North Little Rock High School - Wildcat Yearbook (North Little Rock, AR)

 - Class of 1964

Page 1 of 296

 

North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection, 1964 Edition, Cover
Cover



Page 6, 1964 Edition, North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collectionPage 7, 1964 Edition, North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection
Pages 6 - 7

Page 10, 1964 Edition, North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collectionPage 11, 1964 Edition, North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection
Pages 10 - 11

Page 14, 1964 Edition, North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collectionPage 15, 1964 Edition, North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection
Pages 14 - 15

Page 8, 1964 Edition, North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collectionPage 9, 1964 Edition, North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection
Pages 8 - 9
Page 12, 1964 Edition, North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collectionPage 13, 1964 Edition, North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection
Pages 12 - 13
Page 16, 1964 Edition, North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collectionPage 17, 1964 Edition, North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection
Pages 16 - 17

Text from Pages 1 - 296 of the 1964 volume:

,,, .. ' .Q- l lo IQ ,', if 1,-- .Q M y K ln- : Q, R -.. :N- -in. -f Ni, ,'-' .fs "' .nu ,n. , ,?fM:'n:lP"4h' - Aj ,1-'r' - M., "- 'fg . .4 ,fr ...iz V4 4 ,-- L wg, , 'J7'.:- 'J- J' J' 4' ,ff ,,,, . rf' 1-,S su, w v:v':'...'E- 'J 'jp A -"N,-I A an 'N nv", ..' 1, "A, ,465 f ' '-4-' 3 -W . ff, - ,7- 7' u. A-. r. as lg.. A sf' .. nf 5:1 4... 'im .r . wx,-?,f5w::g. - -fl-,f,a7?4-3if!f"-" 'fr ii- If '1i-Fj.,- ji ' - A, 'Z ff.: SQ ' " -.m"' 1.5. .:'.f'f A Fa Af' 1' Iffg T4 ...:. - -f2,.sf' ' " ' ,.' F-L fa, ' T. ..2.,, 153-5,2-1 'p+.1"Q M , .z 53- Y ..- I,-f 4,5 A, M... ' .214 - - 4-K "gg Wh. Fin "' -.- ,,v -,- ,,: . . 1' 'ff . 2, -' ' 1 ,kf , lm' V 'vp wi' 1 '-'W' .,.-1 .lv ' ,N , ' ,ff '-' f '+',.r4,-Q AJ,-N --',:fj,a:Vg rw--'AJ sf! 4 - - 'h'.'f'v' 'bf 4, 'JY J' - .2 -. J' f4 K' . -rv N. .- Q - , .-,, .X ... ., .A , -W 1 ,,- f " hi"',.' -N .ff ' xg.. Q . N fl -ic. -A ,-n,,'!,:yg ,-' V-' ' .':".,'!.24 1-"' -,m'j:' g 4' 'f . 'xr "-P 1-g "L.4'A!-. ' ', , A- ' ,.-1 -r' ,rf - -.-, e' .,'- 21 :., fe .. '4,i"--c':- ' 'f' . ' ,-P' 4-".f' . Rf NT, ' N' FY5.. f.' r -vqiw ,A Q - - .-mf' -.w. '51 - '58, Q, A K ' " A v'?""""' 'F'm'n'M' f,,.a-wffffpwrm r-' pe-'fn .f, v 5 ru' .1 ,v 4' rv fa' K , . 'J Q Q ,lv-- 1 .J up wr -'flu' ' uf .4 4... 'J 4. f- Yo. 04 .-.1 u.. Qvgg N4-4 v-v asf' 'fx' -o ,A js ff Q-Q A 4 -nf 4. -q,,, ,vu-,-. 'B ' AP' 4' .ff ,nf ,, v, r 4-, -"'. .. .- A ,A-A: Q uf' u. v' H41 ,Q ,so 41: ful' -4-4 ' ,L wp" ...rm n 12, ,S .u .- nr .Lf -4 ,ff 4 rn 44' .4"! 5,.. ,Q - 4 ,- v, " I ij .4 ,.: . Atv' 4.8. -e 3-fm Aff f P2-',.1-gf: ,a-" pf! Q' if Q-r-2 g2..fS.'7" ,f- , . f- ff Q eg - , Jus' ' K A,.u :A 1, r . , , , Q., mfg, O "Hu 'bf K - . 1 'x-"3 -.Tiff-'fu -4'-"., . ' . ."-' ff, M.. N: , ffl, j .-'.p: , 4' , -Q 4.3 .1- J - '47 Fi'.4A 1 .- Q . ey, "x n '47- H . -'.,, f ' fr f.. ' W"- -'f,'...j. -'5i,,A'A 3. Zh, --f -fs - v tu: '1- , Q if if N 1,--' .Q 4 I as 'J-'nf ff'-Eff'-' f ,ac-.' L-'iw . N.. Q! 'S' , 1 nl .'L pb ,Ut f .N ,f ,pf jk" '51 .vi aw 4,-,. pi 'ldv ,ff f 1 ...ff j.. 3 ,. ,N , ,xi , -rg ., , v-:J 1 ' A .f 1.1! f."?: ,ag - fi 'Q' '. I ,. lf' f ., , N - 4-.vs 'W ' , 1 . , 'af ,wwf ,, , W ., ,H. . w i" f' h Y A i . H L A? 4-+ ', A- A 1 , H N N A, F' W Qiaififwf f my N01 fgww Yiifim mfyiizf NSN? 655533 M Q? 5 . QMS W55 Wa WW xy f of ww N W MQQWX 3 - a , V X , ,f1l-Q,f'.,1- 'J-I ' K' .. ,P L 11 I Q 1 4 M 'A Vx N in .. , -3.,4, ff' , fr QQ ' 5 JW pygmy A 3,1 i M ,, QJSOQB if-1 ff if 'Q' XXSXQQW QMPf55Lgp-N H f f 'tam W V " , V Q55-Ut ' Uv It my V, 6-STG Odgbjfxi. J,'wff'3i ,f"WJij 0' jd, jyfjjxljfgv' 3Nx65wQ5-N306 ENDS V913 35 ,fd Off", 'f Q ff 2' J f.QjJ 'PZ A! JJ WM! 'v Q I " fi., Jifttiff shy' - 49 ' OECD MVN fi J JJ. X, 'AJ - 5 J -. ft' . -. O' C' J ,ff My JL M CW CVWJH 'if' Oy M if If OA ,JO - ,J WJ 1 QQ M WW! po Www J 4 CJL, fd W . ob 'Um C t ff? pg Opt ,W . J! . . ofd .Wi XK Jjcitwa' H gf 3 ,H fffyzyifgikizfsf NW! ff 6QQJ9 ,6!, QYYIRQHE aff! 9f f5g4 WILDCAT ' 25 . A 5!jf- .cy SENIOR HIGH SCHOOL J ' North Little Rock, Arkansas of 9594 WM 1 W2 v Wals hhlibl 111 ggi p y S mutha' Presentation . . . a play-by-play account of one mem- orable year wrought in the life of the greatest student body ever known. The stage setting of our play is upon an exquisite ten acre campus, cresting a knoll, lovingly known well to generations of NLRHS students as "Wildcat Hill." Behind the scenes of this production are the stolid producers and directors,well-enacted by faculty and staff members. The most significant portion of the entire play is granted the cast, the members of the classes of '64, '65, and '66. Predominantly, the Seniors reign in the limelight. These performers have trodden through three long years of tedious study, en- grossing activities, and acquired maturity in every realm. The applause is deafening for the "Best and even more--the Class of '64." The top supporting roles are well-portrayed by the Juniors. Much of their knowledge and experience has been gained through discreet understudy of the STARS of the play. Another year may bring these into the spotlight--for iauaum' aglmj ' an UM Lgtgmbqw - they claim to be "the wildest Cats alive"-- that class of '65. The novices are the Sophomores. Making their debut, they will undoubtedly take another two years to prepare for their major roles as Seniors. Even as they declare "of all the Cats, the pick" -- they remain the Sophomore Class of '66. The plot of this melodrama moves from scene to scene to exemplify every activity. The curtains rise on the anticipated excitement of the first day--the sights of an overwhelming mass of new kittens to the freshly painted face of our beloved domain--from the explosive e- jaculation of our first pep assembly to the ex- hilarating victory over our cross-town rivals. The plot thickens as the actors acquire knowl- edge through their diversified curriculum, offering subject matter to meet the needs and the talent of every Cat. Through the joys and tears--sighs and smiles--the curtain slowly is descending. To us it was the greatest year--and made the most unforgettable story ever told. L litiitor, Susie Gough, Art Editor, Gloria Jenkinsg Editor, Phil Esch QJCXU 6561-f Dedication 4 Main Building 7 Vocational Building 9 Physical Education Building 9 Music Building ll Business Manager, David Wood . .. RS eff?-J' f vw ,M ffwy ll p..,..v' e -v f'-' f.. .',' ,.,,. . 4., f"5'-'A' . ,, . , 'W ar-ff' "'f...fj'-nr, K , sf, f- , ' 1'-3. fl-" .f' .,,, ,,'.'f:S"' : xv 'fix '. . ',-f 4 AY. ' 43, 1, . -. .l'fpt"','. LJ'-.5--f f' 1v"S-.Q-fi - 4,..,.. , ,,- ..- ,, . I- ,.,u-z., Q . - .,.,. "',f! .A-,, , - if 435.1 yu - - K -. .. . . ,- ,. -1 2-"' xdff' , 1 1 , .- f , .f , r V, " .rf .-. ,gx -,, lu.,- '.r f .' 'I' ",-.fr -,- ,I Q ." . , -. . 'v,,n.,,.,-1 I., , l.-,' -'.,.-',V- ,- -.- , I". fX vt .."" k?" I .F x " ,"- . '11 5' . . - ..q 1- ,gr I . pa- ..- . ...-' ,- i"' fc1-.:'..--',- .4 ,,',-f --v ,.-.. -' .':', .LQAL 44,5-1 -,, --',, ',-"..' .1-',..-fi,-V-'1 ' ,".f",,,f ,.'-".,,' ,-gf, -.- .. ,, - . . -F , 1 ,' -,-..,. ...f . 1 ,-5. A-, JH- '. 1 -,-xb:.--- 4 E-fEfDND til ft" ,.. Fifi ,ev '-f 'f, ,fffaf 1, - 0, f .,f O YJ .rl if .1-fe' Iv ,I -.1 11.27 ff I.- .-A ,rv su A , 'ja r . Q i iiQi'f 5'fj l ' S1 f6Ql . h. h' 'ifgfi -f A - 1 l ii l 59ff5QJl 1 ? l 1 i l i ' l l l l Zl l 1 1 l M, U. V ,,'f, Q .A.,.. ,,.. k--,,,,.. , V f-,. --f., ff.., , . ,f-,. , ,. , , "qv ff, :-"f , gL,- 1 if ,-. fgfwli f,,' f Q ",, izzifgiifjfgff 1 s ziwgx-fggfgzwausz :z.4i?fv.:1- V ,. 2.5.2 lf: sz: f ,wi -"fm-1,'a:iSrfi1"-z'.1f,-M111fs,iY,'f'-'s'f2.i:-fuiv: w ua:f1eQ:f2'-Qs-fgwg5v.:I,fvLq-5.1: : ew I : :ff 111 ef.af2-lv:fam-,:,1., f ,.n-sL:s72'.fEa,zfgermwe L. vii f fm Q.,,u.,Wg1,,,M .,L- -f--' V. .--, - ff., , ,1 , 1' .,., -,,.f,-,..' ,.-, f-,,,', , , . , Z- fQ'z'.16'iE:fiZ1f,sW'lLiiiu1z'.b,.:',:-1.51-1 'EW 1 . 5- Q Ely: J I 1--fT.lf,::4::-V, :P-:EIL f. f' ff: 1 '-1!,i:,.'Mf f'iE-'Yf-fw.::z:- 7 ffm . ,Ui 4lh f i Q l l l L l I l f i , :,1 1',: fi? :LI ,-i:' f .g?f5f'Q2LfiflfE52ifEi!fIf '1'f, :'1 z?23l5fffff'Qz :.Y i :':h:' 5 ff! fki' 2 '-1, 51i'f',i?e'5f-5Q':ffiff:2j'fff'zZiff?fififjfzifff-3' 2 L l l Q .f,' :gf:5-mimi: sa 'iss,:,',E.:f,.i'fiL'iiif'f",if K' 757-5,W3'K-1,"',--'SHEI-'f.1'z:"f7'Llif-Zl,"?-TIYI'IEJ,-5f', 1l l Z R i l Z A N J , A ,,1 S i f Q l l 1 l . Health Seater, an st new nbias: lzbrar nil A 1f l ff.: 1-1. 4.5-,, ffl f l55ff Qi! i? if l i l f if Z l5 l : 1f f 5 l i i J Ye? J SE? .Qff 5 1 5 I1 5 5?57 5E f f g ff5 ff5f?? i f?lf1?3fil E! i5 l EJTJ i1ifYf?Sq+ fWV 1l g ' l l l l 5 1 I 3-. 73 bij' fff, 9 ,,,1 .-"f r', JF' 1-.A 'V 254, av -Howard Retzloff Photograph Courtesy John Matthews Co. A vi. F 0:- -jv, 1,1 ffillf? ..f'g",3-g.5 . "5,."" -"' .. ' il 33'-lE?f:f'," Q?"'.,'f' , + . 1. 'Z,1,'S'.f,W 4' ag .-11", :fi Tw '31 .fly ,ti , .' l ff 154 '-W ' 1 Hex' 'jk' of. -.-EI. f I fa- ff? A74 V -If ,rt 'i-.7 v -Q, :FT 1 -17 +V av, . MA s sl , :Q-.gf S-ff? K fifi ,f"'A.. . 'au .- :?" ,': '51, M' f1'f" -9 -I' v rf ' :j-cc: C H, 4 :A V. .,c'a, J c ,gif 'V .1 "' W , r FL. ,z ,SS f',,n'5 , ffhilt. Z f . Tie' . iv. '14 -fr',11- a .fm " 555 '3' 'afar' - Z- 4 'Z -3- ' 5,312,155 f?'sg'2'wf:f L'f'-.'2"..f:5:eg.k cgffy -' +4 'lf' 1' ,. f vu. f-'41 , pan Ca' ' ' 'pk W 4' . mf, 7 an :Q A-1. 1 .7 ?F 'WP 16: 1' - kiwi' .ya it ri ' ' J' :- :' f .-51"-r3.4 3- -3 V ' f"":. . . VJ ,..d,,? ffiN.i?Ysiv Ei: ,QR ri Lltllmn . . . sudden blaze of crimson and gold among the green and brown on the hillsides north and west of the campus. . . excitement filling the air as the day of the first football game approaches. . . new and interesting classmates. . . vivid discussions of the summer's activities. . . Halloween comes and goes. . . election of officers. . . early enthu- siasm of the Seniors at the Thanksgiving Break- fast. . . Sophomores' harrowing experiences . . . the thrill of the first assembly. . first report cards. . . meetings, meetings,andplans made for the cold winter ahead. .. ,, t,,,,,,.' A, , -' .NM . 1. A f 355 A ,L ft? ff.-f vw' 'Vw hi U' "" W'--lne..4,,,. K tu"""w""'ll'linstua.......... The Main Building Autumn saw the Wildcats come on to their beloved campus laden with books on opening day. They still found time to crown their queens Ann Splawn and Janice Measeles on Color Day. 7 , Winter . . . stripping the trees of their leaves . . . barren forsaken look extends across the hill. . . chill and strong cold winds bring Jack Frost. . . football games come to a close-- only to open the basketball season. . . the unexpected yet welcome glow of the first snow . . . the Key C1ub's annual nativity scene. . . fun and entertainment at the Wildcat Follies . . . the welcome of Saint Nick and the holiday festivities. . . Christmas vacation. . . Mid- winter Band Concert echoes melodic strains . . . the yearly fund drive for the March of Dimes. . . cold. . . freezing cold. t xiii: ' , 1, ff. ' A 8' 5 fi 3: "M """-wa if-R 'li i . rr 1' ' . if Q g i 3 ,. H 1' I 5 f K Q , " n 1- 2 Q M 1 Y i Q' ,. 7 Q X 3 5 S W, Six g W xg I 5 an-v S 5 g 1 4 I ...H R Q is 1 3 -N... 2 5 6 t K f""v4,-M- , . ,,,-f vnv-.- L E , . JS., iii' Physical Education Building WHY WE'RE NUMBER ONE!!!!l an K 9 WN!! , if 'F N 'ii' Spring . . . and the campus redbuds blush into bloom. . . the season is for Seniors-break- fast, picnic, banquet, class day and prom. . . excitement fills the air upon arrival of the cheerleader and student council elections. . . the last minute rehearsals and final showing of the Senior play. . . numerous festivals of the choral and speechdepartments. . . annually the Musical Varieties provides a cultural interest for the Wildcats. . . bursting forth in new splendor the Spring Band Concert and festivals. . . the graduating Seniors leave this North Side. VOCATIONAL BUILDING lllma QQ!! 'CG , ,,.-.a-w""w1'9'fi4m.m...auav -is Si . aa fr 'L wi ' MUSIC BUILDING f.....,,, y. ,tx "No, Bob, you ean't have the umbrella," says Senior Class Treasurer Bobby Faulkner to President Bob Scarborough as Vice-President Fred llanehey and Sec- retary Cathy Reed the liaster Senior Breakfast. Q S... ggi , , Judy Howard and Natalie Mirontshuk re- move make-up after one of the rehearsals for the Senior Play. .,,kw IAQ I it WILDCAT STADIUM Throughout the year the Wildcats maintained their high spirit whether in the field of athletics or in the political field. Z QW - . . -,.e,,f' .K w. 'f 3. .LJ gm " zJ'9g. -f.. .4 -3.1 xr.- ,,. ,. .1 ,--31 f A .- H- 14, L .- ' , .- ,X .fa-.-.x ,JL ,-. 'J Q .' 'I' .' ",..v, 4.- , M 5. , ,,. v f- -A A ., V .-f- - M, , - ,.- .- .--7 ,vx,,.'.-'I ,--,gn f-,I 1,5 ,wi ' -- ,--,.,1,, 4- J , :"2.1-5 -.L 'ft,f.L , 1 1 . v ' . ', " "" J'-"L '1' 21--K. . -r. ,. ,.. ,1 ,lg-.,'i,, , f, 1, W, . ,f ., 0 H -sf. --- -- . ' --L' 4,. --' .'-f'..r" -,M-,f 4' -w .' '. pc, -in. ,- .vl Z ff I- , z, . :EQ-e'1f'. V,. A ff, 'gi 'ff' .wg-sf acku: 2 ----,.-- - ,,,, K Q 1 N ., ' . rf- Q- JK? Jura: .f , .- .,, k 34.17 1'-'sl .4 'Y -Q., , ,.z- 'R '- .i"'.- ' "1 fr! ru 4' v' ,.,- A f. , N , --,y..mM: ji ,p ,L .nj ,4- ,- I i ...Ig ,f- ...' t"'f.vi4'4'-!1:"'fA 141:5fv'fT-' .- ,,- J , ,1- V .V 3, i 11 V VV SQ ,Vw-'VV.:V, fm S "HfS:V,V V ""-ffm, VV P?i:T4LT:ii?3ggV figfzzlsfww V. V V .QVVQQQZVVV fzzzf?VgVVi5511g25XQieeVeseV,szfsifiiq VV ' Ufsf E VsjL43ggig9'gS2iL5?sVag S ,V LQi,, ,ykb V,,l,,.W. ,A11,W,,. S.SW, X 'EVVVV Vs--,'VVVVVVV--fs-Vswf3fV.V,.V.,ff,. -QV -ViVVVfVVs:V-VgV.,.V,-VV VVVVV,V,VV.V,VV, V V.VVVVfVV.Vff.,,, 52-7wjjjg,Vggigjfqq-f2:,mmV,Lg.-mfQV? 3 VVVV VVVQVE--"V---VV-V1:5fV,VV fygmjIZSV-Sfggmj-3.'4VV.,',?-Q-555331, IV -zfVVEiV2VV vw-Vw-i?f.VV5-5.25:-w52,,V.,VV,--Vw V1QfiVVVfQg1V.gg:1gsVg5 V5iVVV,,f VV g-I-V"-QVZVV-VS-sVwf2"S-1-Wwwf.-ms:-U 1 SVS-ng:s:Va3s.aVSgVl, VVVVVQQ-:Vw up -VVVVVVVQVVV-,wig-fVV,,VVVMVVQVV .VVV5:2VVV.V,VVVVVVVVVVMVVVS.,VVgVVwVVV,3,, VA gi, VS an.VVV.,mV,V3VVVV.V.VV.VVa .VVVV fV5V,:VAV,wswV2-V-n,,,Vw-V1-,'gg'.VV.,4f5gVV-V ,V Vg fV,:s,QVfV.VVVVVVVVV-QV: --:VV V S 352 QZVV - "f1VVa:sVgmVfV "2f2fe,,VM '1'f,w,EVK-fwiVfwj-','fwm5l,, 'lies-VsisifsffaiigiV512-V, V, Q 5f,3WLr,M,.f,Qw5V,,wffvm.V - ' , ge 'mg-SVVVV-?r1VVgw.VQ.VV V:,f,2V'w,-aw, ?,f'75Vj-Mf-W-2b,V2J-QSAqwfMm,Mfym' Wgigifig-ffm-VVVV2 V SS S S-1-252-122-205-f.V 4f.VVV5+fmV+-gVw-fV,M,V,VV.V,, V, myV,fVV,.VfV.VVV2-.VV V M V SV-V-VV..-,VVVQVV ng-VVfuVQw1fS1HV-wwwHV5f,fV lx, --Vw-QQ-5:sf,S:V-S V SV, V S -V,,s 'wa-Vfevfl ,,gVggzw:fVfVw,,.w,VfVV,VVVVWVVVV-VV,ww2VVgV VVVVVHWVV-VZVV V VV --V-VV --VVfV.VfVV5 V fVwiv5d,5Mqf-:V-rj-V.VV.,,,g'VVf'w,3fJgu,,f,,fffg51 ' - VV5 f .V.Ve.VVgV.gV,-'V '-'il-Vfg-ffm ,-V,3jM,mA,4V-ff5gg,fV,VVVVVf,,f,,Vw,,,,V.fVwfVgV,,zn VV- V VVVVVVVVVVVVVV-,,V,2 QVVVVVVVVVVV VVVVV. - p'V-VQQQVWYQNQVVVVVVFVVVVQW-AVVHVV-4.V"'-SV: Vfwsiefgg V f-1-"VVV,:z,V:fgfVV.V VV,.VgjV5VV VV- VM VV VVgf'V4VV,VVVy:VVV..V5,V,V9VVVVf12s-w2VVV'VV.VVVvwffgqf-.VVVWVVVVVSSQQ1VSfw,V:,,.V.V:VVVVVV VVVVVVVVQ-VVVWVVVVVVV -.V.V,.,V V.VVVV.V.V..2.V Vfgggg VfffrfMf5f5g,wwVVVVfsV VV--VNsw5-VVQQVVSQVQVKVVVVVVVVSVMVV1sV.1,VVV4VW,-,1wVVVVg:.,u5VV-..2n VQVVVVVVVVVVVVVVVVVVVV -VVVV VVVVVVVM5-VV. V ,VVM Va .WV gg. - fi,-1Z'VVj ,V2V,V:wV5i5vfw4wkV,,WVQQVJQ5 V VV Vz.VV QQ-2255-VM Lf?V?3'ga3sCi,g,g5VWV-QQQSSQV " V1?1,V.2,4 A a?gSrqsassSi1y4iigg5QVV2-swfVVwifiigsfsaiq-9?iVVgV5sffseixsgVgVgQivsQ35125VQfQ2Qgss5VssVg22VyvSis?f13?gV1zijj 1 V 2 :.gVVf:Vyz-i- ,555-myf-g?3WVq,a5Vf M, ,Vf,,,1 VV -- H VVVVQQ-WVVVQ-gig VQQVVQKQQMVVQ ,VwrJ55VVVVVgV,V,gVVVVSMVVVV VVV,wVVVVV,V,Vg,VVVVVVQVAJVVVVV,VV,,Vwmk V,VVVVVV.,,VVV,VVVVVWNVV S V, V 1' -gg Vwf35fVif.VVVV?-ff--W-VVVf:,Hyfjmff-Vfyggff S - -' .Vf5iVz.VVVP,gVf:V-'V-Jw'zajgg-v,x,VVf--QVVVVVVVVVV- SVS V 1 .K fvxggmw aw 'gfSH3Yg1V'?2-S52 . -V?'a:r -ESV -1 5' -'A -n5i3fQ,'wVfVV-ViV:'ji.ff' S S VV, V ,gym any w s22VVVgwfm --.V SVV Vie.: 522, - -41 -f -- QV:- V- -.Sy VV-..wwVVV.VM1VV2VV,VfHVVm,VVV.fewVVVVSV VVVVVVVWVVSVVVV,,VVV.sV,,VVwsV,VVVVVV,VfV,V.V,VwVQ.f.VVs-g.VVV- K 22 V :Way SV, gw VVQVVVVLQVLVVVK V-J V -V:VV gpVw'2nViV3VKVVw1e2VaV,VVw-V im.-'UH-AVV-,VVMTVWMVVV-'VVVVV-M-VVVVV,V,gVfV VVV A 5,1-QV H VQVVVQV ?VV,,,VV25VVV,V,VVqsVV,VVsV V V,VVVVVVw3V,Vfp5V,wVVVfV,VVVVVVVf,gVrpgwrW.-M,V,WVgg,V,sV-S,-V VMVVVV V V V V - - ,,VAVLmwH,,fwi,.,3VVVV,-'M V -M ,gs iijigfgagg?-V? 5 V7:, v Jl-LV. - VV,-4VVf.V51.Vw'Zf-'M.wf-fsn',VVf fm V V V , 5 -,f V V 1 2' VVgV2 V w3fVV g1A VVfgVVgf Vfswfgggf i v fVVLVVgVV5M-VM,'f'mf Q - --fVaVg:"V-Vi-VV ga V -V VV -- Sg f V VVEi? VE QV . an d V5V2QV,V.:..V.,Vfzjg-5555,V553-5M,.VVV.VV VVVVSSVV5-, fVVfVVVVVVVVV,VyVVVVV ,VV V VV ,VV.VVVVV,,-V-V -VV :VfI,V5-Vg-5-VV,g,,gVzm,V4,V,,,.1.w-A-arg, V V V MQ W V V S V -4V,gg.g,f.VVV,, 5,552 :Eg Vg X ' -VVVSVVQMVQ-VfLV-EfQ?V1QfVwQgws2t- W, pi-we--VV-Vv?ggV VV3Vviviimi-A-g2'Vffi:4-. 'Vg:11W2'QVVVi1V.V.esV 1 V p f -r VVs' - , 'VVV V - ' -- V- fHVi , 1g5 ,,3' g as T amgg- 'QQQVVV W -V -V was V V 5 V '12ess:QV-VV z .g Q ' 14?Q VV -V V,VZ,,g, fG V a -ff s7z5VgVgV,VV V.,VV, f -V VV MV, VV-Vg91:VEaeSSHn212V-ViPf2-VssfV.5aVe Rik 5V':-- . .V, - -V. -:,- we-V SVIV -V N VgVVfVVVVVzVVVVVgVQV- S VVVV-:Vs-ew.: QVVVWVQVVVVVVVVVV 5-SfV--S.,,m,,2VV,Vgx,V,wM-V..V.-W V VVVV V, VV. .. V VV VV, VVVVVVVVVV VV VVVVVVEVV V V. ,V , ,VV VV V ,V VV, V V V V V. , VV " "if3QfQVLigQ:LQi?:. V s ' g23i2?V?a4V.VV 5245Y" J VgK gEi21V , f 'Y?'?-ig ? VVktggig fgEV,. ggsziegggzaigz eVVVQVsVVigVg?mf'2V3ff-fsijeffgieyaeg V,Vg-V'VzV.w2-S-VVVVVV-4,Vg:--if:'mMe'gzgmi,jV.VV--2, S V, f' if--V - -1--MV:-ww-QVVSV VS: - V355 2V A fm 1 f-- '- VV --fewVV',W A 'Va-ffVVfwV-VsVV V"fS --Vw-.'..5.SVf.Z.'.--Vw-1. 3 H-5,-53:55-53?ffwJV5fgfa?jXVgV5, '-'ffm-w f ggQWq,.gV W ? r ,VM ggg1gi2VgV 2'32 Ve - y V-f- 5551 M ,V.V5-Vin,VVg-..VVV.-VVw-gV'V,VV,,- W V 2 V , - LV M-"gf S V ,V3: 3f -"V-A TV ?-Q '? , V 5 -Q ,+v.Vg?i2Vf V-' Eff ,VW5f'kVV2'-'-?'2VVV1-,-S Q - QV VVVV-ff w ' fVVf1f VfI5-ff'2',Z'VV'V'7'V?: VV -HQ, Vggkgggsiigga g H5g,,E5!wTyQakfW - gg -'wig-gggVVVWeVVVfVVVg,1VSVV.VVQge9Vg1Vg2f.2-V:VVQVVV-VVVVf1,.Vw,iam-2-.VSV-5,5-VV-if-VVQVVVQ-gg'-VS V VgVgVEVVVg5VV, V 2 .VSV-VVVVVVV .VVW-5',?QVVVV3TJVf,,VV,fVVV-1- EVQ V V V V 2- Vgx vgfxq V 2 V V-EV 1 - V f -V V 1 V ' JV gig, Q f Vag Vaig5VVVgggvg?5,sVXg-:H LE VV- - igss-if-riffz V ' 1 -VV V42-few ii:-W1-fgVV4i2t -asf 4VVQ.QVVg5452VV212V1V:VV55VVfV:52jfV,E55,iggw,,jgfgszfsVfVaVes,a2f,Am,4gVyV VVVV?-QWffV".rf-5V5v:5Vm.wV.V.AVVPVLVV-VVVV-'V, VVf5gfVVVV.sssz1VVV QVVVVVVVQVQVQVVV VS: VV .Q-SL- mga, VV fwf,VVfwfVw2V.V,,eg'NV,,fV2-5,SVVMVMVV iw: was V if-'mf-. V 55+-5251541 Q-'--Vzhviviis-V-V-V5W1V- V V Q W W-VV-125,-V 'YH-IW-VVQWY-',3'wVV,V-Sm' f'--VzfimsigVV-zgfzweeeswzlssf-VVVVVVVQQVV 1,V5f-3-'iwzffif V -V 2- fV4V.VV V - V ,2 V V - VVVV VV V VVQEQVQVVSQQ V-VVVVVEVV-VQWVWVQ. VVVGMVVVVVVV ww .VWVVV VWVVVVVVVV.V.5.VVVVVVVV.VVVVVVMVVVVVVQQVVV VVVVWVVVQVV VV.V,Q,VVVw.45VVV,V,-VVVVQ V..VVVVVVVVVVVV5,V,,VVVV,,VVVVV,VV,VVVVVV,,,,VV,VVVVVV,.VVVV V ,VVVV.V,,,V,VV5V.V V V, SV, ,VV - V -V V VV K V 1- S 2 V-VG VVQSQ- 'Va-Vi-ifiaffff- V Vi VV V' E- -S250 - Vg 'ef Lv - ' -5 VV V f ' VV' 1 V Q- V' Vs s?q15K2gV-'giifii vV'VgVw2sguVVVV?V5-1-.1VgVV'VgV5Q 'fQL5'WwY'f'w,V'2furV:L -Vigggf:VgVVVVVQVfggVV.VVg,VVVVV,g e V XV VVV Ve.VV,V'Qg-.V,w--,VLSNEVVVVVVVQV--VV: 'V 5,555-5,5 ks-,N 1 VV QV. 3 -V V VV VV ,Vg RVM VVQVVVVPQVVV V-:V w -, V -VVVVV VVVVV 3. sf NAV. 3-f 91 --XV V Vw QV? .W-'Af5'VVf5311-V QSVVYV-V-,,y-fff-M1 XMVVVVVVV ,-fm Vis. Q55 -- - VV V ' V' V gf 5 ' "A VVVVVVVKVVVVQQH V-3,?AV5VV.V.gw-r-B',tg-V-VV3-fy,5VvV-g:1gVf-:V-aVm.VVVw,V1Z,VVVf-'H-HV-Jf9'M,.VV.rVj, -1 --V ,,,5,fVq.VwV5-HQWVVVVVVVVKVV.-Vf,emfwfgxa,-mggygmsp 'V -Q -fm wi? gpg-gnfgfswfs -Vf'V,1?'mEGg-ff-fi.m'11+vi.14fs"Vv-H"..f V V ,V Na, . VQgg'g.9g?:fgVgV V -gui Ev s .V Q ff Va 2, V VV VVVV QVVBVN-Q VVV 'if as -fxfilm:-VfiV5VV3:,V5,fghgg--QV V V55 ii - 5 Vin - ,V-1 QV V. WQQEQXEVVMVVSV SQLVQBVQEQQVVQVVVVVVVSNG .Vigg V V- VVVfgg5L,,VV,g-Veg ff 5 -g5VsgVgVgVrgVVg5523g,g,1Vgg51gVV4V,V,VVV,fg3VgV V eg V fE 1 . -gigs mfg-:.fgQV,-2-EVV-'23,--QVU- VVVVV gig'-534 --VVVVV V V V 3 V. -I if V1 41 -2 . xx, ff: VV X www Elm., ,mal V1 V, VVVQ,5.5ig3?V VVW VV, W-,FV VV,aX,,,fXQ925sVg-5Vi,g,VV -egg V V V V-V , V. V: - . --V -- V. -QV . . .X ,gm , . gg-Vg?5s. 5, JV-if ,VQVVQVVV .VVf,VE,2-V, : VVS V5MVgmVV9VZgkf S-gd. VVVVVV Wg V 2? :VV V-- V5.2 51,5 Q Q --psk zmw VV-VW, --Q..V,gVVVVVVV.V5gV. VVQ3, 5g5,V.V .N gVAVVV.V,fVVVVEV,,Vi?5fVVVVV5EgVqg2V"3gfVVigV553g,55Vs V VV VV VQVVggV,gis.V53VV3V5V,, X-,Vg-Vw ,m,.. VV , g f,g3f5,'ESV.Vi1--JAN fV V' V' V V 55 'V -V:VVggVVVVV,V - V- Q55-1sfVV2f-X qV,fVVVVg3gV 5gvzVwWVV5g-QMV555gsV Vg V sVVggVVVg? Vfipgfwf V V V V V VV -iq -fx. -VV -V gg VVVSGVVM-.MVQV V-View V-VVVQ VQVV L- -QVHVVE--Q-Vggmw HVw?,g- V iw- wiwgjfiwg - V V V V V V V VV, VSV VV, ,VNV W- -. -VVV V. V-Vg V4 .aging 5533- . .-V233 F.-,5Zii5m.5,Vi3.igQ:V ,?WQVx?Vg5V 1 gg 2 .2-gf Qi Wggsg -' if - S EV W-f ii i? -6553 - Qf yssfff d--K Vuig,-:g V a 1f? . if -Q" fgV2fVVsg52 Vzs1g.3VgVVm5, gVVVgeVgVsV?VgV,1f?-2' V ' V' VVVVVV 1' ' VV V z V- V.gVV,V--5 sg V' -V-VV,- V--V -- ,V - -51, .VV---EVVVV-AVVV -V:--QV: V- V,-V -3 VVV-VQ---:'g,-, V V-V- - - - V V.-V VVVV X 1 VV, -XV-VMVVVV W V V. Q VV :L -9-,H V- F--,-:g f -- -V V V' V V E ax 1 V V V V - : V -' Q f L 1 - . - S I , V gg. IEEE V ' V' ' ' f V ' I V 5 Hi -V ' - E - f ska. --V V V i 5 E V . 2, 2 2- 5--V .QV X55 9 V 7 V wgsa ag ' 2 Vg Vg VV ' f V ' ' .fi 13VV Q, R5:g,ig55VV V V s - ' , ' E V VV ' V VVVa V S V, -.2 lik V- V V V 1 - gi 5 - - V g .Q egQqEef,,v3iVQ,!5Sg-ggfmgggf ' 5 V - V f 5 VVV 'V-Z 1 VVs,,V-VMfV.f,-53,-Qf,V- MVV WQVQQEVLV-VfgfVVi75VV 5 .V V V' V- 5 ' ,-V-fV- XV: V Q V i gi V -V V VVVVVVU VgVsX5V55,?g,5f-Vismigiig?-VVQX 223V-V-Viiji .V, , V,2Q1 V-VVS. V2,Sgg??'iVf515Vg1ggj5gJV-V4.5 VwgVsggV Vg 5 ' 3 ' f 2 V' Vw 2235 Qs? 5' V3 Vi' fb- V V V V A -' V 2 V ' ' ' V V V E ' ' ' W - ' VV ' V I VV '- 'V f- ' 2 5 - V g - Q, V:g,4V?3E'-Qi-W-2-VV gV.V-,igfsg-QQSVQSLQAQQQ-WV?fw,V,ggg5,VVV-VV, 'f VV-9 gm 'VQZV X' 2 ' V V VV,-:VVS.'::V'f:E-V --21-fef-Vp-VV-. V V Y -WV SV. pwV.4V3QVf..5ffV1V' VV V S V' fix VfVV-if-QVV".f2i V1-mail V V VV. V V .5 V 5252511-VV VVNFSEVVV-5 ik VV gf -N af- mia- -'V S- V X Q V VHSVVQS3- , , V, V-Vg -Qgfgvm.-2 V V QVVVVVVVVVVVVVVVVVV VVVVVVV V za. V ,VW S qw, VVVBV, KMVVV K V ,V,ggg,V5M1,5,VVQ,, ,Q2AmgVfV,gV,L,,M,x,,VVs,G - 1 2 .. V , V V' 5 V' -V . - V V ' V VV - f :'fgVVVVV-fVV- V .V V VV .Q-,V AVVVV VV.VVV.VVV..VV -,2V.VVV.VVVV,VWV MQVVV VE V QV V V-JE VS .V VVVV- -VM gmVsVVVswV22:Q5gVEV5V3VVVVgV.5VgVVVS5Vg V ' 1' ' g '5 V z VV Q- -V E 2 3 'S-Q-ggVVgVs3Hf Vf-V5-ggVViif1 V V VV g 5 V 1 Q V. V .... V VVVJ V .VV V V. +5 Sw V2 WV V. .wg VVVV.gmV,VgVV Vx VV V iw - ' iii V- gs- Vy a eggfg'- :Q V ' 2 V - V Vg -3- 52? 51:2 2552: V- .33 .4 i5S ?,VV-Vw si q --V E 5 - -V K K V Xe 29 K 3 '5 ,gif -V V :V - SV VgVVVV 5 , -V5 325: ig-I V 'V A VV' 2 5,1 gigiii' if- Eih393'f VE 335 5? V V V V V E 2552 vgfgigs-3 xggggig Vi 3 mVVVV ,?? f - V V s V .V V V V 2 251' Vi V Eiga gg? his 5 SK LV - 3- ' 21 1' -VV-- f- V Xp -VV iw -VV- ggi-gg' 3 i-sg -if 1' ,M V if VV mm V 5 V 1 f sg 2 V V VVVVVV V 5 5 - E-55 ,V 5 VE V5 5V sg ii E 1-QV V-'fVVVVVVVV+V- VVVV V 255 V V- 'gf VV V 3 - V -S V L V, f' Vgxs-2 git Visa? i f Q i ifiggc gfqi- XV Q Q ,V V V VE Q V - V, - -VA ESV eg gi -455 ,5 VV V5 5 - ' - fVQ ' V 5- V - VN' V3 EVE-V' VV Vg, fm . . ' ' . E- 23 5 V V V V V s V V EV VVV V V V. ,Vg . V - ,V-.VV5V. V- -V if I V V 'wiiff VQV 'V V' gg'-"Q V ' V F -fi V S53 M EEVV s V-5 52 - 2 ' 5 fs W?-iii- f Vie - L S gm E? V' IVV-'V-VV V R-iiaiiiii kgif iii ' - 22 ' S-EQVV V -g fsif'-V V ' - V V VV -f VV. gm, V -V ' -ss, V V - - Q, V-V 'V V ' 2- 53.5 .V , V V , VV -, V -z V -.V.,jV. V V V z ' . E QE- Us g- 5 5 ggi VV - Vs-51 if- V : 3? ' 2 V ,ES 'VV V V fi RV - i 5 S s Ei- Z si Es!-5? E- E SEN 2' 5 :I V ' V S E 1 VV Q E VE V, 2 1 gina .V Eg if ii i- QV g -xg 5 Q - V 3-Vg V 'S ' -,V'--V., ' Q V Q V V -15 V V in V V W V ag E Vi -5- QV- 255 gg 5 gigs V -.4 s 25 V 5: 3 5 iff- -s- -m ag 5 i 'ji' VV 2: ff' V QEVVSEE 9325 VQVVVV V - 5 9 -EV f - V V i ? VV? 'V-V VEQQVVV3-QV -,Via V-E gs! 2 M2355 Vgiga VVV V f V- -V-3 x E P Vs: V ESQEV V V513 V Vim 2 Vg sa, - 5 2. V.VVff.aQ:w1f"W' Y' 5 - V 3 V55 V V .f Pig V- V-5 Vi VV 2, V xmas ' 4 w i" V is g .VV '- 'V -V UE 3 V253 'FEV ii' 'E 5535 f W iii'-2 5 " 1eS ..g-'iii-.VV fi V Z - 3? 5- -' 5 'SME 3 V 'Em su Uv iii V 5 V V. V V V V V V V V 5 V V W-if --,V 3 - V .V-mga .VI 2 V V !. V5 s S -. HV 1 2- V 2 VE S VV5 QV QV V 55, Vaiiggfi. ix V V gk VQVVVE W 5 fi V Vg 5? VK VVS E. ,VSV Vg., mg VV M vVVa??rga:f a V 55, Vi?-E 2 'Q V E Q 5 ' ,Z VV 3 V V 333+ ,wg gg-V -5 5 V, V55 V gsgp MV V 5 V V -V g55'VVVVV Egg ii, gs' - 5555 f 'QV fi 5 5 - Z SEN V 5, -VVVEVE 3 -25 2 4 2 2--V2--EEVVVVEQVQQ ,Vg JV! VV? V EE VEVV'-EV VV VV .Vz,V,.V . f V V SQVV. VV51 V55 V V' gk V 2 V V 15. 5, 2 V -:.:. -m y V K f VV - K -g Zigi VVVE51 '-SV Eg Q V ' 5 V3 'E VVS5 gsVV - 5 gg 5, V gg? -Q V 52,3 g Q EV 5-325 V5 3522.3- V ' V V - V V. 5 KJV Rini V VSV 5 Vg . Vygg VVVV ,gh 1 VV: S ' QV 55 2 5 4 'Q V13 12224 gm? gs figs 5 3V V' V 135314 V- V VVg VQ i- V:-f-V, -V - E S s-fb' g-iw, 2 VV V 5-E mg SES -SH 'N -V, - M - - V E 55 - af- 5- -V- FV-V-N ew Je? S- -. , 5 iii' - - 5 -. V' - V ' 'H ? ami w e 2 ' VV-5 'VE -gg, sm' 55135 V QQ-Q VJ VEQ VV V gi VV -2 VV VVVg 'V sg V55 Vg " V VV 'f V i ,Vi 3 5 Q Y QHVV VVQ ii Q 5 A 5 S E -E f ' f V - 5- V 5 -V -s Q55 5. ' 3 V- .' -- VQV V 5 g+ Vg,,V.5 -4 :aVVV,V V V 15- V --Vfms. --1-2 2 M QQ f - QVVV V V2 5-522:-V-2 V -V 5- ,gg 2 .gi V g V-V ga sggg Vg K Vyiisgmgg-V -WV-gg VV yew Q V 1- 5 VVS J- m g EQ if f iV VV M i5x5f'??j'X'-ffg,P'3-Q5-VKVS-V-555, Q53 V 5,22 VVVVIVAQI-VVw2f,g2,fVxVms-VVV-.V,eVV.1:V,aVV21.VV, 55 gg ' f ' V - Vg-AV gi'.gV1Vg.V -sf-2-swwfa-5-Q-12.-fsf4VgVVV VV- Mig V.gg.V2sQggiV?5?52VgS1:i?V?Ef5SW5fs ' WRX - Ve 'aff 3- ..fiSs,2VZeVis2gi22z:VEg:Q12 V V Q- 9-VV QV V V V - 225-w-5155, Hgas-VVQ-Q1mfVe?:i:Q?fz,g5+-S-QVV5-fi Vigfsgif-Vgi2sQ?gHVf, 52V?fgi'i'1:V,asVVffiV2Vfg.VfgQ5,35 2 'J ff? ' vffzfmiwmk f?'E,f'QT wi ' Mi WW 'W .Zi'?BQWvS5?P5:QQW'1m-w'- fig? W. K K,fxH,555Mgms?MM,55,ff3,v,MWM,,L1g,m,.Q,gWM?mfw.,QMW,,3,1mh,,.KQWAQAWJQMWEEEQM,,M,fgfLwgwgikzgsiiM1gfes,1.gM55pes:1g.WfL g,,AwAsf-fmngeinal m,,g ,, fi.. -,gg 5-S.,-wwe -mg, gpg, 93- ,W f:,5,,f haf--.mfmgg qS2:,,1f1w5,fw Qimwgfvgf1:55-.,m,g?5g.mx -iz wsmfw-5 vWQ555Xwisremggefwwggw:BmwAgggffgk-ewwfz-gay-M555-5:msigzlgifqgu,w.1gsQ2z5...Qgm1'kwa-SM?Hrsimf-fwfsfwf-ffmfmfxWfSf5"S7fL2NSwHf2X'ffS2w5wwfQE"s'2Q2W5' 1fQsXmk9f,q5+:sf+r-wiq,f1vffN22asQiAsfsas215SHQfsf2ZQ??L:w1aiU'sswsm-le-E167L' 2w2YL252QigfXf2f5v1wX'2i- iw-' fmgff-S-.gngggisn-S i?i:sisf5zf2ff535mE,1wwQQmwfgwhw,, S Mg55wgim,gms,Kg15QQiQQi33QQ3Q,,Qs2Q1LQKggi25Q5fQ2igifggQxsigmshvfebmggiyiwsyskgfsfzSSgm.ggg1,Efa59351532451.gg5ya+25Qg,isZ15Pg5AW5Qg551w1wLfigSZ1EiiQs2is2,gws7A22?if5ie5g3Q?Ai.iw2'seE?Qfgfwifasfaff,kg A 7 Q59-Ssasgsaivf 222-gvasgifisfgwgwrvsiwizx r,gaKfm52'MS5ifw-S31 iafag-Hgafafgfsifvix--,g Ha J153?mf5B523f3 fs.Q.,mgggz,,i,i,,iw,S1k:ffw,5Zg,511zg3,w'Q as . mywgawwwwAm:W1gML,Q1-vslgwfe,qw,fM,w1m-mg,.LMw5W-ffgwagwig,M.g,.2s,m?2WfSwszWmgggm.Wggmewfwfg,Lgggsgmf,5,Lgb2Sm2vw5MgQ4g,V5.wsiw as Awww Img mwxgg mgsmw,fLmfsg,g-im Q ,5wwf'mgeg.ff f,,21,5515SW,w5,5M5,a,gg51,i Wag, Lge ,my ,Sw , ,W ,W:,,5, 0, VwMwiwk,kigww My ,,,,m,,Kq,.,Lm,,5,imgk,Mwg,kwgfew aAwgW.,6.fS,fQi.M1,X,,Wv,.,, ,,,-.wN,gW9wWw-15513,ff Www W, Ms. M, mfg-WMS. M. Www Y m,,,Wm: m.,M,,s wwagshs gm My sw IWW, A mm A wk few 5 M WLm,f,.:5.,,,W,. M, ,,M,, Q QM,,,MSM,Mmsm. MW-mfQS,m,gfsM,,3m,W .5,myWf2Z,,3gmXQ.ww,s,m,Z,e-5,wfzygA1miQ,mff?WNfM?Law gQW,ag.5enm-Siwgmwgl-hm S W-m5gs?fm,.Sw-ynMy-fgg-:swwyvsw is vmegkgmgmwwff wimgfigwfm-vga-1' wwf wgmslgzw 5,m,,gW,Wm1f im ,iwgfww iwLlggfmgsmifgisw.Qfwwm ,EQZS1gfSE,3af.i2gfQzfQF5gasgg:fgQgfQ,2gg,55Q-Q1gH1SK523EQgg2211Sf5Q5SQiw5asigggA2A2Q21Af15:QwQgQf:41s7fXf2gMg1i5?gff?1wamsgig-Lpawzsswigimf +gaMg.1aiw1mwsifez1e1Lgw,5,5,g .iwwafigqgm S7 ?wXf?viwe7 Mrgwae-5 elk w M1 fxfgissimfw ,sf-Fw Aswfawzix AL Lsfmfmwlw ani? w f- ws Leash QF ' M H, W J, m,Lf, f,A,1wI ,U ik , Q, H, ,Lf ,, - iw -, A. M www ,V , . A Y .M -V , - 7 ,, Q. iw A A. Mfsgssf- AQ- -ep H EW 1 ms, Aw Sv M42 -aw Wawgwgmfeffk - may wwf, -Sigh what :qv3g,ib,,W,.,,,f,5L.,M S Q .qw qs, k,W,.,.g,,-,wywbpfqfiq-f2A,,L.,f N.:,m5,wSm,1'Wgiaew-szfewa,gWQ,f1:fW,X,1g52A,S ,f2mff,SgM.2Q1,qwmyvfemaisyfkmg-wadiimsz.fwwigmfww-www? 5w??X52miM'5Zfw'WE'f3W'- -Sk wg MS, me- ww W A -ew-Xymmfewfgfsbslswwyg iiw - 7. xkwmwvagplxfx LfXL1,ewA -Wwgmss' 5,m,5,3,5l k,g:,15f, S ,S lQfw,sL3g,D.q P.,.:.M,,mfm,M,q,s,w1mhm qzsggwsggzLswgfsegwi 51Q:KSQ2Q5Q521L51X2Kff21xfsgg?wg1Qfs:sfQewffg5w,AgmASfQ-15K2+ggQQ525fS2inif1QbeK3Qff32gf,29QQ95Xfkvwfmwfqwgfwiwwx:sg,gffaQfwi'?Sf:S2?5w1m2fWS4?Lw yyfflakfgiaiwswgfgiigy S-We 5522155351-M2455 HSSWV 'E'LE5?1fsw2'Q5s23451fiQ2m7 - i3m2iZfg'M'?'5?f??gw7 Sm QSM Lyfffifwxglaf Y? New WSW? 533932-f,55s!,fn,fs S LSL, Ss,mg1w. 3 S,S,igigwiwwggggg:sazgQWQewwwgswsmggafgafgfgz1gn3135wisag5455gag2myg9515igsfgsafgagzflfazgzsifissfyQWeSSwWeisfavKNAk:awakefS23:zMsmif?LF5Qff1Q95V155KIWQYSQ'2s28wfS4i?Si5Faf?sfw1'ESNHMSSmsglmsifi '333wifngwffsg,5gH?132weHSSs?5agfw?'T?,Q?g221sf??msa.?gfQSggn22s 15532. ggi?-L'?15f'Q5gs2f 'fs-ws SSM: K S -ss: S S H 2 fy mm gwvfigfsxwgz memwfwwmssgsymayMwwwfESffgmwffseug-vmwmsixsasymm weZ:wxLmml,k,?mSs2lfffwEaSK-925W s-:w,ssQ11wSa,gnwggerAwL:g,S,..g- Y-,raw ,jiwgqgwfwgk was fswiiwig. favs mm. gfsqf-H-:sm gigs Q39 wgvggwgisf ,slim , my L .Queeg xx, fwimsk me Zqf,,,,W, 4.--W , Wy. 3, A I-,Q EMM ,ww,.s,mS,w,:5smQ,M.LQDWMWfgggwff,Z-wry SMH,-wxff'Qzsiywzrwww-fsswsm Aaveag ewwff,favwafwfyfw-W-willL5-Wylkilmsfgajfs' Swiss? 7m1f5w-Sw ,Wm-fwigmgk-ws we-Qf?S2gawfLz5gxamme..JfSf Www 1 M5115 '- M511 5933" ssgseim S ,, S 4 sb H mswfwassf we wwsamf1fQ2WM42gQMme-w2fsfQgqfsf2s2sas1Q2zQ?Msf2QAasQKYQ12Qs55sgG212S11azQzes2ZQwe2522sgWQfQas42gEQagbeSasLmiiyiaezaziisfgsseswwAfSgiSHS2aaHAA1fs2zeasgEa:vSfXfxQs?i2Hze-fLff4fXWv52'im-N 'M?f12igwLEK'Sins2s' wggwfsffiufsimwvkg Hgxwffg-ffifgammu QSWSQJQQQBLQ-H2 -Wiz? S :g,5,W , mgaygggm fy acsiasrxQiQQ2525vsas1wesq2Q21WQK2g5?sf2ff?wesefifnmwfzfwfzvfsx1QifAf'5AmeQQM2iweHise2'ww?fs:ww'fdmww-wwLmflavaisszfgsxwegfisfglw :WL iam Wa S- H iasgefsgisefwrffms,w9?L?Sf'gQSw Siam W ,Fey--A Axggnsfh sw ..m,g, L, H, S 3 QMfM,,g., ah 28 m,LWk,,l,.m K S Q. N,,,s,w,2Qg2i,.L,,:5?Qm.5IggywygQAkAM,f3z51m5mg1s1,WL,gmgw5.fXe3f,,5m1.,1M555iSu.i5sgWf5g2.ggW,Agmy - gmfw is'uw,mx-:gs,AgQ1m,u:5fEuw.RzreHgw.f,f vgsgk PM Wxgwgww Q, 56571 HQSMEYEYKM nw -.Yfgfm-,B-57walw-wsY,g'M? eww W gh E7 k wx K 25 L55 215, 1, -.QM ,, -1 if 1 f -M31 y 1 ,ml A - wi 1 .VZ W Ass if.sgeasaiisskffpwg-sky,.m,sq2:wgw,w AQ was Xmmwyzwmgwag, HWmAm,v,m,,L, rag, .M ,ww . lawns? QMEQ sw - 7 as QSMQEQ M ,M f2e,.Lwiqx-Qemg--, S W wiiwz 3 NS S sfzmfmw fx e 'S-'gag'inmfS22mwfwisesaeaweawffffff+27-:ifGfiisiizagwig-2mfsg?wi2?mgg'4,fsm2?2?wfaz1i2?QQ,:m,1 f,s,fwHaa,qfqmQ-Q7'gem'QHQ5Q91-2325322fxmxfwsway-fB4?a?g2-fwwwgffzeeigff S-Miesrff WG f wa? A HS fm ?W5'1Sfm'r?sKA'S9-S12Xfi2?5S5a15555557 X W' 6533! '- swim X5 wfiwgff mm S ,S S QB,-ffSfQgs,,A, 2 , W-551355 2 S' N ,X dfqzigfggmegwfsgfesgfw,y:1w1:i?a1s?QQv?fskfB2vh1QsmQ1lQ9sa51ff!SifiwQ?fQgs2as.fwfazfxff?laf2S11s5gg wigfiifawis221Yfsw3f2Sf1AASSQ965ifQ53S2wQFQ2wf71Y53fv?i?S??iEeaSlf f'?'??W5Q2H WW V W5AL3qg595sx1?HMHQ4Q-Wiwii Ffa,-sng5E3f wf5,gdiSw:a,gN Hs 5 - , MEM V m X - - S ,w2m,f,,f311 SS S wK,fMy,.,,s Mwfwlgww in-,W .,?1,sMmm,m.LX,wg25,m,Qwmfma-fsgsLfQ1WW,W,,Qm,,,,,WLwMM9,,g2L, mi-,WSMEQ7fwmgggwg,L,5fm,mq,-3rfxsmgggwggwWMF H Q1 by - M- I ,wwawm , fy-A u m m ,XM M M5355 mwmkw 5 ,awk mi A Q gim T ,S-5,-:5,.q,,MlL.. 3 WfQm,m,gL,. W :wikis.w,w5S,'W iw,,WAwy3LwLggf:wgaugQAgfMsg,,g,y5yw.kQ,w5gfm3gLgggv:simsglswfiggmwgwgpfwnwkg me:,fg5gxYfX,ekE1H,,ASQ-wi gggwLm2fSgg:pfS-V Sglgufuggg , mf Eigw was ,Qi 'wg LH -QF f-312' we -1 -f A Y' SE' I , S a,,s,,,,fm..,,, , S ,w.f,m.3s.,.h S S ,,w,3k,,.m,3,wiv WWWSigH5wgM,qg.mSg,,ew.vw.Wq5,,35s51sQ,Qsxmwgfxw,.N Wwggf,,L.,,M1,wg,k,s21A Qgmwm ,wfsgaykiwz-Ly.aww-mf1Nw5gQfAs1ae'e'e,f5.EmA ,A M Mfigpgfg, f fm 5,5 E ,f y -- . f g Wwe, , wr , 5-5 Y QAM . ww. ,. TS,,w,.,f-,AQ i, , ML , Qu 55, ,MQ Sw M gf 1 ,gk my in 1-fswfw , zz -wfswwiw LsW,SwAaf4faggeqgzzeQQimfwwm ,effwmffzsww ea AM QERQQLAMQI WS M Effie, 5? my ffm .. . gage A 'ws M QW -:gy W , ms WWII S, Mwfmwxs 3 :X f,tg,w,ks5,,5,mf,AQ,1,4geZQQ,A32I55Qii1Qsg,g2fyw,g,mgg5gSqg,2L2q,wigLA5,A,5.gQ,AgehggM,2f,3ggggA3agda35iiwg4, gs2ggg,,,,,B,gwigiqg,. mf.X919Q3a,A,E5fwsz,i5LazfwgwXY:,,gg-3g- MMSLQ, ,zmfgggim 35275 mmvggmwy 7 , X W my .3 A . Wk A mr ,. We . S wmfglff Um,,1,,f MQWLsffziwwggyfSZ15Qwwffzsfwgwswxff1emf2ae:2vsf5hM1::-1fwifsf9zswM5ii2wfGfwfigfw-wiy-S15SeQ2'5fwf71 MASPESKQwasfwimiyvHw?fffsSff2fQ?HS2s'f ffffmwfiifg 1 7 QHQKSMM 1"-fwjw 1 'SS mia' WW?55'gEW?5??