en -pe18 8u1M01101 'qd3g3N1we1S01d u011e3np3 :J1111ua10g pa1s11u3 IEABN a11110 saagdsne 1apun 'u1su03s1M 'aaxlnemlgw 'A11s1aA1uf1 a11anb1eW papua11e J9ZEJj u1e1dra3 'uepguqaal s31u0110a13 ue se Q 1 ZQ QQQ NQJ-S 'NHOISSH U! SUVUSS 191W '9S6l fU9!'Uq9:! U! MPN 'ST1 GU1 U! P915!I -ua 1aze1:1 u1e1de3 'A1!S.!9A!Un asnoemg papua11e pue 1001105 1e11ua3 OBUEUSDQLID LUOJ1 pa1enpe18 aq a1aqM 21101 MaN 1e11ua310 9A!1E'U V 1112191151 'CI ZYWJ U.W1d77D HHHHJQ 21110219 21112121119 111115 10 111119 A ,..-.-- --' X . , ,. A .,1-,-,-11. . - .1 . V -1-- --Y an J 746 ! CARCRU 3 RMCM D. McCormick MSC Blas MJ H1-Bm' SKC E.L. Dauz YN1 l.R. Cain x Y gi RM1 W.E. Michel .-1 Dinah.- SKCM Bitanga Msc r.o.c. soria ,' If OSC M.D. Miller QEHI1. RM1 R. Calhoun 2 f! Q n RM1 I.L. Palmer 1' M41 ,4 ,lg EWCS M.L. Sellers mmf 05C CSWJ G.S. Cannon PN1 N.F. Breault I Y .1 IS1 EF. Lanham V MS1 A.B. Sales f W1 ,zz 3-1 " n'C YN1 F.A. Simon 'J Sl O52 Q. Cortes BM2 R.S. Prindle MS3 T.l. Cowan IQ. 2 M53 G.S. Reynolds A YNSN H. Delgado 1 , ,J Q Wi M SBS MS1 l.D. Soliven img 1 if 52 RM2 l.D. King 'm',,fWi QM2 M.A. Romero lg ,.fL5f', I ' vu YN3 E. Edmondson M53 LA. Thomas SN A. EI ' Silva ,mmf YN2 0.5. Boyd Wim? K. JA EW2 R. Patton 2 :A RM2 D.D. Whitmyer QQ, , is O53 R.G. Meyers RMSN Deas 7 .Q ,J MSSN R.W. Williams ,fum fff , --f- fm' V v-f ------ --e ,--- ,,--N., , , , , 1 1 fr ' f a 1 1 W-, ' f-V, 1 ,..., 1 ' f' - " I x N 3 1 N ' N ,f ,X ', 1 Q ' 3 1 4 1 ' 5' f' W f l..l , fl lx 3 l J 1 -4 3 I P 3 1 1 3 1-J I Q 1 WF I N I Ji, f 1 Ky' j Q 1 1 ' ff' ,1 1 1 X Y M ' M TWT n e f i n 1 L, -. 1 -N , X FN. , ' L, ' fm - 1 ' ' 2 Ti f' E 4 Y M 2 Q T j 3 N S A n l fm, Y f 'X 2 2 3 X E l 1 a i N, J 2 l it 1 , 1 1 , H 1 ' 1 x ' 'V' xxnj bi L...' L..4 w,..- ix-J x..l g.J l....g xx.-,f XJ af.:-.gifg .Lf .. no 213 .,sg:,,: -'Tv .Erik .-2 4 51: COMMANDING OFFICER CVN-65 Cazpmin aber! L. Leuschner, rf., U.S. Navy A native of Waco, Texas where he was born in 1935, Captain R.L. "Skip" Leuschner, jr. attended secondary school in San Diego, Cali- fornia and entered Rice University in Houston, Texas in 1953. He earned his Bachelor's degree in Chemical Engineering in 1957, receiv- ing his commission as an Ensign through the NROTC program. Captain Leuschner entered flight training in September 1957 and was designated a Naval aviator at Corpus Christi, Texas, in December 1958. Early in 1959, he reported to Fighter Squadron ONE FOUR FOUR at NAS Miramar, California, which later became Attack Squad- ron FIVE TWO. There he served a four-year tour flying the propeller- driven A-1 Skyraider. This tour ofduty took him to the Western Pacific in USS TICONDEROGA KCVA 141 and to South America in USS LEXINGTON lnow AVT 161. From Attack Squadron FIVE TWO, Cap- tain Leuschner became a student at the U.S. Naval Test Pilot School at Patuxent River, Maryland, in 1963, followed by a two-year tour as a test pilot and project officer in the center's Flight Test Division. Transitioning to the A-4 Skyhawk at NAS Lemoore, California, in 1966, Captain Leuschner deployed to Southeast Asia in 1967 in USS INTREPID CCVS 111, serving as squadron Safety and Weapons Officer. He later transitioned to the A-7B Corsair II at NAS Lemoore, and deployed to Southeast Asia in 1969 with Attack Squadron TWO ONE FIVE embarked in USS ENTERPRISE CCVN 651. From 1969 until 1972, he was assigned to the A-7B readiness squadron, Attack Squadron ONE TWO FIVE, at NAS Lemoore, serving as Weapons Officer, Aircraft Maintenance Officer and Operations Officer. During this period, he was awarded the Navy Achievement Medal for establishing the Pacific Fleet Light Weapons School CLAWS1 for postgraduate level air-to-ground weapons training. From 1972 to 1974, Captain Leuschner served as Executive Officer and Commanding Officer of Attack Squadron ONE FIVE FIVE, the "Silver Foxes," flying the A-7B Corsair II from the deck of the USS ORISKANY lCVA 341 during this third and fourth Southeast Asia deployments. In 1974, he attended the College of Naval Warfare at the Naval War College, Newport, Rhode Island. Captain Leuschner was selected for nuclear power training in 1975 and completed the curriculum early in 1977. He reported to USS NIMITZ CCVN 681 in june 1977 to relieve as Operations Officer. The following year, he became NlMITZ's third Executive Officer, where he served until july 1979. Following a short tour of shore duty on the staff of the Commander Tactical Wings, U.S. Atlantic Fleet, Captain Leuschner assumed com- mand ofthe combat stores ship, USS SAN DIEGO CAFS 61, in cere- monies in Haifa, Israel in july 1980. This 21-month tour included two deployments to the Mediterranean Sea, providing logistics support to the ships and personnel of the United States SIXTH Fleet. In March 1982, he reported to the staff ofthe Commander, Naval Air Force, U.S. Atlantic Fleet, where he directed a variety of special projects to improve the combat readiness and material condition ofthe United States SIXTH Fleet aircraft carriers. Captain Leuschner assumed command of USS ENTERPRISE CCVN 651 on june 17, 1983. Captain Leuschner's individual awards include the Legion of Merit, Meritorious Service Medal, Air Medal l28 awards1, Navy Commenda- tion Medal with Gold Star and Combat "V", Navy Achievement Medal, Navy Unit Commendation Medal, joint Services Commenda- tion Medal and various theater and cam aign ribbons. Captain Leuschner has been selected fdr promotion to the rank of Commodore. He is married to the former Carlene Holwerda of Grand Rapids, Michigan. Captain and Mrs. Leuschner reside with their three chil- dren, Robert III, Carl Alan and Staciann in Alameda, California. COMMANDING OFFICER! 149 y , . . ?Ex -ggi:.1 pkrgri .1-mf: 'il-E25 , .-Q, , 5-122221-Q 5?i'?f5EE4 Quiz :J-far EXECUTIVE UEFICER CVN-65 Cczpmin oyeph j. Dantone, 14, U.S. Navy Captain Dantone was born in Baltimore, Md. Upon graduating from the U.S. Naval Academy in 1964 with a BacheIor's Degree in Electrical Science, he was commissioned an Ensign and entered flight training in july 1964. He was designated a Naval aviator in September 1965. In May 1966, Captain Dantone was assigned to Fighter Squadron EIGHTY FOUR flying F-4 Phantoms. During this tour he made an extended Mediterranean deployment on board USS INDEPENDENCE CCV 621. In March 1967, he was assigned to Fighter Squadron ONE SIX ONE. During this tour he made two Western Pacific deployments on board the USS CORAL SEA KCVA 431. In August of 1969, he reported to U.S. Naval Postgraduate School in Monterey, Calif., where he earned a Master's Degree in Aeronautical Engineering CAeE1 and Material Management. In june 1973, Captain Dantone was assigned to Fighter Squadron ONE as the Maintenance and Operations Officer flying F-14 Tomcats. During this tour the squadron made an extended Western Pacific deployment on board USS ENTERPRISE CCVN 651. In May 1976, Captain Dantone reported to Commander Naval Air Systems Command as F-14 Program Assistant Deputy for Training. Returning to the Fleet in August 1977, Captain Dantone became Executive Officer of Fighter Squadron FOURTEEN flying F-14s from USS IOHN F. KENNEDY ICV 671 and later became Commanding Officer in july 1979. After his command tour, he served as the Fighter Training Officer for Commander Naval Air Forces, U.S. Atlantic Fleet which was followed by a year and a half of nuclear power training. Captain Dantone reported to USS ENTERPRISE CCVN 651 in january 1983 as Executive Officer. Captain Dantone's decorations include the Meritorious Service Medal, Air Medal Csix awards1, Navy Commendation, Vietnam Service Medal, National Defense Medal and Republic of Vietnam Armed forces Meritorious Unit Citation CGalIantry Cross1. He is married to the former Maria E. Szolnoky of Buffalo, N.Y. They have two children, a son, jay, and a daughter, Marne. His family currently resides in Alameda, Calif. rkffs, ..-4"' EXECUTIVE OFFICER! 151 Y XM . ,ZLL 4.1, -' f..,7,-.,,',Q,f:15.,-f.f:::w.,,q:.-,-5.53,cz.. V' ff' - '-A -- xg: - . - -4: :-51.f..,-.- :gpg-.Af Q--.-f-Y N QQ- ----V-1 gms--,Q .w , -4W,:.a4,gLfg,gp.:- ' 'F' ' 'ff' --F. - ,-,..g,-,:...,-.a.. ,..............,a...-:-.yx f V ' -' .,,,.-.,,, ,Ni - V . iv:-l 'M' -x ' 'gjfiigfi-WC: L- v::1g5fi':'- 1 . '.'f.7Y-,:-'Af - A Q6 753 ,.-f , -L 41 .Q w ,g?aS::5fe9f. - .. ,'rv'fv1e2',.,g:1:f fiM.1,5.L:f5,::-v',' 4, ,T-,Q 'J"iQi21L's,a2-4'C-ffF3'I'r:Ts"Pfg2f': 52275, WA ,- .cw-, vffv x-,.:..f . 1-1 ,.-,pm 2, rvfc-1'wm" 'fi' dew, warm JFK-'-:Af , nw.-ini" . ,mf .,Q,f,.f .L,fag...,vwf,,.,.--ak ,Q mm gm ,Vf , ,1 f, xfzkfgw z.,-vi, X:-"finA1-wen'--7w:.u,,gLwA ' 1. - lf ' 'ff-at f M-,,-f W, 115,55 L,,.,,g 1' ..,ff.:,,-w7-'7'-- , V ., ,, ' 'fyf-mvpv .u.:1f-...111,.- . qyzb. 'ae' ,tamp- .,w-:4fwffsaW:f-n,, wwf: ,- ,en L .. 'W-1.,.-,r-Q,,.wmW,ff ww-,1.,,.g, , ' - ' ,+.,, fl- Q11 , - ' tg 211:ggi,-fmfQ.?'f1-,2qA:fe1j,7e'f.,,.,-, igiw-223 ,.,,4f..M,, 1f,,3f.1,wf.,,M,,,--,f,,,.A1,W ,,,...W,3,-f,,.,,,,. ,, L - My 3faeg,ff:,m1f2::Q.ag,sagw2:Wef,q. L-r f-HN-.flffifw f -waz.-K J- 135, 4 fg,Ngg,,1,,1,5,gf .g- "wi"f'"ygawgfiff.,y3i,4,,z:53,,f+ef+23,51131 QZxA?'52'1.,,j1 1,51 ,-111' V-fi., fsQ,xgyq-1sw,,f Q5,uf1,45,.g::,'P,L.k.-1-'L-dag'-1-'-'F .:,f,., 37 ,vw -1' " Maw -1:.f-g:24v1z5,f.M2f4, 5,4 M1321 fin ff-xl?"AL-ww Qjcmffvf,.+fff5f?mi',':.'cf",:.sQ.r,- - fm- Q Q1fQ1:'fa,,'-aw Q:fefi2,e3-fy f, ,f 1 1 "ie--'..Z5m?.'i:w1f- 1 N ,s,fq,w ',,,L:71.f gf: x in .wp1I,:gg,:.sAg,-43m,fQgg:g,w:Qf:gtg-,f fff 5gfr,ff:g:,,..,,1 V .- 2:we-W-frgggpwzines.: my-Q-w2,fg. ,gggl-verge? .f ,f q,s,f.g,,,3,,' 51.14. N149 -" 'fi .-'ig-fwmiqfa Lffmggrfew--ffe'2-'W-5gf',.f4'r'tL j1z1.f.q,f xii., ,:,f,r"-A M:z,.y, -, ,1,:.L4,.f-,,:1-, gfv-'vw' 1ffzggfzivmfqg--iffy'VL,-wi2 "I 1"fi1."Q.f,s,, 4- ' 5?42'efa'.,+2'f2:fQ2:wf - J" in ' ifgtw 'MI-f1,fi'Tg'.wl.2'i, ,537 11:-,,u4Le.,.f.f, gmliwz, ,. ,wa-,hi ::f,.v:f"3f1 f VW? 5j::'a1,- ' -34 ,f f -1 f,,,,vJ,,,..,,,,,, ,.,,M.. . ,, , , M 'A wr-M A --M-f f-'ff -4 .- I 1 ffff-J 3.51. vi ., L,,5gf,1,.,'p-H34.cc,f5j'.Q 454-:A -fj,. .- ,Axrj'.-fx-5,::Q:.,.gf:f,f'-J'-e' ',z.-'nryfrv ,. , V, ,, .,.,..,,, , . ,,,, ,,,, fa. .-fffwfmf-fm.ff .-wm.A-yfffffvffffwms,-1--wf-,.-,-,.,.,.faf.,y-.A.,:f.,-A ,gmf-,-'-,QA ,Q .Wg , ,Q -fLp4:f.f,:f-1,A,:,,,m,-' fanny rg V-f-5 f,.g,vv,'.,:g1:gff7, Qxj, . V: ,, .rw 2435 :f,11-g-wwz -A .K-,.fg1,1:,f f 1-X1f.2zw:e':z,fwfmu.:-1'f f . 1'--,-mfg, fu- ' , .,ffw:.ef:J f,,,-fi "H ',,:'g2.:g.'f'f1r'f 5 Tzkfiffffflif WI i:11a:,?Ef5P31 ,Jail 5:31 Q LF- 1653 1 xr iQ:Qf3- 4, viii, fzqxfpfg,-:bei -wg q4:y,g,.,g:gQ: ,wx .L-af M.N-2 :.,.f , 'fLQ:1:f:'-.,,ri1'ny"fEi5f5Mffq,',i.5'gZ3Q new,awgbgfgyf-12fCp:Q-113121233.,3z'f-ff?:.,'yy"- V " 62 mi L',5g'mmg1f-ff,,far,g9J5 fw5x:,.,.15'j,v."?-gg.-:,f1'11p ',-,, X15- mfsf.,.,sw:fp,wf"zx,1-fwfr : i- 1'-fs-:sff:1:f'fe ghwvf. figezieiff.i,i'1f??.'f4:.g?+r"51f"2'f' " - " ' 121-5 ,I f . ' ' .. 1e?Zii1f!L'i57rZE'55B2",-35213721 F -.. 2'LSf,,.-,,.,.,. .. I aff-+ ,Va-ff Qffzfw. ,- A 1.1 .5149 -:fpvav- Luz' ,11,f:42-:-4-- -we-29.-"J 1.11 4 -'--ff - 9? f ' 'Y ' "S"-2""E15-V-Sf" ""g.4'U SPL-H-.aff ' -' '?-f4S'g'- 971:31 : - V dv-fi-'fwi,4?i',"1fg''af'-,fre-f-Q-f-4 "H-Y2.:'.:?Q4 'f-J Q .-- W "' 'X-Lc"'l if 9ZrWvI 1 'X' Jn- 1.7 W A XA-YW 3-f 12-,,...xz' 4' ,774 'f ww 'f 1. .K 1 ?i'ESf??9fi,fj5i-a ' xt L -y ... ..,., M.,-4 Q3'f?:ar?i'-rr. wsu: xx . .-,.,- QSEBQ-'Kg-::::bg. A --f N -1+5.w-'N f 5 xfflizg-:v :ESZSY-"-FQFZSP ..- f .-,,.,- W- E-"-M wk 1 , s. , ',..-, we.- ' 3:-, .-, -. - ...AMN The Air Department is comprised of 450 officers and men. Thig cruise was unique for the Enterprise Air Department in that it perfected and implemented an entirely new mode of aircraft carrier operation, "Battle Flex Deck" or "BFD." Along with the men of Carrier Air Wing Eleven, the five divisions of the department took the rough plan for BFD and turned it into the most innovative plan for aircraft carrier operations yet deviggd- Divisional responsibilities are as follows: The V-1 Division is responsible for the operation of the Flight Deck, Crash and Salvage crews, operation of all support vehicle and operation of the four deck edge aircraft elevators. All S movement of aircraft on the flight deck is under the supervision of this division. The men of V-1 wear yellow, red and blue jerseys. The V-2 Division is responsible for the operation and maintenance of four C-13 steam catapults, five MK-7 arresting engines and all associated equipment. Personnel assigned to V-2 wear green jerseys. The V-3 Division is responsible for the movement of aircraft on the hangar deck and the lower operation stations of the four deck edge aircraft elevators. The Hangar Deck crews also wear yellow and blue jerseys. The V-4 Division is responsible for the operation and maintenance of the Aviation Fuel System. This system has a capacity of 2.2 million gallons of fuel and utilizes numerous pumps, filters and miles of distribution piping. ln addition, they provide crews on the flight deck to fuel aircraft. The fueling crews wear purple jerseys. The V-5 Division is comprised of personnel who are assigned to Primary Flight Control and the departmental office. Tower personnel assist the Air Officer in the control of aircraft in the VFR pattern and on deck. Administrative personnel handle all official correspondence, record-keeping and personnel requirements. Tower personnel also wear blue jerseys. ir ,v,1,.,,M,, ..,,,..,.A-.. f,.,.,,,.,,,.,,...- , T N. N. .mm j CDR G.A. Baland LCDR A.C. Hansen X ,.: :JI ABHC C.B. Wishom ul ABH1 l.M. Murella ABH2 R. Bartolome 158!V-1 tranny ' I , 3, ABH2 A. Lastrella 'uh.' will ' Ll v ABH3 W-I. Henne AR B.D. Benson LT l.P. McAIiIey I-tau.:-uf1 ABH1 M.R. Abasta Ili ABH1 F.D. Neligh I 11 ABH2 P.l. Bacenel -""'jml ABH2 T.P. McKean ABH3 M.A. Brooks 'R 2 ENS l- Walfas ABHC 1.R. Allison V Q sa ABH1 R.L. McCann , ll Xa 'JJ ABH1 L. Savage ABH2 T.l. Baldini -vm. --H-.1 ye , u9'Y ABH2 K.M. Collins ABH2 I-M. GarC8S QQ.. li Q V I ABH2 FJ. Nelms ABH2 G- Pieffe 'f"R1! ....-Y 4 ABH3 S. Burlingame ABH3 MJ' Fwd "in , u-ami 44" ls--2 Asl-la M.lz. lanssen AN K.L. Kresal ABH3 P.A. Madrigal Asus l. Mendez 'nit' V. 'igu ,1 I fr 'ilu' i l Ni ABH3 l.M. Robson ABH3 S. Rouse ABH3 D.A. Smith ABH3 R.K, Wisdom ,f , i 3 , 2. , AA T.G. Aldridge AN R.S. Anderson AN H.H. Annon AA M. Bell 1134 .......g.,, ,AZ AN K.l. Berezoski AN T. Bolden AN l.M. Carter AN D.W. Cooper J Haag 'W' 16 ff ABH3 DJ. Fees AN l.M. Cox ABHAN H.D. Crosby AN G.A. Delong lzxlhl ' f z v ,f """'f! no ol 'J , if AN l.A. Gilley AN A.l. lohnson ABH3 c.P. KeIlY AN KW- lucas Asus T.s. Phillips we--" u'fi' 'pn , , ,Q Y - . LI- V, ,-A ,. Q . , U v,'.,fg- A-rm..-'.-.1'f, My " ' ' W V A ruoafmv wp..-.,,,--1-mg-v IP ,L w H 'ag-I 55 AN M.K. McClain AN I- MCCrYndl2 1. 'K V naman ,X A AN L. Quinones AN R.E. Ross 4 A M - AA R.D. Acre , 1' , I AR M.A. Clemens 1 if X , If ld AN H. lohnson AA Oberlander 76O!V-7 AN R.C. McKelvey 'lang xg' AN D.B. Thomas Q '97 AA B.D. Benson AA Duncan 'fu .1 AA I.W. Miles ABHAA Rowland 'Wu 1 A fi AN S.A. Pierce M 5.0. poweu 'O' ,JZ AN E. Tillery A N E. Visitacion AA B.L. Brewer AA R, Burke I AA G.W. Eckert AA R.W. lines 1 AA P.G. Monroy AN D.P. MOSCIY AA Sheridan H A AA P.l. Buckl0Y AR R. Chamberlain uh. AN T.D. Farris AA T.E. lohnson AR R. Loving AR B.A. Rychner AA T.C. Thompson gym AN T.E. Coleman AA S.K. Folsom AR D.C. McClure AR Pasquesi AA V.R. Shaw ,Lv AR D. Underhill AR l.M. Cusick AR D.K. Hill AR Molk AR L. Rosario fr-Q' AA O.C. Sosa AN A. Warnigus AA G. Duncan ,Qi ' 'i AR V.M. Hill AR 1.5. Moody AA l. Rutledge 4 AR D.V. Tellez AN F,A. Whitten AA M.E. Evans AR T.L. lefferson AN G. LaBonle 9-nmxvhra -an-. as .V2 ,ma-5 4 V ii ' sn. . LCDR D. Swaim LCDR D. Thorn LCDR S. Wiley 2 LT M. Yaskins ABEC TJ. Berg ABEC G. Fullaway ABEC R. Tick ICC W. Tjosvold ABE1 M. Anderson 3 ABE1 R. Castellano ABE1 Erickson ABE1 G. Faucher ABE1 D. Kimball ABE1 W.l. Lau ABE1 I. McCarthy 5051 ABE1 A. Sena ABE1 F. Smith in E, V, . Y-S LCDR D. Williams Q, if H ABEC D. Ramey ABE1 D. Bigger ABE1 MJ. Keene 'ig' , WI a ABE1 W. Mosesly E 4 45 -xy if 5, ..,,, 1 ei, ,294 ,, wwf V QW. " , ,' 7 f .,.1 4 Z4 f. ,.. .Q 7 1, U, . ,wi Awww' s ,' Q f ,,.,, A wr my-fy 1 Q If .f,V I in ,H ' 2. 1 83 at f N112- xv j, 'F Q 1' 34, ' ff j K Kfwqffk-""-'1:f,1,, my V ? . ,:"ff'iL1f, -1.41 llzfff , g.f?'7'3,ifffH?Z9?4i f ,WWW aff-N" Vmzzml'F22..Q11+'f7lQ.2yQ1W257QQff'77" ' ,,,c7ewfff . Newfv7L,a,.wN"2,-ffif' ,M--W-',,.fjg', WW 1-A-4 .www V H.W'fwf'wffffwM,iagZW ,gQgez,,-'i::.,,4.,,,w'f 941' f " jf' V wwf' ,I 3w,bM,,f.s-1 ,'ff741Ym451' .MW f Z ,W Y K ., 1 Q. ,1! ,,f ' Q . I., kf,, 2 u , ,,g55Q1w-,c Gp!! fy!" yl . a I 1, ?', fig, 1 1 1 S, 5:5- 1 :,,.f,, .. j 2 y i N 1 w 1 , 1 ,,,L f l A I 1 4 ,, I A WEN , 4 ff' if ww, M, ' gf! 'Z 4 4, .. V11 A X 4 'cj gy ,QV V Tx 4 ,'-.4 1, -5 , 'V v 4, '2 f 155, f . -:, ve-Q..-,gee 1-new-F-'mae-,:,eh .-.fe-..-...-e,..-.-. ---.-.. ll 164 ! V-2 Y-f .- .,-- .V --., ,llwn1- .,.1,, n 'lun' fl .PV IC3 R. jackson ABE3 D. Korleski ABE3 S. McCoy ABE3 T. Nesbitt IC3 E. Poindexter -J --I Y 54991, uf . ABE3 T. Kemp ABE3 w, Kennedy EM3 D. Kiel ABE3 R. Link ABE3 A. Logan ABE3 I. Madlaby YN3 G.L. Mentzer ABE3 W. Miller IC3 S. Moffit A mmm? Y.. :cs A. Nolasco ABE3 1. Nystuen ABE3 D. Oconnell w 7 1 1 5 ur Q ABE3 C. Rossoni AN I. Schneider IC3 M. Tripple 4 'JL e .Z ABE3 D.M. Vanert ABE3 S. Ventling ABE3 D. Wasilewslri I 5 x 1 Ing, K ' L .eq A ABE3 G.A. White ABE3 R. Womelduff C if AN A. Barcelo AN D. Batdorf AN T.A. Byrnes AN S. Campos AN R.M. Cole AN K. Crenshaw "ln i ,f fZ AA l.W. Deyoe AN W. Fenton .sf AN P. Goshorn AN C. Hales AA M. Andrews FN M.R. Balo AN M. Castleberry ABEAN E.M. Dasig AA H. Figueroa i I AA T. Hannan AN l.D. Austin '07 Z ABEAN A. Bridgewater AN Chandler ABEAN Davis 1" AN A. Fordin if V-2! 165 166!V-2 V-2 1 nib AA I. Haskins AN T. Hensley AA I. Horvath AA S. lohnson hh. P A f ,-4 ICFN W. Karpinski AN W. Krolikowski AN I, Lenoff AN L Lewis AA I. Lopez AN T. Martin ICFN K. McDonnell AN I. Mclaughlin T T . .A . AN B. Mitchell AN T. Montano AA P. Morgan AN C- N3d89 AN M. Nasato I 1 A , ,f 1' I 5 fa AN w. Norman AN M. Parra AR o.nevf10'df "- 4 AN R. Rhoades AN R. Rubi AN w. schaff AN T. Schlarb AN D. Templeton ABEAN T. Watson w l AA L. Brown 4 1 j AA W. Greengard AA Lehman ff fl AN M. Simmons AN R.E. Toler FN S.A. Weight AA R. Dewinter AA R. Howell AA I. Matos ICFN S. Stone AN G. Voelker AN Wells AA K.B. Estes AA Karl AA McGarvey AN R. Surrafl AN R. Wallace AA K. Aldrich AA R. Ferrari AA Koons V-2 X 167 . V-2 I P AA P. Roberts AA I. Rogoski AA 1, Roland AA A, Teusch AA M.L. Ward AA l.M. Yrigolla AR E. Boatwright AR B.D. Donelow AR E. Doucette 168!V-2 AR W- Hafner ABEAR DJ. Hrabovsky f , 2 AR M. MCDORBH AR S, Mendez ff AR Nasv AR E. Sheldon AA Stepenson AR ,xllgood AR D. Fairty AR Leeman 'V AR W. Morgan AR W. Smith in -2 r ABHCS W.N. Endsley Y.. ABH1 F. Navarrete -lu 'K OLS ABH2 LR. Denton nf, ' ABH2 F. Wilson ling Y: ABH3 C.E. Hatton Amin! ABH3 D W lennex ABH3 Tl Marble ABH3 A.D. Martz 2 iff? H449 Q! ABH3 H,A. Miller ABH3 EJ. Smilh l4,..'! 1 AN D.M. Anderson AN E.D. Asbert X ff AN A.A. Catan AN M. Clark AN A.W. Harris AN M.A. Kuczynski W, 9, , AN C.M. Depuy ..,,,n-5 AN B.D. Peterson ABH3 KJ. Smollen AN A- Aguilar 'D AN S. Barbosa -.N 1 AN E.L. Blanchetle AN Coleman AN D.B. Dupuis AN M.K. Whatley AN R.W. Clay AN M.L. Edwards AN B.G. Loefflef runny. AN IJ. Rumple AN R. Stubbs I I f 77O!V-3 ' ,111 mv. Q- gym 'Q :f x Dif JU' ,lk 7,151 .'3'f.::.' ,jglfi ?-my w Il 5' , ,1 A . l , l . , C 1 , 1 fr , , z a . Q f X ' . , v r l A X , .ix X. . X wk .. Xu? .Q X 9' 77' f f' ,,. . Ei' -af' QW' 4 "V ' QI? I .,k, 4, 12:1 I '.,,,q.. W, . 4 f V 452 f -.X W ,723 W.. 4 ,, f ,Q ww-fuf-' . M? ww 1 , ,W iii if wif 1 1.2 ,1 .5-gf. ,424 WL .F '1Z225i:Q'53:2fffl1f A, ' ' - .Ay-, ,,. lm f 58'-.sl f f - , f gg iff 5 4.-::-pwig, , A ,s-, 2,1 3, :gf QQ?iQ,p,'xX3 xr 3, , fi, 92.5 ,:,--f2+.,- . 'ii U6A,,'fpf1 E I I A 7 'f 55 ,ls w A i v 4 41 'Q ,, ',.,,fz, , ,,: .. fw '-iweflfgffhiwg, -'fm , wif., 1 W g 4 4 av gf: , ,. ..' 9 'w,7bw.w-fww: L ff . ,p M-' w fwww lw-uw: .,,.w: .y vf, 1' ' I .- - J 9 hivfzff- 1: x if aw., 11? fr, 'i,41!?7?NY4xf' Em 'wfmi-:f'?13f5iH2i41yz1 1, .':'fwf'fM"- 1zz:r4,:,fwgfm-imcwgzQ1 If 4 Ig aww, 179-pq ,., ,H . . ,, 7 M -fn hi,-,Q ar, ze gmwi' W-,-,. ., A 1 fm, ,,..f,,.,,, 1f+16M2:1f f . 's ., 5 fl-vane-qw'-P --.f-.-,ff 1 1 'WH-vs' ' fr .1 ' .1 - Kg .,.' ff-,,,:,5fW.gi:,..-x. ' .' - .' ,f ' '7,"'fv vm.'.,.., I ,v 3.1. V I . S, .1 yy, .5- ,fr nz S' ,f N ff Q . fflw f 1 .,, If wp ' 5:91 Wil K ' -1-7 7 QW ' fix ,.4 . , 426.3-f, 1 V 1:44, nw, ff We 4, ' I M.,-ff We ff ,L 141 :,1 L V0 f .ff-J! '31, 1-+fy,g4y,,a'1.1 . , 'S' w"7'5f ?4.,v,, 54 971, 1.3, W7-ff , ,, fy., 4 ,Q hr- ff -w.,,,., , ,,.,.,W 4-f Us nf, wfziwya ,4iPZ,'f'2Zz1z .1 fm ' W wr" fa , ififkm-., ,f ,.,, , , zff":ifH,m,s"'fff f A ,z1f1Q4:4m1i:Y3z ' ffy V 1 J A-21.541-f."i.4:',4z,f',,. V . K, .- fi M ,,04,:,,,, ..,f,'.f,.. 4, ' f ' 'V ' '5.u 3:ff:f-f ,, ',g2g:-fps w:'z2s5 1 . ' xr? 'Kg 'Il mf out ABFI LP. Edwards 172!V-4 'bd 2 . I' R ABF1 T.W. Hitchrick ABF1 R. Partain ABF2 WJ. Chavez ABF2 L.l. Genser ABF2 l.W. Lemay ABF3 D.L. Bodene ABF1 R.A. Infante ABF2 B.D. Ager ABF2 P.S. Coffin ABF2 R.L. lacobs im ABF2 G.D. Thornton 'Izumi f M91 ABF3 D.A. Brink ABF1 DJ- Mulcahy Q 5 11 ABF2 WJ. Andrews ABF2 M.R. Damato ABF2 R.C. Laford ABF2 M.T. Williams if f' "7 if ABF3 M.E. Br0W" 'Qu ABF3 E.C. Carpio ABF3 l.A. lackson 'Illia , ABF3 R.l. Miller ABF3 c.w. Ray Q... ABF3 R.L. Thomas 4 mr ABF3 Walkins 47 'll ue "W, M-,vffl W ABF3 CJ. Chavel Ximm Q' I -4971 ABF3 R.F. lohnson ABF3 A. Mosley ill! ABF3 M.A. Rominger Dunn ABF3 R.M. Tweet 'Na . f 4 ABF3 A.L. Demoss f-.,. ls Y in X Qi. ABF3 AJ. Geist till! 1 V ABF3 S.A. Kerns ul ABF3 G.D. Nicoll ABF3 l.T. Strickland ABF3 C.A. Warren AN W. Alexander 351 ABF3 T.T. Goff lii V-4! 773 J. 1 1 1 1 1 1 f 1 1 1 1 1 i 1 1 I 1 1 1 1 1 W 12 Vx' 1 xi 5,1 11 , 11 1 i Q . 93 1 Q1 F F 1 I I1 i 1 1 1 1 1! Q .1, Q iw 1 1 I 1 I 1 I 1 is 1 1 i 1 I 5' I L 4 1 3 I 1 i 11 11 i H il i 174!V-4 AN H.A. Bgnd AN D.A. Caggiano AN P.F. Danna -...ii ' XA? A AN LJ. Dreux AN G.R. Ethier AN G.B. Guijo AN'S.E. Hanson ,,,,...M..,....w., A 1 AN R.C. Kreisel AN N.G. Mendoza ' i AN C.G. Neumann AN H.R. Nusi . ,fi ,mmf if-43 i AN L.E. Owens AN G.O. Paris Ha... jf WA AN P.M. Dargan ,I wr, A AN R. Gilberlson 1 11 Wifi AN l.W. Harrison AN K.B. Minnis AN 5.1, O'Hara AN M.A. Pritchard 11? AN R.K. Pruden I ... i 'Ulm 1 AN C.T. Root - A ABFAN Stanberry Z 1 AN K.L. While AN l.E. Worthen ,! I,, ! be .4 ABFAA Marshall -0- :pun- AN S.A. Randall lqh. if z AN V.D. Ross AN D. Torres AN M.C. Williams AN 1.w. wright AA Roberson AN D.M. Roethig 5 -o- AN T.D. Stake ic. 4 AN D.M. Walhen AN E.W. Wood ABFAA Lyon X X , AR Laurie V-4!175 176!V-5 I CDR W. lde ,fy ui , of ABFC I. Barrett LCDR T. Heath ABH1 D. Charles ABE2 M. Backes SN L.E. Baumann AN Hanson SN W. Payne Y X., , Y mt " 4 ABCS E. Nelson f N5 YN1 B. Hardin ABH3 D. Carman I f f g J AN M. Clements i I. AKAN S. Hubbard AN c. stein V-5f177 i 1 ! r F V i il, ff W E 5 , 1 i E il "fig-:':fli 4'321:,25i?Q:L25:fI1:,.2-:'g-1 ,.,.,. . "' " "1fn:--vv1L.,,-Y -1..1 J.. ,,,---..-. -- . ,, - , gan -,-- ""' --in' '21'-irav-1'-4''cl-5-3:1-.fvxrf-Q1,.,f-f' ,- ' EEC-1-54.,-13'.,.. f:,,ff, l.,:--71-4'5ff421.'-C -.-- .. . ,,4--,L-,V -,,,.., Y. ,, . ,, K ., ,. ., . . -,V-fit-:HA4.dz,'v,.-Yj4-1,.,..v,,3'.11!r.fe-:.g5L4f:4'n-V -g3 ,-, Hs., ' is-5.--3,xBi5:2a7g j,f:9"'L- 4 ,, f f ,i.'f,,T'41'.,.Q.-,,1,. .',.':,..3 .v-, 1 - -Z1 :1 L 'A :-.zf1-':.g-:f'S'7fy:.- , ---,-.. 3, ' . -.t ,, ,-. 3... - . , .. -....., ...,, M- , -y . -3.2, . . '-1 "ff-' -, f-' -A .- 1 My-Q, ""-"- vi-e'i'.?4-c-15 1'f'Cff-.-i- J-'11--.-,LJ . fl ' T'T.:'-gg -5.-'is'-T:-'fit .f.-:-'f.'L-'4CQCC5- 31 x,.'14'F'-f.-:s-"' J?-211 1 7 ...A,.:,r'-:Y5f.L,-P47553 ,V -3-.1-.. , - - . f , f' N:41.2".-f-1:':: 1.--4. in , 3:5 3 ,f 4, Pf'+1355if':2':i2L:s'Q5i1:.'l::9-i' i'ih1f5-.ff?i-g,-,5'Ez1:fJ?2:ET'54' ' ' 7' Y- MW" 'L-2' A' " 3-Si - '- +1 " ,- -k 941- :fA:4f'+:'-ffl 1. lg, f f, 41,-.1 QQLWQR WW AIMDX 179 3-um5lS5EGK' P!Cg , Q wx 'Q' 'vfQe vbggwvg,:f5-v .g33,j5,,5515,g,,, , iw 254 V iff' 1 'I' if, 18O!IM-1 ENS T.R. Wilds ,, Q": I I1 AQC R.L. McCarty S7 AE1 R.A. Fowler Wham? A Ill. AE1 F.O. Obillo AT1 F.T. Pace K 3 I , 7.27-V ' 5,1 AVCM S.L. Loveland 1 . L . ll l AZC R. Pratola ATI L.E. johnson AZ1 l.P. 0'Laughlin Aj? AQ1 ms. PhiIliP5 IM-'I AD1 A. Quintana Ni 3 AZ2 B.M. Childress fl! AZ2 H. Robinson L AZ3 M.A. Mort lm AZ3 K.S. Woolford M-'I llmf L 4159! i -XAR ,ini Q AMH1 R.O. Reyes AS1 C. Staggs AZ1 S.E. Tucker AZ1 T.R. Weber I ffl- lH 5A AZ2 M.D. Hamlin AK2 A.C. Llave ABH2 M.A. Mendoza AD2 G.D. Penaflor Digg! ,,.3r r T' if AA l. Caggioni AD3 E.D. Castro AMS3 Q.A. Gatewood AZ3 A.A. Hartfield AZ3 G.V. Newbill AZ3 F.D. Robinson AT3 W.R. Rogers AK3 V.M. Woodall mum ' AKAN S. Hazelwood AZAN Ludwig lltugff IM-1! 781 -.4 182 X IM-2 ,Z , I, umm I LTIG W.P. Savino .Ki AMSC Watson ai l S. AD1 Abuan i V3 Y AD1 R.B. Morales Nl' 1 S2 AMH1 W.D. Smith ii 1, lil AMSC Asbvnas AMsc Askins Z' A 5 'ami r AMHC I.D. Ancheta ADC WA. Cox ugh -41.711, AD1 W. Clayburg PR1 M. Davis 11 r M AD1 D.E. Pierson AMS1 E.S. Ramirez 3 y r-ln..1,! 5 in 1 .MVA AMH1 R.S. Teems PR1 P.F. weiler AD2 S.M. L ...iq Brown AD2 R. Cunningham 'Q lag a X AD2 S.V. Embry AMH2 C. Haselkamp AM52 R, Hegglef ,af 'N 9 4 PR2 N.S. Lozada AMH3 I. Bachstein AMS3 P.l. Baker f in I AD3 M. Delletorri AMS3 A. Depriest AMS3 G.A. Huxable 81213. :nm Q AD3 R.A. lohnson AMS3 Kelley AMH3 C.R. Lain 'I lmlu' Y AMH2 F.A. Tubo AD3 F.M. Raney AMS3 T.W. Ray AMH3 K.L. Robacker PR3 M.K. Tonnies Y V at AMS3 SJ. Zierden f"'n. f " AMHAN D. Driscoll AN R.G. Eberly AMHAN l.V. Laspisa QQ LT M. Hickey CW02 LC- Hull AQCS C.V. Borner WM f in J ATCS l.L. Hodgson AOC C.A. lones ATC D. Montgomery i AQ1 R.L. Alexander AQ1 S. Alexander AT1 R.A. Benson AE1 L.W. Estep AQ1 R.L. French AT1 W.H. Fuller f XX x, l X , T V ATC A. Butler yr ATC M.A. Wujcik AT1 B.H. Borger AT1 EJ. Girardi AQ1 M. Griffith AX1 B.W. Crump AT1 l- l-35l9f mm' 11 2 AE1 M.P. Maloy AT1 E.M. Marzo AQ1 DJ- Masfffson IM-3! 