- 'M' 'Wi ' -- -- ' www S esifL,Wg:fA,,i Sp SV5ggg4QWg1sg.ZSMH,Lggzgfmw1Q1QQg,sgK15g325Q3ggfg5Q5aeQya-135IMrsQ,2es,:fngxxi,i2pQfvE11pQiK,gg54fQ,Aagssfw-iggswfgggggyfmgww,fsfiguwiiwaeyfsswfmWai?wws5QPw2wfA?Af'wuEsmaiwmhfffw5 -?51fQMH:2s,s mm Jw ew gggagw w Q. I Wmwwx ,w,SZ, L1. r:L,www.,. Z,mywfmgigfw-,grarMyMyQfafwwgsW.L.,,wQ1mu7gyAgp,,gmW-1-wwQAm1m,27fquQwx,:SXXs"fQ2mA'6wW-fmewmf A Aw PM ww M Ma w , .. .. . is me ,MASQ ,xsmfgxg 1QiseLs"wfS A X53 M X ..' S gg S S Mlsi,,,,y fW3Wi,qmg,qw .13,1ls,g5wS,7s,,grmgw5,w1sf,grw,f6WggifQEW,SQ-,gassgwggggwM-Lmwnwewfxfs X215-if-fwqqgmsg wweff4:g+mv1gssAfg1wfgwx wma Q:sk,,Q21?E5gY rw, ww A Y X AW we wig, wsu an LH Eegf wg-3gew- YE,,kf 3 Ss S S z11.fw:.1ww 5 , Q 1g,m:f1sgy,gm15f52v s.k75ww1mQ5ffgw,,4dwQ2Sv4245f5fifffiskqsegewgwzssgxeglzs12Q:2gfi:Q?,Q2ge:sfQSlwsigzaiffefgfbgfizw??Q15f:aQg51e'vH7LkK?PfS2iQwQ2s2?1fiiwvwxiwfzwvnga2e,fgeSX9mfr?5kfQwzrRg1M' A ami ,sf A Mf K'fPgf"SQ' -5. 1 SESSWMQF Wei S an A V u91iMMv,g.s?54,25i3g, f 2'-ug wi' - wmi MM, W M19 ,1f,,L,fw,,, H ff im H1gum,M5,Q:,9Q1,eqx,m?s -MLQMSQ meS,gmWWswwweX,Q,,u91s4wf5e1Wn,. , ,Q QQ may , H 13 A AA .. 9 gpqw V mm A Ng, ,ggi A an E, Mn ,eww szikk 5223? NFIB ' ,SS 3 4 U 3 ,E U ,w,,5, 3 2 2 ,kimiifwiw Q1 f?gLS,1,S2,,.,5s2W.Www,:Sz.y,QinLEgf,gg39f:1i,W,s2m5s1i?wwg-:ZAW3225,s125eSAz5gfsx2E5:w,A,,sm,Lggmvci5,,5,,gf-fX,zsW,wem,,5,,gywA,5fgg5M1fswf w,e'w.mr,,13gEgg7g5n5S,Q?g aaa- wg X EH w1SQ w5g,W-,NL-5 ,-,B,,5sHA:FM?f2791f 7- gmwsiiw -,f 159' V -gwgwuwwwfk I -W bi?- S K Q A,,fw,:,U-1, 2 S g,f1,Wfwgmf Xfax-,iw155Qsi1gQ21Q2SSeQYA5QQAQQ2222xgsxgzkszgwwgfsggfqggfQ1lmfgw'wwwwsmwwnw-fwsirgcriiX 5212gmfvfwiwrfgesf-LSgwQ1?'g57LawsfszfwLa'2iwm?Sgw?e5g,f-ffzgffiyffwwg-eww K ' 2255838 siwfiffi-Q G m Qgiiilvggifgb' Emfwiwlki 92 7 AQQGYES sw-ffwefsfmaifik 1Sf3i3'?ff2v is ' S S 3 , 3 wwsmfegg S-mm,mf,Mw'25 ,,wvweffs,wemmfmmfwgwsgsl-fywawwgengfsrfsffwiwa-fswzigfzfzfmwisffaw-ffsfiesiwfsfggiwevfmaz,,gfwyifvgfgfwef,mvPai'kgs-Qgwfmasansfvfiflmgxiagsr lfwgigiszfiv xdizfivsia Mm?f?lM 'M gs 'ffixmevif' 'Bra QPYQQQQBAw5?S5f:2fA'XWe'Q"ff?ifv5PWBMW 4554 v ' 1' L iW,W,, , ,f,w5535M ,qw,5wg5wM55q5,,,1S,,W,W,Qg5s5,L,?g5gQ5,mQ,,,M5K,ww115gggwls35g,2311m155,ls,?,gg,,,Qgg3W1m,,g5,g5QQ,gy3ws,.iwgmwerw,aue1s,2QaH5155,A353,,LRSW,13,,,,Yg,,g:2fgQ2g4x,,,g,f,,,g,fI , MQAgui..is,Sw,Y Lb, VIigZmg.,g?35g,5IgQS,, .gas imiagkg 8,3 gmWWW538535,Lgg5WnWEi1wa5gQ5XSzQ: , N K saw S 21215 :wi-L2gfw:Lz's Swzfffisgffzzgfswv we J wsizzfwvhwgessfeaiw2fsf2z:ag:egf2g:Q1fezfzewmgfsiwfw2m4ff11Q?ZasHgwfgweif:2MM5E??QwS51Ww?5?iH222f1MyW5fQfff5ff1Q'iYeW??f5fiZ15155?Tiiisgfigkii'?vYSmM?5?E5f?i5f5Umfmfgggnigngff 55"'51Fg?5555?5QW 535Ff35i5E"i55WfM5?35ggg5EP'1 egg'2155558X3ASuggggigiigilsfqixyigggi'iggsffwsgigw ' " Q S 11m.swi-:ge ww! gggfmf: - Awq:Qf1ii,:f2g- smwgz S Qmm1weWswHg535iw15221QzXmw,gS1me,1w:fsgggqgmssgiwwffsfgagvgsfizxsinfwiwfwlfhe55551Wz2xfHSwex22gM?ii45ggsSewwLxsifmwiamaeeflsfwwg :Q-swsfgqyfg Aw?-Lszeffggisv fwwigwfgg-WSf5"75i'f'1SwS2 lbw? 35 5QY?Wf54?wWQzi?f5f5si33535?h225?5'5W5ff Wv?ff?W'A5?w2fW' HQXSYQSWQYHS 1 ' " La'- xfg-, ,A,,Qm,,m,A. .,gf4mmw qwwy 0, fqgsqsmziggqwLwW2,1fL,,eL5w1g,,gy35,w?1gg5N,52WMWeg,gm,2ZW,fwww-ggigwqgwfag,1gg3QEZ1,ggag,5AQmiHQsweQ21HL4g'LQfxLwsQfgg1?iQazi?:egg3gf91usfmggxsgfmsiksflfwf Rei? W WWSQW XQ-YAire?giK1EHQQ2af?WYHWG3kS5'Fufewf5?f??2wfgg2gS2QswSv'meif11??62Af?5Ef5skQHff 3Z6mZ'?Y'W 'f 3-4 wil wW,35g,w,L wgwiw SW Mmimw jsiixwmw 3 5?gM5WUswigMM5553ZimwA5gwQ,2155gw1,g,gggi?,wgfkwfsgzgygggzfgiiQQ35Y1geQsgw251ggigwXa1f2ggx:fssfswaiwgizga,E?efw?fsWf9H1fwi2Qri fgwkiygffgsg Ame2wiHakim,AnalmeaigmQ25?Lwe,Lg2s9w35gggxff ggim,1qgsfs,9gQg,gm ,X gwqgggvgewagggnsmegfwagggfgailafg new ' -- V ' if-Q Egan gy:g-:i5zFsz.W,1Q- wmzfqws, ,i5,w4MQ,f,, Llgggggwmfs S 2 Sgfggggwffi12,QgfeggsgfmzxsuwsaamfzAQ5523Qwezf1asQ1E55ff1QQ2as214w1fQfsaS:wQ3w1f12f?3?'ffM12??ZM2122if'Qf1Ss?2Ef2YAfGWSmHf2?572145252555KQiSkfW52'85f?HfHP?lQ11Q?H-fLf'Q'if-iii'-Effwfwwf'T5lfQW'5'f'f1fH9f'wifPi?555'W3SWESMSY'W5W'5?f9'S59'5fWW729553A515Y'S'f5?FUvW5ii?WfWfwWuff7'f9'ELw'5ESWL 'vi' A W, A, , .W W . lb,A,,UW.,,, iK,W,s,,,.., K m,,,,,,A55X:3H3,5g?3 ws, L2MQ,1,m,,Q,W.9Qf.gW,.,,gfW,A..Q,,Z,1MfwW4wm,mayffwwfgmxANN-mga, fWQmp51i,,2m5gfWfNagy ,x,vifEs1'-my A K, vffW,?w Mix, mugw mg, fe Y www WA 'mms mvfgigwsswliwwf mM21ggamgev mfwwxffm E, ag? an -.- ,1 'ef ,M M ,,,,,,5, M MV m,,3,Wm,MW,, mwk N, ww f mf -iw?-Q, .,,mAwsgsQm Awmgwsy,,m-Qfgxxwggw-hah!MM-fffwmiggsn , 15w???AwKfwF'wimu-iwsw2SMwHvlfdfvzigh awwMwgwwnnewm Mx- Q59 L., f , ' U 2 A L,q,M.v,,, Mm ,S .,,5g,f,,5,2,5ieg3sfa6. X,ww,M.fW1wgx,,fmSmg,,3ff,y1g1,w.5fi,m,?L5gfggqkQEy1 ,myAsig1SegQ-wgaanzQQ15?sr?3was223S1eeY332fgQmSalwfs?eHm??5S21HwaxyLeffismzsv iqmuaaw-Mm? mQgvmf,ss21sA,Lgg1 Afmfwwasfww 7-Kiss,-w,esg1fwH'wM'wg2eg2fM,ww?-wk wif-ww. -Q1 mv - ff - fa 2 2 S af X 3 L21-sim1Sf"1SWsSSSm.w1Q5Qf?fr1w2'i9'W9w1 ?eS?ff2:51ff7'fW't WWE? i5fiE5?Q3iZ'1??Yk?5'A5'3'Q 333- Qlfdvwfffz mis w?'L2aS?ALgf4u5.5Egm-Qg,Qsa21,e3ili1H ,ss?:4g4Sww,w? M252 , -:. H ?' S M , :fi 1 . ,,,A, M. W , ,.AA . 4 ,,Wm X Av . . -, ., ' Z,,y,5 mw ggwugg M M , 1. .. QQ Aw .,, - A . ,ws1,f,M7s.. -Q Q 553 -:ww---1.-T: Q vgiimf. 1 i, .1 q,,,f , QQW EAQ Q QQM ' fcfgg. A PY . 3217 :-..:sf:5,ff. X -.1 . ' W AA ,gawk - f. . - K it H - -, .5 b K , S ,.-G-, -,H 2 K , M S , -W -wgsszim-3'fivissf-Snfwseii ' - -1 fW'Mm1SQ,..M- f 'Q .mfg I., . . ! , .. ., fic..-5 ? Q5a , T Q, if r, 1 - 4-f 4 'Vi H':: '..': 51',.Z:'5::-:.:':.': ,H I W If ,Ei ,-3 .. 5 sg-15,4 A. 521541-f S iazg 11' : 1 as 52+ gigxzv y Tx, M ig .52 f'22Q5M E 5Q K fisizgzi 2 M ,Exim F5352 ni-:s,,.cE f 'agg -fi 3 7-'Q 3Ef,f11Q:i Q :Q Mfg? if iffhi, K 95 Qgigag Kat Lk 'L H25 5 giggg wgggggi - 1,13 Q: W N up xi ' :gl . if :swug SE giiliiggiii e fx M1535 323 5 E -fv 2, lgxgigiy - ,QM-ii. g figxg W -Q ' V Lim' '2?fvg A 53 5,554 25 "! 5A 5 . A -f is :sie iii ff ! l vfif gif giggiiii ig 22 ' gif .X 321325 22 ,3 if , , 5253? 52? 3' 5. 1 ' gig 3535 f E15 E ,,,nr.A- ,.,7 if gif? . EET WY XZIEQQ 12 "2 515, wz,if,w Mg, f, ,V ' 22 if 2 gp , 5 ' X A. 'Q g V I A 2 N ,,., 'K ,.i, . i , W ' f - 1:17, -I ,'.fz,31- R wx ,-:1j,,7gvy:ii3jig H, s ,.,. ,.. 25533 9581512 ,s fn- f W ff, fisusizifie WN. .. , ,,. ,wkmg 0 S S5 x H 5-,W ir 1' 4- Q , 4 -sa " w 'fix -w 24 Wi" K uv, .Q 1. ,, 3 S I H i YK! X , H: E fi E f S E ' my AIA... 'Q 4 ' K ' ,, . " .4 fl' L Q g wi' . , Q .3 . K H Ig ii , 33 . , 3 " f- 4' . ' AA-7 I " 'X M 7:-. 'TQ Q - 1 I 'Y':9"- V 7-2'5fii35 I-iAi1:1:ig:i1:iff2:i . "T f- pb A 1 Z2F5'Qf'5, ili H .V : Vg, fx 3M "V' ga' A ' W ' ' ,- Q. ,, uv . ff A-ff' ff Hgyg fy." 2 5 Z as 12 ' ' L , wg gg K M ' XX S - 'fa ' -A Q W? 5 H ,. i .. ,. 5W,g23s5QseQgQQE55QQ5Lsffsz223eSA:igfZw42ge3mga:12i5w3aAgbix1Sii5f11Q!fQii5i?Q:f1sxQKg?gSgfgLm,,wrQsf,gg,'5s1Qg5 AH 2 ' ' "" 1 -QwgwfmwfwegimwwLf:fwfsMzswS2SWM?LYJ AW 1 -- Am ,. - .. ,. my WMmimmsmgi:ww,Q5355gwgguigggzfigigggadm,Egf,35:1fsfm1aew?,5y?'sE32'ggmf1is?Q 2 , S Q " ge-12 .,,, mswlfwifeszgia'f3nyiiggazifgggfgggugzgefasggmssiissigawizgi'sgw?52sr2g,5Qifm?5f2H27Iii? 'W " g '- ff " S s' I .t L as ,w,3wmgQ?a. Qzwdmf ix ' . 8 ..X,5,Mw,fwwf,1,,m,Aw,i I,wigumgw,,5,b,,,L5,Y,.1 gAw,1w5f5ns7w?A.gm5 -E - - if l K .b 1 . , kykkyygggqgggifwi -eyfgguwgzf ifgigmggp. Wsngiig, T :sw 5? QQSM nswffmsu wwf iggfi? ffwfgiib? -: : ning gpg. r-"M: ,Mp I Q Z: 1' 1 yy '15, ,Q W 5 :f: E " ' lf .V 5Sf-mmwaskg-NwgWEgg?53:1Qr?P,ggqfm2EzQ5wEa:12X-geexeazegsgrgsaQ?'9aig2,91wQ9?4g2ifWviH:HQ?aAWm. 5 H . , . 1 -, , . 2 2 5 , - 5 5 " ' ' ' X S L Ms fgazeSmQLIW:5WaggpgW142595213,wyggw-gnfSLfxzsA21g?gS?2wmw::geiS2fMx2g5'2isff5A 1 Q 1 ' Eiwmgi Vfwges,mwgmwgggggw.pgggwiQfgigwgsiwmgiwQ1fffffgfwywiyfvs-ayfw f 5 1 5 S Egg E ,, . is 3 1 : 2xSfagis-2f21fw:4mz11fes1yQg51q-ggfxeagfmwwA,I55L1QWQ5,mgggykgayfssfazgaxswjgi'wx :x ,E ' WanSeww?Wy,myggsw555wgAfwessgsiiyfgiQ55agmnssgwnsgfligwgfiigsfggaAsaggegwbafw wx ? , ' W -,w,L,is1,.w,ggsfif,MwZgg,,,1f. Jw wx 1 A 7- W In A 9 1 X -V vga 5U--.bf5gsggfqgQ11Q2Zia1QsvSW53QeeQ22252Z1,K21SAailsQQQLQQQEKSQ-QQSQEEQQQQQWQQWQEQQ 4 ! EMQQSN.:,Wg 71an5ngfQ1g511M,gmfw:Qf2,5w:S1agsAh,,Kf5fL,lgMQwf ,wvgmiklngxsvm-M AS 5 ws1.2zfwsy:w,,, AmmwMs,Aw1WwLf,,f5spMw?Y5wQgQz7'lmg.w, mg'-a7.W,gfge. W-515 Q ,Q - . -fmguwfwf--+s,,M ,fQlwsusew-.wfm-Wfglmvwlwxawafffwxwvfvi,wikiefmw SH fbi Y ' 7 - s - ' efwwww,-m..X , M.wnxfwziwilwfmewwgzfwzsw1m1gfg,:f qw ilagvsrmfvwdimamiw 2357 - i . x 1 sseL4w,.ww:gszsf 91 Mg,53,1,50f5,,Mfg5g5:3,Lg,1G5gq1mwggwfyAgg,fXag54ef3m:?QHfSSh, Huw fm?gggwQv1 H i.-HSL 121. 15 2 - 1 , 2.g,m,9mMbZf 11,wsmg,,x15m,L,,wxw,L,,Wim-QVLQSHHHASMQ fm -:E V is E I g - - - W-aww S S .,k,,,,-Mm 12.2,-My ,Hmm-K A2 ,L fmkmww ,wwm,s1g 390527 H- ,Z , ,N , 'svgeiskfisazmz X giffwiw 7 f 31 5 7 fl! 1 1 , 5 4 . is 3 fs ff 5 3:25, f. 5,5 K , Q ' r 3 W z " - qMf,,,wL ..,,. Le,.f,Mm ,,,AfX,fm,2,,m,,F,m5,m,1e-93. ,gg 5591 geek? Q, ..,, ,51'?3p'..2 , .. ..., 5 V- ,.. L., .2 n..,...-43 n i 5 w 5 r K 1 2 Q1-wwxrzsim by 7511wfM.wM,wW-rzmwfww,5lawwwwhaf-Q'f2Z1Sf-S'P5Xw?i22sw'af"imw - V " E H -A s S 1 - ' A.,.MfS,,,:,,2 ff,.Ms,,W, ,i,, SWQ,,,,m,wMmms,mWgmwS,,,,, W, U .. , ,R , sf 5 Q 9 L ,,.. M, .... S 2 L.M,,Mw msfwfwssw mwyiammgnf AWK MER - v-- -- .. . r 1 : 2 M, K 1 v X f.wm,f M ,wwfff,m,XgWZ I5Q5,1QsnQ.51,sqsWmwwmzgiyiiaeggbiiygygkfiiffkiAn my 3i 3 . , E- . effzgsw S Qggesggfmmwzy ,gg2,gf5f,, my mf .S . 5 5 Q ' if 1, L3 K 5. .2 3 3 . 4255? lmgggssgfm sggwaimabgw-'gymQ1555534Q2415?Egg91,5m1Qqiggggg'W1wHgzgeii w3s?515,3:ggBgggeQ5S'291gwYf,gi zi. fw. ::.,: :.':..'::": 5QkQf5 -::,:,,:":.nsgaf'Wg::'fa: 2: - x 553 .ft v : iii! 4 E5 - f MM 2,,m,m:zQs ffw,:fMf2fQsu,wywmiwv-Mewwise4e?efiQ:QaiwmazfwsL. :vw .Q 3 Sk 5 5 1 fs 5 S 2 E i f mem, A.,, fwefigrzs X Y -: V if: 5 3 g W 5:3 SE 5 f5,Wi,.f,,A..2,,, S 2 wfwfwffmx Qwwwww-wweg1sAW,w7LwwwiimfW-www. avg YQ M - -. .. 5 - 5 fi 2 5 vw Q W, 5,.L2,A.W.5z, Q, S W-M' .M,,,s, .mgaAwww,g17wgmAw..,,gfwfwssww ms M.-ff M -a,,1-::df...:-- . S 'Q ff' 5 5 MM 1,Q1,,wmfwf W., ,mssw-wmawzkmgevyfwvwmgx-,-fw-same W , ff g: f 22 img L N www bf fwffgmwyw ,,.MU5,fwMgzX5W,.,,mg, AH,AMWgiW2f,4ef1Q,1Qfw,,w Wim, egwwzggnm Me, ff 2 - 1 7115 5 5 3 . fqfgw AgL,w1fw,,,wfqgzsiiseefwfwms-fn mesif,2mz1Lggg25vQSig1M,A A SKB .. "Sf 5 2 -.1 ig Y .. .. T H - ' s w if if kj! if is 5 W 2 F sf12222msms2Hm:vff2z:1w3ziss2asw2LimsswfasfmwwzzaemffsfiizeznQX?2fiw1sfi5m1w,Q6?a9?"Fis1??Wsqv5g" A B gg Lgfikziz 4 , 28 1 5 E 2 , 4 wLQKQs1isvgH14fM522e:2iswQfw4f:ff2i1fMwf:gaimwlffgqsffeeiswsigzyLBi1fiQf'z1ss21fanas,gu2,a2 S 5 K sis gg: i : Ls Q f 5 ' f ,Ei W 7 , f ff as 1 I ' H . .. S E 5 ' ' ,5 wwwwwf2fmZ5m1wf2Mmm,QzMf2,xHmgawsfgwwfwgmy45w,,55fm1a8Sf,Q,Q1M3 my Y ,, . ,-,- 2 . z i X w 7- wmexfm V,fs,f5, ,li H vmsmwi Qmgmwgqngz K ms my N' , mfg ! , f -- :w42.amw+w-14f5fif4a:"'21-f:we 2 fc-:l!"'-w' 5 S km' ix ' : 1 9 A- ,Z gf 1 3 5 -1 , if 1 A 33 ' g X .. f. I-wszmmiW.efw:5m,,zfmmfMy Qsvgqggvkgalgx 1,3 A s 1 . , M , f f : : 22waMasQ-frQ121WsaM1Qaliufgiaarfwgwgimgiss ' pf if 7 A N -E 1 ,55 -NES V, F . 1 S - 5 2 s E fi 3 L EE, 'Sip L a 2 - E, Q- Qwiswwzxmlsisyfwxriafigffwnwfggszfsmgzlymg,,psy w , ,fffmf Q- 15 g X Q ,., z Q A2 f - , gl A , QM up.: ' gy Q ' wg: :zz 5 X - E 2 1 1 LawavWszgfgfQggw3E5gMyim5,A :ga x, H ' S fs 1 . - 'E E . fe, , , zz H S w - f 'L 3 ' f -- ' 1 l , 2 3 215. ,, H 1 Bobby Dornblaser and Julie Whittle diagram a sentence in English. English As We Communicate So We Understand The language of a cultured world and the world of a cultured language are thor- oughly studied and explored within the realms of the English classes here on Wildcat Hill. Every phase of the English language, from the most elementary mechanics to the greatest masterpieces are presented to the classes to be understood and learned. The students are led down the stairway of study through the doorways of composition, sen- tence construction, book reporting, poetry, and novels, and each example given is the very finest in its field. By practicing these fundamentals that they have learned--diagramming sentences, writing, and analysis--students in the English classes are able to fully realize the power and importance of intelligent communication. Johnny Butler, Don Bunch, Laurie Tompkins, and Alice Stewart proudly display their projects for Mrs. Perry during the study of "Julius Caesar." Q Social Studies Prepare the Citizens of Tomorrow lt has often been said that the most im- portant thing in life is understanding it and the people who participate in it. To take the past and use it to mold our present and future is the goal of the social studies department. Thus social studies should be thought of more as a guide to compatibility with our fellow man rather than a boring study of past ages. Striving toward this goal are the courses in American and World History, World Geography, American Government and Eco- nomics, and Human Relations. Human Relations is truly an excellent name for this course, for what is more im- portant than learning to live with our con- temporaries. This is accomplished through the use of good study habits, driving, the effects of alcohol and the study of various vocations. Eugene Anderson and Philip Reid practice good behavior in making an acquaintance, rx "Sing Along with Larry." Larry Woolridge leads Kay Graham Brenda Johnson, Joe Cook, Tommy Malone, Judy Rhodes and Brenda Cummins in a "Song of the Presidents" in American History. History courses enable students to not only look into the events of civilization as far back as the records permit, but also to realize the history they read in today's headlines. One of life's greatest advantages is learning and profiting from the mistakes of others. World Geography enables a student to become familiar with the climate and terrain of the other countries of our globe. Last but perhaps more important is the intensive study of our government and the economic Way of life that of necessity accompanies. Thus we learn that a knowledge of our world and ourselves is to be gained by taking advantage of the opportunities offered by these social studies courses. Candy Fields and Lloyd Watson display the bulletin board in American History, 'Nw Johnny Butler explains a geometry problem to Alice Stewart. 4 "You may know about basketball, David, but I know about equations." explains Sally Chandler to David Teegarden. Mathematics These Subjects Call For Brain Power Mathematics is defined as, "the science of quantity and number and of operations involving them." Today mathematics is much broader than just dealing with numbers and their relations to each other. A math student must deal with unknowns, radicals, logarithms, hyperbolas, ellipses, sines, co-sines, and inverse variations. Almost any occupation in the modern world requires a great understanding of math and its related courses. Some phases of employment require only a minimum knowledge of math but most of the newly-createdjobs and opportunities expect plane or solid geometry, algebra, ad- vanced math, trigonometry, and the other higher math courses offered. Scientists, engineers, architects, aswell as businessmen of tomorrow get their beginning in the field of math offered to them in high school. It is here that they begin with the basic addition, subtraction, multiplication, and division, and advance from there to the more difficult and complicated phases of the "New Math." Mathematics is being emphasized more and more in the world today and is becoming a prerequisite for any and all vocations. Bob Moncrief, Charlie Heitt, and Gary Yeilding perform at the blackboard. Science Trains Wildcats for the Challenges to Come Intelligent, curious, or just plain bug happy are only a few of the adjectives that could be applied to the happenings in the varied departments of science. Intelligent is the only word to explain the utmost in science, physics. S2lf2gt2 is the secret password into the world of physics. Physics prepares the high school students to the highest degree of science. Curiosity is encouraged in chemistry. The exploration of elements and matter aids in the comprehension of ideas that were once only words in the textbooks. Bug happy is the only word for the dis- secting, chopping biology student. Biology is the introduction into science for many North Little Rock students. All these science courses join together to make the NLRHS student a well-rounded science graduate prepared for the vast field of careers that lie in the future. No, these aren't skin divers-- -they're chemistry students trying out the new lab goggles. This must be it---it's the only thing we've found that looks like the picture in the book, Bob Vint and Don Trickey dissect a frog in biology. This is making me dizzy---Physics students Fred Smith and Patsy Kyle measure the number of times a pendulum swings back and forth in a minute. 19 "Just read the book and you'll know what he's saying, Leon." instructs Mrs. Marcia Lawrence to one of her French students, Leon Kumpe. Languages Help Us Communicate With the World Since the beginning of time the most popular method of communication has been that of language. It began as a simple form of expressing oneself and has developed into an intricate system of vowels and consonants. N. L. R. H. S. offers to its studentsa Varied curriculum in the language arts: two years of Latin, two of French, and a new three year Spanish program. At the completion of each course, the student has acquired a sizable vocabulary, a knowledge of the customs and traditions of the country, and an idea of the functual linguistics as well as speaking ability. Each language offers to its students a new and exciting experience introducing to each a wide new world. "Can I help it if it's all Latin to me"? asks Maurice Graham as Rodger Sanders tries to teach him to analyze sentences. Song leaders Sandra Firestone and Linda Landers lead the class in some Spanish songs. :..as.f.-11 --f,-,, f .- W. Journalism Recordsthe Heartbeatof NLRHS Journalism--that glamorous society of hustle and bustle and dashing deadlines finds its apex on Wildcat Hill. Though it may seem to be a bowry of bedlam to the outsider, the busy three-room journalism department that crowns the high school's golden tower is the zenith of orderly pandemonium. From its busy interior issue forth the "Hi Comet," the "Wildcat," and dozens of eager students who have found a goal in life because of their experiences there. The entire publications staff is dedicated to recording the life and happenings of the school and its students. The prime goal is accuracy in reflecting the personality of North Little Rock, and upholding the reputation that it deserves. The work of the journalism students encompasses every- thing from typing stories and running errands, to writing copy and selling ads. The thrill of accomplishment and the chill of excitement that soar through the soul when a scoop story is finally handed in is only one of the many rewards that are found in the field of journalism. Hi-Comet editors Jim Lynch and Jane Ann Munnerlyn prepare a story for the paper. L Mr. Bob McCord explains the headline chart to Cathy Phillips, Write...rewrite .... " Marsha Sessoms and Terry Joe Byrd Gloria Jenkins, .lane Ann Munnerlyn, Richard Baldwin, and supply body copy for the Wildcat. Jim Lynch. H411- "We don't care if you are the sports editor, Richard, you can't use any more pictures of yourself!!" exclaim annual editors Phil Esch and Susie Gough. 21 Sandy Turner and Brenda McRaven make use of the various machines found in Business Practice class. Sandy Russell pecks away to gain the number of lines re- quired for the day. Commercial Department Builds the Business World The commercial department of Wild- cat Hill is widely praised by the business- men to be one of the finest in the state. Some of the students trained in this department won several high-ratings at the State Future Business Leaders annual convention this year. The future stenographers, account- ants, and secretaries realize the worth of this department as the business subjects take their place among the most sought- after courses offered. Many trained in these commercial subjects do not have to attend a business school to receive supplementary training to get a well- paying job. This department is constantly kept up to date by the installing of new electric typewriters, and the latest and most efficient teaching methods and procedures of bookkeeping. Although "automation" is taking many jobs, there will always be a great demand for well-trained, efficient business per- sonnel--like those who are graduated from NLRHS. Mrs. Crymes helps Pat Therion adiust her machine Homemakin Tomorrow's Homemakers Learn How Today A fashion designer's dream? "Maybe," could be the answer. Out of North Little Roek's homemaking department come future seamstresses and cooks. With the addition of new machines and dinette sets, the homemaking department has kept pace with the changing times. Along with cooking and sewing a related unit of child care, home decorating, home nursing, and home entertainment is taught. Approximately 80 girls elected to take second year home economics. Around l95 girls are enrolled in first year home ec. Each home ec. student is required to complete four minor or three major home projects during the year. The student chooses the project from different fields of home- making and does the work at home. The girls learn much by experience. Seams are taken out and redone until they are perfect--or nearly so. Pies and rolls are made at home, reports are written and signed by parents. Each girl learns to distinguish com- plementary colors and to arrange rooms to best utilize space and furnishings. A course in home economics at NLRHS teaches a girl the skills needed to be a competent homemaker. Pat Daniels, Becky Gentry, and Judy Jackson decorate the home ec. living room for Christmas ---putt of the lesson on home decorating. A ,Q , E111 r l'o stir a fine stew and sew a fine seam are what homemaking students like Betty Gail Wood and Linda Duncan learn. The feeding and care of infants becomes an interesting pro ject in the lesson on child care---Lynn l-larvell plays the baby, Natalie Mirontschuk and Sandra Grizzle her concerne parents. ' 1 w WAS .ul QM im - f fam -ul,l it , A 761 GQ! iss, ,sag t . L ,HW ,. ' lv- 9 hzxnt- Q , 003, ls. at f QLLZLS' ? ,i , , 3 A 1 , ,Q - -, ' V ' , 'L . 6 L1 'T ',g:g.f:. , - fs: if 5 ' ' ' Q J N1 A ey 1. ' wa? gl ' .3 T. ,,,,,,,,z5 ' .' 1 ' ev ,,, . 'D 4 ' 7 .. ., ,ff fiiwsfflffllffn 'ff 51 at l .. X ' V 2-IW 145512 ,:-3851-EE-"f:5i',:,' .5 Ytfwl ?,L7,fH'fz9f'W3. 1 tu: .1 k.,, ., Y , qs-at vf v,,-mem Q. A - , A L-,L ,L ,. , kr V ,A . ,, 3 'yggtlga , it - ' , ,. t .. .... is i Gene Sylvester and James Salkeld display the radio they built from various parts they collected, Kenneth Robbinett demonstrates his skills on the Q lathe. 24 Vocations Are the Aims of these Boys The tradesmen of tomorrow are being trained in their various fields in our own NLRHS vocational department. As each day goes by our country becomes more mech- anized. The need for skilled tradesmen is being met by our vocational department. The basic rules of mechanics, elec- tronics, machine shop, and industrial arts are taught by the instructors. During the spring members of the classes compete for honors in the Future Tradesmen of Arkansas' convention. In auto mechanics junior and senior boys repair and overhaul cars belonging to students, teachers, and outsiders. The draftsmen being trained in our mechanical drawing department will someday be among the architect and engineers of our changing world. ln the mechanical drawing department ideas are placed on paper for the workmen. Each blue print must be perfect. The electronics department trains the boys in radio and related repair work. Each student knows the fundamentals of elec- tricity when he completes the course. lnto the hands of these young people will fall the responsibility for the mechanics, electrical engineering, and crafts of tomor- row. 1 Larry Rice tunes the carburetor of a '57 Ford in Auto Mechanics. Physical Education Builds for Physical Fitness Building both the bodies and morals of the students of NLRHS are the physical education classes. Never a dull moment in the classes from the roll call to that satisfying shower. Boys' phys. ed. begins with 15 minutes of exercises which is followed by such endur- ance-testing games as dodge ball and rough ball. Also included on an average week's agenda are wrestling, boxing, track running, and peeking through cracks in the partition. Girls' P. E. includes folk dancing, soft- ball games, volleyball, ping-pong games , shuffleboard, and basketball. ln an average week these young misses dance the Teton Mountain Stomp, Put Your Little Foot, and Kora Buska. They will play dodge ball, will jump on the trampolin, and will do various acrobatics. These physical education classes help to develop youth in such a way as to help him cope with his fellow man through group partic- ipation. And then of course there is its benefit physically. . . Not flying lessons .... windmills are displayed by these members of Girls' P.E. Everyone scrambles for the ball as the Boys' Physical Education class plays bombardment. ,...,,.,,,-,,i,,.Mt-.is WW.W....,,,V.,W,,,M.w,,...,s,n,s,.w1.....s..,tW-.s. "Tap, will you please hurry, we're going to be latel!" exclaim Mrs. Jim Grimmett and her speech students as they prepare to leave for the State Speech Festival. "This darn old pen never works right!" moans Jan Winn as she and Robert McBride prepare their debate against their opponents Dana Smith and Steve Riggs. Speech Offers an Excellent Course of Release ln any environment, culture and art are two necessities for a well-rounded life. They are that extra glow in the dim shadows of dreariness, a bittersweet taste in a fascinating brew of actors, debaters, and speakers. The North Side Story cannot be complete without mentioning its speech arts. There are many facets to North Little Rock I-ligh's speech department. Each serves as an outlet to the students who are inclined for this particular stage of learning for future use. lt serves as an excellent course of release. Debate emphasizes the art of thinking on one's feet, an important factor for future lawyers, perhaps, who will no doubt have an excellent beginning here. Speech ll QDramatics5 is concerned with reading and analyzing plays in one specific area. The dramatics department also takes charge of promoting their widely anticipated production ---- the senior play. For first year students, Speech l is a blessing for those who enjoy speaking, listen- ing, learning, and getting just a small taste of debate for next year. Speech is a fundamental stepping stone in society. lt need not be an obstacle. The honors speech art students have won speak for themselves in city and state tournaments. The goals are merely to speak clearly, decisively, and correctly, issuing self control and ease. Just ask any speech student who has achieved them to explain. "Sharon, please, l'd rather do it for youl" pleads Jane Ann Munnerlyn a s she applies make-up to Sharon Beall. "Mrs, Grimmett, what do l do if it won't come off?" asks Jan Winn removing make-up. 4 . Art Artists Acquire Cultural Adeptness Young artists are helped to gain a firm footing in the mastery of the fine visual arts in NLRHS's art classes. Projects cover the extremities of the Wide field of art from com- mercial lettering to watercolor painting to oil painting. Students are introduced to the primary methods of HIE in the first classes and discover Where their particular talents lie. They join in with others in small group projects that will help them in larger projects that con- front them as second year art students. Second year art students must still finish certain required assignments during the year, but they have a free hand in the selection of their projects. Art students are beneficial to the school also. They are responsible for the Wildcat heads that the Football players run through during each home game as Well as decorations for the holidays, the backdrop for the Musical Varieties Show, and numerous other small extentions of talent. Each student tries his talent here and strives for improvementsg there are no bound- aries to the heights he may climb, but he has to start somewhere, and maybe it is here. Freddie Link touches up another of her art pieces Art students study the methods of leather craft. -fdrdgki Qatar lv- Anwar" N , iflfiarr E 2 7 , I 63-64 Senior Choir Officers are Harold Roberts, Casondra Lankford, Barbara Esch, Tim Ashberry, Patty Brown, Steve Loibner, Linda Yeager, .linger Jackson, Terry Mercing, and Pat Smith. Mr. White gives the Sophomores a good beginning so they can eno up with a masterful performance like the Senior Choir on the Christmas Assembly. Choral Music Charms the Eye And Ear Through the years people have ex- pressed themselves in various media. One of the most soothing and exotic methods is through the voice. From the vocal chords come tunes of love, sorrow, happiness and fame. N.L.R.H.S. Choral Department is a highly organized group of vocalists. From the Sophomore year till the Senior year some type of vocal training is available. Be it Sophomore Glee Club, Jr. Girls' Chorus, Boys' Chorus, or Senior Choir. This Department participates in various programs thru-out the year. The high- lights begin as the Christmas Season buds forth and Continues thru the winter. The spring brings the widely popular variety show and the various song festivals thur-out the state. A participant in this musical program br ings to each student a better understand- ing of the fundamentals of music as well as a new and exciting culture media of singing for knowledge and fun. Wildcat Band IS Qne of nation, has been the leader of the Wildcat Band since 1949. Last summer the band placed fifth in the International com- The Nationfs petition sponsored by the Lions Club. The Wildcat Band is divided into three sections, the Marching T T Band, the Concert Band, and the Varsity Band, which is com- op en posed of those students who are not in the Concert Band. For twelve Weeks, the Wildcat Marching Band is a colorful spectacle at football games. But with the close of football season, the Band gets down to serious business and the Concert Band, composed of the marching band begins to prepare for its two annual concerts, and its varied program throughout the year. Mr. R. J. Brandon, one of the top ten directors in the Band Captain Fred Hanchey receives a 55100 ternational, for placing fifth in a national marching check from BobCheyne, representing Lions ln- band contest at Miami, Florida. The Woodwin Quintet performs at the annual band concert. The band prepares to make another journey to uphold the honor of Wildcat Hill. '31 will "dv 'Y s fyfetfgy' .i...wff"""' 1 Tommy Bush starts the techniques of parallel parking here ..... The year of 1963-1964 represented a year of swift changes and improvements on Wildcat Hill. One of the most important of these is the field involving the instruction of driving techniques and the teachings of valuable laws and lessons to be learned. All in one year, this particular course has become a necessary asset to the schedule of North Little Rock High. Pulling out of the parking space ,is just as difficult as parking the car. Brady Gadberry parks the car under the directions of the careful and experienced Coach Henry Hawk. 30 Y . I 4 ' 2 l ' a Driver's Education Develops Careful Motorists Driver's Education is similar to the library on wheelsg it caters to those who lack knowledge of its subject and have not had the chance to take advantage of its usefulness. As has been evident by the increasing number of accidents, careful driving is the ONLY way to stay alive on wheels or,to be more specific, avoid that wreck that will mean to forget the dates for a long time. Coach Henry Hawk, brave chauffeur of the course, is the teacher. His students know that one mistake made on the road might be their last mistake. ...and finishes here with the car resting in its parking space -iii f all HN l iff ' t ,,. ,.,.. f A . . t . Q J .X .... ,V - , -..."'. . - .- J .,' ,-.4 ,.- .J 4 . , . 1' an r-4 K , ' I. 1'-. fx, .'-- , ri, 'F'-,, if ,Q-1, fa- L- - f -'-' ,f X. L' ,sw .f ,., -.. -'-. . --.V FL- v- ' .. 4' 1.-1 .-' Af, ,,. - -, A.- .-- ' -rf'-f 'J " rs' f- -. --5 ? F , , Ar, ad ij 'ff' rv' .151 '-' .-4 . - V '- " .A -1 ,Q .-N A-'Q'-. .".r"-:- .Q ..-' F - ..-' . - .-'- , fx . L- A, ..- . -A 4" , 3 ' VF- .'ef.L4-H' L . Mr, . Q5 I , 2 ra, if? 'IL ho' ' V' .1 -.Q ,J-.j,:s.j, .lyzfm ,,,f . ,,.-sf 'v 1 .po- .11 77 :B EN .1 m1E'3,.'BgA-. fm .1 Rum .. 7 --1-V--W.. B1 ..V 1- Vw.-V11 W 32 . X .1 XX ,W X , .,,,,,,V. 1 .M .M VAN - w .,, -,, ---. W- 1-M-v,M.VV-.,..,..1,. .,.1. 1 1,, ,. . 1 1. 1. 51-fr-i55fi12sS3g1Qif5Q?-e22:I31?-fa?F5giI2f2SQQ15zi.?Qii?,qff55x?+l-Szesiw -"' - -If .fi-.1:---123-.iii--'3fV.1'.Sggawgse-f..f5.1f3-2.111-gg1fsasf1V.. -.21-V,g- -V 1- A-" . 'f ,,-..z.-p.gg5g-312-.gi.-qgg-55-5-,1111,-2, -. 212Q-f-522.9-Pa1Vff--Q-2312-2223-sVzz--Izi..wrd-2525524-iii--iSffS2eFQ-sig-.s..'2-W- --mfSis-11.122-V--2-V--21.21.2112-21--21,li-ye-t'.L.... " '-11':---faz2ef-zi-12fiii-2-.iff.---2-L13-- -555,591.41-V5-Qmirgxg-QXgg.wgg,-QVwas-af-s1215-.5252-fgF.-2.25-.2gg,?gjb. X.-V. X5-7 715- -8-.,,f3QV1,g-iasafayvf-2221zgiwwqggas-gplwmaigi-23.1-2tQmQz21Xq-1-,SWG 1552.26-kdefgfii.-52-,.ffazZ42'.--'Vv'-212-wr.-',i.. wi-.3111.-1-----ii-'--fs--iwLi--1.12-2.11-VfQ-V11-1---SL1--1-152----w-1 111- 11---"Eif11sSZiI---231-1---if? .. -1,'.l1Y---flew-2Vi:9-2'- 52 1.5" -.55-Sw295-i:.zf,gffmz-A5:15-we25-8221155552221:524121f?.S:gi'i-5.5.Eh-avifwgfif-S..:i51z1?zaQf?-affzzzg:,gf2.'f-V'-iff--14 V21-est-.P1--V1-G21S-T1-12?E5z42fe1-vga-Hin-ii----il-wg---5-a--.Q-2-1-if., -'.f.Hi1.?mZa11-iii-4-E2fQ:z.1fi--1 -2-2.125--ffzffsliiiifizs-ii? 51--Qva-eff1..112.1-ffgggi.-me-33sQ.:V1zs-SSgX.ig.gieVizf3.i-gK11SX5.:1mf-1.3.5135 .3 E---.mga 152-1ff-15222gg,3gawg-m:5Xgzz.WXgf'f.if5..s21-1.1Aat.Q-1i.EQ212?2.-V-2L5125S:mggre?QS3ii52ifEVHwz2,.e:z,,fegf.-Vwf-1.1'vm' 2-ie.-,V---fb -11.VV-1-1-+V.-wi--2-.1-av1-Q211-S42.2-Sfiziff-2-5.fg-N21.,milf...., H..-2211.--saw.HE-1-sig.....eel 2 Q11:1--.1giwgf--2-ai.-WB mv-a-22-44.-was-V1..gyz.V.--QF..-5-uegg-isa Vg mms? 1-11-My-L-1 wi.-511-12315A-1zwgimfe-ia22222-'2:5ag!fQgigf?.aE2i1-3'-Q-Rwfiefzm-51-1-Lis-1--17.i2..-'1f- 1- 9'.1V,f--1'.2-1--if11--i-1,-2:.w2.f-t??ws----'----.Qz'.i11as'V1V-1 I4 -VF11-.--ff---asf.-fn-4-,--11xslt- '. 7 22-22.2.--'Vw--fwfviaieaw Wa...VSV...-,L-.aww-.,gX.Q,.Q,.3.9X.mXXXQ.X.Q.551-XLS...QXEZXQ-5-,.X,XQ.-- HE..Q-iisgggggggmag-5..g1...5,..r1g.-,.5Xq.,.V.ggg--...3az1..-11,iz.---assi5.QQ:M-in-f--2-9S3'ifW-5-1342.1-1-1 Q-2-2:---1---1 ---2 VV 'aim,,V11ef--wg...-.1..-Vg-sv1-f-V-if.1,.1zi'.Qmf- 'V.-fs.11Qzf.f:.gsx-111-2 Lui..-ff'--azi.--i-Sa---IQQ 55.-5wig.:-.-Vpfj...--1..-.1g-.5-WX..-V-.i.v1-2Q1V.i,X-S.-X.Xg. ,XS-g.. .451 -.LiQgg,5e,L. X--53.9515gm-1:23.w'WL4.-52.11,...mugfV-tw:QY1f-2-?g:V-isW-.1312-5-.?.Q-ESQQW1531.235gym-1z.12-.4-w-WV-if - ..5'f2i-2,-2.1:1Vfe1Lse.1--1.1fi2Viz-sesfz1aw1-1-- -Y .1 l1--'f1.1.V- 134- 1'V--ff-'W-:W--u' -ww H f--,faef--5-QF-11555151 'iffig",-:ai!S:,eV-fits-fafVm:L.:siW-r.sw-Zum--qgz:z?iQffg-ff-.zfs'f.ei?54azsesfiQw:1-2-11+-'sz-A ' .- 1'-fi.--'sw -- " - f-.1..--,...Q--as-1.....V.M1..:?:f1.Wm.-.z...V.-gf.,-1.-...4?V.-31.1.-.VV..-1--.w...-V..V.1-.V...---.--Vg.11----ei-1..-V--1.12.-WY1.-1V-8--W.HV-.-..- ,-,.. .-.-1.1--w V..-----.VV-.Ve ,..f--,-,. ---,V-1:-. . ,...X.-.5.5VV.,...V.1.-V...-.....1-,,g.-WX, . V. Q. - 1 . .,..-.,.1X,-..X.,. g,.1,1f ,.-,.,V.1e1.--VV1,----.V1--f:-1---V -e.--V.: -V--zz.: '- 1, .. .. , X . - v .. - 1- 1.-111-V.-...aa-V1 ,- --. -. -Q -.W .--A2-sw -.Qg1.V-1eV---:---,.--.-11-21.----V-:.1...--1.-.,V.-.wwg..-VV.5--.--1,V.1-11.1w.Q.V:.1-.....,,-- .-.V ,-,. . , . . .- V .. .-11.5.-f.,Q5f11-...-.w1.11..z.e1...g.1.?X,.w...1..-XVf.1-...1..w.-..-XgQ-.e1--1i4-e.....V-1sf.:1,..--a.--.-.1.,- -.V.-1.1-1 ,,-ff.,-V.-,-zz-V. 1-. -1-X -XV --.--1.1--1 1525111-.5325--1.29-1-.g--V11.-1.-V-..1.-mggg1..13l2....wf--Q11-1,5-my - -X--2351. .5315-.4331-W---..-,-Q1-W,-X5-Vf...QV-...y-.Vq.1ww.M1112-Vs?1-1-11.X-G-Vw..-...1-V1,..-1---V-.-.1. -1.1.V.:--.-.:VV-.Vw-1--1.,..,-.. -- Vw-1 -.--.1-W 1 -wf - -13513.53-XM-1. ,,V--ggig...ff-a...:.g.p1,-1g2m.1fggf..134-.HQ1--3.Q-Q-Vg.-V-1.-351-.vf..-gmg.?2?.,1kg-,1.-Q....-. ,.. ...V1.21.51-.wan-.VX1,z..:-.-:,...1:.... X. V,.:.X.1X.1-2V-..,-. -an '.bf-WV-if:-6f1z.w1v?gss-241-245-ve?-1zi5.5.5H-Sigv-2'wiki? 1.191 . .'-Y5a--wfg.sf--s?--fe.n1w-www-31-eueVVr11SEi'Sw-1--H235-vi .f',1z.V:-'V--1 .-V--':.f:-mf-f-11.1,zzg.1..-za?..:sai'.f.-' .,1--.f.l- , .1----zz:-f-zz-2.--1---ei.-1-i, .. 1',f.Q-V11-22: -nf Xffig.-2-.1mam,-ffi-1.2imW1-ef-11:.1.VasV...-f.V-f -u.wg.g we X 1- sG?f..E.Q2V....3ff'f.Vik-,wx1551.354-V-Q.:Q-www1525-Vf:1.wt5srwzgiyWW-Q-11sV1'..-V111--f.f.f1af1-ik-:Q-eff- -'f.se2:5f1a7..2-Mi-iiwv---sa---1:5V:.1-.6 1- V11-11 1-.1 -:QPl-:----Q2---bw-sez--:-.aeem ..--311.-er - -1si9iffff-V.--.w fwfmmvvl,--V-iww'1w1g1iw3r1!fVY-sv S - - -1558 - 715 1 S 1,1329-1-. VYmfVYf??1sm.4s:'HSQWK-2-11?.+w'--Q 1-651-g1SV1Kfw?Fm?HwV M131-W-S--7-W--.----sf-'---1221--ig-1.11--1-.1,-V1 ..f. V1m.-ff.-.1-sev1--VV--,w--5.1.-:V.1.f--1.. .1.1f'1---, -VV.,-H--. -1...-..,-1.1f-VV.,-V...,V.1 ,-...-V-.--1-fu..-V X,. 4. . .V-XM.,-1.X...X,,,,....,,XX..X.,UX-W... .- --.,-sa.. . ., - ,W . ,..,.-iX...,,....f. ,..,.,,,,M.....X.1,...-..,,yy-...,X,..5-X,,..mV.g....--,...1V,4-Q.-V.1-..,-V..,,............,, . ,..1..,f--z....V.1-V...M--...,,f.1..... .,,.,... ., .--,V,..-.W -eFQ?.gg?5-12ai?-AQ.exifwtz.5:Vgw2:gggrg'f-3225. ff 1.1. 1 Jgw igif- auasQWQY5-Vgg113Wfggfsgf-2353-1-51--Kggg1g,255-...-vga-ekHwpfiiixwefggf-5-211-1.11-Q'gV.-fig.--221:-.f.: .zgef-f.V-..,-1'-f.i.1r.,A111-me,.:eV2.---aw-sf1?2..,1m.5--21.51,f.1-Q1.,Q-..,,.. ,-.ww-11.-iiiV1waz..-11-.atf-s, 5 :-V.1eVy21g-212--,?E 'f H .. . Y-Lf 'fm--2-me--L.-'V 'ff- Kf -2-552352 , V, ..zg2,2zfvL3ew-ali: - f' 2:wF.w'1fg1-3.:gsf.'e -- , gr -.1-2212.-111.112-V,g..1zsi221-7f5?55,. 1-ffff..--Via-Wm...-1.15-1gz:.VV.ufV.415-V.sgmz-.Vg,-.,X.,.Q1.f.g-.-..X..-VX.V1.4VV..Q.5.3-X1.Qff1:1-2-z1ze,e-..gz.V.m...g...-e.Q-V.--VV-V.1.gV.,1,s.V-.1,,, , . --V ,, . -'2.1:z.fV-21.11-QVf1?V WV-13 Vie- YW ? 1,5 .asf,Q4.gwwV1bfpuaQ.,5ig -, X - QW-x 1g55gg1..-g3g53.1-113.5-Xg11rg..sV..mga mf..-Q--Vg..V2,.5,-Lggzwgssega.Lg--QQ1,-ts3.5:qVV.:v1,..ig-gif-,WS:w1f.---XX,-ufVw 1--L1-1 ,. ,-1.1171gr15-1--V2222?1.3.g-.5321-.ww1-.lain-,: i, fu..-z. '-fgfzif,-212.521- -Nia?-'21 - Xi- - . ...S 1- -11-2-2-.sm-www---..fg,45 32132. - .ii-V-...U-fi-1:eV1as--239215--.4-:V-11.-ag...--mg1..z1.-Q-..-M1221-9-1....Q-wwS-....w...1-Vu,1V-..---...QQVW1-,f.:V-11-QQ-- -7 V-1,-f.VV21--.-an-.1-Wig.-ss.-QQs,-14.-,V-1 .,-,1-1f.'V--.xg 1.-. .1:V-q.f-.:-.g-- - E .-5 ..-efig,---15 as I 4 Zx ywmgr - - 9.1, 4-sf-- W Ls- Q -. .X f. .- .,X. .Jn-X -,...-..- .. -.. ...:-: -. - . .-fp--Q..-. 1.-gr - 1... 51: 4,-,X,..-Q. . 131-V-zz-1-14,- - .V H ,- 1 - . . A 5 71.11-fs-VV -VV.-.Vw .- - ww- .V f1.,,,1VV f:..,e,.1:g.1-Q--V.--.-V1 .11-m.Vn-g,,1V-. 1. QEKQSSV. g1.V 1.XV.1Vgw-meWV...-1...-.V --V -V -,-.Q--..-.-.V..., 4-X,-2V - .7X..1s::.VV-V.V--.f.. - , , fr ! EQ- .S-1. 5 ,.X.- - my my 1i1T.gf1sfzz5Vge-3,.a,g1V.gf-sv..g13V5:X1sVg.Qg..-W15---Vw-1Ez.eaS-Q. .221-V-1511,1.3.15.,meVigggfwyxfyzikg-ageV.ig1111- mg..-1'.-.., -111.-1---gem--1-2g.qw .fr ..gQ--iw-..z W-1 1- . ,X .. Y .. . , lf. 1 1.,-1XX.e1,...MX-1...-,V-H.-.S,X.,.,,,.... .,,...QX...-X.,,.........,1g.,.-W......WW,,..,.,.,,.,,.X,,,......., ,,,, ..,-.., X.,XXX...M.,.,1...,.....5.,..,.XXX.?X,XM -a-.-..-'-..- - -- . - HV -- V..- . .,--- - --- f - '..- .- :,..:- -- .,- - .- '1 2 -- 1 L- , 1 - -15 71QVf4v.-321-1-fy?-fsS1'1V1.-M1-we--iw:'12-1111a17L.w-.AwQ51-vwesfzfiw15-Vigwfifgg-Q.--s?11a-54:1mwlwzf-V11a,i..w V--,V--V -Vg-v.w1V.--Vw'1---1-wx-12.V-wx . .... .- Xmas- 1-.., .gi-ig- JW ,- .. V5 M -V...,V.., ,V. ,, -VV--M.-12.1...,V-.....e-1.--1..-W..---......VV.V--.1.....,--...VV.wi--,...1.11VV..-.-.,.V,..---- -V - ,,1-V1-Vw...-m1,--V1V1-1-...W-.1 XX . .. M- .1 n. - .- . f .V . 1 XS., - , -VV.,.1-.Q-...W-..m,mg...-m.,."gi-.W - my -w . -SV1 ,-1 --f...:V,.1,V.-v..-,,-V, . V....-,.- ..f. ,.,f-M..-V-,.,1. L...-,.. 9--- 33' -f 5g,,a,- ----- 3X--ff.--X..- V,--1V4- f .--ff . - Xy-Wf.4- -.- X- -ae- - .fm -1 - 5. . 1- - -f - 1 . - :- -11f.1-1-..--- V..-,---Vw-Vf .W--2-W-1.45111-fV, ':: .v.,' - Q :' l - .. . .w r W X 1 , nf---E ,-'.:1', HJ' .. ,.:.zk .aaf de 1. -ring. f:,- Gsm: 1 '- ,: ,:-::1:1."-i--.:-1'- .,..4:- - 1- .,VV .. , uf- , ,.1 ia, M - x . " -4"- --4.54. '11 -,f..-f,1L.- V W.-1f1'-5112551-111-41zLf5-...L-2191" .1 1134.-Vw - -S -M 1 f- 1 1 - -11 - 5 ' Q ' 5. A - . . . -.wi .. .- - ' S Q -1 ': E' -. -' '. -.., -125 -5 19 , V... , Vs .Q-gk..g-...SVS--1-2.....1mz-.-.s--..:-,- - - HV- 2-,zum-V-1.f..ff.1 - 2 si n- 5-.1 2- 'f - - . ' ' r . 12:,5?Ea??2ge-s,-..- ,.V-fzfssfs.212SMX-.sgia..14'-msg.-,ig-5-1s.esQ...zQ-..g.b:ffLee.-.15-421.2-QV-Q1--ig fx ...-:-,,--V,:Vgw,.31s:--- . .- - -5- 5 -- X 311 . ., . ., XX X .. 1- . .. . - - . .2-ffm .. 15. . - f . VV LLKL - : 15 if - 2fcVf:3.-if-1--P 5' l . ..frf'f-Y -9- i w -"H -5 f 7 V , ' 1, . vsrsfvwau Mi .V -X , . :Vi ,,,. - Q... 4 1 B 5- . .1 X EX X?.. Au ..'H Xg -1- 5 V, ,Y .Pa p ,,X,v::rggs,"5fE an ' -"f-V..-W -'G H-:i:g. :'.'g'.f'4?i3:-'ff-14 , ' fffj g -,gLs1 '- 2 4 . - 5W2-1...-Megfsnv-::-1y1iQ?1s-Eie- Q3 gfufbip 515'-gL.eQ.V-1V.flsVgl:i-9 . , ,414 . .. ""' ,' 1 X 4. -.5-Eg if .gs -. 'V -.- XXX, - .- ,,. 1 1 !. H--I: . .:.: ,. an-.z rw,-.-A -1:-55-,w-,,-gi'jg,Ei,j:e - .. .V.. Lp... ::35:,:5.,X5-g1..,'XjV-- . "1 : ' p,,.w , . -- " lil ' 2.1 :1X ,,. i -W. fgglif x- -Asa4fq,1,iiiV'5E-,.f 'Tl 11,-Y if s 1. WLV--135-ss5?"?V5s11'-I'Li -7- V' K A. 'V ' -W Z' 15112 SE .MW K' 1 , -- 1 i ew'-3 ' .. . 11 1 .... ' - V 'V 53 .,,. 4 My 1- S JZ - 1 wif- . --X ., 12 5. f - - ' 1 -15- -1 -' . - .1 . . . - 1 , . -. X f - .V -..' --11 '- ' X - , .X 5 . , .. . ' -E3 " - -. ' - ifgf' . 2" 1 -' V f - V-1' . 11 . - K- EV.-, g s "" A ' , as. X - mfg? E -5. f n .- 1 - .13-, ' ' 1 1 1- : . " A 15:12 ,- .21.2Aim-155:-1-5V.3gg5g:2isV2'l.wEL-51.2Lggif-.L-5g11,gs22Q-343,i-55522-122VAbi-1:suQ..gs..ag1s.f:1SE4f.s422f.5i1sfiTQz-2-52,515-:Va .'-315: -' .fe-...2i::ffQi1.f.1Q2gids.fV W.. . X -1 E 1 ii, ' 94.5 -fl: Q ' , 5 - . 1 i" -QV .. 'ik --we 'X -. UE - -2 f - 1 -131 ' Q55-5 ' ' K la... - Q I i ' F 5 3 -- - H -in -ilfsvkf--V-N-ss-1-Vlzgafzfg-.1.-Vu.-V-fi-1,-...V+-ww----V.4:-.--f-.--SV.-me---.11-1-.515-aw-V-5V,...f, -V..-1-...f-11Vi:., ..1.g:zeVf.s.. is ,pf .. , - 1- .- -- V- .5 4 1 - - . 5 K1 1-ss..-.Vhg--..,-ew ..-- .. .5151--sean-.sl-mv-1.1.1--V--1-mf,1-Vasu.-1 .-,VV..,.Q..-V-.-aff-wxQ--ff--Q1---51.91,-11-Y---...N w.. -Vw-:-2--1112-1-fk. - -- .-s g . 5 3 1 . if . . .- ,gg-mg-....z-V.zf-..---..,-...1,-f...-M3.1 ...-ffm....V--.V.1.g1V.-e1.V1--z-...1-....-V.-.-.-gg --.....-.3-..11-V..V.Q-if . , 1 - E 5, 1. E 1 Q 5 . Q - EE -'. .M--- - - -.,5f'.. ".-.Ji ..-ggsiigfsfgibiifzif52.5-1.2,-Luizg-25-325,1my-QX41,1f3.g.-gg5434Q-isQX5.31525-?g.5iiEzia2.f-iiw.52-.Lfy 1, 1 . V s . - 4. .1 1- Qi. egiigzxf -1 wx. , . ., Y ' 1-. f V A I -1 --3- . 1 5 1 ff . 1- 3 311' i ' S 4 ' ' X . , 3 1" ' 5 5, 5...-1 . - ,..4,5m.-.QM,f9,Qafg,gXXg,,.V-..g11El.gz.9Xa..,Xg . jsgswi, gXX1,ggX..,:.-11.1.3.Vgi-gg1-13131-7-X1-V-.-5,--,j-.Q-. XX,-4.Xg1..s3gi..aa:'--1-.pwisi--is ..Vgi.3gssifxe-fE.21'.Q?2az2-QL71 '-----111:f-1-miiiiiw ' . . . . ... . ,.,.. .. ,,.. . . . . 1 . ..., . . 1. ,,.. ... ..1 ...A .WA, . -. ..,... . ... .. ,.,. . .. ,,., , ..,. . -,.. . ,,., , .,.,, .....,...1,.. . , 1 , .. . . -. . .. -- . - . 1 -zsK-1-V.'4f- .gs ff.. -VW--1-fa..V.s--1.-Y-.-'11-f:1f.1?3'3f,gXH1 -EQ-,S-18...-W ...-. V11-V 1 - ,1 .1 .., 1--.,, , .,,. ,. .1 ...V --ew V I 5. . hi . .5 iw.1L.5-i2efi..f:s-.5-..1ff-g.--w.5wz.-S-.52-ggww.1-11ffms.mEi-.1-ff..-:V iz.:-.14--.1,--.1--1 f..,-V V 2 -.21 . -1.21 is 5- 53-2 gl - X X , Q 5. V 3953- 1 - ' 1 . 'i 2'-. 4 5 5 ' 2 af - -. fp . '.f 2 2- sw- 2Hges?cgw-Mgwfjgr-af-1w.p--4-55-53--5-221513252f-51.92235-waz?-gqaQg:X.-,X1-.Qs.1.-1sei-2-115.3:-.V.1 ' F-is 1 -ix -1 .-gf X. 'M X, 1- 1 11 .. - - S f se. .. .. -Q1-.5.s..11-1-Q.-5935 , . X . ..,-Hy. 5 . . ,X. - ..,.C A . 3 25 .1 v?iig1iX.,s.11.-. 1m...-- X X. ,X,...w- . :QS kgs..-S-.fs,,..XX.sV...-2. V..--.....,.VxW,..-V,V.,-,5Vg?..1V,5,..m,u..,f.fig-..V......2V-.VV .. V-....X..- --....V..--V.1.f,,.fQ--N, - mf .. :,.,, 1 5 X . XXX ,. H. sw..-. - ..-5. -- Mx 1...-,Q.-M9-m.w....g...k..1.1,...W.1.,sV..,.,1,....--...V.-X.--..,,..,1,.--.-.-.1.-z..,.,.1.1-.f--...w:H--1-w ,. .- .. . DV...-. 1-1..gw gg .X 14... .-.1V.Qm1..,,.1-VW...,.L..1.1....,..-...-.......,. ms.-S..-Ms. .-. --.--1-.1-1.....V..1-1.V,.s,..,.,-. -ws-1.Ms..1 -- . 22-z?k.X..g-g -51.1 -- ., -,1 XS., X ..- .. ..,. -31 ...L-LQ.-1.....,.,........,.1..,-.1.51..,,.-1...-,......,..,W V-..-15.--...Q--1..1.-....WV...V--.-1...V--...-.-....V..-1-,..,-2-..,,--.1-.-.Mez . 5 E. - gi. gg .,?3!...,mXa'559gi..1g5 '. XXQQZ11-V 1531-51.ga-sX5ggXz1e1z,..g..g,...fg.wz2-.Q1QgigeQs11ggQ.Qifagw2-.QQQXV1.2-.ggfp-.sfi.i?-551-1255-53.41. .gf,-fm-qs'1fg.---...g,-11----rim1.YLS-1e2g41-wa?g11Q-g14Q.e-f.s'f-- " ' K -S .12 :. gg Q23 fi?- 3 -1- :' f"'..T -. ' Jing 3, 3 f m.. -1 .-. 'Z -.-.-9. X gm 5 lg 1.3QZ".,a. -if-Q-f5332w...gV1fe'3is3z1gX .Q-QQQXXQSQBXQ., -gh. H . -. .Lrg-.gg.ug.-iwgags:QWEQZEEQS.2215gegggig-mfs5911.25ii-1ai4e21ag2g1,1z.,-.-...v-.fe-gig ' S'-an-j,i . -g l V1-55-112 .-...ww,Vi-X..fz.1...g..--a... .sg-.5-1....gw.-.Q .- E 511- -Ens- . 5-Kg, -5...-.. 1. . , .. .M-. . .,. , XJ- .. 1. 535. X1.- ..-. rs-. .. ,1 1...-gem-1NV.,4z,.-,V---32.15, 1,1-..s...1f...,. .155 1-1-SX. -2---sa-.V .--f -..1....f-...M-41.1....Vff1-VV .11,,.-...W-.V--.W-..z,m. fm?-. . E-1 E. .. , fr .W-gm .--..XXp.-.vp-,,. -My S ,--.mv ., X -....- fn... 51- -Lf .Vg----...-A52 - 1- -'. P3-- ..---.-.W my 1.,12151.2-Q:-2221-8:51-VQLQ.,,,..?g.s.,.--.97,-V..-V?Q1Vm,.ikwiw vw-mgs3.53,i2V..,gw1VV..f11.4,...S1--,1--em.:w5..1.:s1V...---sv1551-..-.QEVQQWV--Kim--lei. -mg - . - 51.31-.1gV1 -gg-1.55 .W 1, 5 . 5. V 5, 5 - ,Q .X X f-1 . img 5. - -- 1. .. ,iFfgffqg.5m.?g11?Sg5f2i.Qfiiw-.f-,gs-.?..1.e1f-15211Q5..s.agwg3111eV-Hmm.Vgndimful-N:a.21.sasS221--fix..-,-..VV3 1 fvzwi-iiiiliw.WV---'-if?-il--M-Uavisfwaz. -. F e xmw?f1.1s1i2V-55332 1. K- '-Ye. . -1 -1 Q -4215 . - W 2-frg.f..f?-3.s.1..1sV4g1--.1.-Q--1.1.1-V.-ea..-21.-.f1e.1-..1.-Q11--is-1-gin-?.-QQ? Q?KN-Q.35151-'ie.wi--21.1--ff--A-ez-1V-----.1-1111.1V.--1.11231115-V-fei.12i-f---uwggswf-wma. 1 , MKYWKQ' gw.-.4--..g11-,1..,1-.Wm-vs-1 1 . ,gm,.1,-1-.-Hiker--9?-'wig - 1 Q? -X , --iw WX....X.s.-5...mg-.1...1--...QV-2V.-1--.Lew--1.21-P-ua?-max-...V-1zzm1-5i15w,.af.-----.Q2152-fs.-fem.-11:1--1-:af.-.V1-aww...V.1,,-.1---s'5'1V-QV-.ean-211.-V111-eQe11s:f1Qf1-1--w 1 1 - mb.-Q-.EZ-..V.11a.-g,gM.-2--Q?--1-is--.1 V gg.. -1 .afifgg-32w?R,.w-91-ffgwaffg .gf -wi ,155--9. newig.1.,2..s...SgS:a.aeV1-1-11-Q-1-2.11.gs:..1em--..-1,-2--1ri---msg-gifs.--.Q-.1-2m-5g--15.51--.wa-.fm--wx.'11-2.115-1,...V.nw..-zz:-fm-.aff.1-iwfV-2.12121--9--15-111-2-mf.. -:. yn ., Q ls?S.-1wg.222.15-wiii,iQf5211zV2H?QgX51-6.51 ,51-2s15Q.,X--VggVg.-..---.Vxse-..gzX13f:Q-.Q-5351393 - 1-- 3511 V.- - ay 31 -' V11X.Vs.-Xsmie.-HQQQXB1.Z5s2Va1g,ygg3I5-55.1.-gp-iff B - 1 1 . KHXQISLWQHQKX-1sn,g-f+22535iQQ-?,S-1-..i,56?Z5f..1w.f,i - - .lg 551153-2X54?'YGaw52251gi15sXXe512K-Q9iSS9aE2BU?f??si1-iii-2.-NET'LZ.-"ilkS15?.ai?g-21fi1awif2Q2Q55-.1Q,s::g:ssaa?Mw1wsq1.f--siig.-Vi'---1.1,-1.12-2.1'L . '- ' - 1 1 .. X, ,.-., . .,, . . X. ,,... .. . X- .., - ...., . ,. X, .. . .., .1 X.. .., X, .,... .-1V ---- ...- ..... W.,,.,.. ..X .,k,,.L,, .. ,..... -....-,.....X .,.. .1..,. .,., ... .1......, ..,, .- ,,.. ...-,,... 1..m . 1- -. 3 Q '- 1 7 L - -Y -- --ff 5 -, 1 1 -- .' . 5gQ2gQigii1gE2iq.s112- wi?-fe wigs- .-2.5 -1.- L us e f . -- I , - Qsfggsg - - V .- .. 35 --1:----.11--1 --41f.a.g3e.-.-.ggQiggg.QX-ima..Q3.giggaa-,ipaqigg.?3.51.gVX..g15g--,XX15V,.XX. X..zg,...,- ,gi Vx 'V 2: , .g 4 Qgifg-i1.31fVV..3Mgg.gVf1..1.- w e -Q 1 11-.XX Q X-1.35.VX-V15-NXXQ...-35bggLg3.mXXX,.51157,-,X15XgX.Q..g3.5.g.g.gL5g1,..X.-.X.g,-XXg.-1.5-fiizjf,-21.1 .--..f1i1.2g11-411..X--amzsiiiiz..eg-yzesfgfiiin-G22as af' -fi-1 SS ' - - I . - .V ' N H. . - i I -X - ,.., -- 5 1 -- , ws- X.-,g . - ' 1 52- -4- 53-ig 15- :vV.:5-3.5-3,--iii'-42Qf.iW-.5f,'2.2f.',' . - H - - -'1 ,- ::'. -:.e-f-?:v--'K'--WE. l.--?f2s,-W' -H ' -2 -111-25.51--w'1fV:1 VH ws.--.-11. sf . .' .-L-f-v6i?.f 1fff5V Tiifi-W7--52.1-S--'ffsi-?l.Q,f5 QV Q -551-mV if QETQS-.1---11.530115--Q...via-Xfsiw--2,.fi7229-5ei?L--Gas1-2i5.f4E..ff1z1K141..2222-Q.-1 ' . .. . ..... ,. f .1. I ,,. 1-4 gif.-g-.5hfQ...f.1.T-151-,G--gf-1 Q . - . - - 21. -VM..-g,Xx...m--V-..11e.14...-V-..,-a,...1 -,W ....Q--.,..1VV-7-...--mf-21.95.---8.1 - V .1..--V .--.-.V-1---, --V . . ,. X- , . -Q11-Wfv-vgse-1,X3..f....3?,,,,.XX..X,AX..X,...-..f+f L1??- ,XX .. 1. .... .-.. H .9511-4.1-. V-..,-..-.-..V1....-3 1.-W V...21...,-L..-..V...,--...WNW. ..a....w.-.Q .. . , , -X5 .mg -- S - -, S -- ff 2 .X 3 1- m f -Q.. -ME V Y1 - -' Y- 12 .sf . 'L --.- . . 5 , . .. .,1. . ..,..,.1.,,X .. . 5 0. V- .1 ,. X . 1- .. .w?,1f. 19... .QQ . X .-.Xm ,. X.. . wg .1..gw. 1. .,, ,.., 1-,, 1. . .1 5, 5 mm.. .QM . . . V .. X., -S, . -. wgg... , X, 35.1,-.X3. 1 - . ,, .Q .,.-mxp., ws.-X.-1-5,1 .g552s....wV- .m...sf,,X...,S X 1,.1r,3.s....fV- .V ,..,m-g,,...s,..1.1,,f.1V..V.--..-11f-s.-v-----ww..-1--Q.--Wff.-.ff11ff.-322.815-arg--Q ' W ' ,sl . . -- 1 H - -21 X X 1 X .X 5 X Xi . 1 ,.. , , . X M..-i.-.-su...--... ..,-Q..-waygz. .... ..,.Vw V..-1..-.1-1-e11.X,X,m.-.5 Q-159 11-. -...,1m.,11-.- 1-. -ef-.....,V.Q--f--.,V-VV.-...iw1-.1-.K-W,-1...3...-2--...-...im ,,,, . fi E - V 1- -2- 1- .4 5.-3. 1. ..L .., . --.-ww. .V-...S-M. .2-gf -QV M.-.. -2- -.1.....-.. .-V. .Q.--...-...M-Q.. .. -21. .. . .. 1 . - 1 ? 1.-. .. gi .. S. -- wi 1.. - S..--.1 5 .. -1- 5- -W -11.-X-1-...--,-W V9.2 -.21--2--,.wSV1A.--V-1-.1..2G-wav - 211. -X 1 .1 1 - ' " - , - - ' 'fe1V1-1 .X -- 252 -X. 5 5 L XX X X .., . H , X ., . 5 1 , . - -Q Q1.Fw.g,ff,.VgS -- Lal 1 . f 1 .. . - -- 3 W , . .. ig, Q.i21ew.5.--V3,EafVf1.2:-1Vi51.-.-w5.-.a-.5-i4--Q-.QM--gf., ,W . E . -. - . -. , .XX . X . . . 1 .1 - -. , ..-.., ---- -,f....1 ww 1 --... . 1 --1f-.e1-V-Vzf.-1,.-w.-1..-ww. KHEHW1---4652--U -9- .. K 1 1 1 -.1 5 . , 1 5 .. ., W. :::..w.. M--'-W ..,,,.,, -m,,..3g,g., -.V - -- f--- .- --1-um--mis-.S.WmV.g-am.-351- 111312-,-'M-UK ff- -5- , X. ...H-:, , - X-a, .'...- ...Ji .4-"g'..- JI: .- 1 I .. , .--.,v-wiv .... - -. ..,.M W..W,q'fG1W 1- fa-'..x- 35465. ---ef . ..Hi..'.-25:11.--w1.13-fi'--5531-:sag-S..--134V -11E?f?51?.bsfif5.V.wgf1-.Xff?.-f.g-1.1sfKf15122--XV.w9Es9AW-'5?5?Q5- -5- - 1. . . V 1 11: ,... ----- - -M W1-1-W-Q -.V-4fg:1..f-.gg,.-1- 1,qX...-. -1 sv K , - .. 1 1, .1 -- ' - ' 1 "K!r,w-- . . "" Y i ' 2 -E.. .. . NX ,. . ' ' -gf? " ... . '1-.me --- . 11-22. f:1'-- -.ig-..--z-.u .-4 riff--ff?-i:. s 51 .. -in -4s5"?"1--522 -" :- -553-9--iv2351.11-g.Q1.1'f" T1swuW-f2-Q.3E2a--f?TfV.sSiXgf-135522 -S-1-Egg? , . ., . - .V 9 1 - 1 .N 1 -..-.. ,X,. 21.-,-1.-,-..,...M .--f . -- . - . ...X ... 4- 1- -.S-. . '-. -----..4.-...gm mr - x.---.-1--. 1 1..---f.1...-:-f.......:.-2.4-,.... ..--.. . -- .. 1 ... -,...- .- - L , V W Q,-..,-a1.,,.V.e11 .-.-V...--Q...--',w-..,ifVV -1. 1...-.gmgsq--.X-,.V-V 5 1 - - - -isis 12 1 .-,Km -... - - - , .M.M,g....,. 533: gw- X5 X f.-.mg-QX1 - SI .. - - 1- L 1 f - Q- W.-1. gwffw- ,ga-212 f . -f V-.-. .1 - .- 1 X - Xwgws- 1 .. " Q- , - ,. -11 fs. T- - ' - 1' 5-al. Z. 1 1. 7 -. --.11 - -3.--a-f1.V1V.-.--F -2- . -BQ-11-ffV.5---ww -V V ., ..2S:SQ+"'-W-Q'1 -. V- ,Q-is-A 5121 ,2 L. -wma?-1-E92:Vw.:f -QM 1-1-gn 11- 1-V.1iVg1. ,,igigm:--,,-.g- Q---Q.---.Q-igVZ wnY,.-V-A-.1.s.e-Q-sw 11.1 .. ,.:1-3f-2,,e,-Xmfm---..m-- ..,.-..a,g--ew--M Sw... 1 f w'a----1f-gs-.V- -.1-M.g.1?-wfs.fg,.,g...-,.3ig...1-r- V.-11n1...s.,5-,Q-.Wag-.5-if-1-.E-..1 . ff-wwig-1-f.Pf-1-1 iQ 'fggsqfilffglf-fi-?f4Q-Y -2ggsigf---9rf1V'2afg..12wf11-.mgS-.w-1w-?1.:1Xf5-- Q- . WQQSQSEZ,gnL15VQs.fg.1-.5---.Q.11.aw.1a5-..X1----.-siiifae'-V551wg-?sf4-V-2125552125-' .- - " 1' 1 M51 --wig.---52m,..a-Sig?-.wi--a1,511-.V-..-.-mga..-..W . - .., .swf-1-q..fV12.-111-39.-1---VX.gfssV,.gX,X-.133-11355-Q .. - .,.Q--5.5552 .1 S5X...Q...-V.1,..+X1g...wf.gQg.g-5-.gy ,W.:sf.gQl.EgA15s-ggggm.--f 1.g ,,..,.,. .-,..,-.., .,..... X,.,g.5g.f555w.2g1,...gE5 ...,.3...P-gg.-3.3. . XWE-S51-Q?-eg?-.XT1 X...-.X ..s5w.?:3W:E1-.12 ....2Q..5 .Mg11...1....gf X -M - V .1-1-12.522,-V..,5 .-gf?...1-V.:,f-1-22-we-1,g1...,Si.1-. ...-wifg2.1.,.f.---.---....-1-QM,-as.--.Q.,V1.-V..Q..-.,.1,-.XX, , ., V,,.-.-XM... - .Q X W- '- .. 1 . - K?-Si SQ 1..m,.1- ggi..--Wig.15-2ggz52..W.mgw...?g.q .SX --... . - 1. ...af-...si WQXQK. ,,-3g,q.m51.V.V--.,...-if ,..,.1g.wa Lafaviggl-5. . 13 1?f.,gs1'.Vi2f.1-x-.g.V11Q.-1.5-Q..,-X51-rhgf. .g1.113uw.g1E-Q-75 .-,.-.V.1m..A.LV..-5--52.3-fa,V,..,,,..y5.-.-.-..,:f.w...- . s: Q1-g.q5ff1qg33?"-1..f111K5.mg1-V-Sf..-1--V2.3-aiagffg-Q-:Xa--23-11 is -.eq-Q.:--, .1-.-3,1-fig,"--mf..fSH?.?1-Muff.--21-.1313.-X11 Y.. . M-1-gi-2.5-fav-Q3?HJQQ?-2--S1-f'4-SW:--I-fVJfff- -S -f' 1 - 2- 1 - 1f YQf15SH 55212-iigvivvffl-125-f'.5 1 " Q: -fa-wg--1123?..1-2-f?-?kfW--iw--52-5.12.51-si-1-.aa-1-,..aVa1.gi--191.-,fx-ww-Va -- - 92x31--112-iw-V12-Q55fm1-.1-f2.f:-...-.2-,.1e'1.91--S-Q,..wfiVff...1f.1..---.1---fa?-f-. .., wa. .,,,1.,, -XQ,1,.-1-..,.wg-WV, V. .1 X, -X: X . - . igmf wig- .sX..fx- 2- is-.5-.img-sl...-. Wiaffw.. uf ,ff - S5331-1 , -fs . .1-.5i.Vx.-.gfgms--.. sg. 1... .-1. ,,- -W-211-.2-5.s1.Vf-1-:,.. - fs..-Q...,.1. V11--...., .V....,V,.....,.-...Qi..s.:iVx.--...-,.,.1..,,V,mf3n.W,.su.-Q., . W1-mrs N151--Vw 51.-1-...H-V...--Q.-.fw -as .1 1- ff- .-.K -Va. . -fig.. - 3-3 ,sw Q ,gs,1f.f--V...--1--15-.,.S1?w.!.e--sw 55. 'SX-X.-21---A--QM 2333 w- ----.Vw -- g-XX.. W- .-1-Q..-19i....-...g,1w51.55.111 .1.,- 2. .QQ - 19...--1-S. WX- --- ...S-Q V if-1si.,j, 16.2.-1.1.1 - X52 -- , MV V.-1 ...ff 1X,V,,-gf..-.. -g5,..s1--.g-gX,- X si, -1--.gg --f -- ...J V..gV..,VV,-.Vw-G-1.1....V1.-1...-1.1---I..--.-1.M-V.-1--1-.Vw11f--fggfhififusw -f?.1gaaVwgiViH1.--L-si-yg511VVg,g' ' -ml -X --1.-.1g:-QV-3-I L. -sw-1f1.-1 Law- .Q X ,...V....X1-.QQ-...Eg M . .-.,,...-y1...,,.11-9, .. . . 1 ..,,X X ., - X1 -1-,gf-2521, - -91133. .. 1- -1-.., 1-X... ..,-if .....,-Q53 es- 1-1-5.1519 pf Qu -ww-1515... - V5-1--..-V-..-.W--VM1-.M-.-1f4..-- f...-..-an-.S-11-2.55:-.2-MS-1- Q-.1-.gmXg,f-121.535-?..wE .3-sm-,,.wVV.,.,S.V.g .Vx-V.---1. - . ... -- X -.HX-. ,5rH.--Q.-..u...fs-Q.1g. XM-X,X.. X Wg W- fg,1X,,X... fs-...fn-. . ..,-.., f.g.1f....w-.61-2. 1.--gy. .sw KW, - .1 g,..Q.-1.-..,...-.MW...114.11,.V-1.5.-Q...-,..,--.-....V--.1...1..--5.141-.MX-11 -- ,-3-sf -. Qglfgwlx 232-wi- glgiss-Fix--c-141--e-522--S-v1,g11V .1 if - -13. ?" ...Vf21-1..a1fXfg'.1g:1-25'QsEE1.1' ?3-Ss,-15?gXgi3fMf5.-- H-91 15.32-isle--ig-Sw H. -...ff -5 ZVQQWW-.1512--face-:1ei1V..XfVi-zz-mgl-z.'1-wV:.m.yz-wmaQ.X.g,g-11.,,?52i--A ' - 1 -1:-.Q..A.g1q.....-g.11e-2.3-w??5Qg.z1 'f.2gy1i-,gg-?ffmV 2.....?. -. ,Eg ' W 21--3.-s-Wm---2112-EPS-p?51 was-SXQQ.---9?-5.5 .1 - -EM QSMQ-H1--Q:g1sVQ.f..sz.s.-21122.-v.Q--i-Y-1V?a2.fm-awK---we-V im rg --g1 enqg:1V.sV.g,w1.agas1,- ---- iw- ,SN .V-,.-w-32212-5.55 ,fsfigfes-. '- -1- 11-.WS--we-1-fig.-+5-gxgjgf-ai. . . H: - - -. -XX'grXg1,X .., mwgwavgwafaff1--f12-J.bwz-ew-..ai?.2Swf1-1-.fbf-r.55g,5??5ff-VK Q- U-gh - -IMQ1-5i.iaagfaVma11n1V--QQKQQEQQ .91 fig-1?'f?fwV..f?S!.i55-X... ---W - -- . - .aP.K.g9-QQVXQ-11-if--iwi5..1 15-1 .gag-14 Vw ff- 512 W 11.5-mf..---Scif-if2sa11.a1.1-1::z.eewfr.rQ-sm-1211s-11am-V.g1f--A .-fcfiii-g1.ws121?3.:s11-ki.-212125as .. ,-W.-5 15. 1 16, gwaiagwggbmf- X, .V X ,,-.gig-S-VK 3-1-5 15-2-.-1,.,.,m 1--.qs-,Xg22V1sfi5.--1-3.1,-1f..if X3e5?5.1..... --Y.35--,,,1f1.,- Was-.---M.125-2Q.:-e-3.11--sa-T211-we-11.12-f?r1,Q-1Vz'g-sz--sz-85.5.2-15-2356...VVw- -We-1--1 .5.-.Q11-.VQXQLQQQQQ.V1-...:zgs.1.g1a-21131-5-15--21.9 2-25,293-SP-1,--1-5-.. - 6152?-'-2.-121-52.-gf--5-.1133z2..Qfz,z11ig1g1?.. -2,--1321 - V gQ--zew1gmf22fk-2i-e-fs-rf1--12--am-wif-1-21.5521-iss'-22-2-1.3.1.1--X1 -...WW -1-X...1,.Vgm ...WXwg.-........WB... MX., . - 6 29:95. 1,-Wvinqfaf. .3141-gig..-Se-11.-.., :W -- 1-.,g51 eV1-sw 1:2-ii-g,?5,??a-.512-1.2-n,..?,giSmwVSJ5 Q, Q- 91. .Mm pi-1-. f-as W A . V-..z5zwv-H-f,11-4'.-V-aw-15--2'lf-ev-?M5.-ew1a?1s?k:??1-1--ga- sf? -5 wav.s..gV1-.-Vi:--rw..1-.-.--ww...-Vw -. . 1 MW- g.-.....,-Y V QV- ---H 51-5-H --X - 1 -A ei. 1...-ww. 1-11-2.11-1.-1.9 Jw-11. -Qu -1-V.,,.1.,Xg. .g, .1 ., .,X,.,......,.,...XXX.....-.XX,....,.-...,....F-1...,X,..X,...XX.2,...-W... ,W ,mg-.,X -mw-gq-.VVfag.,-1.9.1--...V..-,-V.-,fV...,,1...1-.ws .4 .,.. -E .W . . ..- 1-Sw-1-g1----- Q1 .1152-55 1-.iw ef -1.-1. --. - 11-51-z-...m-S .-5.5.21-1-K-W1-51,-..sf1,nf... -iw.. ...Vw sm.. -Q55 - .-..----Vw--V 1---..,.Vg.,.1--...M---2.-. -1115.-z. 1. 'wf-a2-mfg.g-ge,geVV.gg-.1-g1..-..,-.....21-Vw-.Q-X XX. .. . 1131... Miki.. X,-V 1-12?-.g -1.-11 -gs, -WMQWQQX,wp-..g.?efw..,.-..1,.Q.gz1..,-.-...g 1.555.211 Vg . 315 .ff --.,V-1- 1-...am X.,-5 .gelzfw-1s.7.a1.iffvV.5. swag. -. Q-51 F-va--,,m-f2.12ai11ag www .-wi in -- gs. 111 1-X?2-1.-Hwysky-gi--S.-111...gV-QV-www-91--1-eggs?-4, 1.1 ..3121-gig--.1-aaifkfizq-21.isff,,-.15--'.2:-ffQs1s'1'.--we'Q-2.4251-22'.s1-sa?-11222.52-whim-1 ew?-' Q.. -.Q-QQQZV.:-.-Vg.1.,....-z:ae-.w...1s-.fy1...1gr- V-.1 1- - X ' M- 1--5-1 -52,3---.3-1 -. ,...- . - 932. ,S-Qmgf.,.-...X..5-1.-1..z-f-,g.1fg11--..f,-1--...www-.gg-.XVA-.gi-11335.-.., xi-gm--.-1,--A--,,..,.-..,.,,..--.--.-111,----1..,V-5.1as--V1--z1VggEV-.1--b-:ssfe,-s..s1gf21- mf 9.51. 19-egg.-1---2.1,-,V--.V1..-UVQ.-..1.gaV.-...Q-. .. X -- . ,, . .,..4.E. 5.191 Qi.. . Q..,X 1-gg.- gg 1 ,XX v1...X...,gXwg., 2.5-7.:WX....gz,g:...m51w.5-e...5..yV-m1.wXX5...1..,.QSM -- 5.1--.X....3q....-,,-V .gX. 5219-gm ,iw 511.Ksvzzhe-11x1Qs:q5.a.f-.img11:3141. as-4, . s g1sQHxfgg-,QXQQQX--S ,-1 .Q -rl .. fiv-L1E'21-sri' -fig,-2221.-Vn1fSf-Nfs3i'E2m-FVEQQSAQ?-MSYQEFSQM-5-5-5523191-W -' EV-if-1Iwf-.i1'.-2-.ici-1--.3--ii'.iwfQz42i:1-1-2.5--1315fS?552'Ss.2:12f .- ya--A-111-.1.fg4-..g?3,s1-ef--.111-1-Slim-Vsffi--Q-1 - -. -- -.3 --sg --w-.wg-S--1.-1,g5,,g EQ fn.-rp. - 1?gfg,fgX.5Qa1--fsxgygkqfiw,.QWgf.-.s.g-5.1-s.gg1-Q.,5.wwi.1m1amg..gfm.,111.V..g-54 1.25.13-2.1..---:---V-.,.g,z1f- .',-12---m.51.51-1-,..L......5-f5..UQ-...QQSYE2-15.5.1.5 . -im -.sy-1.-1.X.-11 IQ1-1 3351. V -- -- - .-5-.5--1.25 -1 L 915.5 -.w:.-Ssflis-.rm--Vw,---1z..z-'-l--2.-wQ.---.- 2- -S .Vi -1-f-.W-911-555. -n --Q-:X --f.1a...-:-fQH.Sff?X,2.XXs--1121-wS.bf-'1.si.--.-1-h-f?-- -.5-...gf-is-1,12Q-1faV512-if-1Vw1sV..11ewfmsaf-f-1:2125f21-E?--1----fa?-1-2-1-2-V--we-.f------.1--'V' - --ffl-1'--"'fi--fl2f'1f--213'--'ill-ff--24--ff2YffJiifff?Hif ,,,f...sX,,,XVV..-.-.g-.. -.Q..-Vw...-2...X...--.- . -- .-.,- -- .-X. gk --W.-f1fgX....g----...ypf.,.. . . -.9-5595, ..,X,.,..g..1.3.5--1...m..s. 1-1,f1..n-5,11-..,..1aQ..1-..11.----.Verma-svf1g1-1V V 12.-.--V.-.1--fV-1,--- 1...-2--.V.-QV-w---....--V..1.-.-5.1--1 .m,...1eg-11 - .fi-225-11 - . we- Q . X 11? . ' -K -- - ' ,xg -1 X..VV-wg -:,.V. , ,r .., VN, .,.- V .: X.: ng- -:1 ,--1 f.. 3 V.: hz: 1X 2- - 4 1 ,- A- : -- ,X -,,,".. -:7,,::- . .5Q:.f.s1,,1V-- L ,g,q4.1' asf -51' 'llfils' S--1 i -7.1-.-W1-' ms V. - :,L-,M-1..emi-..1.r-I..-4-:zaizf-Q,if-if-15'-1-5-3,g::fifl.fy1.5 .- K.--V L.-.,g e1 s -- .Q-f:.f.::..:1:::L,3,:f1, 512. i---.ss-5-W . . 1 . .. . .. .. .. .. -.,.. .- Q21 1.1Q1-.2019-3-1--afme-V-,S-si'-.:V. 1- -aww-M +V-: . f, . . --Q. A . 1 1- f-'Q ls- - M- 'aw-1 2--1--ff-.. -V-Q1-.S2:,.fV--S--iv14-rwfeVww...VV-.f,VG Q., 5-V.-.. .1 -.V,:--...1-1.-1.- .-1V.1w.1Q2- -- . V.-, -. , .X ,-.::L.-.f-V-.gf1.1--1-.Vw--V ..-1.-,.,-. --...-f.- .-- 1-. - 1 -. -., .... . .. .:- .1--1.1 Hg, . fx. wiemkigz--s:.s-2'5:', WTZ.---VVgv1'-'f2???L-few I "'?. 51-352 :-- '31- 3 , .1 X 1 r w . -X 1 --4.1 - 1 - ' V Emir: :- 4g .'Z1"X XV',!f.x'-if-2'f52f'235? Qsifszjgifi f9w5s'3..sz.z-fegffsxg'Xfipif-1vg3"'Qvsf'2852-25.-251.72-Qi2.s3jg.-g155I1:32li-215QSXPiif33513213-Eff-Kfsazggfigss-QVsf-5' . : 31.1,.L,-V..-::,ji,,:-S'fA'if17f?i?5?f-ZLEAS9 'ani-EFS5-5-'1:5'.15 'iw'-3" "wi-1 " W-"','I12 " ' 'L 5 -- .V - 1 ----- . --1 -- - 211-1 1 vflazr -. -milf-1----.eV ..- .1 . . N-V.-V-.1--XX1X.::-6. - XQ Q- --- 1--1:1 - ev X. 1 --,, -- .. ... --,,- 5 gqfff.:1,.5pf.-1..iwvgfwg--X.Xf21"zV-V--VgX S- .,--Qzfw-."1.-wg.34.11.1V.q-z....X31V-g,.-g.s1,.g5Q.V- .sw,..:-- --514.sg-mf-V.::3i1.1g -Viz.-f. ' - 5 . 1 --' '-' -" 4 - V1 Q 5- ff--1 - - . -pa. - . - , V - - -. X , -1 -." A ,1ia:f1.E:f+1 Vi ' . -"-41 -w-. 1--fm ', .5---f-V. . 'Q fy -2"'-V7 -1 - , ::X-..'- . :, V Q1 - WQ1.-532559 ..1QgXVggpa2'-.1 1-2-11-sw-11.1-g -..gX,.- .1--V.gs:ii.gVif3f-tif?-QQAQW1 ww-mlekiifgii-2191fi-2.1-21'..'ff-',7--'V'1siii 521:-ili-?kw.42M1a2V'gSi721224lei-Q9 V -,-1-..-..-Z.-MV 8 --3:--.2 ww- ix- - '. , -. - H ?5i?QN"15f -viii-.-1-M-1? -ww.: 92-Q.-5124:-.m .V'-Q15-11-51--V1-vii 1 - ---.fe-f.-L.--w mu -'iw -2 Q-1.--...-1:1-W1-1 1.1 V-z:zf.VV.a--1-:1f..-:1-.s1LaS:- 1-1---V . - is . '- - - . .- 7 - 1 .. ....X-ss- 1.fxVV ,..4V.:-... - - .2--M1-if" Sf' 11---1.-1Xf--'w.',-.Xv----Va:--V.-Sf:-.Vi-M. -s.ff-1-11...-V1.---1.5-Q-1:--.f-.aa-11-1V2-V-1-1--1-Vs" --1V.-f-.1-.1..VVf1 -gg.,-1....VV--:..,f-:--:.::V1V--1.-4.1.1-1-.Q1'--V.fm-r--5--1.-.2-.'-V Q-am - - . -1 ,. as fgf-11-.1-..:11...-va' -- .. 1 V .V -Vigw . WX?-X.gg------va-.:u.X5gV.Xi .--1... g, X . . . . - . . -, , can - 1 a -1 -2-1.gf-My-.gvv2.1.-V...X..-Q..-1.2.15:-.V-.5.V.,-.,.-.wav..g...g.Qff--QQ-1. - 5.51.-1-.,,,-1.31--.V-,f-.X.V.., .www-.5 f-.azz-sw.-2--.1sQ--ff.Vw-.125--1.-w.1-.V.1-fe1v.fV1-sa-. 11-1Vf1f-:-H-.fe-V.1.-115.5-.wr-W am -sa.X1V15aM,g1-1-191-ff.gge--- V ,...-,.1.- -..,-.-1-.. . .. .1 . i1 'L -.aw .r . -.1 - S. 12-.fS1.Q.2.122-g-es!-.Qg.2i-fafaeV-Vwe-V1.5-5.22.-A?Q-aw--Quigms-5:1125-11. -1- wr1.115-f.fQ-.1-.1,x:2V1.-gf--.-if --"-.1...L,-V.-1:V.-V11:11.isi-22?fi-efwigz-5-W-12-S---1? 41-551---fSf?'sf1-'ff-14wsf1es.f2:S-1-wx-1-25Y,-2:fwaf1z1-E'--222-'i.2:1s W - -3-252-X5 X -1 91 mv-.-H11--.V-wr-iw.-.1p1--HS M5641 431+ ew wil- 'gem-sfwfw-1-M-V--.11--Vf...---Qm..1s.w.-sn. . -1 X-5-1,9528 .F-1-Q-.VS-3--Q24 -.zqff-1-fn..--W-11.15----fre---.mm-V2-MV--f1---1-wi.-1f.wfm.1VVa--1.g.ff.gq1.V11....-em Ls-Q1-V-Q.-.wmaz.1--...S-1V--.1-,V.Q1V-..,.1.--1.-2:-12-s.1-.a.S.fVfm.5eVg., .W 1-wr.-1s2V..f1sVg.w-m-.-wV-.f2V..-1----.q:...V1 1,.g-.:QV1.s-- 1-Vi-112.-.2 --V .,g-H-s-. .- -f1Ks-iwsiu-S-Q12--maven vzfw? wwf .51,H--251QQ-w-isk...s-ww-.w..g1V.V4-'V-.f1wl13..-zkmfvw-M111-1.- H--s2V--f-s?1-1?--.- - --21-2-1.539wi-V..-mg.---Vim-.'...M--11.f2..c11-Ve-ww.---we---1s.Vg-s..e2-1.-avg-Qseiwx. .. t1Vs--V:--m-P::V.-V1---feV.e1g1,-f,V.--141---V1-1-S,1VV.w1V--2-wf-111-551---aff -awsWaff11swffV-.riff-Vwfekif1MV1fs1Sw9F-Q:1VV-w2---Ami'-Ie-2.115-wxfdfffsff-Eggs ff' 22,5-,..,?Xg5.Kg351.,.1Q.1m3h,511nX.,5iXifb,.,.,V.g.,,Q1- ug-... X..,w!,,.V- F2-1,iX.... 1,.,,-.,-1..X.gg.5.1gg..V..51q.ys.m1g--VV.1-vfrimwinva...,,...gX.3115ei1V.m.Q9-S.21- -wi-gXr1X5.Q.3.XQg1,S,a.1gge-..,,S-...1,.-my,1.,,.g.gXv,.55..-...yi...VX-1.5ww,,.X,,VXVg1.-3z.13X,,2Kwwaq-1.gm1 .Ewa-. sn-. .35.51.5gs..1..w-12.1.3.--...,-.WV.1...1g-.1-,.:-11-.-.-1.1551.Vw-wixggss..imgQ..1:5211-.2132-1.-152-11-21.,RV-11..,.ww.w..S.V.-at--iv-w...fVv1.V.2?:ggss..va'-WV1 .. . .XMmX.E?EW..QXm....,.-1V...5-Q..g-wi-JXASEK ww. ... .,.i5gVzV3..g.....g1-..g.s,WXX5V...1.-V51.-15.11.wa.-.-.gqX.....m-gg1g551,XX,-gWi31,g-1-MXSLWX.. ,.X.,i,.,X.fsgmLy1g.g.,f.g1X5QQ,i..-,........,..W.5...S-..,.iwWg...Q1S.X.3.m.z.aWV.i-.-,.V.ggX-.g5,3-.1,-.wa-2-fafen3,1-5.2-ww..-.::.1,1...1V-.ef.i:1:1.-s:.S-.1L-11-11-gas.-faf-f-E-K-531-:1Q.gX-may-Eumwfg-a1?,g:-we'f?f-VJe52-S2-fS1122-:-.-Q1aw-3-1:1155,M1K11mi-gg17fa.a:1f1...1-wwafii-ffgavn? X .M X .X,X,?1w,,-5915.1-,.,,-.1..,..Q.X..,i1 12259 395 1 - 1141.32-.-E,w5gmV..sgg4..g-5 gs-.gmx-.1-...ge:1,,X1V.w..1.VQHXX-misii--.X...wi-2...Q-.-Q--Vgmfgfw1S5f-1fX..f5zw:w1es..E11a-5---...VV-W-1-Vwa.-vf11m.1fg1g-eV.V.w.1-11..sg,-2g2f.- .1Vs9..w51?..1..,.,gX-1ff.f1-V52-gm.1g.1e.zV,fs11esV:-wg-V-...gg.11,,V--M451.V.2.1x.wVVvg,,...,ff..1-23.zs.ml.:1-.1-za-1--31112.21ww--w-11:-21.is---V-,115--1-f mgfaay-1-ws:-is---fiiig -. 51.4, 5.515337-e1,XS3z9:g.1:V-af-ah-Q..1.Sgwi?l.3Kfaze.gg4-Qgqjiw? S--V M ff VH- 1 .15 -9.wf1sr-as-5-.mi--.asa --112,.W-1.1-K..-21seVzws1511:.1--:ra51s..1.f-..e211,QVSK--nwe .- M1---135517 .Q--.V--E-..,.-2---rw.-.iw1152--Mme..V-.1--2-1-1-:11,5VH-51111-Q-S1ww 'Q-s?f3,aW1551-Q-51-21:11--2:KfS-.w-92wf--1:.-2-1.--i-,-Vw,..f:V1-V:..1t..1w rw-12-V.:-sfa...:--9-z--..2vsf--m.-..-:Q-35.55-1-2-V112-1-:V-gee...-xg,z..2-.Qmf2.-:1gw..5..-,5V-1-15-.iw-1--.., .X . XXX XXXXXXXXXWXX. X. X sg. XX .WQX...WXXX,XXX.,XXXMX,XXX...X,7....,..XX.XXX.XXXX ,.X-..,XW.X.1iXMX.2Xi.XXgX..1.Q-E3-if.-X ..,-,..,-...,g...,XXX.XXX,Q..,.......,.X.,....,,..V.-....., ,...V.,,S.......X,....-VV.:--ww..-my-1...n.....-1--V-.,1--...W-....--..