185 i X . Y , Y Mmny N uf r X-'WI AT1 R.L. O'DeII AQ1 l.G. Purgason AT1 T.R. Richmond Y, f H AT1 l.G. Schroeder Ili!! AT1 C.R. Suchowski I! 51,1 f' ' AT1 R.K. wilson X X maui AX2 W. Behnke AT2 S.F. Hasser 186 f IM-3 w Y AQ2 S.H. lacquez ....,,f Y AQ2 Morley 5115 AT2 D.G. Roy AE2 K.M. Schoen AT2 G. Tomlinson 'Hmm , AE3 B.S. Andrews Ii 'mins fr' ""'-hun, 11 AT2 A.L. Larsen AT2 D.G, Perez 'I AX2 R.C. Proctor AQ2 D.M. sim a f """?-1 hgmmu. AT2 D.W. Townsend 5.95 AT3 l.D. Atherton V AQ2 R. Littleiohn AX2 1.3. Rigaud 1 1 W 11 AT2 R.K. Ruth 'Ulu i 'L-0 AT2 S.S. Spence 492 AT2 DJ. Vaughan AE3 P.G. Bacon mmm, X AX2 D.L. Martin AT2 T.T. Miller M3 IM-3 I 787 516' I V E I l Q 2 Y . i s 5 I 5 1 4- , eww '7if.H, , .f f x - sa f, fd V wav- ,ru ',,'-:nj H Y f V t .I .,,,, ig K V3 IN Y? , 1' . 1 K Q f -"' P' ' 1 W J fs! ?1:"'-'n- A . 5 fig-Q51 -ir? , f f , . b ,, , . . jckz! , Wh, ' mf M A ,., ., - ?:? ' 2 W ., I 121:23 1, K W , em , .W ,, .IW23 Aw.. xy , Jzivi "' be-Z5 QQ, 1 nfl- ,f-as V1""3!7!E5' Q ' '47 X xx . lf .Ml ,H ,sg . 9 3. f 1, Q .W E93 J" W 'IA -1 i gym 7 f ,H 7 ff v , ., , , "', ,Q + , x x Q 7' x .Q-HY' ::,f, i ,,f, 3, W- . , 'fb 'NI f MGP: - ff ,,. my 7:fM'vw , 2? I 55223 x Aw, 1 C .. gia AQ3 W.K. Pace AQ3 T.L. Pittman -.ir - 'K.t AE3 M.C. Slavik AE3 S.L. Tillotson f AN R.C. Brown ATAN R. Carpenter Q.. Qi ' ATAN S.W. Combs AEAN G.T. Diehl "lu 1 f rr: A AEAN M.A. Gotauco AQAN Di- H'-11509 1 an-.744 X L uuqu. Y AX3 W. Raita AT3 R.H. Richards AE3 l.l. Simmons AN R.C. Benitez 1 ATAN LG. Clancy AXAN LE. Gompers ATAN D.C. lohnson 184 fr ATAN n.M. lohnston ATAN R.w. panes ATAN l-W- Koehler f,,r U AOAN LM. Marshall ,V . 1 790 ! IM-3 AEAN l.M. Pastore fa ,f , ,fw A2 J ATAN M.D. Warner AEAN D.I. McGrath 4 AE3 P. Sinks ATAN E.P. Winbush AN 1.5. Lang TECH REP I. Butt TECH REP G. Renaud ATAN H.A. Poehlef ATAN P. Pardy ATAN D.G. Sloan ATAN T. Sneddon AOAN K.G. Wiser AEAN W. Anderson TECH REP D. Brown TECH REP l- Burroughs TECH REP N. La cascia clv K. Rasfhke clv B. Towles CW I- Vimnl Q ,, lf LT Gus Beall -1' 1 ll!! ' ASC G. Williams il ASM2 L. Baniqued I, 1 if l-TIG T.N. Lee ASCS L. Thomason ii f V xl z AS1 R. Abler AS1 R. Angelito ASM3 R. Cote ASE2 N. Davies EMBL' ASC Hutchins ., Nh Ad 111 AS1 R. Kelley f K I 1 AZ2 P. Davis I -4 il..- ASC Que ...J f . 5.49.4 ASE2 P. Middlebrook AK1 I. Purification "" 11 4+ N ASE2 I. Edwards ASE2 D. Fleming in f gvim AS1 E. Reyes ASE3 Kirk lM4!191 I - --- - Y . , 1-gm-1-N .qggrr-A1--,-V-...Q-, -- 5.-hull , ASE2 B. Moneda ASM2 S. Pappas 1 ASM2 S. Sanchez ASM2 S. Smith ASM2 G. Taylor ASE2 R. Velasco 792 X IM-4 w ASM3 W. Estrada ASM3 S. Hensley ASE3 l.. LanCl1anlln ASM3 T, Moreland f ul 5 ASM3 C. Skugrud ASM3 N. Williams 'lu-. W , Wi ASM2 B. Pickenpaugh 1 ""i Y A552 P. Taggan ASM3 B. Baker ASE3 L. luaire tg., ff ASM3 L. Patton ASE3 R. Williams Q52 'Tv EW, ,yy ,Q ,, W 3 yy .' if :L my f 2.2551 M" " 14204 ' YZ" f , -QAM! .cf 4 ' H s 1 . . A '- -1 urqygt-111 .f f Q ,M 1? K "Q 'B , A.. wi ,ww Q lm 1, 4 'if f-fi Q' Q V ,' 4 A A fli, W, Z AX ., g,,l,4 , in L fgi R 'Q M Q - if 42 - . is ' Q ,' H X af ' , ff-pg 1 ,, 11 1 - -, ff . ' f n- 1-f ' .' W- H Q ,,.-?1?Q-f5- l Nz- T 'f' -gf 21", . 'f . . iliiuf -' , W " 'l 2+ ' X' - 7- ' V, ' -: c Y i'7",g'fif" 1ss,4fc4 A I ' iiwsiwelf ' - 7 rx., , 'Iwi g!'j9:ff5' W-QF. : f-,iffwvffis-':: , J nymzr-41-:g,71, J .gf .fir -. 1 . 6 I, l Q4 x ,rf " 421 x 1 'Hia I UI'-1'-.fu K ,,-ffm-551-4 ' +5 ' . H f . 55-s,:.j: A-51355555 1- TF Q- K Ll, :HQ " - , 3 .11 ,I T ff x Q . - -' L' ,-7' - , - ' "" 'Y'-"Q Q 1 N .B I .l,,,- "' ' -r iff? 'L , Q- ' x ' - 5 fi . . X ff Rx 2, .1 " I N - wi? Q i , ,IZ V? ., I - , . 1 X -2 Q .- ' ' 1 - . ,- ' ' Q l I . 1' .h ' N - .. ' ',, ' L .iw X . :X , -if ' ,4 5 I , ji K X A mfnnvwff 'F - l'.MlWWJIFMVJW1fl5F nf pw .t W ,, Afwfvm, 1 T fy WW," 1:25 Wiyff ' 1, .L ,L fQ,, 1 We P ' ,. 1 The Communications De artment aboard USS Enterprise is g P . comprised of two divisions, CS and CR. Collectively these two divisions communicate in a wide variety of ways, 'from the most basic flashing light to the most highly sophisticated state-of-the-art electronic satellite communications systems. CS Division, commonly referred to as "the Signal Gang, is primarily responsible for visual communications which include flashin light, semaphore and flaghoist. There are more than 65 flags and pennants, 32 positions for use in semaphore, and Morse code used for flashing light, allof which must be memorized by the men of the signal bridge. CR Division consists of Facilities Control KFACCOND, Message Processing Center KMPCJ and Teletype Repair I CTTYJ. Facilities Control is responsible for ensuring all radio circuits are properly set up and patched to various outlying stations. Our "Tech Controllers" make split-second decisions regarding circuit restoration. They also tune transmitters and receivers over wide frequency ranges in accordance with current frequency plans. The Message Processing Center handles all operational and administrative message traffic for Enterprise and her embarked air wing and staffs. Using computer and manual teletype equipment, the MPC processes between 1,600 and 2,200 messages per day during peak operational periods. The Reproduction and Distribution area of MPC will have produced, by the end of the WestPac deployment, more than eight million copies of message traffic. The Teletype Repair Shop is responsible for maintenance and repair of teletype equipment and Xerox copiers aboard Enterprise. ' The ability to communicate, whether with flashing light I or' satellites in space, is vital to the success of the "Big E" mission. Throughout the cycle of work-ups, readiness exercises as a Battle Group and deployment to the Far East and North Arabian Sea, Enterprise communicators have truly served as "The Voice of Command." LCDR G.C. 194!COM il l SMCS C. Sheffield SM2 l.E. Furman QQ,- SM3 l.G. Score SM3 C. Forlastro M, SMI LC. Hill f SM2 T.l. Goff 'I 454 SM3 D.G, Spratt AL SMSN I. Russell -.,m SM2 l. Prentice SM3 R.L. Ray SMSN l.P. Couch SMSN A. Sanchez SN D. Vogel 1 l SMSR B.T. Fromme in SMSR M.l. Sharpe COM! 795 X. X-,f --X-Z 196!CR I H pu- f o -no 1 ' L 1 1. - J if was, r ' Wm I ig S LTIG S. McNally ENS R. Grefe ENS LF. Poe V ,J ' 1 M 5 Q ' ,"' ir- RMCM L.E. Long RMC B. Estes RMC C.M. Murray RM1 S.l. Baker RM1 M. Earl lmlf yi E RM1 TJ. lones RM1 S.R. Kirby RMI I.A. Linville 'lm L L L! RM1 R.E.' Phillips RM1 D.A. Seymour RMT A- lf- Smith f.,-in , pil ' n RM2 D. Carson RM2 1.w. Cooper RM2 C-5- Uwe" RM2 M.A. Lykins ff -mm. f RM3 l.C. Campeau ,fin-I' -1 ,Lf RM3 M. Demaine nl "Q- RM3 S.D. Hire E fihaqf 1 RM2 B. Richardson RM3 R.B. Clark MJ uf RM3 K.R. Dodson RMSN A.L. Kisor A-'Gigi RM2 L. Washington S RMSN l.W. Cohara du. RM3 O.R. Drake f W1 as l RM3 S. Mack ff 2 l CR In ef: RM2 1.11. wesa RM3 G.L. Crowder RM3 l.l.. Eberhart RM3 l.A. Macias li CR! 197 -.131 RM3 M. Mummert 798!CR I Z. RM3 T.A. Palm Z B RM3 F. luarez if J f li , I W -f 4, RM3 Santos If ms:-Qi", RM3 Willis RMSN w.1. Apple M' 1 6 RM3 LR. Newberry RM3 R.E. Perrine X RM3 I. Schlinger RM3 I. Tuten RMSN R. Adamson RMSN Brown We RM3 M. oebme If N RM3 S. Plavnicky RM3 KJ. Rose j , 1 55 RM3 T. Webb RMSN E. Alvarado nMsN w.o. ciwn 4 '4- .JW WI . r-ummmrnmmrn f rf' f f 16 f-.Q J fl ww , .1 4 :Wf- 'W f 'Fx 'Wi-v-. .NQM 1 9 e -M4431 ' 'X rwh. '- - - . :"'1. W-:Qs :vw . ' f i - 112 1 -, M 4:-.ww . .. , 1-:S M,,QY'?w"'H wr f I-1 A " . ..f..,1wf":"', , x , ,wh , . ---..-14533,-:rg Y - f-+ -. we W , - .1 -img:-xg: ' 1 14 l 1 ,O W ?Qw.' , f, 1 fsfaiwawf,-. 1: ,vi-f' ' 4'25??,fa':'a4w we -' yfgifa-fy ,, . rf X "nu, w, -z Ar.: ,,,,z. Mm- Jr M, , wif fV?wii5C:5f,, 03214452 12 ff . if ff X s. xx. , , , J F4 vi HMS" 1-W 1 A A Wzzrzif 1 1 A ,....f- 4 . . ,S -.. -ff,-L-1.,-. ww.-.1 fm4,:1.,,. ' X The Deck Department of any ship is the backbone of her functional seamanship operations. The same is true on ENTERPRISE. Boatswain's Mates are responsible for conducting key functions in traditional sallor's - evolutions, such as Sea and Anchor Detail, refueling, rearming, replenishing, maintaining and running boats - the Captain's Gig, motor Whaleboat llifeboatl and four utility boats, and for supplying and training bridge watchstanders. Whenever ENTERPRISE enters or leaves port, Deck takes care of mooring her to the pier, casting her loose, or dropping and heaving in the anchor. The boats that take the liberty party to the beach are manned by trained Boatswain's Mates. Whenever the supply of groceries or jet fuel gets low, Deck Departmentimans up Underway Replenishment stations and transfers the goods with skill and professionalism. From Reveille to Taps the Bos'n pipe can be heard piping orders from the Bridge and Quarterdeck. The tradition of piping dates back to before 1492 when Columbus set sail. Deck supplies ke personnel to man the bridge underway. Under the close supervision otythe Boatswain's Mate of the Watch, Deck personnel stand helm, leehelm, lookout, lifeboat, and sponson watches. Boatswain's Mates run the ship's sail locker, where canvas and other materials are 'sewn into canopies and covers for equipment throughout the ship. Deck also operates the paint and Bos'n Lockers and is responsible for issuing' and controling paint and cleaning gear for the ship. Fancy work and knot tying are part of a Boatswain's Mate's craft, as well as the piping of honors in special ceremonies. ' Deck Department was extremely productive during "SRA 83" before deployment, rehabing many interior spaces, sponsons, and preserving the ship's sides. High scores wereachieved by Deck during Refresher Training and the Operational Readiness Examination CORED. The senior ORE observer commented that "ENTERPRISE had the best CV' Deck Department in the Pacific Fleet." Deck Department has continued to maintain high standards throughout the deployment and uphold the Deck tradition of "taking up the slack and maintaining an even strain." 'ff 'lfl I I 1 LCDR LJ. O'BRIEN III, USN ' ' Department Head Q LTIG M. Gentsch Q? Aa BMC M.D. Digman BM2 Anderson all BM2 Sanders lu BM3 N. Falls kii, BM3 P. Gilliam I Y I 1 ENS G. Brown M' 11 JS BMI Breitweiser W xi-. BM2 Lee BM3 Belasquez BM3 R.T. Garcia I 11 BM3 Zingsheim L yr Q95 'Isl DIV BM1 D.R. Fuchs BM2 D. Rhoades BM3 Creveling 1stDlV!201 XXX SN N. Ericloon SN R.Hen9on SN Nicholson SN K.W. Rochester SN G. Summers SN A Thompson SN R. Thomson Al !, wi 'N XXX SN Updegraff SA P. Antoniou 1 SA Elliott SA M. Vasquez SR Boreland SR Ripley SN C.D. Walker SA R,W, Wilgon S SA l.D. Aran! SA C. Ceresa SA B. Greenlee SA W.E. Rau A SA A.E. Yanna SR ANN SR M.L. lones , L X 2, SR McGuire 'Isi SR Sparks DV , ,, ,e - 1st DIV! 203 gn Q9 PS BM1 K.l. lones .qu-'ff BM2 A. Downing BM3 l.B. Buis BM3 H.N. lones BM3 I. Walker I I SN L. Bums , Ann Y BM1 C. Wilson BM2 1.0. Puglia uni .Z BM3 I. Foster 'iyzhlx ml BM3 Karbowski I-Q . Q ,Q BM3 V. Yubeia SN D. Campbell SN E Cannon 'Cl SN L.H. Gray SN Litehiser SN D. Miller 'Nr SN H. Sinclair X SA T.G. Hoke I SA Thomas ' 4 SN Houldsworth SN W. Magness SN M. Perkins SA Christian SA L.A. Houck SA S.A. Tripp 4 'hmm Eff! 1 6 J, 1 A lx SN M.A. lones 1' r SN Marietta ' '7,, Q15 If SN L.D. Pierce SR K. Cone 9 SA l.M.QKamer SA C. Pearson SA M.B. Rios SA Southwick SA Adamik xx S if SA M. Williams SA Wvav SR Nielson SR Porter X 3 IS su Maymon 2nd DIVXZO5 ...- C M.-.--1 if X 1 'XX 4 Rx 1 I X X 1 1 1 1 r- 1 1 ,f XX! W ,, V 1 f ' L,J x I ina ":"l2as 1 f Y LTIG I. Knight BMC l.R. Clarkson BM1 David McFadden BMI Randy Roberts BM2 Ronnie Bames BM2 Ray Kornegay 'ilk f Z 'Inu i1 mgmx "1 gs BM3 D. laramillo BM3 Robert Lauer BM3 Maier ...z .1 5 VV t ... 45 ' 206 !3rd DIV Pill: ,f I V nu , , .f BM3 E.L. Muclrennan BM3 L. Rodgers SN Clifton Adam Jfiz f sMsN Baumann SN LL. Greene SN Norman crivbv SN R. HBWICY SN noe L. mum sn a.L. Mitchell --9, ,xgygvj d DV SA C Hutchinson SA M.W. Maleport SR Britt 3rd DIV! 207 SIDECLEANERS 1 ff" ,p ' uf,-L CWO3 Vivik BMCS D.L. Dove , .mul i , xml BM1 Bernardino BMI B. Francis ,fy ,L 1 .. ., BMI D. Moench BM2 B.K. Locke 'Z a B3 'H-I-.ff V Y r I, I. 208 XSIDECLEANERS BM3 Baker BM3 M.E. Brown l ! BM3 Loren L. Carey SN Edward Giblm 1 11 -EL nf nn., Y JI l J am Lester penkim BM3 Marlin we l.-Q l BM3 David Lovell BM3 l.P. Malvasio 1 ' i iii YN3 D. Parsons BM3 Schallhorn BM3 lay W. Stahl SN R. Connor 'mm L. BM3 Holder BM3 Morris L1 P, 4-L' I 1 i I I l SN Quentin Wilber SA Lirette SA Pritchett SIDECLEANERS X 209 l Th iiii ii'isiionDoifithe Dental Department is to provide a comprehensive e mls approach to preventive dentistry, patient education and treatment to Llental 'E f disease ii'i Aicioirnpleteieprogram of services is provided by four genera en is s and an oral-surgeon assisted by 13 highly trained auxiliary personnel utilizisngthe most modern dental equipment available. Prost eticservices are supported by a fully equipped dental laboratory staffed fby ,y t wo fully trained and experienced prosthetic technicians. The calpabilitiesfof thisfacility rival those of any large prosthetic laboratory found in theilnited Statesxtoday. During deployment periods, emergency care is aviiilhable tospersonnel of other ships in the battle group which are without dejntal facilities. it i"sss' -ss All depagqtment-personnel assume integral responsibilities in the ship's battle dressing stationiorganization for general quarters and mass casualty evplutionsiizidditionally, the oral surgeon augments the Medical Department generallanesthesia capabilities, an important readiness factor. ltis the belief of the department that the dental care provided to the crew of lENTsER'IZlilSEtcoT1Uibutes subtly, yet significantly, to their overall morale, personal comfort and lhealth. Without a doubt, mission readiness is influencedf lniafvery positive way. ff l 3 " ff i ff" ff 1 l ,ff 5 l i i l N' 5 f---f---W--4. t is ' l l i l r , ' l l vnd- Y -- ff-V4.7 L. ..,,,,4..,..,,,H t W Pei n rm? r"c"i l Q lil l , ' l lll 1 1 i li' ' l l il I l , l lll 1 2 1 all l l l ill l l i lil Q 1 l r l ',,.-T 3 iv i i l l H . l l l I l l 4 l 1 i i c-..,.,,W,,,n 5 t,4iM4NMAAdv M ,ffl FMXN f l l X, ,X l 3 N, fl l i ' f DX gi sl, f -, lx X l 5 l i l 'l l l l l -D ,tml J I lf l l l l li LW ..D-J L,AW,,w- ,ml l l'll pt . f 1 ' 5 , 2 l ,W , 1, . . Mmms ll . ' X, ,,,.,, l l l i ,f""" 4 rl 1 l l 1 l l l I l i i i l w,A,.-,s,M,i LAA-QM! Wm, l l Z1 l is . if ff' l l X l ,ff lg g 4. CDR DA. Roozr he ' DC' USN CDR f.M. KELLY, Dc, USN Depdftment Head Department Head 1 ,J-. LCDR C. laworski Tum!! 1 I LCDR R.D. Smith i. .YA LT P. Hamilton LT P. Lindauer -.m,,,,i if :ff DTC M.M. Lagdao DT1 G. Nepomuceno DT1 P. Walters DT1 W. Kirkman ERI IJEIXI Il'll- , K ' f 6 6 12: 121 '55 2 , " l gg , ., ' '1 L2 ' il 51 . s .T I DENTAL!217 :ln IJEINI IHL 1. ar DT2 F.l. Conti DT3 F.C. Aquino DT3 RJ. Beal si Af 1.5m , 4 -, i z-1 1 n fffyw '-" Vk' 3 5 , , i DT3 D. O'NeiII DT3 D.L. Perkins DT3 K. Sessions ,J -mtv' 3 S gl? Y ,ig . DT3 C. Wilson DA L.A. Pules DN R.G. Speer 212 X DENTAL 'WN Nf 'YY , Q., b'. xxlpr DENTAL X 213 214 ! ENC DEPT Enterprise, a ghost ship - sitting quietly in the darkness and moored to the pier. Without the steam that drives her four massive engines and her eight turbine-generators, without the auxiliary equipment that provides numerous essential services, and without the well-trained and highly skilled men - more than 500 engineers in all - who keep her running in top shape, she would be but a lifeless hulk of steel at the mercy of the tides and wind. The Enterprise power and light company, Engineering Department, whose motto is "machina bena constituta" and whose mission is making the "Big E" work, is actually four divisions. Machinery CMJ. Electrical CED, Auxiliary tAi and Damage conqtrol CRD Divisions all work together as a team to accomplish this tas . Their story: Thousands of repairs accomplished, tens of thousands of miles traveled, hundreds of thousands of telephone calls processed, millions of gallons of water distilled, and billions of kilowatt-hours of electricity generated. 24 hours a day, 7 days a week, from the island to the pump rooms, from the bow to the stern, the men of engineering are on watch and working. ' Q M-Division with its Machinist's Mates and Boiler Technicians operate and maintain propulsion equipment, evaporators, and the turbines that provide everything from electricity to high pressure feed water. They work in the "mains" and "arms" where high heat and humidity are a fact of life, yet they always achieve whatever is required. l l E-Division is comprised of Electrician's Mates who distribute power throughout the ship, maintain lighting systems, repair elevators motors, and galley equipment, and ofthe lnterior Communications Electricians who maintain the ship's telephone system, gyrocompasses, main communication circuits, fx "5 iwmfggiziy sound-powered phones, engine and steering control networks, and the various alarms and indicators required to operate the ship. A-Division repairs and operates all of the ship's auxiliary equipment. The A-Division team is made up of Machinist's Mates, Machinery Repairmen and enginemen. They supply steam to the catapults, hydraulic power for steering and elevator equipment, and they insure that the winches, air conditioning plants, emergency diesel generators, fire pumps, ship's boats, air compressors, and liquid oxygen and nitrogen plants operate safely and efficiently. The men of the Machine Shop manufacture, rebuild, and repair needed parts for the ship, the air wing and the entire battle group. Damage Control and Repair Divisions have been merged into Engineering from their previous departmental status. Although it's I-lull Maintenance Technicians are renowned primarily for their excellent emergency response team, the "Flying Squad", R Division actually has two other major functions: they are the ship's experts in repair, welding, brazing, and non-destructive testing analysis and they are responsible for the training of the entire crew in techniques for damage control, which enables the ship to keep fighting in all environments. Engineering Department has its own administrative section which handles the overwhelming quantity of paperwork that evolves from running a large organization. From the routine to the complex, the yeomen of the Logroom keep the administration in order. Engineering Department: the men behind the scenes that propel the ship and provide the power to help make ENTERPRISE the premier warship of the U.S. Navy. ENC DEPTXZYE -'ww-rf. .,..,..- -,..,.. .wif --- :Bb f ll LCDR D, Armitage LCDR M.P. D0elll'l9l'l LCDR DR. HBH 1 LT M. Sowell YNSN W.L. Walker SN H. Brogan 216 X LOC ROOM LTIC K. Barb . ..-,f' J , .,. , 4. 'xt lm CWO2 A. Stanton MMCM Smith MMCS H. Gardner MMC W.E. Bobof MMC Folz MMC A. Marshall MM1 S. Barnese 1 MM1 R.A. Brumme MM1 M.S. lessett MM1 S.C. Henderson --22... , MM1 K.P. smart MM1 R- Towle MM1 C.E. Hickman MM2 K.R. Aaron MM2 B.R. Alkire MM2 C.l. Ankner jf 5 l ff' F A LTIG I. Sigler MMC M.L. Boles E Ilx ., J5- LTIG I. Vance V ENS I. Battle .,-' 'IJ Y x ml MMC Collins MMC D. Ebeling --q.9,,,..,Y KT-V 1.1.0.7 H L.-1-.ire-v, 1 . , l w W -DIV '-... r I MM2 Rl Baker MM2 T.L. Bombe MM2 M.A. Brown MM2 M.L. Clark 1 i 1-.., 1-tu V V 'X" 31 MM2 K.A. Doss MM2 M.L. Clarke MM2 R.D. Cowgef MM3 I-R' Dfw ilu sqm fy J 5' 2' - 141 - : ,, MM2 S.R. Egler MM3 M.R. Evans MM2 R.W. Fisher MM2 D. Foss E' ghgur MM2 C.W. Geralds MM3 l.P. Gilmore MM2 R. Guthrie ,hh , L..." I vm.,-, 5. 'QA MM2 W.M. Hay MM2 R.L. Henard MM2 R. Hernandez MM2 l.R. Hope MM2 Hurteau MM2 R.M. Ignacio -, -M11 'B L 'gl , MM2 R.c. yngneeh MM2 c.R. lamison MM2 D.T. Keeler MM2 LM. Kennedy R.D. Ketels MM2 p.w. King MM2 R-5 Lime" 278!M-DIV 1 'bl 131, -1194.57 ul 2 .SA MM2 K.L. Harnack MM2 B.D. lackson .Ill 1 "1 , 1 I ,f fx i 1 ,les.A Ny f XS Y M W 4 1 I , f 6 E i ' I l Q ' Y Q Y V 1 ff 'll Y 1 Z 'fi QZ :ff Sf! g ' E I L 1 1. '."'l X , MM2 L.L. Long MM2 M.F. Lundin 1390 AAA MM2 RJ. Mandia MM2 D.M. McNair MM2 l.D. Murphy MM2 M.E. Nussbaum 11 MM2 A. Rivera BT2 D.W. Slates MM2 R.B. Somers MM2 C.C. Thornberry MM3 l.R. Barone MM3 K.C. Bayer MM2 I-I-I. MacDonald MM2 M.F. Mahaffey sqm MM2 G.W. Mehling MM2 W.D. Miller 91 MM2 G. Parsons MM2 I. Pendergrass ig., MM2 l.L. lr. Smith MM2 K.C. Smith Inga. MM2 l.A. Wagner MM3 D.A. Barchacky MM3 I. Behrens a V ' MM3 V. Bell l l l 2 E l l l l . l l l ' l 1' l l , l 'u l l l HW ll ll W IIN YM WE -Ml l 1 l, V xl ,gf ri l .M ll ll w. 1. ll ll li l l l 1 1 l E l I l l A u l T 1 l tl r l l 5 P 1 w 5 1 E Z K A w Q ii l 1 220 f M-Div MM3 D. Chamberlain MM2 V.W. Curtis MM3 R.T. Doran MM3 I. Garcia MM3 S.C. johnson 'Z vi MM3 PJ. Collette MM2 l.A. Dean ua... MM3 M.S. Earl MM3 M.L. Gunderson , lil MM3 D.W. Kramer w lv MM3 M.A. Crooks MM3 DJ. Donahoe MM3 l.l. Farr MM3 G. High! MM3 W.l. Kramer in Y wi MM3 M.w. Lindsay MM3 5.1. Logan BT3 RD- L08h"Y MM3 LB- McHugh MM3 R.D. Mcmahan MM3 M.H. Mcwhiner MM3 1.H. Middleton MM3 D.D. Murray MM3 G.W. Nail -21 l MM3,R.S. Newman MM3 W. Prince BT3 D.E. Rice MM3 W.R. Robbins MM3 D.B. Schreiner MM3 E.A. Sharp 3 F! MM3 G.A. Tuano MM3 W. Wagschal FN l.M. Chacon MMFN S.W. Conard F 11 . MM3 T.1.,Na1ak MM2 M. Purcell MM3 H.P. Saunders MM3 M.T. Spaulding MM3 I. Warren 1183 FA l.C. Cooey 4 FN B.D. Baker FA C.E. Barker FA I. Brandy MMFN Crawford FN Davis MMEN L. Deckard FN T.S. Burrows Inn,- FN R.B. Dillman M-DlV!22l DIV FR T. Dubasik 'ilu . ,A, . .1 A MMFN B.V. Furr MMFN M.A. lones MMFN T. Lahrman FN DJ. Odden MMFN T. Rohrs MMEN G.O. Szugyi 'slug f ,ff FN T. Gooding MMFN K.M. Key FA T. Mastrud . A MMFN B.D. Olson FN l.M. Sellman FN D. Szymanski MMFN K. Harris MMFN B.C. jackson rn., f I MMFN D.S. Klingler FN LC, Kohlbeck MMFN L. Mills MM3 B. Nonnamaker MMFN D. Ponds MMFN D.S. RameY .4 FN o.s. Shaffer BTFN s.T,srevha'1Y E FN R.L. Tinney MMFN l-P- Tf0"50" Y f K! 7 ,J 1 If X' ' LT H.S. Carpenter V Win.. 2: ENS D. Peterson 74.1, ,ir EMC AM. Dimaano gf fufqm If EMC P.S. Prestosa Y of EM1 A.O. Cruz fi ,, WJ LT D.W. Renncurrel IC1 G.E. Baker ,fr J ,.,,,1 EMC R.G. limenez EMCS R. Price """- 'Ill EM1 N.G. Datuin E ' ' .,,. ., ,off L ' ,. ff' -fi fy ENS M.A. Cabello SMIJKW: ? EMC M.T. Pimentel J mm I 'ul 5 EMC l.E. Regan ICC W.K. Rucker EM1 l.K. Bristow M!! .QA EM1 I. Fineran EM1 Q. Gaco EM1 N .R. Magadia EM1 C.L. McGowan -'in Y EM1 S.V. Castillo EM1 A.V. Piatos E-DIV! 223 i'W'ui,.f i EM1 D. Sanderson ""'- ri! i EM2 D G Brew EM2 D.R. Craig If 3, if -"hurl dv IC2 W.l. Feis 224 X E-DIV mm-I 'Nw IC1 D. siephens EM2 M.D. Baker EM2 A.R. aogdanowiu EM2 D.H. Butters Iii r ur IC2 G.M. Davis , if EM2 T.A. Gardner EM2 M. Herzinger '11 iw L4 EM2 M.M. Calvo 1-, g D W IC2 W.S. Davis EM1 E.S. Gloriani EM2 KJ. larvis qi I: W 1 . IC2 A. Case w IC2 T. Dodd EM2 R. Harrington EM1 C.A. lohllS0l' 'iii E.L. Mann EM1 M.B. lanes EM1 R.c. Little EM1 11 Q f x ' 1 . X1 fm .. 0 af-, ff:g?wTf x " 5 , .x w . I 'W N M14 1 X rp." 'Q . fx X1 3,j',g:f J if flgiyff. ,A ' xx, , ., ...L ' fwiz, f. A H.-,p iwz- ."4-lr, NQ11 uni 1.5-.VT . , K fxswf' :.' , QL.. W X L-..,,Qg4M:,,- ' f'lI-1:3 -..--,gx,, X . ,Y X iz'-N Q: A 4 W, Y2i V x g,Q ml EM3 W.E. Garland EM3 I. Gehringer '-U. '--.1 14 V EM3 C.A. Haase EM3 K. Hamilton IL. 1 ,f 'ls I ' Y! - 1 li IC3 M.M. Hodgden EM3 W.R. lensen EM3 E.G. Manganais EM3 W. Niedbalski 226 f E-DIV ,.Q,'7W" , ff vm.. , 11 IC2 P.H. Marchant EM3 M.P. Mayne Manu 'Sqn I ' 'Y I a EM3 DA. o'oeu EM3 x.P. o'c0nn0f .4 . '-lun. -4 lslhhl 1 EM3 S.P. lones EM3 S. l0l'd3l1 Q4 'ling' X. ' 1 l f 1 ll 1 1 IC3 I. McClend0n EM3 c.w. McNair EM3 R. McMuIlan ,ig A nm!! fly Q.. v l EM3 LM- Perez EM3 R.R. Powell EM3 T.K. Raines --. EM3 I. Gotthardt EM3 R.D. Hedgpeth gl. EM3 S.D. johnson IC3 l.M. Lynch 1 V ii EM3 P.L. Neetzel 'ilu EM3 S.E. R995 ics 1.0. Richard EM3 1. Shivers EM2 S.L. Sullivan l EM3 W.D. Vick EM3 E.L. Watson IQQ ' l if A FN G.C. Blakely ' EM3 B.R. Robinson EM3 T,C. Rose 2 a .iw EM3 M.D. Staton EM2 K. Sullivan 7. , 'Q EM3 O.B. Talley EM2 T. Thomas fi 1 , 4 "ff " EM3 G.A. Vaillancourt EM3 K.F. Warner IC3 L. Wickstrom EM3 V.C. Wilkins 'fini' ICFN D.R. Black FN W. Balchelder EM3 A.L. Williams ICFA C. Butler EM3 B. Williamson ICFA A. Butis lilug X - EM3 F.S. Wilson EM3 A. Zimmerman FA M.R. Cabaniss ICFA D.P. Carden E-DI V I 227 A EMFN B. Daniels ICFN L.l. Fernandez EMFN R.l. Gentry EMFN M.C. Holmes EMFN D.R. Kluber FN P.A. Lowry EMFN C. Davidson ICFN R. Duckworth EMFN M.N. Ferrell EMFN E. Flagler il f ICFN M.A. Higginbotham EMFN W.M. Hilow UIQ EMFN S. Howanitz EMFN M.S. Hunter ' Q ICFN 1. Lopez FA M.A. Lopez FN R.E. Means ICFN M. Mitchell FN LR. Morris EMFN F.T. Navly! EMFN P-I. Saile EMFA S. Sierzego FN W.l. Reynolds ICFN G.W. Schwartz 1 4' A EMFA c.w. Walton ICFA R.R. Wham ICFA W.A. Bange ICFN R.l. Bird EMFA IJ. Corron FA I. Fullerton ICFN l.F. Newion ICFN A. Strickland FN C.D. Spruell 'wal Ll I FN A.E. Yanna FA S.l. Brassard EMFA R. Gorsuch ICFA P. Kriegler EMFN M.E. Maslowski ICFA S. Oderwald ICFA T. Shaler E - DIV X 2 2 9 A-DIV if-Vw ing LT D. Thomas 23O!A-DIV ,ff I 'x ,W f , ENS R.W. Tack I ' A MMC R.H. Eden ENC A.D. Silva W-1 MM1 H. Bostwick IN MM1 P.R. Castillo -mm, W1 T 3 MM1 D.D. Folz f A ENS TJ. Werre MMC BJ. Bates ,J 1 ' MMC M. Manning MRC l.C. Louden MM1 Athjar MM1 H.R. Barnett Y, MM1 G.N. Brown MM1 l.M. Carino J' MR1 L. Fainield MM1 W- Fernandv Qin' MM1 R.F. Fortune EN 1 GfiSS0f" l 'FWH- MM Ag ,521 5 xi MM1 M. Henriques MM1 S. Kuester MM1 l,P, Rafael -. 