-..,-V....,,...--Q...-.V-.1-...-..-V-...V-1...-11-.--.E--.fV--1-1.1-.W.-.M.-1.V----...1 ..-1....1.-....Vw--,..-..f-...V-Qs---. Q.. .gm-.1 -- . Zi- Q1Q-w-?-.si-fas.3.1Sf..--V--iVQ1-M.-55.-11.-1.1Vw-SE..wiivg-1 .ke-.s.vX-1-V51-..,:Q-1..-we..,-..1S...,.,.f1..g..Q.f...-1-..,S...fX..-.X.1--S...V-21.3 gs-Qs...-2-1g,f.,fX5.,..-Vgm,.ww-Lg...-...-Vs..,.Q.1-1m.wV,.1w31...-s.3f-.,,g..-55.5..,-.5.1-Q1-....w1....1V..,,F--QQ...-x...1..,..1,V.--..f.,,....1...,..-V...XX.1V...-z..--5,-.,1X?.1g.-51sV.1uQgQ-V1.9.g,.11.-,g1-..-V-sw-...ZLL1...-1--1.--af1--V11-2--...---1112.-:SV-.-w21-'Z1-ms.. X . 3.VssQ.wa-esmhfz.-VQQX..X,3........m --rg ,Xp -'gg X3 .gg g1Xg.g.g.w...3,.1vmg1,111515-1151.11--,X:3Xf.:1V.5,.2-.3831-.wx-Q.2392--FQ--ggQMS-3?.e:?,5-a2w.e2.i.5-1my.. 11.-rw..-11.V..Q.fgg::f.m.fiHfiV F1saw1-51-25-.Q-Q..gi-1mesa?gg--531.1-mseiaigeasxf-512--2512122 -ess-21-Q-2-at .2-S211-1.1112-asQ2T221Q113121:1:Q-wiQss--5-e-,gas-2-1.-152.1555114111223 ex-.1f1V3151.--1-1.3-LmszmswiLwfigfsikf-mgkizf-EN Q.4.1ses..fg.g,.2ggg,-SX1..Vg-543-45521.g.X.,Xgas.,1X-2,12-35,231 53595-g-Ggw.,.gJg,g-3.51121bg12331-..LfSLiQ-5.1ef1g-gz21f.51g..-.i.1g-fa5ef1agQ:-1FQ.V19-1gaQQ.1gS--ii.-.Xggig.-X?3.5352-X1V..w5gfg.g11V,,gsgTwr5S55.4211-12.-,-mg.-5,,-,gps-1,11.vis1-1.-1.is-15we2.1fs225ig-525-3ewis--.Qmgfm-1aE5f?gw...32.-1.-7142-11X-151-2141waf,-1V-i2.f,ff1--.1fs-.1.gxiii-,Q1e5L?11if2IQ.FQ?Q-?g-5.1221ig9,5-swgwz..-.5-Q35-.KS2'g.zz-1.2--Q-...iii-zzwi?.1f2111--7.5221-1i2sfiav4si'zHi1gati-sa-if . ...ww-1...-V.X.1.-.,...1VV.-..V.1.,,1s-gag--1-e1r.,.wfgig.-1. V was-1.2-555515 --1-1 , - as Q-z..n..1,..-Q.-.z..1-.-V:1.-...Qg1.-:-.1-Q-.evm1,,wag.1-Q-V.121..g, ..,-pm--. a.Qffa...1.:..--..,-fm.eVg,f.1Xgg,.V-,-Vg...VV-1....X-,..,...-f..-5.1W..,.1-.i,w5.-.-.1.m1g .V ...- ,,1,V..V....zf.-Vg.--.-f.w.---fp-......-V- ...qw-gm-1-. t.-5-S--fm-.fm-.W-fe-12-1.1-.1,.f..-me .1-V114we5--asf---zeVs.1-Sf.+21aYH V ,V5...,..1.,-..Q...1,--g,...- .YS1--..,,G , .,XXffg5s 1.-g.1...-Vu.-QM 1. ., ..-1-Vw.Sq......-f1,,Q1V.11.i---Gs--.m-1-.1g-sfE.--,-----1QQ....mQV1 ,...-1-..V,-f.1..--V-.., .-MV...-V-..--.,....-.w..,1.1gq-52.5-.Q-1 -mg--..V-.-1-..1..--., .M-......--.V-..,.V.VVV.-. .. V...,-..1...-,...-....-V-fm.-ef. ..,-W.---E-29 .1-www-1...,--.V--eg.:---.1-V.-..,--Q ..-....-lza1-.ff.wa--.xS..,.f.-S---1.ww s-- 111-Vf...-M--..-...1-.--,-V-.1-5-V,,-..wf1f.sf....m-1..2-ix' - fa?-f. wx-W1--fa. .1-J-E... 2-.-1-.--1--1-gs... 1.-.wx-V ,Very'1-av1.VsH-1.2--5-gg-.1-ef.531-.1wV-.VV-.w---f-f:-Vff-....--.:1f-1fV:V1.-1V-.--..V.1V-1--V211.1---1.3-V:-1.1.-1212-X--gs.. izw-S-wg.-1.2-132.ww .M .1 ..--- - --YV.111.1.-11:---1ff--.ww-.f,.fM-fevwffsf-.S-1-1-V--21W fV:mm---22-.fuf-f-Y1--iew-1d-.1--M2111--Qvfbl,-.2-1--'iw ffifw-fi--2123-z21f:.?i'11.1V,:1e-11---iii-15-2-FZIwxiigfzesff . i- .'1-W-'F -' -W - -'Y-l',S,-Eff 1433,VYL-m1efa21.3f,---5.51 Ha-1 -li 215531, 1--fl ,ggi..1S'1.g-5aUi,.5--j..51-fig diff'--im---igiz:1-22-555.1-V.g1ii'zz-sgAges V. -V 1.1, - ,- 'hi-as-.1..V22'L5,sf.z -1-.1--w-.2--I15.12-sax-aff-ZQSEQMQSQQ-Q511ij'Vg.2zeiM1s.'-se- wa.:-,ze--z.V--S..sfL . 1-V ,fi-..--if X1 --ez-5-11Qgi-Q2.ff.2gw.gj1:.:a-2'1+--2.212-.-xt': --" X . e-..VX.::f.sg....wfgg leaf? ---- ISPTL- . 'L T115 - , 7.15-'555-'TL-L?2YT+5W?5",fi5f759:5?si:SliS61EV.-2?7.Sf'S3'Esf-Y-IYYQQV:QV--'fe ,E':'L-'T' " Q -1'E,:'i'i1lf -1: nf 72. 5i?L-'3Lisp,iiQ5..S5E-2- -5-i-'ii3Z.a'V.-Si:-' .:E1..1f -1 5 , 1 'F'.'i?L-321-V5352-QE".ixfSiiikVii3-S-'S'V .P ik-Tiki'-215155if-V25-53-f'---57-V725 - - 1.-'5 -hliiifuf f?155'Z5iV59'- 1 sf1g,'a-1--2.1-1.1- Ve-V .-Vgasaiaf-fy---.1-53 -qu..-ig.-P..-iv --Vqgg-if1152--gggseej-:gg-1-212-1-1-gig-3:1-g.,5.gX.-fX., 1 1, ,.f..--.5,gse.2g...g.sqiia-sVigie.-gg-:-15-1-ry ..-,3:ef.:gZ-.-ggi: 1-lim..-1,,i--1.1-, ..:- fun:...---f.3-Q-1?-ig.:322152 1 - 1 ' .VV sf ,zzszfxzfl .lf-2-rl-:711.fV',:X ' E52-1.. - .ff- ..m1'f5.151-2V..-3'zmf-5-itQ.wg5fkgsgmi-155 .5-1.5-VX 1 .V X L X -- 1----11.-. ...- SV-, ..., X-, ..., ..,,XS .,., 1 1, X. , .... ..-- --0 :U f ill .l5iQ.1. . 5 .1.,..,, .91 .X.1 ,., - V..1.:fa1si2.V.5.rV..:1--aff--13 .,,, bf .,-'V V-V AT'-.M lbifig. :A51"-1i5i1z..Qs1V-vi'X-U-511. -1--f31ag,. .-V.f .--1 gf- A ' ..-- 1,, ,.,, ,1,. . - .,V .'Lf'Gif6-fFL'V-.ess-ffl.. --1-1 ..f,s..-.V.1-1 ,- -V.1-..--V--VM.-.qw1.-..-V...E.-igw-1-Vg,-xfm-f2 ,--.--1 1z.1:V -, -- 11 , -.1 -,.. 1fV., . 1- --.- : .. -'---2-1-Q.-1-1-3-I1V-'------fwfr li: if-lk. fig xi: . A'j1,:l, ', K . -Q Qi? sf 2:1jFgQg5 YX1?fgi:1.5iVyz1af2?ilsifibiifiisyil. 1,Ly2,fwif 'Q V., ...7-fkgiiill512.52-.Lf:3XjXiifR?57.lP3.gf235'iQ.57M:S'Xgs 1, ,Xy.'- L' X, .LX X.g9XX1f,::jQgQ5fL?'biliwlljigiiflssiil'lS?Qifk2fjQ?i5YjE :-..j.-f, "A ,: Q1 VT .Q X Yg5T:5f5'QQfifi?Q35f-ZLSQLQHVQ-'Z z'7j.rz-ff -'L21q:i.:g1-igii-.5319 liiifaliig X - 1 - .ig35'X1V--353397.X,-5-. , , V -VX? ..,, F-25Xg1q,X,:fy..l5X aww 33255 .1 X:g"jz:531jkgg:st1 ,gpg ,gyigws 1'-133-',, -.7fj.- wr by ', .xy-1Q.i:V,'..lg57..rjXgViiz.Lsi.3zt11L?vzEf:Slfi,ELs -U,EZPSS'iIQi-.Q-171-51.9,'Wil'31-V".1. .J -5257lsffiwksif1sV":5lT355'!lE2..:ee.,z.usfffrii 55:59 'sr' .... :Vw-S-V' -.V5f'7"'-gsifkilfif-V7 755'--TLSM-I-?'L--ii-, Y " K-5 V -fflSf!-Wfi-'iififiyf-SFX 1 ' V XX... XE.,15X,3..1.,X..,-,,-U., ,wM.V,.Xg.XXX,Xm.MXX5X5g,,. X, XV A5 n5XXX.XX,5VXV,,X1X,.,X.XXXr3.X5-XQXMV..,..X.1X..1.1m...,,iglX,13-S-.,...X.5.Xg ..,,551w.,i....,WX,X.mQg...LQ-12V1.fVu...-1,V.1QX.1--.asp.-,.vVQg,b-1. 5Q1g.Xs.g5x--.--mg.. ik,.,a-.fX-X..Q.,..G:1X5g41wQg.,.:1,-XVVif,11-V..1.1--,V..--1.2.----.Xghsfz-1 52?-1:..gg.VV.1.fezf-fm--f-eggE-g..,QsV2-V.f-tVw an wg-.,.--1 ...wg ,.f2-,11s.s.gwia?f1-1g 11--f-.1V...wWf:5,...-ifW..-1V-.-..m-..um...- wif- Wm--1-....s1Vw-.Af..f1--.M.m---1EQ1f'V-..-.1--r 1-.1-...VV ,,1sw-.w-mfs-.125-.etfffm1 -QFQQ-QV-5.11-ww:Vg-..-1-:M--.x:f--.-.,f-VV-.1--,.-.af,.V.V-1-1..-..gyV- S-my --551i,:.1v,gi5,3..5.1--.gg--1,1115--.1-.V.,.-,-1.11 .,.,, ,.-. W ..,.N......,,,.,.w-W..-, 1 .--Q-.....-.:5-.g..-qf,,...q51.-,--V1-,Wy-..-.1g.:..i.1-..X. 1--..V,::1.--,,.-1M.Q.s2VV1Vw-1Qgwpmg-as. .,.5-X-iff?-15.-3-. -.WwVM.---f3,-.g:m1--Q-wwf...--VM..1.SV.1.e1--,-..15....-.-.W.:--gf1-Q-fV-m.-Qf1fw-Q.1.4Q-.SSQ3.g- mf,-1-:1V1ww1'1.-M1..1--.-f1.V-.-.-1.1.-1.4L-1.11. - -.-Vv1..ff-sw.-.V--11uw:-Q.-2-.2--.,-sw-ww-11.--'K .1-1 1-.V.1-fz-- -- -111-1--.1 .------.V-----1.2-mmV-.1111-few--:vw-.SVV-1-r-...VQs..-.11-s-QV H- - VVV1. -..--1-f--.fV,f1..5ff - . . -V.-VV ..f 1-., X. X. . 1 . -X...1..1.- ..,,.., .. ,,,,.g, .. - 1.1.,. .1.-.---Q1-...f-V..fq..f..V--1.1-. W..-.1...1.VV.-., .,- -1-V--H,..1-1.----..--.Q- -- .fag--V .-rg:--.mgrg-..21-,..m1wf1-21 XM1V1...-1-5.--,4'K,g1-2.,x--v.p1---ez.-.Hm.f-.-,...i.q.:-fr11--S,-WV...-,1-..S-9...-.5.-V-Sw., ..,.gs-.1-1.--...I--X V.....,5... .....-,.,..mV...m........W.g.1.,-1...1g1.,.1......Q-..,...M...,.X,.1,...V--.V...,.V..,.....,V.1.1-1-..X1m.X,..,m....-..,...QQ.55 ::..f.1V1zVw--3.2.1..,-Q-...,V,...gz-Q.. .. -- .Vw-.RSS .1 . X.: X -...Q-,..,-9.1 .Q 1.,,X.1-..,-.mmV1w1.....X..5,, ..1,,V..,.-..,.XT1.1,XW1,1.W.S,..Q...,,,i,g.....X,...11..,1.1gXI1,..,..,,, we,..-11...--,...1-WV..,..1X.-.,.-,g...,.,.XX..g. W....QXS15-.g,,-X..e:-5--ga--V..3.V-,ff..w.N 11..-.-f.g......-- 1,.fV..-V..,Vm,....-- --. 5. ,-...V.....,-w,....VVQg.b.,SYM.V --.,1.-...X-VVQWQ1, .,--g.X.V.,-...M--.X....,,.VgS...,.Q-35.5.16 ,Q .,,X.XX.g, X.,X.X XX . :XXX XSXSXWXS X. XX XX.,,.yXX,.,,XX,.,..X,.X,XXYXXX.,.,.X.iXX.,,X.,X.,,,g1 X, X, QXXXSXNXXMWVXLXXXXX XWWXXQXXXXX.XX.X,..,......2,X..1-..,X.,,X,...g.,,..,1 ......-1, V-5- S..-5:-,511.11,V....1..5....Q-1..1,.1 ,..-,...-..,V.-, ,.V.1-Vw.....,..V--..-V-f.-,.-.., 1- . 1 ..m.X,,.Q..,..,wX,.,,.,.,,X.... S . .. . ., ..1.X......g,.s:f1,- M...-..,,.., 91... ,. J- ..9.,QX?J.,,,,m1. 1-118.1 .-.ai .M-.Eff-1.V-,-1,8-.f-...1-1 -3. ... .-,V-..1......V-.f.. .-.........,..1.... V......,,.1...1 -5.1,,W..-..,1,1.-1-1...1..X,......,...,.,.....,,..1VV.S...V....X..-..1......,1..f--3. W1---..V.,--..,-1....1,1 1-1-... ..V..,X.-WW.. -. 1-V. Egg...-WX. .1..,- S .-..V.-...W-.Q...,.X,..,X,, .K-,,5.....,,,XX.,.,,X.. .f-.2-1...-21. 4.-.., X.. ,...,,.,.1. ,.-...Q 1... ...Q--5-1 ...,,,,,..f-LV .--we-. -V...1.--Q-ff2gg..m-.Sw-..fs-.WV--..-V.-..1.-. V ...M ..:1....1.V.w- -..,V.1.-5V.VV--- .V..,s-- -em.m1.1.-..---V1--V..-.Q-1--....1VV.1.., ...-11.-.,1--,..,---1-V..-...-.. ...V-V..,.V-M-VV..e - V...:qg1fgH..V.wV1-.-ZW.51-...gg-Q.-Q.,,.11...-QQXXZX. .. ...XXX .- . ,Q 5,,5a....g-ga...X5Sg1X.g,..1.-.3,zgg-,...,q..,...Q1-,:.1.---11.-XV...-M .iff -,V.-Z..-1.VV.kff3.,-Simmwwxz,555-ggwimVwX5.gX..2fXg...1..s..,.V-6-,1-.1...V...2,13.V,V...V..1VzV1..:...,w,,.a.,.5g.gA X-g.-.3-gf.-.1 .13x.Q5X...X.s.W..1-V-....,-Q-W..--V....,V,,..,V.--,.,g1---V.1.--,.,.V-.,Gm-V:-5.-11.11---1.151- -wmmw1V-.2'Hw-V...z-Vw-...fe-.-V1-VVMVQ--K---VwV1fV1.1-.-.-VM-Q--3-as.-.2-1-ww ,M X. M . ,. . M, ..X.,Xn.,. .,.,, X. .X ,. XX ,.,1-..x...,... .X..m-1.-1-5. 1-M..-.V1-...X ,,....-1 f...,,.....-.-..m.V..- .1V..,-..-,5--VV.s...q.--V-.g..:.h-----1-V.-aw:1-.., ...Q--. E-,,,X.,X.XXX..,Xg.., .X,,....,5X.,.X.,.X5,F....p,d....,X. XX., -XXX... XX.E4gwMXXX.,XXXXQXXX?,,-XS.,.X.3XX,w.,.gXg.5..gXQ...,-f...3,515.11-X..qX1XQ1-.:1.X....--M...11V.,,1-15? X..,5gg.1X,,.gQX M ..gX,5.m.g,...........,,X..--...M 1-VwW--.V--.www1.5.55-.-fw-Q-1-wwe- V-.1-...QV-.f 3 1.-V-V11f--W...,-..-V---W..,....,,.-Q.-,sv-Q.-.sg-5. --1.1.---.Qs-.,,.g,1-V.-.Vf-..,V.... .1.-V..--.--V,-, V.,--,1--V..w -V.--,..--V---....-is-. ..sm..,,XX,....,,....,1.W,,..,.,X.,..g...,....1a1.. , 6 , ..,.Q 1.,,.1...,..n4..w,-..,.X g.......,,.1X.-,,1....X,xX,..1Q,..w.,X.,,.e,,.k,,...f g-.1.1.., .9 W5-,?,1 sg. --.-WX..-.L..,... Q..V.-..-....,...X....1.-.a1,1.-.--nsas..-1--15..X1-1.1Lg--.,f...,-,V.1.-.V--.1.-1-...V...1VV...-..-..f-2-..-......V.......,.,.V......-a..-.,,-.w........,,....KV ...Q-...1g.gX....,-..,.....-.1..-.-..V,-.V-..f....,,,..---..1V-1--.1.,fV..1....----VV-:Q--1.---Q--www -,Q-E. -Vw mu., ,Vw -,lg-V...,-my . . X,,,,Xw,sw1ns..--Wag........s.,.agX.q,.,g.11,, ,-.1,.1., 1-...WX1-Q..-Q ,1 XMQX .X1.1f:HS-1-, 15. .., ..,...Q 7 1. Hs- 1 1 ,.., ,,..,X..,,,,..,..-X,.,.,-V -VV--m,1..-.VW-V .1 -SV 1-H1V.ev1f-v .1 g---V.-.wx-s-H?-..2...w.--V.1..V1 ---V-.1.-1---,.1,.....VV- .--Vw-------f -ff--:--vf1VV-M21-2, -V1K..qV..11..1-,......V.. X-,-....,e.,.1 ,,.-.,1..-,-.-1.s..S,,,.,.X. , ,ww .SX .X -..- lm.,,1w.z 51. .V,fV1.a.. ,.--.s.,X. X, W,..X,,, - ff .. - .., ..,,M .,,.X, ,-..,-.551 .W 1.8, ...., XXX..-51. 2+-.sw VK,-af 15--.-1.15. L-..,.Q-11,,... 1. ..---J--V-3... -W,-,-aff.-.wg-V. -- ew -HG 7-1-W - --x --M-11-111 --1--1'-f-1--Sw -S1-V-----w2?---s-1-1-sV--1-2--S ---V --1 V11---V-Vw w--f-w-f- --V-"2-wk- 5 M -.--.--w-..-Maw-.-112621-1-51.1-.VM1?ww- - S-55:1 fu-ami-FQ:-Q-. 11--11-wg--V.--ww--Vwww- -rw --Vw-1.58.4 ,1X..X,.,.,. ,,.,,-m,.XX?:XjX ,..1....,,,..XXX2...X MX...,.-,..,.1.....,.,-X...,13.,,,1.,-.W ,,..iXXX..,m.X,1sXX.g-,X.egg5..., ,W--..X.,..X,,X,..V,.-3. ..--1-1,.M..1. -.1.-...Mm.1V-ix...11.....-.1--,-5.1-::,.V.,,,2 wx- f.-..,---.-.1--y.....V..1 VV...-....g.--.Se--.w--QV.. .5-Q. 5-..g..,wX?.,..X,....,,1..,.,,....,.X1...X,..,,XWX.1.., X. W .., 1, . ,,..1Vx--M-Sm-..,....,.XX,X,,,1..,,..V.1..V.,......,1.,,.....H-.1,..,1.. .T-1-.5 51..-x11-.....,-..1-5...-S.-.,,.,.,........,...,..V,X.X.....,.....-...,.. .1--WX.,-1-, ..-.-.....- ,-.,,..g,..,..-.-,V.-1.1....--.-.V..-V.......,...V,V.1f-.--.-1.--.1-V.-Vw....Q.Q1.-as-1-..--1-H1.VzV-VV-----z.----V-1V:.1...--V13-,--.---------.fV.-.V.----.--.-----.V----.-1.-ff--ww----.-.-.1 X ..,.XX ,,,, X. .. .3 X XEQ1. X. Qs. gg .WX -Ny.. gm... ,.. X...,,,...- ....qX,.-..,,...,f.,.-1.31X...,.,,,....1-..., ..,...g --..1gs. VW... -SQ. ......... V. .X ...,.,.-..,.,1..S.-V- .1..1V-1-S -2V-S15-XX.-,1.X,.1.1g... .,.......-,-...,.1.V-f-...XJ .. ..... . ...Vw --K.. , .ww--.-m...1.... g,,w.,,X,.,,. ,Wg,..,.g,...,.,.5.,,...-4.V,i.W51..X , . X ,. ,XgX..gX.X3y5.-X ggX...X.13,..,. ,X,,...,X,....X,,...,,,...XXM1,.,., VM, q91,X..-...X -.,...X ...,,.,X,, .-.1-. .,.,,,....,,3XX .E ms,-1, 1. ,X,.,...X,.g.q ..X,...,1.1, ,.,.... .,.,,,,.-.1. 1a...,V.1.VV..S,.-Vs.-M.. V51.--V-1-1...W-1-1...-.-f....Vw1---.-.1-2,-1..-,-.1V.1.. -.--...W--V. -1 ,,......, ,.XX.,.., .. X X X ,, V .. .-V-1. w. . .1..,....,.1, X. ., X ..,,X..X5.M.XXX,, mX.,,,XQXX,,,, .,...,..X,X,,..XX.XX1.,,.,..,,..,,.m.X-V...g -..1..,.1..,,,f...,5,,..,11.Q...X.,,,.X,X,1,.,,,,,1.X..-, ,.-.,,a...........,..V-...1VL-vw-1...-1 Vw ---- 1-.., 1...-1. .WW-1. 1515 ----...,.,, .- .2-fx..-1-a.1.,f-S M-,,...fV WV.,...Val.-.1.-....w.1--fef1gS..-1... .... -.--,M-..1,,..1,...1.-.., ......... ,--....-.---,,....,.-.N-,... W-1 -.-1...-.. -W.-. V.. ..QV...., .. ..,...M-..,....., .-.-.,--.M-,.? .... .1-,..-,. V -.., H54 -- Q -A 1- V52.mz'1. ,e,-511. .H-X...rg -,Vw--' xiii, xx If ., sg- , X -S, 5-3,1 1.-.Ji-Nlsrm.. --1-s2zV17 53-31-1'HVww.-W:1,s-3X,,e:i7.1V-A-zwsgi. -1m,.:gQ?fAw1 ltemwe.1Vw:m5gVQ:5vu-m.g.- -fzzwggzw. V1-,-2.112-W -mx'QW-MSFNik-fairs--2--fwV1fs' Life?-Am icri'?-'few14-93.4Vw'-'5.L:w1z.xL.25v'1-.QV-.1'gfV.-9,11-S'1ff,--W11--U'---3.1-sf'-ez,Lsfiifwr-.55511--Lfiffmff'-'-Eisz-Qsiw..--191.1--2-aw?"-W--:1,-1-WL.:Y-T-.5sLzfW-'n-- W--'vlwwi-V 5921 f :f .,..- , ,,.....-1.1-fmfwhksfd. . .,..-12.....--.12-...,5.1.1--.-m.1...---M-...,.. X-.XX-.X gat -- X' ' gw .eafsK.,-,gg-,X KX ,K X- , XXXX - XX. X. wffew' 'TH ,,.E'iiaK127SE2Xg'X55T-3555 , Q X- X-.Xf1X:',i -,X.ii:Xfa1ea.X5isgQg:i1W .,'.1-af3?f,lfsf.Z-'fif41KffX-343522553 M .. X .i-,X..,,.,X.,,55f,XQ,gf., XM-X,X,X.ff5KX:- K ' .ws ' ,3,f,.,XX.,X.X- ,XE . . "" Q , .W-?'Q'2??f'JX?,zf MX-W, , FEA , . X . X , , - K , X- XX.:wa-1wiigsiii.X21-1X,w1m.1+,f12z2i',1if9i2-51-Qi?-'iflllfsfXsiieiv-fhaXfateww-.E:iSw?QQXXg2af2XgwgXE-IKXXXS155feXgef?fg-vXQ,,5,kR,g 292. " Xswggigs. , g i-Mm.QXQWXX1-jf?g,,,,,,,feXgg.QEX-.X,,g5Sim . X 4, 51-r,XXe-,,wy,,5X,-:1..XgfXgsi XXXs,W,f:-,gg f E2x ??S55QaiQgEf1s5-Q:'H-szwxfvigfxligfgfii.izwsihiiiiviifkf:-?'f5s4iXs55XXhaffii'2WiKS11?M'55f'1Hi1v555-?K:9YH0fKSK2i12f15'AW KM.2?1Xfffd?8Kz8Xfw,35QXs.XX.55:Xs1Q MQ: X5XggiXiXS,XXv,X'fias.sXXXX.wkiwi:-X1- Kwgifef . :QSM QHSYMES 53-gfiveagwgf-FXX KwXwgaw5K1fzX3Xg,.X fX.X- M521mam-XX-XXX,-X.-5 MXMX-XXXwaf.!2.X:X.m1-X:XwfX.,fg.X-X-X--X-X.XXXfX-f.X--X:-XSXX-11-22XX5-fXX-QKfX--X,m-XX-X.-,XffLfXXXXXX.gfXXXXxXsXXX1-XX-wma X vme-Xs12,aXXXX,f5,5XX X X X .XQQXQQLX fin ,.mgg,.XXXX,,w aX,QsX.w,wm.X,.zm,5.X2.eg2.,XX-Xggwefw ,. gs 8,155 X. - X,fgiXX -mm XXXQXQQXKM,m.,XX,m48,w,3,X, w,,,8.?25-XSXXXXSSQX-i.Xmg2f,.gXX,,Xm. ijXX29s??'3QfX-wiivfstfifs2X:ffSXfXKX-f-X-SX-fri?--X-KX-K2-'ew'-Xifn W-KTKIX-sw-2-1s1X if-X7 mf-XKLQD:Qzzfzwwwg-XQXQQXGH--Jaw-52' Xssfiwfsy SsHXXX?gs?K-WQWWQEGS Q-sew Qsw'L'R-STK'ZviW5le4E5'2f1XXA1efK SQXKSK-Qsf2KXs51f -Qffi N-EXXX-,Y-HS.-mgefiffff-SXX.:m, ,X kgsX--wfXXXX,,XXgLw-.ww-XS XXQXXXX XaX S -XL-Kwwgfmgeff-.XwX ,X?'eX.2-sfwfmeh,:awL-MXKK-fX17-fi:-:XtXfr-XXQ-Lv--WL-wX-XXXXX,-1X-fQ:.XX-fe-X--rf 1-X.ff-wivwaX.1fXeXf:3:z,sX-.yfefwXX fXXXXX?g?1,QeL Swdwiavhss-g,??XwfXqX XX? XXXL?-555 5222 5ssXX.X,X:-X2www.-.X-Xg?E:.X,XX--X,,,XXXXXX-zX-X,.5X,X,Xs1f Ugg?-gm , -wi.-.Ss-XXf,,5XXgX3',X .,.,, . X, Q Ag1-kg2,spXfXXSXMg- wX,,gX,1sX X,E,QE,XeQ,W-?LfgX-.X-gy:a,5,XQ.Q.. W4 Rf?-iw-XfifileffXw-2X1:i:XiffXYwil-ifXKZMXEX-1-sf:-Xlsfiif-X-ici'KXK-sef.X-X-aw!X"22f2K.Q1fX1Xffs-X111-Q2--:WKf-2-fiwfihwf-WXXGWSQXFw2HvX-K2'f2XisXwXgLs2m?MffX1QXX23XXmw- K. X. mgfiixigi'wglzzx:sigf-SgiXfLQ1gg2i3gXY553gKRfigig-Sflii'iHLiv:'E3"gfQg1il5f3gSff. 9 -XXQ:Xw,,-gfzmxffiwm , X555-X' KX- -X XX-,aiefwfsffgis-FXXQQXXS?sX-XXaXaXggX:XgX,wsz- gg5352,Qag,sgg..XzXgg-iss,X-ys3XsXsigz:isX-.4,f',L.Xvs3,XgX-3,,za1g5X5siiXz,..Xv,g-,XX,X,-XX,, .g,W.XS,X,-X,,X,-gg,,X,X5.2X53,W57L,1k,7QX,i3,,Zgw,,,,wia,9?g5?,9,XX.Q55,mXg??QgQ5,gSg5,g5gl5g,. Xi? XXQXAXTESML 5,53sgwfgm55,,,Xqi,,S,3ig.,aww,QXw4X3gX5iXgy5,?z, X KWXXQKX kiifiifmffiiiixsfg'mPfSWiKF2XWX555'5wXX?5f?2?XX5i5f?53iffKS?'2i5f?X-5535? W.1X,-wp?51535:-QQZX-weX-ig,Xgf.,-ai.-Ks,.XM-:XfX-w..qgafX2--X.X-gfgwsi-X,,,XXX-K, XX, W2 X,,qX-:f.3XgX,fzg.Q-.QX.g-?gf,,,.,5,XaXQw. ,egsqwgfgtgef-5,7-wsngwgf XXggg1g5 g3g,qgQ,fs- , X zegm.-QEQQXXX ,5X3gQXX2Agmgaig,-XrgXM,M.543,1gX5,Xg,X,g5,,ksX9g5XXW,g5,,g5g,. M5135X,,Q,5gg,,X5wM5-5,XX,5gw,5ggA,.XQ: ,., X, gX7.,wg5f1, "K5qgg.Q,5X,1XX,,g, QQ, may ,5,,5,,XXXf,3Q,X,,,q5,, 5 , gX.X-XfX.m-XX-.5X,fS::1sX-5KX,.,XX.X -X,.zX-XX.-X.Xfs.X--WeXX,,.X -X,.X,XL...',K:,,,..,.X,mfX,.eXX.1XXXXX-wpeixqw-wi XWXXXXX. . XX5Xe-Xml.fX.X,wX.,zQXXXXQE-wX.mX,XwvXX,-3.,,.,,,,.f,.Xw,X,Xk, ,JIXX-,i,X,,,,,,,w,,,,.,,,M,,X,,,,.,X,s,.bx ..,,g,-m,,m,X,,5,,,,w,gg,Q,, x ,QSM gggwggxiwkkgfg qM,M,,,,,,g.3,K,,w,,,5g,hw ,,X,f,,,R,,,,1,,,L,3,, M-FKI--P-fK"f---KX -K--HX '-KK'-ff-XX'--fX'-f XX--K'KKKX-LX--Kff-X--f'-K-QXKHXKXX-W-mf 'a1iBFXfX-I-KvzfgmKifWgf'Ai?L WLM' 'fK-wkfw Xia meXwwfw-XXX,-XfXXXzXX-X,fXXX-X,mX,XXXXXXX.-wwXXXXXXufXXwmf:X:f.XX5sXzXXX,XX..QsXf XKXXXXQXXSQQ-XXXXXX.:-XXHXXXM. XXX , .MQXXX.,.gSXWq.f,,gXX-2-XXX-wX,.XfwX.X,XX,.X,fm,XX, SX-3-QS2S1hifi--lXX'1UXfi'-2f1eXXif-fsifffH2'1ff'1I-KX-W ff1-12W-'KKK-X'-X--2iiKfKMKX,-Xa 'p:X,X--Mali,fs-zXs11zQXK-wffxv.??'Q2aSw2-35:-XX1XsX2giXXeHX5QS1:Qv-E52-asv fzeffiisewsw .samfs:AKX5ezXi1ii:XiFEs2izzfswa-iz,XXa:.s-M1-iXXfpzw:isK.1bXX-XKXXXX-XHXZLXQXXLQX-KESXXQXQLQFXQrw-S5s2xfXXsf1m:sfXa+faSXQWLQESXXXX' Ss35i2' E'X SX' -2' .X,,,,X,,,,.,,,X,,g,,X,,..X,,-,X,,,X,,,X,,- XXX-,X--,Xs1.3fa,q-X,sz3,gXXX:,-sires,,fm-:,Xs2rX,-XgggvXwsgggwgwv ?g23g5igqXXsfX,gXa-sggg-252555155,gXXfgmXXs,,5.52X-2e.wqgg:f,Xg.z,,Xgg,X.XX,-,X--:WXXIX,-LXQQXXXX,,wg,,Qgf5X.ggXkXZg53,?,Xi,,5X,wS,5f3X2,m,1m,Z5,X may ,j?ggf,a,,gg,Z,.X1S,,5g5iS2W3,Yi,5L WWW, , 5,sgvsff-52-35,2ii,3i,.b.,iX-.-3.3.X.X,X7,...,, 43, ww.,:.X,j.XX.f,Xg,.,,.-gXXX .X-,X.fg,X5s5,X,,X,ggXfy,5,-.Xqgy5,3155?WBXXXQffaXwgg5,Epw?ffgwu5Q,'3lkymy-Lgm.g,51Rz1Q2gXXXX,mJ5m5q,.X,gXXX55,,X?-QQ,,,4Q,,,-XX,XW5,X ,,,,AX,,,.,uX, ,kg55,f,,gXX53X..,W,,,g,y,,X5,,w3,,,:g,5X,,wg5,5.g,gw,gm5gXE3,X,5im ,.. , W ,X,,,:g,gigm,,,MX,51,5,WQgyxagggimgfMgwrmggiw,gj,,,mX,.A,AAXLX , gig,g,,f,,.-,,m..,,.,,.,S M., X .. X ,. ..,.X,.X,X,,S.,,u .mga-gL,X..s5sXj,WaHX.g1aL?:,m5,,glsgyaaiggsggzgg ,,,.mpiwgyQ,XX.gy5m-1.W,,Mm.,f.-M, X,,,.X,.g X.,gX,,X,X,, .,., X52 M..,,,w,1gf.Q,,5.X, ,,,2-.Q,,,m.JXXM,xt,,w,Xs,yXg,,aMm,S.mZ A 5 X, i,,,.,,X3M,7g,g ,E,,X,.325WM.Lw,g,,5,3.X,g,,wNK,,n,,555,X..,,X , MG. .X ,swiewr-1Kfzsiwif,-XL.-KX-X-SK' XKWK 'fxiffix1233iHf?LfSfffXf21fM,g+2i5fK:gHifsi,e+592Xsaiafeslsywgaia-aiSX2jg5:hqlXf2K-Eiiaiikig,-amen?Xfg.a112f,.eai2gg,.egffXX1-1XXX,f1X,.XXX--X ze.yyXM.XXfX-XfegiqfgaXXX,XX,23391ggXXwQ,XAsgXX12-X25QX.XX5g5gg.zfXX52gXeXgf:fXX?31ffXX fi- R-XXXX.Xiasa'1X?e1Xg, if?SeQE1wg3gfg5isi:3-afgymg-XXXK,sw,ag?5XX:gX11.2-f,,XgK:Xfz31X-X,KQXXSKXXX ,,-- 5zM?,,s,X,s,...--XX:,Xziga -K fSawsLXXQQKXQQQQQMSXZWLSXmeQ,Ss,if3,gsgX:5eig.gi?ZX-Sesafwzvgszsa2.XX511Ee9,16XX-i,.em-YXQQQQX-vWasil,-L.X:X:,g,,311.,-X,X,-fy-X X--z,,,g,Xv,:f 5 X Q,-XX,-AQgXX535,.5x,3Q,XXgg5,X,.5,3XX,,3,w5 U xg,.,g,S,,-,,.X,.:,g.: 1,5..3,m5zX-52-Xmgewifa.wX..,1sf2:mXg,-SK-Qzfmggfni,SQXXQXXQQQQQQQS-X,szg,X5,,1Xg,X.,2fig.:QX,WXXI-X.,NX,gVX,, .MX X, ,gg- mgw 5,.,x,A.,7 .,6,q5B,mw,?5,,,5w3.,,,ggm,,W,.f.m,,ML,,kXk,,,, Mg, V 1:I-'11QX22-1IQKiziwi-Xfigiiqfzbaiw1an-QQ2X1Qf?Svxfn2fa'fG'KisHfiS155IAifbf'5222,vi252195152-fmmXgK,Sem-salXX:,'.XX,b:,-tw.X- K- K "-" XXX K fwggwgfiQmXXfXii!egiX-.QXXXQ-XXWXXXQQY5,vX,.fX .X-r-XX X Il- , Xa-.5,,K-wif-Xaf msgX-taizsaifawiqisgX2X-551XXGQX?22azef2XaiQ2:ggQXKgsi?5i4X,3g5:f2XXag??Q?.eiKX,?aXX5a,:ewX325EK1.fX1XX,1S:f-1eeyXXfLr-aim,,wwX, X.e.zf,z'zfX-fzXgfX:5-we g53Sf5QXfi,XXQX,X-35X,,,,,X5,gmgW,,,,.X.X,,X,,w,,,,,Q, .,X,,,,X,,,,?,.,,,.,., A ! 21.-X'4::'X--K ' f1:7'-X.X:-X1:5z:QKfl--,-sw :gy Vg. wygrfwyszi V X' U. . f . V HX- M - -. 3 gzX.,w1Xj5.sX,.X-az .X3aX,,,,w 4.5, S., XM ,X .X XX: K MX,.sawM,f,:g,L,-g-4.g,,.,.1v., Xp, 5-XX.szseY,fS,, g,,t,,,3,5,i..gXXk ,Maxx 2 G V HW jg? z..,,5,,,i5VY.:XA -vg'5.PXw1-?X1'5,g,,,l,XX, 5f,.V,,t:U,L I A:k,JV,.. X... ,,,,V ' , 2w:e.X V',wilyXGXVXX'ziiffwigs'21,fX?f2,2f?vs----wi?-i2iX25"e5-:P5ESf12?f?-35,1275f2?:XX3S?'?32X'?KfX1XXXX52-S22Ki?-fa-:g2X2iaKwXf,:i--X-XQX-X.XL 'M:X3,,Xg-wfXg.1as1sw 53253-Q55-fX,fKX,.f,,f,,,qX,,Qif.7gX-.,X,.f,.,,-,,,..,- X,,X ,,,,,,,,X, - , . ' X 1.-' -- z1X-fX.f,QeKs5XXK1- ,.p1s- , . fl-1.,,,f ef- ,-XXYKKKILKLY-1X2if1?XTVXf22 S2-I,XX2Kr1g2iX1Z1XX2Xgf,:Kiwigi:..g2szfiiw1XsffK,fU2z5 .3 XQJQQXXI -1,sK1f1g,ggf ,-,qi-,X, -591,3 f' ,1--, .1 1 '- ,.. ,161 -X- j--gr . ' .XX-'f' 'LK' ,..f.w1.as-XX-KMXX-SX1-Xf:Xf21XffXfwXJXXwMwX:Ke- .:X . , fXX , XX ,1XvfwwX,-X-ff,Xm.Xe...,Xff.Me,.Xwgh-Siwgfm,-Wf,X,.X,,3.-,,.,,,5X,.., XXX,-, ,k,L , ,,, - . ,x,,m.,,.,.X.XX,,..,,g,,.XX X,XK,,..,,ffx, .. , A ,X .. ., , ..,. ,,..,.,A..,,,,,,W,,,w3q,,,,9Q,wM ,,,. .. ,,.. .. . .y , ,:,-' .,f,.l.gx-,-'-Xg-,Xiff v Aa.: 1 iv ' Lk -,EKia'73fQf71:??95F9if7LS532EHLSEF?532559l?3Gi.:i?3?iiifX-' zzz,?2Le:X-EbE':Sfii55-fW'ir5" E' , ' , , X, li i A4S?Xis'4Q"ii?S?V1iP55wii"X 3-?i"Qf'R 11-LIXFHKQ M35rKiXs5E23i'X,UXi.Te,.1-45'3lL32Q'XlT2X.5KZ 'EXLSS knifv .flu TJYQZ-Xf-NZ? ' ' -- 4 . X ., -X , , ., ,,.,, - -XXX,,XX.XXXXXX.XX,..,XX,-pm,,.Ww3,X:s,X:X.X,4.3X1,X,.-X.XXs,.g,X.mXX,,X,X.X,, ,- -XXX:-Q-XX:,1XX:X--,1.fKfXew .X,a.,m1XX-SXXL21wXX.XXXQXXXXWXX,,XXX-Xw,X--X..X- 94- , 21-SML-' sKr'fL"lji755 rK"!'2l 9212? will sz" fg.m.5,X fswlgvw- fzlbf-Xd,,.-'7X,:sv'X, , L Q :X-was? .X,,',fX'X A " .,,K, XY.'z.Xs5L,1-,':,X 1SY.?zwX,p xy r.72w':?i .M Efmgifffeg ,X-yy. :XX ,gf . 3-X 5,391-35,,X-Lsm,Xq,k5.X., 1 ,N5fe5.3, ,gy ,XX:iV,v.5,i,V .X,Xi,,u Q Wag Q.W,k2,.,,H,5.v ,M n Q , , i .,. ' ,. , ,,.., ., ..,., M., ,MX XXX... M, W . X, ..,,., ,.,..,,A.,, w, .,., ,, Atyh .ryh 7,,,A YVL V ,W ,,v,,L.,,. V ,, . . ,, . Xmzffz .QX-X375XX?lX-wxghQE'-XXTEX-wifwi2QQev?.+?F5Q33mX.m!s22bwX XX X ,. -Xizf-ffiifilrikfgy I iff A V -. .- -"A- fK ' L, . L ,,.1,.X...:,.fXX,., .,,.. , ,.,..., . , .,.. 4- KXQXMXQX ' NY -1 if' A - 5 1 7- ' Yin gf-- A fif'X.Xz. -,HzX:g,. , .. I -1' XX.1vX.X,fff1-X-.Q-M253 :F ' ,. u 5- KX -X'1',XXXffXX XXXMX, ,f - 9- 'ww 52:1 ww -XXX -J' XX-,Xmfsssfi-m6?5,s '54 w -4' X 1 U 14?gsa1a7,1zXls41T-X452 ' - . ,K ,.g.. 2 ,,,.,.MXXw R... , a:?2WX2?ffsi'ga912X-Xa MX- -f .F . X X .X-w. W M ..,.. XXX X X ,gy-,X ,- - ..- : if ' vi,-, , Q. ,, A M.,..,, -,,,L,kLfg'g.,,m..ui,vZ-. . X ,X,.X, XX., ,gg . 2 -. Ar., '-1-.QW X5 ,- ,XX - 5,4 PM . X-Xvxw, , , an- X5 ,4 .X .,X--WX, .X y: -3 555- 5 -- 4 X- RQSZQQRQ-1X5 -fi -H ' X X ,pal M- usrfggwigg-wg 1-0 V , X, . ' ., ,K "F f2S2f'2Xf!fXg?5,Q if suv ' .N ' K ,,, 5 'I ., X '- . -1 ' .,.1"'M. ,QLX is,-X ,QQ ' '."'. 1 X ,X X -X X f f,XXXX . 5- ' ' , W ., ,, ,, ,. .fis...X,2XX , Xg'g+,Z45,:Wggg--,Xing - g 5 .W . 5,34 XK"xXXgv is :fig gp .W , ., ,f, I. X K- ewggf 3gaXg,- f ur- .X V .Q--M, 4 I W J, mf , if ,, , X K 'K ' U X tv-, X-, X X X-X mam X. X X -T'-2XwfX-XJ win sl-" - QQ ,X X.,g-X-- X.. - .X ,.5wXX,Xg532,gfXX,iXX -W., Kr, Ks - sg 1, X 4" " K4 ' ' fefgz 'ip ' , ,QQ , ... , 1 , -J 1 -gong V31 "'lp5??'i- lkxg x . 3 ,XX Kw X. - .aw-i.e35fiv?gX2g?a a, ' , 1 wfaigzfz-QX. -X .X -1' P W. Y ,... ,....,.X.,X I, M 45, " ff , A ,' 5. 'W' - . - . A ' --X. ' ff . ,. X X .X YQ -ms--XXX --2- ' ,f L ,, X K K X ??X,,fsgfX+rs3X5f"ge .X - ,, ,-XX ,Xaf..X:i, mi . . 't ff W'- . XX -W . X , X. f . Y XM -TK Q4 -- Yr .Xi :X-ff.' 235i5fiiX??E5XX'hTfiQ2Eg Y K gzaffzigzg-QLQXQMQQXX I .url GQ!-I . - ' , '1 Qiijf' fvfjviif . f ' AFL. 1 - f' XW.X,XX,,X.X,.,,f.X5.X,, I . - ff- .4, -X X - fi" lar' -:E,hq.-.- 'wa-f' ' 1 f- ,, -1 19i?:?5i4f'XiigYF:Ig5Lffi if 1 -ffzaXEXiei1XggziXffSiif , ' ', , 7'.,. , fzwwsff Svsfgggwk , ,. , ,-'K . KiX5?VZ5k9ES4Y?if.f?Q5g4xYf' -. - ?' fi.f315?,igeSXg5.,g 35 -X '-r 5S '1 Xgsm21a1XE?,2X f ' X 4 Sw -f gw aif l 1' ' f' 1 ', Vi, XX, "f2Xf?.2Si5. -'EQSEEZLEZ5 X XX ...XXX ... X. . ,., , Xa"-5.127s?fgsI:,g1E.w,:5x'a ,' :iff -' , ' -fi- '55 I " i'g-nviifff-2-Hifiszfs nu. ' 35 fl? .1 flv+.f"-53.,"14- f if: -.,iKiX,XX2i?f XX , , - :XXX-,PQ X,.XX1-X,XK'K 4 W ' ' f ' 4' ,f . , . K' sF t ' iq' ' . X.. Qliisii 4Ff.a'. . - -' ' JVAKQX'Wi-'24A1K5'i:':XX , .. X,-X,.,.X,,,,XX ., . Aw-3X g--.X- X.X,X5ggX.g,gfg - - r 4-auf, - - ' X ww gfwneif ,X-:X X. 'lgiiaiimsig-igzwiqi -- . ' X1 .,XfXX-X.,,X.XXXXXXX-XX. . ,X :ik'XXYQSXXX-27-f'X.XsQg,mQ53Xf -4' , ' 7.955-ff?-IXlffZfiL?ig3iT5Xi " .1 .','2.21-'HiL2'L.',fLXXahg3gi. ' 5 in 7,2 ' - , ,AP 4 X ., X,,,X,,X,,X,-:Xia 1- - . X .. -f,- XXX-XXLXXm-Xsfgw-sXXgqgQsaXX-5X-sszg,fp.se31ggfzggffXgszX,XX,.KgiX,-33,4,,XXgf,X',ggg,L-1,,X,. -,g5,,XX-gX.g5ggf3,gg5 P' ' 1' .. W, ,,.W, .,X5,5-XX5QQwsiigffliiiiigzxiiigZLEQLSQQUE-bzTg4g3,.'K-3-'mg X5-XX, , :Tfiliigi:i"TfQ:iikfiiwiifQEYEZQQALEV-QEIZZTQQQ',iQ55L122Efgfgixgggbggfggwgggimggggfgggfggieigigzgiggfzg,fQfsQ,Xl5g-1ifX,- XHQALX 5.5 , , 'gg -W rl X . ,nf XX .rf -4- l-'- Q, 4 ' XX --X14 X-wife'X55-!vfK1fX21Si.5953-211 i X-Qi 'XVI 'X 'ii 1 X if XKfXl5l3XXL??y'. f55Y?i"ELK5'',?K5YX-,?'1Vi?3Qif A 'T XU9?-' nw . W3 ?"'f'9ifX5i23ifdN-gibiffbz -:'if-Xf'zfT,fX is- X ',-ezffg : . , X X 1 ' f, . YQ 'lK4LK??l.fYKf9?..5K9 .62-3?fZ5?i3i1S55Z7LL?KXQLQSSZX!fz2Kf32'??EisEX ,i5Kf?ZQiQ3?,9?iii,l'- Lf 3L:K57'Tf--W if k'Af'Y3X+w14h'5rXsv5'Wfff?Z" JL- Xi? X' J.-QTXX - fwXzeQeXX,sgQX,,.,yX,,Xg.X,.5..X,X,.X,X,.kf,X-,,gX,,X,X:..,X,X1,XX ,XM XX,X.,,X,1XX,.XQ.3,g,X,,,,XX.2XQaX3-a.gX?XgwXyfigiigg iT5?X-,mg f,W,mXX,?Q2g.z,XX.,,5,7,'X,XEX-, ,X-XX, ,, .XiX.s,,. ,,, ,,,.X,,,,:,,,,,.X,,,.,g :JW LIWH-F'SHXXXXXXQ--XKXX-1KXe-XffK:1-X-M,,.XX,-X,.XX-KX-2.-XX--KX.XX ,,X,-z. - .eX,X-,--XXXXQ-3 .-X-f,X,f2,L,X.3Xf.s-XXXQwWwgwsgasz-X,SXX:1e,XfXXX2:-fsXXX5ggaXXXQ,sXf2XEifgnX.XXffg.XXMXXXKL-X-X,X,-XX.,. XX-,X . XX X-X.X,-X-f,.XX-,XX.X.-XX-xg1Fig?QQ-YQK2'IgQWX,aX4-2.fXfQ,aXf-:w5XvNg2fs133g2SSg.XXXs-WX,-KXXW-XX,.XXWX-.X,XXX-.,,XXf: -,,i.,3,,XX,2 Q-X.X,,X,fXXK.,X,f 9 ' ,-a., JWSXUEKS?-SEifiesK XETW2-ii'fX1'ili:i,X?-1 E 5'-ffi' X-?E-!IL:i-- A-2,5 7-2X'.l'?X A 'X L lT'115X'3?5 'N'-X1SQEis'Ei?12i7LK N57-iii!k?'1Xf5113"1'biJ X'Afq?i7Z4555lfafIQigiiwvixiiX'X'iiXlig,'ffifsz XX-W U 'X fI'X1',. 1' . ' ,TVX QLLLLWL " ' ff: 3:1 i"XKYZ555iiY'52Xl' 1 EY,Q?K?'f,Xfsf-Qlwlss L ' 'M X fv-ii, xii 'X --SX F iv' , -' ' -1 nu ,. X .WX-XXQXJXX.. ,,., -X , v -X , , X , X XX -- . XX ---f X.-M--,MX X,-WX-XXfxwXX9SXXX. , MSS fi!-WX-,.w X.-S -fA- 1 - .- X XX ZX. . .. X, . --MXN.-X-Pe. 1-,XXX .XM X ,XaX.X,.aXf- X .X X K. X X - XX ,, , ,X ,WX ,. X, -X X, ,X, ., , . ,, ,,,,,,,,.,,,.XX,,,,.,,X,?3 , ,X ,. rf ' VHZSWTVSEf2:i7-45Xif2-21f?--ii'X'L-551. ,z WWT1 0-H-X XfXf,K5.1i - 7 X -' ':'- f - 1 X' "'f,i,i ' ' X'?5T4Xf-P51 1'K5f3?i'Mi .QiXA2+2f1Q2:"?'Zi5X -1 T? HW ,LXTKXQNX-2 ,Lg 44, '.uKfm,g1i, -' 1-fr,'f'. X,-,ggi X131 33, X5 353,315 g.'5,.Qs3gh,fg,g-,iqg:2X7-5-Z .jsVX5,qbf-,XX,:315.g-if-kg, , Xi., gf 7. ,V ,.. , - ' K K ' ,Ka-2"'v" .wr . - K :P . .X-X. wgififzfw-1':z XX,-:,,f,-,simfiq. -Ka,"--K1X,,'XX ,- " Q-ff X...X..X,X.3.,X.,-X,a-Wi L'WigKg2a?'LgwXX.5,-X?, A-XX-m ' Xw..XX fi.-gQ'g,5.-sy.gf,5,X,qgXX,,., -,-5,4-, Ak , J, -7 -- ,X Lia-f X -X ,, - VWKW V "" 7 all S XX x ' ' 241 "ii-i'f:i2.ff'XLT-K 'K X. 'X ' -"' . . XX X, XX .X . , Y I -' - , f X L 'K :,-:- -1,5-2.-W-X5:L.g:gg,.az?-.QX,,,.,-XX,-3.-gX- X .,. ,-X. -,,, ,, A we X -X M - 6 KX-XX Km-.XK ., :X2g,KKX.XvX--XXXXW -,XX-a-.Xw X X. ,,. wa. - X X . . ,3- wvwl-XX. X sf f., ,- ,,X , , mf 35, 5 X, .,, .,L,.XXv,.,,,,:.Q Q-Xjs,ggmw,:s,5e.Z5,LW-Lk..,, 5, kt XV , .4 M, , 1- I , fQegw-K - K XXX,-XX--s.f+X.XX,X:.X-X X ,,.vXr.X,,X ,Kw--2 .,Sw1XX-Xmmksmg,gh-,.,i,X,X,,Q. -XX. X .,X .0 ' 'K K Q f -X we XX-f-zszglfsf.-Km-.XX-XX -W,-XXQ nap X - ,- .X X K - 'X-X1,:lXfXv-iff ' .gg sf. ,X - X,,,X A' KK X 'Y . TIM ,xg ,fjM,,,jwi,gj. XX jf'-,, , , X - 4251X?jX,, Q.-'fl Mfi"1" 1 ,,,,,35,,,,,, ,ykk ,. .X,,z,QXX-XM 1 -,.XX,XX.,,XXX.: I NKIK H V M .L ,,. KX--Ki, iz-X , 2 XX,2?L.XX-3 si -53'X,,.-'XX5,:zqgXz,X--gg--Xe, :Xf,.:'Sif X- .,-X 1, ,W MX- fav--.X, X -X ,WX-X ,,.f .X.,sX.-X.5.X.XX..W X,,,3,XM 5. , ...W , Mm,,,., if .gsigggffggsaaX,,SZ?Xfi-g4,f,X,fXX7 K X1 XKK A-VVLKKXX ' "KY-'XV-5Xiifllff-iwribikvssihk':zsiiwiiw-'12 r1'M1.Q.:Q:1gL5,5X,, X,5Q.,5,1L s3m.",gX,5m,,- ,.s, , ,- X - K wwf 2 X-XXXX,f.X.X2f.,,X.X-XX ff ,, XX. X XX- .,QsXf'.?X:XXgX,XX.f-1 X, X ., X , ,Q -SKI .- . vw sXXX-z,X-:LQX-XXXLX,Xf.X,QXfQ,XX-f,.X1X-X ,X ., .,,,,f.3,,,,, ,.,,,, , .W ,N , ., X, ,, gX,.,.,..,.,XwX1fX, fgXXXXX,XXX,X,-mf, , ,X ,Af . ., .,XTX,X.-HSQXXMXK-X-we.:-,af 555-Xiffzg.-.XTX-,,.X,,,, X. , -is K A ,1 -- ,..,. X-, ,E,,.,,,g?g,,,,,S,,.,X,M.,,5Xi,V..,VX,,,,,,,,X, . X X X if 5' M -X6 X - --11-X-we-2:simff-wewwf?eg-.leaf--K.fear-X-fm:XX, M,-,,XX-A X X - ' QXYWZEffUTif-?TL:f-iiivf2ii1Q:.sigiTigLS1'2-M23X-As1gfgX.jli'gg 'jgiilz-XX-'wixif I AX - 5.4--XX. ,QXXQ , X KK M' ff-f2l:Xr?:3z?if'2iif-.sfgs gin-:fi gn:-X2-'X .3 X, - X K ,..rX-X,X:is-X221-nw-wXS-fX--XfXeQ1e::feswX-weXsfiug-Xiz.,-1,5.,X , .XXXX 'Xu-fsX-X..zfX--XXXXXX-QNXf,,.X,,,XX-fX.,,X,X,XX,..,EQ-W. ,X,,.,,,,,,.X,,X.- .,,,, , , KKK'2KiX:1X-mg: X-asaXXXaXQ23Xat2gias2X-fqg3:za,X,.5KXXgQ2X-Q215,XXgqpq,g3X,X,-.,g3,,.. ,X XK5'-SXSW"5.XzX,ii-2315.5 .gzikzusiifv'XaXgv1zfXX:g.X-35:awgqq.-,.,-1 'X-'X-5, - .. WM QKX-XX::x1l-XX-QSX-fax -W' ww' 'M,?-wifi-:wb-WK"W-'s XXV-X.'v,w 9' X' X S fwgjw ,f ,,s-egg. gg,-g,,f S ' W ,Mm .Xu-XXXX.X,.51XXX-X5',X:tf::K.X,.,,-,gg,X .,Fx-X12,..X-Xa-MyXqfgmgwwfgygg-Qyigq,QXg2:.QwX-MyXXXXXQAXXX- X , M.XX....,XX,,,5,,X,, XXMN, -X, , , 3 E, 5,5 X X 5 W 2 5 3 XXX X X 4- m W 2 X X 3 5 X u, EFX XX -My X X, X Way Qing? WRX W XXV x Y 5 55 5 x Q XS S i X W XX nm 9 ,Irv -ug KK.-X - inf,-'XX-, XX -f -- ,, 1,1 . .,f',iXg1:X, ,,,,VX,1 ,,W,.,XX,5,,,, - :Ei-isa. 1,2-FX Q -K ' , K ,rj , , v- Xa 'firm--X 2 V - ,zr V ,3 . , Hifi" ' I 5-'-V A Y' X , ' K -"lX1LiiTf'ff- --59l"EYl5iUXXZ:f"L5E1LKi?5E1?f5i53ii34554-XIQEWGQ--,J.',p . , 5 , , 5 'E iw -X ff-1 Mr W -5 X K XL K'-X ezgzyfi-XXf,.f,-.X--1.w.s-gQXs.g:,W,.W-Xqfm.-,QM., ., X . ,X ,. wlvfa ee- ,, ., f X rK- XX.:-.Q-X X...,.. . . ,., + ' if-iii W' , Sw- . ,,X..,.-f,,Xl,Xz'fX-gi,f2'-f.1, .,XK .nf KQ,i?X-',i'gi?Xf: , 3 ggsXXX.::gX:gg::,..XX, Xye., .:g.,X3,f 5131222 , X, .5 ,,.,W..,, WE, ,, ,M , ,1X,,,,,,, 16, XX,-,HX .,gfX,-XgQXgggf2g,2gz,Qigry5-is-wsz,2w5Q9Xgs45fff?,g7gggrQXX,X':X.,,XX,,1z A mgXgA,5,,:k,, ,V K ,VV ,KJ it Lfigfswl-'XL-'iigl-4',.- X X -.,.f'flH-WX-fi'TK-I--Lii,,2-WX?-52f-WL X -XXX 1-XX X12-X ffl-if'1fXi',aX-Q?-K14:12--wifXX'X35fl-AfffSALES:-WG21xf?fX"XvXiiiffiz-W:ff-fff?XiSsi1-E52-wffqgfi-2'L1via-21521455524sine255f.Xiuiw2XLz,-Xifw:XXX-XX:XzX.5XXLf122,XfX.fX:.p-'wi-fXXz1-',iffK2,am:iKXXX-1i,:.aXi:Xz1if,.s,Xs,1,-Xi-X,:X-2-mir -X X. XfK..--1X1-XXXMXKEX22-K-QXXL-XKWKWKX-QzGf'H25iWiii sisfffiimi- m,,XK.fsXXX,eXK,:XX:XeXX.X,XX-XXXfXXeX1.1zX'eX:Xwwas.XXXL-XX.,X--XXXMX-,QXif.Xwmzgafzrwg-ssifsfgX-XXXiXX?ssXwsXuzXaz+2.X-LX.Xfmg1XXs2Q,X.sXz.:Xev1fvK.X,XXgwXf,KXX,QfK',X.2XXsKK4X -X . Nia M2521.f,az.42,1QggXgg., ,V,3.,,K5-,XX,- XiX34,.,X-zX4,.,A,t.XX-g, , XXX-,XXX zmghfq .qu X .QXQ,f,Qz5g,e,vg,X.,:,,ssX5,,g5agggysgs ,, - ..g, X. ,R lg, X, my ,S,eXXX,,XM ggi, iggswig-g,,X.gX.X,g,EXHWMXM5 5-X w,,w,,,g,X,S,,.,,3XX ,Q.5Q,,iw,A,W,,, ,3,i5.,,6,SIy5g5,45,XYiW,1gmA,M,MX,5MX.13XgmL,,,X,U,. 5.7,MKX,.f,5V,,X,,X,,:,XX, M ,,, ,5,X,,,,,X,, ,.,v,X,,,- .. A K ,fm Q-my,m,,,...X,,X.X, ,.wX,..,,.., ,.,,,.XX, ., . ,XX X X, .. ,, ,X XX,,,..,,,,Xf,XXX,X.g.XX,,,L,X,X,,,.9, ,Ms.e.fsw,,.Q,XXXX,X,5,K3gS F3 ,, w e XX ,, XWXMQ-my ,,X,g,XX,1X,,,,,,,9,X,X,,XL.wX X ,,,.q,,XU,,XLX, 4,1553 ,grg,X5,,3.,X,,,,,g5y,.Z5X, M, ,X 3,gy,,w,,s5X X, ,gX5s,QMw,Ww sm,XmiW ,w,,,:,..,W,,,, .,,,A,,.,, A SX, , , . ,X .. XM3, ,, XXM1w:weXzXXX:mm-X.s.1,fX-XX-feX25-KX,.w-XXX. .X,ZX,'XX.Xe-X'-:X:XKX,-ff .fx:wsXXXXgQfXX-XgwggwgXXXQXX,-XA-ZXWXXMXEXXQX,-Xz'z5g,w,,Rg? -. .pg--ff -X .WX ,Xg,,,XAwX.1,,qgX.X,X,XQXXM,,,4wXw,XX,X,,,X.,,M,,m,2gX,WLwwgg,X,,-w,,qXX,X1imff2zX2XX-?vwS'hffzKwz2-2vsXfb323aYxs2G3HQ2Q1X:w5wXXASQMQX-N ,,.X.X,f,,X,.5-Xz,X,XL.,-X..,,X.g,,X.X,-,n,XX, , ,g,X, X Hfiswafi-EX--fXfXK-wif:Q-ws-XXXKK'Xafvwf''Xs1wXX',X-XX.--ww-XX,-XXX'X wi-XXX4QXX'XXwXfXfmezsX,XX-smzgsfXXQXX-X.a52XXw,ifQXsfX-S XXEQL H K y2A?m2fwi'LXQ4wvXazX,X4e2-,XX,wwXwg:meXXXX-XgeXfXfXfQff--XXXXs3X,XXX-XX-waXXeg,:XXezm:weXfXff-ffwmzgs-X-XXQKSXSX.wmszms-X:X-X15-Xrwziz 1,-Xgf,-.,1'XX.X,sX,-Xff:-9-X-,XX-K:,'X-ww-XX-14-XXX-1-,XXXK1 XX., s9,g,,X5XfXw,X.gXgX,g:XXXXXXgg.mQiX,sg,XXX,kwa:XX,,3,X.X,3,s,.X,-X,.XX:: X.f,.:X, X, X,,.X,XQXXwXX,fX W.WXX.Wuw,g,:qXs,X,,QX,,XXnXXee1XgggXX 5372112 XX,X,g,Xq,.2.iX,.w,X,,X, X,,X,.,,,XX- KgXwi-,X3,,X5XXXgrXg,Xp,X,XM.X,X,3mXXX,-X,XL3,, XXMHXSXX,5.585WM.,,1Eps33..5,5,Qpf5,-a,,gZ5.XHW,,,5,XaX,,,?,i3W,My,,.mg-,,,, ,,X,,V.,,X.K,,r V,,L,., ,,,X, ,, in XXXXW.XXXmX.XXXX,vX,.m.,.XSMXX.Xg.X,XXXX.,X-X,,,X.X,XX,,X,.W-XX,X,-,MX-X g,X,.,,X,X,WX.g,,,XX3Xg,XX,5,,.,,,X,,,,,,g,XXfW,mgg5XXX,w,g.X Qs , w 5, ,gi?pJX,,s,,,L., -qw,,,,z,mfkfgX.XX,WXLXHMXg,w.X5X.,W,Xg gamgg,X,,,.XLM,-gfXX,,,XXsif,,-XX5-,g,,q,2,.,,L,,,,,,,mX45,,Xgg XWLXAQQXXXQXXC,WMXQ,-.X-,m,g,X.,,X,q,,,,X55X, ,X ,XX,X.XX,X,,,X.,X,- ,,,.,, 'SWW'Kfm-K2XW-1f51fMXfW1ffwKYKX -W -Wfw WXXHKSQ-f'X1XXfw -'X' WXK-XMWXXMK1f'2'-QXTIQW-SX--'A'1X5X-611532XVSMK - 1525-fii'-W XSXSSWHX-f?ff5f2Af11fh-wK 'HK W IXX XXX -hw-Kr11'XwX--XXXXXXX wXxX,LXfX-sm-XXXXQXX,,X,XrXXXX:XXX-mi.-XXMXXXXXXS XXX.XiXXXXXLXXKX--SQXXXXXXXXXX-QQXXXXQXXXXXWQX--KXX,XXXQX-,XJ-,.. --X XX, X.-XX. Xg, fig- X, .XX X Xf? XMX--wwllf-WIXXUXKwK'XX1X1MX-Gif-''vX'XKXX-MX-X-X -XXX-1iwVXXX--:XISU-if-'ffl-HX-wifWSLX'MwX-Lffwnsfn fw-wif 1X,,X-Q-ww'--w:f'Xy Xffgaew,szfw.XXWX,g,XX,1Xz.fwX,:z,XXXX-M-X:-X.XX,,1X.WXX,.,X,X,,,-W4.,,,Xgm..XX,fa,XmgwX, QMXWMXX-XXX,1X,X5.,Xg-,-,?S,.,X,,.,,,,X..,XXfgX.,,XX..,X.XX,,XX.,A,X.f ,M ,.X.X-X ww XHQXQSXQFMJXX--SMX-:wwX-MXX,'K--Lf, -1 ,X.f'X-XX-X'-:XX,:XX:wXwXXs-ww:svXX-vw-Xw1fsXXX,1aww-wwgwglir X. K-XX-XHAXX-X wr-wX,f5X,,,X,-X.f,.X-- ,X,X,X,SX.X,ewXXXx,XXXX,X,WJ:XX,s,XfX,,,w3XX,X,-X,XX3g,,uXX,X,gX.,,.,XU, WX.,-XXXXXww,ewXwiw.vX.XXXXwww.aX,X,M,,.m,,.XM,N., V XX-M ,WQXQXIKXX-X-Xww-2 X-w-.,,XXfXXf- . , ,X,XX,X.X, X,.,X,XXXXXX,XXXX,,XX.XX, ,Q XX XXXX,feX2XM.XX :XXX,XX.Xg,.mX,,,, XgX,yX.XX,-,XX,5,XXXX5XXX,,,,..,,,X,X-X,,X,.X,,,,,, ,XXMXXXQXXQX J X,Q,gvX,,,XXaW,,. , fig- .,.1z:i- V .XX asiiimyfigggi255-52fzeX5ewX5XjXXgff-tfzfa-mf,fglzu-tfXX.QfKX,-X.XXXXQ,XX:-X'fi'-.X,,.X,,X,'ff:5XfLf'XX:W--uf4X152Eiz,ffsisQZeas3555325,-ei3X.SiX'YsfzX,as:gfg2i ,XX X ,wg ,X1aX1fXes,,1X1.eaL-sm,XQ3XgXw,,XXXX.XX,X.,..-MW XXX , iw ,XXX-XXX, mm,.XgXeXX-XQf:a,fXXWXXXXXXX,XXq,.X,,XX,X,,XX,,X.X.,,, ,,-,.,X-,.,,,,,,,,X-X-,-11,X,,Xg,,X.g,5,Xi,,,,,,,,w,mw,,,,,,M,,.,wG,wig gig ggi! .. XXXSX-,QfMXXf2Qfw!,XXXXX,,w,g,.XX.X,.XXSQXXXWXQXXXi. ,,,,,,,,,X3.,,,,,, , ,.,,,,,,W,,,,wgs,EMXwmw,mQ,,my,M -Q Xw5WXXX-XwXXXXXXXfzzw.w,XXX-XXX,LXX,XM,m,XX,,,,,X,,,,,,,,X X,,,XX,X,XX.,,,,WQ.w,X,,,,W,,X,4X L XXX wipewsXXX-XXXK-wwMX-XW,-X,.mXX..X,,,XXXXXX.,XX,XX,X,, M,L,,,,XX,X,,,,,XXX,f..X,X,,,,4.X.X XXX, , , MXXXXXXWXX-XX,XXX WXMXXXX ,QX--aXi,1fXXaX.X,,X5yfXXXXW,XXVX,.X,,,,,M,.,W , , X4Mm.fXsw.XXXXX,yX5.Xsw-w "Would you please stand for the Pledge of Allegiance and remain standing for the Alma Mater. After the assembly pass to your 'fourth' period class." President Bruce Cook presides over the weekly Student Council meetings. Student Council ls the SchooI's Governing Body As our nation's congress is made up of rep- resentatives, so is the Student Council of NLRHS. These representatives come from every homeroom and the decisions made by them govern the activities and projects of our academic year. These activities include the Wildcat Follies, Color Day activities and assembly, the Christmas assembly, Friendly Week, the Awards assembly, and the Student Council elections. Harold Roberts accepts the Homeroom of the Month Plaque from Treasurer Tap Pritchard. 1 Xou kick him and then l'll stomp on him," says Fred Hanchey Qdoctorj to Bruce Cook Cnurse with the long skirtj. Key Club Leads the School In Spirit And Service "l pledge on my honor to uphold the objectives of Key Club International, to build my home, school and community, to serve my Nation and God and combat all forces which tend to undermine these institutions." Every year approximately 50 scholastically fit students, who have proved themselves to be trust- worthy and willing leaders, recite this pledge before the student body thus obtaining membership in the Key Club. This honor organization, sponsored by Kiwanis International, is known throughout the school and community for its services. Among its activities are non-profit work in the basketball concession stand, construction of the Na- tivity Scene, placed on the main steps during the Christmas season, its assembly which is rated by some as best of the year, and fund-raising campaigns. Our first song will be 'Nose' OK, boys, let's pick says Beatle Phil Esch to John Hendrickson, Hal Piercy, and Scott Hines. KEY CLUB OFFICERS-Fred Holbrook, corre- sponding secretaryg Fred Hanchey, secretary David Teegarden, presidentg Bob Everhart, vice- presidentg .lim Lynch, treasurer. When did girls get in the Key Club anyway? Key Club Members pose as hysterical maidens while the imitation Beatles perform on the Key Club Assembly. "Did he say Sally?" asks David Teegarden frightj of Richard Baldwin, who as Dr. Jose Zorba Qshort hairy, conducts an anatomy class on his magic blackboard. OFFICERS OF BOOKWORMS: Left to Right, Secretary, Mary Sue Normang President, .lane Priddyg Treasurer, Kay Smallingg and Vice President, Fay Smalling. Mike Finney really looks busy as he plays around with a toy frog in the library. Hundred of students resort to the library to avoid sitting in study hall. We will admit some of them do have work that can only be done in the library. Bookworms Are Eager Library Assistants Selecting a book in a library is easier than it sounds, particularly here at North Little Rock High. There is an omnipresent crew that make it their duty to aid and assist all Cats Qlarge or small who have a bit of trouble among the encyc opedias and novels. Bless the Bookworms. The Bookworms are North Little Rock High School's student librarians who ably and fully commit themselves to the efficiency of the li- brary the year 'round. The Bookworms have a few tasks that would make any impatient person blow his brains out: checking out books, mending books, collecting fines, and helping the confused and bewildered sophomores. To become a Bookworm, a student must have a good C average with no unsatisfactory citizenship marks. Oh yes, an energetic interest in library work is a necessity. As you can see, those healthful busibodies that are seen each day are commendable stu- dents as well as librarians. These assistants to the librarians are taught and under the supervision of Mrs. Carpenter and Mrs. Cook. The bookworms are responsible for decorating the at tractive bulletin boards in the library. Y-Teens Serve Their School And Community The Y-Teens are sponsored and aided in their activities by the YWCA organization. All members of this club automatically become members of the "Y" and are entitled to the use of all facilities of the YWCA. Girls belonging to this club learn the im- portance of service- --both to man and God. Y-Teens do those things overlooked by most people, but which make for a world filled with love and under- standing. To grow as a person, togrow in friendship with all people, and to grow in the love and knowledge of Cod---these are the goals the Y-Teens strive for. Th es e girls give to the needy, entertain children at orphanages, share in the collection duties for various drives, and promote activities The Y-Teen Officers for 63-64 are Secretary Kathy Barnett, Inter-Club Council R e p r e s e n t a t i v e Linda Stephens, Chaplain Jeanette Pfeiffer, Program Chairman Sharon Reeves, President Cathy Reed, Vice-President Diane Avance. within the school, community, and city. The Y-Teens ofNLRHS annually send delegates to various Y-Teen conferences, where they meet more girls interested in the club and its objectives and make lasting friendships. .linger Jackson sings, a lowly Soph bows to a mighty Senior, and pretty little Lindy Reeves gives Dream Boy Fred Hanchey a big SMACKEROO as Cathy looks on during the annual Y-Teen Assembly. These boys don't look like it's all that bad to be a dream boy, do they? Larry Carroll, Bobby Faulkner, and Fred Hanchey were the three Senior finalists. 3 sfiqf w . at A y 5 r-ay .ff Ill f - 4, 511. 11 - A , f K , gfifef 1 ja, f ' if , , ' satw1T:i,..:.wfwwf . RiZT'if: T it X al 2 3, 3 fi M' az25fiiffiz2gfgg:a?iit.aa ' 7W2eg.fa:s,vWgavg4Q1ss tb, ww' , Hsgssasiems V. mi as ...MV 113: . " .tgiaifisszaiiff PEP CAT OFFICERS: Left to Right, Linda Kerby, vice presi- dentg Phyllis Smith, historiang Cathy Reed, hand drill leaderg iinni Spl res1dentg and Suzanne Clements, drill team ea er. ish A g Pig , Ea E As usual they looked great!!! 65 Ar cu ci. v-4 s. D-I P-I FY cu S 'o KD i-4 Ph o 5 UJ ns Q. as :s O rn FY 0 :r cn :1 Kc ua c UQ as H E sn P-4 rv U1 U o 2 5 F! :r rn cn l'f H an ru f-L so F1 l'f :r CD o- sr U2 rr KD ff U D9 .- a. UQ 5 ro 2 .-. FP :r O o : S ns K4 Pep Cats and Catettes Represent the Wildcat Spirit One of the most exciting and Well-known things about our North Side Story is the tre- mendous spirit each student of North Little Rock High represents. Possibly no other factor intervenes as much in the prospering areas of sports and good fun as does the blending of screaming voices representing the tireless, unyielding, even in defeat, Pep Cats and Drill Team. The Catettes, or drill team, is a specially selected group of girls who have been chosen the last month of summer for their marching and teamwork abilities. The Pep Cats is an organization for all girls who wish to promote their school spirit by steady attendance of football games and various other sports. There is an interesting factor about these human pep pills that stuns and perplexes. Each morning after a big game the girls' throats are a bit hoarse. Now how do you explain that? i rif- :sz ' i L, uf tffrf ,. - ' me 'Wlorward Farch!" Tension is high, even for the leaders, during the Drill Team tryouts. Q E ,, Neither rain, nor snow, sleet, nor dark of night will keep the Pepcats from supporting their Wildcats "Boost a bit for sing the Pepcats as they give their team moral support. W swift ' 7, i 5' 40 sm. The Art Club officers areg Sheila Holland, Paula Fielding, Jan Winn, and Donna Colclasure. The Art Club was responsible for making the homecoming crowns and painting various backdrops for Senior activities. Here Jane Young, Norma Edmons, Elaine Anderson, and Nancy Wilkinson work on the homecoming decorationsg and Terry McCord and Diane Brown prepare the backdrop for the Senior Thanksgiving Breakfast rt Club Is Composed of The Top Artists NLRHS students join the Art Club to learn the appreciation of the finer aspects of art. The artists paint for their own enjoyment, for entries in art contests, and for the school. Every year the Art Club makes the scenery for the Musical Varieties and other assemblies. Field trips to commercial art studios and an annual banquet make up a part of the Art Club's activities. 51 M. W,-K' A "I've had just about enough of your wise-cracks," says Ritchie Campbell as he shows off his newest masterpiece. L2 Forensic League Is Characterlzed By Success Resolved: that the Social Security Benefits should be extended to include Medicare. This was the topic chosen to be debated nationally for the 63-64 school year. The Wildcat Debaters made a good showing throughout their season, bringing home many decisive victories and a few OFFICILRS OF THE EORENSIC LEAGUE: Left to Right defeats Dennis Raw, presidentg Susan Frost, secretarygSally Chandler The League was rated the top debate treasurerg and David Herrington, vice president. team at the State Speech Festival, Winning five of six contests. Among their projects was a debate presented to the student body in an assembly. "35U,OOO people die needlessly every year." .... ....... ' 'This is the American way '??" exclaim Ste v e Riggs and Dana Smith as they open their debates. Susan Frost and Robert McBride display their gifts of gab as they debate a timely topic. Wait until they re not looking, Sally, and l'll give you one of the ham sandwiches in my attache Casejl whispers David Herrington to Sally Chandler as they ready their notes for their debate on Medicare Theta Science officers are from left to right...Neal Spearmon, Sandra Mabrey, Bob Finnegan, Kay James, Larry Carpenter and JoAnn Toland. Theta Science Trains for the Challenges of the Day Theta Science is a club for science-minded students. The club has as its goals, the promotion of interest in science, self-expression in science, and a definite channeling of scientific aptitude. Member- ship of Theta Science is open to all students who are interested in these things. Among the activities of the club are field trips, picnics, and experiments. The Theta Science club puts forth a special effort to complete a project for the Math-Science fair held annually. The programs presented by the club at the regular club meetings consist of lectures, demon- strations, films, records, and student projects. The programs rotate around the various sciences and include all sciences taught at NLRHS. Walter Craig, David Teegarden, Paul Tompkins, Neal Spearmon and James Powell hook up an electrical circuit. Everyone seemed interested in the exper- iment.... .of course there's always one mugger in every crowd. 42 Language lub Create Interest In Cultures Equaling the color and festive spirit of our neighbors in Mexico are the activities of the Spanish club, Los Gatos de Espanoles. Center- ing 'its attention on Pan American Day, the club presented an assembly in commemoration of the exciting celebrations observed by our firey Latin American friends. In the course of each school year, the Spanish club strives to cultivate a better understanding of the Latin American coun- tries by studying their languages, customs, and recreations. An ocean away from Mexico lies the bustling little nation of France. To those studying French here on Wildcat Hill, the best way to learn about France without going there is to join the French club, Le Cercle Francais. Every year the club produces an assembly depicting some facet of French life and thus familiarizes stu- dents with the rich heritage and culture that abounds in "Gay Pareef' From modern France to ancient Rome is merely the length of the hallway. Students of Latin who belong to the Latin club or Quo Vadis study the customs and culture of ancient Rome. In their annual assembly they wear the clothing of the ancient Romans, in this way they learn how difficult it was for the Romans to keep up their high spirits as well as their togas. 'yew " -yrre ,, , as . 3 3 f , ' L. O S if 5 s 'Q glmf' ,,gk?'f5 ,A . l . ia 52 xg' ligase i X ' .Q ,A . VZL, , , i ,-"9 x i A ' 9 , i gf.. Freddy Link, Anne Fleming, and Carol Bartholmey were contestants in the 3rd Year National Spanish Examination, and Anne finished Second in the State. S it it W .' , 1 ,. ,F ' fi' . , - i ' ' , 5525 A rf is f A , J - gj Y . ' ,fag ,gas -gig - 4 , 5 ig ,f 5 if ' I ai : 1 fi git ' if V ij' -I ',i K ' WA' ', , ' , -'l t' ' ' ,, " 'itulfl al' , S Z Y :aff-b, ,r. '35 ,ap p sr. hz? iw: 'M 'i 'gi . P' I I U . fb if -ig, . A ' A. , S i, vans, ,- : ., . ,' r .,,, ixis rsaif ,,,- -fibwg-5: ,' zz 5, g , If 'iifif , l 'ri f '-L V. ma. I , ,,,3,s,, if fy In 2 Ja, ' fl ' ii" tL3,',eQ -2lfi11firfi 'T A ' ' , if 5 A 5 -"f eifia' 1" 'Y' ' 5' , Y iff t V E t 'f - -fs, 4 2 1 4 ."' l3l'Qi 'i ' l gil K. Q' I fi +2 1 , ' it if u r ,l , , -k,, If 1 V ,V 'safer ' , at 2, Q, Q tg ' , 5 V " f ig 22' ,mit 1 2, .tiijlf , fi 3 , ' ' t " QL fi? , ,V , U , gi V V .,.. . H 59, ' , if 5 j Q '- ' 4 - " te" ,ig 3 1. :f f' - ' QQ , W,,, ga, 5, Q "er, - ' a, ,rr , ' ' 1 1 ' ',.Lf" .W g,L5g,, ,,, 'i .ft,f,r 3ig3gi.ii,,,MV i, AV agp. , if ,V as r,,,., -, ' G, 4 ' ' s:,'sL:i,EA', ' 'i-tsF,,ia,f,.i Kathy Jordan sings "l Love Paris" as Barbara Hall Qalias Pepe le Peup emcees the French Club Assembly. William Thomas and Reggie Kinney go through another dialogue for the Spanish Club. The Latin Club Chorus, composed of Tina Price, Renee Sorrels, Lynn Mansfield, and Shelia Bland look on as Nancy Wilkinson, Steve Loibner, and Ronnie Durham perform on the annual Latin Club Assembly. l 5 1 2 ia ii by Red Cross officers are from left to right: Judy Jackson, Kounen, Becky Ball, and Patsy Wasson. R icky Red Cross Provides Service For the World Possibly one of the greatest single organizations that has had its effect on a group of peoples both here and in other lands is the Red Cross. It is always there for the help and aid of all people of all nationalities. It has been a gold- engraved page in the history of the North Side Story. lts make-up is simple enough. The organization consists of one represen- tative from each homeroom on Wildcat Hill. They are selected by their recognition of the responsibilities the membership brings. From there, they will attend monthly meetings and carry on the busi- ness of making their business the business of other people who are in need. It aids those in this complex life of ours to make it a bit lighter. The Red Cross will continue to help the needy. Its rewards will be gratitudeg thus, it has reached its goal, and will continue to do so. 5 Mickey Roye and 'Kristie Vick read the jokes in the Red Cross Journal as Candy Fields receives her 'i7nttt" 'U "tl' Red Cross pin from Judy Cox. Mrs. Perry passes out interesting information at one of the monthly meetings of the organization. Monitors Lighten the Duties of the Over-worked Staff Lightening the duties of the over-worked staff is the main purpose of NLRHS's mon- itors. These armorless knights rescue those in need or distress, especially the office staff, the faculty, the deans, the counselors, and most often fellow students. Monitors' duties are numerous---an- swering the telephone, working the switchboard, checking in and out library books, running errands, monitoring the doors, selling supplies, setting up experiment equipment, and typing various information to name just a few of their tasks. Students filling these positions must be reliable, have character, integrity, all of which NLRHS' monitors possess. Hard at work is Dale Johnson, one of the staff of Mr. Burnett, Dean of Boys. Donna Stouffer maintains the duties of the schoo1's Bookstore Monitors. One of the newest additions to the Bookstore are the paper-back books. Here Monitor Jeanie Bacchus helps Mike Highfill make a selection. Office Monitor Dick Everhart operates the new switchboard installed by the office this year. 5,4 fl' "l knew l forgot something," says Murry Witcher as he rewinds a film. "Next time l'll thread it through the projector." Ronnie House and Bob Finnegan examine a pro- jector before using it. 'n""---Q--..""""5 Film Crew Provides Helpful Service For Teachers Playing their part to aid teachers in teaching by films is our film crew. Operating six hours a day, our film crew shows films in classrooms and cleans and cares for all equipment in the Audio-Visual Department. The film crew on Wildcat Hill consists of seventy-two volunteer members trained by the head monitor or sponsor of the Audio-Visual Aids Department, and is divided into six crews of approximately twelve members each. One member is picked from each crew to serve as head monitor for his group. He is in charge of writing passes, making crew assignments, and checking all equipment to see that it is kept in good condition. Equipment in use by the film crew consists of several 16mm projectors, record players, tape recorders, film strips machines, opague projectors, a set of telephones, and school maps. Thus our film crew is helping to pave the road to learning through sight and sound. Ronnie House and Edward Tennyson prepare to put another film away for future use. That film must be a humdinger. They seem to be getting quite a kick out of it. Film monitors Joe Cook and David Garrett get ready to run another one. Stage Crew ls Essential For Every Wildcat Production Music, curtain, spotlight, action. Yes, a stage production is really nothing without the help of the stage crew. These indespensable boys make certain of raising the curtains in time, spotlight perfection, sound effects, and manning the footlights and over- heads. This skilled crew may be little recognized but their work is much appreciated. . 1 ' fi " 5 Q, C 5 - Q. 6 5 fs -a Q , Manning the spotlight and controlling the microphone l are Mike Hedgecock and Carl Hamlett. ' .1 F E l i "Dad-gumitI!!!l always stick my finger in the wrong place and get shocked." exclaims Edward Sanders to James Ard. Stage crew members adjust burnt-out light bulbs and give orders to other members of the crew who are working the spotlight. ,' V' la H 1 6' fn HX , l . 1 .aff+ -fwwva- - ' ? OFFICERS OF FTA SEATED: Patsy Wasson. STANDLNG: Left to Right, Christy Laman, Janet Bond, Kay Smalling, Becky Ball, Linda Kerby. and Janice Jones. LEFT TO RIGHT: Janet Bond, Janice Jones,Patsy Wasson, Jackie Carson, Tina Price, Marsha Sessoms, Brenda Sanders, and Christy Laman serve at the Teacher's Tea. Future Teachers of America ls a Club for Tomorrow's Pedagogues The Future Teachers of America is an organization for young people who have a desire to teach for a career. This organization has four requirements. They are good character, scholarship, leadership, and most of all adesire for teaching. A State F.T.A. Convention is held annually. There students meet others Whose desires are to serve humanity by teaching. The F.T.A., understudies, are training now for the jobs they must perform tomorrow to be the leaders and followers of the years to come. They realize that as future teachers they have many long and tedious hours of study ahead of them before reaching their goal. FTA Members participate in the FTA Assembly. Future Nurses Aspire to Serve Humanity Many students who graduate from Wild- cat Hill choose some field of medicine for their life's work. Each Senior Class turns out a number of doctors, pharmacists, technicians, and especially nurses. Quite a few of these people first began broadening and developing their interest in the medical profession via the Future Nurses Club. The activities of Future Nurses vary greatly in order to encompass all aspects of the nursing profession. The members, usually all girls, are privileged to hear lectures given by important people affiliated with nursing, and programs pre- sented by other members. Each month an Auxiliary meeting is held at Baptist Hospital in which plans are discussed for various projects designed to increase the girls' growth both spiritually and emotionally by helping others. Members of the Future Nurses Club are always urged to work as volunteer helpers, called "Candystripers," during the sum- mer, to help them decide whether a nursing career is really what they want. However, because "all work and no play makes Jane a dull gir1," the club always has at least one picnic or banquet each year, to help the girls relax and develop the friendship that springs up so easily among those who are bound together by doing the work they love. G. 3- rife? Future Nurses officers are from left to right, Judy Jackson, Linda Patrick, Nancy Bailey, Elizabeth Palmer, Betty Pennington, and Linda Wasson. wavy' Martha Jackson, Melinda McCarty, and Kathy Crossman pose with two of their old friends, "Skinny Minney" who smoked herself to death, and "Oscar" who just didn't drink enough milk. 6 E E s 1 FHA officers for the school year 1963-64 are Judy Jackson CTreasurerb, Sherry Polk Q2nd Vice-Presb, Marsha Sessoms Qlieporterb, Linda Lowrance QHis- torianj, Judy Philliber QSecretaryj, Becky Ball QPres- identy, and Paula Fielding Clst Vice-Pres.j. Not pictured is Eva Harrison 63rd Vice-Pres.j Enjoying the buffet given by the Home Economics Students for the teachers of NLRHS are Miss Kresse and Mrs. Fleming. Future Homemakers Ready Themselves for Coming Role "I am Miss FHA" is the phrase constantly on the minds of each member of this organization which is open to any girl who is enrolled in home economics or who has com- pleted one year of homemaking instructions. The members gain valuable experience in entertaining through club-sponsored teas, luncheons, and banquets. There is a first and second year course offered to all High School girls. The first dealing with all aspects of homemaking. The second year course reviews the essentials of the first year more completely. Those who exert an extra amount of effort are awarded the Junior, Chapter, or State Homemaker's degree of achievement. To merit these degrees, members must show that they have grown in service to church, school, and community, and that they strengthened their personality, character, and improved or added to good family relationships. When these courses are completed a girlis ready to take her place among the women of the world and be assured of her success. Several Home Economics students enjoy their annual buffet. Each of the six classes participated in this outstanding service project. if F 1 il 'Wm ..f',- f.-weiffw i FBLA Today's Followers Are Tomorrow's Leaders F.B.L.A. is a national organization for all high school and college students enrolled in business courses, the Future Business Leaders of America operates as a part of the school program under the guidance of business teachers, school administrators and businessmen. lt is devoted to providing young adults with educational, vocational, and leadership experience. lts main purpose is to promote interest and train students for the business world. Any student who will have completed a minimum of three commercial courses with a B average in each before graduation is eligible for membership 'in F.B.L.A. At the State Convention held each year, N.L.R.H.S. enters various contests in dic- tation, spelling, and typing against students from other high schools in the state. A few activities of the club are dinners at various restaurants, business speakers on several phases of business, a career day, initiation day, and the State Convention. , . Mrs Hendrickson gives typing pointers to Sonja Mason as Jean Lavender listens FBLA Officers for 63-64 are Mary Herrod, Linda Atkins, Nancy Duckworth, Judith Moncrief, and Sandra Turner. Mr. George Bartsch of the North Little Rock Times interviews Judith Moncrief, Dorothy Landsman, and Susie Carmack, winners at the FBLA State Conference. Annette Laneer, Mary Shook, Janice Measles, and Wanda McKee arrange the FBLA bulletin board. Future Tradesman offices, pictured with their sponsor, Mr. Hastings, are from left to rightg Jimmy Wright, Harold Smith, LeRoy Higgins, and Larry Stewart, Larry Stewart and Jimmy Wright learn to use alathe and soldering iron. s f- " ' '- - f' 1-11 -1 Wwmwwvwwmtwwlextw Future Tradesmen Will Run Tomorrow's Industries Vocational leaders of tomorrow will come from the Future Tradesmen of NLRHS. Studying vocational courses such as machine shop, auto mechanics, and wood- working are required of all Future Trades- men. Each year the Future Tradesmen take an active part in the Arkansas Convention held in the latter part of the year. High honors are won each year by several students. Without today's Future Tradesmen there wouldbenovocational leaders of tomorrow. 5 GRA Stresses Physical Fitness Maybe a girl is sweet and gentle on the outside, but she really shows her stuff in Girls' Recreation Association! This as- sociation extends welcome to any girl whether in physical education or not, to participate in the numerous sports which are offered. Games such as flag football, volleyball, table tennis, shuffleboard, tumbling, baseball, and basketball are enjoyed by these female Wild- cats. Girls who prove outstanding in these sports receive either a charm bracelet or sweater with a Wildcat letter as reward for G their ability. The hlghhght of the yea-1' for Club mem' Turner, Becky Ball, and Linda Jones. bers is the state tournament at Arkansas State Teachers College at Conway. GRA officers for 63-64 are Susan Peterson, Camille LaGrossa, Sandra ,r,i -mf fs df mfs 1 Y - .T is L A "The next person that grabs the ball while it's going across the net will get kicked out of here," snaps Camille LaGrossa. H , f-is mf HOLD EVERYTHING!!! How did that boy's poster get in the girl's dress- ing room. Pianist Diane Avance President Jin er Jackson , 2 ' , and Chaplains David Teegarden and Dennis Baw. Chapel Presents A Spiritual Uplift Beginning each new week of school in a spirit of worship and prayer has long been the practice of many Wildcats who attend Chapel every Monday morning. The programs that are presented in Chapel are always short, invariably interesting, and con- sistently contain a wealth of spiritual stamina to be applied by the students in strengthening their own faith and improving their own lives. The Chapel meetings are non denominational and strive only to inculcate those attending with the sense of honor, integrity, justice, and faith in Christ that are a part of any Christian belief. A different speaker presents the program at each individual Chapel assembly. Sometimes he is a teacher or a guest from some field of work out- side the high school, but more often he is one of the students--or a group of students, as the case may be--from right here on Wildcat Hill. lt is always a balm to the spirit of a late-comer to stand outside the doorway of the Music Room and hear the vibrant voices of his classmates lifted heavenward in the singing of praises to God, and to hear the whisper of their prayers, seeking His guidance throughout the coming week. As anyone who attends Chapel can readily testify, it helps make any week a little brighter to know that God is on your side. Walt Warford gives the devotion in Chapel. Q A' '1 '5 1-:A -. tf' 1 1 .. ., ,. ,, ,- 'J - ,-f'.,v-.,.- ,.,', ,,.- - fm- -A,,'-- . -'I-LF"., -J ' -.J . L.-1' 4,-f"3..f',, f-,f A H NL' id-"'.--Y ,E , -N.:-1.,-l,.:' .-f ,2.',-af "'wj't' ".,f".."'1, " ' f 'ff' -' , :',','--JA: ...r ' ' I fx. " -f5.,,ur 'Q . L-, f-v ,--1 1. , ,pq , -lg, ft P adam . 'QRS 'W '- lv 1- ,. . 35' 1,417 "' -1. 22. 3155 .-nf 9-'Ulf-7' I 1. ..g 1- f-- is? , .X f 53" if ininw -12 .k vu ,A ATH ENDS me h h hhh eh f Ye he I l 1 e l l l 1 l l ,Ef . Rock be from an i 31334, 1505? assured1y,ewiii1eesed, however, by 'Our Wildcat stadiumfhand field house. The the stage for fehepfootball games and track Q just as the field house plays as setting for our basketballecompetition. The hero members of the athletic heeh heh l perform year 'round on this? respective stages eeee fai3iieg3h1:rux eh'iheroesn because of their emitiative, ability, el e i31"',ff5'94CI'ifiCC. One ehhe rememberh heeg Chafacfelf hhhe 1101? fh01'0Ui3113? eelhhe f eee hehii iffflfff'-9 been we wer: h h h hehee K 'K V gig,ggfzigggzzkfaf,Lg3:145235-as1-5:5-ff-fiffggM,.,, w ,g V f . ,-,,.,,--,.f,.-i,,,H,My-1,,,,4 :,z.Me ,,,, .M--,,.e M, ., , ' i -, ,. fffree,,Q-5,161:-wif.-,:5fs'if-'-,-'yy ' . ' . , i 'fi-1,gg,,egg,g1,g-his-eg54,2353ws1g:5zjgzzLsQ5gyazika-Q1TLge:'2gEHfzf.1L--TR?-f:'f:iii:,f.U.1'fs -'i , V ,. ,.., ,.e,. A , M..,. ,W n-ff ew., i ,.., M., L:-I 'I-1' 1 , e , - '-f., -W.::--1-wg k',- mn -,,.,- ww.: - , - . I I I VVV, H it,:wlLf,wv,,,W q.,, 5, ,, .. K, ff:f-21::'2.11::f.3iw-1 . . x -f ,- ---me e i eeeeh, "liABLE OF FOOTBALIg5ge fej le heelee e e eehh 58 www, sf' 5332! .xx-.r'3Q,,W Q.. . 4:4 N , 1 ' I Vssif.. , W , if 'G M k .M LM J'e.,x - J,-ff 4. ,, -Gozette Photo aj ' . g f " . 13-A ai.. ,. 1 A '2 3127 , 'E '.i9..L . f",Q"'7-' .. 1fJ'10'?f,:9!"1fv , 7,4- -y 22,-r .L-ez' A q,,'f:4 1. 1. fs' A 349'-w , , V, 3" -l . 'fb Rf? 'if :Ns 'H- ' f xi' ,rf if fa- 3? fi? Ta, 1-er. 'wr .c',"T1 QI., har, :fb f"',.lf1 'QSC-k ,.5,... 'diff fs- . vi? "- .- ,,. VP," .f'f51 sp J 44 sk., 4 Sz" " -3' .yf ,Pf .1 5-zu 4 3f..f. ' 33" .4 ' FP' 1 414 ,. 1... f- .1153 A' Iii? . -ffrr' ' 1' aff? C, S:'1f ' .,,,,..5,., " '11-1,,.?1J ff"--r -- .?'f-vsfiea ngtf, I -' ur, ,af 'sf TJMA . I A ,it A" "f sy!! lt' , n -' Q23 ' fu- gi? A fir 'h V' - if 5 -7 if .5-f ff if 4- . r 2:1 3 rx 1 Arg if qjpggi. ' .1 40 " " If , 5-IL: - - 'v 4- ,- J- 7 .. 9 , V' 'WV35 .vhfgf . 