3 MM1 l.S. Smith MM1 E.D. Wheeler MM1 l.D. Yancy K M 11 , Q V, gi! e,7,e Y MM2 M. Ahern EN2 C. Ballinger MR2 S. Bergstrom mu., K Ill MMFN G.L. Black EN2 Burlingame MM2 T. Calaustro wh. '-I.. V MM2 H. Gilliam ABE2 S. Greer MR3 M. Gross MM2 M. Davis MR2 K. Ekstein 'LZ 3, MM3 S.C. Guzzi MM2 l.P. Hadveck igm' 1 1 'I-lun A M in M um... '-1. , f Y xi f 1 'f ' ' H 2 M :ff M JA '1' .J -QA EN2 M G M lka EN2 P.A. Shibles EN2 1.0. Spears MM2 E.D. Ingram MM2 D.L. johnson MM2 L.L. Lane MM2 M.A. Maier . . e A-DIV!237 ....jM ""'u.,. , MM2 c.w. Richards MM3 AA- AMOS 11 ai 14 'inf 41 MM3 l.T. Campbell MM3 M. CarabaY Qu. If It .X A A MM3 T.G. Carr MM3 l.P. Dawson 'Wllni MM3 l.M. Downey 232 XA-DIV 'X J ut MM3 T.D. Candy MM3 S.A. Gilbert MM3 T.A. Baesen 'QQ ,f I MM3 D. Cardenas QQ , MM3 T.R. Dickerson MM3 L. Geopfert MM3 S.D. Gilbert 13 MR3 V. Bradford EN3 E. Cardenas MM3 F. DiMartino MR3 A. Gianetti N MM3 W.M. Green MR3 I. Healy MM3 M. Heine EN3 R. Hutchins 'W fum' lin' EN3 T F Iohnson MM3 M D Merrell MM3 P O Rosenthal JA A EN3 D D Wade MMFN M D Bucsls MMFN A L Cole 'mild MM3 R Locke MM3 R M Muller EN3 P R Smith MM3 P I Wllson FN D R Butler FN I Davis "m"" l "'l1m YN3 M Mayberger MM3 R C McGrath IRIS-l MM3 I D Moreton MM3 S Rlos MM3 P S Turel MM3 I Vlvonl FN B Afflerbach MMFN Bowers f-..'Jv ENFN D W Chapman MMFN N C Cochran .lin I MMFN W C Evans FN D F FGIIKOH ja I , I' 1 I y , 5... li I I f I arl' I 1 Q Y ' ,I Rl ' 4 C . V I f MMFN B.T. Nabb MMFN M. Rogers 234 X A-DI V All FN S.V. Nichols s Z MMFN C. Rominger A1 MMFN GJ. Paskiewitl FN M.R. Richards FA A.P. Ruelas FN R.K. Saurers FN LE, George FN R. Goodale . , 1 ' A MMFN F. Greenwell FA R.B. Guarente MMFN R. Lavallais MMFN R.E. Levelle 'lun 4 FN D. Mainelli MMFN Moore FN D.M. Richardson MMFN D.A. Riggs FN L.A. Shorty FA A.K. Simmons FN Green FN NMN A. lbarra FN Logie MRFN M.K. Moore Q i 4. ENFN Robinson I "H-,Jo A MMFN IJ. Smiih J MMFN S.E. Straub FN M. Tatham FN A.L. Verm 1 ""'1,, MMFN K.L. While MMFN I. Weiderhorn ENFN D.R. Wright MMFN G.L. Adams FA Black ENFA V.D. Bunn -..J all -r MMFA A. Davis MMFA D. Dill MRFA l.P. Doyle FA I-E Frye MMFA I. Haeberle ENFA R.A. Hill MMFA S.D. McCoy MMFA M.S. Penn MMEA A.M. Rolfe "-1. ll FN D.M. Wade MMFN l.L. Adair MRFA F.A. Campbell MRFA IJ. Fischer FR S. Hitt FA A.P. Ruelas A-DIV MRFA R.K. jackson FA l. lagodzinski FA Kreifeldt FA M.A. Williams MMFA A.B. Wolfe FA Thom A-DIV!235 +xgX'Mx'Qa'.'.,aj1j MM. hp:-L J3ll9M 'H Z.I.H S394-100A 'DT ELH Uolsmlll 'CI ZlH YI! I 1 ,!' .aagqaw 'HD ZLH A , WDIUW 'IH Z.LH 1039-'D9W 'X SlH as i A 3I9nfI 'VD ZlH Inf 2-H-1 ny... Aug 'ry MH uauvM 'yfg LLH '6,, ,, Af filli UOSMPG 'MD llH , , z A ,H- 5W9!lI!M 'TN 11 4 KBIUOJ 's'c1 un 49311215 'I 31H :ir lIl!WS 'TO 1.1 -'9!9W3U-'08 'V'd l'I If El'0CI ,h, SHO-'ls 'a un , hwy, Kvw 'Mo sm -U... Sewolll 'D'H llH 092!wvs 'v'v DLH wg '-D!U-'S 'H ELH lu... P'-mlwzl '81 ZlH vsf A ,Hmm- Ulvvw 'u ul-I lI3M0H 'HU DLH "i9 4949115 Zll-I l9!UYCI 'Cl'd ZlH lui. .moualpog 'VI l,lH ""'Z-2-f 311015 'FX ZOM3 , I , , HUG f 95K Llvllnu 'u sm fy A Salwva 'J sm Inj. , "uf SUM! 'A'W llH Y ZS Hwwnw 'To om zu. I '51 :- i .,1 - HT3 M. Belke HT3 l.P. McCarthy HT3 C. Virell 'Nm HT3 P.A. Wilson lil l ICFN M.G. Egberi HTFN S.l. Heller e-.,,, 5 FN N. Blanton HT3 W.D. Meyer HTFN S.P. Wielputz HTFA D.M. Blaclimon HTFN B.C. Escano FN OJ. Hunt lx , V, , , fl F lj! Wi HT3 D.P. Kelcham HT3 D.A. Niskern :umm HT3 S.M. Wilcox 'thu HTFN l.A. Bryant FN l.E. Goralski 'J HTFN l.L. Lopez ""H. . HTFN C.N. Leach "Ink, , , HT3 I. Pultl ig. I HT3 1.51. Williams HTFN C.l. Coloni 11-f 1 FN C.A. Hawn HTFA C. Louaillier 'Ulla ' , .V . n-il, I-in. J 'K HT3 B. Linnell HT3 DJ. Manthei HT3 A.T. Marlin ml g I HT3 R. Riedell HT3 B.E. Shaw HT3 D.S. Slerling 1 l DCXRIZ37 ,W . ,, , A ' . vw-v-'!F!33I-'fn-5.9-Y -- DC-R T eell l SN C.H. Martin FN M. Schackow HTFN SYCVOHS 4 -I z FN K.D. Ward i V HTFN S.A. Wilzbacher FN B.A. Greer FR D.T. Cancel FR G.R. Holland 238 X DC-R FR PJ. Hughes HTFR NMN E. Logan X FN T. Martinez 5 FN S. Mitchell HTFN C. St. Sauver FN H.S. Thorsen HTFN l.F. Watkins YNSN D.C. Watson HTFR R.K. Bell FA B.S. Ellwanger cj HTFR l.L. Kirby, lr. HTFR D.W. Newman HTFR W.A. Sigafoos FR T.D. Stroehlein FN W.l. Murden Zi FN T.L. Trower A HTFN D.A. Wenger 19 AA FN l.G. Gibson FR M.A. BroadU5 5, FR S.M. Thornton , .WH .3 1 - , .VW-,lv W " ' , ' , - ' e - ' - ' - jf' f 'J 1 7' ' - U' " ,. ,' m N M M l Ny! I ! K! NN DC!R!239 The Execunve Dmarlmml provldes a operates the raldllo and TV slallnns nn ln llwe cnfnmand and crew? The support no llne Execullve Officer lunclinns nl shlpg the prnvldes exnellenl cnnnseling nn abuse and cnnducn group r handles all nfllclal co legal forms and dssclpllnary cases records, the Legal Office DFQVM6 pnnled malerlal nrlglnawd lon bolardlg maintains rnorn man 2,500 enlisted other slewlcesl such as LD. card issue, reenllslmenlineparatlnn papewvmlcg the all dwlne wnwslnp servlcen and malntams llbranf, llne Pnblle Allan-5 Qfllce Dll'GVldE'S publishes the shlpfs newsmper, the Force ls llle ship? pallce farce, enforcing regnlallnnsg the Brig Staff maintains and pflsnnfefrsg the 3M Office lns adnnlnlslratlon and nmnnllnnrs slllpwlde llne blggsl morale factor nf mm all, lunch wlllw our loved ones by gmup nl individuals and ratlng, nie functions as a cnlmlvel team, sllflvlng and servlce possible, cNABB, USN md f nur, 4 Q umilidg , W H YNCS DJ. Roe YN3 l. May YN3 M.W. Roland YNSN S. D I Y uBois YNSA B. Delong YNSR l. Salinas NIS 1, Schaffer ADMIN X 241 .. x-W: VV f,g-- .-. CWO3 V. Teasdale VNC pl l e Myler Em. D.O. Hoyt S 191173 Sefremry Y V tang! ,L a' Y N, .YA YN2 S. Mayer YN3 D. Pung ,f 4 --. Z3 ll We YN3 I. Reichenberger YN3 C. Robertson 1 I f Z YNSN K. Chappell SN R.Ff20mi'1 'LU gi :,', .gg .f 242 f CAPT5 OFFICEMNNEX A ,J I3 PCC L. Maglinao PC3 W. Brookes PC3 C. Leininger PC3 M. Mead In , SN M. Garrett i T SPA .Gy PC1 P. Albritton PCI A. Ortiz ...Lu I fm-M, , V, , ' -, . W, M-- . ,-., .--.., -... .-.N -..U ..-.....f....f...,-.C ..-, f- . Q.-rg uc.--wsvzlvmywcngaswff---vmqnfaaegqxx'' E Vx,, PC3 R. Danielson PC3 T. Mathews 'Ulla PC3 K. Tucker SN T. Slaughterback POST OFFICE X 243 , . ,r neuonowf- -vat ,--. . PERSONNE . I 'fav 5 Z ENS D. Detera PNC R. Gil PN1 L, Clifft 1.75 Y R 2 PN1 E. Femandez PN1 M. Reintegrado PN1 D. Tabligan .ui , mn' f "' f """ ' V H ...H PN2 R. Bantog PN2 A. Centeno PN2 B. Cmz ig? 1 41 A Ml PN2 R. Devera PN3 K. crecelius YN3 K. Davidson slams: lj mlm has f Q I 5. f 4 PN3 M. Durbin PN3 1. Fluetsch PN3 W- Wlfkins 4,11 244 X PERSONNEL da PNSN D. Baccelliere PNSN C. Franceschini PNSN M. Nashiro PNSA L. Larson SR T. Obrien SN T. Devick SN W. Furia 15.6. f f, AW SN E. Romero 12 It i SA E. Alforque PNSN S. Emison SN l. Lieberknecht SN O. White PNSA K. Pruitt PERSONNEL ! 245 f ,"f"F'!"' ,. - . p-vanvvr' - QR' Q IDMEQQM "'F5i. .2 S LT I. Taylor ENS l.R. Fallin IOC M. McGougan 246 X PAO lO2 s. Duffy MM2 1. Lee SN A. Gordon mga, SN I. Patterson SN G. Wojyn A.,-Q. i fl! lO2 G. Henry nl 103 M. Hugen SN M. Pankey SN R. Ross IOSA A. Sweet 49' AR R. Hodsinf ug,- LCDR G. Theriot LTIG G. Maxwell RPI D. Granado RP3 B. Coleman RP3 l. Hoffmark RP3 H. Reaves RPSN I. Beachley RPSN T. Taylor 'Kiln' 1 Q? CHAPLAINS CDR M.C. Slattery Senior C lmplczin l 248 ! PRINT SHOP Ll1 D. Besler 'inn Ll2 P. Clapper ith LI3 R. Chapman LI3 K. Rosado 'Q SN I. Boykins SN L. Phillips Hgh! 'Nia LI2 I. Antes LI2 D. McRae LI3 F. lennex SN I. Blomberg LISN D. Derr SN S. Wallace ah l mm ,gm H 5 S HM 'mu LCDR c.c. Scanlon n LT P. Phillips MMC F. Greman EN1 R, ruanery 340 in: ' MM1 D. Sorensen SN L. Chee MMFN G. Wilcher ' i . 1 4 GMTC B. Gertner OSC H.R. Pace, lr. ABE1 T. Smith AE1 R. Stephenson --0' I W CAAC HNW rag -A pf -V ,:,f-- x-fp ,-- -.1-.. 1 .-...-.-..-... C 5 LCDR D. Bell l bf Z LN'l W. W0l'lll 250 X DCPOXLECAL or r A l"""f'1. , , ENS E. Meyer CWO4 W. Van Dewark Inn,- LN2 R. Roemmick YN3 B, Kloeck LNC R. Sexton YNSN M. Doyle ,oo rrA r V BM1 L. Stover AN B. Afflerbach f, f , SN T. Hartman SR C- Cook , 2 ol 4 AA I. MacLean FA P. McEv0Y 'O AN E. Erickson M3 FA R. Kerner FA D. White R li g in MA1 W. Perkins MS2 W Archambault ABH2 E De0campo AD2 I. Henderson BM2 E Hennmgs OS2 C Schlesinger A02 D. Thulin A03 R Anderson EN3 E Cardenas EM3 L. Patterson AMH3 K. Shanklln SN S. Chavez .3 "':'1f """""" -" 1 , , i Y-r-nfrw J SV BM1 A. Clayton el 11 l as-2 MR2 W. Dolezal Ex 1 AMS2 R. Morneault X . MAC L. Hicks mn. . mhz!! MA1 1. Eulett MA1 P. Knight MA1 L- Perlas 2 BQ E A02 A. Ferraro MM2 R. Filler Fw . A QV! AMH2 l. Grandstaff AMS2 S. Pappas DS2 M. Prater MM2 T. Redd ZDZ I MAA Mi-my MAC W. lordan MAC F. Selinsky MA1 N. Agua 1-ln... 7 ll -Bill--1 , , AMS2 L. Baniqued MA1 G. Pfaus ml ' , M AQ2 M. Hayden -1 JA ET2 T. McCann Mmm ex li ABF2 D. Saunders -al Y T ,'9-A O52 A. Reed aa!! EM3 I. Bonner AE3 B. Brazil lar MAN MM2 M. Brosemer QS. C AZ2 S. Mohawk AT3 M. Boney 22, ABH3 M. Bro0liS l 1 N C " Eff -1 x B131 MS3 S. Comer MM3 l.P. Connolley RM3 I. Eberhifl 7 . 'J ,4 Qi DX iff, J M4 ,gf 1 ff V J hiv? V, ? Q 1 1 f v f aff f Q. 7. 1Q ,, ,, , J 'mm gf ,Yi i f " 'v-Q. 4 i S . ,, ' KE". fy ,, Q4 If, ,W Ji E 1 2 5222322 ' . ff- .a. -, on . A ,, ,J n w 1 5' K 1' ur ,fm . "' ' -. av ! ...F pa. 1 3 s 4.','jx,', VU K .- ff' , v, A Lf, I . 'I g""., E f J I 1 xl , , I i 7' I X , I " '- x r , XP ff 1 ' -.,i , "A' 3 wl' Qzsgifff-Q3 swf 1 Q"- ,,s .,'f,,. , . 1 , , 4, ,rf . , Amy, ,, . '92 5. ff e?::- r . x.',- L, 'fgfgafgy-1:5 , . 77. Eiifigfiigc ' " ,K 45 .52, 533:13-1?,4'f': Hx, W' ,, 14, , ,ff , A 71.51454 7 wx W Effie? f .7 , 1-I' Y AQ. 'Wm .1- 5 Q f ' X 5 If A 2, Sq?" D-'K ,I .W . -f flfaf. .1 f " - - 1 ,2 f' if , ,Q wr W 5.55,-' ' ::,c5.55V- ' f-1'-:,'qi' .4 I ' , -1 7 ,-jf ' 5 --3 ,14 4.43 - "' Q- K -im: g 1 5:1 , A , , , ,1 2 ' , J. F ,X , 1 , 11:5 ' i, ,,.K. , L 3 ' . f. -Q x ..N Mm, ' 71' "1?7'?'f:-v-VM. . , W, ,jg "' -. ,fm I V..., 5. 1 9.733-,fx I , H f 3 4 ,X 591 1 1 f ll ,, , ,Q ,,, ,.,a fm ' A M... :' yr r i 4 i 1 1 sw ,, s , I! I P lg f . , . , . z 4.4-Q-af:-.-Q:-,-Pg'7!:1?.51, ff 5'-11, -j'r '-giJ.,L1f-'-.Lim ,1--if 3'-W2-3 :f.:,..-.'.' 5, ,4 , If N, -57 , ' I V. , V , , , , 1 1 N 1?-' - 'V - V 5 Y , P i , 1 'I if ' I ,I 5 Q 85 al , I X Y 62 Yr E Q 5 Y , X , , i, ' jf km 1 I , , X, XIV -VT., Nil' 3 If -il Q 2 ' A' HA ,f i-5. 1 2 14 ' Gp 5 CAPT M.A. MOHR, USMC l 4 W I . Commandzng Ojfcer ' 3 A . . 3 E ,.t,LQq.i"-" ' . -If ll 5 ' BU S T , 41786, r ,,,,,- O f:r.mn1'n Lp -I- r '-325 ff T. l A Q ,3,:?j H -2 ' Q ' Z Luaig f 1, A 5 y f .67 ' fi Z! 53.5 57" QQ: , l .,':l.'.Vfyl? Qy i '2F.INE C0 l I . ' L. fi 1 ' T1.mefMkQ1f1iuime IDJeifes1dmmmcs1mi is Q QmimeQUIll, cimmmmamxql m'MlIf'a'AN Al'lw"q q WEN, Q M Q Mm M52 mm Sm 1A l K QW W ali-xfpawfdl time IElN IT lE IRWQHSIE camo fd auf 52 QF? - wwdt'A7crQ3 f :.'L6f1f1"'1 " n- 'W Q -5 S-QIQKCPM m.QgE,,f21Qw,n,Q,, M,.,9Q Lwu11 u 1SJ 5 if 1 IQQ,gA I '+I -g ' "V 'Q A' - H"-'CQW55 5100 f lrl llJQg-gfrilu U " CKQDIQF IRG9lQQI lI lnfllmg UIE16.1LlirUi,LmCrDlfai1ZQ'?iriI bJCc35QufcQl3WuQfS, EWSEQQ M39-f'3?m3f3V mf'55','Q'Y1W UMW? MGQJTQTDQ HQMQ lrlhyg lHilCQQ2.1CdKQpuQsQ:fLfQ-Qsfss Plllai am Qs ufcsgaamsffnlbpillee SQ-'par l,mamlI l: 4mg QIIU I g??CM"m q5 Mldf'm'Q1W'-' mf'55i3'0Q5 'WC 'Q'Ul'ffi'C? f3l55m5'Y13i3SfviiEQGfive Gmeumcctiicfmumgs ufwlmnifmi by amy iwmcdle-xQe:mcdEm1uQcmm: mQ1ivdI ' iQl'?JQfFK3R7mQgiW?E?frV' 1Qg md mf lImEQuH' 1QQ'f 'pM'f5'l" 'GmQ'mg' and 'Q' '1fQC U'WS2ff www? laemaw lx gf - ---- - " ' 55 U -U 5 QIHO 00 455, Ailno lime? CQ1DT1JlQiMrKQwlf lffZG-3611 Mimi IDDEQW Wlfmrfriih rHmQIMiQIE 1 c, Cfmro uf 'pew' - v - V J .. HK 0 A A HA N Q 3 AQ 3.1 1 an Q ,. W A me A Q Q .Af . Cfsccpamrmgll CD1 r6lQ?u,rs ami QIHI Qy1,mQf Glu A A Q SHA L"YffPwQmmKQQQWfmG?m'0 W9 MfQ'fUli2Q DQQeQgifl.WmQfQu us AKirmm,umu.1swe1uuQmQ We IHICQQE Owngslmeem Qt,lewmQ21mig army liumQl 1LmiQ,ulhne' SH 1fQQF1Q'W?l"D' 'f?LQ HWQ C1fWMWffi'fWf2 QGGHGQY cw cgmmqu NCQ me swggmy NCQ - '41s ' r' - f -0 "G-QOUQI 'WS R Aitrfqefgcs affQT"l HQf T' of ' H 4 Nw Tffwfrmo I IMEMMQ QQMQE My EQQQW HJ 5 Q , V A A Y A . 55 ,L Qlun vlj' ,wCLrLqmu 11.rEQl,lrml,numg Qu ,mrgrfnulfy ,v ffJl 4v nQ1Ng5g , , - A , Q . -1 ,.1YQJ,uQI,QfnuSsIim1.ssf5sucoJ1m me WQDeifQwcclh1mf'ncamu Us mask T1m,MkTQ Q Mb? A Q fm 1 A- 'v'VHAdLm 1 Gwlligfmufrifeqdl fnumiicb Q fHlC9aDGfkQlLrLEJfLiQ31fg Pflgjv jq A AD f" A A K 5" -2 G 'rum -QU U-U' DCD SLu?JCl,WlHrDQlmu QC-SWE uiRG9u1,r Z Wan uQv1Qn r x Af.1T, . o , , . -1 C- .U .QWCQQCQMQUSJPUQ Swv qppggr Dv M ,. if fl .,. Wi WIHQ CQ.u1r21n'fQfIP1laL dm . .. Q O A EIHUCCDIF, oucfislulucam amncdl lH f0.fQQQucmmal,Iuwm wfI mI?m ELEQW un f . -W f- , , ww dm uwmafngalfuw Q1 me Mkam-mms W Eg, V A E v ,, C, - , ni ,D UV ,M Q ' G- 'ima G-DU INMQIAVIYIME5 UCQIAI' yQ5.xlIfg?': , A, N ,LF , , U., .0 r ,C .A . ,5 gg mggmfecjg oo ,. ,A in 9 ,Q U T 'AAD M5 J, 5 Y I f'H'iQ1'f?"i"M3H'373 CQ'-'U CQ EamQ'HMmHenfn1,11ksZ1mCnAf0I pagsifcpgilmd Hd an :nmQum:cfm:we,m cCQfmmlQllQuQwI,1ul WQulH el 4ffD0QW QW - U-016-'N-Wk?-W'Y11? H 'I3I'Q- MSCS of 0 -'ei V wimnufncre 21mJf i':"" id' - O H ' -f CT 0 .1 ,, . I , I ' QQTSQIQH amd aCQFlQQWUgi1?0l7iiLrD61u Qgggm umm Img QQ Umg dmamgigmigfil Ulm? QM 1 A W MDC? VV1Elfi QHFQ EWEJDIM EQ rrelgmmd 1159 my - A .. ' f ' A F 1- f f Y 4 ! -1 1 fCQCQ1Lu1:ufcesuhe cf2JfQQ1boaI,Iuifuc-29 Q6 an cccmmmlmat Fri Qu CQW FQ UQsm"fQ R MNID5 USN uw I 1 5 I 1 1 5. + 1 l ' , ' A A ' Y .,' , 3 -F 9- -I-T11 .f-E5 f :":,N.l.-Q.: -.. -. . -- ' K' :.-:f..1f.1 : I if - -,-J . .,., -f-f.. N- 1-02,-E-, at-f-f., ,., . -.1 f..- : - - aussi: pp ,ff-5--. v-1- Lf- ,, L- .- A N'-1-E-.f.f4,':-azfftkffreh... . , 1.Sax3:ss5Q?51 rf.-:-f,5,2i-19:0 Xa-ze: Z1-fi . A 1 1 H? 1 1, 41 ,uf all ,Q HY an ,F A - :-VN ,-:X 3 ij mf,,,,.,, 15 . 4 'f 9 . ff' Qaffgyy, -2Z,::',""Q 'Q' I 'V 0 w 0 , , 7- hm 21 -"1 . ,fav-7g 4, J A , .31 4 .2532 'f - ,BJ 11 b P5 S .U , . 1 fy r' V' 1. yy, 4459? iz '5.'f'Gmf' 5 we Q ., .., "' fs If H -Ln YQ .-1 .5 . . .1 W1 5134.33 :X X, Y TQ5El.l, 'lux ii . if .fy ,A ,pm ,I ij Dj 'fx' , fl, ! C' .4- n':"faa'9':Z- Ja , f g 3, Y 1. , qi 621' ,A ,y , A N1 515 is vj . , V Y I - - - I If , V - v Y - - . S ..,-11, I T I I I 1 W Q . .lf V 'lf Y ' , . -' ' x ' '- .. A. '--x- - N- ,- f .,-, V. W- f ,, , ' - - - f- , - ' 5 - - P , Y',.- -, ,. .-.'.-,-, . -L -:-'..'- : -' '.--5 . , J -- , , ' ' - ., 'f flu! - . -' - r'4111.1..-pu.-gifs H . N4 11 ' 1 J 'z W l U I I 1 5' X l w l 5 U .1 .J Vi ' I I LI i 4 v -1 Iii lf? 1, i, L15 lg' ,1 A 1: I 4 L F I 1 if , ll l! 'Wim ,,, 4 F 'I ! 3 , 3 2 Il :V ' r '1 HI ' '23 M . it ' fi My P' Q -' :"I PM 'nz """'h ' , N ,.,.i MARDET 3 258 I MARDET LCPL l.L. Weston LCPL R.D. Wheaton LCPL K.A. Young ppc, F Aquino PFC D.M. Bair PFC Barry PFC M.D. Blair PFC LJ. Ebert PFC Farley LCPL N-I. Frieler PFC G.T. Gozalo PFC D. joseph PFC D. Kingsbury PFC R.L. Malone PFC C.M. Martin PFC Martinez ,I ' ' I hulk- tgi- Vx f Q5 mkhh F 1 PPFP P 1 4 ,,,. ' , X4 1, ' F 'M F 'W . F F PFC C..l. McLain PFC Morale PFC Pearson PFC Qllifk PFC Roach PFC L.l. Samuel PFC Simon PFC A.A. Stokes PFC Wilgrea P MARDET X 259 eff? v 'l mmm, 'l I lil 'iT'l"' CDR DJ. MARAIST, MC, USN Senior Medical Ofjqcer T Medical also plays a large role in health maintenance through an aggressive preventive medicine and shipwide sanitation program. The potable water, for example, is tested for human consumption on a daily basis as are the huge variety of foodnstores brought on board. Annual hysicals, immunizations and sanitary inspections are conducted by the Medical Department to ensure the continued health of the crew. The end result is that I ENTERPRISE remains one of the cleanest and most habitable ships afloat today. X, r-Q ,Z 'Wu l-CDR MJ- Grayson LT l.M. Squires LT T.C. Falvo 4' wq,,K,f :V nil- E 2 LT M.C. Olesen LT B.W. Wamsley LT l. Williamson rf SX ...J LT l.W. Taylor CW02 B.C. Ross HMCS G.R. Prater , Lf. I -Qw K , T HMC l.E. Brewster HMC A.B. lacobson HMC H.E. Wehry --1 11 HM1 P. Falcetti HM1 R.M. Llagas :High -in L mr Y. "Y ifllhf I- ' HM1 LE, Lewis HM1 R. Paden HM1 D.R. Reese ,,,, , ,V V' , H ff, , , 4 .Jf A . V ,iff ,,,, ,1,f5g4W1 V , ' y ., 3 f", ' 3, -am -:mv ','.5 MEDICAH261 MEDICA Ill HM2 AM Cardwell HM2 D R Cobb HM2 L 0 Coleman HM2 I lesseff 'Dun 'QQ 1. HM3 R Demarest HM2 W F Ernst HM3 W Holloway HM3 V lohnson UHHIII xl HM1 MW Roberts HM1 M Wlllls HM1 HM W4-,ods 41 HM2 R E Ross HM2 C A Weidner HM3 A Awdaca N HM3 S Llvlngstone HM3 D R Markel HM3 D H Muller 'Q ,l l l ll ' il 262 f MEDICAL 142 41. , f dw' 1' Qff 6 I ..,. n, ,, ,157 ,Y-3, , , ,, , my , 115750 ,gfgggg Q,-f, f - W W of 1 Pic, ,Ng pw 117 "Q V -, 19.1, , il 2, 'F K 5123ff,a,, I 54, ,HJ ,fi ,, 1 Aff, 3. . M' . ff, , , 11 ,. -,,' 22f2f:F:,-Lf,.E",P'f-f-,'n'ff.5'-iii , 9554452 Hifi' F" ' 'fl -94 wff,.f',g,G'.,g42-p,q3,Q,g M3791 'f . If ' '- ,ff Q42 I -ffl "4-5 "Eff ':"-S., V -H W.. rf 'lm ff ' f' ws EMM aff? 1+ fg-f1:,+-,sw if ZIEWEW yn ff-1,.:4Qf5w 1, z315Cg'1"-Zi'-fu-'. J wfpff .,f ff?fv,n,wyf,g. .1 -.,,- , xy ., A l 4,- vf "f:0.f.,,g3fM,5Q : 1:-zfQ?y1,,c,' 3 , 'Zag-Qf.h4A24a'i Lv-1,-f,.,'.3g, f mzfas-:4 gfff , we ' Mi" izfwhf f V' "QW" 'gm f l,4.5,1'1i-13,5 Q' lkll f 14 A FSS? ,:Q-:fffv iw .X f .fb 4:,5w:.,f1if'of' ' :uf -,f'-3:1114 ff M .um 36511144 'ffwf .' i-'Z' '-,ayzgfyi ,V-1125" 1-' -fgy: J 5121. ,,.Q:'11b.'.ff ' " ' ' ffwffi' A --U, R . wil 4 - 5 - ' -,fm 1. . If K. ' n frilga , by Q, Pj, . ,, -1 , I PM ,A gg : I v gr' 'cc . 1, ,,..... . ' ' 5.- - '-w-.- 4- --1- 1. 5'-H im?" C W ,D V, ,,,,,. , , , eg, hw., ,:,,.k-, ,..,,--.1 2' Q- T431 g xr, W , "':' ,..--a , ...,-F. . s....,'ZT ,-,,,., L , , .,-A-. --- --M: ..+-,Q.... -Q---1 .JA --5f',,1x.-'avi-J --13::?5'L 7 'S' ' " ,,,',?':4.r-, 5,.Q., i,..,,.V-5, -1.:-.1-,Q . ' , ...ng-15, .4 . . 1 ttf - 1:5-1:5 - - -N- NAVIG TI 264 I NAV .41 . ,, . N.. 1 A .., ' .. '- fs, N, is U N l I ,.,,..Z7,- gi, I ' 1 ki CDR R.M. EDDY '-eq... N awgator jm- Aazi' , . ' l lx. L. .X L, x f YA deff' Wi' y xl, A V. f 5,535 - . f- - ,rg '- X N M fi: 15554 xi ..X. ,, g -A A . ,,,g,g,' 3 11535, N xx V ,NN b A 4, V? .gm jf? . 'KA' ' L, "JL - x f ,.uau.y,5b f- my ' Q y , ,f-ye 1 Q! . X. ? A 5 AX g . ..., ' " 'W g , 1 W ,X-,,,,,,. .f-Aw. . b 1 - J Rx x 1 1 kgs gg. Q Q ,N ilu. x ' 5 I Q X .. x 4 f A 1: - Q-mfwx-'1' x - ' ' fav NSEETQKXSZE' .'-x-- -flifxf' X-'HEElEfT?fLxTfiX-2-3 Q -PB- , . Q, Q1 . K 1:1 ' ' " - gsf-114 --Q-Xie -1 X XX ix.-Avail firw WEE-3i::51 , .a v'-f X - 1 if 9- It-5:x5-:4z,5 viik . . 1' 1 K ,. if ffiiziz ' S5 ig' 'ff' - T vi Fil '33 f 'H- .V V. 'P 5 ' kk K . -- X.X,Qg2W . g - V 5 -Q YEi3ifx-- 5. ws -.WT -X E:g,f,Q-f' if-, wx . x 'fii 114l. X A I z x.X5M,i:,L Q- 5 Q- l , .-new .1 K M, N. 1-5 . ,Q sf?-S 1 " ff? - -- i X X 1523, Tfgfi, 2: : A. -11-,-'? 4 F54 5 -11-., . - -5 nv" " '7T'f'-" "W"-2 Q A-A -if ,5 Wray Q-r-z-"za-ge.-f-:L-L.,1:..fi1-,11 17 1-1: pff it 'L 1 2-Y' 5- -" ' T " ' ELT' '- if LTR? fi71'?3'T571T:?f7:'7I5??I-'.'3T-112735' -1' W' A N- , - , , ,, . . Ll W df vb, 'Zhu , "H+-J. LT W.T. Shortt LTIG D-W- Rencurrel QMC T.A. Wilson 'Dinh ' , may ff 'Whiz QM1 l.R. Kincade QM2 MJ. Callahan QM3 D, Dgminiqk IV fr J f i W K A iam. mmm f Y f R - BI 9 QM2 G.C. Erickson QM2 M.T. Hamling QM2 B. Langenberg Y 5 uf P 'If' 5 N 1 M, cf N lf? 91 a , M.. W ,aff K' ' F F P ln --N-Al NAV! 265 xi-ff---.J ry f4!-'hinri ..-,- . ., . . r,-g 'K' " fGZ-'ifvi'7xp- ,iz ' 2 XX ws K , 1 i',' U Q k Y o P ff " -. ' fmy r ' '92 f 266 X NAV ,-uh. QM2 I. Osborne QM3 I. Browning V QM3 A.R. Exum r -M-f H QMSN G. lacobs n 12 QMSN Walkins N , r sw. , QM3 L. Barton E, QM3 P. Coulombe QM3 L.B. Page QMSN Huertas QMSR Gonzalez X x ' 7" Y 7 ' 5' L 'L " ' ' ' , .' 1,' :T-I4 -1, -.J-V, .-.J a , F , ,. , , ' ,, , . I . - L , -Yr , . , . V, Y . 4 f.....f 4 .., x.,:fV ,, a,,.-1--3.:,-ur -N: - 1 ...Q , ,Q ' -,, - - . v .- -0 a E Q -'ix F?-1' '- -' . : 'i 5 -L -"7 , ' I f ' f " .1- A- - Z 3 '- f-":1iQ1'::?2 ff-T2 55't'f'--3-1, ".71':4'E""-V.'Aiff-7.ff1f? i'ZI.,. .r " 5 f - L ' ' ' -- , V . ' T-Z-I-255+ rv ,I 4 .4 f NAVXZ67 ifvsk'-f"'H F 7' gl! Wi' IDRC CDR R F PURDY USN Opemtzom' Ofjqcer T The Operations Officer is responsible under the I Commanding Officer, for the planning coordinating and executing the Operational Schedule of USS ENTERPRISE and her assigned aircraft including safe night and foul weather operations of aircraft and ship s logistic services The Operations Department is charged with the responsibilities of collection evaluation and dissemination of combat- operational and intelligence information for photographic services for meteorological services for the maintenance and repair of most electronics equipment including equipment assigned to other ship s departments and the operation and maintenance of the ship s weapons systems. The Combat Direction Center KCDCJ is equipped with a variety of air and surface search radars, modern ' communications facilities, and sophisticated electronic warfare equipment. The Naval Tactical Data System KNTDSJ is the principal system used in assisting the Commanding Officer and the embarked flag officer in the exercise of command. High-speed digital computers, display consoles and data links present a real-time comprehensive display of tactical air, surface and subsurrface information. CDC is primarily concerned with the supply and flow of information pertaining to the tactical situation for ship, group or force operations and the dissemination of this evaluated information to the units concerned. , Strike Operations is responsible for the overall scheduling and coordination between the ship and Air Wing for weapons employment and readiness training and prepares command UNITREP and OPREP-3 reports as required. Combat readiness objectives are achieved through long-range planning based on operations orders, letters of instructions and other tasking from higher authority. Daily Airs Plan scheduling depicts immediate ship and Air Wing training requirements. 'C 'Jf'-CZNYQFZS .5 1,129 I X- - ,-1: u if 5 v -415225 gffav-:5.zaff,g:-L52',.'gf -4.,fnf- ,QP-gafzf -if - - p:-ff.:.,f,g,1 3-1 , f r Lzizzaw- '--v.ffcf"-...R--1 ' , q , 1 - ,,, ,. ,, 'E' ' A " ' '- fx-, - ---Az -Q -mm.-' 2- an-'-'P-'f"' -f'-.v V yi'-'-7"fif ,f-- ,. .- ., ,A A 1? V 1 J 1 I N, 1 4,1 .. ilfii -2 iff?-j5',E?iSgfjaf f:f2?'ff2uT4Z"aQsf1:f2f. ,512-.afefzm-' " N' ' ' ww- . fletzmfg. ,ag I ,,k4 -Q. fl ADMIN 1 A K ' "l""l CDR A.A. Nichols LCDR D' C0nklln f' V ig LCDR MJ. Guertin x52 YN1 R.K. Kennedy YN2 0,5 . Harrell 42 'Ginn f DP3 S.A. King YNSN H.M. Carr SN E.L. Ingram SN B,K. Roy 5 l ' r ff 1 GQ, 27O!ADMIN 1 fl Q 'lib' ut Z' ff mlilli L ""'3m,, 'G-I ,J CDR R.P. Rose LCDR WA- Carpenter LCDR C.L. Deming LT LA. Blanchard LT 3.1. Herman We l J I A IR GP r- ,fax Halal 1 'JM C K' LT l.O. Myers ACC C.l. Burnett ACC R.D. VanWinkle 2 AC1 R.C. Hall AC1 L.T. lohnson ACI C.T. Ohl AC1 W.A. Tumer AC2 l.W. Calvert AC2 TJ. Fabry lllly N li Q a 4 uf -1 AC2 R.A. Fairburn AC2 E.E. Hehir AC2 L.D. Hester Acz c.E. xleansdnnaan Acz 1.1. Norris AC2 T-K- Sfeele AIR OPS X 271 AIR DPS um AC2 K.S. Van Hee AC2 B.K. Yamada AC3 QA, Bard f V fg I J kg... ff 'ul """"'f 5 11 "Huy AC3 K.W. Brill AC3 M.A. Carter AC3 l.l. Fraga Z A A X , 1,1 fa AC3 Huffenberger AC3 R.W. McCoy AC3 E. Nall 5. 'QQ AC3 D.I. Sanchez AC2 B.D. Sharp AC3 D.R. Trevino if as K ,f l I as 112 fl- L 5' V a l A AC3 S.W. Wilcox ACAN G.L. Ennis ACAN Kinsinger 272 XAIR OPS ACAN A. Torres ACAN 1.L. wood ACM M. Pera l l CDC f X Im CDR l.W. Williams LCDR I. Kelley LCDR R.l. Messersmith LT WJ- Al'ld9l'50l'l LT B.A. French LT W. McGrananhan ,Q 1 '- gf' . ,V v ight. 'ba' LT l-T- POSCh LT R.W. Roehrig ,X 'fiim' . mm all OSC R.W. Franks OSC P.A. Howe con H. Highfill 'N el' LCDR T.R. Lilile LT D.W. Failor LT L. Payton , mini. , ultra LT S.L. Wilstrup LTIG T. Greene ENS G.L. Dukes 1' .,,4, E' 4-Us Umm AWC LP. Newton OSC M.E. Niebauer OSC L.A. Reed TIL I ENS R.H. Payne CWO S.P. Skidmore vm. AW1 D.H. Bell AW1 PJ. Boundy CDCXZ73 E OS1 FJ. Delp w?fv 051 QW, Ladd OS1 E. Perdomo AW1 Stufflebean 274!CDC l DP1 R.O. Sullivan Q... f A ll 051 B-M. Walker OS2 B.M. Birkenmeyer i K ilruq Q1 V AW2 Blankenship OS1 W.N. Chidester OS2 M.C. Clark s Q1 I OS2 D.M. Delnay OS2 P.C. Fales DP2 Frick Y N3 ning Z Qllg Ewz 1. caster DP2 1.0. Gilbert G- Hendefwn AW 'lung' HI vnl F. Holbrook OS2 G.W. Houze 052 W. Hllff , Y Q s 'W . 'ff-I f ku lug 'jf 1' lx Z f x' ..., 'ggi ' AW2 R- lohnson OS2 G.E. Kane OS2 G.A. Klein nab? Lgjnl AW2 Lovera ig. 052 D.R. Payne EW2 D.l. Wells Aws 1.L. sandy IW. .wa OS3 C,W. Click OS3 M.B. Elceser :V N., 4 I EW2 K. Moscardini OS2 Pohle xv-V Q., AW2 B.S. Westin OS3 W.P. Chester OS3 K. Curley OS3 l.L. English EW2 I. Nicholas 1 ing fi' 1 C : im... OS2 R.W. Shell y L H OS2 T.W. Williams Ll -fig., AW2 M. Nielson AW2 l.R. Noyes ilu!! 1' Y S rm., Y CLE! OS2 R.A. Simmons OS2 M.O. Smith T! 5 1 EW2 FJ. Woods O52 l.L. Yost 2 w J, C CDC 'ilu , O52 B.R. Slone gd AW2 T.D. Zimmer OS3 A. Clark in OS3 S.O. Dee OS3 Farmer I 'E B 1 Q O52 K. Tealer l N Y x A os31.A. Bell CDC f 275 F N f EW3 W. Scace OS3 l.C. Sloan O53 B,L, 5 276!CDC Pears OS3 R.C. Stuart HWY EW3 P.G. Cac AW3 Greenfield ll . 