5 R s'uDFe:L:AiRYiQe'w -4 Fri BOB SCARBOROUGH Center Captain 3 Year Letterman '64 Football Comes With New Look CATS OPEN WITH 26,0 WIN OVER SLIBIACO The North Little Rock Wildcats opened their 1963 football season in Wildcat Stadium with a smashing 26-O triumph over the Class AA Subiaco Trojans. It was a perfect debut for new head Coach Ken Stephens. The Wildcats got inside the Trojans 20 yard line four times during the first half of play, but could only score once. Joe Smelser opened the 1963 season scoring with a 19 yard scamper, leaving a trail of Trojans in his wake. The high-powered Cat offense then cranked up on its first possession after intermission, marching 81 yards in 12 plays for their second touchdown. William Ketcher, the eventual high scorer for the North Siders for the season, got his first six-pointer of the year by crunching over from two yards out. Steve Daniel kicked good for the PAT. The Wildcat defense held the hapless Trojans to a mere two first downs for the entire 32 minutes of play and only 84 yards total offense. After forcing a punt, North Little Rock again set sail for the Subiaco goal line. Bobby Faulkner, the Cats shifty left halfback, combined with Smelser and Ketcher to move the ball to the Subiaco 14. From there Ketcher romped through a gaping hole in the Trojan line for his second TD of the night. Daniel added the Cats twentieth point of the game. The final score of contest came in the last quarter on a perfectly executed 34 yard pass play from Quarterback Bruce Cook to Junior end Ricky Cross. STEVE DANIEL-Tackle Captain All Big Ten 2-Year Letterman PLANNING ..... the Wildcat strategy for the Pine Bluff game are Head Coach Ken Stephens and Senior Quarterback Bruce Cook. JOE SMELSER-Back Captain All Big Ten 2-Year Letterman WILLIAM KETCHER- All Big Ten 2- Year Letterman Back FUMBLES HURT NLR IN LOSS TO CHICKS The Blytheville Chickasaws smothered six Wildcat fumbles, stopping every offensive drive the Cats could muster and blanking the North Siders 19-0 in both teams Big-10 opener. While stopping North Little Rock at every turn, the Chicks manufactured three scoring marches themselves usually after pouncing on a Wildcat fumble. The Cats fumbled on the first possession of the game and Blytheville turned it into a 21 yard scoring march. From this point in the game until halftime, neither team acted as if it wanted to score. The only serious North Side scoring threat of the night came in the waning seconds of the second quarter. Quarterback Bruce Cook rifled a 15 yard pass to Ricky Cross who then flipped a lateral to Joe Smelser trailing Cross around left end. Smelser raced to the Chick 18 yard line before being pushed out of bounds. The half ended after Cook had thrown three incomplete passes into the end zone. The second and third Blytheville touchdowns came on drives of 46 and 72 yards after recovery of NLR miscues. .IINX CONTINUES4 HALL 2I-NLR 6 The Little Rock Hall High Warriors won a football game they shouldn't have against the North Little Rock Wildcats in Wildcat Stadium, Sept. 27. The -North Siders completely dominated the second half of action, racking up 244 yards total offense to the Warrior's 94, but Hall made the most of their yardage and cashed in on NLR mistakes' when it counted. LA RRY CARROLL-Guard 2-Year Letterman BRUCE COOK- Back 2-Year Letterman BILL LYONS-Tackle BOBBY FAULKNER-Back 2-Year Letterman 2-Year Letterman STEVE LOIBNER-Guard ERNIE BERRY-Back 2-Year Letterman 2-Year Letterman Hall scored 14 ipoints on their second and third possessions of the game and made the first two periods miserable for the Cats. It was a different story in the last half. Two plays after intermission Cook spotted Cross with a short pass over the middle. Cross again pitched out to Smelser coming around end on the Cats' patented "pass-pitch" play, Joe then galloped the distance to complete a 64 yard scoring play. The fired-up Wildcat defensive corps held the Warrior offense to no first downs in the second half and stifled the Warriors every offensive effort. 59 PIERCE DETERMINATION ..... is displayed by Senior line for a touchdown. Quarterback Bruce Cook, qllb is seen Fullback William Ketcher as he breaks through the Subiaco carring out his fake in the background. JOHN DOBBS-Guard l -Year Letterman LARRY SI-IELTON-Tackle l-Year Letterman BUDDY HOLLOWAY-Back l-Year Letterman BOBBY DORNBLASER- l -Year Letterman Back JOHNNY PLUMMER-Tackle l Year Letterman WILDCATS BEAT CLOCK--OILERS. I3-6 The North Little Rock Wildcats came from behind to push over two second half touchdowns and grab a 13-6 win from the El Dorado Wildcats at E1 Dorado. lt was the Cats' first major Big-10 triumph in almost two years. After falling behind 6-0 early in the second quarter, the Cats hung on until the opening of the final period when they started their first touchdown march. William Ketcher picked up three first downs on the 55 yard drive. Joe Smelser got the six points on fourth down when he circled left end from two yards away. The second NLR touchdown came with less than four minutes left when Bruce Cook hit end Ricky Cross with a 50 yard pass that completely baffled the Oilers. Steve Daniel, Bob Scarborough, Billy Lyons and Ketcher plugged up the holes in the North Side defense to limit El Dorado's Offensive game. NLR KEEPS WINNING: TAMES CANE The Wildcats used the forgotten art ofblocking kicks to down the Jonesboro Hurricanes 20-13 in Wildcat Stadium, October 11. The North Siders scored early by taking the opening kickoff 60 yards for a touchdown. Bobby Faulkner pushed the ball over the goal on a one- yard smash. In the second stanza, Steve Loibner and William Ketcher blitzed through the Hurricane line to block a punt which rolled into the visitor's end zone. Steve Daniel pounced on the loose pigskin for six points. Steve then kicked his second extra point of the night. The scoreboard read 14-0 and Daniel had eight of them. BRYAN HENDERSON-Center l-Year Letterman I'-Q RICKY CROSS- End 2-Year Letterman WESLEY MEADOWS-Tackle 2-Year Letterman ef? Qi BILL McNatt-End BOB DUNWOODY-End 2-Year Letterman 2-Year Letterman Jonesboro struck for touchdowns late in the same period and early in the third quarter. Ketcher preserved a l4-13 NLR lead by blocking the second PAT attempt. North Little Rock came right back for their third touchdown in the final period. Ketcher started things off by returning the kickoff 41 yards to the NLR 41 yard line. Bobby Faulkner again got the call at the goal line, going over from the two. NLR HALFBACK ..... Joe Smelser applies an effective stiff-arm to a would be Central tackler and sets sail on his game-winning 85 yard T.D. run which gave the Cats their LARRY WOOLRIDGE-Back 1-Year Letterman HARVEY HOWARD- End 1-Year Letterman 6-O margin of Victory and their first Win over the Tigers in four years. , KELLEY AUSTIN-Back 1-Year Letterman nie WHIT HALL-Guard 1-Year Letterman " WJ? WWW Wu gi 'Q it N , POWER PLUS PUTS CATS PAST TROJANS The revitalized North Little Rock Wildcats posted their third win in a row when they came home with a 13-7 triumph over the Hot Springs Trojans. The Cats were now 4-2 for the year and 2-2 in Big-9 play. The Cats drew first blood in the initial quarter. The North Side line sprung William Ketcher loose for a 21 yard touchdown jaunt to put Hot Springs in a quick 6-O hole. The Trojans then started on a scoring march of their own, picking up the needed yardage mostly through the airways. They scored with seconds left before halftime. The PAT was good and North Little Rock trailed 7-6. Finally in the fourth quarter, the Cats got the break they needed. Linebacker Bobby Dunwoody scooped up a Trojan fumble and returned five yards to the NLR 36. Ketcher and Joe Smelser then started to rip off big chunks of Trojan real estate. Ketcher dived over from the one for the winning TD. Daniel's PAT was good. NAMPUS CATS LOSE IN NLR HOMECOMING North Little Rock finally reversed their old hex of losing the close, one-point decision. The year before, the Wildcats dropped three games by a total of three points. Against Conway October 25, they finally won one, 7-6. STEVE STORM-Tackle l-Year Letterman DAVID ROBE RTS- Back 1-Year Letterman hun.. RICKY THUROW-Back l-Year Letterman CHARLES FOEI-INE R-Guard 1 -Year Letterman BILL BURNETT-End LARRY CARPENTER-Tackle l-Year Letterman Squadman Conway pushed across the NLR goal line with 2:31 left in the half. They missed the extra point which later proved to be vital. The Wildcats then struck back in that 2:31 for their only score of the night. Ricky Thurow, a soph stand-in for the injured Bobby -Eaulkner, rigped off two five ard bursts to the Conway 46. ruce Cook, the Oats signal- caller then befuddled the Wampus Cat defense with a beautiful 46 yard pass to his wide-open end, Ricky Cross. Cross went into the end zone untouched and then Steve Daniel kicked the winner. Thurow, in his first game as a NLR regular, was the leading ground gainer for the night with 83 yards on 13 carries. 63 INSPIRATIONAL MOMENT .... PAUL BAILEY- Back Squadmah ., M. :- ., ..J.. . after the game-Players, Cheerleaders, and Coaches kneel to pray-each in his own Way. NICK HEINTZ- End S qu a dm an L qs Ty . f ' 'W ., Z3,:":': 'li Qzgiif 1 .,. 3 ,s, V ' - f Wwfbsi - w, 1. E' fm 534,255 'pd' wif MW 5 ,S ' w Z ,,+ '33 gg 1: Y X .Q 1 ,233 f . Qi ',.':,.f".'f- , niniigjkiigi f I , ' , 5 be 2 - . ' YA? - 3 3 Qi, gg-e11zf12QgfQ . -'fmgk :Six 35 5:-:.1 ,, CLAY HAMILTON-Back Squadman LEON KUMPE Squadman - End ZEBRAS LONG ONES STOP CATS STREAK The Pine Bluff Zebras, rated the Number 1 team in the state, handed the North Little Rock Wildcats their first white-washing of year 14-0 in Wildcat Stadium. Gordon Norwood, the Zebras quarterback su- preme, connected with halfback David Hunt on a 65 yard scoring pass mid-way in the first quarter. North Little Rock, although held scoreless, then made its only serious goal-line threat. Mixing his plays magnificently, Quarterback Bruce Cook moved the North Siders to the Zebra four yard line. The big plays in the drive included a 32 yard pass to Ricky Cross and a 16 yard "Utah Pass" that Cross carried to the four. The Z's stiffened, however, and North Little Rock failed to score. In the third quarter, Pine Bluff unleashed another scoring pass play, this time covering 36 yards. WILDCATS END 4 YEAR DROUGHT- EDGE TIGERS 6-0 The 1964 Wildcats did what only five other North Little Rock football teams have been able to do. They beat the Little Rock Central Tigers. The North Siders did it with an all-out team effort, but it was .Joe Smelser who turned in the big play. Smelser, broke into the open over left tackle with 22 seconds left in the first half and scampered 85 yards for the game's only score. Smelser bulled his way through the Tiger secondary and then out ran the last Central defender for the clincher. JAMES REDMAN-Tackle RONNIE NICHOALDS-Back Squadman Squadman GEORGE JONES-Center TOMMY BUSH-Back Squadman Squadman ROBERT BOSHEARS-Back BOBBY FORTNER-Back Squadman Squadman Central marched to NLR's ten yard line early in the game but Bryan Henderson, and Larry Woolridge broke up two pass plays to end the threat. Henderson, Woolridge, Steve Daniel, Bobby Dunwoody, Bill Lyons and Bob Scarborough all turned in a great defensive effort to contain the Tigers offense. GIRZZLIES OVERCOME NLR EFFORT I4-6 North Little Rock rushed to an early 7-0 first half lead, but Ft. Smith's always-tough Grizzles hung on to ring up two second half touchdowns and down the Wildcats 13-7. Larry Woolridge, a North Little Rock defensive halfback, picked up'a Ft. Smith fumble in the first quarter and fled 50 yards for a touchdown before any of the Bruins could catch him. Sure-footed Steve Daniel added the point after the touchdown. Ft. Smith moved 73 yards in 17 plays in the third quarter for their first score of the night. The visitors then stopped the North Side attack and forced a punting situation. The Grizzly poured through to block William Ketcher's boot and took possession of the ball on the NLR 13. After a futile but courageous defensive stand by the Wildcats the Grizzlies tallied the decisive score of the night. LONG PASS IN RAIN PUTS TEXARKANA OVER NLR Lady fortune turned her back on a bunch of wet and soggy Wildcats in Texarkana, Nov. 21. The Cats had earlier taken a 7-6 triumph from Conway. This time that one point went to Texarkana ancg the Cats suffered their fifth conference loss, 7- . North Little Rock again scored first in a game marred by fumbles due to a continuing torrential downpour of rain. William Ketcher the only NLR back effective against the Razorback defense, crunched over from six yards out. Steve Daniel set up the score with a fumble recovery on the Texarkana 21. The Razorbacks scored on a never-to-be- forgotten 60 yard pass play in the third quarter. Texarkana end Travis Giles slipped away from at least five Wildcat defenders en route to the winning touchdown. JOHN COLE-Back Squadman Squadman MIKE RE ID-Center MAURICE GRAHAM-Back EDDIE WOOLEY-Back Squadman Squadman BILLY COMBS-Tackle JOEY SCARBOROUGH-Center Squadman Squadman ROCKETS TAKE TURKEY DAY WIN--I4-0 A "flat" bunch of North Little Rock Wildcats were surprised by the Catholic High Rockets on Thanksgiving Day 14-0. The North Siders thus ended their moderately successful football season on a sour note, finishing with a 6-6 mark. The Wildcats threatened first in the third quarter after a scoreless first half by both teams. William Ketcher and Joe Smelser moved the ball to the Catholic High 35 before a fourth down try fell short by inches. Rocket quarterback Newton Kershaw then lobbed a 65 yard touchdown pass to John Brainerd for a 7-0 lead. North Little Rock then marched to the Catholic High ten, but the Rocket defense held for three downs, and on fourth down, Mike Butler intercepted a Bruce Cook pass. The Rockets then moved 90 yards for the clinching score, pushing over the TD on a two yard jump pass. Wildkittens Post 5-3 Season Record The North Little Rock"Wildkittens"completed their second straight successful football schedule, winnin five of their eight scheduled "B" games. The ildkittens lost only three times, and they avenged two of those setbacks, beating Hall and Central the second time around. A starting backfield of Ricky Thurow, Tommy Bush, Ronnie Nichoalds and Clay Hamilton provided most of the offensive punch for the Kittens. In a 26-O romp over the Sylvan Hills "B"-team, Bush crunched over the goal line for two touchdowns and caught a 50 yard pass from Hamilton for a third score. Bobby Fortner, a sub halfback, added the other six-pointer to complete the scoring spree. Almost always shuttled into the shadows of outstanding offensive performances are the im- portant efforts of the defensive corps. George Jones, Bill Burnett and James Redman all turned in good defensive plays game after game. Coach Henry Hawk is head "B" team mentor for the Wildkittens. M ... Wildkittens go through another grueling session under the eagle eye of Coach Hawk . Steve Hglland Joe Donaldson Tommy Frazier Bob Candy Gary Hargrove Squadman Squadman Squadman Squadman Squadman R R ' -a .N , s ,"- 5 A E 5 g - I Y 4 Q ..,. . , s , , . A - Q if .. 'gif n - i is 6 -Z Steve Jimmy ' Kilpatrick Bill McClain Gerald Howard David Donham Mayfield Squadman Squadman Squadman Squadman Squadman a s J utna J a g ,Q t ,l t y ,..::., V 4 Q in . V , ,ntn n... , .. C awqwitagi Wwwwi 'rfi :irr i J so 5 f : q ' i ,, .. Royal ' . . Steve Hitt Hafshman Louie Plummer Mike Blackwell Travis Holmes Squadman Squadman Squadman Squadman Squadman 3 n... John Glover Tommy Dew Squadman Squadman A 5 1" ' ' H t, ,,.. . V' ' li' we ll? it N. - -in Scotty Wright Jimmy Red Squadman Squadman .ki-Q' W.- E ,M , I , Dean Duke Mike Loibner Squadman Squadman f -4 in -,l ,, ,,.,:, - ,.,. N P1 .,.,. .- Ll 'J' V' W is v V il 1 x5-of 5 ii? - A his .1 Richard Long Squadman fab f W ' Y, 5 Larry Norman Squadman ,i- - 0' 'V K , . 3 33? aa? I D hampions AA-AAA State Big IO Conference Little Rock University Twin City The I964 basketball season at North Little Rock High School didn't look very promising when practice started way back in November. In fact, the Wildcats had only one returning starter and only three lettermen. The future was downright bleak, especially when teams like Blytheville, Pine Bluff and Jonesboro were putting teams on the court that were almost nothing but lettermen, But the Wildcats, under the direc- tion of Coach Jimmy Culp and with a slogan of "Defense, Hustle, Rebound" swept through 30 games with 26 wins and only four defeats. Not only did they win the Class AAA con- ference for the third year in a row but they won two major tournaments and crushed all opposition in the Class AA-AAA state basketball tournament. The Wildcats, champions of the state of Arkansas, became the first North Little Rock team in fifteen years to win the state title. It was a fitting climax after two years of frustration when the Cats finished second in the state tournament in 1962 and 1963. RICHARD BALDWIN Two Year Letterman All State All Big Ten MVP in AA-AAA Pride is evident in the expressions of the three Senior round- ballers as they pose behind the trophies won during the 63-64 Championship Season, The trophies are from left to rightg Champions-LRU tournament, Champions-Twin City tournament, Champions-Big 10 Conference, and Champions-State AA-AAA tournament. The players are David Teegarden, Horace Prickett, and Richard Baldwin. State Tourney DAVID TEEGARDEN HORACE PRICKETT All-American Two Year Letterman One Year Letterman North Little North Little North Little North Little North Little North Little North Little North Little North Little North Little North Little North Little North Little North Little Rock Rock Rock Rock Rock Rock Rock Rock Rock Rock Rock Rock Rock Rock Season's Record Searcy Hall High Catholic High Conway Catholic High Pine Bluff Sylvan Hills Pine Bluff Central High Hall High Pine Bluff Blytheville Central High Jonesboro North Little North Little North Little North Little North Little North Little North Little North Little North Little North Little North Little North Little North Little North Little Rock Rock Rock Rock Rock Rock Rock Rock Rock Rock Rock Rock Rock Rock Fort Smith Hall High Central High El Dorado Sheridan Hot Springs Jonesboro Texarkana Greene County Tech Conway Catholic High Hope Forrest City Conway 3 use-"'A' Ei 5 DEF ENSE.. of Bill Niven and Gary Stephens puts the stopper on Rickey Tanneberger in his efforts to come up with the Dall. Qlbemocr at Photop HUSTLE,..is displayed by Wildcats Gary Stevens, Richard Baldwin, and Bill Niven as they fight for a loose ball with members of the Catholic High basketball team. BILL NIVEN One Year Letterman All-State GARY STEVENS Two Year Letterman All Big Ten QDemocrat Photoj DAVID BENNETT One Year Letterman f , E i . Twin City Tournament The North Little Rock Wildcats started on their string of three tournament wins for the 1963-64 season with an easy triumph in the Twin-City Tournament held in the North Side gym. It was the fourth time in five years a North Little Rock team has won the Twin-City Title. The Cats disposed of Little Rock Hall, 59-44 in their first-round game. The basketball ability of the Cats' two Davids carried the Cats to the finals of the tournament. The first David, a junior with the last name of Bennett, com- pletely demoralized the Warrior defense by connecting on nine of twelve attempts from the floor. He added a foul shot to bring his one-night total to 19. Gary Stephens was second high man with nine points. David Teegarden's defense helped quell the Hall attack by turning in an exceptional job on the Warrior's Billy Campbell. Teegarden, while he was defending Campbell, allowed the high-scoring Warrior to only two field goals. The final game of the tournament pitted the Cats against the smaller Catholic High Rockets. Richard Baldwin and Gary Stephens, the Wildcats two post men, pulled down rebounds all night and kept putting them back in for a 52-45 victory. Although the North Siders played a sloppy game, making floor errors right and left, the Rockets couldn't cope with the Wildcat's height. Baldwin and Phillip Bressinck, the blond Rocket gunner, scored 20 points each. Gary Stephens' twelfth and thirteenth points of the night with about four minutes left put the game away for good. LARRY WOOLDRIDGE One Year Letterman A second quarter spurt broke the game open for the eventual champions. Horace Prickett had five points in that short span. LRU Tournament The Wildcats crushed all three of their opponents in winging their way to the Little Rock University Invitational Basketball Tour- nament championship. Sylvan Hills was the first to feel the Cats' fury, bowing low to the tune of a 68-35 score. Bill Niven shook off his early season tightness and gunned in 18 points. Larry Woolridge followed with 14. The shorter Bears were no match for the Wildcats rebounding and offensive strengths. Coach Jimmy Culp described the second game in the LRU tourney as the Wildcats' "most perfect of the year." The game was perfect, too, as NLR smashed the Pine Bluff Zebras 75-46. The Cats thus revenged an earlier three-point loss to the Z's at Pine Bluff. Gary Stephens got the ball rolling early in the initial period, connecting five straight baskets and finishing the quarter with ll points. Pine Bluff fell behind, 21-7, and never began to catch up as the Cats once led by as much as 35 points. The final game of the tournament paired the Cats with their cross-town rivals, the Little Rock Central Tigers. The Cats stopped the Tigers' scoring and rebounding threat, Kenneth Robinson, but the Tigers couldn't find a solution to their big problem of Richard Baldwin. Baldwin played a magnificent game on offense and defense, getting the important rebounds and scoring a career high of 27 points. NICK BOYD ROBERT VINT One Year Letterman One Year Letterman Big IO Conference The North Little Rock Wildcats, already champions of the Class AAA league two years running, made it three in a row in their 1963-64 season, sweeping to a three-way tie in the Big-Ten with El Dorado and Pine Bluff. All three teams had 7-2 records. The Cats started on the championship trail early as they blasted Little Rock Hall, 64-56, for their first win on the Warrior court in two years. Richard Baldwin and Gary Stephens paved the way for the victory, hitting 36 points between them. The North Siders broke the game wide openin the third quarter after Hall had taken a 31-26 lead into the dressing room at halftime. Pine Bluff was the second victim in league competition, only it was two different Wildcats who were in charge of the wrecking crew. The result was a 73-58 NLR win. Woolridge, a junior who had just broken into the starting line-up, blistered in four consecutive field goals in the third quarter and finished the night with 19 points. Senior Horace Prickett, who was be- ginning to reveal signs of the basketball ability that was later to aid the Cats in their stretch drive for the state crown, fired in baskets from every angle and direction for an 18 point total. The Wildcats hit the road for their first big out-of-town game of the year when they traversed to Blytheville to take on the title-contending Chicks. Gary Stephens took over the leader- ship of the team while Baldwin was sidelined with four fouls. He brought the Cats out of a three-point fourth quarter deficit and onto a 55-45 Big-Ten triumph. Stephens hauled down 9 rebounds to lead the Cats in that department. North Little Rock returned home one week later to play their fourth conference opponent, Hot Springs, in the Wildcat gymnasium. David Bennett and Richard Baldwin combined their talents with 23 points apiece and the Trojans fell hard, 78-65. Bennett, who had been consistently hitting and scoring well from the field all year, hit a peak performance against the Trojans, scoring on driving lay-ups as well as long jump shots from the corner. The Wildcats dropped into a first-place tie in the Big- len one week later when the Ft. Smith Grizzlies shocked the North Siders with a stunning 56-35 loss. The Bruins forged a com- fortable halftime advantage and then enlarged it as the game got older. The Cats, obviously outclassed for the night, got colder and colder from the field, barely hitting 25 per cent of shots. Little Rock Central dropped its third decision of the year to the Wildcats, 52-43 in the North Little Rock fieldhouse. Richard Baldwin, Gary Stephens, and David Bennett got the key rebounds and the key points in the third quarter to put the game away. The Cats only led, 25-24, at intermission. Stephens collared 11 rebounds and Baldwin had 10. El Dorado handed the Cats their second conference loss of the year, 72-69, at El Dorado. North Little Rock had led by 10 points with only five minutes remaining in the game, but El Dorado caught up on several Wildcat floor errors and went ahead on Bill Rainer's effort of the year against the Wildcats, scoring 36 points. Richard Baldwin had 15 at halftime, but fouled out in the third period. The biggest game of the year, up to that point, for the Wildcats was the Big-Ten battle with Jonesboro in the North Side gym. The Cats needed a win to assure them of their third straight title, andthe Hurricanes needed a triumph for their 28th straight year in the state tournament. Jonesboro fans went away disappointed, 56-43. Junior Bill Niven made the evening his biggest of the year, scoring 19 points fall of them crucialj and grabbing a team-leading total in rebounds. The Golden Gang kept it close for the better paft of three periods, but Niven's 20-foot jump shot at the third period buzzer put the Cats ahead to stay. North Little Rock formally wrapped up the Big-Ten crown with a 75-50 win over Texarkana at North Little Rock. Horace Prickett led all scorers with 15 points. A -AAA State Tournament March 10-14 was the time and Barton Coliseum was the place for the Wildcats' greatest triumphs in the 1963-64 basketball season. The Wildcats, state runners-up for twoyears in a row, were out to get the big prize on their third try, and get it they did. When it was all over, the Cats had racked up four more victories, and more important, had brought the state basketball championship back to North Little Rock after an absence of 15 years. The Wildcats started it all with a 58-45 victory over Catholic High. North Little Rock could do no wrong and the Rockets seemed powerless to stop them. After a shaky first half of play, Richard Baldwin found the range in the third quar- ter and dropped nearly 95 per cent of his shots the rest of the way. Before Coach Culp cleaned the bench in the fourth period, Baldwin had accumulated 29 points. Hope was the second in the line of four state tournament victims, 81-60. Gary Stephens had his best game of the tourna- ment, scoring 18 points Cas did Baldwinj and grabbing 16 re- bounds. The entire starting line-up of Stephens, Baldwin, Niven, Bennett and Prickett contributed heavily to the point total and the rebounding edge. The Cats came within a breath of letting the Forrest City Mustangs take away their treasured state tournament dream. The Cats had the Ponies down by ten with three minutes to go, but when the final buzzer sounded, the scoreboard had NLR ahead by only 59-57. Some uncanny shooting by Forrest City and some mistakes by the Cats paved the way for the breath- taking finish. Larry Woolridge hit 15 for the Wildcats and Baldwin had 17. The fourth and final game of the tournament saw the Cats face a team they had already beaten twice earlier in the season- the Conway Wampus Cats.'Conway had made it to the finals with victories over Pine Bluff and El Dorado, and now was paired with the third tri-champ of the Big Ten. Robbie Robinson, Conway's superb all-around mainstay, kept his teammates in it for three quarters. Conway led by one, 42-41, after three periods, but the Cats came to life with a bit of solid basketball from everyone and walked away with the Class AA-AAA championship, 65-48. Bennett, Niven, Stephens and Baldwin were controlling the backboards at both ends of the court, and it was Niven who finally put the Cats ahead to stay Qwith two free throwsj at 43-42. Conway began to foul, and the Cats be- gan to drop their free shots. Nicky Boyd, a junior reserve, put the icing on the cake at the final buzzer with a 25-foot jumper to set the margin at 17 points. BILL BURNETT DANNY RUSSELL LEON KUMPE One Year Letterman Squadman Squadman R I Z t A fe., Mill' ii ' "Wimsa.l. Q ,f H REBOUND...the third and most important facet of the Wildcats strength is exhibited here by Richard Baldwin against ConWay's Jeff Shannon in the finals of the AA-AAA State Tourney. QGazette Photo? l 73 Wildkittens Gain Experience for Varsity Competitions Post I5-5 Record in First Season for NLRHS Unknown though they may be, the North Little Rock Wildkittens QB-teamy are an im- portant part of Wildcat Hill's basketball pro- gram. The Kittens are made up of juniors and sophomores that show promise for later varsity play. The l963-64 Wildkittens team turned in an impressive l5-5 record and whipped every team that beat them at least once except Jonesboro. The Golden Hurricane nipped the Kittens, 47-44, and then hung a loss on them in the Wildcat gym. Over-all, they lost only two games to Big-Ten schools. Jonesboro was one and Central the other. Danny Russell ranked as the number one scorer for the Kittens, averaging around lO points per contest. Bill Burnett and Bobby Vint were the second and third high point men on the team. Leon Kumpe, Nicky Boyd, "Lefty" Holden, and Pat Goss and Larry Hudgens saw most of the playing time during the season, Boyd and Vint divided their talents, playing for both the Kittens and Wildcats near the season's end. Coached by Don Jolly, the Wildkittens turned in their second straight exceptional season. One year ago, the B-team went 13-l. Their record since the position of head basket- ball coach was changed stands as 28-6. Now you knowwhere thevarsityWildcats get that winning tradition--from the B-Team. TI-IE 63-64 WILDKITTENSARE FRONT ROW: Bill Fred Roberson, Danny Russell, John Bakalekos, Wilson, Ronnie Holden, David Roberts, and Tommy Robert Vint, Pat Goss, Don Bunch, Leon Kumpe, Johnson. BACK ROW: Coach Don Jolly, Bill Burnett, and Larry Hudgens. .. arf S. 4' +4 9154 'K .NA-v V--Q,-A .-ik -. J"-""'.-'-.1 - 1. - . ,,,. f'.3-Q,--1. .A."1-'1,,.- -' .. r'-- - 1' , . .., 1'-,' ,fx 141- ...f 1. fini" Lffj.-fs '-0. ly, . ,. -. -:V L.,-h , v -I fi-'J'-gf.: ','- ,zg af --'-. ,ff .- A Q. -f 4,1 A--H N - .. Y, ,.-r' , -a-A-f - 4-,x. 1 ., .1222 W: Qi' ',.v 54" .55 rl'-L. Elf , '- 1 v. f. ,wg . ' .A Y any.,- 1- 1 11 4 L4 v,.wvf A ,, ,,... W, M ,fkv W M, kk.. ,H A,.v blsf ,,, A A. ,W :f,,L W ., W.. ,M M, 1, ,mm I.. ,. . . ... l .. i .Z . ... M ... L ff . f', wi--,eil .e:-' 2 .fz :',-f 2 ,1'::lfz ifif 7. .V -V Kghy S L Q Y'- T A , ... .... . ,.., m A 1 2 .... i A W Sf , S 5 in f f A: L f S , www, 1 P X K NW, sm X M wfisz-ww, af w iw X Q ww :Sw m , , KM W f S , SM X wma M A 9 S, aw f M 5 f Q msg X f g S W V , 5 V Y D, f l hx H f X 14 K L 5 ik 5 jgwgsxf 5 wx R ws S X S X 2 X S ,QS ww ,yi K H250 K N, sm ,SK XM :qw Q 1 X V ,N 3 Y :ww ,K M fi W iw Sw 5 5 V 4 R 5 Q. S , K x, sig, Hs 1 W ws 5 5 S L g , L AWA W ' A- K, V Q x A ,. S W2 -- K ' ,Q . 6 Q Q - f -- lift" 5 S . . ....,., .. N Jew :555i1iE?iL5s31jAf5.e.?lizW:5fs:z.1e5,vriQ512SWEgifoiQifiiv'552321',ii:i?f,QE'Qf'VYlf?:zI5iE:7QSk'ff:esf-iii: fff f "'wz1L-'iv W X ,L L5 . .. j' 7 RL:,512:flfillixiii,ibfimi'iii'-3F3'fS5VziQ9En5YlTf?f5"'AW ':if-f'15il1:?:JJ'if-LL5S5:q59lZ7.50153297':i?V':5?:7LXa1SEi5Qf1H:HN 'W 5 Q f,z-.liszfgimw:my fa, V .7 Q ...., ,,., A 5.5. ,,,.. , iiliiiwei 'i 3155921155 -Y K A' ,mxsvg s 5, s 152121 V11 ,lk :M K Mm? gg Am.-.lb 7 M,,,,,1,,f1-.gg:,u -- EMM A L. Q ,,,, -W A A., ,Wifi :Q , wi .. :evlf vw? fiflkfgqif'Q191YL?:??'S-ms :ge mf keg:-7':QE-f,1f:':zXil5"f': S 59,5 it 5,.5 , ,. 4, .55, , . U ,,.,.5,. M. .,.. U -- jrwea. . wwiw.L-.,-f1.mk-wmqh'1v,1L4L,:-Mgsv-w ,wgw-fgvswermm-wxwm.,L., ,V 7 W W vwimqgagwawfy1naw2-wazwg,weamwxzw .V 2 aiaizgswfwfzaillssif ' xg - .. ,A - Q mis: Aimwiqggewlgimm,.LMMez , Lg: , M, ,Q MW M ,, 71 ,Q - W ,. ,wwwgza1M,,,m1Q- ggggi f 1 ,L ff, wgwasgmf 5-rw i ya ,Wm .Q E ,L w-,Qmiw . ww A -, , k Q , ,, milfs 2aiez1z:5ggm.ggw gasmy12a1ssfa1Q:334m,,5lfgil,554,:W:W,wlggaagg,qlfwr-1mfgsx-gmggaw ,,g5g,sf4Q7yAm15v gwwsssm gizfgylasgilqygasggw w -Q7-31552255,wgggffsgeg w,,,f1sgs,5: fgfanwlu vpiQwzgfgsxwzzffsszw-gaaaflfsfg-.:aswx3,fffagwziis ,vw 5 K ' L' W far Qzafw eigf QMQQQS vzeaf fwimsf lvv sfi, 'few wasggi:11525517re2ig:qMgsi3:??fQ2gggi?1222123,?YsQ,2f4fiiiia51Hgi'viiviiriyiiiflwif,s21E5i"-iii?fSfsh:iQffg1s-fiaiwsififm S wg w f1mu1yf.m7Qw- .-' Q Af -Q was- 17 - A my - . -I 1 A ,gufgf-.swamv wwf -www51wg1M1:w:3 swzfm, W f,1:wfQ:e-.'w11-MyIwmzfsiwf'-'M-My 1.552 mi " ' W' M I -. :ww f fa " 'fs1Qlg55,wg.Wwz?:Aawqgi , - 'A - V L- W - 1 ff,fs,,w5sfg,Ls W 1 V V 1 zu - :'Fw5hfWQ, .Q . , , - Lg - i Q Suk,,,g:z21L,211gw ' " A : ff if A ' I 1 f Y Lfs- Q W1-SML' Q1 A S Y ' .N ,,. -S Als'i4sW4l"52x:gQ,g1::'4Y,Z5?vKSF'f,sa1f?1'f gg. ivpiLsv,gQZ':5sS351'.qgf,g 52 Aw fVi'sYf':s,IIA-mggfgvjg 9'glxs1,5y Lind 1 ip: my pagan? L 4213- Qi 'gxigygrj mw 55 Y, gy . 7 Amy .. ,Q vp , u,-.kgiwm VWZL1 mm 5.41 sifhfq, in igsfjiisrifgfir -3793531 -w15:L91':yIl'f ' :e1zf2i2,'E'm2mQQ images:,iigspgfgfzlgfqwap,wa,zwgfzmig Hate: W -Lu waives -Vg V L- H 3592- Q x'1-45:2-ff QW ' X 5 f ' A if Xgsgfifg-Qz22:pa QfLLf?f,wzgs21w- wm fgga-df:iq55,f,,Qfss14QL1gg -f W W K' , , V : A ,L,mf,ms1 wk-wf 41 fy ,. vw wig: M Wm X T 5 wg fx RS we I 5 S,w.U.,.gW..m.s,b.w. 0 A A 0 , W, M S 5 M.4,m,.1f--Mm -A Ifnwiffggzfgvezx wt fiW,5M5,WL,,Q ,W awk gm K ,gy M3:,,m gfaiqwgfifi-52igfgngwm Qggmwfsa-ge MQW weGiwiwigimwm Qg:gf f ,vf' mvqiwqif ,Q ' fs, " 5:11225 15 K W A-M, A fiiwfilavi'fQff2f's2ffffLl?Qi1i S X fggaw,,1Qg,m:s S 5 Z2 V :em U :iw myzs Qswzfe wi W gkmsfimi ,v2fff:m,4LQ:g43:q:-f'- M . A. 'ae 5:1 gm, wfsfk, 2 f ' '- f f wasVemma?,a111f:':1':m1f LM avsw2.,wW'1fiw:ww- Q A- W , Q M,2z5ffL1gq,kLsY WW E S1bmf.:Hg.wfizzwfwqgzsgzfwfig1 wg mm-,mv-mf'wfffM:f fMwfWfM1'fL-3lf ff 'L M Wm ' K7 ' Q f .www iw:-wfw,m,M wa v-lQzi: W 3 w,AW,,W WWW ww S ,.w,i,m,,1,3,W,wM , V ww N 'AVN 'A5f?s'5WZsz1,K',- 1 he ffm - 5, if VM A ,M SWS, .wfmfm ,,. ,L ..wg,.,,f gl 54 swf vwiixk ffm A.si"A1'Af9-'Q' 553 77 .Qgittixfsszfkssfi V fsiwhwfl Qgev-Um 31' S55 VJ -.Q QM 1'ibi55:Gi57 5219141 - Lawsf:Q:1lfSfEJ5557waSf9?gr 7-, MISW: If -W MN mf M wnwsgsfWW Q,:w,1w5Q ,M X ..., A ,K .W ..5.5 rigs , 5 ,. W .5,. 5.5, . W, i.?,wA MWQQYNJ Xi 51, ., S V 5 N, X X , S S, S, M, S, ,Q WWW, sz A Q ,Q ,S S 5 .. I ff 9 5 ,Q S K H' 3 W5 f S S SW 5 X be Sv N 'S U W G M A A' Y 2 Hs?FbwgwS issikg: W umweffms-Q Q V ,wi -Q ,Min my . M L- V W wa- , WMM aww A sm gkfwfaizs,fffe11wa'zs2Ws4i1w. . .W , .A .. qwm.,l1.w ffkwi:NWS-QAM vwm.kefwwwnw-Wm wwf im fwwwa W1wf,,M-,nw-,gwwww-W,my www-,N ,W 7 Ae, mf -my :Maw ,pf M fglv-fwwmwy fs-Uv w w ws v,1Lfv,wxw,zwmmuw -wr in 1 Q1 -syn -mimzwisf-.Lf gk awww gavwkm Asmaff :swf . Mm. -W ,,1u':w mU,sm 11,1w.f5L ,L ,wgwx A gwm m ,fp s1f,ga,zgwfwMf5fgNx,,ffW..fn ,QSWAM im .sf ,YXMTMW-frfzf pk frm 7 Qmgf lwwi mf if . A My .sa f,,wzq?5if.mf QQz.wimf:sgKfs51sw:f may sw M wk ,Af -S .S A-by A. -V Aw M . ,,.. .,, .A.. ,,k5, S gf Sxgaixqnngv' Am i, ..1,Wg,m.5v,,,A k,p.,,:1uf.w ,wmwffv -fx-ufswfl ,Am 5 ,S ms X S W, LS 1, k Q Q Q 5 ., ,,,.W,s,,T, W,Ww,,A.5,.Af,K,A Khwrkfvx ga MQ Wg 21'-"2-M-1 wel Mmm- xy Wmffsamv -M ffff' , , 5 , S M W, Q A 5 X, 3 .25 is A- L, will La.v,L, . ,,,A AL,AL,LA. . -,.. . W ,. A S sw? S0521 zfffsw 'Y 9 ' 5 X S ff ,L .Q V- I H i ,S v,f,.,, W .W sg M . WY V, W A 2 k M in M , .Www , , A Q fawq Sym 22,15 312633 : 11,1 :j,,ZSwE2i12??fsef N,.,xf3,w mf :2LL1,-gs.,,xm- ,W-qrawipssa A. , -wgegffhgv 55. 5p1"fj2fssS AL wil 2,n'5ggg,L1":Szs5f5?: if A3133 :W QWJAZX'aGx'iii0fZ:'L1'l15s U :Sw-557. ' "V: 'W' 2, 11, 3 , S Y 'QS -11'siwlfffwiwmlfa-wf,, L- ' AEiiasfeesmasfaigwffmzgaaxwbqifwh? fzmwff'AwiEf1wH2ffiffkf2sSWwQ'-YL gil M5WS1?W5f'J' K' AWS 3z:mef11mw.L W H A M A Wwggf-www,fwwfgvzmxi'ffm 21 W vw U-Hhiwisgf' ,zwwk Qwy-sfyfvf x1m,f2'kvMQ??i11sQi?irNiL f2QaimFi9liif?52i1fizffiirsiiff1wi-1155,za:wgf::fYi:52g3i1Hifi Xaxsf J 53,56 vim , K ,s M W wg sk wk 5 , ,ff 1' gap, yfgiflaf - . Egg fg AQ Wy 5 Stagg saga'45iilirigilszgwx-.kgyiiizv17523-SixT31QH?s,.,L1'QEs-Qigfffwkicveiiff 55:55 34.2 ,iiiriiiv Qi: 175561 viii 1515 Yi" SiQaifiZ197W:301f1Z:LgQ:V W :wiiiihhf wsXSkaf12?XsemeSifffi1fkf?igQ2?w222g:e2ff1f 1-1 ww' ' v As -2 -51' Y A 'W My W fel' Z MQWWWWfgszwmimfl 1Nz'1,,,A, my1f21'gQgi32g,ei,5,ggmeawgggaaisggs ,wwvswxmag7:we-LLM717-fL?wwfsf'MMH'feisqaw www- K A p3,Ti5:f1Qg:w1g.e,-LLL'Fas", ,K f 25,3 ,W was MM LW,,1,,,,ff .,,..W,, mn, ..., . W , .V S .W Aik, . f Sf my A K X My W, flw'-gf A W in MW, A , . ,, LA , ,L -. bijisx, ,,wwQ'fi , sq i ss ,, 'figs iizgffifi622210Y-ai12isSl52a2mzfiY?,wffzgazmill'i1Af,a:s:aiw-use:fnffiwfai V 'H W R S . Wa, KM, wx, S 5 f S, vw S :ws M Y qi, W Q 5 M A Q... W .Q.. im. ,,,,Q W L. . .L Q..., .W ,A . . ,A,g,fA,,:v1smsaKr W, ,MQ ,ww 112 ,v3,,,,m,L g,,WmAf wg wp 5 5 qv-1 -Lg . Ml, , W r ,1zQ'Ai1fs' ba ww Ss S S ls A A. f . if ,1 www V Wulf:,'.'i:v-Wzjfzwiff-'riii' 1521931 ilffprrf' ,L A M .QQQ Wim, A V, W, Q..,Q. W . .,W.A,,,wf ,,, v,,A, Lb., W, Sf .Q,. MMS ,,,. ,.Q. 5 ,.Q, E, .,Q. ,Mm ,.,,. ,,,. 5 -,Aww A ,,,. S.. sM.,,R,.sm ASM-,SA my Q-QQQQQ.Q. - , H is W fs, .,,M Q.., AMv,kU,1,f,MM,,7f .,QL 5 . ,Q MELA ,L ,,,,1,s,,W ,A -A imsmfgd QM. in Mm ,M N ,wi :,wfn,Q1ggg,-:yi Siw-Uimiif M 7 mx W wiv M W X 5 Y ' 5 szgibifvvmzfsfw-zw5 -,flEs2K1Qr2k1Mwwwwif-'wwf wk 'wx ' 9,-3 5 Q by Wm , S A - A Muff' . A V , .M AA V, - Av.. f ,..'1..i-i511-vlb' A- 'F-55: ,:b,fag,1 .fvfikwffliwe gligsiw f 5, wxgmfk ,Mm ill-.av W is W J gag. S S W JL wg?-Km 5,9 V A .f Q2 3 .sf L5 - ' 5 ' " Y xsiewff A ,,Xwh :mggzzsix-gm ,Q W ,l . , m ,A ggixqgafikvmg-eaq2:sA Km ,Ms,f4, , ,. ,f S ,ga an Swv ,S , aw WW Wm my ,mklwfesawffQefbferin W ..., 5 K, ,, . ,A aww-M 1 s 1 W. mmf kim fry ,K S ENV 7 'f' V' ' " V ,, 59-low Aw-3 A Maggy X 5115, ww' W ,MM wwf Wwwkg , ., A W ,M Q . 7. MS, VM: -A-U nk' ffbssjfggggggigs igwgikww-,X,aaww w mwwfqqff-mm -inwgvlfm FMA - HMM 5 gsgifgszbwrmflHzlsmswmga? Qfggk V gk PG A ' -f ' W A ' M .Q.. WL. D. .,,. My A ,M ,N Us M: ,wi ww Q -:gg wg,wgspzwgwlfoafamq- "wSWwL"h" "W 'S S 'M "V "X W M ' 3 A i ' gg ggggigvf gqgffg' smQa1AfsgQg,,q ima' sfmvwsvz gew -mtv: mf :iw siziffiai 2' A A ,, W 1 N W .W uw Z. ,ww H1 rw if www Iwwil 5 L, V w4V,ww Asif R wwfVjywmwgifsmfs,,TW .,,,,3:V,,,a,, , .W ag. , 0 ww. ,X S Q vs., W K S nn Q W K,,,:45 wwrm, M vw Q1 Gm- 7 mewwv Ls- ww-S11S:aa"Q11bf 14 V, .V . MWA V Q :wfssg-wxbia-.fliiill . . .L . . 4 A 1 ,uffmzf Wmif-ffx, -X5-.'2fQg1,z1'2uwa figwfsavmmx -21057 afzzf':ea1l9'VLmgJ-f gb: :SJW wswizx iffanizbrsifx ivsisalwazzmm- T W" ' b L ,W ,w,w4,, -an A X s f ,AN'252i:s5,1i?.ibi?fl H5 M ,g - msc ve. . ' 1 L fLgngfzfgsw,w,wm ,www A M - - 1 Q ,,uf,,W,vn,W5,s3 p.S,,AwW,nwY: 4,715 w , 1 1. 1 ,hzsjjgi A . , My Vg V ,W gk , 5 Wakiif 1'E,:w,31Lf '-.fewzgy www Ag:,H5wsm,z1 wwf fszsmus-vffssw isa if Lszsiiwsfg mawleff filgssrfklwfw VJWS Tliixex 1 1fFS!'vi"3:fk A 7 AQ .M sw-:wwf:xWE:2'1l:wf QT- . ,W A S ,A HK, ,A M , .SM , W k U.: ,:LAMAAw,1Qff',v4gww.g,i1-rimsawkfmfgizfmmgg4M:L,i1LLfaszLfiQ1'Q1g'fsg1w-lfizwawabfa3:13152Lssfwa3.Q:zwwzA::www, M A ,W W L 73,1 ,Ayn ,g ,i,,y.nLQ5l,1gg milk: Usgwx M g.'r1',eu4w:z1s524L Jegg5,,1"ivzaAj?'.rss3wf5T'Lv N512-15125-S424 wi 5 S'i2E1'fjSLKLG -fs'-WM M' 'V' . V' ,Yi B' W-me f2l?5fl9?Xs?W:S5J2f42L Ai ?'s5'V'f Rf w sv dwizxii -593 fs-A'Kvl'?1f5?J SF Qniilivxklfw- fSffS:5kilEf:'f'f51A s,,w,,g,gwf2agQ22g,4,,i mam WS:,,,.Wv wg ,, www- -X. -W A ,532 mmfkiffffa-Mraw?ffm. , M ,,,5s,Asfw,A.,,w ,ww w,Af,,gff1 : 1 , -fh,,T51,WLf'f,2,,,k,1,fs:mw ANm,,wvm M m 5. ,iw A - X..Q,,.U, ,. A fy ,Q W mpg sv ,zwaigigubw ,xufsmzww Q . -.v wff .fu U -W A -wk :fx wmwfifisa 2 125 -QL 4 fy' my W Y-www f M . :msg A , V, , WM my A-qu, .Q, .Q.. Q ...Q v,7.WQfgL.L:5.v,:1wf , . , m . V ,, myfffqibqeaxusw554'gQm:55a2Sv,z'Afm'giffa' w1:i1m5H1Xfuf11s1Lmga'-255 ww Hr 11:24:11 -U -Sw Q fr,,ge.'Mggs37 . Zi . s V -1-V M A2 5" 'V 'A A 5 .5rwwg5'?f,qefv5g ,vm,g1,ma? - : r . - L gfgzsw 1, W. -- -QS W Mmfiwx, wrgsgqi sgsaeimw iwfssf may W :MW-Q :wk W., ,W MS, H sw - gzsafzg Q1.s,,?:f,sQq,As,1,,w1,iaww -M ww-fy www 'YT H sim? gsigesii Zfigfiwk , , , , My M A S , AWugfS.m?.q5fm,ff4:mfzyfgfefv an,wsmevaszsazsaiwwe ww my was gm ,V f:g2ffx?wMf-mfQ-fwwl f , ,ix X A Q . ,W ,Y W S .. in A,,ANfllfmwsgf-wagfiwsmlwibfgfwAvmywwf,-w21m,fs.M mmmf-:LAwwS1ffm:gp1Q:5w1.Q'W,ggfmsmwqmwf Mukgsagsgf ,h,Sg,L,,Qe1zsQviwfm:gig-w1,g,wf,1Msp igizsamrzsav gm- w5?w?lasQ7QQ:5i'.'Qs1x1wzg'27:b- fu: Lawazgfwwm-fifmw -ww if M -5212753 3 A Mg- --,yy A- '- Nw 1 W wg ,1sg5rwffL-fwffgffwwagfxaem -'df M y Y' 9 W 6 QM, .v,,?A.S,w,,fM 0, ,M fw5,mev,,MMs,Mkwgziwfswxfsqw - -ww :1L2ffff'AazQQQz2waeaS ,S ify5swuQmgg?5?iwHSf5iimfS22fsg ',. '1 , '. V VS is 3 HQ -. ' .-.42 gvEswrv2E,z1zg3,glfs51ize?wwfgwaggzwgzmefgg 'xiiizlfewlwwfr-MMM Swwfwfi-Mlm W A Q -- 2 5 isafxivxibs fimss' 5E,,iDJ5fi!f?lik5gb3i -- , - ' V ' 7' M f V A 1 ,- '- AMX VZFZQQQESFKQEQ3-?iQ??'eX2?s.1iiaf-25:-1556 iisg J, ,V . . -V W, ,,. . 7 M M M- .V . ,Am A V AW,--uw-A - Q ww 'mf 'wfkmgkiiwysyfvifiwkfknffm 'f ' W' ' 5 2-Szzliissxaxwil meayfswfaeifaegvswflw kfw M1121 wewwww- lzesfsssqgq wsu V- A . V V -A QW. Q, -MW, UN Q k -:M ,f ,-A VX X .War UNH if saws? . 1 - 5. -- Sm: yin-fm-fS11':w:3L13QSg: X Lzuvzikw www?-gym :way my fezmffk, . X y W -iwwxkxi-Wfe HL :L X L rg xlxqxbgw, 5. xg ,316 ,Wy,fM193wQ,,Qsg,g,f,fQ-,pkg xswmgg 1 , , V ff A. ,m.,m :wv- f. wwf A ffsswwfw Q ,wyggrfmisggyii fm Qqwirsiyfww ,ww fm ,iffmsm was L 3,5 Y ,muwm A ,,f35m,fw1. ,M K www M. Q S M sw. Q x if ?Lu:?5'1:Llg'5 1 W , a 31 My Apef. 2sMW,w.,7,U,3,v:Q, X asm ,, w,Sy:,2.sL1f13wL A.5vwf,xL.wi.:zavff-A ,Y S A Mfsfaw gW,W,4.wLNEW, wmfy. fXs.Mwww ,B M M .W ., A N K , fx ,Wi-QL, W, W. L,Wf,, . W, . , Q 5 ,,.. ,, A Q ,, , wisp gs mf S wwf 2 my Q W FW W M ,rl ww ,:az'1+w,emffiiwai mwahmff5:wf,iJ' f' ww- -,,wMA.Y5-, .V 1, ,ww ,, k ,W . w ww Q... W .QQ. ww , fy-mm-'.X+ Q1-wwf-Sf my ww, M - ' A , ff, M y - -' yff mww-,J w A MT . Q Af SF? 221 Q Hi? 'WA 5 S H W S L S215i3?f5ELQf'??irPfN 322734iT'i'P'Ai5Ksfl5Ysi5SZ3Wi5?'ii. 5 1 W Q. - ,Af ,1 yy Q1 ,Iv fx fl fzlw 5 ,. ., .Y ,x A ,, , .MWs,.X,.:fr.mzwz.ww . V, M, i ,M-1 .MQ A we .V wal im.-UWig-Q1,f,L,w1g,,11awx2fg51A,sgwq-wf :slffwwysvwswxw A . . , ,dwg wiv,-W'g,,,mm,1g,5s1m5:waxmagav-52.sEwsw.1,gfeLf55grf wg fawvw uw If QM 'wf N ww -- ., ,s 1- X5 , ,L Wy, A i g5M53'1m-aww w M1 wi E I U , . wf5f?'gB'-Mffwfggiggifkzfgf Q msiqg ., :M S Hg if W0 W uf 'M 'X LS S f S X iwpssk wwffsff Q,wQwS4'Qf Q , .L wk vm 75, ,M V7 SQ M ,SA ,MMU ww WMV, , msggnw W My A M sw Q ,. . V, -,.. LM ww,-i ,A W, A A. V, V A , V. ,Wv,.m.ff,, 7 --sf-xy A V, . . ,A WM LM ,. ,5.,mfw5,L W www M-Milam, f5w,.m,,Wf,i.fi-wm,f2Xzw.SW. S1 W . ,N , , ,A ,W ,vw ,A w r V, fm . Q W my ,u5,,,,,kra2f1Q:S,ig:mm im Q, 51 hh ,Q ,Q-gwfv-QLQQS -7 +1 ffsvmffw ,fx:f21w.m,wz 1w:fw,m2m,Wmff sfwfk mm ,mgm-W1 sw wwf ,ww fm ,Qs www lr',wfagwimfwzw frwwwrg- wb ff bw - WK 7 A f w wfws lim1:z??A7w?:wM-wtwmekml Kea: if M1111 ,fl -iii' Awwzwisgw-Umswwrgealiix'N'-,asf-M1521wasffmfwwgsrkwffwwywffmki mawfasf .M , ,A A . , ,,A. ., V, M V, L, A 3 ., AA QX vigeugggsm,alggggwiagygw - . . . f .W Q ,, S. -,jifwigfglmg w,,W?gwwaL5,iM,5wf,,,5qW1gggv,,w,L,,?m.W5,My1,ZLgwgqF6magmaQb5g,fgL.Q,-55A,Sf...gg22q,ssQQgimL, Q ,igsvmsfiwwfm Hfiyaggigv H3193522,QAALsgssafgqggifwggflggigbgl1355 , , ' - , - ,, ,3,f5iibg555mgQ22rg1gez,fraegegsg2MSze?famay2212Lu525133351SwSiwghifiggmieigzsfraxgfgawsgvQQasQwgsgswggfgggssfgfazsggaixsiV.igss1zg22Q,ggf225W 7 gslxgigsggsxf :MWmmwfn5Mg1E1fSf5Qs11QyQixfQv2E -- I " Y W V5 A . - .- 24- 1 wfwyiayzwgasezsfkfsfviuggwamiazfgagfnfeiwsfwv5'fsseSfMsSaeiz4abiS2Sfe2ywwfifzvfilglesff?NwamfgeafwizeQkiisaifvwgwidefK 'L 152wiewiwgfimiswifwaswV-wi-wi A- ff - -W.q,UmA,31,?ggQ:,gW,5fsfg5vw!Bg2yggEgQi,,ffaJ"m,,i5.q M M A fg1i,WW3gW,5S1 M www N5 xg W1 Saw S, ,S A S . . , . .. A A L, A 5511 ,wg f, ,L x,Kmn,xz,vf:gigmg3,gsffEfq , ,A L. A. ... ,. W, , . .. . . : 4 A ff Jw , ,V Q an - .V - Qgsgkm .I W. ,,,v,,WWW W,.,M,gg 8. ,Wagga ,fLgw.,,awLM.,A U. MB ,,,.,,,,.,m, aw QA. A - - -- , R, Q . f.. M - . ,. w e - w x w 5, -A.gwssgx45:gfAfww15:aw ,xl way:-'a'EAsv mfqwwzem.-W wwf 7' -N. w,,,Aa5-M ,,u,5iV'3k,i,fi3f'g.5g,i,.gi5i,siQ1Vg5gg!3E.SzQ8.qgawk I X . V, , H: q, ,,. ,. ,. . . ,ss 5956 ., ,.,, . ,, .. .X ,M . ,Q 5 1. ,L X K S J V ff , A ,A ,A A, A, M :W VV , , A A, A 5 A. V A ia 1 1 ,W ,,Mw,i, ww Qsfkaw -wgmlgggfggf Qxwigmmmmwvwfnmqe kwafffwwAsffiswcawafrf -Sf - I k giiggilgliw ,Q , 3 , am i 1 5 gm s f m v w me aswfigggg,ggfgiigii555wggiiggisgggggmztgivzgwggigjizgEgggsxgiggiiiQf5gg,aE5vL,fgkQ,g52gQg4ga,g,:3,QQQ'g3ii 4,213 Wa Wm X.,-K f A ww W f - -- ' M 'A Q X L x 5 5,57 y ,f ,gf MQW? 552, H I -gag F at 2, ,,?5l,,DgE Er XQTSMW, Sm Q inggfkggfg WF! WMV, ,M sm fi W as M0554 ,SW 5,255 wffwmv QQQS,-wgktm-5 xiii:-,Wwfw ,5 - iv rf, X ww Y 5 A -xy M. A . , A , ' A P h - W M ff - W' W A A in ,M f gn Q X ww msg we S Q1 M1559 M is Nw 5.5 ,xx mS,A,,,f, A5 mm NS v Swigfggy if 1.5 ,MQ mm ,V MHS? 4 sf' W f' ,mx-.ff N S, K Q fmwgl if W WS is 5, W, , ffs M, N ,K 5 Mew Y We gd M,fM 5 W Q yi Q -X, vim gui 311 wi, as ,Q QW sm , 315 L,m,X.fz1 mfwnlsv, M U sa, ,wwvm 3ik3,,sMf. was W2 sg wa Y 'W t w by q,,,W www A A f - fy - . an - 5. ,- 1, ,. :mg wmew,Awwfam,5yLw2h,3- 5,113 A.,,3w,1fg,iv ,5wg,,2,g5W,5m15,17ffwvgsgwigwg,mw:.sgv,gff 1 W1 sf 31: mwz,:mfw,W ' 14 m,fmgfs,wq1f gm A waflxfywvgiwvigfi-Zswsgffw-ww fn- 7 S-. M A715:www5mszfewfs-wgfs11qqw1m.wSmmgfmgaifwww,QwafwSingfwwfmffgmmm,122fawi:wwffum:Vws:wiwmx-U,zNa?:s1mzswzfklf' XwzwmvQikwfwsvzw A ??Si?2gQxf53q 'ffm gg vfd?gs3s,,,6?f1SHf2W - . ' W fi-43235 T . -: I -5- Q l irsiiwsfiwzgzifgefiyifwkswfw1sisawfeffmzwI5-56121252261512522wfwf1'fysQLwza:usei11f-fmfgggsifzf2gwawgzssqamyfwsflfswlizgffsgggsiggsxwfwfgwgizkwamifiigzgs-33.. V X?Qifgaag1gQgm,faQ2wwQS1aa:hf'A , M ,V A Z Vg. WmS,,n,, A U . Sm ,W ,iw ,:,z,W,K,,,,d,WwM,,Q,.,.QMi, MMS LwwsfgLWWLS-,L.M,A.Q.,,fQ MM-sq,,M-Wwwww W-w,.Wwm,,M, sq-afM5w.M . 425 .MBR ,g-,A-WW,-,Q. S 21f1siuf'Hfsfff,ijgfv WH '??fff1Qw:rWm,sg Hfzwm'sgaL A M -1:5115-W .sw ff1fmw,,s:fM,sv1wgq55 .-wwww' fwAQ5sw,Swaw1,fwWfsgvr,1,,mmrwrmV-f,95.mm.w1g.Wfgwwfgw-Q17.m,mQgw2W5zgsfgmMs14.gwim1Qzf tsvifwggmfswgv ws,-wfewgv,iffsf-afkmaAw m1'fasw1fmf-S A ifmsiws HMgggfbw-mfsmffwewmwigQfq,fw:Qmmws-fL,L:3fwe71w2? Q2LfgfSiff-safwfezwgipmwwWx.Wg5fl rffmywwwgsmMMwkfsw3:1shamfSQAifwwfwwfsmwwfixfkgwfwzwffww7f2:ws1mg.,,.A. W 5- fwwg Sqn Y A E, LQMfQ.x5iMfnS,w,4 QWY4,qwAui-Lgwilgqg-QglwkabamffwfwaA,,,Qf1asLf,.,L,m-wsf,g1WgQ-,,1fxarsgwsfslwlf:wg-msimgzwwxw13,y,2aQ1f:sQfww,Mfsfvzuwsmawazggg,UAgiifL7Q1bwfsZ1Q51Qw:211Sa1:gfawmmmgwfgmkxf wwffw:qw-mm,ww11w5:fvAmiga: mzw igmwxwffskswfs M : A-ww - - ' -- Ts: wwfwAim-aw1msffwmwm,xg,,L:SwwwisywffqszwlwwgfgfwxwygX,5mMmfwf11,wLfgeiffmfwn, Mixingswwfwwwlwfxsvamqgwg-va msswfgwwwfggvm-ffgfswi,I-Uff-- My Aw'-S, MLM, ,M M, WEA , .sm . A A ,W A .,,Msem,,m WL.-WMM Mm.wQM2,,,f-U,Kw,w1,-Wfwwfxmikwwg,nwmsw M ,.M.,M,.V1,.,A.M,,,?U , .f,n,Q.gSiz,yWgAQg,w ,L,,:3,gpAQp,g,,1w.m - M V E A - Q--5 gh,ifiwgwg-Mgislmf,1sqgW11g,mf,g,m5a-Qw,wvxLW.swafslwfxfggswaqgwqg,wwsxwmf.sixW,is5AQQgX1Q:12zwwwkyixawgw-QwwfLfisAAmf,fMh?f.:f:55fs,sA. A x we Mg,W,,fMQ,L,V AL ySM5gh,S,,9v,,RS.,,. W A fp ,ggygwgingiAwQmww,,g,Wiy,w1sQ5wmwQWg,AQiwmwggIff,MwQmwa1wfs:f,xswzwgfwwsfw,G, KWQL,w,,,J,,v,QSMi ., A W ww W A ww, Hin , V .L.,ui,,,f.Q, Am vs 1. H -- , - . ff . .WL WS,,5.,:,,fqf1M,v,.,F,,,Q5,Wgs. ww ,W ,A 5.sML..w,x U, 8 V ,R ,A 5 3 M 5 Q Vw My waz. Www vg,m1es5Ww.sL MQ, . .. -N kg S ww S iw 5 S, ,MQW ,M ,XL S 3 5 W -K W "f'iS1Aggi 2 gixzigiliikzxf :Q .111 ,A A , W. fA.,f,,,,,1n., ,,Mfw.,5 , Wm mgq,,5gna.,g5,,Aug,Qwmgwlmgwwf?,X-fNfmx,Sg,fwwfMama? fgiiwwflvffivfk is Hikxfiiffffzlk-flw' fqfw' 7'IfZl1:SIQ2f11:5-wi , A ,J A W ,A .S IQLA V71 my mf Hill U A, A, A .. sy-:M-::fQ117,fN'e2iL:':f?.?ae'5?.: if Eea , fx,--8152155525111 MX. ,SX AA A ,A AA ,Q,.M,,.,,W Am.M,,L 3 , I I xx K M A , ,5 ,ik,A,,,,Q.L,.5w,3,:,.q,m1..wmi,,yiffx1mfgqkgggfm,5,u1g.51mfw:e,,x,lzr-,wsfxqgsfsfbmwsw,,w,mWqw Q:wi,MaL,,gQqfw,-.fffwslylwHgkms,-Sfsv ff . f. ,, V ,L , V, A W Q ww ,M wr' w M y , wfmz n,s,,kfgaSi?m::fq f-,Q-q,f:2Szs:2w3-'kmggzxfifuggfwfgqzwwMy wfyfsw-an wif -f A fpwaiwk 1 A f A -M 1 f '- Qi, -yyfgwywxfgw535g-g'i,gmJS-WgwzvxfZAa5,2fwSjH 1wgz,r,fmWw:,fgmz www ,V-izwww MM .wp M, 7. WM A , A , A . A 2 ws-is uisiwwais Y M 4. .sa V5 W, , Q1 ,wM.fn,,,:,H ffwmlgw,,i7f.ffi.Ww:,,Q M fwfww A ,M-S.-amz wmgwisgsggkigmgxzgg iw Wm M2 X A ww nga' wgggpwgg ,Mp M XSZ2w?giTwiigwX5w5x fggygiswgigwfxr ?wf,3,,M3f1w,A SgwxfisgLm1aw:V5,w1,.5fri,5 ,,.W5njfsf, S ,H was S S 5 5 Wm A Q L59-S W w Q We M, ,A M:.S,x--W,.W ,A-. A M, M A . we S Q 1 :2z5a?z1e'f?' ., ,Q S, H N fp, Ng ws L, ,S me 5 : S S, gf S hx M L wg 3 M 3 was K X '21 its ,K , 31. ilggfggf Q X ,S r ff , V Vik V wk. ff A UL A 5 W 5 AA vfMs5,,..n,,W A Hx W, Z AMWfQgkkmsfgkwfssnwifsw 5 in 'K N ff? ,, AA . U ff . . V -igusv Kenya- 32552 "Mila fm,yxzsgfwamgfAfsyfiggffif-qgwQfff.1?gwl-Tmw-msmww -vm-:Sffww,5.rSifv.f+v-gw Af S, ,L ,M K -fy.. .. A -K - . W :,- ww f -'.- f 1, ,1Q1, ffffgeifgkw ,Mf,vLqQ13b,1gsmggsl 3-ffQ,MwwggwywwwmAsgf:sf,gszawx.5,gn5f:,5 -iwwiszswy-fwgwwg. Z --. Q wisfxf F A HMM 2 'A .Af V 3 ,H 5, ,W w w M MX I W M --- eggs'-be-w23qf'i zgffsaaww if wr Swv .W 'Raina-2EWHiS'if2?2 ,iiaiwiix az -. - , W 553 wig,-ga55u,,g,,Q , aw iw - f ,K 32. . vu x . - : www ms X5 X Q, lax K A , , 1? 3 ,M ww Me. w ays SQ f W fs fs WM? wg M W , S S 1? Q 5 A A ge. f S 1 ,sf Ss. se A Q N MM 1 A A Bgmw -,ma-.wfsrgnzzaaww K f . 4 if ap. AA A A 31 M. AM , wk. M,,MgaMw?k,A.. Lzyfxweafa ,- yu ,wwf-xiwgmfusesifmvswg . Q65 A .sq sffim gi Q K, . 3,5 mm Ygfwm qiffW,w,,Knw,k,mgQwB:' wgsggvwf-IMQ-saMwggg,j-ma3S,ga,g,1.g.w.- Ly., ,- K www qw, ,1 ,af 'V vm - . - . . " fu was 12' - -1 . - :- -2 W :wwf 1 153119 - ff mf ,L .va ,V 2 , Lb 7 i W W L. , by .Wa -fwgqw f Q1 af? Li M wif W -- PM -5 G? -ww ggi W QR R -W X S im, M A. Sw.-1y1w..w.Q W . , W ,M :W gig ,gk WSWS wmv w,,,w,? w,2s5,,.L .s,W5,,5uKwXfA, M4?.g ,iwfgk ,S ww :img mfmwiggfm . A ,VL :mf ls 'M S15 -gsxibsfws M, in ,,A,531K55m'Kf'5e1w Mfvkfiesx wr fs- PI' fvswxns ,wi35'?sfSS1i ' 3-TW 3315-HBA 45 X Qz, 11225252 X1s?'6f'?is.s?S-FsxfgiiL5H?'5'515i?:5bE?Si1'EiXas3gXL51f5'.nsgl'zx5'.S1 A TLS:1s,?23?X21Z'i. RL Y'-if 92? df-li? 5'A5SYE'3:2s'S'1i1'iix1V15ifki335?5fsxe2f3ggi2,E51'ew??Af "W in ll H , ' . ,. gm agar: A V gfwg W H. ,-5,-i. Wimvgwd :gg Mfg lqgfgglhrkglk zgmgigzw xg w,:',g 53: 1 , 7. ,H Lsqmvg mf gp: , A gy mfs r Qzqfs- JQQQ: Q ,ggi 'xg ,Q ,Q -, ,A RgQ1if:1,gZ55f,wg1g1Qsif5-figQifwgmffaLf,m?y,,,7,2pfz .www2iQQLg5w?f?LT2sf. 3 h2vX,fM,.-21222-wxf, WW -5 EA SAW- ifwigsw My A,A,L , X,L, M W V Aga v egg ww Q Sa mi A 39 K Q fm f Vim .,.. ,. w S' ,fm . 4+ ,, S , ? ? gg ggi SX y 5553 X sigh ik ,5 Q35 nw, me ,wks . M- S -Gin L-A ww f ww A Y V L , 0 A M ,, 1 ,Q ww Mm U sg X F Xe N, 5 1, 75 .A ,,.,, K, M A Wea Nigwfg, W R QQ A S M QR fy ig is gf fm ,ff-:sim HQ if H fi-5 2 X W Mk Q M . ,. A W I -, . , U , N W M 1 7 5- Q . A fy 1 Sw W J A. M1 w Af . M .MQ Aw A ,aw Jig 11a:A,ia,LQza12g2fvm2 - . ,N -A , A 1 ,,,-am ,Af mmf W, ig, y A Mx ,S U M - W' wig 12555',sxug,gP.zz5,vgga?:-smp:1ge4i:,A1:Qf1'wi,bifV1 gf .girly fc W'EM7sh2vqwwx1?Ei,fa22wfm1i?w11sm2'bwf:'1HfJQg2i wf2:ezs5f:ssSaa5rf get 56331 5 sis1SwA.sifQQ51mi1iiQivfl-5igifgii2:if9SQw56325231Siilfwkeifiifsiisiivfi fifi 3, A A y,sg1f5Mew21ggai:f12ef'2:s1awgJae1 NwweQfiefwsfwiwwslmqi fXa:7sfSwiwwwmawsfwsffwfszsiwfailifwbLawme2miswV,g.4g2wsfgQggwsqish ,Hffafgsfsiisfgvgwigsgffqwqww. mxfswgfsmgsvwz fw,,w1gQsLgkf,mi5, mfwzwsaf:ffsa2mSsi1vf5sw-'ff-f g , A ,, f eff QEQWAM ,wa fA,w,g,fWff..5aX,gw Qfffmmi,-,,.vY ml mef5mgwsw..,.vq,gf 1m,,yAmm-,LmMfv,mwf,Q,fw,wf,,,,,,,,S,S.,kmxgmgwgrimmwg WZ, W 71 Q, gn,,sg,gWm.5,,5B55,,s11Q-qgfmm ,igm,5,, M,,awwf,:5,ww,z-ymw,LL gwgig,ssjS,w,,5qHWff,g5:Q,,,uQw rg15fm,rMv 1S55,s3mi,kg1f.,fx1MaQ21gfLwma? v,g,,M,1w5MH,m, Qgggwvffbm:Kgwf,Q,5w,,fw QMAmZwgg5,M,wWafS- ww ,awww A, X253 ,MW ,f5'a5gMQf.mmgwsfgggifimm wirzsfs-wzsffskwgafizfsgagwsfk .V mga 5 A .7 g-ws VU 51 ww S- fgfgfgam M W5 52512533 Naive-f ww1Qzzeiq-wsmfSfgqswgnff f pw-sw wr my gy Q .ri wfm- 12-M far QV SW' M,sf1xff.w n.g,ws,: ,, 45:5 miwfwk WW, iiigig?5513X?3x,qj5Q'2,32.iSjigmgigwtgugfngizsfmz qzjiggizmgaggfiiaw 45322 sk g 50,,03:f35'i,y3? g 1 Q ,x ,R Lv S ,, M, Q3 3624 ,Q S '32 M S52 N E , 3 in Q 35 S ya, g 1 sf, vw 5 50 M A , W MW W A -v1M2Q:zf'ew-may,milfs . AA A .V ,M W, .., , W ,W ,WM M .A if., Y ,- Wwf3k,w,,,L w S A . . ,M , ,Aw V' W W M we .-gwjffgsiwlwx , A H - ,L ,M A M ,M I mg A ,, A ww, W W Q, me g ,yy A V, 5,2 ,, if A W' ffmwwsgi ,V .ww . V Swv ,D was S, 55,5 ,fg HfisggggffgmgziwmwkHSfQ:ivv?zwsfSf-2Q-w- QA? ggwffwgf by ag A Mmm umggmrfgwi qwWaffMsigifgwgifmiffigwsqgwfifQfw,:Ss:M's1Q?frl5wW . ssgsxfxf 3 igwmgfwigwxgwy M5215 w.,,Q ww1wf-ww-Qwxfif-gm--W-f w W -, 1 Shia Q-SNYS1-iwmfyg:1ga1w21www Qmzmfawimu'uffsmffwwfssmsf 4fMw.f,Mzy?1 Agwfkggwzgipi ff wa, my wfwksfw f W M uw-Hxgywzf M W H W wffaw 52255 Sw f 5 R S W Q 5 ff F I QisM2353gf:2xf2i5fM55-wfwww,,gfb,S5w,gii5gg?iS,uM S-iglggwggf-Wg Nw gi? S M-Alias agp 325 Q M5 2 W 5 W ff Sk wr S A we Q E A. , . A. XL . W ,M -,AN -5 7 ,M wp W gy .f,,ff4A-,,..5-f?:s1'e?k5i? .V A ,M , , M, V m W, .L f S-ww , I 2 V- eww 2i3fHwNw:'3f5if. W' '??fw3aa2iss22Qffwf'AffQ5it55ffifAM:'b1?se-wiigsii k gnww3agigamgfwmumgezfviiwwfzwgfbisqmefwf Qfwevigisfixf MH fimmi-Wigiw if Wwff25fw mf? X MM S4 1 W 'f A A5 S W - i A A V, V , - f. - V- 0 uf yu' A.yf,.7s:BA.., Y W Y A W AA U, , ew H E Mm .Nik A Ng w,1f5fJifxX2?5?,NWwf Www? 2?,1m1Q,w,a,wafm,1fsaaffgsy.W,Af,W-iv, , .M R M, W A , MW A A Nm A 51- I f fefm ,fSwnwff2'M'f ww?w2E?'f-Simi M51 A A fs:-L62 iv-Q1 Wzfrv-wx, H wwwwfAiswehffegfige-fwfvafsw 2 Q My 5,-gm? ww gm qmiwsm,QAg.-M352-Q5Lf.:q,mwpa,2Lf5ffwgLiHwwikzawulgwaiw izwzzrgww,-frlgygll WAff,s.5mSwmmmI,2wsf,w W,qgwxxfwfwssffeywwgfqmdfwi fgfgfwfmf-aa1MwgXX'fm-m iggwinikfaisfhafi. wwawLfm1sws1f3gs,x nga- S K2 Jgmigdgigfgsaylmaiabf 15, ,.QbrwksgfxmfrQseggwwmmgyfgsisvgfnsw.M was451fffQ9KWefxmggs-ggmi-f7?:ffa2m:gmyfmmgsm agijwiggggkgw sw fyiasw. ,wwXgigwafg-27mmsvwiwekwfbfigiskamgwq.-gnfm X iM,wiww,fwwyw- mikqm'fswfs-fmw1effm . gmt, ,LL 5g,f,gW,Q:,mwk:,-,,gwwggm mE5wMg1sa.g,Qgg5 myQasggQM,WimW,sLfs,W25mfw,Miiwgw by kmfksigfi if,sua2Q5wf5Mi,if57fs'Qws?1fakfaiwggwgnsiwg-wQgagiiagiaemiignziiifg? gww,,wf53Lf2gsgggzxaifgxswsz-wiuf ,3f,gfw?qg1QgfsG??9w75zQ,2ieg1Q, aavevwQlvQ:if1ifsaSigmfigig3gfix,mmsmagwmkg-Sag aafisxwyggfm A y fwsf-awww :iag1H'ff.ffSk2253Zf27WisfWs'fQwfa5ffsQ . - ,gggwsfwif-212-igsszilfiiffsiimmwizwwumesmsswfzzffiismwzffnwaeswgizaaiefigwrimwssazwgfilmmxQizrqiifwwrsgew-gswiffamLwz2aSi2f21f2seifSxw1Q212isQiei?f,w?2WiwQQsfwailiggwssiigiwaiwGliiigggmiufSSwfmw2?w22f?esM:QSQ . 3g,qW5fgs,gggg,g-S L, wfzazwgxsgzm 51 'vi iw A-af swsisswifeirifev W fwffw W M f S 5 , M ,V M A A , ,A W ,W ., ff A - , .f A, .M fi W A ., Qu ,, J i , Jawgmr wg,n'fs,.fv- iffy?-fmfwwlilis'G2wi?W6i5li45A-wifiliif A , A A, A A W A A WM, ,fm f, -ww -H ,W Afiffawm iw -an 'ww X A f ., ff? JISWI? me gffcfisiw wg- Wav, Q1 ffwis wwwf -Q A Q 0 W lswgggq Egg? S' wQWQ.s'?khs,w ,Wgfm L, ,. V W H Aw, AAA, A, ,,s,.v, - A , 213:-PW z I t.'gA.xxQ:, A 3 .-444. 5,.....,,g 15. V , ,- A - AAA,A L A-- 1 AA, ,AAAAAAAA,, EMM XA AAA AAAA I LQ. AAAA AAA- ,15,W,w ,l5,11:L.L AA,, Hs: z,QgQ,af1zgs2m-yl,f:Q,g5.,fsf.Q.,ZW-.lgimyflaw-mziigviv -:Qi Lia-uf-W-.3-Qs-.L w w A- M- AQ1Q11LQzQgf,gmNg:ss1f,:f,:,:fggwg.5sfgQ::1Tf-vga,iw'Mgr:-.z,:Aw.3l,,1L::fiz-Aziz:-wr-5HIS'kwiwf:fesf-.L::fw-'Q M, A V. A A Lg541g:az'ffgz::5es5.5g,qQ,rW1ggQff:s,u5ggvgig-,ggguggplw-qT5:j3f55sVfpsiyx. 5 :fu-E-.srr,:1L1Lfff'.:-1115:iff.:5.is'7Ti:51"5?' ,i -.f:miie-.zlsgiw.QgggwLWB:-.mgiw l51:sqs5SQ37exs2 421 55iiAS:Whig-:S4f:39r1f5fQvgjZqsgm-gif11ss2f+Lsf2i:p:5i':wt:fgEg5:wL::-V :gi-kL1sML:i1 ' 'mfsfff:a.::gQ3l.:fl2:izmy Q,r7.g:Hj55!t1.5i' 5 ggggiiwg -:nw ,.f2ee-.im f S if2mf:QSWQgqg1Sefass:Egg,gggg7fE:ezAaaQQHgxgffaassaizfeggmzeif,aengizin:,.z::fQs-.X -5-asap-.Q1.1. fiff '2 U,N.Q,ifaieiiqqgeigggszg,Qggwaeaifs22m:ggQ,1z11is12133354fgigilggzggisifggiifvzsiigwrl 1:1212'-Qmfifg Lijgseaii ff, ies 515 md' ::ssf5?iV'SZ'?7iv Wi: 513 91-f551f"' : paw-f:s"T?a9f9Lifetxi'-515-in:s1Y',1i'-A--51149:E-Ski -atv-igiief 9314- ', f :M K -- -K AA ,Agfa-GSL. gs' 1- X, M wvxfsrwl,Q1fgizwvfgwwsgmyMg,f:geimgg-Wim fm.Q:Lfs:-,za 1Aisi5:s232v-in2i-inifL2:3Qs1gfs-2ifQQsimfgifQQ2YQ.5iwaigfvswag-ew-:fzf2ffLwav A ' -fx Nw.tam,-K1z1155ig3VY1QjgLGiiQzeifflEi5113E5-rigg2iiig2fiy::s?E55:liTl:say?fiiifiiiiggkiktggiwie-ii'.a1Z'5.51'EE w1L-i" :5L:vtlg:Eia1' -31. 55gg1is5ei115giA15Qai2211zf2wL:S1aS1,zms:fn2:Q:5afkieiiwsiieiigzwfiailwifmzziiL.vsgie:fv giikiiz-:Nj ig-:Q-,iv -973111 A 'N' 'L' A13ac1gesqgsggfis-:05ii:eLsSf::sq,L2GSAzs:g-Q.:5g3.st71253.5-,:L17'.iEesgg:!1'9l?a:arf ,mS5f:s'H:'V'-?Y'.:1i7E:V1f:5:.L 'f-Vi ,, W lmgmz1fg:.gQgsa:sa4::w:img,ziggy-.:Qfr2wfs:5Jgf1Q:N:1mfigss-Q.viii-1:22.iis-Qaz:.1L:Q:1,1: A fate: A ,- bmi5gggwgwgiiqzggssisfaw:pxwxiligieffAQei:s:xw:s:f1fea2zif:rfaQiwW-if -wean: I..--wi A ,'Qzxgfmiwwfslf:sw-Jessi-ages?fsxwfgfi,izaywsgfgki-51,5-.Mi-,,.dw ,ww ' A V' xy gf-21" Lf--waz' 2 ,fffmm K NLM mfssamw zrfzfzm 1f:W:za1 ik. .iw - 15: '12 2, 31Qgas2zgGmg422:22fgfQi Mn-1: 11215-S-wwf1f5522?5gai2SiL25Yg22Si?iii.2'1713251:Q:kiei1Lf"if :WQQT-1f1"f-52:7-1555-i'fL,i'25f:ff -' 5s3Q53QQin,igZ,Lg5,fiQ55if1gg,Iis53,QQi5ga5-3aigiQz-2Q2Wggef1.Q:fQ,fz-:Q-la-wi:efL :L::vw,:f1 ,za-w Q11-.iw A ,Qian ,.2::'-lsfii-2215212-.Q -V MS wr5EfvgfQQ2tsaz,1g1g21fQQEEfr?Iiffeiiaiizliufiiziexii:m1:',gi:4222ze2i.:msf-fran 1,212-sf fi, ' -lsiiw-ai,-:is-xi' A 1,-GifasQsg2f-gfifgizaifmgagffy,,weiwfgmggiwgfisiaze-.z:effmg-2:25-'::f1g:1,:1 wif' -fum AA W 7 M.,f?,.M..:,,.L.Lf::f.,A.,lg,.m w,,f.S.:.L mgzmf11gg..fggggfm-1:5-.1::sz1IwafsfqQ1,-uawvza pwxggi-.L:,fre-gzmefra-wwwAaf:-fv.1 A.D,..5m-asgzfesmgffsiwQ52if-fsiim-16-fzimlfig:-imgQ1zfggz,1v--vimAwsmz-yt.,fwifs-azifkst-.A 7-'ff'I,wipwfszywi-f.1:g:11z7:--1'-51.gw.b..,SWA,mq,.L:f-,,5f-.fvziQ1 ifwgg,-k Vg, g,f,:ff:,-lk. f1:1.Qgy '- 'fzfffifsi-iff Kwiife:zxsf::w.g1E2, -iffrw?L - ,sew,,i'-em-vv..wv1w.' Q -A Wzaiigz fQ1G1effaQQw1:eg-wx:-fw:-132-wa. ASM: AAAA AAAA ,, Q, 5 X K - M mswwg ,A gm. mmwgalgffiamessefg N AAA- 1 IEW, S his A,AA , A AAAA S -1-H 7 :H-?:S5iZ:s:-Q55 flflx1SiE1li5:2L5f'TZ. .E-El .. Lswggisgzkg gsgi211gggwQfQzz2fQ::2w21 ., ,nf-, L f-fp:f.L.w::if' as -+-i'f5:x1L-I i ' A ,...4 W. ,NHmgwsiz::ti5.Ll'L:s,QL:5-5 f:QA::,z:f1L-,- , Ml. .L AAAA ,1A,,m3. AAA,A A--AAAAA A-f-A- AAAA - 5 wmmgssfgi , f S S mis ww,-k,::-yffgzqg,. '1.-ggif-,Qwiiwi-S - -,.:--sw.. -- 4e:lEs:-is 1 S ,V S , A-AAAAA S A A,AAA AA S S , , S G Ph ij ,fb S S ,S S if S f S S S S S , , S S S f S H Q S L m S S s SA ,L-',ff:SffQz-,,.L,::s -r f.:1'.:...g,::.L,-:m,:, S S S SQ Q S f SS M S - S S 5 S S 5 5 w Q, S S S S NV M? QM S .5 3 kS,:y,gjA135-,zzkllfv,.:,5l:.'25.7z:5.wgg:mlzviilfzgiigwf.yZ,fzg,5:wm.kEwikwz331 Siswzkiiii'Yle3'Fi1liE5ZWYQ451:77-lf':5sG'TE!s-M fl"Vl-Q2 rv W"'Zi?'---1'iT'-SY iii X 5 i S lu Qi ,W2,-wfwwL,.5:Q:m1msQQ-2fg,f,wf:w1zw:wwe if:LewMffazlg-msawiffgswmfQ-Izws:7i5:::.fz,..L:mfzg:, S Z S M S ., ' ' S f gg S S 5 www:iqek,wgq:,:Mmf,.WLMggflgmlggLwgieifzfieiizwggg.1g25ZWeg5ggmfsm:q?:y-.:gwxggzifkfggsiig.ggigifgzkgmgwgem:ggsgkmfzz.maiswaifiwg5,HX11sgg122fsZ-.5Qff3.:s:fqLfp:zz3wQ2:w:Qgwgfu-aLz:,gsz-.5:2 .1 2:1-wr: .,,::fg:5:::f:,::gk2,w 3 Q f S S S S S S , , ,, 5 S H M W WMM M,53551-:g:7g53p,:k, ,jf7.fqg1555ggEi5:nk,45333.ka.w5-lgklaigwqzigggxgg5iiYzES?iTiL5i52k?1'55g,Lk,5ig,gQgai'i:1g2QiSzggfpagggie-ggi?L5::i1w.fifiQE,5155fz1Qaf'1121gg5??afiTi:i?Lfi5iQ:Q5?111LiE14:AfiL?sQL!lh5.Siiifsng3LZis,.E27?55gT:1fiTL159S':A siliifisiill, .f:-:fi--11552551'l'9AQilliii, K S Q 3 2 W N 2 S S --mvgmgas:giffwqgfmagQs333221gmIg.Wsfhessegilfziefsasieggm!!:swQasagwgs2L1hxeifmiz2ikzaswgiwi:QiigiafiggegaxQgsQ22QQswwLe15ffhi:zg1zfff.ggf22ga:.Lff...s2K.sez:1s11111if1gQfgezgsli -Waisaggfsesgwfzsew.awif SJ, s S 5 'MSW 'V' W" kzgfhgfzg 352 ggiikillkifyeiggggilsgvvQL:251552355S15SimfW?52111:Q3ggil5i35kEiggQ2is2il1zr5s17gE6?gyi?g:g32iisg25E?7g1'EQELQEiii?mg122225351523232ZQi27L:g-322125252:sS7dsas.ge?i7giSi55Zf:Q'c:1gqf7:.:2gieSflLg527TI:Ig5h1Sw133.s-gfjyiggA QTQ-liiillkysrfizi''17iS:?25k"u'A x 5 S 7HgWwrwwnkHmwxsy,E,,,Ms,,l,,,.,W:Gigif.:gLsgs1f.:,fg,.,,f 555.Zibfg-igiiwlgil,,E-I5,ki,:qgg:5q-kgqgfqggyQ35,,wig-isgfwgmggq?V WwwggiififkHzfswgfzgkgggfgQzigiqfgsss-25e:m:gzQsf16252222Q5:vgfmsfgfesjgxs72mligsiglxzwgfgfgg23523151Awwwffmwalgqy''W gifs:fg.:fwz:5:.fi:e::S A1swf,gif-.1:gf.1f:a15sf. 5 :wgViqgigissawg',iz:WJL:3g1g:a'L:5:fjy1:1wi11.a17L:Lf:,'.L:wzvgAfas ,ggi.fssfs:wzj5,f1z'wikiniwzfeSQ:-eziggzpufgggssigz1m33g1L.s12ggwxgiezzafzzmffg:5Gil'gvL1'iv:"VinS2msf21f'fs1iQs1Iiwfgez1':SW.wiwrfiizzzsgimvflgveaflikgxuezimgwlzfuwgf,:f'f2FizsbSi,z1'f,zu2SSQ:ffLiii-uLlQ::fxfli5:11-ifww Q:-,iff"f'5:ff11f':51A1" 5119?F11iuV1'::,:- Q, Vwe552132212-3,21:iegiawasemimegaffiaimgkzwii'i''X'ffiy-ww2u,a2i?fk1a!Lffgz,f2gH222 .vu-Vggigfiffigmiw:Lf:1LIvifbfkz:maiwvgw3gwg1e::liftQsiisiwQawsiisagisgziigWgeek?1322312,Q14alizwggi5M557gzeizigqgisfqgQg:fQ1qQu:5525352355211'Mgg5izafqgamffgkfsgrsggiigffgeaxmw511g.gga7Qff::ag:r ,mai wggziiwwm A:-Lsashwvzifiwzzi-'aim' :wel IfN.Q,My-f,m,y1g:,r1g.f,lLfzzh.wgQ1-zwzwmsi .MifQ-we:mgi,-,:,,:5,ww QHaigifgw-.ggmgzfifez.wxifg,fw:w1y1,wi,zfsfgqsglffmimi,L1fm:5::MQzWff,wwZ1:v:y:g,:g,m:Qgmqwgy.-qw.afwwfr:-J-.yQfzwzlgwkgfgkxgQ1-ezwwfswzugwew:ag,mz:sm-'gewasam-fwvig-fz:'-2.f Sm-ff--+1..w -L-ffg::ffw:-1fzf::f-f- 'wmv gf 'AWSisS22Mii2QaiQ21Q3251fzgafimeaaigseasli',:-saw . lzzaageg V 11e-frzzesiwfixfzaiawfziggegiskzfai5gafgzizQww-3sa6211515mgetm12,5QjlzmtiigizizissgzgfwgaQ223252215isakgisgiijgsizilsaggliiyzelm-FR. mfs,4gzsggg:gzmevQe- ,, A WV,,wwMymgmaqgizkiw,5mi3Hfs2TLaWlAQ5-13555H Vllliwgygww !TMk::,kEkVA Miygm33,555,115,3w3fg:e:ggs:g:wg:Q,,ggg:q1g:Tg31,g5:gg1fggj15:2gg:s1gsQivsQEi?1Lg5i'wipesVlsgfmsgailify111'1f.:,1TNG'gZ5iJ'lEYS,iff-l4::'xq2FwSfLF'VifSS41'f3?1f?ki:il5LE2?i'fiU.f2i5:Q51Fas-VSYEYQQA-WLS'TI'Ri'79?sfYZfl:2'fE!i.-S25-V 1'.5f'Y:Tf-IL'-f,iE1f12V -'EM-fl-55611-5'11fPP'Zf :Q H-Mm S, ynL53ilk-2131sig?ily.Qqlpxrsqisrwzflwzwg:QQ19355315lyfiifxgsy,-L .,alf.:gg17Lsfvgif5::3334,z1L 'fs33Q..sg:5l3:7gg:Q5vzggjz133225-igggizzifkiiwggrgzzfiiigzggif:Mi:::sg2Zk:"-WisiiliagwsigiwP125:ziaiqiwigiwigf4:s127iiwigg3SsfW2ES1gsijifz'iii?NNE?'AQi3Q195IQSI1QK221Alisitf5?1s?:Q3?ESEL?i1zlYS:l2Lf2T1'sQE:1Lw73s1?iQi'.12f5Ei-wigjfifi'W'-g3E,2i,:v1520.51151-ziiil:,1Li'f1'-VP-'Wi-f--gfmzx-rllf--fy'-'f1 5-zz:-L1 L,v,,.W,,,M,.,v A.Av,L ,,.v , .J k,.,. ,G .,,L.. 3 Akh. ,v,:: ,.vA. , ,k,A A W, ,k,..,LAk,, ,Lkk,,, Af v,v,, , k,LA ,Z v.,.v M .Lb. .,A, v,.L- Q U-sL.,,,.5 .,,L ,-v7 M ,v,Lv,,,, W ,.,, K ,,v,.A ,, AL,A W,,..s..S,-My .MW,,,.q-akWMS, vkvyf .WW q,v,- M su- 1sQQ,fQgmgfi1g:gigmfmqggiw:1QQ:3gQ,XM 11g:Q11w.Q-Yf.gwgsf:,Qw ffzfigfafwgsesaggazezkfggswiq gg33.31gm?iwgfagmggavgzzgazewea,mayqigm23.135meiwg:weanwwzezwss-Vf my W 4SgiQfssiizsaizmagggissi1Q-w:?11k:Sfi2WZlS1Sff 251521152221'1fiY'1QQifgififI2ii2UQSwxfiifwiilxifkfilvi fi-iii? .:e::wg A V11 3-11575,LzfQ791L:ss11Q5-:lkizrmgfxgksygf,:sip,g5gwizL:,lgrewlu-smtg,-zg3:,u.g,3gg53LggAgi,fggJlLfg:z:53ff:e1vf:afG::L:9k:s9wz15f,iU-Sggffzggazf':fgy1L5,,Li'?ag1'1GH,xrupywssfiki,uai7i:f2fgLk:wQkfssJ555:Lis1Si5svQ'lAw1ifg.rr2MQfxiklsirlbfwsifz1ifW?2i1L',iiI-l'5 'fikfflflfivhiffii'-4 VEaflbffwilisv1815:i2A:Q?Q1Alb:Qifflwfbfiiflff15-:WZ:Sir-W:h'ESC5F'f ' ,t'HfL1,: ff'"F'f?f3'97'-LEW'"A"ff'l"""':' M,,MWM,wW,:W.mv,WN, ,z.M..,.,W, if,,ALV.,zM.,.,,wM,.W,iwNsw1fM:,.v,,m,.,i.!,,,mLf,1,S,.,:sMww-S ,-2.w.,wv,Lw'gf k.,q,f,-vyswsw,.Q,,,w-MMw.L,.fS, fwqw maymwfwMM,-ws,Meng-b,1zf,,-fgffswisva-N-syASM-wfw..UMf.-7fWm..-,VMm-vim-fia,Q, ,-M, .-W iw-,::.,,..:N..,, W 1 X Q2Qseavzzsfam-lm?g5,.,.fgQw,M,i3:53.L5wEW,,5,,,,,,,w2If,wAlQ55w,l:,,,Km N:W.khw,M?MMM,KM,51,,,gmQ5,3i,1X,,,15Si1Q1Ai,mMgQ,v,.,?-igzzff551Wi,,f1b:q11mi,E5Mm:mfWsgs:q-1g1Sm,3gg,Q,z1w1,gmfQg:s-.wwwf-eww:gmg:mgg-.fQf:zw- fp-kwa A .U ..11gi.1,:Q:L,-,A1 ,, rAZ,,w,53MM E5w:f,3,lg, wwg wiwiwf 1,f,xgQiMgW: M-QQQwe:mfg-.wgm,U :Mamas 151QLfiQQasQ52fQw1QQ:gemgzwg-Eiga-zwgf,gQg,aw:qg3:g- yazeifiggsfbgqazeewifgw AL1-.L13:1IAfSew-fs-.gfwfkafgfsf fm fsyiswa .wmmwgfwlll-war 1: : :fwfr ww-1affiw'.2f law, AW5:w,5,,3:M,E,wE,i,gm1W,,,,3lf,,,iw-f3i,:Wiw,QMMI,Jg,w5:k,L:,,NZM,.251:,5,f,mfzg,mffww:wwgq5,2z-M31125Q53-.wifggqfwwwwf-:zamyVzgsfmmwflfm:mfwQz13:s1w1z:QLwiwfmaxwumwifflefwvlzwwww wifIas:'iz.qgszfml,MZHWMM4-.V-M--2migef- V' :WNW K '-Likffvvviw---2211-fn"is-.L-:mf L.m.mfL-W,M.Z-,K,,Q,fr..vLk,.g,N.,A.5,W., A.7-vg5.w.f,,M..A.,1-,LM:,,.5,,,,,,w.A...,M..fM,s,,z,:wM.,.,Q5,Q,Wff,Mgq,fL.:qA.W,1.M-a,.,.s,fgfN, .U,,w,-sgww gq.Mm,w-syWyslq.,We-MM,1w,:m:qfw.,--Www,M2W,f,, sy 1 W ,S.sw.w,f-w5a,.,,w.U-fwwgw-z,-V fi-5 , .ky-S Q ,.-f,.1:f,-fa Vfssygigfwligggsaigfigiigwrfgk'.sgZ2wS1g4kv?,xg5?LTL32Ei5:, .Wgnf9rg3ig:e1q52:sG2T'siEZlggsf'iixlisiivbiQ.SQsWj:3f"9FfAsGi1iE5!,5imQ:3i:1gfS3i!w1f3TLfwj5?3i:fE!g:fL525i'2yiYfsssgliwlgkiwzi'-gjiVH59112565159?if52?552?ZU?5112f??'fSg1?lG9F2ffaSiHw3s12'flkwfkxlgiffg32E"fWQQ.5i1L1Gfg15:v'fS?2:a9"ii2s1v21Lf:SfflL5?L5f?izgjiT:::fii?Q.-iliisili:Yagi-L.L1iT':iL-flFG ' ms "Kg 13:Ijkgy.'g1i1 2-rxgiig -S1fEQ:::a1Lggg3,,kfagzkwigimgwyQ35ifgmggfgegjwx4:-gggg1:gff:mf2'15?1gg,:ffigs:z-iggggqymgiy,fwiwpiigqgmekV4551igfJg55Sgk55:3LL1Q213azj5E,gg:29gw:1g,-yggfgsigimfgfji: w,1g-fzijflr gg 5-Z55-:L1Q,ats1SerNaQSy:sg:gfg,51QiiS:ss11L1s51j2:.1:gg31gf2E.g9xu13g57L1L5vfss15Y5-flilwzwfgi,:Xml1V55511as2liQ5VLfiz3Sill-L53Lfbiiziwlgiiifiz'if f31125S:'2gEkLs'TTgrn55:wtYZEEL ,.'f1',i5vii'1f'?-- :, ay-'Els' iggngeiwfzikfissglzxzsfkw.gQa,fs:5g1Qi2zgm-.V313253Tmsiwgqemggs-iifsq,wggfwfvya553was:www24efw:gw2g:2QLg:sf11mi-.Lsfiwzifwl.Q2213415105221W1fw:2ZEmwgkilffefiwwvglimf- 1312::f1L:s1sS':2fwliiif?Va2iw2iLwif2ff1Higfszwfws:www:wiL42f2'.sEQvwikis . -15222-sei.:fwwf:fi.:f:2if2v-1,- ws:-ss11f's:::fs-: if-A. .Asswf 'S55111S5911g21E37L2fi:1LQg1L2iYZ155591415255291MYlSii11iU'1iw1Qs1iSY-5?lseiiizizisifiiwliifTT.iL:waA55i'fsiifiesfiiwlilfw'-53'WZSSJE?Jfwilfiikii'YMiz333wma523:iw?55552Si?i?ii'E:??fg?ZES?12f?i?1SSWWXLIQWV:sfff?5?511g?Q355i??SiG1-fiSig?5ii5Sf9?e+1W2!i1A23i1'lfb:5iKKvi1i'W'25155E1'51Aiiif5,z?71SW!