11 OS3 l.R. Leidner gi OS3 H.D. McCain 1 f OS3 K.A. Newman OS3 S. Provencher 1 'W l OS3 Thomas O53 H. Lee 9 fig OS3 G.D. McCreath 4 'Q OS3 M.A. Pengilly if DP3 Ramsey ' Y. EW3 B. Upson f. fs' l i. OS3 l.T. Hicks oss r.c. May OS3 R.S. Mercado Wa. AW3 M. Poyet lag' 4,4 , , .J .ffl 053 R.E. Randall OSSN RJ. Abbolf OSSN D. Alatorre DPSN S.l. Garbett OSSN D.P. Gunn ? EWSN S. Lewis AWAN H. Potier 3 4 OSSN D.M. Davis 'Ui X!! 1 E I ,Z ,X OSSN D.V. Giebelstein OSSN B.C. Henning OSSN C.W. MCNutt EWSN D. Undheim OSSN I Desaulmers OSSN Egan EWSN C D n e ,W , Y - . . , . YA., CDC 4 .,,, I un- EWSN R. Gilbert OSSN W.K. lohnson OSSN M.L. Poage OSSN E. Waksmunski OSSN M.B. Watson OSSN l.L. Wilcher AA A- C3l'Pin0 CDCXZ77 1 P CDR G.M. Weborg 278 ! CVIC CDR W.D. Lynn LCDR R.A. Davis sign. mln. -J A ,away f x LT l.L. Dufeck LT l. Sheppard h,g l CWO3-T.R. Burnett CTOC R.H. Harrold IS1 M.l. Ferrari CTR1 l.H. Givens 5-..,,71 Lili QYJ . ls2 R.G. Foy CTA2 S.R. Rider +1 Ji I. 'mu 74 L 'i 'dig ISS M. Cifarelli CTO3 D, Donaldson Y 6 V1 LCDR T.c. seigel LTIC L. Brooks UQ fi IS1 H.M. Cheverria DP2 R.C. Boyle 'un Cl'O2 R.V. Wilt - 1 1 isa R. Fitzgerald 'Q 5 fwgfff' ,P 7 Am' H4 ffm, ., rw, . V-V1.4 f 2,-vf ,ff 1 ,,.f. 5 'fp ,H gm W, Qw , M5 , uf, I , fuss 2 A1 ,gwjy 1 I, 4 W ' N .U fn wt 1, I 4 ,ig-4 , f ,, U L 1 ? 'wil' 5 ' . Y, V , ,W AL . , .5 ff. , ,- ,,f , X ' w 11193 fx L. Y A ,gft 41211- 1 ' - 'L'V A ' 1 -f-:Q -v C95 . 'fl , . ,P i is D it . L in N ' 5 I,-X ' 280 1 EMO Elvlo LT F. Severance ENS S. Ferrario i FTGC I. Durham FTMC T. Wooten J , Y...-.-T 'fr 1, ma .JT CWO3 W.D. Flury T' ' Ya X., A ETC T.L. Beller DSC SJ. Elman ETC K.E. Hillard ETC I. Mainwaring FTM NQNQ5 'j ig.: C K.R. Olsen LTIG T.I. Deilz ENS E. Ornelas i E fx' CWO2 C.G. Gower -Q J DSC M. Bradford Q. DSC I. Segida 4 'i'.J ENS T.M. Bristol ENS M.T. Vaughn Nab. mf! Fl' CS W. Umstead S E-vang EI' C E. Budack f mm FI'MC L.R. Wills x-S82-4 '- ' ,g g I . son ET1 D.F. Anello DS1 G.G. Clark DS1 F.M. Franco ICT M- Hams ET1 D' Ham I Y LL. Q., 41 7 ' SZ DS1 Hernandez ETM1 R.B. lames DS1 I. lardin il., , AX1 R. Merritt DS1 R. Midence gxhv 17.1, 1 '-qgif Y ss D51 C.V. Kass MM1 EJ. Labee ET1 C.E. Macon lbw Y ET1 D. Parsons ET1 M.l. Real AX1 R. Stinger L DS1 C. Umphress EI'2 l.H. Albee ET2 l.L. Allen ET2 M. Anderson lC2 T. Barlow nm. ,5 i , Le1i!4f,ib.! ET2 G.L. Brooks DS2 S.R. Bryan FTM2 G.M. Busby N41 lixi DS2 Chrestensen FTM2 Cunningham D52 R- Feemiiel' EMO!281 EMO Slug tl. IC2 V, Fernandez D52 Fitzmaurice 4 2 V 282 X EMO inn, FT G2 E. lacobs RQ! D52 I- I0rdan ET2 R.W. Kerr ki I ET2 l.T. Knapp N lf, ET2 H.L. Martin 'Ulla f N FTM2 RJ. Paul H 'I p in ET2 T.E. Reynolds " f- -ra FTM2 M. Sherman ill Pig ., 3 D52 Liwanas ET 2 T. Magann 3-45 ET2 P. McCurnin E'l'2 j,A, Moore 1 if rr f Q R Dsz s. Pavelec D52 M.A. Prater L' ' .2552 FTM2 S. Richards FTG2 L. Seitz Ilia f 3 f FTG2 P. Stearns DS2 T. Stouras l?l'2 D. Thornton DS2 I. Walkley i 1 Y gill: DS2 l.P. Wolski DS3 T.l. Baker 'hnl K1 l ET3 A.o. Boyd Y, f . ET3 D.A. Gacke FlG2 D. Transue H2 W. Wallis FTM3 C. Baguio DS3 T.W. Black 'ulfuf 'irq ET2 P.D. Valind S .1 4 'lf lg .Y .' S4 . KBC FTM2 S.T. Wicks 'L ET3 T.G. Bailey ET3 R. Benson Fl'G3 M. Brodock Fl'M3 I. Campbell ET3 B. Coons 11 'aiu ET3 T. Y l""ru 7 YV 3 .43 , Gaffney ET3 Harrington FT3 M-5- Hur-I g X if Q-14.5 ET3 V. Costello ET3 E.T. Dean ET3 M. Kibler l I-TM3 W. Koonce DS3 I. Findrick DS3 Lancaster E M O X 283 ET3 T. McCormick ET3 E. Newberry 24, lC3 R. Sailors DS3 F.l. Smith 22 ET3 D. wilbanks ETSN C Habo'-'Sh AN I Lamore DSSN MJ. Nagle SN Slmgerland HSN D E Upshaw ,,,,-? .1 LT B.F. Moore PHC R. Engelhardt .awww n E ml PH1 R.C. Bennett PH1 D.E. Douglas ,R-1 Ll PHOT0 PH1 T.A. Grube PH2 l.T. Christian 7 ul' -Hu. PH2 R.A. Merckx PH2 R.A. Rupert PH2 R.B. Trembley PH3 B.H. Boleman mm. I!! IV yr PH2 KJ. McCreary PH3 l.R. Russell An., V PH3 B.K. Fasick PHOTO I 285 V l ,l l ,l el' fl E P N i 5 i l l 1 V l li l l ill Y l l T W l M i P H Q Q l l N "HI: l f 'Q-'lug J H, 1 V3 l PH3 Hamlin PH3 LA. Roop PH3 K-H. Sanders PHAN l.R. Allen z PHAN Gappa PHAN B.M. lohnson PHAN R.D. Menard PHAN M.W. Pick PHAN D.D. Srdoc if ' f I 1 a PHAN D.E. Stinson PHAN D.A. Watts PHAA R.F. Helm PHAA D.W. jackson PHAA M.D, Mungell l ll ll ll ll !l l 286 X PHOTO f if f -,117 Q. i CDR D.A. Mautner AG1 l.W. Carr AG2 GJ. Comfort Y 4 AG3 E.R. lones AGAN B.V. Hehir 3 AGAN KJ. Poole ,, M AGC R.A. Ward AG1 D.L. Dennis AG3 W.A. Batty 'N-. AGAN DJ. Cyprian AGAN D.K. Irwin AGAN C. Riordan fig 1 AG1 D. Banks AG2 W.E. Anderson AG3 R.l. Glenn AGAN M.A. Harvey AGAN W. Kluss AGAN GI Lltzenberger AGAA Diekmann 'lung Q f. I, N r ig. i i, U kv tl 'VL :L- 3 1 H. if 1 lj Jkngv. ,M l 1 I EQ? R 5 W 4 g w 3. 1+ nl fr I -...N- ,D Ng 288 X REACTOR vi F f , X' I z ' m I V e A 2 sf.. rr MMC K.S. Burke MMC P.H. Burke SN T.A. Williams YNSA LL, Mills 3 r LT K.W, Byrd LT Schmidt MM1 C. Collins EM1 Corbitt ET1 C.N. Dansby EM2 M- Bowden MM2 0.1. Brown EM2 Ax. Cornish LTIG B.T. Bush LTIG C.M. McGuire 11 EM1 Head MM1 LASYQPP9 ET2 Fisher if L MM2 IJ. Furseth inf L, MMC E. Leach ET1 Brixey MM2 T. Bolion MM2 A.C. Boone "'-M 11 MM2 DJ. Hansen ET2 M.E. Hughes RA DlV!289 K V Y. , rv, ' X 1 ' Q'wqwu MWQWE 'J' an w ,iffig " "" mi K w f " W mimi 5 V-.. l WH 'V A luis, L s A 44 s, A :its M-slam? 'ti ET2 Martinez EM2 S.F. Perkins F73 D- McKinney :Ms Miltenbeger 29O!RT 1 1 ,X 'lx' n'f MM3 5-M' PYIC EM3 K. Russell If MM3 T.A. Anderson MM3 Bea Y 4 5 . v X sl' MM3 I. Buric MM3 Burns MM3 Cook MM3 Ehring ' -J EM3 D.D. Fullmer ET3 Gibbon f r MM3 M. lohnson MM3 MD Kellogg JI EM3 Shaw ET3 Welch Y. MM3 M. Boyden I MM3 LG. Carroll MM3 B. Florgnce Y STA EM3 T. Haslelt 'Ni ET3 M. Mann Y, 2 'Z ET3 Williams Y LCDR M. Gastrock LTIG l. Cleary 1' 1 , "JH-A' , J "iff I ' , ENS S.L. Tate 15. E'I'C Davies 'Th' E'I'1 l.L. Gypin CY. alum 5 LT I. Newmaster LT I. O'Connor ,f' X. T J LTIG N. Sharpe LTIG l.l. Tenbrock I ,,-- flafal- L7 QQZQV "1" C . Mm.. ETCS D.L. Gordon ETC LR. Cook ,. Engl J ETC R.T. Morris ET1 M.E. Fischer bds ,f sig! l:'I'1 R.K. Hanson l:'l'1 D. Heacox ..'-4"'f' .4-rv-'4""",,m' l 1 L15 ,,:. , , ,,,' C ' 'i xxx:-'. . ' K ea ,Vr'r l V , SQ:gQQLf I ET2 I. Peterson 1.-hi 1'7" K W Y V h""l- Y ET2 R.C. Austin Z.. Erz B. Barkey ET2 LW. Beale Q.. X R.D. Clark ET2 B.C. Cooler ET2 BJ-L Benz H2 K,R, Bombay-d ET2 S.W. Bruner ET2 G.F. Campbell ET2 D.M. Clark ET2 RCl291 'Qat--, -...,.xiwfQ?W,,,,.n x ,,.,,-z........ ,,.,,.,,.,. ,. ,.., E I I l i i r I 1 i 1 1 I s"""f11 Erz 1.5. Hager ET2 G. Hults 292 X RC ET2 R. Hallstead ET2 H. Hergenrother ET2 l.L. Kempka ET2 T.l. Kreischer ET2 L. Coster ET2 B.K. Crozier ET2 C deVente ET2 PJ- DUMWHY SZ -1 , A ET3 E.T. Eggett ET2 R.D. Felt QI? iii, EI'2 R.A. Fritz ET2 C.D. Garcia W ET2 W.M. Hetzel H2 B,A, Hines 'S l:T2 K.R. Larsen E1-2 Leese ET 2 T.W. Dawson ET2 LB. Dunn xml ET 2 T.M. Frawley ET2 P.l. Gigliotti ,f f ET2 C.S. Hoover ET2 C.l. Maddock ET 2 R.W. Detzler ET2 G.S. Edelman ET 2 R.S. Friend ET2 M.l. Gudeman ET2 G.E. Howard E'I' 2 A.L. Maton ET2 R. Mauk S2 m T.H. Moe TMA 1 ET2 l.D. Rahn ET2 L.W. Smith ET2 C.C. Teeter ET2 L.W. Watson ET2 R.A. McCann lf! ET2 T.A. Murr ET2 D.W. Reid gQ l ET2 M.A. Smith ET2 E.S. Thompson ' xii LX ET2 B. Wyllie 'L shu- f Y ET2 D.L. McGaughey 11 ET2 C.L. Myers ill ET2 K. Rod ET2 K. Stephens ET2 T.L. Tucker ET2 C.H. Anderson .V ,.,,,h,...t.-., ET2 D.W. McKinzey 'M 11 ET2 S.C. Napolitano --m 3 ET2 L.l. Roeckner l'."v'7' 'N'-J ' :L as ilffiiliflff Y, bf '.9lff3'Yff. mia-1? Viyrizrji-.LAL fff: ffm: '4:1in'bf:f4V.1:f'7if91lw3 ' fgglflll' lwfv ,xy,,wf. . it: ET2 T.A. Mills 1 1 01 ET2 M.S. Noland ET2 R. Olds I qui' ET2 L.F. Sanders ET2 R.S. Sandidge ff., Q .u.u,:r huzzah .ffif:'f21'1:'1fl349'Wu. .f42l"S:f' liflfflzig llifliill lvl f'1', 'fzf" 7 ff X all M- .nl HW -.1 f N 7 lx m , wf,,.,Va5:5fzaf..,wngi7W1s ' faqqfS:1'5,l.x54j:5frQ:5:i:-:!:"' ET2 G.l. Pearcey ET2 l.D. Slagowski ET2 l.A. Strong 11- D ET2 l.R. Voorhies ET3 D. Anderson 1 Y RC I:T 3 M.K. Beckwith ET 3 S.H. Benham N ET 3 Greewood ET3 D.l. Hackett ET3 C.W. Landes ET 3 S.P. Leonard 294 X RC ET3 T. Bak ET3 M. Budzinski ET 3 S.D. Hanson ET3 W.A. Lund ET3 o.A. Shoop lil ET3 GJ. Volz ET3 D.K. Banks ET3 D.D. Cherington ET3 R.R. Hill if Y -04 ET3M.W.Merg ET 3 l.P. Shostak i"'f Y xv ET3 K.T. Watson ET2 I. Barrowman f ff 'B ET3 T.l. Christ ET2 D.L. Hopper Y ET 3 T. Monaghan ET3 l.W. Smidt G V El' 3 T. Beardsley n T if di ET3 K.B. Farling nfli ET3 S.l. johnson If T 4 ET3 l.C. Morris S3 ET3 Stonebraker l:'l'2 M.E. Becker ET3 LM. Goble ET2 P. Koller ET3 A.G. Raymond ET3 K.E. Van Bueren T. , Y . .il ET3 G.K. Yabiku ET3 T.A. Young ET3 C.W. Zellmer 'vi 3T'1'N?.'f'3 'tg I if V iid LTIG K.P. Wolley EMCS T.D. Allen EMC M. Burghardt pf 'MH a , EMC Warner EM2 G.R. Arne EM2 G.A. Carlton EM2 C.E. Coe EM2 R.N. Ewell IC1 D.B. Hoffman EM2 A.M. Kirk EM2 R.L. Kuhn EM2 T. Mackey L. EM2 D.l. Matatall EM1 G.F. Maxwell EM2 M.H. Ohrstrom .. 4 A EM2 L.D. Phelps EM2 P.A. Smith EM2 D-R- Vefnief ' in 'Q ' V1 ' . 4 uf , ,, ' l ,VV 8139, AJR Q:-ul. W j aw! Hwy' 'f Q M 1 ' my N, '48 -' X' ill ' fhszzfzfsl pw.-:'.grfl+fS1: :1 pr-sf ,, H -ww QWWQ . . 3: ' ng' aww M .1 V.: Q wifi ln-M W dx lQf'f'Q'w.g91-ff-'w. ,M ff 'FX "N" ' ew, J E, im limi W A, if x. 3' N. W Z'WlHW'WM M.-1' 1' ll """M-. 5 i 1 M 4 af, , RE!295 N ,... UM- . Aw,- A - We Ziff ,ff 44 iff 4 vyf' 4 Q , , A f5o1'?!AZ7 6 fam, g A 4 rf w xi -' 1 , A . 41 1 W 6, Q WF' f 'QlPJGV-Vi' 'X H4-. . . " Fifi' L W Q , 'f ' A 5 4, 9595 , 1 - I "" 4.1: If Q 'if , , , 'iffgj 'ki ., 'ws ...NX 1 ,, Q. I 1, ,li wuj f LT R.G. Havlick LT T. Wetherald LTIG D. Trumpoldt MMCM D,L, Bowers MMC S.M. Henry MMC E.M. Seese MM1 K.D. Briar MM2 R.C. Betschart MM2 S.A. Bianco MM2 I. Boic MM2 M.T. Brown MM2 I. Christensen MM2 SJ. Crum MM2 C.A. Danielson MM2 LN. Hancock ll MM2 R.D. Harrison MM2 B.S. Hastings MM2 D. Haynes Inf MM3 1.1. Holliday MM2 D.R. lohnson MM2 M. lohnso-1 all D eeere, T in RL!297 'n ilifliv . V Y . ,. , A,'-+:'-f-'f-:--a:'- lm-.-.-.Q .f.-,+.--,-., .........f,......- , . '21 1 'V M 'cp' M ' AB" 'MTX eil H694 vffwiif.. www :ww Ml ,' Ze 1 ,Mi , A A f f :g,fM,W M M 4- 1 2 W H an 2523 ', .':'Sv77S"s 5 H n WWW 'sa wmv, gy W 'mb' v--. at 'iw ,,MWfWg 4 Bw u1.i'Qafmn.Gu1 MM3 B. Heck MM3 l.D. Houston MM3 D.R. Hove MM3 l.D. jackson 298!RL S JA MM2 IJ. Kreitzer MM3 DJ. Minier M" iv SV! MM2 DJ. Phillips fx.: x MM2 T.A. Tierney MM3 T.H. Bowden "flax, ' MM2 Lafreniere Qing MM2 C.T. Mullaney MM2 R.K. Plakke MM2 M.S. Tindall MM3 R. Follenfant . v f 'Q S If wi till: f MM2 R.F. Largent 'ilu MM2 T.E. Parrill 591 MM2 R.F. Taylor MM3 P.M. Allen MM3 E. Goodin 1 Y MM3 D. Luker MM3 S.M. McDermott MM3 LM. Zdankus iiUi?15Q5?fI5Y2 E 2 fofoao U nqn LCDR C. Lussier K faq, mmm CWO2 R.P. Free iz gd, MM1 D.W. Dean 11 ez MM1 B. Ridgeway MM2 W.C. Black 7 gel MM2 B. Cox - I LT D. Churchman , 1 - 3 n 1 ,.f , X ? MMC M.R. Orta A 011!'g,,L.f MM1 D. Hanks i..u. MM1 G. Solberg 1115 MM2 F. Boleman J-C MM2 I. Curry LT K.D. Duermit lm V MMC K. Parker MM1 W. Moss .. ., . Y. Rl rape 7 -"F'!'- 'L N amd a lf r U. ww. M K M. LT Monaghan LTIG S Snider f V Tins: nl I I 5 ' JA? MMC W.D. Wylie MM1 D.R. Bower "'B...f MM1 G. Nordbye MM1 Poziombke MM2 M.R. Best I MM2 R. Campbell irq, I MM3 B. Deaton RNH299 1 x N x w 1 I N 1 1 I w 1! LA. X. x x ' ' x N l .. 1 ll A ww'-A .ff w ,, , ., . .. . ep,-nb-.- . .Q I " "' V . - , F J , ft- -A , VR , gy,-nqgrpgg rnwgnvfv,-gn.-fl-r--,..5,, - ... ., W l w w ll 1. l w. I ll 2 12 1 2 5 .1 3 "X L. M lu V r 12 x . N M 5 l l l MM3 1. Hanman M I A V MM2 Kahanca I 300!RM MM2 M. Hauptli MM2 N. Hillman MM2 F. Hirayama . 511' 15 MM2 M. Kehler MM2 Kleinschmit MM2 M. Leblanc it!!! MM1 A.R. Decker l M, , U! MM2 D.H. Fisher mt MM2 C. Gaines ugh . MM2 R. Hall MM2 P. lmmoos I F Y MM2 D. Edick MM2 S. Fleck 'l .14 MM2 O. Gotsch 5 .J MM2 I. Halsey YI ill MM2 B. lackson lx -K+-4' Y 494 MM2 R. Filler f 1 MM2 Fredrickson mi, 4 MM2 1.5. Gwise MM2 l.W. Hario MM2 T.L. lenkil1S MM2 M. Liddle MM2 D- I-U99 MM2 T. Marcellis F E I MM2 T. Mason MM2 K.B. McLain MM1 F.M. McMinn MM2 A. Mosher MM2 L. Pontnack .im J V" wr' , ,mx ..,f,M', X .nw 3015 s 1 kv A 'fffj WL' V nfl MM2 D. McCasIin MM2 D McKinsey 1,-B-7 MM2 D. Morlel u-...tp V MM2 B. Mulligan MM2 R.W. Munkres MM2 A. Pullam MM2 T.l. Redd MM2 R. Saucier 'N-. ',z A MM2 Schulz MM2 l.R. Selman MM2 E.L. Summa MM2 M.l. Takacs MM2 I. Tarkowski fi MM2 l.E. Taylor MM2 I. Thompson MM2 I. Torrey MM2 M.D. Valdick MM2 l. Woodward MM2 Wotherspoon , -an-wx 3 . ml! ry, "1 ' - r,,fq'. , 'rvzf jj,- ,ixfz 'fy ' I , 1 A, MM2 W.L. Tarr MM2 W.L. Wright RM!301 hm.. MM2 T.E. Yott MM3 D. Evans MM3 R. Evered QW MM3 K. Green MM3 W.l. Hahn 302 X RM MM2 W. Ferguson MM3 PJ. Hammer fy' MM3 M. Bennett MM3 B. Chaney MM3 P. Crowley MM3 l.R. Gentry MM3 C. Givhan I MM2 G. Aviles MM3 D.S. Book V!! MM3 LJ. Chick MM3 Delossantos MM3 E. Gocong MM3 I. Basile L, MM3 l.K. Caery MM3 S.A. Cory MM3 R. Downs If MM3 H. Goritz ,hiv MM3 Hasselbring MM3 B. Hanna MM2 T. lacobson MM3 M' 'eww MM3l lohnson MM3 DI Kelly Wu., fl MM3 D. Knighton MM3 S.l. Koontz umm fl MM3 I. Loftin MM3 D.D. Mackey .MM Nl MMFN l.H. Martin MM3 K. Maschino MM3 McDermott MM3 A. Moore MM3 M. Qultter MM3 Roettiger ml X Q . fly: 11-N- MM3 G Kennard ,-.. .-J MM3 M. Linker MM3 L. Mahoney 1 WI A J!! MM3 W. Matthews 'Nm ixll MM3 M.D. Nyssen MM3 R. Pihler ff E E MM3 A. Perkins X, Mm M. Phillips MM3 Puckhaber y 'll lx MM2 Rosenthal MM3 T. Schenk MM3 R.R. Sill MM2 Weber MM3 MM- V003 RM ! 303 -in uw -4-'J' The ENTERPRISE Safety Department is a small but essential part of the ENTERPRISE Team. The Safety Department is responsible for implementing a comprehensive safety program based on objectives established by the Commanding Officer. ln carrying out this Safety Program, the ship'sSafety Department must promote maximum cooperation in Safety Matters at all levels, ensure a wide- distribution of safety information, monitor the submission of required safety reports, and maintain 'appropriate safety' records and statistics. In implementing safety programs involving General Safety, Aviation Safety, Motor Vehicle Safety, Environmental Protection, and Personnel Safety, the Safety Department must instill all crewmembers with an attitude of "Safety Awareness" on a daily basis. Common sense and'Safety Awareness lies with the individual, promoting and improving that attitude is the task of the Ship's Safety Department. . . P r .. S ' A Sdj?fzycOfj9'cer it SAFETY hung ,f Qs, am. A ABCS D. Hewitt g BM1 I. Flowers l AY!" D my A01 C. Thomes YN2 F.D. Enrlquez gm ,4 HT2 D. Mills g .QM f G ' , f. if ' x'1 l5WJ EM2 D. Noll mf Wu, SAFETY X 305 A Y-2-7FCiFQFET"" fi I' ' ' rg", w 1 lr .,,,,, " 1. lt -47339, 5 ' A X, o If gl :lwlznwm flasls Axmq f 'x 'if sc Q.. v f A a 5 x Q ati ? ' L, 1 m Q f' ,, ,, A il , FWZ, .. ' .N f,5H f- f , . , W- .NM V f-:ri:r,:::L'A:,1 ., M- ,.,, V. . x , X M , L t yd 2 . ,I f W , , M Mr Af I 21553-1WVfV2'?A 5hR.rft'-2-lfxiiu-.xgrdw -. N x -' 'M -, A' 'fag'-,g ,vw- .yang -. ,...J - E ww 6 'L he W W W, ARM f.,1N957 Mg. ,Quik " X .t my ff 1---. W:""" nf- ' -if. i' -rg if . , , '1 'z ,O , , '9 F" w I R iff" 4, f , gi .45 s -K S , - WNW ,,,,....,.-.--W If ""' Fw ,X If , - .V ' U, us 225 , N x, W' ' - H f x,J,5,L ' g. A I , . M,- 'H7 '-"""w., , ...,, fcvffagp-bk I ' I 42 ' W, , "' 7-.V - .'.":'x--. h '...a:w x ' 5 ,. -5251-1. , f'7"" ' , X 'A 'C 135' k xx, ' 'QT,n?,5.k. 1 f.: A 4..:x A i I - 4 ., .1 "N" ""'5i552QifC--, 'L fff1V4ggg,. Q L. ' " ,-1-' . A A 1 Li,-9' , " - V .. -- - , f 1' , ,,.. ,, 11' 5-1. rl Q" 'if1:':.,-?':.5EF,,:, , , " , ' -. . - 4 ' f :Iv :EYKT'if3x?w?5if'f,'.ZfE7i5-V" 1 f' - 'Q 1' ' ' ' ' " ' , ' .- - -' " ,, ' -f:-'ugwfqza-'-211:53-is--sas-Li'fszvif-'wsIii?-z gt-2-7. fr :LL . , . - ,- - 6 ' V' -1 " - ' 1 -,wx5:5ggfggmgrfwfyvgg-i,:z45 EQIP". .HF-yn . - ,. ' 5 . - , - '. , , , ' Y -slf . -f-111' 11 ai!!-331251555153-.l"?ii?f f -., . 'wf3'f,Q15f'32T:.!E'f.1:1fZ52552.15 ::, 1,15 Y 1 , .' -fi-'A , ,ffl - X I 7 " rf . . 2, V. , ,. .N V , V . ,, 1 ., P13 , . , Q ,rfw 1 f, , ,- V-. - : 'q - V. ,-- - -b ,' z f ,,:f.,-L-:,yg:1,"'22fae'jief,'.,,. , fr, . Ld v . .fl-J:eiff,-Q'-'14-mfcz',' - -- - VV .- -t , 'f . ' ' w'z:e:f..1tA. 2f , ' V- ,:'L':",,y1'ffQ,'1"'.: - ' gag ,ff . f " Q . 3.5:-f"4, ' 1" l 2 .- 711.1 ?.f'X?gaA:giA .'-' f:5g.g,'f?f.5Af:3-Qigim' V+ ff '- ' A ' ' - " ' ' ' " ' 'Y"Lf 1' ?2ff+k.4.T:f-?fsm+QfffHfgA'ffsfbffiP'ff'1?ff?fv"wg"4V2'f?SfCKL - - ' -P" ' ' .. . ,. , f W-J 1- Jazzzwaff-A::??gg-1'22ifszf1ff.: W X 1 9 -"'f?i'3 'i':.,4, -' , "Q"",' 'F " A ' A4 7 A-T -.- . . . ' -V -+4 1 x.-4 171. f- -4: - Q Cuf'.'5ggg.lgflrf--Q-7-f'f'i""'4'--Sgt'El"icTEQ':23i:'N'.If:2-, 5 .-.L '5' 'V "' ' K.. lcfffefi-3. - V 'P' -- - 6 ' sinh! ' ':"'r-':""""" A'-"' 1 V-f .r 4- , H , .V ,,...,. ,.-. ,N-A,..N..--.-35'-1-'--, . .-wwq-nz-Iv-., -gw"d'sr'w-- - - + , x x . .1 .fpax -4.4.5-,-vi ,,.T'-,:-gytwxf. .-4,-,,.,.A--f.-,1-,.,.':,,:-1.3, -L-,.,,,-N ':,:,:.q:,-.',-c,.,::,,--Q . ,V , - Z' - -4, V - -- v , . ji-6:"" -lv..N 'K ' "'-51 5, - -- 1:2 3175-.fTA1ZI"QxfJ91LfK7fC3Kf'wW- f ' fkfi-'i5:?W'3-SQSGFQ-5'-5:f?3" "ysr':'3.-1:11115 ffI441'.'-2.:f:-:s--'fff:-fr:-3-it-4Ti-N'1.',::?f11'Q-F-:4-if-2-fR-1?'.i'g.P'2!'-W-- 1. A ff-- 'Q' ? "9Qf4 -mx' -9:-:.1.1l4.i7.' we-I-5 1 Tl- UPPLY ADMIN , ' 'M'-N., , V W .Y I ,.' 308 X SUPPLY ADMIN MHZ. LCDR M.L. Mitchell lilly AK1 K.K. Diedrich wg.. M52 S.K. Kramer Y xml YN3 Sullivan I QL: x l SN Duewer l 3 LUG D. Epperson MS1 D.V. Willer MS3 R.D. Northrup MSSN A.A. Branson SN MJ. Palenica SN R. fl nf A Stommel N'-'fi LCDR McCorkendaIe : v ,f ef-' 1' ' AKCS R.S. Salazar .-"" e' ..,,...1PlQ, 5 Jim SK1 Felipe 'ml AK2 P.D. Barcos Ulu , Y aw AK2 C.M. Millard X59 X4 SK2 R.L. Parrish , si? Lin. LT D.O. England SKC S.T. Bayle Hi, SK1 Gonzalez if 1 ibn SK2 E. Deguzman SK2 M.B. Orino 'Qgm AK3 B.R. Bruce 5999 hu L LTIG M.R. Stockwell S If if 'lg Qi l AK1 P.B. Catagan SK1 G. Pecadeso SK2 Evangelista I-mm 1 5-521 SK3 L.L. Pagel vlan. l Vi JM ska T.P. carter Q .ef SKCS W.M. Fredrick 55,9 ,55,,i,,,,,,,,,,,...,J-1+-e-ra-ug-me-1. ' 'Nfl-f' -"" u ,. .. .....-...-...Q mm. 4 'mtfmfqi 'llnn, '-' fl Y f nfl SK3 L. Christensen 37O!S-7 SK3 E.T. Cushen SK3 H. Dewan SK3 5, Hamilton -Q ' Y ill 1 SK3 Gall IM3 I. Humphries SK3 L.R. lohnson uma ' ' - B- f U1 -s.. 47 AK3 D.P. McLain SK3 A. Navarro AK3 MJ. Pope ? -lfhqki A 1 1 . V 1 .2 AK3 D. Preston AK3 A.D. Rivera AK3 A.R. Williams 1 AKAN R.T. Guerette SKSN G.K. Hamel IMSN I-L Hawes . 5,99 .I A SN K.D. lohnson AKAN c.F. Perez SKSN P- Rifumban ,X ' 1 V 1 I ff W img y CWO3 A. Pena ' f n.ff MSC D.T. Escusa Ly MS1 G.V. Cayabyab UZ!!! MS2 G. Byrne fitqi MS2 D.W. Madison y Sf 9 MS3 R. Bradley .- .-.ae .1-.. .x W x MSC D.M. Anilao g n "inf V MSC E.M. Medina .Ev ' MS1 limenez MS2 Dolopo 'nlhl A I uf MS2 M.R. McQueen .1 ' MS3 R.G. Grisby MSC l.C. Aure 'T MSC N.S. Viray Q, MS1 R.N. Yangwas X ' , f MS2 Ebuen HE. an ," MS3 L. Bandfield 11 A11 'nits a ' . -LDV M53 T. Haynes 'Wk MSC l. Burgos MS1 R. Basbas MS2 Brown MS2 l.H. Ford K! X i ,001 M53 K. Barrett Q--Q-nsnqlrevytlvgsilf S2 V 1 QQ: 5 MS3 LD. Ivey 372!S-2 A f, il MS3 R. Meade t"'!AJ I ' VKX MS3 C.M. O'Brian MSSN Achorn is 5 l ,Q MSSN M.S. Grantski I 'inns 5 MS3 E. jackson MS3 C. Martinez ill!! f Y MS3 Meneses MS3 CJ. Moloney MS3 S.G. Quammen M51 R.E. Vaughn MSSN Daskalakis MSSN G. Fitzgerald 'tml' MSSA CA- Guver MssN o.L. Hummel mtf' MSSN Oswald MSSN Russell "'i.1 Msa s. Mayfield MS3 T.A. Morris 'N 5 M53 K. Young MSSN Goldberg il PJ MSSN T.E. Krug MSSN See MSSN D. Shimandle MSSN K. Wooldridge MSSA P.S. Grasso MSSA L. Rome MSSR Alexander MSSR Rauch MSSN LF. Villar MssN Young MSSA Lange iii m " Z MSSA LA. Spinks MSSR K. Bohler 1' MSSR A. Rezzuti ml MSSN S.K. Weslphal MSSA R. Barros , ,gf MSSA Pomeroy MSSA C.B. Wade MSSR Hernandez . Ig L vc ' MSSR D.l. Schwartz f as I ,Q MSSN B.M. Westrope MSSA R. Burroughs MssN 1.w. Qualle MSSA Zemzicki MSSR Hightower MSSR l.C. Simmons ' '. L, .-Fw: S-ZX313 .rag ENS W. Hargrove SH1 R.B. Garcia SH1 P.C. Ramirez I 1 ,Q 314!S-3 SH2 G. Butcher 'K : :EBM -Wk SH2 P.E. Lee NW' xnl SH3 C. Cunningham WWW: 'H ' I SHCS C. Henderson SH1 R.L. Gawaran -Img ' 2 SH1 R. Simsuangco vf, SH2 K.A. Gordon , .a.a Q SH2 A.K. Loving I 'xml' K ' ' X.: SH3 K.S. Hapner N SHC W.A. Bennamon 'mm JM sl-I1 c.c. Natividad . bf . SH2 l.l. Barton """"rln. xxl' SH2 A.B. lansen SH2 l.D. Virgil SH3 R.B. Kemp ? lrqswg if 1 Y SH3 A.l. Meulens SHSN H.l. Althaus SHSN S.L. Evans ,4,,zl" f A SHSN E. Guignard Qs , SHSN l.P. Osgood SHSN G. Sanford SH3 D. Sanocki SN S.O. Colman SHSN C.E. Green SHSN A.L. Nix 5 ! X XX SHSN l. Sanchez x' I I I SHSN CJ. Speer S-3 316!S-3 ii . ,, X SHSN T.l. Shambeau SHSN A.L. Upton 1. SHSA G. Brown SHSA D. jones 74 SHSA l.M. McLean SHSA C.D. Shrum SHSN K.S. Taylor SHSN M. Williams SHSA Edgman SHSA G.G. Linse SHSA I. Rodriguez SHSA A.R. Winn 1113 ' SN Tomko SHSA E. Brennan M 5 ' 2 SHSA L.l. Garcia f SHSA D.D. Maxie SHSA 5.3. Schultz SHSA A. Woodworth ,,......-.-wo ENS C.M. Maddocks may Q2 DK1 M. Dimalanta DK2 S. Baraceros nu f' DK2 D.H. Unger , wi .194 DK3 R.A. Hackett SN D.R. Aitken DKC M.E. Hebron Q15 DK1 I. Manacmul DK2 l.G. Lirio I wigs mcz N.L. wilson by P DK3 Lucero A DKSN Glucksman 'Emi if DK1 C. Castillo DK1 R.S. Mericle DK2 C. Ramirez DK3 A.N. Diaz DK3 H. Wimbrough DKSN D.C. Racca yu,-L Q-unpaved -s-anne--f DK1 1. Crescines S-4!317 mm ENS B L Montague MSC B Aqulno MSC F Mandlgal 'wg gl 1 , , N , ,, V R 5. I 1 . I I 6 ,ag 31815-5 if NX-, MSCI B Vlray MS1 P Almanzor MS1 F Del Rosario it MS1 T.B. Munoz MS1 A D. Obello I i Q fir Q9 MS1 A Manmang MS1 O.G. Reyes M52 NM. Abagon M52 R. Ares M52 C.W- Gudde lmwliur MS2 E.P. Martin M52 C.F. Sales 1f MS3 P. Anderberg all-Jan, f M53 D. Broadnax MP5 FUI!!! MS3 E. Checchin fl! Wi E U'-ln M53 M. Costanza X. MS3 I. louan MS3 M. Mitchell 1 I,-L 1, f K-.1 MS3 W. Colton x -.mf 3. MS3 G.L. Earlly l 15 'mf-11 If MS3 l.W. Mahone i El lp ..i, x1 :Inq M53 D.A. Largent 1 -H... f pug,,g.-,-.:y,pg.m,- xr-f fu:-1-sfo-1 -N-'few--S-Jnyvrpgungwr s-5 M53 P.B. Campbell MS3 I W Corn "T'L.i"f'z MS3 E Holland K Y RQ MS3 S.C. Mankin MS3 G.A. Taylor uulzxil I 11.11. I xml MS3 M.l. Thom MS3 K.D. Spitzer IB .1-lr ..-:fy ....f...l S-5f3l9 I -AW 2 S-5 mimi I Z lv l 4 MS3 H. Zastrow MSSN Barber MSSN E. Blankenship Q 1 , MSSN N. Brown MSSN A. Buen SN W.M. Cratic MSSN H.L. Foster MSSN W.E. Gysbers MSSN P. Martinez W all U52 MSSN W.T. Minor MSSN Reeder MSSN Sullivan LI A .ff Q '...aqk ,i an 320 X 5-5 MSSN D.P. Wasson MSSN Wernhammer K w ci 9 H2 MSSN R.D. Young MSSN l.K. Zaclelc .'?f11'i2! BEZIWI LT LW. Cummiskey AKCS D.B. Adamos AKC Dytico Ju AK1 Arciaga Hman .QQOA AK1 E.M. Santos smug, '11 AK2 S.A. Tacotaco AK3 M.A. De Mayo AKC Santos S3 AK1 N.M. laplif r Y, AK2 R.S. Florida AK3 M.A. Dahl 'Gyn' X 5 A ' .aa-ll AK3 A. Gonzalez Y:-an wtf'-rl 'IlLf1YBY'1'41"l5QF-F QW AKCS E.T. Damilao '41, ' f 052' :A AK1 B. Cagayat R Hamm EDA., AK1 V.L. Phipps AK2 M.M. Rivera X . S-6!321 X 322 XS-6 AK3 K.W. Grant X.. sl Y AK3 1, Mon-is AK3 E. Siewerth AK3 S.E. Smith N.. ' AK3 R.B. Switzer AK3 D.H. Thomas Z 1 SN T.B. Elliott AKAN l.l. lohnson Z A AN B. H. Long AKAN Miroewski ' AN P. Rowell ,I ky .. AA M.l. Leu CIV l.D. Creech 5 CIV S. Gearheart CIV H. Goehring , , V ,g.u..,.,nppngun-ggQ. yl9gpgmgiiggg,-a:,-Lggusrir1b'.x'1,:xvf-aqwrvra--:--:vwavrf4sg!l'?lQll1!1l'5 V , .... ., ., LT T. Worthen . f DPC R. Cascone X X i IC - --' va 3, DP2 S. Moore 5 nqgiz' l 'Q A E DP3 Cottingham DP3 I. Ervin DP3 R. McCollum DP3 Zaremba . --.'...--1.-v .x -I -,, ff Cf "mf H 'mmm 'ami DP2 T. Warren DP3 Cuevas DP3 D.A. Lewis DP3 C. Snowden 'll-Dil DPSN D. Boreski fl! wx 'b :GA 57 P X 11111 C T S-7 ! 323 324 ! S-7 DPSA I. Davis DPSN 1. Donahue DPSN B. Elwood Cya, DPSN D. Griffin SN C. Hutchinson DPSN D. Marzan 2 DPSN B. McCon DPSN MJ. Lee DPSN T. Lopez Z A DPSN K. Raskin DPSN S. Reilig DPSN Robinson DPSN V.E. Sham DPSN D. Swizer SN R-W- While ENS I. Samples SK1 Corpuz SK1 O.L. Santos IDBI!! AK2 Antonio SK2 W. Moeck SN LK. Ancheta Exim' I Jim!!! i SKCS A.D. Carig Mile. .aw AK1 EA. Madrid :ff SK1 NLR. Ure 561891 AK2 I. Fierro sz.. nf 1 fin SK2 A.P. Sarmiento 'M' 'ul SK3 D. Anderson ,..,-.caan-vw--fvlfpgypyan-7, iv 5, --'-:rr-v1"'4v41a. -swf qnnQvl1'fl-Il' , - , I . .1 I i P V, ,wg-qgrygj-Ge-1-,gl-:rf,vpeg:--mf?-'vs'z1+v"P-A-'fewfm A, Q , ., 1. , A - ,, -, 'S ul sm A.s.Ama1 SK1 Santiago W? 11 A SK1 M. Yockeman L AK2 F. Miclal 1 inf SK3 G. Alexander "HL . SK3 Archuleta S-8 ! 325 ,M , .lm f 'Ign- in SK3 M. Brooks SK3 B. Buhain li V1 'Qq. SK3 T. Hansen SK3 M.C. jones , f 55. nf Y ' f x99 . x 1 AK3 l.A. Park SK3 C. Piper , if 5' f h ..... ' 'SJ4 SKSN S. Babb SKSN I. Battles i -1 'Z AN D.R. Brumfield f ' -ffi2:f'7"?15-2? o ' ffiwi' " , V: - ,i f Y 9 5'3 " f., Q, ' .- 49' 5 ,' 'N I -f X AKAN L. Dansby 326 f S-8 ""lHl. J V SK3 M. Carlton vt- , 1 Aus P.1.Lyles 'L 11 SK3 I. Westergard 0-0' SN I. Brimhall mum! SN W. Bryant Qin- y A SKSN R. Gallegos SKSN D.L. Cilberl I YA SN B. lenkins 1 f YNJ SN Mendoza AA C.B. Moore f . 00' I Kf AKAR W.A. Peters AR l.A. Ruiz -wmv-1.xf...M V x 5 f i f f 1 f QCD' mms: if '25 SKSN Fess AKAN M. Herd ...., nw- 4 SN W.l. Law SKSN Lipmeyer :gnu SN l.W. Noble AN R.R. Tackett AKAR Gonzalez AR B. lohnson pq-spgganqp-gals:-Qu?-yea .nw 1 -g--fu zv- fs-vax-4-4.v4---1uru1nv'4mlInG-eh' S-8 SR C Ross I AR M. Wilkerson i ' s 5 "I h "E . 1 . .,.,-., S, - .--W S-8!327 ,C -.. ,,-... ww 'Nw 0 T L 1 110.11592 5g111f111L4zf,s-. 1'f1.1 15, Eb , 11- ,vp ck, 'RLY 1 1 AX MP., M1 .. 5f11.w1crf.1Q1 lffw 1 1 1iC1fff111 111i'121111W1F1 Q1 Q111w1Q1111Q1f13f5g1,! i1tg111HigQ I. gp 11.1, .,,ff,Z A 3. --,J fy. -..YV 1 .., 953' 11113519 QEWQ' .QHQT24'?Rji'fU3k5Q!.H,YOl 1551511 1 ,1 111 ,mi . ,.,.,, 111, -az ,i1'L1Ix.,N P '1 111 111i'.Q,1!1?31Q51 ezigmr' Qian 112911111119 111121 1i111f61.21e1s13e15.i 1flEw11fnQ1:Q1g2'A1 We ,, -Q Lil L ml ,... 1 i 1 1 E 5 N 1 E z l 1 I 1 Y 1 Q '1-. '--fc .px X , i,,..-N vw 1 -, 1 1- f- 1, ,1, .. Q 4 X f --,.,,.-. W.- X Y... -,,,,,,, 1-a 1... Q1 211119424 - 1 Q 1 11 X C17 sl H Q -wx ,11 -1 1.3lw111Q1E5Y1' X .. E E E 1 Q, X' 1 lf, 1..I:i-xx'-..1 2 . x' Yi X 1, x -. 1 Q :fy V HV! ., , za , 1, 1 i ,, ,1.i1T . M 1. ,-X .-.11 .sw ' K rw, .L 73,13 1.0 X 1 1 , , ti. .5 2.11 , . K fiffl' fifff , .Y s , 5 1 A1. 1-1 31,1 1 M Z , 3 , 1 x - i 1 ! 1x1 X. V X' 11 5' x 1 ' S3 s'U..iXQ, fx --1,...L, RLE533' 1 A if X ""' ' WW -gi: 15iN":' ' A 1 1 P H, Lg : - , .iz -1 1,1 M .- 51 lH1fsz1111..,,,.'x .1 . 1 .. , 41 f'1,11'N. ,A '31 f 1fi1Wf 2 " 1 1 'W' 41, , 11, rl-jj.-' 1: Aj U'!J11-51.11" , X111 'X 'i.f1f,- 1, 2 Ti 1 1 X Nfff-', '-:Q 115'-. 1 . I , ix 1 -x 1 - lk X ff V A131 A .S Q . '. 1 ,-1-111-..- 11 -1 X J1 19.-1 ' M111 1xf L 1 AH V. . 1,-X11 1 11 1 1 1 .f.1.,,1!, 191 1, X H ,,. ,. .X f 11 1fj1Q1QX11p.31r?-R11 5111: 11.21, Z 11 - 1 ' ' 1 ,. 1' 1 1 1111 .1116 .ma-ug.: Af W I- 1 'XL .- .- .'4xf,- .41 A x " x M 1 1iJ21Va'iQ111'f1f - -11 .I ' "' BCL ff 91wYi.lF1.i1LQ1fYl 1 153 N ff ,f-' .ff-...vw Vw we 1-A 1 f1'11+!f'f" 5X.QF,I'QIgJl!'33 EQ!!,l1Yx'i,551a,ifJfU ,W ,, Q-1:2139 -. 1141s -,,. L ' A . , ,. Us '+SL1?.1if3fY"sf iE'.U1Y.1Qei1 S421 'Qr'S'?f1-if ' ' ,Z1'?.1,rx15Q11DjfIElLGxKUi'i1 ,QLQEKGI M , I ,.-, .1 1 ,' 1, Alek" :X X' 1 - I 1?1iUiFfiTr5'fL12E1Q 'f , S fm'j'iX'E'19' '321' 1i'1"'-Md' 0 Jw 1 f , . 11 we 1i1551u1ia110i1Q11fm4?151r V N X N A. , ,I RQ-F1511 N141 15?y!,,a'f 1?fQ1m6j1'11'1f5sEf-55 1 9' ' 'V ff' 'ff . emi mW67g.1.H,..J KW X W11... . N: 15 ry 3,21 , , , . W' X M Q K' 9 QTKQRQKQ'UKSQWWYIQN mf'-Q53 MWF!" 'WQ7 515601 -N .. .U .41,.., ,. .s,. , 11.9 . ,, ,L A 1111 1i11.Q1kQ 111u11.g1f111,1, 1131111131 .1 P X - 1 1e3F'1!!1fSiE1 MQ WEEIQYM S1 116 f A W 1. 1. , ,. , R '1"N rx If j1T7'3'Z 11112-1-:M , -"1Si51i,6 1w -HH 4 A14 , . 1 - ' ,. 5L3Kf.Tg13+11111.1r 1,11!,m11 1,111,141 .1.11,,g.,.-: 11.1.11 1213Wf?11r1'i11'i'5ji2N'rf9G14f Ii5wfC'1j2'wf ' ' " " ' 1 - 11 W1-W-W1 -.J Q 11... 1 11. ,X 11 ...V .1 xf1.,,V 1 .1 11 1 1,Qml3iW.i1l 111522121111112-2l1'L511v111g11.1114.1 '1 .M 1 WQOWS aE,,A.W, IAM nw , ,. .. .. .. ., ,. . , ,JRE ,1fQ,AA,QpIEx1,U,HibE1,a21 mkismbgilmlv SRS 13.1.Q., X 1 13353 W W ,, x'-, 11.1.-z S '11 1, 1.18. Q 55?-111.12--N. . 1 1" 9 555 . 1.11 ,. . .. .. , .. -- 2.-. 1 LSJUNKQI QIHUI' 'QixN'i1!E11E1g qQ1S7!i'E511?'E1'U11255511 m' X k . if 11? intra!-r21:r:.gegv:f r., 1-1-,ws-avw, -'far-' Y. - ., LTIG S-L Bafba LTIG R-I. Sexton ENS M.c. Eoff Nccs D. Taylor AMSC I-A' Banks NCC I. Carman AWC D.L. Moffitt EWC D. Roseberry instruction in communications, counseling techniques, human behavior, military justice and human resources management, with increased emphasis on a positive leadership approach. Prior to the ship's departure on the cruise, the Petty Officer Academy was coupled with Supply's S-2M Division to establish an on board leadership program which included both classroom education and hands-on, practical experience. The indoctrination Division is designed to give all newly arriving personnel a brief but thorough indoctrination in ship's regulations, operating policies and standards. "I" Division has conducted classes continuously throughout the deployment and has indoctrinated more than 900 personnel. Instruction conducted by "I" Division includes: general damage control training, 3-M training, human resources management and numerous other briefs which familiarize new crewmembers with the ship. The Training Department's Special Services Division is the vital force behind improving the crew's morale and welfare by providing quality recreational activities both at sea and in-port. g , The many features and activities offered by Special Services include guided tours and free transportation to various points of interest in foreign countries, a recreational facility discount and ticket cash rebate program, intramural and varsity sports, and the maintenance and distribution of division recreational funds. On board the ship Special Services maintains a fully equipped weight room, a recreational gear issue room, and a VCR tape rental library which offers more than 225 movies. Special Services also sponsors special events at sea and in port including bingo nights, ship's picnics and other shipboard evolutions. "lf it has to do with improving the morale and welfare of the Enterprise crew, Special Services is more than likely involved." Rounding out the Training Department are the men of the Command Career Counselors' Office who form the nucleus of the Command Retention Team. lt is these Navy Counselors' job to provide information that will help the men of Enterprise plan their Navy careers. They also guide crewmen in gaining future assignments to duty that will most assist them in advancement. TRAINING f 329 , um.. rqlmhmf '--14g.1:i.iQ.i'5.'1, Z Q KM XA ""'-A L A01 T.Marlett NC1D.Zug PN2 v.1. Cooper ABH2 K. Thompson lun. Qui? 4 ' 11 M JA ' A S ,3 BM3 B.M. Colgan PN3 I. Rosemeyer PN3 H.M. Vazquez PNSN K. Card 330 f TRAINING 5 1 i SN M. Szymczyk SN A.W. Williams AA R.M. Bailey f Q AR M. Bristol E1 Chatman AR S.l. Finch SR l.S. larmain CIV R.D. Anderson CIV T. Smith , 1 V A - Q. in 3 j,,agg,'g' -5143-vazyfyffnsfgaffte-F-'4:"+ , . V . -. ri., ...Z Q, . ,.,.,w--anprpqsngws-a-affn-fu:-Q f-vw -1 ...U-,..m..41el1H1v'f TRAINING X 331 3 5 1 nip" ' ff'fi,'f7 " ll I '.,k V. I ' g .. EZ?-' 'T17 ,mv nf WW, U 4 X.: ,if E .,,,,gfL LCDR R.L. Cunningham CWO4 l.D. Haldeman -mu: I 'Q GMT1 LH. McKown itil Y GMT2 R.E. Archuleta GMT2 Fisher um. GMT3 l.H. Miller LTIG D.L. Mortenson A .. 3, m d -A . nh--,Aww-grfqgqggggqnyggy,vg4gg,-Q--.-35,2-:friaye- sffffmffrwvra-.. -:v,.-'4vf-fxxnyzl1:v5vmn-:1xwvrf-v1'l'l5Y!!f-'F"1?"9-"1f Vi ill f fl 'NX if Sri ll lf lfj ll in T Xn X ll ' ll fl 2 1 My l V fl QV U J! FY! ff!! XXXW-ff lg ll V ssiihg GMTC R.L. Mitchell GMT1 W.H. Bankson ' 'l"iPsg., 71.1 GMT1 P.E. Perry, lr. GMT2 l.C. Daniels 2 GMT2 Gaines , "lu bl GMT3 G.O. Terrell N- GMT1 R.C. Wagenaar 5241 A l GMT2 B.s. Debski Wigan, GMT2 B.W. Killion GMT2 R.G. Sisco GMTSN T.S. Clemens GMTSN T.M. Dahlke 4 fum' 10 GMT3 K.D. Bass GMT3 Gospodnetich fn.. SK3 T.M. Hornsby GMTSN P.E. Mayes YNSN K.E. Woodward 2 GMTSA D. Chesnut W-DIVI333 'm f- mwww ' ,r Q A 5"i'if'l f' L' 1' W I.: ,Q 1 ,f r I 4 I 1 x - , 2' 1 S6 ENS D.S. Gutierrez AOC R.W. Smith A01 A.R. Galicinao ! -'M ""'n wi . 3 A 'V xc A GMG1 R.G. Luke A01 l.O. Weaver GMG2 C.L. Garreti . . :mimi iq """' . W1 3 S4 GMG3 D.C. Henry GMG2 E.F. Miller GMG2 T.D. Reyes Ima.. I 'Ulm GMG3 5.1. wisong GMG3 R. Henderson A03 S. Llitera I N X , r We 2 'c if' HQ: 1 3 Q Q 2 ' I -..,. 1-1 . f. gf . n f 1 lyfflf' ff-,' f Ljcf M4 'Ln , Lygfl , 1 U f 1 ff f , 334!C-7 ii? A03 D.R. Peck ltlng x, 1 iii AN M.H. Dunson 'Q' AA M.B. Crowley SA C. Pena ,..,.6,--mn-vnu-9nquvn,.-mivv A-cw r 1 1-1-4""""""'!"4"""'1"" V. ff.-A.-..f.f-y:.:,1.,.,,, ..,: , ,KVL , .- .. ,. . - . , - ,, ,. , , , . , .521.131252,iaf:.-',aff,1.:g.'--':f- Ziiff-inf,i'.1.j,"',1f'1-2...:'gfgjzfflf,-,' - .4 1' , ,g : ' 'L' , , Y 1, 5,--1: :gy-'-.,.-,..,.,q13.g::-5,-3-f-,:,,-:Q-..g:Q i'?iff1Pif?331?3l3iZif?.1g?f5:2?:e?-if?PEEQEZ-2?E-.25-5-A:i:E'.'f 212 5 1 ' jp, L-. ' 71 Z1QzifiTFf:JT'i7i'Ei1'Si7ES 'K ' "A A 'W ' -V ' , I Y --'I , ,rj-,aqgqgmr xwwirvr-ff4's1r'4-ff-'--'11, " ,, - V . 3 - ,,.-fu, ,- I.:-,va AN M.E. Burgess AN M. Turnage 4 AA B.D. Davis AA M.A. Pence AA M.E. Supplee AR Cook AR Cox C-1 X335 ,mann Fgrm' Wi-W?f9f43' iv '-fo '. AOC G.R. Miller Y if A02 Fails uma Y A03 R.E. Hayden 'Ml A03 M.A. Stone - rn . ..u-. A01 R.F. Cruz 'llmxul ' Y Ldv! A02 K. Upshur lillll .OPI Q A03 M.R. Hill lily. ,lj Y A03 P.F. Szuba A , ,-,, ti F E LE--:ggi 'J' Q "pn A ' I V, ,f ,J "" Al 1 0 VV ,V V . L We It V , V ,fa ,, Q, 'llum Y -144 X A03 M.D. Winbush . 'Z AOAN M.T. Coates I mm" AOAN l.N. Martin :msn AOAN Speck 1 AfQ. at Y 5 i ei Qs-mtmi-f.:w. wi i Q-NN 'f AN l.M. Bailey AA G.D. Belcher AN R.L. Hayes AN T. Lafreniere -n.,,., AOAN S. McCloskey AA D- POSEY ,S AA D. Stacey iyics-Q-igizlfl-If?i?a1:fIi-,:vf:s'f'+1'fff"!f1-+W"?'f""'?!!'W4""'?""4"'5 mgmql AN TJ. Bennett AN R. Larrison AOAN B.L. Smith ...Ia C-2 X337 338 l C-3 V milk LTI. Richardson AOC D. Shaunessy A01 E.A. Lane A01 A. Liupaogo 1-Eff mlb! I . .., of wi 1' .v ff ul A01 F. Ruhmann A01 l.P. Vele A02 L. Firestone A02 j, Pete,-Son I 55? Q 1 14? ..-..1,, M! A03 D. Anselmo A02 Powers A02 Ragland A03 A. Camacho 'Nur A03 P. Carrasco hm, A03 D.l. Hallis -'lu ,E A03 K.W. Kerry "lla I A03 T. Rubert '."'Q, 7, j I A03 R. Switzer 9 -ca- AN R.A. Cole ...,.. Ai 4! A03 M. Carver ""' xi A03 H. lensen ""'f 11 1 A03 C. Leveaux ull!! A03 C. Shields AN D.l. Brown N... AN D. Cottingham um jd A03 B. Fierro unify A03 S. lones A03 G. Patton 'inn 1, A03 R.R. Smith ""'Af .1 1A AN M. Cargill f 'll-ln x 1 AN R.T, Dill 1:2 . , ,.., , 5 f wi, ,vvfgggq-gg-71zy,ygurr'-1:g:grftvf+fz:c4w-f-P:-'1w1.n-'4'-I, .. ., . ." ....., -A ., Q .vunars-seas-ncpnglnpngp. afar --1rn1rl'nmuxw1mKQ1C5'l'fU9'fi'l4'l' fZ,xVVXx I m f-X K ff? L+ YQ g .ff rf ff , -, , X xJ 'f L-J X MJ! f xx ,V , XX-Q xl C-3 X339 -v--q-rv-zguuvsf ,,,...,,. - . . . -,..,,. -,W . U.-....,,... ...,. ,. Lf q A-- A. F 5 'K N Q . AN R.N. Elletl Ifff ,UNI 4 A ' 5 AIN!-51hX 'A L gszznwu ,mm St-Lmul nuns , NNW Q:-umm 7ni 340 X C-3 I 5111.5 AN W.l. Gray AN D.L. Harris AN M.A. King mmnf, x 01' fn' . A AN D. Plymale 11' AN K.W. Strand AA M.E. Hulme AA I. Skogan AN K.l. Kuntl AN B. Rumble AN C. Wetherington AA K.M. Knox AA T. Slate AN l.l. Kelm '-f- A AN I. Nemeth "lu- AN M. Skupa 1' AOAA Carrier AA K. Pemberton AA A. Thomas 3 2 .. Q, .. .3 1 .g ' ,at .,-51:-:,,.: .,,..-413.4 1. 1 ,- . ,w,..,f...-...A. l A-AA -f-,-na-dan-pv7n5gQqq,pQgg-?f0?q1f,u,q,rf.-9-Ly .1101-,-:g.,.f,w-f-af-gf:-14:5 -Q-V-'fem-fa--fun:-3v1'?evx . M .. -3f"'f"- , '. . fl qv- ,,,. . CWO2 M. Madden A01 R. Huereca A02 I. Poole J 1 muh AOC C. McPeak A01 I. Chedester TM1 F. Dalrymple lim! A01 L. Trammell TM2 l.A. Gears A02 D. Mauton 2 f i Y i . , V 1 Aoz 1. Schell Aoz E. veredecber rm M. Williams 'H -W H" ...---.....-..............b-.4......-.4.....-.4..4d.4---+--: V 1 5 jfi45fiiffiff,ff12 I ke,-.YV , W . Q -..,a,,33c' Q ' ,4 C-4!341 .Y'Y'f"f 1133 ,A - ,X Y ,f 1 "'sl TM3 M. Emmett TM3 B. Lyster A03 M, Mullen f 1 'Q' 1 'tg' , f A02 L.E. Riddle AN R. Aceves AN W. Alexander Y 1, 1 "mfg zlfsQ: f AN R. Bartholome AN P. Bermudez AA G. Fisher 'qi TMSN Huntsberry AN K.E. Kelso AOAN S. Kimbrough nut, 9 X MIN Lynch AN P Mcxmny AA N Munoz .-AGM 342 fC-4 if A ,AU TMSA T.A. Shead AN OREE TurnEY J! 1' A " mmf LT R. Ramirez YN M A01 Tauscher '11-ll A03 L.M. Colyer A LT W.R. Strebeck AOCS A. Bedford N47 M, '--N AO1 R.V. Townsell A02 Kaufman lllbl " I, 7' fi ADAN K.H. Beasley YNSN Kowal mm' '11 GMG1 A. Shulmeyer IIQQE ' A02 V.B. Noland AN DJ. Morgan EQD Xml ,f wk., lmmfy Q 7 -:J lf' AE LT D. Sink CMCS K. Randall A01 C. Capeharl Lib MM2 1. Ritchie 053 D. Gibson 053 D. Mcxaig C-5!EOD I 343 2 yr' ,eww ,warg-,mf-1-sew-. lf :Wil Destroyer Squadron SEVEN was first established in September 1920 as a reserve squadron of 15 ships homeported at Charleston South Carolina The squadron was deactivated from july 1922 until April 1939 when it was reorganized at San Diego Cali forma In December 1940, the squadron was reformed at Newport Rhode Island and until the end of the Euro pean War was actively engaged In escort duties throughout the Atlantic and Mediterranean Theaters In May 1945, the squadron was reformed at San Diego and operated with the Pacific Fleet for the remainder of World War Il In November 1945, the squadron was inactivated and in january 1946, DESRON SIXTY was redesig nated DESRON SEVEN Ships of the squadron partici pated in the Atomic Bomb tests at Bikini Atoll and saw extended action during the Korean War, including the invasion of Inchon. During the Vietnam conflict, the squadron again saw action on the Market Time patrol and engaged in the bombardment of North Vietnam. In january and February 1979, the squadron was actively engaged in Indian Ocean!Arabian Sea opera- tions and participated in the evacuation of Iran. The squadron is assigned to Cruiser-Destroyer Group THREE and operates as an active part of the Pacific Fleet. Since assignment as the Anti-Submarine Warfare Commander CALFA XRAYJ for Battle Group Foxtrot, COMDESRON SEVEN actively participated in all de- ployment work-up exercises and embarked USS En- terprise tCVN-65j on 29 May 1984. Currently, DE- SRON SEVEN consist of the USS CUSHING tDD- 985j, USS KINKAID CDD-965j, USS LEFTWICH CDD- 984J, USS MAHLON S. TISDALE CFFG-27j, and USS WADDELL CDDG-24j. EQUVHBEESLBQIV SEVEN CAPTAIN H.R.jONES,JR., U.S. NAVY Captain jones was born on 12 March 1936 atAmory, Mississippi. He graduated from Southwestern at Memphis with a BA in Philosophy and received his commission from Officer Candidate School in May 1959. He was awarded a MA in Personnel Managementfrom Central Michigan University in 1980. His first tour of duty was in the USS Allen M. Sumner KDD-6923 where he served as ASW Officer. From 1962 to 1963, he was Weapons Officer in USS Robert H. McCard CDD-8223. His next assignment was Operations Officer on the Staff of COMDESRON 34. In 1964, Captain jones served as AssistantCurrent Plans Officeron the Staff of COMASWFORLANT. Upon completion of this tour In 1966, he reported to USS Dewey CDLG-143 as Operations Officer. From 1968 to 1970, Captain jones was attached to COMUSMAC- THAl!jUSMAGTHAl in Bangkok where he was ASW Advisor to the Royal Thai Navy. His next assignment was Executive Officerlof USS E.A. Greene QDD-7115. ln 1971, he served as Chief Staff Officer for COMDESRON 32. He attended Armed Forces Staff College DFIOV to assuming command of USS McCandless tFF-1084j in 1973. Prior to reporting to COMDESRON SEVEN, Captain lones had duty in the Washington, D.C. area as Head, Surface Warfare Man- power Requirements Section COP-393l, Executive Assistant to the Chief of Legislative Affairs, a student in the National War College and Head, Enlisted Community Manager tOP-132Cj. .Captain jones has been awarded the Meritorious Service Medal, lOlnt Service Commendation Medal, Navy Commendation Medal with Combat V and Navy Achievement Medal. Captain jones is married to the former joan Brown of Boston, Massachusetts and they have two children, Penny Lee and H- Rlchard III. I I I .Xf,-n..flXFw ffffj T'XX.CXw ff ff!! XXXXXP I , ff, 'ff' TSX HX f If XXX xxx I I I ,I I f I ,ff X1 f , , ,I I , I I I ,X X f f 1 f I I iff lv! j If I I I I I. I I I f 'I ! X If LIN 1' XX J CHIEF STAFF OFFICER CDR WO. DAVIS IE! nmigli AIR OPERATIONS MATERIAL OFFICER OPERATIONS OFFICER COMBAT SYSTEMS LCDR IACKSON LCDR MORRIS LT WINTER LT SVVAGLER NOT PICTURED LCDR STROUT LCDR MOORE LCDR ANDREWS LT MCCARRICK LT HUBBARD MATERIAL COMBAT SYSTEMS OPERATIONS MEDICAL CHAPLAIN DESRON 7 X345 E ,..,,...........- ' .f-.z--n-ulr,vs-fn:-vqgqgayqpgyfggf fav,-Q, xg --. -'r--f 7 , .VY . . If ff A SUB-BUSTERS I Jfysx N : . E., Z hmlluj! z ff .v ', - rf I mi, in-f mmm f mcs K' bl Msc Boria YN1 Murphy RW Savage O53 Mani' 053 Frmen RMS my lm e I NOT PICTU RED: MMCS MLINARICH RM3 BRADLEYQ RP3 MAU RER 5 OSSN Malseed RM3 Lori 053 Ogouline OS3 Victory RMSN McGriff OSSN Anderson i "DUCK" Fastest RM alive. The ."POWER SECTION" WML "MOM", where is DAD? 346 X DESRON 7 SWAC", DAD says to put that WM? thing Out. NCCM OSBOURNQ RM3 MIDDLETONQ WHAT? Are you out of SUN TAN Lotion Senior. "SEA DADDY" "'VlC" "AIR MARSHALL" IACKSON A HOGGER? What is that? DOC" RE-ENLISTS E A CAREER COMPLETED. "ERROR-FREE MCGRIFFH A "LETTERS MALSEEDH Mr. AEROBICS "DARRYL" DESRON 7!347 Z . v W' ' 13 vi 7 V f f --wg, I , ,V ,X 4- ,V rm.:.n. . . u " - 3 , wi' 1' 1 wk . ' , f wwf- ' 52- ' 'U l-1'.'9r P A ETL fri' , , ,, f I -, , i , an , 1 - Q f. 4345515,-',s,:'gZ,.- 153:14 ,:r52f',':fgjQI-1" 6 L ' ' fiiflilfy x- V ' J "'ff',, ' Q n ew ' gfeaef., ' :-12 4 ,, , f' A ' , In 4' A 1 4 i . L' " ffnwafigggv f ,,.f,::1f,,v,gf.p 1- - wg fl WMA fi ., , ..,gv3:g,y 4 1 g f ff':Ff? Q, Mgt: -A ' '::P2"W'Z f ' f:-'if f I fx A fl .3 1 Z 6, 1 -.. ' if. f A r af' if af Q . f ff, A, ' , f 1 1 1 Q 0 V f f 4w I If 01 Q I af l , , , fl iff Q 5 Wo f f aff " f w W I Q f , f,.,,,m -'IW ,ff -W, H fazfpf ffm 4.595-f1ff,,'f I ,,,, M A, 1-..1. . , , f f ,ay " " ' :W ,4- I ff 4M4?.:,fE4zn l"'Xf: 1 7' ,'f.'-Wff ' wfiff ff 'ff,Z,'f5C'7'l 1 Qffffizwz f, ' , ' , wfzfyg af gym 5 pfgfmfzy wa f:'2z?w,v f ,4 f x . , ' V- Y H ' 3Z'f'75 ' l , I '- f fp f ,y fw -I ,' ,ww , , fafljuyfff' ' 1 , , , , , , yiffyfiify ,V .44-,Qi V- wwf, 1 , , , ,, , Qf . Q , , 'jf 5,717,W,Q,gylcfzmgyfgfyiffifaewn, , , ' ' ' 'Uv , ff? ',,2zfffZiwf.24fff,,.Qi"a'fwz?'WQi,,tf2',' Q3L.w'2 ' . " f " -f :pix 4f,:fZM'1fi af. '21, V V'I'rf'ff"mWWf"'Mf2ff2fwWW: W ,,ff,fW'1ffifff"Q " 1 ' ff w,f,ffj2wfmaffmQWgswzfm53134W46MZZfmzZmgf,,fqgg5,f'f,'f ,wagfma ,. , ,z-,fy - ' ' fwmzmwffyffezffWiMime!wfaezfwwfmfffffl :V . V PZQLW ,mmf 'V ' 1 f . Jw? ff M - . I WiWfWffvZv,1f:f4pz4my ,'y!hf44:4y222L . M11162"M,15?x:c.35,wagpmcc Wx ' ' , .. 14? ', -.wfkfsiifjfw f ,,pffwmf,:w:wzgfQ,e:1,f:fZa2451 2' W ' - ' ' 1-l5fM'W+f V " f " ' ' ' f 3 f '- ' W, -fa ,Q , V? QW-4- W, . ,avfffw2fgcfM-ffZ2:f2Zvf,v15'2f':',f, ' ' fm ' 'f , q ' , ' , ,v7:',',ai,w1 1 ' , ' x f '.wz6yf'f:y1-ww:P:,'w-f1'-wfw,fnL,',44 ,whymycfadmfwwzfwf,Jnc OffM2Qazflvaf'Irfffarww, w w , - -V ' f ,641 , ' ff1,,,,f , ,WN , of ,y,f fm! f.f,f,,1g,4,fa My WW, My 49,41 if , H, ,Q V, U w ff, , 4 f23,'fC, .4,,y,Q 'Q ,fX4'44'f,'Cw35 zz,wy,.C, , a ' ' W , '14'f'?1-M' ' ' 2, Lfwtw ,wgf?ff2f'f1-' ' f ,jffffz i42?ff,f'ff,: ,pf 1' f ,afkkz V 'f f , , - I ,L " Wilfvfiif 1?f'2Z",'2'ftt1 ' ' ' M - f I V357 xv " ' , ' ' Vik: ,, - L, 11ffg',,',,,,,,f,,,2:,g,.,.,,f ' -' KZ!?h1ZW4QQ2JyW4'.4223.Kmy,, , 5, .. fy fvyyagw v ' Y , WvwpggffrygnzmfcgWlf?G?E:4f4pff', , ,, ,M , . ,wgfi.-wig-,ef-q1,g',,1,ff.fx, 241' W , ,UM f , , 4,,W,f,ff4fWff , ff,ff,,,.M ,,f7Q,,4y,f. , , , ,f , , my ,. ,,. , , ffmff, ,W f,, ,, ,, ,M , f, ,, ,,,- f , ,ww f4',,f4ff f,5,,W, ,HV ff -w,fzj5f,g Q y+,,.,'w'x,-g ., '-, ,,fifpf4ff,,.y'L1fwff,-'WW4v,2f:.4:,m cf vgfyzmiVf,f,f,:mvqw?,x1my,,Q ,ff4,gf,f:, ,ml y H fx , 'f ' fYMLWWpf4qwWMMWwfmxy'mfi?w,:ffz6:ff,13,e,414ffM,:vg,Qewwfwff,f f' , ' ' ' v4Q,44v,,4ff,f,f f4U,,ffff,,f,,,Mf -f g,f:f4g'4gy --J 0,wiff,gg,fMf,,4f,4,:z,f.fm4:1.w,f4y,fifwwwf4,f,4,awe-:ff',,fgwwam: ., ,mi f ,W f,,m,,f mffffff , fwmwfawf,,f,,ff , ,-. ' fvfMf2:fWfwWf'Wfmvzzff ' , '- wwf f f ,V ,gf fffwudf , f Wf - -' , f eff! 1' 44 wwf? iwmwas-v f' 9,01,46,AMW-vc4,,1,',af:40 ,m,fQ4,ff:pf,f,.ff'ffMmf -Q .1 -- " 1 V 1ewHwgyzf4w7,4v7Wn.:., ff" ' , V ' . f ' ' - A Q ' f' f "-' f ' Q A ' CARRIER AIR WI ELE VE Carrier Air Wing ELEVEN has an impressive record dating back to October 1942. It has a distinguished combat history and a capability which places it high among the fighting units of the United States Navy. 4 . , Commissioned on Navy Day, 1942, the Air Wing has recorded a significant number of "firsts" in attaining its place as one of the Navy's top fighting organizations. In june 1943, the pilots of,Air. Group ELEVEN conducted the firstdaylight raids during fighting in the Solomon and New Georgia operations of WW II.They also took part in air strikes on Leyte Gulf, Indochina, Formosa, andthe China Mainland. For the above operations, the Presidential Unit Citation was awarded to the Air Group for its extraordinary achievements against the enemy. Duringthe Korean conflict, Carrier Air Group ELEVEN was the first Naval Air Group to engage and down a MIG jet fighter. The Air Group was instrumental in keeping the Pusan Perimeter from collapsing in the early phases of the conflict, and participated in other significant actions such as the Inchon Invasion, the Wonson landing, and the highly successful movement from the Chosin Reservoir. With the addition of the RASC Vigilante, A6A Intruder, and E-2A Hawkeye, Air Wing ELEVEN deployed on board the USS KITTY HAWK to the Seventh Fleet in October 1965 with the most modern, complex strike group ever assembled and evaluated under wartime conditions. During the period December 1965 - May 1966, the Air Wing conducted air strikes against targets in North and South Vietnam, and delivered more ordnance than any other strike group. The Navy Unit Citation was awarded to the USS KITTY HAWK and Air Wing ELEVEN in November 1966 for their superior performance. In August 1967, Air Wing ELEVEN and USS KITTY HAWK were again awarded the Navy Unit Citation for their efforts in the Vietnam conflict from December 1966 to Ma 1967. The Attack Carrier KITTY HAWK and Air Wing ELEVEN became the first shipfair wing to receive the ,Presidential Unit Citation for performance during the Vietnam' conflict. The Citation for KITTY HAWK!Air Wing ELEVEN was approved and signed by President Lyndon B. JOHNSON in recognition for their combat operations that were conducted from December 1967 through june 1968 as part of the United States Seventh Fleet. Carrier Air Wing ELEVEN set numerous records for the Vietnam conflict, foremost of which was a 61 day line period, longest for the war. Prior to the limited bombing announcement, Air Wing ELEVEN ranged the length of North Vietnam striking enemy power plants, rail yards, and lines of transportation and communications and were instrumental in the defense of Khe Sanh. During Attack Carrier Air Wing ELEVEN's sixth WestPac deployment fNovember 70 - Iuly 713 she again broke all previous 350 X CVW-71 records for combat sorties flown and ordnance delivered. This record was short lived, however, for during her seventh deployment she again broke all records. Deployed early due to the 1972 Communist offensive, KITTY HAWK and Air Wing ELEVEN became known as the backbone of the "Linebacker" operations fthe resumption of bombing in North Vietnamj. Bombing the length of North Vietnam, Air Wing ELEVEN was instrumental in forcing the North Vietnamese to negotiate a final end to the conflict. In 1973, Carrier Air Wing ELEVEN and KITTY HAWK transitioned to a 13 squadron air wing and 107 aircraft to form the world's largest air wing under the new CV concept. This new concept, TACAIR and ASWAIR on the same carrier, was implemented and deployed to Westpac in November 1973 for a most successful cruise highlighted by an Air Power Demonstration for the Shah of Iran and the Chairman of the joint Chiefs of Staff while operating in the Indian Ocean. The first CV deployment of a West Coast carrier demonstrated the flexibility of simultaneous TACAIR and ASW employment. Following her first non-combat cruise since 1965, in Iuly 1974, KITTY HAWKICVW-11 returned to CONUS for a brief standdown period. In 19.75 KITTY HAWK!Air Wing ELEVEN once again demonstrated their versatility in the role of a multi-mission carrier with its second CV deployment. Following this deployment, Air Wing ELEVEN underwent a major reorganization incorporating the Navy's newest F-14 Tomcat and S-3A Viking as well as the new A-6E CAINS and E-2C. ' 1.977 saw Carrier Air Wing ELEVEN deployed to WESTPAC aboard the USS KITTY HAWK with the newest aircraft in the fleet. After an eight month extended deployment, Carrier Air Wing ELEVEN began preparations to move the Air Wing to the East Coast. In March 1979, Carrier Air Wing ELEVEN deployed to the Mediterranean aboard the USS AMERICA. The Air Wing was comprised of 10 squadrons with over 90 aircraft stationed throughout the United States. In September 1982, Carrier Air Wing ELEVEN deployed to ,I WESTPAC aboard USS ENTERPRISE. Following the end of an ' extended seven month deployment, Carrier Air Wing ELEVEN commenced preparations for its next deployment. Today Carrier Air Wing ELEVEN is comprised of two fighter squadrons, IVF-114 and VF-2133 flying the F-14A "Tomcat", tWQ light attack squadrons IVA-94 and VA-229 flying the A-7E "Corsair Il , one medium attack squadron IVA-951 flying A-6E "IntrudGrS , and twouanti-submarine squadrons IVS-21 and HS-61 flying the S-3A "Viking" and the SH-3H "Sea King." "',""""'F?ff4A'r1E1vl!Q?1f19f:?1v'rf::r:'svftpm wg? Esearfivfrfssfcffv COMMANDER DAVID L CARROLL USN C ommfznder Cmfrzer Azr Wzng ELEVEN A natlve of Wlnter Haven Florlda Commander Davld Carroll attended the Umverslty of New Mexlco where he graduated wlth a degree ln Business Admlnlstratlon He reported to NAS Pensacola Florlda ln June 1965 and recelved hls wlngs ln October 1966 Commander Carroll lolned Attack Squadron ONE TWENTY TWO and was a member of the flrst transltlon class ln the A 7A CORSAIR ll He was the frrst Enslgn to fly the A 7A A Plankowner ln Attack Squadron 147 he partrclpated ln the flrst A 7 combat crulse After two combat crulses he reported to Attack Squadron ONE TWENTY TWO as an Lnstructor pllot and transltloned to the A 7E He was later assigned to f'l'l8CkCHl'l'lBl'AlfWll1Q ELEVEN as the Landlng Slgnal Officer whlle V'llQ wlth the Dambusters of Attack Squadron ONE NlNETY FIVE were he partlclpated ln the major summer Vietnam offensive of 1972 Whale attached to Attack Carrler Alr Wlng ELEVEN he completed the flrst ClilS?3rn Paclflc CV crulse on the alrcraft carrier USS KITTY HAWK auC0mmander Carroll then reported to the Naval War College where he ended the Command and Staff Course Fleturmng to Naval Arr Sta Lemoore he reported to the Flghtlng Redcocks of Attack Squadron TWENTY TWO and deployed to the Western Paclflc embarked ln the alrcraft carner USS CORAL SEA QCV 431 He then reported to Staff Commander Llght Attack Wlng U S Paclfrc Fleet as A 7E Tramlng Officer Commander Carroll reported to the Warhawks of Attack Squadron NlNETY SEVEN as Executlve Officer In January 1979 and assumed command of the squadron whrle deployed ln the lndlan Ocean ln March 1980 ln June 1981 Commander Carroll reported to Staff Commander Naval Arr Force U S Paclflc Fleet as the Llght Attack Tralnlng Officer ln November 1981 he reported as Commandlng Offlcer and Flrght Leader of the Navy Fllght Demonstratlon Squadron fBlue Angelsl On 18 May 1984 Commander Carroll assumed command of Commander Carroll has been awarded three Dlstlngulshed Flying Crosses 28 Stnke Fllght Alr Medals 8 Navy Commendatlon Medals wlth Combat V the Navy Achlevement Medal as well as numerous other umt and serwce awards He IS marned to the former Patncla Bleklckl of Ready Pennsylvanla CAG X 351 , ' ' ' ' ' ' H. carrleritlrwrng ELEVEN. U U I , ' ' tion ' ' , CAG STAFF 'Yin Z! ,f' CDR R.R. Burbrink LCDR M.A. Carrigan 'WD' ir LCDR Ersek LCDR D.H. Genovese LCDR D.C. Heine Wh- T. : LCDR l.M. Squires LT R.H. Berardi LT B.W. Wamsley T Wh, .3 AVCM F.M. Slavin PRCS D.C. Cuthbert AMCS H.T. Ziegler will SA Azc M.c. scares AK1 r.c. nacala YN1 Mr. weig annum uqxliw r'!"l1Q rf iv SZ LCDR F.G. Cook mf LCDR GA. Spalaforg 71 AOCM R.A. Newcomb YNC R.S. Bowen Magi i e :VA AD1 E.E. Wood CVW D.K. Knox CVW T.R. Hall CVW D. Lagorio .f... mmvavwvrrwwse wh 1-WY'--P""'v"5'f""'?"'5f'a"7'A' -gf, ' ' 3? iii' X M , 1 si? J 4' ff 'M -,T ,, , I , W 3 VM. 4 , ,194 x Q'Ml7n'wff I ff' - fi' 4 Jw W 'VW 9 '- f,f M ' WNW wiv? MJ M5195 iw, mf,Pf'1wCfm2 2 1 ' x l 1 I Q Q Q x X x x x I 1 ! ,ff , AxXw.Y,,,4Y'N--MNA, 'XXX TIYEQCQ iif1FQfQfEWl5fE1G W?ffel3imi5gffm1fK A5s miEii:Sm1lJmi1m31ffiQ Yixgmifiiwmf Siiiaz c3IQH1liifQ-fm fgimifsfww msiiifimifl Ququiwffirzsmvfab QEUlkiqmimiagffi xxxrziifiifkf f'Cliuif:jfifQf My WLM iiilkwcifm dbxmfraii F1531ffIg'1l'21zixii1?KCQ1iHQ1,, mimiim iiifhgrg fgmfmamril CEM? Miiilkas ML 5111+ filifliiwasfSims ?k fsif5Qmfg,y fimiiidmHimxefimiiagwa11:dELi1effiQ CQHQWB fimwfilfkgaaifizfe f':Qe2z3ii1iiEwi11fcgQ5 im ikififm -, , . . , V u M-f f-ff -M'-xv-H rd A 1444 if M W fff f X JJ C f .f L, 47, f. -1 ,A L ,, WL-A,,,,. , ,g LW , , f ,Al Mmwwu WMU ILUQLJQ rm! fkldwffm ,gxfCM g51 r1Jmif55 :MDE vglmgggm ui Ezm1'v r34E 1 MQ mg wg, , L , Q 'L V flu f '.,vKl1,M i3,1.m1An7QEJ ,,rg1,nj,ls,f,, f,nQA,n4KQl.QiQ,Q'y Qf51,mZQA,H1J,, Qyfufil 1 n,m11gg1 nAKg1l13fg .i1z,mQ,1 M xigl,i',jf ,M M Mm K 5 M, 1 Rf ' Y A I I WC, T Mm , , ,g Ck, fm f x J Q E1 EM Q ,7 , CM f'lfN1y'lHW' 0 41' m m l11fM'l'xff 'W' V V"f1fJQ if ' V' '!"'Q'T I? nkfv 5 ,- LK . k 'WX--hw' ,f f"2"1 -f f- fr ' ' 7' ff" 1"'f-,, ,f'L "., , ,.,,, gg-,, , CMlLfI N4,0,lill nL,5 QM U',M5 llQf1I72fW Wfifiniiffw UUIEYP wwe UfUQiii5?,5 i5 WmB4l.eQufHiygl fg i fw,nfg1T rv L -X ' "TJ-V' PQ 'f fi'-fff f ,H Ewfff-ff 'V1'hx-, .- VH- K -L., W ,-, , "' ,.-,rf fx ljlnxrfg Q'fQmJ9l1fCUiVa MrU1 n nm1f27' fJi1lLn,Kgi!l mn,f xiwkifi 1.3591 lg A QQM 13921 1Kmr1M1 '.Gm 1u' Q,U2umf3nffQ1im syseifigmxsf, VA ' L f5f13UWifWlE5 ill' 'W4f2Ii11ZPfEfi1Tmi i mil mmfiiigm QEGUQ Hmififmims EESQHTE Qing p Q fi' 'MQ H'-f' ff-'Ng Y f Pi! .Q-fhl Q-FJ Vv,.1,A,.,7 ,,,:,Q,,.f, ,,,,.,,, 4,,7,,-Q 5 K x-L J,n,lliZgiQ1'u 5n9J,fir,n,n,u,g.4L15,7 :iQ1M gm f,fr n,Agi Jff3QLQ.f,y r3 Xgfc,gif5Mg1jg9, Qggplnmguzjgi-fgkg4jfi 5'3 qggQ13yQ m 535ml X X .- new 1, ny,u,f ,,,,,,, 1 X ,.xdf4Q. .MIL , CDR M. Middleton LCDR K. Golden LCDR D. Roulstone ff" ' Q ,rf 'r If Fl ' 5 ' 221 ,. 4 1. 4 Imlgy, nf fig .. ,A LT T. Andersen LT S. Brown LT S. jones 1-' -.-m,..,. LT F. Thomson LT L.S. Ude LTIG B. Costa gi , , '7,l1n.gkV L Wa S zz LTIG R. lohnson LTIG L. Miccage LTIG F. Quiros 1 LTIG l.R. Robinson LTIG R. Sandoval LTIG K. Stapleton Hwnytmg , L L A JUHI. V LCDR M. Squires CDR M. Staley -n.,,,,,, f LT W. Pearce XRVQ LTIG S. Garlrell vc- , LTIG B. Reidy , . ,A , ,..4f H LTIG E. Stover n HS-6 ! 355 .f f 5 .4 ADC C. Rohrer 3 AME1 R. Cross Wi.. If X fu 3 . 9104 AD1 S. Marshall 3 5 6 X HS-6 A01 M. Beltrano Ili AE1 K. Goosby AT1 R. McCloskey MK ,A V N'- S2 AMS1 R.T. Benkert AMS1 L. Borbajo Y Q29 mn, AD1 I. Grabowski AW1 P. Griffin l gl AX1 D. Mockenhaupt AE1 M. Pavelka r x , ENS S. White ADCS I. Mitchell I... J, V x W I. 3 I f ' AMCS lones 'il'ilm, f Y AMS1 l.D. Brown ix ij AT1 Hollingsworth AMH1 A. Raguine I CW02 P0iSS0fl AECS P.B. lames AWC R. Cordova AMHC B. johnson l 1 1 'Rims A ATC H. Newman AMSC G. Robertson 'MP AMS1 l.C. Brown AK1 C.Q. Cabalil lm. ' AZ1 D.B. Lewis AD1 S.R. Manly , , AD1 MJ. Resnik AZ1 l-N- Rhea Y Y ' ' f 7ZGCCW7'f'f"'1 .wlxvzw-,4 1-,'?l4:l'315:31'l'3' mtv! sf AMH1 R. Schaefer Y X414 AD1 R.E. Socito AW1 R. Veneman v AD2 L. Alexander AE2 M.M. Boineau f 1 AZ2 K.L. Boschee PR2 Brannon AW2 K. Davenport PN2 W.l. Flood AW2 Focht lgmzi A02 R.E. Ford AE2 D. Hamacher .iii , VV ' -06-li AMS2 A. Holland AMH2 C. Houston I yy.. 5 1"W!n. I I 11,115-AA AW2 W. Huntoon ww Q AW2 l.D. Hurst m 337 AE2 T. Lawrence AW2 l-E- LOOP r zz ,- .ww -rv., fr 'nf ,rf.1:... "'5"1. 21-f:'fS- 'Ml'-".1., ' . . r 114' HS-6 X 357 ...gn.5.:aA-.xa-u...A.f.-1.-:D ' , MQIQ 358 X HS-6 ""' 11 A -ff! ' AK2 l.E. Mahoney YN2 P. Matthews mfqtmu. AD2 McKeon AMS2 R. Morneault 'Img AW2 T. Peterson PR2 M. Ratliff f V AMH2 Rossdeutscher AX2 B.G. Scalia WP., sri! AW2 T-P- Speer AE2 E. Sudendorf Mm,- AZ3 Beafup AZ3 E. Behlmann AMS2 E. Mcmmosh PN2 I. Penaranda Y , f tS2 AE2 c. Riegel 5.1 AW2 S.S. Scott .mmm v AT2 K.P. Theis AW3 TA. BoyleS .num rioiiyrrnvpvly wr 'vflr --1-ev-I-1--,sawn Pull' - 1 " , 5 '-Hi'-,f'-.rfi':r.i'9:' 1Asfili-553223-Y.-A-'ilggzi L-2-'4f:2rfff:1"g-42.2-:ff.:,f-:gf1:z?4f-.:q4:z114.1,f.L-za.,m.-1.f,,.'.: L J -1 A 1 , - - , ,. , . , ,, , , , , ' ' - - 'I is 1 42: 132221531152i:?1gii1i34i15"ffZ,"fi9l'-' 1413551-315-Ei' :' 1335517 11 ff 1- f - f -2 " J' " ' , e- - 1 'A 175,'Q7fE7'3E5'?2-'SFP 'PE'-'i'3-'ifgiififl-f'ff3?f1 2?E2f.5'.+ri:'53f:Fail: A ff ' .f ,A,e,.,.'- .,.a. 6 -4 1 1 - W , Q.'af1-'ffmvffi-.1H-wwe:-fff 'H, - ff- ' , , V. - Q c . ' W -K ., ,si '. 5- . . .F AE3 M.E. Bright AW3 A.C. Dorcas 1 hm- , AX3 I. Eldredge AMS3 R. Gonzalez ,thu , YN3 0.1. Leven x- -T 4' amz. AK3 M.E. Collins W! 1 47 AW3 F.D. Deaton AMS3 L.L. Dubbs AE3 W. Elder Y! 1 l l, if '."'l AMH3 D. Endres ADAN E. Forstner 'ii AE3 l. Gustems A03 R.M. Hogan wr 4,4 MS3 M.A. Martin AW3 K. McCulloch qu' 'uni Lu! AD2 RJ. Huber AMS3 D. lacobsen 'Blum . fel? AE3 B. McDaniel AZ3 T. Michael AMH3 D.L. lobe AMS3 D. Montoya J AW3 I. Kingsbury AW3 1. Parsons 4 4 Y 1. ul , dy K .all .4-. , i tsl' n.- AW3 T. Perna AMS3 D. Prittchett AT3 B.W. Ramsey PR3 D.T. Rote AX3 l.P. Scales AMH3 K. Schiebelhut AX3 T. Scholefield HS-6 I 359 ...4,.v0L.. .g ,A '-I.-vai-A ' To M :-sf ' -fear' ' ' c , .- ..,f -- .- WH: .. - X XX M H Y XX X iw , X ! X S ii X. i. F I s i I X .44 I i Q H E WX X X X X X X XX 'X M X X 1 1 X ,X 'N X X X X XX 'X ,Xp X3 Xi S X X' 1 IX GX X X E I' R KX X5 1? 6 a 2 If A 2 4 X X Sw r F? I I X fl W1 I X ' N A .mm MINEQW XXXw344k'Qff'-14iiv3'Xs:X -MXQXA X, X,X,X.X X,X.,,X,, .Wm fi'.-:www M-X-XXX- 44-X-sv' X Wgiace ,HaXz'X:MsH:'w-.X me-X X mfzfi-na AWFQ' r 'A fwxiflib MH-W X-Sm-2iX1 "www XX: ' 1513-fi 36OfHS6 Q um. X - U' ,f INN fu AX3 S. Soderstrom AMH3 W.l. Thiel AMS3 A. Thomton Ti., Awa D.H. wood AD3 LM. Wright Ao3'n.L. Yochim AN R.L. Anderson AN R. Blacketer ADAN l. Barrios AN C.l. Bolner ADAA S.L. Bruley YNSN L.D. Butler ,Q- I AWAA C.N. Castner SN S.L. Dixon AXAN R. Eisenman ' ol! ARAN D.A. Hoenie AEAN B. Kirkendoll ADAN WA- Lewis l X, if R lf 525 X 231 1 fi! X1 'MX Xl X J' ,i Q11 'Xi QQ 91 Z Xif'1! II X X' I! I1 - HT ADAN D. Lightfoot ff: AXAN L.L. Starr AMHAA l.D. Eckert 'Z AN B. Hargraves .1 2' 1 . ! A My f, AN l.M. Lettig '1 1 Z 1 . L4 it AR W.S. Wilcox AA 1.1. Merkl if KZ AWAN K. Thompson 4 AN I. Gustems J' I ADAN P. Hernandez AN R. Schlagal AMSAA Woolridge 1 ' ADAN Mitchell ATAN Montgomery AKAN Morasan 'RS ll ntl fa ATAN l.D. Powers PNSN R. Reeder ATAN M. Van Hyfte AN R.M. Benson ADAA Cook AA Cotie AR W. Darlington l nilzq AN E.L. Harbin AN C.l. lames AN M.S. Smith AMSAA Young HS-6!361 E9E!ZZ'VA APPBJDUW w3Av Kwnw .1 I SOMZJ uaiivs 'fra 31V 1a3uHds'u'9 :Jswv P19d9lIS 'Du sawv 531.1 sbbv anluwx 'wa soov P Q55 'WL 53WI0H 'D'X DI11 PUFIIUH 'V'1 DI11 UYW93-H 'M'X D111 '4a9U9l3G TG DI11 U!U'?D 'D'CI DI11 ,.4 If 3PYM O W 11 JaAalulqod d 11 ini KSISUIYM M 9 11 49" uouans v o 11 'W-T51 1 aIq0N 3 W 11 WMF: 'Will' 1auoSeM 3 A 11 Mwlllva u w 11 af", PWW'-'D 1 D 11 fm in , V V V S 1 V Y V, '--' Q - 'Q Y' . K Y Y V' ' Y V' - Y R Nag? Hhfxhv' um- .1 1 1.-My 1 1 'E' ' , 'B 1. B f if ' Z X X f 7 A I W' ' 53 H 7 1 ,ff I : -, - 91 3 V. W ,ff , 6' 1 ff 1 Z s 2 ' 1 5 1 ff 11.5 1? qi' G ""'b' V, 3 ,JA JBA fl lm. Xwwva 'crx 11 ..-.,,, H ,mgffg Suzlvumuzuog 1911921 'VH HUD Jaagyg Sugpueunuog ,INA 'ITU UCD ueumgd 'M-3 H031 f f' Higgs. 1 IPI!!! 11 3l9n0H '1'1 8031 -144m I ,f 95P!1Pl00M'3'D 11091 ,ar JGDQHO BADTDQXQ SUJDH Wim I' nk 'sassaaans a1n1n1 11amp u1 aauap11u0a WM pu2 S1U3lUI.lS!ldUl0J3P 1s2d .llalll u1 ap11d mp1M p12M101 non' sypgjpau 3u11m1811 am11 '12aA. 12pua12J sn01Aa10 amp Bu11np sl-,cya jgaql 101 V861 A12n1qa1 u1 sxpoapag amp uodn paM01saq gpm aJu2ua1u12mu u011211m2 u1 aauapaaxa 101 p12MV 1a11123 33018 A DIL1 5n0!g!190"0 alll 'U0!l!PPP' UI '88'AIJ 404 PWMV '0l50D9W BPPM 0900-'PD WCIVH 0111 105 00U!W0U 3VdHIVAVNWO3 amp pamu2u s2M 0M1-A1uaM1 u01p2nb5 DIJPIIV 'KDUBJSJ a10w 'asud1a1u3 5511 p120q2 paA01dap A 1ua11na - . I - 5, 1131111111 'uafmalg Su1M 11V 01 uaa1111 Su1M 11V LUOJQ PGBUPQJ s2M PUPUIIUOJ IPUOQIP-lQd0 S,ZZ'VA 'Z86l MPUUPI S l UO 'UODUBIGJ 1auu0s1ad pu2 ssau1p2a1 12qmu0a 10 S1203 BPQMKAPN arp 10 1uau111111n1 paluapabv-'dun 105 l,86l 100W0A0N SZ 01 6L6l ,ww 1 mu011 011123 'a100mua1 SVN IP a10m1s2 pu2 uaa1111 8u1M 11V 13.1193 1apu2muu103 01 PBQJPIIE SIMM aJ1A1as 101 UOQIPPUBUILUOQ ' pun sn0110111aw amp pap12M2 a1aM snpoapau 3u11qS11 aql 'AAPN 'gn amp u1 u01p2nbs 1132112 1saq amp SP 19-A3 101 'WMV ,b1sn13a2w ap2M BJUBJPIJ wqyg amp u0M uo1p2nbs alll 18- A 5 pup 09-M mpoq 101 p121vmV u011ua1a11 UOSIOqJ!N '1 uqol Jva0NlM1v1wo3 0lI1PU9'l00I:l Julvvd 00150 500-'PP005 a1q2A01dap 101 p12MV u011ua1a11 10mpuV uaplog 1113V,DN13 19-M amp pau12a gg-VA 'A112u0111ppV 'SJPBA afmpnaasuoa 509101.-3n'43m00!3!!!3 011111-A1uaM1' u01p2nbg ' xp211V 56130550 'QIBQLUGJQG 01 A0g,,A1nl amp pu2 09, PUB 55, A12nu2l amp 8u11nq . p 's1uawA01dap 1861 'pu2 0816161 amp mpoq 8u11np 2a5 2u1m13 mpnog pu2 3111324 u1a1saM amp u1 saa8n1a1 u21sV 1s2ampn0g 10 anasa1 pu2 1131235 amp pu2 'gL51 u1 ZSDBPAPW amp 10 anaSa1 amp iSL6l u1 u0312g 10 u0112nJ2Aa amp '896l 10 S!S!.lj olqand amp 101 SJGAIIQUPLU ssau1p2a1 papnpu1 aA2q sxpoapag 8u11m1811 amp Aq 01 papuodsa1 S3S!.lJ au111aJ2a,1 'w2u1a1A ll1.l0N JBAO saa1111s 112 8A!SU31U! SP pam SP .IOQJEH 8u0m1d121.1 10 SU!U!lU amp U1 pa12d1J1112d gg-VA 'ZL6l u1 3S!n.lJ 12qmu0J 1s21 118111 Su11nq 7lUPU181A 01 x1s pu2 2a10y1 01 SIUBUIAOIUBP 12qmu0J aa1mp mp1M 's121vm LLIPU18!A pu2 UPBJOQI amp 8u11np u011a2 01u1 041 , PBIIPJ uaaq GAPLI sxpoapag 8u11m1S11 amp SJBBA pg 1s21 amp .IBAO ,fn 1!vS103,, az-v alll '4I1U0U09 P09 H',lMPlWls,, I :IDIS VV ,WUDJH STH ,,'JP3n0J,, 8!9'J6J H'-'0ll1UPd,, I 15-1 ,,'112s103,, np-,1 amp ll8l'l0Jq1 PBSSBJBOJU a1m2m1 s1011d Su1paa3Jn5 ,,'12J12ag,, 19-1 amp Map s101211m2 xpoapau 1s111 aql '0M1-A1uaM1 u01p2nbg xp211V SP-l.l0!1PUS!S3p 1uasa1d 11amp pau12S sxpoapag 8u11m131:1 amp 19111 5551 Alnl 111un 10u s21vm ll '2A 'x110110N SVN IP Q9 u01p2nbg 1a1qS11 SP pau01ss1muu10J s2M 11 uaqm 'Q1751 Alnl 01 DPPQ sa12p A-l01S!ll 5,51-VA . '11213112 Il 1125103 34-V amp 1m1311 pu2 A11 'U!P1U!Pl.U 01 s1 U0!SS!lU 11am11 'S.l8J!110 LZ pu2 uaw pa1s11ua 055 10 dn ap2w s1 UOJPPIIDS pas2q 011123 '9100lU9'I alll 'l9lI0Dl 'V'lI 803 '40 Pal S! H'9l900P0ll 3U!llI3!:I,, amp s2 UMOUDI 0s12 'QZZ-VM 0M1-A1uaM1 u01p2nb5 xp211V ZZ'VA ?f7- r 1 1 1 A 4 W1 ,M ,K .W -v ,gr ,Wm will ww! ,., wr. YN Y 4 Q , !'b iw! wgj W 4 4 Q J - Q 4 , I 1 X , 1 s W , w'Q X x X 1 Q ,H 364 f VA-22 n, ly w 1: ,M AMSC Gulnn ADC M H Ryan PRC Walck DK1 Armat AD1 BJ. Corpuz :vig-3 AEC D E Moore ATC M E Scott ,Z W .vpn AOC D R Walker 'Eh -006 AE1 R E. Bales if-Y -mv R 1 AQ1 C.R. Deleon 4 Q f ga Y, f - MS1 E.r. carduque NC1 Ln. cast -M er , I AQC M.G. Parson ADC Snyder XRS-. 17' f ,, 4, ' 5 - J Y f' 5 YNC Weinhofer My f' AD1 G.F. Brown AMS1 l.R. Denker AZ1 A.D. Gonzales AMSC Porthouse AMSC Speaker 11' P A01 Andres PR1 l.C. Byham SN.. Y AZ1 AJ. Eusebio lim 'H' ' 33 AQ1 l.H. Grahon 1, " uf AE1 Haley AMH1 D.L. Hiltgen 'Ulf' Y f Ml' .W M AT1 D.M. Landry AMS1 L.R. Larson Y fa' r E4 AME1 G.A. MacDonald AT1 D.F. Maddick AQ1 Meadows AMH1 D.G. Merrell "Q, 1 AT1 R.E. Owens AMS1 T.T. Porthouse E! AQ1 S.L. Root A01 Sanford ...mg 'I gh W9 f 1 Yi H n .1424 of Vflfwnfm 1 AD1 Kilgore Y SV 4 AK1 V. Lee PN1 R.Y. Manarang AMS1 LC, Miller AD1 Riney 'T I A01 R.M. Snyder ' im-ffesow .. . ' 'W' M 111 l L fill- 5 , W . , W M21 A D , -44: rimpf 'l'9"'w'b1f' V ' v M 3 rl ' ' vf MW ' rv lllilh ww if VA-22 X 365 lr- l-. AMH2 R.T. Barnes A02 Beatty AME2 G. Benson AMS2 E.B. Carter AT2 R.A. Castro AE2 R.L. Clark Win , 1 AT3 S.W. Driver 366 f VA-22 AK2 Espirilu AMS2 Fade AD2 M, Gu A02 Bennett ff! PR2 W.K. Curling ' ,dqhf Q AMS1 G.E. Speaker AMH1 Tadas 'Vw eizgni PR1 LC. Walck 651 A02 F.B. Birdsall AMH2 DeBoer W . - gl-IA AO1 P.E. Steffey -M AD1 D. Townsend my ,U AQ1 D.M. Wood AMH2 Blacher AD2 Deguzman v-4 YN1 E.L. Swanson Wigs! ' lllj PN1 Vowell 1. il AD1 M.L. Ballard if f, iglml, 'I 5 AQ2 Blair A02 E.G. Delacrul l Lf, l I 13' 1 .Y mmm -l an ' B ...mr B ' Y l li ""' .mem --I isavvma AT2 Halter A12 Harwell AT2 HJ- Heimffi wwf- - ? ing AK2 H.F. Henle AE2 a.H. Hill Q 11' F 1 H AT3 M.S. Hood i AMH2 R.H. Houser AQ2 R.l. Hufford MS2 P.l. Illig hiv' :maui 'I , AE2 X.L. McAfee A02 McGraw AQ2 M.A. Millis flilimr 'X -1 it A02 K.R. Prior AD2 S.A. Ritter AZ2 A. Sanford A02 P.l. Kerrigan 'I A02 l.l. Morris AE2 D.P. Scherer VA-22 milf- QM AD2 R.G. Mack A02 Marinez N' 1 AZ2 M.E. Pakaki A03 B.W. Patrick 'ling , AQ2 K.G. Schmidt AT2 l.B. Sharp S5 -11... Y Y lil 1' 49 AT2 R. Mason AE2 l.L. Poynor lllQM!1l S ' Q AME2 1.0. Shives VA-22 f 367 ,..-l Y J.. , , 1,--nn ,, 0" 2 ......,-...,.-. - Y YIM-, Y N ,-A-S ,,g,,,. aww-.Nw 5,33 ! , -vw.. I ga ri? E AQ2 D.l. Stolhanske AD2 M. Torrefranca nw ,r my AMH2 Voyles AE2 l.F. Webb ll ltllll AME3 A.P. capreni , Y n51t'4 Y --1. f ,fl Y B. ty '53 AQ3 R.W. Athenour AQ3 G.M. Baumer AE3 Brown PR3 R. Cameron ml? Q Y.. my l me AME3 N. Cinciripino AMH3 Cline AMS3 KJ. Comella AE3 T.E. Delaney AD3 l.T. Demsko ill' ex W-..,NY:1 H AK3 RJ. Dickison A03 S.A. Doornink AE3 LE. Downey AOAN R.A Du 368 X VA-22 Man A03 I-L Epstein AME3 Fischer 1 g PR2 M.G. Vanasky .4 -.Q PN3 K.M. Archulet I , AMS3 Beckman AT3 M.A. Campbell AD3 Dibble if Al THQ M53 D.A. Fischer w ,if AME3 l.E. Flanagan fi A03 S.L. Gaines AMS3 Herring 4 4 ,,,f AZ3 l.F. lones ,gn I! A03 M.A. Lafus -51.5 A03 S.l. McCollum min: AMH3 Fleck AE3 Gunn Wim. E AD3 l.S. Hindman A03 L.x. Lafferty um. AMH3 G.A. L005 AMH3 W.G. MCC-hee AQ3 l.R. Fox AMS3 l. Hawkins AD3 lones AME3 KJ. Lattimore AMH3 W.l. Lynch 'mg' I ,1 ul A03 v.w. Mello VA-22 ! 369 LJEM-if i AQ3 Mortimer AMH3 H.T. Peterson YN3 R.G. Reingardt AME3 1.5. Sapp illllk AE3 While AE3 E L White AMS3 R R WIIIIHITIS AQAN B rt il AN RA Bl'0dEl'ICk AOAN D. Carter AOAN Cavaness AZAN W L Childers AN S.Z. Clark AEAN O.N.M.N. Cruz AMHAN A.M. Drisdom 'Hlllh 'I' r, lm ADAN T. Elly AKAN R.R. Esmero , ' -',, xf.' AN Franciose AN R.H. Fultz - ' ,1:f441fa,' ' Mr' ADAN R. Gardner AMEAN GJ. Coodland AQAN Griffioen AEAN Grogan r 5 f E , , Jew 1' I AA T.M. Lully 'Z AOAN Lynch '19 A MSSR Z.l. Faulkner AMSAN M.E. Gallagher ADAN Gray dl" fir AMS3 Kellenberger AMHAN S.S. Milton ,Q-.uw-p--sen-pr-vrr , v v f awe:-a:gr5w'avfffgx'a:-sbvsikuwqm-gs:-gl L. 1 mzrg-wg y lk wr, , L, ' X all f r ,, sr 'rrwvgy figifgvt -wr 5'll""'3, , 3 ,ll link", W rf My N' 1" .1 .M NNW? 7s 'W " W -srl? ll 6955 M2 N5 Avlullvklm H Q viklibe Qfiiklffm ,-1-'lr rw H , ,',.'-'rim-r ,fv:f1H'ff-,ww flaw ,u,v1:1:'Jf'ff'-'rJm::t- 11 f' ww MH W- www,-JN my wp, V, Q4 rwqvpq gfalhnfflgr1!Qr,w,,.'-. vmmzr: f AN DJ. Kriegler AQAN Lamore HN Latham r 12 yali' A AQAN P.F. Montz ATAA G.N. Myers YNSN Neal liilu 'sits . AN Ledlflll una I AMHAN l.H. Nicholas VA-22 X 371 'I 2. :I ,1 1 r 1: H H If xx' l 'J E I 4 I, Z h ! E i 1 .-J 'Emu I Wifi! 44 AQAA Pilkren Q AMSAA Staples AA R.A. Walton 'hh ,fy 5 AEAN TJ. Bohman AR Hiteshew .af , AA I. Romero AKAN D.M. Powers xg, MZ AEAA Shuler AZAA Washington f AMSAA T.C. Brown AN l.W. Horton AN P.D. Rymalowicz X S ng . if A , Nwxw all 1 V Srmifidlvfmial lE 1liC5W 15TEW1:'1FfQTQ1 LJlfE? f'QrQmmfe:1mf2fQ sefffvffnfia as 1'Li?ggifU'lf Mlairik fQ1 fgyim?ai4imiWm im Mimiwirik i1!ZD EHi11 Um E635 :nw zxf zfifiig1k 5ff'Q!fYQ,, Gb? fimimlmm WfiirEfmiiigfghl mm fm- i?Mf aE "03?fff!UETiiYK"'7 afm fgz1 ayQ A4e, ' "UWfHfWWfT'5We if W' f1 3f5Sgihs'f!fIgy E2A?ie1ifHf?5Qs mfmfl Smfiliff fminiihmiiuim JWYr5Ql'5X?U I if?-WE? V51 2f'QfimrQ filiifii' fm? film ifiiimf fsQ yfQimQl11a'Qglme ?fm 1QYpv52Jfli?5iyf Gm Khin? 44iN:4QE,, fiwmmffifmg ygftiimg im smidfllil fiVQiffmJs?rQgm iEii1 zfiL. , Q Qfmiifwes f'Ef5 4m'gi i zvfm1 smfem if6,1f6 r 3QiisiwfiiiwfgfQQ'Mj4Q?ifiufi fikgg1h1gymf emifi:s FTW ffU!5f5 : fi!EQ1IUEFrE!'il'Qimg fi4T 4?ifffiii 51 qgyqgijbgyg g4f5y'qgWj5j 51551157 ' fM xiYfWE1iEE fim TQi'EQ1 'E14fL,, fQ345i?1'2r221'f Cm?Qiifiiiimgmfhmg, my 1ii3wkrQ im iT1f3 iWQ1, Wm' Y HE'f'M1j b1f"w'w 5 f3:ifkigqw2fil mf + 'CTTTW ff mal f'mj1iem1fm'wif! W3 a Efjm5'1 filmffiwav: 4:1:si?m ifz15 i m31mfem a cf5fa1miffi? f'Cfj5xm21 731 gms EEsviff'5ff'ifEf?Hf'Ef'2fii? W1 1QLiiE fi 5551062 M'.iqjmjf l S1I 5Qffy1jg2 fyJ'fy ff1?f?gfg13, fmm 3 g'bJmjgqffg , E mfm'E1MWs 5iiwibf Z2 ' Ef? g1'e T31 '5zE f, jfg .feiii Eim 1? . i5 hk U Wig G EfEe "EWfff 'fffi11i JFVFQ fw2 EFiifQ1fre13m flmwflh filfmig f4IxfEfhmiiwid l 'f5W' ifTl? ?Hiffi Jf llfff fwf3fl im Rib? 16 :2TvN i,aIW- f- 1 111??4?-xavfii 1'22.a11 se2i' w 'XFNIVP L f 1" 3?1yfAf"fh'2 5Q'Q!2U il'QE,WjjAi'gjr! fifmfrx 113-v'V7jx,,, A, 4 47,3 .wwf ., ,V 56Qv?75K! 1 wfif 321 3 33 vi 4 A ef w, , 8257 -Mei 1'L'g2fW' 1,2 2 ,iw . A v MQ. -Qlffng '75 A r is 1' A if ,gjhyg , 4 ,,: , . .f L XR K X giIiafrffzimeu, 'V ,,,15p,.Qmltfwy-'f'1f.y fv ' ' N '1 1,,mf:w11fs32,sef5f sa K g X 1rfffiamli4?Tm1gmi e , ,W ww -, 'Lf jx 8 X ,, 2 1lg.11122?Wgif'3? v1', gif RX V f g',112i22Wi'iii '3 W ,, '--.. .- fiZ.v3f'1?f'77? Z " if ' I-' x Q Huis 2 :V 5 we wx F23 x f , Wf'gi3 , img ,, ' ' ' y:3-i,i'1" "4 15751. Z si X X 'f2szmiw r L fY,,f, ' ,Y,,,, v Y f ,y:!21.f25i2E3fpf , ju Aff: ' v':t,Jnw32iG - fygqtvi. H':w'1ewggw .f .,w5L L Lab,1gfx'E"gLfE3f5f2?gaeLgezu:v ' ' Y- 3,2:wn'.w,4z5lvW! ff ,QMY,,l,9,f?,,5'4mff:4,f, Elf Mll2?1'irfWf'i"'f 4 4 z , . fx Jw, fl ,mm nv., V 1 7 , , 3 -M ,iW:1-w f ' , I v: wfzwwfg 1fUJGTEii1f Qiliiliifiiilifmiffiifhgz !MfY'21'f5f EfQg1T5sffQ1'9i:f5 FQWEG mrmradi 15Qii:213 tfffQimifaimy mQfiQii1l1F Gil? 5555353 wfislfwi 51 awQfmQff5.fl Mzwiifemifdiliufss Uawifvif Emil S5iEfEGY5fH'ffvmmfgy 51l'fQ'v212fLid'l fm? awtffiimf Glliwmiazmgg ildkcs lltsimfsim 613551-35 f fQi f1QQ f?,1?L lQi, Um i312wji3UmfEr'sw? fiwffi ilEHfEK2i,, flvliwiwfji diqgriwffid my 5 3Pi'f ifif?iTKQ:Milm,rEiifaim Uifefim fitQ3TifmipmQmf'E,Q Mrs iimrg if 'iififiwkfi UMEJF fWEWf?2 iQESiE 1'Q2m lTF?ia1ftCkmrz:vifmjg i33'ii?r5 fQa?w1ubf:Q Gb? "E1WiTlf5JifJ?QQfiY5ff fam am smfixfffifkmis fmfmincmiwiifl iimimm midihms-w?m121a?'Q1'EiQl u: 'fili? iifm aEi1bi1Qis1 ' fifr2fife 3misQeikAmm 5:5 QUE' iiiiP3f5?rQ53I M12 Mia? iY2 VAisNg3 "3iB' wgsf?m3 7 sE?i N r?IEE2Ei?f13?Jll131525135 fQjg,fQm1df1m53i1 QwaM vsa11iamm. ' M f' f f ,-nf K, ,X -- j,,.f ,- , if ,f:',,- ,, ' ,. ..-A N' U..-A ' "Tj X X4 P. 'Ll- USK1 frwilff 'Elm 159335 WU? 1 1,'x:2 M3Ul:?,'jf' fiwwgga i,5TY32qS1M3 fYEr7fE4III.r Tllfii WifQf5!?JYU3 Wilfiif g?Qm1?fl'3iEfE1iYl 4CT1 Efismf fimpi6fi6 f3:fm5mmEf ii? ffifmf' fiwdfBfi2crxQ1ifQM5 fiwifiwgg wiv iifwr'QYkim'Q3 Smfsinifs ami? mm ami? i7f2'f vHS if fi fCf QW'2wnz: fi!fg,:TiU2if1?'fj1?x?fllfL0 Fifiw fiE?Ejl56'A27'fUUQ GHUIIFS fG'6MllATI'M?4fWfGs3?449 wUs fbjfmiff'H 2 siibggf 45i1i?Effbjgf .laimaiwift v:fi3mW1iaIf51 1E31?'5 :fmim' ifr2+ ifQ1mil'mtfrmm iilfiifrgi, Qamaj fikinw l'mg:5'mzv3a1 miwifiza? fini? lhmifs fiffbQQT1ZQ'5T5 M211fQwii1'f' fWi1HTxf2f iYi5N6Piii'El?nqi c zmawcrgs13wjrfif?r.fir5 f Hirgzef'gg,e' 3krQf'QiwiWilQIi3 -. ,WT ,M,,A,-f .,., .J .Nw 'Q-x,- - ,,v-,fi,-Wwxff -TV. 4' ' Q H4119-19-55zluiwmna amd? 1501Ulif3,4UINLUI3?Q! 191u m:m.a,n1iEmn-Q53 5gigmpuffu wv - 1Hsi.'Q V035 UIQ Vx "l,.-'1',-.H 'QL Wfjj, ,NA ,J 1, gr X MM W-Mm V b MU!J 54fvv:i ,,7 f,, lr.rms:?fJa1:4 :ww 'l N54m-+34f :S 1r: mM nv'grEL, 'Q ,. '-vx-Q-'its'-rf-1 -va-new Hs- myggu-gn ,, -+.+--f--frmmwmmfxsrie-l'1!!1l'Pw'1Nf W -4- , V .,,,..,.fr.,.....,, ' '.,,Qf...."' , Q . .. , , V-C,-.1-3.1.5 , v-:,a-wvgff-f.--,f.15.-r :gi-.-Q--ffgffvf-g fa--A Y. . . . , h , - ,, -Qi , . ,, . I uf Ll .. .ff-X iam . ,- - Vs,-: ga,-:fu-V--515124.-r'-1 -.-y-.ffgf-, , ' 7 ' ' 'J-'S' ' - " " A ' - g.... , ,, X . I Aw CDR L. Doyle Executive Officer um- LCDR T.l. Keating LT T.M. Gray 'vm'-Ai, f fi, . i V- V. LT G.G. Morissette LT S.S. Ross '-.+L f LT s.H. swift LCDR l.L. Akins I-UIHZI, LCDR M.l. Reese 1' LT S.P. lohnson HQ-Lil..if LT G.D. Neary X V 5 JP' LT T.W. Rullman LT B. Wamsley LCDR l.R. Goddard CDR E.L. Tetrick mm? LT S.W. Bartlett CDR TL. Hzglatower X ,,,r I T , T LT l.l. Lehman LT M.E. Pinho LT M.R. Shand fhgfr-J I , I mc. L.T. chidesmer me Mccloskey mo wanm ws w.1. Campbell i Y , ,uv -1. I , -1- -.,.e,-+.,1., ff ENS l.L. Fisher VA-94 X 375 w.1.4....:..n..L....4..g.x4.:-.v...4- ...aaa ...... L. wld K 1 AFCM l.L. Fielder AFCM C.E. Yeaple YNCS V.T. Borja M Emi 4' AQCS V.L. Brown AMCS D.P. Monaghan ATCS Youngblood 1 ff,- 2 ,C qudii AQC W.F. McDonald MSI F.G. Castillo 37 6 X VA-94 I . ff . 'H 5 af c"! 'gp if fl . gfff .sm I ff' .L 1 2' X All l AMHC l.D. Arflack AEC K.L. Black AMHC Hernandez f' N' - 2 E127 ! ADC CJ-I, Ice AMSC jenkins AOC A.C. Marr 'Jmwj '15, ATC S.F. Sztukowski ADC D.M. Trauger AMSC R.D. Wilder AMH1 w.R. Britton A01 suse AME1 G-W- Calhoun Ma. C+, or 3 A11 o.L. Close AD1 0.5. Cook PRI 0.1. craig PN1 E-M. Deiesus AMS1 R.W. Deville AK1 w.T. DYllC0 1,:..,c:'Q:: '-:Q,Q-Q..-,-g1..,,:-.ff--11,-,-R , A R R. R y , ,X R, , , 7 - -p..--.- . .1 ---1,-J -, --' 1 ..,,.A.,. V, .ch ,,,,,.-,. J F....,.--., ..., .,,,,,,., MMR. ,.,. ., ,,,,, . .,...,,.. M , R V I . rl K t , R we R ,R R R y R ' s ' ig - . 2.1.5.5 AD1 M I Elllott -ar ' Y wx' AMH1 N R Hernandez AZ1 D G Muller 5. ' AZ1 KA Class AD1 DZ Gomez Muay .go Q "" P1 AMS1 D B lenklns AE1 LO lenkms 185141 91" lmllul AD1 R B Morales AMS1 H Munoz Emi' 'N-Q Y? ug,-M. Q29 AMS1 Rl Grosz ADZIA Gutierrez AMH1 M P Hassett Q-llB'h QED AMS1 R N johnson PR1 R H Kuczynskl AQ1 T L Lymangrover 'imma 111.4 A01 H L Oney AD1 D R Peeler A01 H B Roberts i YN1 P I Hemdel AMS1 RP Manallla Amcl scan VA 94 X 377 if ,V,' U I 1, . V ' J I f I R' iv .XR R-, R VR R RR V R zlzyn, Q ,V 1 5 i ty 'mg faqs' Yr , 1 R R t 4 R 4-: xert in H - . R Nl R R V . ff V Y A, V- d limit? Y l V Q Y fx , Y 4 wi B X R at 1 1 sfz - I V M r 4 f" -1 lign- lu, 'Y 'nip ,689 AME2 F.R. Catlett AQ2 M.R. Conklin A02 A.A. Cornett MQW 'asa AMS2 R.M. Ferrer AT2 F.L. Fleming AK2 0.0. Gajardo im. X iq. gl l AME2 L. Hardy AT2 G.B. Harrison AZ2 T.L. Hebbard 378 ! VA-94 AD2 B.K. Davis AMS2 H.G. Garcia AMS2 C. Holloway X ll X w v r A01 A.D. Teel ig 1 " f Y AE2 E.B. Allas 1 Y.. AMS2 R.D. Cadiente mf.Q,u 5 A AMH2 T.C. D8Sll'ee Wm. A02 D. Gomez AE2 ox. Kaya , NA, xg +113 "Q'lrf, Y glam, AMH1 L.R.C. Thorne A51 M,5, wing, DK2 O.A. Araracap AQ2 P.R. Beaudoin fb-:ff-ff . Hilla- MS2 K.A. Carpenter AMH2 Carter I AD2 l.L. Dulay AMH2 Faulks fig. ' 'ml ix' 5f xuoy AMH2 Grarldslaff AE2 M.D. Hall maxim! Y AT2 R.C. Linstead AMS2 D.C. Macias Y.. AMH2 Michell AT2 C.S. Owens AD2 T.A. Rose Llrtliml, AMS2 M.C. Tucker AT2 Welbom 'I lo-. I AMH3 C.G. Anies lain: Y .41 AD2 w.w. Niggli 5 f'N .314 NC2 S.A. Pace 4 e.-2 1 AE2 C.S. Salter A02 M.C. Turany ' ' V , .-a-4 AT2 W.P. Wittenauer 'till " X. AD3 T.D. Arndt A03 A E Aurandt A03 m."lf "URI R P Bed I HM3 M C Bell AT3 T F Biddle AD3 S A Breech AMS3 M E Bowles AD3 KJ. Bunow sau fumqm Kid' AK3 R D Cadlente MS3 S M Castaneda AE3 Clayton ln' 1 rm-I.,-,Q 'nm .Ad AD3 G A Cooper AE3 W F Cotten AE3 A.D. Crawford QQ 380 X VA 94 A03 AI Davl A03 B L Dun op A03 W-B- Evans Y -Hn? AMH3 Form A03 I A Forton AMH3 E. Frazier l AEAN 1.0. Fuller A03 AM. Gentile Ara l-R- Geyer I 'KH' ' ,V . J ll , 00 Q um jd .. ' . . I ws f J , 1 ,vu r .uv u..f-fn-4-wfgfrvfv -fr-ff 4' 1 Illlku 4 ""' Us! AMH3 R.W. Hanson Y AQ3 s.w. cilkey AT3 I.V. Hutchinson A03 G.F. lasinski Xml AME3 C.T. Mitchell AQ3 TJ. Morton I?- AMS3 R. Rodriguez AMH3 L.A. Rue .viva AMS3 S.R. Westhof AD3 T.L. Welborn 'ln x' AT3 R.D. Williams AMS3 W.A. Yohn AQ3 M.W. Hecker AQ3 L. Larosa AZ3 l.L. Nesmith AE3 M.D. Seymour AMS3 l.R. Wied l lx-1 AMH3 l.L. Zamora Y. AMH3 C.A. Herrera rn.,,. 1k e lil! A03 Lord AQ3 l.C. Mack AMS3 Martindale A03 D. Mesa 'ilu' PN3 l.M. Norzagaray AE3 S. Ramirez nl.,-M. V A13 F-I. Ramos AQ3 H.F. Ricker mlm I f , RY p n'0'4iJ It-.- PR3 S.C. Stringer AMS3 R.W. Sweeney AZ3 D.H. Vollmer AE3 E.S. Waller VA-94 X 381 ADAN T. Beard eteeeeyte 'ZX AMSAN M.R. Bildstein I uf u XD i AEAN Brenner AMHAN R.V. Cartaciano nn., A i 4 AOAN T.A. Conte ADAN A.G. Cornwell ATAN R.K. Davenport AOAN W.E. Davis YNSN T.N. Day 'ln "Q L, 4 W .gr an A p 4 l... 4' AN M.G. Ervin AN K.R. Prado AQAN s. Garrison ATAN A.P. Gehrels AOAN T. Goyen 382 X VA-94 f 21112newee SN R.D. Becker ADAN D.A. Bentley A ATAN l.L. Boger PNSN F.E. Boynton MSSN C.R. Buck AEAN W. Casey Ill ' AN l.C. Clark AN P.M. Clark AN R.D. Denbow ADAN L.W. English x t:kt.- 1 vi' AMHAN R.L. Herbel ADAN Hevvfock ,1'lwgr,:gQ'11:7:i?.'.r, A,.,..5.-..,.. - ,-1-144-ff f' A--H" ' - g -H ,Vg , ,W ,,,., WYWV ,, , ,, Y , Y . , , :.,.L....,,a-.,., .B 1 A J PNSA l.E. Blackburn AMsM M.:-l.ca1liff 384 X VA-94 AA l.A. Bodie AKAA Harris AQM 50SSraaf MSSA R.L. Cornette 4 k AOAA Hewitt ADAA c.A. Hoffman AQAN T.E. Riley num AMHAN W.I. Spani ru, I -can A AMSAN R.D. Whitaker AA L. Ballard 5 ,ar A AMEAA L. Delacruz AA Holley AN B.M. Schuller ATAN D.P. Stack Hman 5 AN M.A. Young AZAA T.R. Beverly AA MJ. Fleming AA S.M. Isaacs A "IQ, ' ll 'ff AKAN c.c. smart AEAN B.C. Trimmer AA K.A. Alvarez PRAA T.C. Bingham AA M.D. Funk AA D.D.H. l0l'l95 Z AMHAA BJ. Lawton Z AN BJ. Magestro I AMSAA l.l. Seibold AMEAA M.E. League 5 7 A Ara AA McAllister is AMEAA l.F. Sharrow 2 X ADAA Leverette Q AKAA McCreight AA R.R. Silva ,,,,,4.,.x,,,,., A , A -. AMSAA LA. Moody oh!! AMSAA S.L. Steadman 2 r lwmru 4 4 9 1 'C will Pew Icliflfpw l ,ez ,1,W'f,,, 1-,-A w. -, ,, wi my ,gun wil vi AM ,Adm ,gurl 15 , grip ' 41' :H 4- 4 f-W Wil 1915: WWF' XEQW .gg " " 15' ,.4bw4.,5 qmail. E ,,2,w3,J, J w,, , 1- - ww, ,.,,,,, A ,Ar-, Mg AA LE. Nunn oQ'. fi AA D.P. Sweet X YNSA R.M. Ortiz AA N,G, Scholl Al? AA R.E. Taylor AMEAA RJ. Voss .....,' A 1' A f -3 AA D.R. Williams AA D.S. Wrey AA A.A. Wimberly ADAA T. Yarborough SR Leety ATAR M.R. Reed ADAR l.C. Stewmon l 'x H" 4"" 'a ....,,...-... ..,........-...,-- VA-94 X 385 , ...Y - - az... -Y- vvr ,, , ,,,,,,, .T ,...,...- ...Y gfhf, xi N 'll 1734 yi ,-,X wc U xe PF, A '7 x I U '1 1 ' 0 1 xl-, in ,Ia X, 'L -hi Mm,-,1.f!.. ,X Y, ,f qfzff A ,, K, A M. ,. , V, ' 9 Wli?:fALJaQ A M, 1' . Y ,,,, , .,,. L, ' 4 fi 23 0 1 H 1 1 vc fxgfggm Q i 1gx6i wsesULE :1x'.W.., - ' wma ' " - , W. ,LJ Wwe, Q i,eW.K5 iE3v5liSfnQ2 ifiiw Q6 ll2fLQlfhQ532.Ky Ps , f Ax E W' YV X? gr xx f My Fi' ' " -W ,. 3' Lf-.U ,. , .,,. 'Q 53 XOYH U-,L-fwf?951l1" f,-1.-'.h-,Qi-U,UM M3if3.U.-BEJ iz,-:4.,U.q fr U11 ,, ,?35R:1,fW" yr! 2 1 Ajvfuf 1 , mQx.w::. , ,, WA, Y WWE N ,, ,W ,NIUE H1 1 1 1 1 1 1 1 1 1 1 m77i5'72-fv QWCM- . - I ff, f ,. fi' ww QM! ww' WM H1 ff: -ff ff , ,,w,,4ffff f f,, fff Laying ,iffy , ,wp .1 CDR D.M. Brennan 1 1 . LCDR R.M. Maskew 1 1 1 1 1 1 1 1 I A Q r ,171 1 xi ' 'J 1 1 LCDR G.M. Swanberg 1 1 1 1 1 1 1 1 I 1 , , J! 1 1 1 1 V K , 1, 1 1 if 1 1 LT W.F. Bankowski 1 1 1 1 1 1 1 1 1. 1 1 ff dm!! '11 I 1 LT M.C. Geron 1 1 1 I 1 Wap! CDR Rosenberg CDR R.T. Wojcik Executive Officer Commanding Officer CDR B. jones Commamizng Ofhcer V' 1 113111 1 1 ,rii ,. msgid? CDR A.W. Houck CDR G.M. Sims XJ Q .Wo ? I, 'Zia' fx ' LCDR E.L. Morton LCDR l.F. Schork m.11 LCDR Thomson LCDR TJ. Toms 1--min LTIG W.T. Byrne LT C.K. Dawson cv, 4 V',g,'u J Tuff LT D.H. Gildea LT l.M. Hendricks 1 51313 .41-'vu 1 1 , fi 1' 1 1 'M fl, f W. ,v , W' UQ-, j.'v."Lx fl., N 4V,' 54.5, T, e f 4, qq f 'Q 4f J 1 1 qi v 1 L w X 1 w . -4, 1 L it ff 1 f ,,,f f X mugs! ff? , 'J z' f ,JI , . .29 ae , ,, fy :K-595 li QM J I Q 4222 -LJ:-GK -.3211 qs ' Q vg,,3l4y, 'ff"'J2'ffi5'1.Qr+r '251'f'Y"'Y Qws 2 f-, ,M 4 ffllflww o,. I . . qv 5 .P 41- 42 mf' , f' ' M532 . WN, ,., ww- f. z I X i 2 9 ,,,---' ' if Ai' S 2- S : f, . P f , 'f 75?3f7fQ?4 X 45141 ,Q ,,. 54: X "Ili 912 V ' 'YF wi J elegv x, ,v,f':J.-,-L 1 ipfjlf A 5:25 fl,J5K,'-13 ,, .f, ,Ng 1 Ar, f A an , Y, My ,,., ' 1 ':"p,., 1, , y f V nw H. "'nf."f W' W ,,,,,. 1 1 f. -X ,Q .,A, A . ,f ,fy , A f ssfifgzif -J' g 42 4 1 5 3 Z 'A 1 3, E 5 f ' :ying , may , H iff fain 1 ' fi, f' by V 5,3 "' ,, V ff, ' 5' " f an ,Q D xk,A-U, , . 1 way , sf:,-,fn 1' -":"'yff , ' MM, ?1 .ff :f'Ambi95V'u,4U'y' " . .JM-1,f, ,,. , ' ,' . ' .?fj'j,3,f,1,Xgry7 gg2f,5Q::f1'-4, wi: E,f1f5fix?:g'f L 'gg-fIfE".1'-, ' . f 1 ,f,,4,,7. my ,f f5'12 ,i?y3'E1"fff " U 7212- Vf 1 , I 4211, wi .K xl , A Ak,-. v wv ffm 'M' .1 if . v,-5 f JJ-:J 1 f 1 '31, 5 V .. v mg ,g. A A3-A ff I., .M v it , ,,,f'g:'-'M Y.- -.5 '-14--.1-4-.4 -1.,..-1,1--.-.N -,, .,-.-1 .. -, A. , , , . .. . 'N A f' ' .1 "' ' V rv-44-. rf'-' Qu.:-mocq.-gwegq . . ' , , ' W-' pf' 1:33, .- 't a ' 4-ag: 111 ' . 1 , Q 1 'W-Q. I -f -Qxivwvj-..6,3f7.,,W:-:lt ,:?.f,3:,?,,?,,.Vi5A,,:,A.:1 .,f,,.?,., 34 Y, I fri , ,ff-Q 15-,..u51z.. , 1, V ffm- . ' :fr 3 . ,,1 X , , , ,1 AOC M.S. Gregory 7 fffrll A K ! " Q ,E Vi L ,,,f 1 ATC W.D. Nelson ri. AQ1 AJ. Beckeu S2 s A01 S.R. Daunt 45 'WWW , UPN? fax i AMSC l.L. Bahr AEC D.P. Bradshaw . xwb ,ff ,E ii "sf H ml Zf ADC S. Paradowski ADC T.G. Stroeder xvldl A01 E. Branigh AQ1 N.L. Cooks 'SWE mmm! QZ 'X AD1 D.D. Dawson AE1 S.M. Derusha 3 , , I 9 X Q AMHC D.L. Mccaffee ran, A Y, 54 Am M.A. Beach A01 1. Dahlhauser ""lfm.,u hd :pl AME1 L.L. Dix g,:,7p,zj.' ,im 5, 1. ,,,:'wlW.Q mg -A .,,, Huw Wim 1 Fw ,. 4s:..u.:-uw.-...fag-s-f fb VA-95 X 389 Webb A01 A.L. Ekstrom AT1 B.E. Fredericks AQ1 W.H. Gallion AD1 F. Hardy PN1 T.M. Heinz AMS1 Imlah -En, .. mi Ill Eli Y Mm' Y 'ffluf' I WM gYJ NC1 1.c. lanes AME1 s. Makoski A01 T. Middleton YN1 M.E. Miller AMS1 R.w. Minor AQ1 LR. Murray 'U' f sv AZ1 CJ. Parrish AMH1 A.L. Shepard AMS1 Smith AQ1 W.R. Swarmer AMH1 Teems 390 X VA-95 ?lunq K PR1 D.L. Vanwormer AMS1 D.E. lacobs Q Y AE1 R. Pancoast AA AE1 M.C. Wells ifia iqlf " AMS1 K.C. Zander AK2 T.R. Beuck AT2 W. Brubaker Quan! "'g A AQ1 N.F. Faberski AE2 l.W. Giles gnl t,.4yj,' r-.-L 1. 41. -nh, :ll AME2 GJ. Annas AK2 Barnhart M5,,zsg..2,. L f it .q mn AT2 C.S. Boelter AME2 K.L. Brock W! AO2 E. Cunningham AMS2 l.D. Dahl , ihl ff. zs, a rv 1 ' 12, ',s0'1 AD2 F.G. Francisco AE2 5.6. Gehis 'mv WY. fer- J AE2 G. Hagans AT2 M.A. Hall AE2 D. Hickson AN l.I. Kapp AQ2 R.O. Kirk AM52 G.R. Louis Illini 1 V, I 4651 gl zg.n,, ll in X, 113, AQ2 W.E. Morrison AZ2 A.O. Mullins A02 L.A. Munoz A02 H.A. Myers AMS2 K. Nakanishi AMH2 W Y W .E. Nett AE2 F.C. Noble VA-95 X 397 x.....u.f..L-.-a.-na-Ia-Luv.-s,-hs--22 """""""-""'-A' 7 , 1 X ' z E V ,. 5 4 , , iv l I I 1. I I T9 if l 3! i 'I 45' ,U 11, 3 ! i F ,, jl 1, ii ! I R, 1, 1 1 i l I Q? t + xl z ' JI s Q 5 X if ,: Q. - 1 1,1431 7 f,MyJ,J,,,1 I mMm.NM,,g-f--vu-1 .1 fm.-., A 1 W ,, MNA-3:11 -wa . M7 67 fi ilk ! Quqgvg .--it gy. 1 SQ Jas., .. fxa.,:.A...- A - - AMEAN E.A. Owens A03 C. Pantelopoulos 394 I VA-95 j. AE3 IJ. Seymour AMS3 W.D. Stanzell A f A03 w.H. Payton W1 .Qld MS3 S.D. Tanagras 5 Q1 A13 D.K. Reynolds AE3 L.M. Triplett 'lu I I3 4 f AD3 D.W. Wathier AZ3 B.B. Woods AQAN D. Anderson AMHAN K.E. Beans if ADAN MJ. Bell 47 AN L.A. Blakley J! ISSN l.L. Cook 2 ,A AMEAN WJ. Dupre 2' ADAN O.G. Flores 1 I ATAN M.P. Griffin 1' M frw 1 :K -f-,ff -ug Q-1: ro- -ww--ur-pnsuylrl A in ""'1uf,4V r A AZAN MJ. Bento AMSAN l.P. Bishop AQAN B. Blackstock AOAN I. Chmelar AMEAN L. Christensen I AN P.N. Cotti ADAN I.l.. Desmidt ATAN l.T. File ADAN O. Flores f 6 AN M.H. Forbes AMSAN M.s. Gregory 1 2 ADAN v.s. Guerrero AMSAN LC- Hall i VA-95 X 395 ,,1,..,....J-.a.....- 396 X VA-95 7 , I AMHAN T.L. Hamlin AOAN l.D. Huff AN R.H. larvis l A. Q fl 4 AEAN R.W. lones MSSN S.A. lones ADAN D.M. Kelley i W AEAN K. Kirkpatrick AN K.D. Kucera AQAN B.E. Melikian li W AEAN D. Meriwether AN A. Moreno AN wJ. Pflfe ao' A AN R. Radebaugh MSSN K.L. Ramsdell AN A. Ruiz ,xg if s 7 AN K.L. Sayles AQAN E.M. Schubert AN D.l. Selenke f X. V, -,J Z AN E.D. Sewell SN P.M. Wenstrup ly gg 5 '42 ATAN B.G. Woodward AA R C Hlgdon ATAA R F Pate I 10 I AEAN I. Simpson AEAN M.G. Winisky AN C.L. Burnette AMSAA I F Moore f 'Q' X AA I C Rltua AKAA ward PRAR 1 L Deaver AR G A IOHCS 1 MW wi. ., M , 'ra -4 m N V o o A , A 'Q ff ,f , X r U i K' 4 A J, f X f 1 ia, o o X 4 f . o o , ovyo A ga A ,g V A L K , b ,V i U A. wY-- V '-,,:,,,ri ' ..F,T4B -as fd' ,-:....,.,-. yu .. , . . Henman iii' Q, ,. "'5:P1-ati.-I :N grn: -u,--,-1 ,fx - -V . -,. .Q-app -, 4 ..,- Y V , .Nu KES-Hg... , ....,--A 5, ,2ff.4. five 2 .15 ..-3:71211--A-.,:f-fm.r',:1K-,-fn--fkf-Gzv.:fM4+sf,19 xi' rf-1' -4 ., x.,f.1q':: -.a1.:,'.:-f-1:vff:,y-kim-pf - -H f ' ..,f.v.-...-.af A Q Lal , 16 ,ji .5 A- 3 . -- J..-N N 5 fr A-N abs 1 X V A 5,1 K, ....a - J 1 .xwgsmamm ,-U. zlgg ' ' xx? nu ,, X ' 7 ' ,.,,,..W.w ,4 Pk ii-425' ff im, ww,-nr., , if ,mpgazzv - 'K f , - ,- f -1 1. Mg: V fkl' ,-,ff-' ' 2 'f if V- , af xv A . S A ,milf , 531- Qi, 5- v- - 1 li E2-'EE?i'?P??1 1355113454 EZQZEEEQZEE''iCi1?f33'5L51H7f.i'iff1241-'I4?f7""-glefi EJ- 1525, , , if :- V Ya? Qegg-1Lilgpgfgfggiffgegagjf-gfwgfrsgg.555.2fg4f'E.?-a2C5s21f3e1r171ig f.1i5y:f2,+gzf:gg -:,.gffj 5- ' nr- . - 3.21.5"ig-X5:-4wi"ar:S1z:r53.131-.:f:v:1..' Jfgfghiugiffszfrp, 4:1131-kgs, i f---21,2 - - gp-. - .. J - 1 A- - 'YAP ""4'-ru, .M WL' gunman. ,. .kr 5 A K. ,uc W Iglh 'L ' . , A! A., . 'Yg - 35 . f fi 5,2 ng L54 : . I X, vw TAT he I hw 7.1 I,m , WP' . if 4 My ,, Qi Q9 1 - M Q- Q ' v. ,,W2..:9'f14 , ,f if- 2, M, an , in an 4 ' Vflz, wwfiqml -.,pL,1, -f f .fd ':,, 4 -.9 ' ,,p '.X14.1aioQf:f4f 46'1ff"":u' I I Mfr Q gfgmaa 1 - . In I . . I V V . f V if V W, ,,.,, Q 2 QQ., ,wmv f Af -fx Ig S 193514 1- ms .HJ , , .JM -14.11 V i V V W mf rw ' 91 444 -1 V ! 5 1 avr ,. fx g.,.-,if .119 33122:-Yhgixi:-hr iw?+'3:5.'.Q- ., , ,fi .2 ,... , ,..,,,.,,.:..A:. ,,,y,,,,,x . , ffm:-, ,gm I illi . , - Q K PO.. M' - A 400 X VAQ-133 ff' T , g -1 fl LTIG S. Rorke AFCM I. Pimley 1 ,Z ATCS l. Mayfield "'-vw... E. T ATC Asbridge AMSC I. Moore f'N lilmul AMSC Troxclair Q., 'ff CWO2 A. Hardin AVCM B. Dial AMCS P. Coombe AMCS B. Mangeng am. mix ADCS N. Russin AECS R. Schuler I. Q, 1 4' if--1 il Q A-1 nh- . ATC K. Cleveland ATC W. Denning KW Z My J ff 'EP il W! NM, ATC F. Pacouing ATC T- 5nYd9" ATI L. Asbridge AK1 R- Barnes iwffklrlzfiiiiffn -any I AD1 l. Boyle 'Q M51 V. Estrada AEI Guier Q K 4 Az1D.Hood AT1 M. johnson min. I AT1 R. Palmer E! .wr xB Y Nl ex. Q AZ1 A. Caiola Q? 5 I IS1 W.E. Fremgen L , AEI M. Harlow l In-V AD1 F. Howie ...La- AT1 lones ,IL fail AMH1 W. Ransford 'Q- AD1 D. Coger 5,51 YN1 I. Garcia NH V ADC P. Henderson w ,: f AT1 D. leffs rwfp. '!. AMH1 R. Kemker 5155352 f AMS1 R. Sadler F AT1 W. Key AD1 c. Spear WW, .yy L mm, 'mmf Wi :V SZ PN1 I. Kume AMS1 L. Lee AMS1 McDonald 'I , . K 6 5 I YN1 L. Stewart AMS1 R. Troxclair AK1 CD- weindel VAQ-133 X407 . ' qff' Q ,I-' 1 gi LL, I III I 15 I 1 1,1 1 1 1 I1 I 1 I I 11 1: I1 1- III ,1 II 1 1 1 I 1 '1 1 I I , I I Igi I1 II I 1 I IE 1 ,I I I I I I 1 I 1 1. I1 1 If , :I 11 1 1 1 1 1' 1' 1 1 MI I II ,II ' I1 1 11 I 1 ' 1 I , X 1 I 1 I I1 L I 1 I 21 I 1 I ' 1 I 'I I I fJ1 , II 11 1 Q I1 I I 1 I 1 1 I I '1 1 I ' I :1 1 1 I, ,I I 1 19 III I ,I 1 I I W, ,I I. I I III I 1 I I 11 ,I I 1 1' 'f 1 1 I 5 1 I I . +1 I I 1 I Q 1. 1 I 1 ,I I I 5 1II ul 15 II . I -.4 N, ag' ,,.' ,.-Y ..WV,3- - f- --W ---f!' ,.. 1 , l ., r, K 1. . 4 A I , . N 1 -a "Lg 9 ' " , bfi 1 L1 E1 - . , . - ,- ,a- f 741-'f , ,1 , , vi. ligsf. .,.5,,,.:1,',' D, if - 1 n 1 It f ,- Q V: I Lf 1 I i- , , fa' lf, ., 1 at ' lv ,R . ,- - ,.' X ' ' xj 3 x Q ' 1 . -. I . 1 x u 35 . ' 1' I 'V K, I X .---'41""'1'v .Q ms, wg, 1, " ,fuk ...qw Rx I I - 1 Q, . 1 I . , Wig , I: ,-"gif I I .E 1 K 4, X K C, I 'I ?2:,x,fx QI, ' X Q-- my 4 ., ' "' , I 1 . -t:1: -gsnmk ' --..,. W,-f'M ,-uh'-5 I fag if , 1 2 - ,4ge71f1,ff1yI 151 1 11215 1 ii' , SX. 2, ,T z x, A fig.. ,IK 'Sf -ff?" ' 5 ."' - , I. 114 " K ,1 Ii, 1 ,.. I ,Wh 1, . ., ,-,N . ,,' yP!::fsf, JY I +51 ' gf 'ffk uf MMI fn QW' fn' ei I E. M- .E 21,31-Lf 'V f ,1 f 7, ,L .4 1 WW, AM, f Q.. ,.- Sf ..,,, :xg , ,Q ' ao- M..- AT2 T.L. Parmerlee --. fl' AT2 F. Roatch Lf'--f AMH2 l. Spann A02 M. Whitford AZ3 T. Collins AT3 G. Donnelly L Q 'B D ii! -1 ' 5.11 PN2 N. Pingrey AT2 I. Sawyer i V 5971 3 AE2 D. Tice AT3 P.G. Bames AK3 R. Denney AT3 S.G. Dyche if 5. 'rf " ff- ,... u- ,--fgerr 3 rulnl me Z AZ2 B. Prince --' if .er NJ AE2 M. Schneider A02 A. Walters A2 'Ie bi AT3 M. Boney L la AE3 S. Dickson um, PN3 R. Edwards MS2 R. Rakes VAQ-133 VAQ-133 X403 E 1 AT3 S. Hodge HM3 L. Kellaher AT3 W. McKinley AE3 R. Muna ASM3 M. Pikey AME3 R. Sherry AT3 T. Sparks AT3 D.W. Spinner vn.,,.,-1 ,bf AK3 c. Sturgill A03 M. Taylor PN3 D. Tracy MS3 Willams Y 4271 AE3 R. Winward AE3 R. Wood AN I. Allen AEAN T.L. Brantley PRAN K. Brown YNSN R. Burgess AN R. Cannon AMEAN Carlisle lug, I 1 7 ATAN R.C. Chavez PRAN R. Conklin .mir i:"'l AMS3 I. Yelton ADAN I. Brown AN F. Burns AMSAN C. Cayo ATAN R. Deines .H-If 4, iff, ATAN T. Demott ATAN C. Duarte AN R. Fisher AMSAN A. Fontaine 1' 1 'Q IQ" hi' f . lzlul ut-1 'U' if l. , , ab AMEAN Framstad ATAN L. Gauvin AMHAN D. Hammond ATAN D. Harit AN E. Haury AN Huff VAQ-733 X405 pg..a....m4..-.- 1,3 rf 1 Q ki V. I ,t I, 0 A I ,r a N5 ,gywx 7. I AEAN K.R. Zeller AA L. Bennett AMHAA R. Bergdoll yi AMHAA I. Fooih AMSAN B. Forseth AA B. Fritch , 19' AMHAA K. Gentle AA D. Harden ATAA T. Knowland AA Ordonio AMEAA S. Parker AMSAA R. Reid ADAA R. Scarselli AMEAA K. Slomchinski AA Wheeler ADAA Wilson AR liqU3Y .9-,-3-f.-v--an-1-:yur-vggqqj v kr,y5,i.-.:f.-,-.w,ygcf-'--:ir-.-ef.-..m1:-.zryfvlfqq-45's-.fl-vm-fe:--'fe ' , . ,. , , , su+763v'Dn1 1.1-14'-vxl'41lrl VAQ-133 i Fnz. .M ,'fVuf.j,, ' . .uf gtk-'R'4U J X, J ,,,, '. , ,.... : . ,5-..,j'g,,r-.. "'- -1-sr "' - ,- ' 55 1, F-T?-Life ,.,f1.e:rx1-'E'.9!J.'?: N. I y, ffl' I 1 i J' rf fu-51 liliwfj. 3, N E vu-fl-IL fi? ur-' ' ' H155 - ' iw-li-: lfliipqigri 2' VC., , .. V, 1 i , M ii?5?liQ5r'1, VZ. P i.Q'f?g-gil? HI 4 ipf T Mardi 'Ii file-.QQ 1,5 kzifsfi ffifiiii lifivv 'ii if ,Q iiifiilis vit? F3252 C l-if fi van Q-.iQuLi,,a..1 l ,1--- ff ,1,. 5 1 ffziaii'-bsi-' E7iz53'F'ilif?7235 f5:,Q'ZQ2i.:51.f,Si, . 1y,,,.s:E. .. 5, . wfzengg L1,g,n4,,.u I-'if1?ujt','5"Z.'5' +1314 ziziigsiis' f ,.W,,,w,i K x lnffmw- i, ,M iwifzizaii hfiirffiiiif , , it ' W , V I' mi '.1g2fi'xv:ff-izfzr "r.a'51Lrfaf.,:riL' EFT fiiiiieviiixi'Ziffiiiiwizffi fi'-fffifrieei.-i ffGL2..5ii4ei:1vfQf,gL an 2723454111 :mera i:1i1s,a'1,'e4li.4f:-f.i:,'g.A55fq:ai:,g1Q.Qf vii: fzligp-zzifzgafijqjfz ,615-gwwsfiligfi5y7:f?my1i!1-,il iwibfixi-iff 12311: wfxiieii,zgaifgzgiiyfg J Hfaf,'r7:L91S1RJ'-if-"il fifirffwmw 'ifSG?Gif!Lf':frmeg!Mkazezlig!g.S?fiJay0:- -fifwQi?3':'ii,Q1' i if .wr.iLq,y,a,i7f:'s5g.fj5ggzyqsq 'wgqrgrogi' Www,gQ'igiii"-r:q.1!iba5igg,,g'gizigsi,-if "ami,ci--'wzisfxipgizrie ,f,wL-ifwfsgm-iv fpgfzizfsfzafpi-5153.-failrffQ123g45g575.3q5Misif:fi,Q-,Wg.'f-awpWg, 7,ffq1v,3f4fifQmglwmsg qqpfni wi-f. A mfqsi..-M i,,,,,-1.,.,ii.,an.-ai:,,,,v,,i ifw.qv.- ,,q.1,,,A,M1,,+, p--,i i-V,-YW....-.w.y.i.wi ,,f,f.-,af-.,.1i rms. iw:Hiefqs'iieiiz-MLMiivikiiwf11461-fifLii'f5Pi"'5WiiiieilgggyiqifxfrefiiIfflikiflsiafG'fiifz-:'fi1ii2fi'fQf5ai E2i4i1'W"'-5223115-54541:'4W!Lw'if51R1yf1ft' " " , , ,. illigikfllif Wim!'fikf2f:5"iiis,far1-ii?FW,!z,:aQ1:1vgHio1fw:'fl"mike,-2rwafef-IQFS1mi-wwfiiffmizlsfn-1a'Gs1.:1:i.:ffei' ixfirx-v?.-:warww115.155-iffraiiififif-i3:'i1:if-:PA , -:J:2f:i'1,-, M..-,qragqfv ,nga .wg vxfm-i-nag, mf- mia,Lg,ii511:f:iL5Y,A-:-i:.1f1i4.,i:1:Q:mim,5iii5fi:i.4m1gAiqgg::q.pgsg,,.syifdfg, 'qu Q-i5:i.g1l75f".1.4'i1.ffv9sJiI:2Hrsf?C 1-wid. -2":rziwi-11111 ' ' Lf"i'5f5lf"'TC' 'Liiiii L1"il2iiixie:'M'i7e2ffsi2fi2i7ffisIli!!!newf:i:iiaee5pf+ger51zg:g. :iai- i. A -ch fix -f 1 wwf.-.r . im -mf,-fm,-am i-miiflii-fi'm.' fam 3 ngigimlzifgiz-:if 'iifqfif Wea:-if' igia-fair-irimffdfizlsznsi.new gli-ef-fiifiawi tw be is ':ff:'ai'f fzaqfjiiviggiii +2-2 , , 451' it ,w'ig'da3:-E7'I:ZP w , if 5:i:a2,12"wff iafzffaqg' 5:.g:4si.:a,fi'lggg,Ll , wait: 5 :sffiwiffiilizzf Wyiifiii- i' i J f rfiiiezg, , , , ii si Hi K 5,:Z5.41:i:cEf iw- LS iwrz My i igggziifiiiggbg igfgrg-gfggggxtjri iii':i:fgv1, M i 9-gy, ,a f , rw, 5 ,mx '33 ,i,f,,,.,l 3,,lvf,W,1:1n4 ,,.,Q,14i,.-i,.,,, ,H 1-gf5i2:rrf1:fi'.-ii' L1-Qgigg ,asfA-.ff35:4-Qv.i:gz:rr:wQlE?i:wL-ff i!Ef'i5a '-ggi! wil'-xiii 31i,iz4.1v- QEIIKA: W wiwafefi it iff-Sari!-elif eivfifizfifaf 5-2:6421 , Mi? ws 'W 45 faizeaigffri ffm.-rfQv:iMgi3vi,fs,fzf:U,.fwwma .4-mWic,?f3 45,,1,Wf:i i'if:fi2iQ22:l , , , WLM'-iii21IJiSJfs aifmrsvisty-iirwaaiafssffegmri -: s' 1:-.wr is Qi.-1Zf.qvi9i-1-,mapa 2e1g1g1::11i,i:-min,gwfggfieriiflzfiv-ii-,pyzizrafisz' -112.1 'gi-51-Qc'-flii: '.2E1Z.'i:eg-xiii:1-'ii1:"I-2 fKr3gq4i5f,:1:?1wqrif5r?iwires! ii f -'f'-"-ggiy'-'ymqiiwbf'3a1s:4ei:qif2xv,.qi,,i. AJ xaiegiqTM771-L!Glci,iI5i.:Z'Ii'slfiirlilflgqwff 4Exefnifiilvdiiy:'591i:l'd4:iiLH,,1q,iriw''U'i4UiE52.rf'i.if1i-'l:a2''ii' ..,,,,.,LX.X.-,,,.Y,,. ., ,.,.,.-ri-i,.ri,.,,. A. W, . vt H i. as ,t,n.g, 'Qi f1:ffi2iffi:21is:f 1 sssccc c e s is Q i i s i 5521 iip The 117 Wiiillbiiiisefs - homepoffed af NAS and fi membe' of the CVWA-1'fU55 ENTERWSE team f'Y s i mainfain ffm' a" Weather' mmtmissionf WC "HaW"eYe" i I in iie almafl- i it AS an ea'lY Waming Platform' the E'2C'S 'ada' Provides i WT Enterprise's battle group with a three million cubic mile fp surveillance envelopep detects and assesses threats from i f aPP'0aC"l"8 high Weed aifcfaftf and monifofs mafifime lfaffif- i AS an aefial Combat infofmafion Came' and aifcfaff fontfollffif the Wallbangers provide the battle group fighter and Hffafki c 5 aircraft with the necessary data to intercept potential enemy i aircraft prior to their approach - in both time and distance - to Pacific Fleetg iiif iheii sifiking zone. Long range deiefiion, auiomaiic track best sqummniniihe i i lI1ltlall0n, and high speed pr0CeSSll1g, Combine to enable the i is j ' Q i irppi l i""t,l 5 si 'f'tp g llit ig piiii l jx iiiii i iii p 1 iit'i 3 'i',,il,ri ,ili WT ill: i lip 4-:+11L1'12f 408 XVAVV-777 1 S 1 ,435 "i , .-,,,.Y- 0 f - - . f-iififfifiibiffffi r-- -1- '-' if- If-QL 'ig' 'if-' i. 1- -icy. xxx fe ,fi J H551 'mggziii CDR M. Allen CDR R.W. Bronson CDR T.E. Magee Executive Officer X 4 ,W ,C,, 1,6 we A 1, ...- LCDR Cook CDR D.H. Allen Commandzng Ofhcer LCDR M.H. Cooper LCDR W.C. loller LCDR Moason LT R.W. Adams 'ab if an , k . .'g,,:xif,. LT L. Berg LT R.P. Catalano LT S.A. Crawford LT Crouse xftw, X ff 'iff' EGR. L, M14 :ripe 2 LT A.R. Davis LT Dohm LT Millon LT H.S. Rodgers VAW-1171409 . .1 ,, 41O!VAW-777 ff . Q fbi? 5 LT H.A. Shelanski f V mc M.R. nano Z LTIG C.l. Lefevre ...-4 V LTIG Robertson S Wye- , I LTIG R.M. Stiles LT C.G. Stein LTIG M.D,. Disano fx LTIG C. Milowic Z LTIG M.E. Schar W, , Km, . '- LTIG l.l. Taylor LTIG B.W. Asher W' LTIG l.A. Kupcha LTIG K.R. Newman X Q www, Q V LTIG I. Simmerman r X ff I S , -mm. A' f ,Ji .ie ENS E.R. Robles W I! rim 1 , 1 'ma T Z' l L .L A . ENS K. Weis AFCM C.D. Barber ADCS KAW! R.R. Clayton x, V. - ' AMCS l.M. Ellison ADCS C.T. Reed ADC l.C. Okazaki AMS1 1. Ablang AME1 Collins .ra AHLAHW 1 my Z z ATCS G.R. Heinitz ATCS G.L. lordan ' w M, . ,k,, . V, AKC Madrid AMHC Mills AEC Ruch ATC D.R. Wright -'Rf' M SZ AZ1 l.H. Cadman AK1 B.G. Cagayat AT1 l.F. Hanson AT1 l..H. Hill smug AMS1 S.H. l.ClJI'0lI ADl R.M- l.l-lChli3 1.,1-S"2- ' 'ir'-w1'2-'-,.-M.1.' -fnseyn-, V -J--mweaesuww .a ,un fm. 4-5.1. N H-,f,,.. VAW-'l'l7 , ,,...wf ji ,Z VAWL117!411 :gnu-. 5. "9 AE1 I Materlale l CQ? AMH1 Swagart AMS2 K L Donahoe Him PN1 Otalora i AD1 F Vlctormo AT2 I Ferguson r EM? :Kun in ol' E6 AE2 P E Slavm AD1 E S Sumabat gd' AMS2 P Pagunsan AMS1 I schofleld AD1 R D Shusfef 'uhh E :mu 5090 Z V AT1 S Wllllams AME2 G Anderson AMS3 I Cabautan AT2 M W CFCSS PR2 M S Curley tiling? nz 5... T Fltzglbbons AT2 C A Frels AZ2 KAWJ D R Fultz AD2 A Gelaclo AT2 W Helsterhagen 472!VAW-777 PR2 R. lssacoulian MS2 Layno ww AMH2 R.B. Mitre AMS2 D. Phillips U1 Y E Qi If ummm? AK2 lohnson AT2 C.M. Kirslein hug' "Un 54 AK2 R.E. Magbitang AZ2 KAW! P. Mendoza -lim... AE2 N.c. Noble M52 D. Paiarillo An R.L. Pinard AMH2 R-L. Price v .,...f41..+-S.. .. 5 U VAW-117!413 , .. .., ,. ,. .,. ,... . 1,:.l.,.bA..n,n.,x..iM.g,.w,.A:5-w-f-+'-v'--gf-M-g-f-'- , , , . , 5 1 .1y,.,14.s-nyniqgf'fkw1gfgsfdc-a-zwaf""fg"-"!-, I , ' M T y r II II I VAW-117 AE2 Pundsack 'I' I I I I 1 I I JAY W 1 I AD2 T.S. Role MS2 D.M. Shaker EVN AT2 E.R. Smith fu... AT2 R.C. Strom I I I I I I , , ,f. , 474!VAW-177 hai!!! AT2 B.K. Ulmer AMH2 TJ. Wallace M 11 Qi YN2 Welker I AT2 T.G. Shank ,"'F'uI X AD2 G.L. Stanford AK2 S.A. Tacotaco AK2 Wade DK2 L.A. Wasan 1119, 1 S YN2 Whitfield X AT2 B.D. Yost -sign fl, AMS3 T.E. Freeman I 5 AD3 W.E. Hine Q..-. i AD3 S.P. Mercado ,fr ll AE3 T.F. Schneider HEL... MS3 Bandfield AE3 M.L. Goodwin 5918 AME3 KAW! A.L. Iohnson YQIQ,-,ts ATAN D.E. Mitchell 4 AMH3 R.A. Sufbdn 1 "NI-J .X1 --mm., ! ol' YN3 D.D. Cooley AE3 F.R. Courtney IEE Y, A "um, X, I, i ful Y -.x., AT3 S.P. Dean AE3 B.F. Easterly AD3 T.A. Edall AE3 LM. Harris lingua. AME3 Luciano AT3 A.A. Pappas nm, 3 AD3 l.C. Taylor '-llllxu 2 S1 3 Y QV ""' if y 492 121 PR3 I. Thompson AT3 I. Underwood AMS3 A-M- Wilson VAW 717!415 'H mr wg H P A ' WW. win: YW 6 2 x Z W, 94,7 .N . pw 1 Y' ,iw ,W 476!VAW-177 ADAN A.A. Almazan ATAN B.R. Beard f . 2 i AMEAN Bush ,g r, K6 AN C.F. Celis ADAN Freeman AN Harris PNSN Baker MSSN Beller ATAN l.l. Cain lr ff! I A AN K.D. Dixon ATAN Green AN P.D. Hayward AN Baily 'lliiv AMHAN l.F. Berndt A I' ...W 4 AN D.L. Cameron AMSAN Franklin AMHAN D. Gutierrez AN Hominda 2?'lQl4""Kfl?llUP1Q!l 'xr ,gif ATAN D.A. Hornback ATAN C.B. Massey AN TJ. Peters ATAN K.D. Stitt AN D. Vallejos AMSAA M. Krupa -.aw-'1.w....N H 15 09? A .1 UA AMHAN Hull YNSN M.M. McCoy AN BJ. Price AN A.M. Swiston AN T.T. West AZAA l.P. Lang AMHAN A.l. lohnson A. ATAN Miller AEAN H.B. Rose AN PJ. Tarantino AA D. Florence AA Ramirez AN R.D. Larson uh... A I AN A.A. Mills AZAN RJ. Spivey VAWP1l7!417 ,,,, V-. A U A Q KLA,-.zf ,u-49: JQNQLI , -' I ' 5 I' QA-:if " ff' if 131: 1. 9715 ?-iiiflflill' page---gf. ,-hz,-A.evr1vq.g:-ffm:-yfeg-114-v I. I, .' , A . L -5928 , '. ', . f VF-'l'l The world famous Fighting Aardvarks of VF-114 made their second WestPac!I0 cruise aboard USS Enterprise KCVN-653 from lune to December 1984. Flying the Navy's premier supersonic fighter aircraft, the F-14A Tomcat, they represent the first line of defense-for the entire battle group. Under the command of CDR Lyle G. Bien, the Aardvarks assume this vital role with dedication and honor. ' While preparing for deployment at their home base of NAS Miramar, San Diego, the 'Varks continued to add to their impressive record. For the second year in a row, they won both the COMFITAEWWINGPAC High Noon Gun Derby and the coveted "Mutha" trophy which is awarded an-nually to the most spirited F-14 squadron in the Pacific Fleet. Blessed with superior il 1?-- L HQ Wei. Wmwmwyw is in .Q V. ag sailors and intrepid young aviators, the 'Varks combine a finely honed degree of teamwork, discipline and motivation to - guarantee their readiness to do battle and support their reputation as the Navy's premier fighter squadron. , The Fighting Aardvarks can be seen daily in the skies over the j Enterprise Battle Group maintaining air superiority and remaining true to their motto, "First to Fight." ' ff' svn, lx M-f' . , , Mmm. L CDR l.P. Kilkenny LCDR D.A. Aldrich Executive Officer 'rf ew- f ' T 'mmf -fe-' pl' LCDR P.O. Nevitt LCDR R.M. De Loof N , K, Y , LJ , ,T . y . LCDR D.M. Tyler LT R.C. Berg ,f LT R.E. Erickson LT G.W. Goss "-QE' LT M.R. Ledger LT Mickle ' xxx L 1 , L A lf' 7 Vw- mm l LT D.E. Norton LT M.V. Rabens , , V - V - -- - -, -V ., Lf...-1--A-JU'..v-f...41: -.pg , x v. .0 LCDR Ardan LCDR T.R. Brown Y.i,, ff' aw 'V 9 44. ,- V nq,.u- fy , . 1 A ,X . LCDR W.W. Reynolds LCDR G.L. Stuart CDR L.G. Bzen Commfzndzng Ojfcer " -v- walk-, A LT LM. Dailey lf' J1' LT D.L. Kennedy f' LT l.K. Nawrocki is 2 . LT M.L. Rinn VF114!419 L.-.'....-can--f f VF- 'I4 420fVF714 2-Sam 1-,aff V. .J ' LT l.E. Shay 'G 'WIL- LT M.s. whiny . .ff fa V ,f . ways' 1? LTIG D.P. Rouse 'Kip-v-' CWO2 I A Wants AOCS S A Hughes as AQCS I A Wilson AEC F O Aranda AMEC D L Cashmor -it 1 LT M-D. Stowe LT G.F. Svatek . f 1 X wk LTIG l.C. McCampbeII LTIG T.G. McMichael O.T. Childress, lr. ENS W.E. Conner, lr. ,ff .mm X Q57 AECS I M Frazier AMSC I W Hlckmill Aocs D E Muslusky ATCS T T Sfhaffon hm 4 , of Ls . L I , , V X 2 liaix r - s , s W J I .ve I ig:-Q . . 5 W .. Nj iii., 4, ..,,. r ' ,YW A ,'V, s r s k ff H1 ,. , Q , , x. . , ,' , 3 he 'sns n 1 'f Mi af?" K W2 , 5 'L ,O rf i hh 'ii' . hh r 'a fm, ,544 -:M-ve.-vm-wrfw xmfygaqvy. 'rw n ..-. fs -'s dc rs--ww 0080311 '19 191 K 'fn' 'ml AEC Long AVCM G L Myers AQC R R Smlth AMSC C L Whitley ADC E E Wllllams AD1 Anderson AMS1 D L Arceo -Q, We Elf. A01 M Blunk AT1 T L Boyett AQ1 S D Brock AMS1 D E Brown AD1 ET Capehart AT1 FA Carson AE1 K Conrady 'tvs i- ml L ug AMS1 DM Dull AK1 Rl Estrella AMH1 RM Ferrer AMS1 R D Garner AME1 V L Govan PN1 IC Guerra PH1 Hanakawa .' . 1- x ' .--1'f- X- - . -- VF-1141421 ' "7 ,- . -. T -,--g:' ,L Y. 11. F--"1 1,7 '- " ' -.22 54 . ' ' f f :aw ..,.-.5 -. ,.5u a.. ' 'a:..v4s..s.a.,u-x.A,..r6xuL-c.LaT.5.a,.f.f..,..,-:.,-,-+-. V t H 1 S-In V 3-3-I---M-f--'Q V i rv Q , ,....,.... ..fw::rv., . N HA AD1 M.C. Hewlett AE1 L. Maurer AMH1 N. Rivera ? .Mmvy AE1 G. Strawser AD1 D. lutajero in AQ1 l.C. Mires I MS1 Santos AMS1 C. Tarpley 'tr j .rd .... AE1 L. Long AMH1 L. Payoyo veil AT1 S. Shufelt 5 if YN1 F. Trujillo gf!!!-'ffm--0:--Q-1-fcfnagn-fnnrs11l.,. V . f,.., - , 13 Q '. lf ..'.?'Q"" X-H, .U of .4111 up x' f'V W DK2 D.D. Banks AT2 D.I. Alcorn AD2 E.C. Amparo AME3 G.C. Biviano A02 I.K. Black YN2 G.A. Brandau Lf., 1 AD2 Dieiz AE2 S.A. Brinegar AQ2 R.W. Crow L AME2 K Frazier AMS2 G Dlxon AQ2 W C Erwln F-'I14 in baby fa! AD2 H D Garcia AD2 I L Glenn vu-.,,. AD2 I Henderson AQ2 K B Hickman AK2 I R Hopkins AQ2 I-inihan AQ2 I M3YC'an0 L. im, N MS2 R Matel PR2 I R McGhee AE2 MBISEI' AZZS 'R Y S 'dba Mohawk A02 A Ohvas AT2 D C RBOVCS ..a,.-.h.,. Q 'Anim AME2 F Renon VF 114!423 f' I I or ra 12 I ' 4 fl , 7 . 5' 4 .1 ' - . I is Y W A I1 I , ' I f' -J ' 1' k 4 ! . ' Q71 ' I I f --I ,f I Y I , if I 'Q A Y - SZ X4 gn ' ' - A . - I A -. - o'1R if :iii N-44:9 -fe-51+ -"' I 'Q AD3 H R Andy AQ3 B E Baker AQ3 LL. Baker AME3 A B Banlao A03 D R Brandenburg AT3 M E Canaday MS3 A.M. Edra lx-ll -' 'ff-w-2-wr-fvz,L,fLi+rQmgxpgm,.j,f1w1i,,Le"sev1r:f:,,1: 4 , , .' - .1 n V .L -V Q X, f , sw.. , ...,.-,...,-.-,-,-, , ,.-.-' -- -Q . , 2-if - . . . - 1. .,-:f - 21 , . , As:1gz,:.rzH4f2.ff::e.Q .-,,, . V .f,- . 1 J, -,5,.,,,:5,Y..13G,,Lgf-f-1.235-f,3:5,:15g ,fv3,,-,1.1.,.,gbf- 4, . , 1: ,L ra, ' , , -, .. , ,A ...V V ,Y V- - A: V 1, , .- A .:-- -,.,p-az:-Q.1f.-J:-4-1, x-1-fu -f- --'rr-1' F:-. -.--H mf- v-'Y---- --- -- - Y - F ...-., V. , 1- f 1- M. H .ff 'v' JL V . ,,A,,,, W, ,J W ..-A,-,,. ,J V WX..-.,,,,L ..- ,,,,.,,M,s ,H .,, , M. ,S-s.-,.:,,,, ,1 M- ,,,-.,1,,e...,.M,,,1,Lg,9.V ,,,,,,,,,,,..,L--.e, AD3 R Hernandez AE3 W T Hlggms AT3 B Huerta AT3 Ml Kelly AK3l Kennedy AN D Lara I-111 lm! AME3 D jackson AQ3l lohnson AZ3 P W March AT3 D Mathews -li! AD3 R Meyer A03 D M Muller AMHA3 D Morgan A03 E Murphy AMS3 C Nicholson ..,A........u, vnL.sm+-xa9....a..x.:..-9 1 1 ,V , ' ' 1' 'f:"',fwf V ' V ' ,,2,g,,,f1.,f,,ffv AME3 R jones AMS3l Keapakos 'liar AZ3 D Mathls AT3 D McKenzie 7 2 at' AD3 I Parsons AMS3 M Patterson VF 174!425 - , M I , i L k,VV I A A y ,"' , wi in ' I he I l A f-, 'l aanl f ""- . I if l li I ' I L5 1 Ti kv , D L 'V I I Y . 1 ' I 4 J 'qlmh' -Y fe I EVVV- V..i 1 -"'. A ' E i,,,,.,,v...,--.-. - , :jfs 'A' fn-Us. 1 5 P 'x .NH A VF-'I14 xm . X ' C4 Q , 1 4 3 1 rflP 426!VF 774 A03 Perez PN3 G. Pipik x X.. li 5 AMS3 E. Porter AE3 M. Scott , Y R7 MS3 L. Sherman AE3 A. Shorter un.. 1 AD3 G. Strassenburg AMS3 R. Tippins TS. AD3 P. Turner AK3 K, Waits 'ma-'if Tl, AQ3 T. Pittman AD3 W. Scott AQ3 B. Staver 5 Nw. , 'I I 45 A03 M. Tubre AD3 S.A. Zigurs Z ' 'ov , ' S , 47: fi: AEAN M. Accarrino AN l.L. Arnold AN G.S. Benally AOAN R.D. Buhl 1 , . uf, AEAN R.C. Chipley AQAN Corcoran AZ: AA D.E. Degrave AMS3 M.E. Enck fa AEAN RJ. Garofalo W n ,-W. :- 9 Elf ,vi 9 Www N512 1 35' -.f Q 9' f AN G.R. Gomber HN W.A. Hart AMEAN M. larrosiak -S AN B. Magnuson 331:11 1 A ATAN W. Murdock 428!VF-174 '92 ATAN H. Karstens AOAN D. Large 4 YNSN L. Marchand AN D. Maurer MSSN E. Ohearn PNSN L. Penn '- 2 ADAN M. Lenox ADAN Lim AN M. Mayberry ATAN R. McGiIvray AQAN I. Putnam AEM 1. Roach I .gf . AOAN R.M. Henderson ADAN A. lfurung YNSN B.D. Ingersoll YNSN R. jackson AMHAN G. Lockamy PRAN I- lusli AMEAN P. McGowan AMSAN D. MOI'S9 AMSAN Roberts AN Ronguillo M- xumsw-awww fv- -uh---f wr AEAN E Sampson AEAN B R Sanders i' f AMHAN M Slaughter SN D Sroufe 51 K A AMHAN R Stockes YNSN N Sylvester AMHAN Thomas I K 1, AMSAN H. Wilder AQAN I. Wright AR W.E. May Ill , ,,,,, AMSAA R. Arias AN I. Aviles, lr. AMSAN W.G. Bloom 1 'li'-'li AA R. lohnson AA T. Kurtz AMSAA NOWBFO ""r-. Jo 2 ADAN G Waller AQAN M wailing AN D Vaughn AN K Volz 3 - Mar .A AMHAA T.S. Adams AZAA T.E. Ames AMHAA R.A. Anderson AMHAA Arbise .., 3. 5 ,f'9'2 4' ATAA S. Bresnahan AA R.A. Haines AMSAN G.A. Harper AMSAA R. Higgins ADAN Peterson AN M. Smith ADAA Socarras PRAN K. White VF-114f429 ,-sf... , . - - V - , , . .V , e.......-..-........, , . V Y. ,, , Y.. e. --- --- A--.r-.-. ,.,-,,k, J-, , -14 7--. -- , V. il l F, , V Y A V v- V Y , V A. ew, - E LCDR Flannery LCDR C.A. Lesher "fi" Im. R LCDR T.V. Moore ' eww-V f LCDR G.P. Wiener LT Cantarano hai, 'lv' CDR R.P. Rose if Q-v L LCDR W.A. Hall LCDR Lorenzo . 3 1 g LCDR M.T. Serhan Q-,E V LT D.R. Barnes .A-gi! 1 , lilfll - LT Crawford fixj f I QW T ..m.a.f4 , LCDR D.L. Cochran CDR T. Payne Commanding Officer LCDR TJ. Kilcline CDR T. junek di A C ommczndmg Ojfcer ,Q , , F MTM LCDR L.C. Mason ' 1 QM gi ' LCDR G.W. Turner wqly . I inn -'V LT Brown 'WE 'li 1 LT Bumler VF-213!431 T 1 f , .ni 4'....sV, LT l.D. Durmon LT Gebel . '95 ' Mgr- Q, Q. T 'NIB-if LT T.l. Tinsley LT C.B. Vaught ENS l.P. Bradberry ENS C.P. McEvoy X ,f Wfl, rf Q- T 5? Pipflwl' L ' 1 A if 1 , LT Hackmann LT lf- laggafd LT Lawson Jw' -ff- L LT K.M. Wallace MAIOR D.E. Wrisley LTIG K.G, Caldwell ,f CWO2 R. Siudym ENS Lepard AFCM l.l. Massey f 'NZZT lhtxli LT Milhenny V T N1 X 7, , if LTIG D.C. Lanotte - .V', 4 5 44 if f ADCS Brown pr' LT M.l. Puz ! l::Af'.?ffv l fr f ll i ' if LTIG E.M. Trexler 45 1 T E AMCS F.l. Cook 432 f VF-273 - 'mm ff ay AQCS R.W. Decamp ATCS Hogan -f.x.f 8 " if I r Umm r ,L ff, , I -, 2 j AECS K.C. Vickers ATCS K.E. Prinsen PHC P, Fein AMSC M.N. Hudoba f ,,l '3 ,V 5 ADC Sariti NCC B.W. Thomas AD1 Brackett I AD1 LC. Bunte YN1 A.M. Centeno ,wr AQCS C.R. Lewis K I ui AZC EJ.. Dial ADC Reese AD1 C.S. Alhambra 5A AMS1 R.L. Brooks IS1 Chesser -gm.- .,-14.1-14-f VF-213 X433 if J 1 1 'w 1 'r 1 . 5 5 E L V, VF-213 N 1 1 k . Illlllldl 1111 111 1111 111 11111111111 plllllllll llllllll Jllll!!f fflfflf I - ' I ? Q ' Q 1, .. Isl, ,, U.. Ill ,:f' 1 t I 111 A ,jflfflllf M 'Q x gs f W 5 5.1 1 Wi, ill Mi if! V., il 1 'QW .1 434 1 VF-213 42 -gum gk! A01 T.I. Darbe PH1 P.F. Fein , Q84 AMH1 Gause AMH1 D.W. Godbey if A01 lackson AQ1 lagiello AE1 l.D. luslice AQ1 MJ. Kern 11131, SZ AE1 Link AME1 W.A. Love K ' , 2 AME1 Seevers PR1 E.L. Seitz . x AD1 Fox AMS1 Gray AE1 lennum PN1 Cargill AQ1 H.E. Mechung 1 XL1 YN1 Towers 11 dz IL., 117 e Y 2x94 AT1 LR. Freeburg I A01 P.E. Hamann AMS1 lordan uf AD1 F.L. Lewis 5 A01 W.D. Oconnor Till, E AQ1 Zweimiller mini f 'I .. 1 ,, AMH2 A.O. Andres AME2 B.P. Baker KY umm l A A02 R.E. Bownds AE2 Bresock 1 A Y! .5 AE2 Cenquigrana AD2 Coburn I AD2 Cunningham AT2 Darbe I .7 5, Vw I L A02 l.R. Godoy AK2 l.D. Lawson A02 K.L. Lewis ti.. MS2 A. Lucas W Msz Bentley ii! I PH2 MJ. Buvala AMS2 Coert lf , JA? YN3 RJ. Caddie I s.: AME2 F.L. Lewis PN2 Martin A03 H.F. Boone X v--. L..."i""" P- VF-273 X435 . x M s ' :xx N ., ,, . ,.. 5 Qi . K. JY, PN 1. . va 2 , , W . ,V S J f n x I f .!:,z-x, JJ5, ,., , 1 . , ,EX x,,-, I xl .1 ,, V, . f ,.-51 -QM-,I n, f f,.., ,, , M .. . 'fm Og-, ,Lf .fn ff . A,. .r z 1 x, , s 1 x. if 2 I- N' 1 -fzkfmi ,ff 2 X ,-,,, , ,-gf, K v 112. v M, f ,,,., mf xv-f. Q,-,.4z:Q7rf,. fi Aw i fa , L iliii' f JU, , 'f?ffgg,"V ff X 4 4, .W I5 y , -4.4- . 9:- 5 9 . 'W , W. ,. I ,f ,, .1 K cg Z, , g,, i g yr QM. '. ., , ,Mm , af, , ilu gg 'LW in Wf W9 QU4 f,,,,! ' ff,,'if7" 1 A03 Delgadillo AMH3 G.D. Hackett 13835 ' PH3 Hinman ""' 2 A03 R.L. McCormick WIKI ' AMS3 DJ. Price PN3 S.A. Robinson yi 'X Ill 1 zflv..-'Lf-.-'Lf-I 'ii fk"i',. : . ' , ' ' ., - f -F ..-:Q ' -:Y ':-1 - fn L--..u,::f11,1- ,I m' sgQgfg?gw9qfwggg5-5,t,e:Ay,::,5.vrf:,w54gigsmgngyaq-:ww-wfqg-H-gg ally, rqnz' V 1 f ul Q4 A03 Draszkiewicz lS3 D.l. Elliott temp. lf AT3 I.A. Hall AX3 Hares mmm iv ig as AK3 E. Lopez AMH3 E.S. Lopez -Inn..' AMEAA P.E. Perez AMS3 B. Prater :L 1 11 ADB Rayes AK3 D.A. Rendal ,13 an AQ3 Sopel AMS3 Stewart .HL Y.. VF 213!437 X X: . , f' XE H!! fl j, Q ,, 1 "Q 'il 2 - W! 'L.J.,Q J AZ3 Templain A03 Wolf V AN Bartholome ,K 5 1 V: AMEAN C. Cook 438 X VF-213 AOAN Dibartolomeo AN C.A. Gariepy 'Q' 1 'Qing AMS3 Thompson YN3 Trupianojs U11 PR3 M.A. Wright AQ3 l.G. Young if-I. nu J A ATAN Burchett ATAN M.F. Campbell AMHAA S.L. Crawford ATAN C.P. Dembrosky AN H.B. Flores ADAN Foreman AEAN Geisz fi J ,f lr AQAN Hagerty if If If J PH3 W. Wilder ii! AA L.B. Ahlstrom f 'O' if III! AN Collier ,fi AA P. Detro YNSN Foster AOAN Harden .S ,wsnuaawx ---5.12445-L..L :mf ,wp-L:-.:ff :arg.fszbtifpf-,rQ?sQff'f2:f'z:gff51r25f,E-ff-f'Qsihgfbaff-.wiQ5-2.2511 341: Qiififfkiil 211' i': fi, 1- ,Q U? Wiz. u .www u , fra" , 3'Efz1,f , V1., A , ... .. ww f ,,,, , fy 'wi , . ,,. , at ff 4 3.1.5, f ,.,gf1, frzf ff' Y JW' " ,L " ,- ygyvid fww X 7'?'7'7'.-A X' wwfif' 12, .39- f 1 1 Z.. 17? -we.. ,, f f My A. ,., 0 ,fy 5 'ff E-' LMQJ' 36' 0 ,Zi f 45 I . Hs: ,, . . A A 4,2 Q W K Aw ,A ,... ni , gf ...d.-af'1,.., .. 5 V f X W .1 if 6 1 X x ' 1 1 ' .11 uh ' :"" Pfiff, 1 - ,. . - , 1 V mf Y5"" , " Q, Vx U sr Q 3 L-1-3,3 , f-9 1 9,3 I . 65 , X K, ,9 ' 71 1, .s- . if .oi ,J . ., E11 , Q' - Wm ' 5' K r x , ,gf4.135Qbv ' , f:f,..f,w,::1HYfffz v .L ,1 "Irs'. -an, :ffe L" ' , I - Z :'f:44:'Efv'1 - '51 1 , V , 5--.1 f' HQ -fi' , m fs-fzzgf..-4 .,.f:1,,p-A-,1',1p.y2f ,,, 4 A . 5 I 4 4 52 , If M ,.JVv,, ., k? M I Y '. , ' f T 'Q' .- ' f K V-L "1 1 2 A i ', ' 1 3 A ' , 'f'fQ3,"' aan-af .M k ,, - ff A lgilff is ' F. ,XS M, xL1,24fflm-:gy j it Sl 'Yum-0:6 5 5 if 'iii , T, 2.- - 'u "W" 1-mmf-, , "E ,,-,,Q 1 :V 'mf - Z I 5 'Q ,.w:1f' ,731 1 Z i 2 S V . 8 QQ? ag J . lg ps ,A fmgggfv vii QW? 51. r 4 Q5 i7y,T'l:Q.l I M 1 1 , , W ,flif -W. H u.. M , , 1 F. P-QL? .Avi 35 1. , wana", y n., L l ff, si? f ef lugs, 1 Y.- 1 440 X VF-2 73 ATAN K.T. Murphy AMSAN Myers ADAA K.T. Pendleton AEAN Pfaff AN G.L. Potter ATAN R. Ramos AQAN Schmitt ATAN M.P. Sheehan AQAN Sommerdorf AMHAN Spalding I AEAN Taylor fl. f ATAN M.A. Negron AN Olson nas AMHAN Phillips YNSN Porter PHAN R.S. Rebman ADAN Ruggles AMHAN Sliever AMEAN Smith AMSAN Steele AZPN E.L. Stroman AQAN C.W. Tignor AMSAN Tuggle f R l 00' .41 .mi l5UKWiWpw 19-xflvf 4 -h 'mwwfyzq 'Hvdeqf'1Qlf'6-R1 ee-an Y' '- I, .1 '-fin-1 T22 T5 '21 21 '- fjfi' J 1 :Qi " 2- i-f4..'F-iii!-132'F-ji'.:12':'Q-:5,'ki-iiiiiiiiiff.,Q-:Qe3'5iu14?:5f515'iLii713:.p1,T.:Ef3-r:.gf5z,j.-1'-2: VZ, -' ' iii 9-1-fJ'f1-if eeee1,..Jf1,.: .. 21.4- nike, l-- .,....,f-.14-.f.,..-, .-L.L:.,,-YTH..e..-,..4.,..,:, -. -,.,.. - .7 . . ., N . . . ,.,,.... V A nb. ' '. ,, .. ' , . ,, ,- ,, , - ,.... ,. .,. I, ,L,A',Q,5!' -2g.s:1"s, 11. , 1: " -,Jes A q i -J.. A ,. , , .. . -.A-1.5-7.. :,g:,g,-7 - " - " - ' -f- -'F' A A , A- .ffffe-e.3....if's --1,-"fi'f?.'..::'X Ryu:-L.?'i,ff-'ff-',::,Y'2:::1,-.-'PGA' W"?i- '-iw: --fn, . ' V - . .: v , ' , -- ' , . - V ,. Y ' -'r' f k V -2-V:-H -. K - PHAN G.L. Walker ATAN l.S. Whidby AEAN R.I. Hewitt AR R.I,. Hinkle f , 200' "4 AN D.R. Withers ATAN DJ. Wunder AR R.A. Laflash AR L.L. Loll AA Broussard PHAN D. Curtis AN SJ. Ellis cf,,. AA M.R. Mayo PHAA K.D. Nelson AN MA. Poirier have-1 -5.1 AR Sandiego AMHAA Smith AMSAA Spohr AA M.S. Suber PRAA R.A. Thomas PHAA R.L. Vanostrand AD2 D.W. Brumbalow env.. .. N V. ' " A Y l w l 1 1 i 1 1 I VF-213 X441 . ,-. - . '.'.',"" R "1 .'-'. ' ', , W1 -r, ,"..-. ' ,-. ' T.:.'i ' 'V f ' f"',,' ,-ff" ' ' ' ' 'A "' ' 'i1 "v ' ' ',-Af.w'.1s: 1-"vs lla'-fm.: A 4 Q1 td,-.Tru 1' 7 Q f - v. ' "'f if ' , ,. .IH RH rt: ww ..f1: 1 F 111 V 111 I1 11 1 1 1 1 1 191 1 M U12 J 1 111 111 1111 131 1 11 1 1 11 1 1 1111 1 1 1 1 1 ' 11 1 1 , 1 11 11 1 II1 1 1 1 3 1 11 ,l if '1,,1 1 11' 1 11 11 1 1 11 11 1 1 1 1 1 11 1 1 .""1E!Iwf,1,, 254 'ra 3 1 1 ' 1 11 I 1 1 1 1 1 1 1 11 11 1 1 1 1 11 11 111 1 I 1 11 1 1 1 1. I 1 1 11 I 1 1 .a V U' 1 1 1 1 1 1 14' 1 1 Il 1 1 1 I 1 I1 1 I 1 E 1 11 1 1 I 1 1- 1 1 1 i 1 11 1 1,1 1. I '1 z, , 1 1 1 1 1' I 1 1 11 ' 11 1 11, 1 A 1 51 1 1 1 1 1 l1 . 1 M 1 .7 ' 1 1 .:-1' 'Q 1 'I 1 1 . 1 1 . . .1 1 " '1 1 '19 1 -1 1 13 1 f' 1 ,xi 1 L13 - 15 11 - , ,.3:5.. 1 , 1 ""fi'fff72', 11'L iVf51f3'4?'f'1fQ . pa,--.A ' 1 1 wp- :fini-'I-F. 1 , ' f - - ff: an 1 1 r 1 ,1 . , .- E-3g','iYf+:-.' ' ,Z 11 Y 45113-. Q1 rx, : f".:Q'Lf""F'L L., 1 . , -115--f -' ' --K-11i-:21a:1A'- H 'I . ff ik" My - A 1-.'Zf+5Hif'f -13 ' ' N v"""""""' 4 """ ' --was-:....-. -. .. , 1 . V 1 f 'T' iezff' -'-- -u - ,LA V 1- ,Q .,,-gm A L- -1 5 Q' 1 x ' ' T' 4' '-1"'fx, '-"fQf111w'A .1 -It-J-ZA - v,fEr::,,..,-'11-- :V - TSSFQLS5 ffl ' A " QF...--:.1 NAV.. X ,Pw- 13 ' ' ' " ' ifk1'z"'f::1N..1 'J wg,-, Eilim, CDR G.W. Kolarov Executive Officer LCDR G.A. Main LT Duke ,4 ' 'I RQ xi' 'R I LT A.S. Granger M 1 Iwguf LT K.B. Kilgore LT B.A. Rodgers 1 3 ' CDR G.W. Sassen LCDR l.P. Gorman Ng. Q K I -'Ex' , 'a iv 4 'mi 1 LCDR W. Westmoreland LT W.L. Brooks ,if , W. rf QL x "Ink: 49 LT l.l. Fagone LT L.M. Gillis 'iff ' -. - If ' 'nil I 1':w'i.'il. LT E.L. Hegwer LT S.C. lones 'nw t LT R.P. Millerick l-T l-M- PCTSYF' LT l.T. Semikoski LT Smarl9S5e LCDR C.C. Hathaway LCDR W.H. Labarge 5 1 4 , , hgliwl 1' , ul.. LT . .,, , LT D.L. Brouwer LT F.P. Drake milki' Q E' XM ,' ,f gf CDR j.S. Boyd Commandzng Ofhcer ,AA-h-, .,.,g,....f VS-27 X 443 VS-21 .X 4, X. X Wigs Y 5, ,, LT D.A. Sorensen LT W.O. Waddell LT W.V. Walker , f.., ,A 1 A LT l.D. Ward LT 5.1. Wieneke LT l.G. Woolway LTIG P.H. Adolphson mc. K.D. Blake LTIG l-F- Davis N EJ! LTIG P.L. Hoffman ENS G. lohnson LTIG l.A. Knock Q, HRH! k A I f- z' 4 E' if 'YI lf AVCM I. Ortner ATCS W. Brannan ATCS Ege E if-nhl! favr f 4 ,lv . ,J ,, TW. LTIG G.F. Labuda LTIG T.K. Sanders ENS l.W. Pritchard CW04 LE. Mulder ,MJ W 4 .ff 5, mi ' I I xylqiul VV I 5 ADC D. Acklie AWC P. Bigelow AMSC I. Butler ADC E. Cruz V. 3 J 1-inf Qu . , -mu.. 1 ,1' , y . fy V stlz 1 AMSC C. Kimbrough AZC T. Leonhardt AEC Pomy AOC R. Schuessler AXC G. Zumwalt AD1 W, Agee PN1 E. And8I'S0l'l 444 X VS-21 UE 'Kara-'11 'mfg I im AK1 G. Armas www, I ! AW1 C. Black A01 S. Brown AX2 E. Condeza -him. ,, AMS1 C. Garza AMH1 M. McDanieIs K K AD1 K. Auld AE1 I. Barkalow 1 ll f AW1 W. Blackman AD1 C. Broadhurst "'ln.,4.ffl . x ,J A AME1 D. Buffington AMS1 T. Creger -EIB: l 1 .QA AMS1 L. Davis DK1 M. Dimalanta W. QP! bd AT1 W. Haleen AD1 W. Hopper MMM AD1 McNamara AD1 L. Melchor W.. :Z AE1 A. Ladrillono AX1 W. Lardin in 2 Y im, .da-. AK1 A.N. Nerida AMH1 D. Peters ..w....,....:s-as-A--mf.-hx-1-A "'7fli mai! li' Q., . .X AT1 E. Marquez AE1 I. McClure X AME1 I. Price AME1 R. Santos VS-21 f 445 'smug i -:qs , - ul -gnc A21 T. Smith AO1 L. Tucker NC1 R. Vagle AMH1 E. Valecrul 446!VS21 - Rpm, 4, PR1 R. Wratchford AW2 W. Auker AW2 I. Blinn AT2 l. Bronkema ,, ,L Q ,rf 4333.75 X '- ,, , ...Q V, A .,,,:..wLgf3452' e:v"L,'z" , ..w1.f,-1'iIZ72w356 LQj2Sf',1ff',' n.e2,fu.5 'gl ' - 1- fm .fn 5F,.,,l, , 1 f vV,mnl5,l,lAMsigh, CL., V , I A ,10''3Cxlll1:5gAX'lM."f?' 7 ' 72" sw' f Sf' , s..'.,a?w'f'Lff-1, cw.-1 25,2-.lf ' Frf1f1',1!.?'Q'?,!,z.1f'5 f 'u3.,'z" N" f' X """ up L . f f' 3 J' ,,..,.7, Lyle CAUTIQQN i J f , .11 42 AK1 R. Villanueva AME1 B- Wl13l'l0l1 311 AZ3 l. Bagley AW2 M. Baugh AME2 T. Buxton AE2 M. Dealy ' 2 "W A02 P. Eaton A02 A. Ferraro AD2 G. Hobbs Axg D, Kane 'arf f f -un AW2 D. Larington YN3 L. Leborgne , ig.. K ul AMS2 L. White AX3 T. Blevins Amsz M. Delgado AMH2 R. Haggard MS2 G. Kostka ii!!! PN2 C. Macias MTN vi ,?"' ,, . pm Q, .,,L,,V!,, Lv., ' :MQ if , af6if,7f 2 QW l ,Q . W ww H "N Q x-Ka, M fpfmfz fzwvafff af V"'. ,W xr' if. .. 1 np , 41- ,ff K QM ' J in Ju, A 4 HM.. , ,,- ,f X 1 9 V ,Www-v , . wi, . ,,. W, , Lfw, x, " W 19 M, f v ,Q , fQ9+c,. , +G' ' g"4'f?f' ' '7 wf .M ,wr xf .A . .af 'Q-f,xv2w,, x " liqnl A03 M leffs ml MS3 D lohnson s,,.- f Ara M Kelly uhh were AK3 D Lanouette AC3 T. McGurren 'lui AD3 R. Prince 4 ,.-.uw nw. ,. N H - M. . ,..,,..,.,. , , 1- -.vf.ff...,,,.., .1 ., fm-ff- .. . .--. . . A ,. wr' ' A 'fr www--0 - ff V fnuma..e.anuzuwsu,vsw. - 446.14 f AMS3 G lezek -.lim s Q7 AMS3 R lohnson lim. I .re- AT3 T Kephart Qual L YN3 B Love 'Ili- i- 'ul AME3 A. Melton AX3 P. Miller AN R. Monton AMS3 W. Nails AEAN I. Perry 'hlxnf X42 V ci AD3 M, Rgberls AX3 M, Ruggeri PN3 Serrano AMH3 K. Shanklin AD3 L. Smith . . , , .. ...r . '. .--2-f , ,,,,,.. , , , -. ... .,,.. ... -Q --w-M .:....y..-,-4w.x.,n..w.1-,....1,,f..g.,,f..........f....,...,. i Y K " ' " in-61-vi'-0'4" ' ' V V ,v,,V,4,, ,, .,.,, .,.-4, v f-Y -,-j Xi V ' ' - "" . . Y ' fill! ll: Y Awa R. Peyton Q I AZAN T. Spiker VS-27 X449 ,, , ' -' " ' a:.f ', -4 194 4 they 1 AMEAN I. Beljeski AMHAN S. Brabec AKAN M. Bradshaw ADAN R. Caburian PNSN R. Cunningham YNSA E. Danet 450 X VS-21 V2 AXAN T. Darling i A AN P. Davis AN Coleman f .93 AEAN D. Debroux ADAN T. Szalay AMS3 T. Wilburn AN D.A. Abacherli 1 ATAN K. Barefield ADAN M. Connolly AN D. Demuth all hm.. 9 YNSN I. Turner QUE. AD3 I. Wilcox ADAN T. Bahan ' ADAN A. Bayutas AXAN T. Contreras f ls-I - AN Dewey c ,4A,.fz . xx,.4x.g- 1.17, ..f -,- 4-f .,.f..- -432 ,:,.:- -4 ,f A.: V-, .g 2' .fm A. ,z ,- . . , ,. , f f f W, ff ff Lg 'Q"' !', rw 1 of 4 va ' , ,if wf I,-47' . if W-QM 9 , ,,v,..,. ky Ay 64,39 1 V I , vw,-7, ff ' , Q, 1 1 4 , , , ,Je ,Lili f V S" ' if 77 w ' if f 4 9 ,F C55 W ' ' ff.-M.-7f, - .M f X., .,4..dw..f- .. -,471-,YC mm-W,M,Y wks: mfig2-4-i-w,....'n-.1-sm.i..1...n.11gg-gf - ATAN R. Montgomery l'l.l 1 AOAN D. Pierce AMSAN P. Murphy AN M. Biantz 1114. X!! 4 f' A fum: - l , PRAN S. Orkney AN G. Provorse AN M. Pace AMSAN R. Pugeda ATAN R. Roskam ATAN D. Ross AN E. Santiago AMEAN L. Scott AXAN S. Reagan AMEAN S. Shimono 452 X VS-27 AN T. Stapleton I ATAN w. Sumlin ADAN w. Winsley AOAN K. Peterson SN L. Reynolds ATAN I. Shoemake AN T. Streater AMHAN D. Toon AMHAN Zibrowski AN D. Phillips l 'Zi AMHAN D. Rodgers ATAN T. Sneddon 133. , AN R. Sullivan AXAN P. West PRAA Abston AA A. Adkins ATAA B. Cope l l A AA C. Green AA C. jackson AA I. McKay AK M. Axinto AXAN S. Douglas AZAA T. Gribble ' A AA S. Kuhns 1 I 09' 1 AA 1. Mitchell AA Baker AMSAA B. Brady MSSR Anderson AA B. Dyer AEAA R. Edwards mnamnmajm '9wFe' ,nv VS 21 A W El SA K. Hilliard AA Linderleaf AA Norman MSSA Raleeh MSSA O. Tharpe AOAA Van Mill 454 ! VQ-7 VQ- The primary mission of VQ-1 is to conduct electronic Reconnaissance Missions in support of Fleet Operations in order to obtain information and intelligence on areas of Naval interest. The Squadron's area of responsibility extends from the West Coast of the U.S. to East Coast of Africa, an assignment which has earned the squadron the nickname, "World-Watcher." M LT Clement i J LT Robey 'fur' g Inu 3 3 X, 'fav LT Erickson LT Hooges af :ii , LT Sims CWO2 Robinson fii iii 42 1 ll! Q9 R LT McCrocklin LT Page ADC Perez AMS1 Readyhough n z T LQ 'X md -ii, LCDR IW. Page Ofjqcer in Charge f . f - , j K , , I ,gi 53-Q 1 f A A " " ' ' A 5 V 4. wwf' ' Q 1 , I , , i, 6,,,,:, L, ,AIN A 2 ', , f :iff ',,7-n ,v4kW'?f'7f6' ,g f,Y'52637341326:-'3'?ZV'4gi24' 'Ji V'-W ' ', " I jf ff-,j,,x", ,,,15, vf'3f,,:f,f4y1-V !g,m',1f3,f,:',n . 2 ' mmf' ,. 311 :ELL J Q T. , ' , ff, Cf" i - ,Y .f k Z if lQ,ff7 'Zi' 4, 3 T ?',-.ikifil N " f ' H Q' ffl? ' V. W - . VQ-1 X455 na. nil I i fl 1 13 ul A A rl u VQ- Q , ,qwhkm 1 0 nv il 'L A, " ' vs., I-Q Q W ,, X, may 2? DX ,.-Q . Jw 1 4 w l 456!VQ-1 M., wh inn 5' . ' 545 P U. Yfwm, ' . .A 12' P W F . , ffsfwql . 43 ' ,,v.,wg'-.1, A . f ,- H--44 van, 'W - 24? V, , V 'X 1 ww ff -a,zf.,m 'I -' ' 'L 1" if.: f ' : f..fH. 1 ' "5 4fw.,i!f1'f2Q ' 'f'f1'w'f-:+-L'- - 2- fi. '-'K-u+"'f ,,,. f - ' ' , jqyf -553 . . .f44,E22,'- - A W A '1 1 0,47-Qj,As,,., ,,,-- -f -4' V I A' VVV : 4ffgg5?fq,,,, H0kW by fam , Q ,S T.?P' AD2 Bierman AMH2 Drapeau AT2 Kennedy AT2 Trethewey AE3 Campbell -J 2 Q19 AME3 Drusby X y AT2 Cervenak AME2 Duvall AMH2 Meders K x.', 4 ' AT3 Brown lu... ' A YN3 Chittim ,f V. ' mimi! ', V, QI . AE3 Graveloe 'x"PJ"",f Q yj AD2 Cumbee i . AD2 Halsey PR2 Sawyer AE3 Byram AT3 Dellinger win! ' 1 'Q AT3 lustiss 'Qu f A AK3 Larimer fi A13 st. Manin ,-mm 5. 'qw AE3 Nelson UF., . x ,QV AQAN Courtney aug f, iesvficzf k'?5' .1. V 1 V '. ,, gg , ' 'YT' , AT3 Paananen AMH3 Rose K AEAN Dinallo AN Evans S 1 'I-rig, ADAN Ghandour ATAN Ham AMHAN Petry AQAN Van Natter nf" ,3 1 1 in ' Y 211114-f,,f... . .. wwf """"""' Ami? ,ww-"' .,f DV ' , -.,,,,,a ....qg,x.... ,5,,......, -..q..-evans um.: x...b...-fav 40'- VQ-1 X457 a A 1r Fleet Tactical Support Squadron FIFTY WRC-503 was commissioned 1 October 1966 at Naval Air Station, Atsugi, lapan. Prior to commissioning, VRC-50 was an Atsugi based VR-21 detachment. The newly formed squadron initially operated the C-1A "Trader" aircraft for Carrier Onboard Delivery KCODJ. The introduction of the 'C-2A Greyhound, 6 December 1966, marked the beginning of the new squadron's totally new - capability for providing 'COD service to the Fleet. The C-2A has a cabincapacity of 10,000 pounds and cruises at 240 knots for a distance of over 1,000 miles. The 10,000-pound cabin load may consist of passengers 126 maximuml, mail, or cargo, or any combination of the three. Seven months later, on 11 luly 1967, the CT-39E "Sabreliners" flight transportietl arrived and a new phase of operations commenced. The CT-39E aircraft cruises at 450 knots, at a maximum altitude of 45,000 feet, which provides rapid, fatigue-free transportation between WESTPAC military and civilian airports. I - , During VRC-50's first year of operation as a squadron, its ' personnel flew 10,374 hours while transporting 8,646 passengers, 357 tons of mail, and 753 tons of cargo. ln' the years that followed, VRC-50 continued to grow in size and importance as an integral part of the SEVENTH Fleet. In September 1968, a I permanent VRC-50 detachment was established at Naval Air Station, Cubi Point, Republic of the Philippines. VRC-50 then operated 10 C-2A's in direct support of SEVENTH Fleet carriers operating in the Tonkin Gulf, Philippines Sea, and South China Sea. In recognition of VRC-50's efforts and contributions in the Far East, the squadron was awarded the National Defense g Transportation Award in 1968. uj 1 LT Bllllngton AMH1 Chavez in wr' AK2 Almalen AE2 Brockway AD2 Mesklmen 'Wi 1 "N AME3 Mlkolatczak AMS2 Stelner AT3 Busalacchl AME3 Hamilton AMS3 Howell 'use' ADAN Murphy AMS3 Rellly TECHIR Bornschien AZAN HenfY AMSAN Little AMSAN Storro AEAN Wagner fs- - ., ..,,........... N., t , J, ,, -. . - . A1:..f..i-....-....... i , mga.-auuua--,.v.wn-.-.w.x.n,,n.xg.:.1A, Y VRC-50 I 459 ' ' "" ' "af ' ' -4- 2 X 1 T , '-A A , - , 8 '- psA1.Mz3 g e A ' t The Lord is constant companion H. f - 8 Thereis no need that He cannot fuwll. Whether His course for me points f , to the rnountaintops of glorious ectasy 1 4 -8 orto the valleys of human suffering, 8 ' He is by my side, ' 8 H H 1 8 He is 'ever present with me. ' He is close beside me H . . t x when ,I tread the dark streets of danger, .Iandeven when I flirt with death itseU, I 1 'A ' He will not leave me. ' 8 I . ,- K gWhen the pain is severe, He is near to comfort. ? When the burden is heavy, 'He is there to lean upon. I When depression ,darkens my soul, , He touches me witheternal joy. i . When I feel empty and alone, A 8 5 . He fills the aching vacuum with His power. 4 My security is in his promise A P .3 V to be' near to me always, V ' -5 - and in the knowledge 5 that He will never let me go. l 3 . - 1 1 i eq ' i 1 1 1 CDR James M. JOYCE, USN TVF-11418 p16sAugust 1984 A , LCDR WiuiamA.g 16 August 1984 8 RMc:LarryMax, fCOM DEPT1, 8 218 August 1984 .x x .N ,..,.:, - 5. .l V,-11- K , 1 , -. ., 1 -A--.-Q 1,.',,:,..,,e., -, -.. I., H . -v . f y., 4.-Y-, f . :. ,ff ., -. 1 .. V. W Q : A R . - ---Q -' " --.. -- -. V- ' , , J ., . .4 ' V' ' Q '-'+-M172-.sk-.-iir3i"nz. . -EL-.4-vwferi-frfekl-W1-1f3f'11v X-w4f2v---P:'4' yf- :.' '1 ' -.1v.em::'a5s'ff1gZa 1"fff-5-":if.i1-'Mi?"N?fL7CS'.??,-'S'3'.-Jill1039-"?,1f11'A '-.'. e-i..2L::.1,-f f'. 1? ' , 1 ' X 'MTF f. -, .A ' -.9!- I J' -, :Q ry' I HM- -Y.-V. ., 4 , f . '-'14, il 1 , I Q. I ' ,. ., . r , I i ix. W, , . I I l - 1 Chl ff K ,,. , W , V li-5 . 1. .wx L, H , .24 v awk. xl.: Nh m Q I U, .,,.e-Lgn, A I Y Mg 14- .- , ,. gf "'fVf5ifYf9?"' gg, , " f '-'-' 'f' " '-m qaf-ff 3 4 I , 461 -Q xfhk' " 'W-.T "' 'M' 4 fi' ,Q-372.-' f , , .-lf'-fp -: sniff. -f - 4,-':3Q:j' Y.,-f.f'f-fig" TL' 1: ,. "jg,-.,',gg..,,,,. V-..'-g:,,:Q -5553 Fi' '.3Q.g- -A-- ""-':,-ff , yf:i'f"' 3- - ., f"""b.. - i V ' 7 " .. 7 5 f f ...:-'ag'-.Q-Q-QT,--'-A - eg -,g.:.5g'm,'Af3' 'if3111.Q",l,1"'Q5-3.2i.--pf..,,lw' '14 "M A-a'iQE?'Pi""A:3"'LQ41-:H:Y'f "fi" ' :ri-xsfn' -:Y -'sh' ""a""x--V if ' - Y W - "'ufl'f""' "'f?- ' ffm" Fff T ' 1' ' ,..,',.. . . , 24 .,, - -.,-. "Gif-v-ff 1 -I-W-.iiP1-www-R-v-qv'erffmzarxin5-qvifrrfr-:F-vrfzf-'zstzffffgrfz:-2f1'ftnrs7Sfz2E2.'Zf' f2fi"1i'3EiS3313':?222521fF+'v51EF"Fs'?i3?:?JI 'T' ' , as1:jQg492f:4sfe?255-:biz-gf-"fN2'f"'., g:,gff:-fill? ?iX?'1"- v'25 X-555' 14 up vfuq digs' '. ' - 5' 1 ..-"A H'ei msm'-i-av, 1,92-- ' g.,f:eiE"s 'tg-22.2 'A wht-234??:f.m5521,-fE:J::i.A11:235.-rs:Q1-qw.:22.2-:.::f9f-:.b:fyJ:':asv51352141-i'3::-2:12-Tags-,y:avi::aQ-.nv-2-1-1:.-:-,:-:.-3+g- X 4 1 I V 1 J 1 , I 21 ' .H 462 World C Printed by HUNTER PUBLISHING Wmston Salem NC 1 ,4 ..,...-.-ai ,I if' f ' ' E' V 'z i . 1' ' K . ' r, I . 2 i 7 . Q t va . ,U - ,.-.,nV, ' I ,fmpgp F H,.f,.V.,.-NN' -lg, , ,V 5 , ' K K ' , ' . ,, ,rf.."llQ? '-11 ' ' 4 ' ' -' J ,, f. S I W :lf r L ku Jun Mig' 1 t 4:4 6 , 5 ,TEV 7... -f V ,. My .Vim 4 f ! . , ,. V mf ,,,, 3 , V: . A I " M 4 K gelpm, V 5, ,.., fb Ali, 4, Wfgx, ,wgwz-mfg 1 , A, .A., V I :w:4,m, M.,,.A,rM,,v, , ,',,fg,-V:.1.--, ,fe-a,V-':5,'.g':r-1g,Vw,- -- " 'A 'V X..qffgf ,,,g-.V H "'A ' W 4 . V 'K ,ml . M. px VM. ,J 4 , fizmggiq I Q11 ,flllf . ', . , :f'f'1wf ,. 'WZ ' ,, 'Q ,Vw V Vwmwaw Je. i5ffi?25Afff"4'Xi+?WQ? :iff - , . ' f ,Q ' 21.11 fum BN, ,.k , RL 313- 'f- ,QA 4. -'-.Q-'H , - 'xaffl " V " , . ' W- 1?-10Iv'D .vV'Q'-IM' bf V, ew af-far "51'f'1-zV 1 f-5.4, A' "' W MW, V ' - ,.. --VV 4,55-1.-4.w1fi2""P""MM Wh' X, 'fnfx if "V Vf 4 M " K' V .V V V. V - 1,,,,Q.,,4,5,f4:fgv5JiM....-4- gy y,,,..,,... , . . :gi V .,-Q "'- QB -ff 'L3r1"' zii?375? .1 X K X., .4 WV V , 3 , ' , V -V ' V'-1 ' 'W ' ' ' V . ' V - f 4 " ' ' ' s Diff' W if 'W "' -' WJ -' f.Mw+ X' 1 ,V 4155-el ?!"'x ax 'm"?'4-N'M'xfL..VV ,QM 3-.fx .I-.:,.'1,V x nfigx 1 N Q M ,,,1,,,.e V .V V K I hx TJg..i -:Q v h -hh .,VV ,.. 17' 4 -, X M . Fin-5321+ . Q, . ,,,, . ....1.....-.-............4.....,.,...... 4.14 -. .- 4.---.-,fm .- fs--1 .-as-vc-M-' -guys,-,Y .nf-gn-f-v--4,-f-..--f vm... ,Q im vw ,Mg ,uf-my I 1 ,. ...U ,ff--1: 14--up-.-I-ww' 1-I-az-rm :gras-n.m1 N-mwhvwrsfqfn, .1 I '- ' - ....,.....f.,.. 1.n.'... u.. ... n. -,..-n:u:...,.........-1 ----A-as ----- -----1-f A, - A 5, . . M Vn-ma,,,,,:,,,X,.,1,.f,,:J,..,.,,.,,1 L. 4 .-f.,,,-..... ..-................ 4 I 5 fi W r ,, --1 l I 5 1 ' 4 N .Y A ,MM 4 -..,...,,v,,,,,, 4. Y-.. 1 I., i V1 In .L.. - - ...V .UQ-17 W N ' E525 ex: ' E .M .wx .QQ N r K 1+-Q K "1 F! si. li i N Y 1 W N W


Suggestions in the USS Enterprise (CVN 65) - Naval Cruise Book collection:

USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection, 1978 Edition, Page 1

1978

USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection, 1983 Edition, Page 1

1983

USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection, 1986 Edition, Page 1

1986

USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection, 1988 Edition, Page 1

1988

USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection, 1990 Edition, Page 1

1990

USS Enterprise (CVN 65) - Naval Cruise Book online yearbook collection, 1996 Edition, Page 1

1996

1985 Edition, online yearbooks, online annuals 1970 Edition, online yearbooks, online annuals 1972 Edition, online yearbooks, online annuals 1965 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.