-WEE?f15E?lLf17'1Lf-5l,pSi'.1AQSw.3fLsi2'-fuiggiiifig-2 -f 5.55-1-,,Zi-:L,3:::73l7:',j2,,QL 45,51- ,xkQzxyfu.xmf:Q,.w,11.A17A.LM,,15-W gveq, .nys--we,wfzwgw:,1L.b,w.Lvifw,-wwf.qiawikfsfwffw:SymQ-SH.riaskwaff-wzvxm-Exim1sm11m2Sw':s,Hfssmggfinf.-1:IiyxgfswiwzusrfnewVw: xpswiwAzzw-vg":ew:s,Ha-wwzusi,-Qfiw--vpwfwxw-giwhmz Wx puff,vimf-fQ1g:s-Qwzki,-y:v--px mg-L,..5-z.:fgf-1 M-, A--A---,, v y.:.w:f,-fiqf, gpsif515zg5:Sqg22z15is15-ffe::2gg',SLS5'5:3ii3:532:1,QLA?51:4qs2zz1f,:qi:Q71jiLw'EE5:cai:gayzggsziJ-37ii:2z1gg51r1g:Q5-V11gsSh1A3SL5soif213?22?Q:isS5QU5Q2gi525svI1Q52As21ag:gSf?ilLEi?rw11wii'EHgg2ia1LE2S?i7AfSi?,.SQ1TFSWL 1,11'1QQzwsffisfsmfsggvmgag,mzw4Qsff:ige2awg5w12f1Qesmgfwps :iwgwgfgeei11azasewzawg:s:iw-ilieswwgzbifgg,zEQ:fi-,wig .f nw:-gifil W , 'fqgfsgrzgimMKIM-L5:wLYfEi?Q5fe:sf ,:,ggg,11sE7mg 1,4523 M5521f5511wgVig,s37Iy..:S1gfwzwigiwaui.w-k5:z:vQ:se14552,-.zggi5gxiL?e1g,5i:L:y117r:g1,ETL-f1f,:21fSi:w11LfsGffZQ62Vsbfiiuavi-Tl-115275Lf5kF2Z1biwS1iff5Wviffiisafz-ffwiglwliiiiialiisiiv451EixlfffP5TQS125B5l1f?L1zsf25??f:S1Z5911bSA12152515732:1F55S'f7?r11:Qillffiigffiiwf-QE:i SSYKIZQ I-H555 'EffI-'H:1"'1:::L'2iI",, KAas15512235-fqzglizvgikwfwiyziigili 35gg,feg,,l3g:LgQ11z-:gykgwjw gy,:xagggzgg-Q:'gQ3If11a27IL52ggggi1:5gi1r.55gZv:gw.:SggQx'1gZf:f':1f2f5f12Zfr5S-'LLk5.w13?2'fiS5S?iz'iiiigqsajiyszggggifkyfg if :5ggLS3U:'51'5513715193-.xfgsilfsligikvegEealzgviiiligiifirzi'RLYL-SE:s2f2E:2KH'iimliiix'fb525:3z2fT?feg7Eis:5l?S?ii'IEQEQ7'-IAS?Wild'LF5ii's!S7?12S2:QG1f'?-H''life' . lfflnfefiii :iiI-9725:'-'5:'ifF':i1:":T, f S ' 'f Hrs gixwffi 9AZgigiizsslgyigQ3ii1J?SS22gf2lTLsfZT!Era' 5121552sf?V,-tiiYQfSlfA5L--SLL55liQf:Qkf7EQEYlE5:1255-5':LQ?IASGQTLSL'RLIA:HLQ5I3ziAS7iffQSi3ll?gfQ3g,qQiEg?E1hQ1gEwi?f9ii1lZSigma:'LEQ3ivQ552r1DiiixgfQ2ijis1r9223:xgliiiggfbijzffi-5EvgsEffffa1:i15:2gq!7gnl55EJ5393sQ5521iQ7Es1f7EU:a1STQE:1555?IA2T1W?S5?LL:1V.iE?x52i27zWT?-Aigfiihiiifrf'ff:5551'iETrrfA':k"' L'7"'ll---A .,1LfUx1As4:sm5521432112 Lsnswzpsm.,,v,4Q:w11L.U-'xy kgwlfyzu w:..-rluinuss-m:,z,,5f2w-wilfw serve92fAssaz2wzi':Q.Meir-eg:nv--azz?--wmykwa-'::Gsi2ff:pmfQ1fff 31 :mfaQL'hgwf -1z1'rqL:s,3x5sfII -Qsrflfgrff-Q-Szil?:fzgxv-W:sv-2:gg:muasf2fg,q:,v-ami?-1'fsi5X:1iff5m6'Aiv-Y'gwkfaffzfsivNeff'-512-V SSN--Q 1'fl:1'--1--' -V' FiiwwQ51WHS:Sfbilb:1SFifZ'fM5?i15Tf597:1'sf3532SiYiT!217E5S'9E4135-11 zgwmfii.rffiiifilxifhf. 317will5272333535SWfiiihiiifwviikizkakikfif-Lizizhiihisfl?3115:iii?23339212525fiifW5itffl?3919fiiig1232f57541iigiipiiI253535LEPiii?222719SQEEYL1S121issriigi'-L1QQg13E'iET21fi?liilgfii41215-S1LG:7l!s1EF1l:f1If:Ls:7ih521gf?z- -Iiiifsiljfkzl-1,1 ' ggsg5:e:QL:5.gZZi5iu1f5g5,sLEk?:S:g,,153.1g5usgsJy:MMil:w2ggg5m:gri,i1Q.ggf-uikfkgg-,zzyggs:ggiiyggii.Q:figf1Z1'Ef,zH'-yy::L11Qig.xgi'Egzi'51.5515.5s1Q91wQ1L:ez1'3k55Qf5z:1'ygqua27 lpfZs?wtigi7iiA13S2?wfZilrviig:,W",3i"E53g,z-iggygv:'fi2.s'1,Q1i521'gii?-JAQEQ,.S'gfk11L:Qg5m,3gL5:J:5,ss11QQ2c2'1U73?if3iE3 212211551 :?11llL5!ff1 5 if -I -79 1'-ST:-3 1---Vx-'f'fE?'1Y Q 7714 gi:55fiiQ!QgL?Q?f,g?ij!igQEf9vEQgL:Sf1ga:i7gz 7'ga5"'ff.Q:1Hz:12551i.iL:5f51222154527 L55Kgs:551532?2GiHQ:L12L?i'?I5':2iTZf2ZL?iEi?Z.Cs1jif' 22'zisggiiiigqiiflffiihgf'IZV22gi172Z2572if.9?iid35Y521il2Q?iAQ59?5Y351gi55SZ55375Q27isWiii597ig22i5?iiT255Q15Q3WEisT?iZ:iZ15i?L?Qii5?5llTf:bi7fEE?lL 151:52f3f2EQ:15i52ig1ji' " ,ig R" ' S wa-ivzs:wfzwafmaiisesefmxeaygezigas " eazfafzzi622:gasesfgggrwgzfzz,feez'i:asiYzsQs21Qsmi-.LY2fQssa'1f,E?1,:ff-,ifageff fQsQsf-SiglxxfgswsfiiasayiQfgiiefwai'-iasamgzmaaieiwf2Qs22-beiQ22:4si2i2wii,fsawZ:2ii21assialwff-lssaigwzkeffflew:111if22YQs12L:Sii52i212225fiwiwffilzifl"EW S S S S H Miw 2 L , S , S X S 0 Qubgfjkyf51555i1geli?s?1135kEswg,gzfggifg-7,. -ffi'1g:,57V'133121559rsiilfwzggfikigiziigiggiiizsi''1-,qgg1v?:fLe:Ur3QLE2TEfeikis5L.g5Y.,'i"5::1-if A H K75125,:QiLG27is11aQELgQE1giEYm5EfjQigrsf2Z:1Q3352L?2il1532535igESi2g15iTz,rS5igE5igSiE?9 K' V" 'Z :swzugygsfRmfvxm.Lsi.Lfgy,5:,1:L.QLf:-51ia:z:z.v, :.g:g,Hf3 --'ct'-522112593-Wleiiazmggl.ezmmzgggzzweg-nifff.:s1kiff 2fz:r:Qi1f:1a--- K, I--7 A .,f:vm.e1QiGwm1:nzv7'.Lf:i1L::ss'1iQ5:7'1221wig':fL1i:w1Q1L.:f:eE'v,1g:m1z9f.L::fS' Ss sf' 5 ,,qs,kfsmmwmWMMM VkUk,m.,Lw.,W 5,,Nwi.M:1L4.,,:,w,W.,.,z..g:,,,,W,,L,.-W , N -,1-Hi., K,-,A,l,fQ:WW.1gfM-.L.i-vzis:ms.,fwf::Q:,.,.f1,fz:h::L,.v1ysm:m,,ww,M ,S , S S S A.,., . v,.,, V ,-v, Z. v,.,, .kA, , v..,, .,.L ,.,.. , ,.,.v, ..A. W , 5 ,v,A A A.,. v,,. , , A...., A.,- . v.,. AM., .,.., .,-,A 5 ,.,. S mwzmm-,'.vf2z.5fQ :w,if,23i1L..fg- Ul:y-29-'HNLSXK 'WP' .U-1fT'::iflkvV-lP:7tiLLf5m:Htif:mxw.1f:fg1L:W- H:g::,1f:?-my V'?1,.k-:ft1"-fi: -fmtlSLsL:Q,-gpwffv-ME:ifas2,uL::"'l:s11Y-Aw'1'-:iuwf4f61H:fsr1SgL.wW:wkfx'W 'MA s s :WSgi21as31-I53QQ7:5Q31gxZ1,E.,,LK5ggvL5:gm5,:,1-kmriqgfwigz :ggi-gfggggz,gggiwsfilzgsmzii,z1yfv::g-mm.HQEW,,wiz::',w13-,giaewgnimsmis-11ea1?2Q:315s1gQ5:g1wgLf5g:51w:5,e:Lggsag.Qa:G:.:,W,:gA S S ff S L S S X mmf,wfwfgfz.1k.:Mfrg:L--fM-M1if www:,,mif1g.,,ffWm,Ww.1w.qw:,,w::,.Qg-,,,Wz-fy, .L:wfw:a:,:-,Avswwfwafwg'ws'w1Q1:AfwfLf::111wwwmggwm:,MASK S- N sf S S W X S S S Q,,Qiis1:f5:m.wHf12mziggmgl,1Lx2:24:Wg:,.mgmg,was-lf2zLLz.fLf-15., f:g,m:ewg,:1-M-.ff.:Q:Wf,Wa-MM-,ggIf,1g,:ww-InwLsfgwL:mfb-mfvzgizf:f:w:s,3wezzg5fs-zifmffeafwgw 2 1 A L w S ffQ1fweaigmgwlfafsxmw5,5-fy.,lifs:-,Q:s:fz1f,:wginI-Lum5:-.wlgwf.W-iw:2-vwme-J:ss-f-L:Ur:f1'i '1:fLfs1:,1w:,A1,:11:wv11flgwgfzfmg-aaiffs:Lwwnw-fe:.saw-,mvis-W' L S Q 2, S , MW-MQ5Qiwlg5If-ifgmgaefwgfmww.fee,1w,f:L-M.,,iii-z1f.5:,g5gg1L1zaif5:1Q-LA,pggf,.f:m1L.3,l,:fg3Q.W,Lmfavziggzxgigs-,::-vwgsvfa:l,mg'.f:Mes-iffbggzyfggfwflgif-N-mm AS g S 5 1 my X Q , S S 4gg5if2wisp-.gzieg1gwsqgsz5525251222igfgzaivqszggw-ali4 11Q1Qi4AQ1sasgaifQ53gfVgetwzggeswzfgifagzsei1gfggQefg:m5qgs2:z:egzggazal,Qsaf5EAI21Qs:iz+72QfaQeEqzss42f2e:g21z,fffrzrfsmaaiaeszw51311551215 5 M sf Q 2 , Us f S S S ff y S S S S "QR R f 9 gf Q nf, S2 S, , S sf W SS ,iz ,ix M S , S fvlfqgi,-igg:311g:qz:Q1e,pniq3:fzgzffz1Qm:szmaf2:.5f11ef:v.e:ifi'"1?,.fi',ffff:a1a:s1wwK4ffiii1,2ea7fm4Ia2wz1+sa'.1e1newwi:lf-Lzesf2-feizfmat11mangagzisfzzisfvgw'ww'-alfz-' bp 5 X, Q, K , fs 3 S Q S S M S S f S S M,QQ?-.W1,-fggfw,m,QWMQHrf,mamme,ifX-Saw-fwwzliwie S f S W S J? f gwfzfgfz.1L,u1Q.g2fAsgvmmr?,smqqgwwgis-Newz1:w:w1e2w1-mf.51lfimwigffwifQamfmfifwiwf.1aifagmwzv-15:wwwwas1 s S S S T S S1 S S' M S X S is wb? Wi Q2 Q Q UK 1 S if , X Q 1 S as 5 S f 5if,m:qg1f::zvgfQfzQ1,gg,w:Qi1zwggwzffeimiqf.fwgg:f,1r :-A:am1m::LfLwLasfgwwgemfw,awww,ffzgzainfg1wsaik:aiiiiwfifw:img 5 3 S S S ff :Er S S S M 2.4 3 ,2 S S S S 31, sf S , 2, ,S S L5 gaggedzgwzugi311fffsy2gu:55:w2fgi1 Af?iL:e1ffiq?-gllki,.sL1QQig::SHws1l:l5:-2ILM:-.'l:52LLGsyw1'fi'w,z1LiQ?3'f55:Y::Lf2?ZL1i5i'fs:vQSwv-if: sf'E5a!"-KEQQY -52:19 1 31wwwAi55515qWw.m,wQggWq.wiw-:awMy1W'qw2Ai5my-ewileefgfslgifmffklgzqfaeexwpg,fmeuZ,:i1w:fww-ya S is S M ws f , , guy p , 3 S M Q S W S S S MW S S 5 f wggmg4QswgswzeiwfzgswffimegefpwwwyfssgffSQ24y.Lp115nugQsagiggfQs:11sLfmswg-Mmf'.Wmil.,-KM.fu-f:'Liqiepm, k S 3, SSN am ,Q , S ,SK 3 K YZ S 0 Q S S , 1 X X S K K , 5 S SS SS H S L S K S S gg 53 Z wg UN Siw MQ! S 5 ,S Sf W I S Mw 1 S 2 9 2 S ,SEMww1W,wi,u1f:fl Iwifyfifw-M,ff,m2a.f.2g,gmt,iM15,:zm1g S S 1, S S S if J? S 5 S , SW S L , Q S253 W M S2 Sw S S ,S SS Nj 5 3 wig S SS M 5 S S S K S Q w S, ,sg ,S Q Ss, , S S M fs gs , V13 5,1 S L 0 j X 5 ,KS S Q Q , fj, S gg j S S Q X, ,S , , by S S Myww:fgfgQ.wqL:mz-.wwfff:,gl.ggxzllgizkw-kgf::a,W:www-zmffs: 1 V Y S S 5 S S ,Sf S 1 ff S Q Q v X S JN S fa , S V 2 S mg fa ww Sf Q Sl HSN if 3 H S 3, 3 S S S S S5 g S S 7,mffgifAQQ3i,,m1,gmfssigggmmesizzi K 5 , 1 S S S S S N , 5 , S , 3 X , , X S ,S igkymw ,,,, .,,,AH,4g:v5frsn- Minka. mis E S Q s 5 S 5 J SQwwe11g.:Q:we1fq1'www fx' wr S S m S X, W S, S S , f 32 S, 5 Q S S, e S, fQmfQ22igwzfL2sf2311QQ,Qdzfwzz SS W fx N S Qi NK X N in 5 5' S S 1' W X K W 3 N M A S S s S v tiki?'AE?:1"i5??VW2111'fisi 5 S Xf s S S s S si' K V U 3 f s :fm K x 5 S 5 g an ,xglgmfw-5,w,,ga.L fm 1 L f f S is S 5 S S S 5 w f S S f 1, Q S 5 , Us S 5 Y M3izszeiwizwaffifiaimgi MSM S 5 S 3 S 5 S Y ami W S Q SN 9 S Sf W SL Mi 'M wr Si S 5 WW S N 3 Eff 33 2 W D S SL 5 H S 5 ,S if , S 3 gs F ,S K S S J Zzf ff 2 iv S YM Sa S, w Q is SS K ,X u QQ 5 Q .K S 5 is A Q4 S S fl , W S 5 F 5 5 is X , Q K S A K S W X, X ,M S A Sw N , S , S 5 ,Ti 1, Q 2 A S if is qs Z , 581 252241845 ,M 5 M55 Lssqnifgi SS 3 sw wi Sn iq 55 Q K zwswfil 5, we K is? 2:2 R, ,ss 5 gf 1,5 ix Us 1, S ZS S ,5:EEyi'i71Liif 522 9 ,s iss F S ri' S S 'S YK? X Ns Q, 1 is 3 X as YE g J, S S 5 S S 9 T 5 zflszxgfwaf fs jk M sz 3 Q fx f W 2, S5 K fe EMM in uw ,sf QW ,iw , as H5 wa ia sf 2 Qsf ,p , ESQ 5 m S M so S S -A X 95312362 x a L wx s X ,, Sm 3 S, WS wx xxx 5 S if Sswsw 23, fs Q Zszfxsfwsfwhfmqiwes Q5 gg, aww, 1 Q ,S S S , S msgassswf , was if 1 ww S S 1 S, Q S S S W M so M My 5 E a fs QS S im Sm 5 To S qfgwki. Si ,Z uf mlwxw , , S 0 5 w We fx W K1 M K V S 1 S1 ww' K, 5 Q w ,sb 1 X Q S Y 3 L 5 f S Z Q Sw Z fmwfzwik xx 32 W X2 Z A , M f if S W it is Q wfxgf fn hx ips N xv Q , SS' Ss S 5 ,bis A w X S S K S iq S S S f y x Y 1 5 ff 5 gy SQ ,Q si S S SS S1 .www 5 , ,sf as S xg 41 ,S S S , V S 2 2 gn ,S Q W I, , S W S S1 S , 2 S f www Q sf' S wh L, Q Xb Q M Q w., S W 1, S S M 2 1 S f Q S - Les-f.sG214V,,x4 x x,. 5 S S 1. x,. 5 X r x is S :M x S K Y? x S Xa Vx is-fi S K. V2 5 5 s W xv ii 35, 12 S SWS., ,M jfghwgwmqij igiwbxx M. , Mg X A msfffshgg 592,55 'gisiqqif SLS gi S ,mga , S SS S S j www M 5 is S A V ,Q iw Sy S uf K S 1 y 'G S W S fm SSS S S f -4,,1,. ws S S Q x w 5 un M S, vga ,S , S ,J X L , , wfffwvw sm Q 5 K W f SWF sw gif S a 1 f nf, my SX S S fx X M sz an Ns S g S S S, sf S :1f,,?,,,,n W Sw X, 5 S 1, Q , ,S ,LSL ,K S , m M w , S ,, 9, S , f f Q Y ,V sf, 1 H, vw S ,S gf , 5,5 S M X, 1 , 1,2 as 1 5, X ,S 3, 5 S S S 5 ,KW V SSW i X S gg! W X ig: 12 SMF, www Sb XMAS 5 Sf M, S waz L gskjf 0 S W SS 5 9 Si SS Z Sf M S S Q . ML 2 , 5 , , .??vQ?f,n S 'Wi 5 W , fx is S1 HSM wi sw Q: Kiwis W 1 SSWHSH P S 5 'W Q S S ,,,3gf,,54, ,Z LS fs , 5 A SA K :gr is an M S aw 5 S mfs, X Ek sg QS fy S S S S y SS S ,S S giilfyli -N n, 1, 1 gg 5, gfgssug S fi Q X Y, W xg ,MS wxxfw wp, jg, gm wg us M552 SHS Swv ,gs gwfs S ,S Awww Q f 9 S1 Q S W M af 5 L f si up sf Wg 3 S ,F qv ,A M 53 Sy, M is K QS, 5 , , ggi S ,S S mg, ,S 5 S , Q g S jf Irv 23 S rs, SQ JUN Md xwqw gmf 53 2 ff Sw fm Sd , :R zf M ,Sm YK Ms, 2,5 X 95,5 ss, WSWS, V , L, S L gf 5 W ef W fi, me M w ,Q ,SQ gf , S2 M, S g S fs fb j WMM, iw W, L Q W L ww fs S ,kwa if g as ,gm Q S W, f gmxvm, S sa gf Rx S kj S M , aging? ?3gq53wgw wks ww Ski S51 X SZ Q S f bs J wi Kgs Ss S mm 3 X fx, , S X 1, , M, M, ,, ,ws H H S, 3,Q,g5 U Q Q SSX , S L S S , S ig in ja Ki ff 'K Q S w S ,f bhp gf J 1 32 W Hzifiiw if M gf ffxii '22 wwi, 5 S Q M mmgggg X , .qs L is L W ,S , X Q L S S S fl S UK L H, , sg sq 1, ,sa ,Q ,S A ,Q 52 W S S A L A S 2 wwf? Sw f L w L w Q 1 S A M Q L, X X M N gf A ,S me S X, , Sw ks as 5 K L W L S fwf' Q M M f an 2 5 us S S1 mfs S, 'Y 2 My Us SS S f Q W qw wb S L 5 53,mai:fwu -S' wk L Y k L EASY gy gf W sg M5 S 'if f 'M 5 2,5 S LL , S W-wg 5, V 5 Q L M S 2, Q 3 L 4 S S -, , ff Y S k Q w Sf Ms S is , S Lqfmg-'ez sa Q ,S LS 9 2 , U, X f in gi S 5 , 1 S, use 5 S fzjirf 5 ws S., ffsjg Y Ms Y 5,3 3 Sijis Wm S 25255 5 Q mwks 2 552 Q X S S fx S Q, 6 ss S , S 3,fQ11':,z my S? Qxxrii, M S S, S ' S W , W S QNX, F? S MG ,mg sfmks KEN gf' X12 Q 1 52 6 ,K sg Q Q xx Z ms S, sf S, x S S sw SZ mqsgaw A , Q6 S S S. 5 SA , S V , , X4 W 5 Q1 S Q S K S 5 S Q S J, S g1',,,v,g 55 gnfkm S X 3 Mass xg Q SS 5,3 f SN WWA is S, ,K SS L RMS f Q S ,m,,Qf.,y 4 W5 ivy, 4 W S x Q Sm wmv, , an ,SS Q k ENWSQM ,WS in A M S mxwg-Lf LQ f H 5 M Y Q A m 2 v SM 2, X is g S sg 5 S m 1 SS M M giff, f gn Q , Www 5 M gh ,bf NX Hin gf gig! Swwwv f YQ M Swim Sb w Si HS , S+: is ws wsisgr vw SML, my X, jk was Q 9 , if W M as Smffijwga 25 XM SS ,lxwpgep w Q ww A , X. X, fx Q S X S, qw ,W S 8 ya gf W 5 mfg Lf it in wg 5 K K 5 X, A 1, fsf f 3 - My - x as 'sf S S as X58 5 s 1 g5EmQ,wZ-H iq 55-xfgi M 5 fig, S 5 H gi 55 Lf ,bug ,jg M wfwwf sg, S2 w 3 M Q , S Q V-RJYSQQ,-21 .1 'R sf sf P4 s ez 22 x ra S s s awk S if V, ,Y 1 KX Shi, gw, 2 yy .K fi bum ,Q Mus ,N wax q,,,S S S ts S5 , mx 2 bsjwfs S61 EM Q swg S ,Sa Ss , by Ss ,, S Q L, M S -nm Wm . Q Q H Af X 1 Q P4 M A 2 V S V 2 X, A-W, nw ga 1 1, Q X, Q Y M H S M Q A , , A S Q W Q Q X, S Q SX S H 43 x f Q S , Mf QS, if N Q a Q m 1 QQ M a, ss, wax ,K gk -fi ?x.,k L1 , Q 5 QQ sw S sf 4 S 1 Q 4, M, ,, Q S ww yadxmqsxafie A ,Q 32 5 ms , S, M5 N fgswww ww N2 S K sg, S J 2, sg ww we f M X 5 jx my H W 2 Nw ,wwf S Q 'nw S j is vwwshf K3 S, R S 5 5355 S1 HN M S me gi fsqg wwf, wwf Q ,fi is S M .mais Mm 3: Q f 1 V fix? wo? W S X M 1,8 5,53 my a ,xi -K Mb 9 xafgk is 1 ya S xr Q QE T: S51 5 S f wb , W S www S 52? Q Q Q S Q W S ,S ,K 5 A Q M w , S Q Q S .. is 5 Q F , V Q , sf S mx ,S 5 ws S X, ss V ,X 3. Y, if Q K k W , X, sf ,S ,S Q qw L, S S S, , Jag N ,QW 2 X, F pw KN fn 5 5? SLS 9 ki ,355 fm , Mrk! -E 5 Q ,Af ,ZEMSM f 5 sq sf Wx ELQMSF, 5 2 ,giwmgw ii' K f as N x G Q 5 Wmwg fsgf W, ,WSW -,Z w wwf MQSUWLFS 5 333 SQ VKX Q k YH fisfsfwsiws iw ff 5 , 2 2 wi S' rx ,Q Lv gms S sf 5 -sg X? mash 9 S955 51, W Q , Q qi xx? 5 S Y 5 .qi , ggi 58538 mwwg M,a,5k,,pQ'i3f.,,3:f S my gm 2 YMSX Jnfxs ,gui V f z S4 S X 2 r ya, 4 Nw M S. A Q , yn Vim? 0 .K 9 nw wkslgm Fffwssmxihvlgf 512-XM. W MmmAsa?-5,-5Q2255Q137125zvfgiswwgwfzw,-,:2Qgqgfqgiygmegw-:fi.QnwfgzrLv,fi 'Q ,.Q-M1514 ' 1532155512293-Miizf'Li5Ss2,123-fiweiiihiwdw f31:gigf'1i-Skifxgwfxf ?1i-29Af?f:fmil?wfsEfgf,22:m: ,::i:giEs:s'ffEM2jS-afiifsigsfiifvgiwsi 12145522299 2f.w2i2T, 2 SmQnffQi5fxggY91EwafigM59WszLas23fW1EQ-sw1if1w1Lf5:mmw-- fszw.mgmwmgswwgee-,xwmmff fmzmgww fgwgixwzswfQvniimgqrsmnwfk w-f?,,4gWmfA1k1g,1fz,g5f?4 Qafifggksufvsigusy iiaggw'Rs':g5wrmg gwigiwfigwegylgfgfwmwQ5gsf7,Q5fs3s:?7f5'5,1qS21g5fz:fgYms:Q51f2a-wiilq:mfwwwgfggf-.Q,f'QHLLSM-2-sail:my f-fffz.-I, gf. 51as,QifS1Q:vL1fgf,gg5asww,uwXS544QaiQzSmayvwAss-J311QQQbe-fafm1fafw?EgsW,me1fgf1qzwgWwsfvifwfzfzfmg,1uQmgazygshwsg1wf' ,,.mgnffE:-1g:e21.Q-Qg5- .Jm,,Qwg,5-fggfw xazggfgfaismiggfi gw wwffgiifgwxiesfgygflsiwexffS22Q5228-asaf.Ewa:wfiifsvws-521521-sw:'ffizwilcfw-fzeifl'--r-Siw'e2'.fs f . mgQQQ5gfQ15Asae71Awsg:mifagaeaa5anwgQwR1g,Qfumesgmggqigxgwmfae?5asmysg?.anggzzwi:sE2:-fisgfaflffsgivya-wav-wfwwsfeaggnsgfwaifsgaswiggsinzwfggga ''2LL,QAQW+XSK5:211?5itsQiwiflfsvzifsisffhzefigf:fvff:ifwisS12aSF-:SQL1fslwvsikwfl-1ff'-iv"'-Qf'ffff' K f k Q w-is ,li , W mmf LJ fx ,fav .. .V my W Xi -af- 'LINC W M g , M fEgQ1iT4 fy f,MgSgf1ff L WW me fy M. W :Q ""2??,Rgg" ' X Q. WM 2 wwgmg M W" , W' M' ' ' 5 may Wax M W'-V?'m'b,.51iK,,2f'7' W Y g4s' a ' ?5g.?'fm w 1.4 h """' 5 X 1' -E. ,. . mum, i :. Qff3?- iv 4 1 . .Ju .xzkx -:,,'j,,vg"f."" 43,5 .fwih N Hwfkgfy ,f f.':v.-,...'f-.,,-24 E u ' ., g'xs1f'-:,' ',d'E""9' sf-. -' ' '- " -- u... , ff--, x an Q ,.. .1 vvqf-Aw w' 7:l,,..Av ,qi . ' nf, 5' 'H 'U ' ,g X' 'mf:,-Qf2"2f'ib',":, 'Wk 'fi nav-,,aH,,f-'-Gi' ,1,"'?,-ilf'-,. '.,,,,i,,,s-1' A ' 1 'H 3 , Q 1.f.J"n'.vr:,".,- H4 "U 'k-f3g.,.,Ss'- 'cn 1 4' 'lc-GQ. .""'V 4 A W 1 , f Thi 'f -1 "Ml 4 ff'i'VF"f V " , H+ M f I M At'1"' f ' ' S' " ' .. va- . , . .HI '7N,, 9 I ., , ,Z kk' N ki rgbiiq -Howard Rorzloff Phono Courtesy John Matthews Co. ag. .i . '3'.. L". .1-gJ.:1'v,,f, 1 -sffssxr 7-,A ' rn- f:7vL'5f!'f wr -v t ,. . .Ll , 5",3'f' - "Q, ,iflpf rr ,lil . 2' Q54 - U Uh- If ,aff ., - in -' I -L 'Z 'i Q, 1 . S . 3-. 'ram 1: '-.-r :KL :FQ .e',i -'iff ,W L. 'fit , 9531,- ,MJ 'vifj -'rf . 1,4 -. is-' 92 i""- 1'1" -Psp' 9' J Uv' ig: jg-'rf 4 . N, '19, Ffa fi., 1 Y . 3' ' ' Af" ol' . . .v, ,. L 1-'43 K 1-.122 gif-QLT' '.,.. . is? ,Q-,fy . if .fx .L av. -T "fI.'r"f 'T A 1. ,f. axiyi, z?"Q,.o? '7 1-fr. -, 4 .. -1,f'Pf.4- fm- ' "fw,c2'12 he, gf , ,A , ' eil V,, 1:5 3: QF. if-F '3- A1f""' F I 5? ' gf f '-ff. sf T .ff-' HY: L22'f.:3'zf L,-z ,. aQ1":.1n3'7"f rjwowf 5 flff-i far- VJ, g. 92" . 5'-Sig? , ,, ,-dr, -151:25 ' -ff 1 5- X, STUDENT BODY PRESIDENT BRUCE COOK Student Body Officers Uphold the Tradition of Leadership Good leadership has long been the lifeline linking together the students of North Little Rock High School. The leaders of our school, the Student Body Officers, are invariably the best, invariably the strongest--and invariably represent the cream of the crop on Wildcat Hi l. Democratically elected by the students themselves at a special assembly, their selection is the culmination of weeks of planning, cam- paigning, and "politickin" in every sense of the word. Once elected, however, each Student Body Officer shoulders a great responsibility both to the students who have supported him and to his own conscience. Each officer has his specific duties, whether they be presiding at assemblies and meetings as President, or handling the Student Council money and records as Secretary or Treasurer. Whatever his own duty may be, each officer is ever aware that he has a great reputation to uphold--the reputation of Wildcat Hill. Treasurer, Tap Pritchard, S e c r e t a r y g Barbara Esch, Vice-President, Mike Rhodes. DAR Good Citizen Award CHRISTY LAMAN This award is given annually by the faculty to the girl who displays the most outstanding citizenship in the senior class. Bausch-Lomb Science Award STEVE LOIBNER This award is given to the top- ranking senior student in the SCiGHC9 department. Senior Boys' Quartet Senior Girls' Trio Judy Huffman, Linda Yeager, Jinger Jackson. These girls were chosen by try-outs from members of the Senior Girls' Ensemble. , ,gm Paul Rice, Don French, W. A. t Tucker, and Terry Mercing. 1 f' Members of the Boys' Quartet are chosen from participants of the Boys' Chorus. gf' fm! f? Mfrs Nix Q-'14, l Drum Majors John Matthews and Sandra Mabrey. The drum majors are selected by the band members according to their ability. uk l 4:31155 N...4r 3"-"""jqh,,., -1 gh Student Directors Walter Craig and Patti Andrews. Elected by the Wildcat Band, the Student 'Directors lean the Pep Band during assemblies and basketball games. PY' fir im? Senior Wildcat 'xiaid Janet Pullium Senior Wainpus Cat Maid . . . . Phyllis Xicfiuin .lunioi Viildoat Maid. . . Leo Reid X-P J unior Wampus Car Maid Connie Robertson Sophomore Wampus Cat Maid .... lilaino Anderson M. X 5 J i Sophomore Wildcat Maid Linda Muncy 4-0 xl Z N e Q, Color Day V Ha, Wampus Cat Queen Ann Splawn w ! Royalty Wildcat Queen ,lanice Measeles :GR fffx, g LH, ,ik ky I ,mgvixae v MAID Sharon Reeves 22 , ffiggi J- n wx MQ xx 4 , G- v :W .WAY ,A N K 4 ly ! 1 VV an QUEEN Cathy Reed I ,... ' ' .. ., 7 ., ' , A L , 1 gk A I ' ' - 1- 2 n ' hn e n in ,gf n MAID Linda Terh une .5 MAID Gwen Brinkley MAID Janice Measeles 5 'Y' MAIID Kathy Barnett MAID Merrily Orsini Y-Teen Valentine Royalty Senior Cabinet Suzanne Clements Mike Metcalf June Wright P , A f. i' , 1 if: VV Dana Smith Patty Brown in-it Ron Bostain Phil Esch ai' ' ' -Q -. ..-,. Q : Z Janice Measeles Horace Prickett Phyllis Smith ff sw f 'W we 1 -Q g Mike Highfill Dorothy Landsman ' EP ig 5 L,iiig,iq1 Susie Gough Larry Carroll Susan Peterson is Q 5 wQ,."fN 4 Dick Everhart 3' iv g Wx., Judy Moncrief M! pw. u fa L Jimmy Taylor ' ' , liiiidai-95 J' :H ,Q -tiisg f , 'zlmiifs if - w1i.11Ps'js , , -' f 2... 52 - Sinus' f 2 5' 2 H . fi. David Bates David Herrington ' fi 53 W h i g g jjg, " ' Marie J unkin Ji- 'f f w Steve Goss , gr.. J if-ww Julie Whittle ,,.,,, i f A-f 1 - " Terry Mercing J A Iiiif 'f - f f ' 1 ffm, ., , ag T' 7 i ,4 ws Crystal Cox , .,r. wi '-iviiiii .15-s,g,g iw 5,1 I A512 Q fi is ,, Connie Barker Joe Lynch 1-2, 43? mv fl H J m iw'if,,x f 8 w in Mr' X 2425? gig Q.. tri' 5'-g:FggAlz 4:1 8 gm ,Q 'P ,-f:zLi' -1 I5?,iE,lii7iEz?:4,,'k K7 V ppgagfiggili iiigifkh g, i"i "' J i ,, ,qv nigga R15 Eve Elias Charles Kinchen li, Dave Ouelette Ann Splawn ,xi -Q., 8 Murry Witcher 2 ' an fi Vicki Harrison it W C Jack Crews 5 , I -if 'rs J YWTQV A P at Ferguson 2 g Q , iw ,. Pat Higham Wayne Wallace 44" ,.,. 1 514-' we "'i Harold Roberts Jeanette Pfieffer Junior Rotarians Fred Hanchey Richard Baldwin John Jackson These Junior Rotarians are chosen by members of the faculty for their outstanding citizenship. Each one is a guest of the Rotary Club for one month of the school year. Bruce Cook Jim LyHCh Dennis Baw David Teegarden E , 'E E 2' f 1 51, - W Dave Ouelette Dick Everhart - .J was ' f":f:'-'4'1'f1,:i' ' 'K .e r fx It shy , v ii 2 1, Q " 423 wi ' 532' , V R2 K ' , ,i ,f 1 Athletic Honors ..ff'i..X Bill Niven All State Joe Smelser All Big Ten 'QUE-yi 'Hom Richard Baldwin All Big Ten All State MUP AA-AAA State Tournament All-American Gary Stephens All Big Ten Steve Daniel All Big Ten 5 E liletr gf 1 if Bai Y . William Ketcher All Big Ten 'WCYWUY' Girls' and Boys' Staters Boys' and Girls' State are eight day training courses provided by the American Legion in study and practical application of problems of self-government. Different parties elect officials who serve in city, county, and state offices. The experience of Boys' and Girls' State gives the individual a deeper appreciation for our way of life through religious experiences, respect to our flag, pledge of allegiance, Americanism lectures, and better understanding of the freedoms as guaranteed by our Constitution. Phil Esch Dave Ouelette Gail Millsapps Dennis Baw gs? WM fa ii rffii.. . 'T Jinger Jackson Dick Everhart Janice Measeles John Jackson Becky Ball Steve Loibner E w'i""""-N-'mtrtri ,,iii,,, i J fi J J J ' im3gfSi5,iFa,,, J fkffhx Muriel Hagey Gregory South Olivia Hicks .ni n. i. www! jiifw SYM 5 2 -.. ,M ,fw- .nlf I A Mike Rhodes Carolyn Brisby A -Ya on Fred Smith 2 . . 4 ..., Ella ' fpf -2' V, ans LED. if S K SAQYIITETFQ Christy Laman David Herrington if g my if Q 4 S? X ,sara ifiiwii X i he nil' 9' 3 y P if L. E3u??'H?ifmfw::i 'I f Barbara Esch .w""',dH. If Jim Lynch Bruce Cook ,,r.,.+ LM! ff , 2 1 if .tuxrlufh 1 - Jack Crews Cathy Cook Jane Priddy David Teegarden .fn u Bl F 1' Fred Hanchey Jenny Wingfield 4,,,,,-M-----m,,,,....w--1 ,C LF"2:.Z-5 3 'V T"---..- Wildcat Cheerleaders N.L.R.H.S. Cheerleaders are selected by popular vote of the student body to represent their school to the best of their ability. Each year at spring over 40 girls assemble on Becky Reeves and Jenny Wingfield the traditional Wildcat Stage with the hope of being one of the girls selected to lead the great school at North Little Rock. But only the ones with the highest potential are elected among the great Wildcat supporters. Karen Yedlick and Diane Snow Donna Munnerlyn and Susie Gough Co-Captain Sharon Reeves i.i......v......i.....Y ,Y -7,7 W7-w-....-.....1.-...... ,:,. I ff 9325 '-"- 1 X Sue Shugart and Barbara Jo Simons. , st Co-Captain Eve Elias is Good luck is the general cheer from the cheerleaders as a pep rally is held for the football team before their departure to Blytheville. Charma Head and Jane Ann Munnerlyn. 44 rv Arr, A ,ti fe, fri, Y al, vw, W ww .A ki .. f- ,A 1 if f 4. .V ,qw f, f a:ft':w.ff' , .wnfm 1? V f it ' 7 f ',:::1,f,mS'1--1. ff. ' f 9" mf ,,.. Neff 1,1 ,f J ,v -'aff-V, -i bf F? 'wr - N ' K, iff- M ' K 1 ,Q -Q 2 5- All State Band a n d O rc hestra EARL ALLAIN PAT ANDREWS MARY ENGLISH LARRY JONES WALTER CRAIG MARILYN VINES A FRED HOLBROOK MIKE CROOM SUE DILLON JIM WALKER LINDA WELLHAUSEN RICHARD PURIEOY PAUL MILLER CURTIS DE RDEN BOBBY ANDERSON CARL BRINKLEY DARRELL DOOLEY MIKE YOUNG Frlendllest Wildcats Senior Girl Jenny Wingfield Senior Boy John Jackson Junior Boy Bobby Mills Junior Girl Kathy Barnett Sophomore Girl Susan Gasaway .- R x 1 Sophomore Boy Tommy Dew , mr, ational Honor Societ Fifteen percent of the top-ranking one fourth of the Senior Class and five percent of the top-ranking fourth of the Junior Class are tapped for membership in the North Little Rock High School chapter of the National Honor Society. Character, Leadership, Scholarship, and Service are the points considered for nom- ination. Principal George Miller is state com- mittee chairman for the Society. NHS OFFICERS SEATED: Jinger Jackson, Deanna Nichols, Sally Chandler. STANDING: Tim Ashberry, and President Dennis Baw. Members light the candles of the initiates. SPRING 1963 INITIATES ROW ONE: Left to Right,Jane Priddy, Jackson, Jenny Wingfield, Sally Chandler, Fay Smalling. BACK Judith Moncrief, Muriel Hagey, Barbara Esch, Jeanette Pfeiffer, ROW: Dennis Baw, Steve Loibner,Terry Mercing,Corkie Ritchie, Sandra Mabry, Patsy McKowan. ROWTWO: Jenny Wilson,Annette Dave Ouellette, Fred Smith, David Teegarden, Jimmy Hill, Merritt, Olivia Hicks, Deeana Nichols, Patti Andrews, Jinger Tim Ashberrv. FALL 1963 INITIATES FRONT ROW: Left to Right, Mary Measles, Brenda Young, Nancy Antonsen Marilyn Vines lred English, JoAnn Toland, Susan Frost, Judy Philliber, Phyllis Hanchey. THIRD ROW: Charles Claiborne, Dorothy Landsman Gasaway, Marsha Sessoms, Connye Barker,Kathy Jones.SECOND Paul Tompkins, Annette Laneer, Johnny Glaze, Patsy Wasson ROW: David Herrington, Kenneth Lovell, Phil Esch, Janice Jim Lynch, Joe Lynch. SPRING l964 INITIATES FIRST ROW: Left to Right, Renee Sorrell, Carol Bartholemy, Barbara Hall, Susie Gough, Eve Elias, Jeanne Fortner, Cindy Hicks, Paul Warrick, Pat Smith. SECOND ROW: Paul Miller, Carolyn Killman, Judy Cox, Diane Allen, Anne Fleming, Kay Harrison, Sandi Brown, Paula Fielding, Marianne Borengasser, Linda Adkins. THIRD ROW: Connie Robertson, Kay Roberts, Kay Smalling, Phyllis McCuin, Christy Laman, Phyllis Smith, Jane Ann Munnerlyn, Ronnie Hicks, Becky Ball, Edward Hale. FOURTH ROW: Cecily Hoffius, Sandra Turner, Nicky Heintz, Whit Hall, Freddie Ann Link, Jerry Paul, Dick Everhart, Dana Smith, John Jackson, Fred Holbrook. FIFTH ROW: Russell Jackson, Hal Piercy, Linda Stephens, Linda Wasson, Carolyn King, Greg South, Bill Bosley, Scott Hinds, Al Rutherford, Ronnie Ridgell, Larry Carpenter. as Y I I mqwwvw f - . 'ifiilgi i fem' ' "-- as jgt- '.,:. ,- -i 7- --Y- Thespian officers are .lan Winn, Phyllis Smith, Ritchie Campbell, and Dennis Baw. Marialice Brown, Robert McBride, Pat Smith provide the talent as Dennis Baw conducts the Thespian Assembly. C xii Thespians Are the Best Actors Of Gur Presentation Thespians is a national organization for those interested in the dramatic arts. To be eligible for membership a student must earn ten points. These may be earned by presenting a skit, par- ticipating in a play or viewing a stage production. Fifty points over the original ten gives the title of Honor Thespian. In addition to points, a Thespian must work hard on all assignments, giving him infinite knowledge in the dramatic arts. 96 Tri Chem Represents Top Scientists Tri-Chem, an honor society, chartered in 1939 for the purpose of stimulating stu- dents to further their interest in the field of chemistry, is sponsored by Mrs. Matthews and comprised of students who have had one year of chemistry or who are current chemistry students. Members must also have a B- average and must maintain this average. Each member is expected to advance through different stages until he becomes a master chemist. To achieve this goal the member must complete rigid requirements set up by the Tri-Chem society. Throughout the year Tri-Chem members participate in various club activities and projects, such as individual student experi- ments, outside lectures, and field trips. Tri-Chem officers are Olivia Hicks, John Hendrickson, Carol Bartholmey, Bob Finnegan, and Mary English. "tun- 'Frog Manu Steve Daniel looks out for Mrs. Matthews as lab partner Buddy Hillman "Hindues" a lab. "Let's see now. If l take 2 parts Hydrogen and 1 part Oxygen, I wonder what sort of deadly liquid I can come up with." "I don't think that's very funny at alll" exclaims Quill and Scroll Treasurer .lane Ann Munnerlyn to President Jim Lynch,' Secretary Susie Gough, and Vice-President Phil Esch. Quill and Scroll Honors Top Publications Staffers Membership in Quill and Scroll, the International Honor Society for High School Journalists, is the gift of the faculty adviser for student publications in rec- ognition for outstanding work done by staff members. ln addition, the student must be in the upper third of his class in scholastic achievement, and his citizenship must be satisfactory. Sixty of the more than one hundred students enrolled in Journalism this year were able to meet the requirements for Quill and Scroll membership by writing, ad sales, photography, art work, or general staff work. New members are initiated at the Journalism banquet in April. Quill and Scroll was organized in 1926 and now has chapters around the globe. The North Little Rock chapter obtained its charter in 1936. i l The new initiates participate in the candle- lighting ceremony which is conducted by the members of Quill and Scroll. Pledge Mistress Marsha Sessoms pins new member Sherry Polk as Cathy R eed and Janis Emberton look on. Publications Honors Mr. Publications-Mike Moore RUNNERS-UP: Ron Bostain, Sharon Reeves, Mike Rhodes, Charma Head M iss Publications -Brenda MCR aven Messrs. NLRHS Mr. NLRHS, sponsored by the Y-Teens, is selected by the girls of the student body. N.L.R.'s Junior Miss is chosen on the basis of poise, personality, school and community activities, and talent. Ricky Colclasu1'e--- Bobby Mills-- Sophomore Dream Boy JL1DiO1' Dream Boy Fred Hancliey- -- Mr. NLRHS And NLRHS Junior Misses Pat Pt1gli--- Judi Howard-- Alternatc Junior Miss NLR Junior Miss A' .. ,.-a'f1.- 'F -Tv ...- ,- ,. ,,. , -:',,: 1. 'wx . -. -f'ff'Z,:' I Pd. "LJ 1, 1- .1.4- .f,, I f.1:?:jL,, ..",,gd L.. .. ,-. . fix, "'.e ,- A, f- f 0. . A . i x. ' ...f u '1', v N ..f --, .Lil-.11-ih',l. '. f',f- ,-- . if - ,,- -1-,f,,, k ,, 'VU 5- jg . I af' .pw I--A I . ' f,-.- .".,.-" A - ,- .H.,,'. A,-1: f-, n ..', '.. A.,-.,g, A., .,- , -: -' ,Af , . ,-- ..- . .."' ...fx-1 W-'J..-ff- .4 ,,,'V,,-fi.-v ...I- .... -.. : ,r,-L - . g',..g,vn-.,',,-"1",k,. 4z,4js.,..-5Y,,. . T, J,..,x!,.., . ,.,f'.::if -,,vgf.-u . . .-- ,r 51- ,uf-- -4 ','..,. ,,,f I ,-.. ,.-.hy. .4-fa-1 , .. -.-Ve, nr 5 -f -.-1L,--',.--- A - - - 1. .z ' ,..Jv ff-' uv, .Q 7 -, B fwfz --f va , , - , ' 4' "ig . w .4 M. .Q , ff ,- N ur., c .Y W,... A.- 4 ! 81. '- ' v fm ,- pif.-'-', ' an 'Y 'gk' -.- 1 4:- -LKY, A: K-J' 5.2 L.---. 7.-H 1 ig refs cf Q 4 3, 7, , .rv F. ry. N . Nl? N. 1" , , AEBD BR ,, Y V A , ,-f, .nik , A ff. - "' - ,-, , fu.. uri, 'i pw , -li' R -,. "'f,:f f 'S--' '-4 6.5, fx '+'1,: -1,1 w , .--- - ' -,,Pl'.., 1 , rf' fr,-P - 'fs 5:21 .v,f- . ufsly, . if 7 ' gf.- , , .f- Mr, gf-ff . 'Vs , AZ W Q'-iig, , '53, gg' ,. - . -1- Paw- ,L ,. ' ,QFQUTI-4 1 ,wa -,r-1 , ,ye ,M -, . .0 ,f rv, AS H 1" .r ra .f- n.!J ,- ,ff 4' p :kv 5, . EN. 1 Q" -'1 ...I-.1 4 - - .x.'v.,' .1-S ,L ...-.',a 4. , .Q 4 I , -:, -5-1195- -4.541-, gr' M, ,U ,, ,J . .4 S A I .aa Q. 1-fa. , ,- .,1,f.w iff -1' f ,v fl' .f .4 , " U, ..-1 , J. . x',A2f,, A-M 6,2 ,A ?5SEiE:--- .A , A A SENT xii: , sas?AQYYEQAAA-t1AY'.H2YY'Y-Y 5.1-5211--wifi-f1'.iAs-Y ff' --1ffiYY- Y-IL-1 'fibwwilAjsxmf'.EAf?IzE?L.-s'.?iFLAiL55YA-1 wiifm ,AY .,Agf?1f:QE1f-,3jA AA--A WA- SSAXQA21iAAAgQAif51LAAfggggg-Igv1::gA:vz':fjl ' Y-iiE1AALSk2fZL.!zfYI.5'fsfEZiQ:ii5Ei5:?'Al?f?i5Yi AA, ,1A:,yLTi,.k'ML5A 45z'Tl-SYSSQHZ-5' -Y?'S'fA-H K7 -YAW."-U,A..A,A,A.A, ,. 5z3gg,,AgI AA,.A,A,,.fA AAA.TA5A55AAAgggA.,jAI IIIIIWAKAQQAI-HL'1zffI'IgmAs5:Apex-YY Y'A-f1,.A-wmzng. ,A.A 1:-AA::-.Aw 1-:'2AAAiA:vz::A-f H915-51.fzfLAifsf " - Sum Y-5911?-VTIWI 1'Yi"Y-SVN-1"' A. , AYAAY?Aw35gAA,gAYAA-YA-AAAwAAAA-AwAAAf.AAYYAAAA-YY-.AzAA YY f',2-AAAYAYA-2-AAAAYYA 'Yssii-Magi--A -YYAYYAAYY Ys'a-2viAfvgsAYgsa-Q. YWQIAYY- Yw:-Aw -, Ag., AA..-Y-AA-- Ag?5-IWYAAAAYAAAA-YAAAA,AAY. YAYA AEIAAAAAAA7IA,AA,.AIAqAAAAAQAAAIAAYAAAAAAYAAA-AAAQAAAIYQAAWAAAA,,,AAAAYYYAAYYAA .AAAA--AA -Y-,A Y.AYA-:As-AAA.sz:IA-YaAAtSAsegAAmAYfAs?AEwwY,A -Y1A--mfg Y- YY-fa--YYA .Y Y - I'-f'-fw-" 'SY??Ak2'v"'Y2W" ASW:-YY"'I-2Yf 37 A,YAw--YY-.AA-A-Y-.A--YYAAAAAYAAAY-AY:A'AAQAHAYAAIA,iA-?AAfsx?A14YYiA-zfs-21114152AWA-AY.. .-,rf--wwf-AAAAA.A-YA,-YAAY--.AAYAA-AAA-WAA.-YY YAQY-YA-YA, AY:fgs,A -Ygf:A---3 .,AfY,-iAALzzsfAAAq.AY ,,,.AYY.AA..Y- AY ,,YAAA,-iAAez,.AAzA.A-A Av -vw, gig5135fqf15ggLgj5.g7gig,gAAjgjII QQII 1A3Q53AV5gf?ggjgggggagggggjzggczfgl3A:gAAff5As:1AisAfL:is:5A45iiA.AAAle?E'.5iZL5QE'??HiEZ:fLSQEYLE-iL.fL2Lii?iii39EY' ,,Ai!f? 5252-V? ' ,fig-':f47M?f Y:QE'Lf5LAg3L5?iAs95fsswlii? MZAKQEYQSY aAfi'?LAf?LfW-i,.. Q "-' A ,. -it-34S55T'Yf1z .sig-z. A AAIAAAM.IAA,AIAIAAAAWAAAIIAAAAA.AIIIIAIA,.A,A,AA.,.AAAAAA,I,A,.,AAAIAAIAYAIAAAQAA-gA.AAA1,A,AAA,AAAY.AI-YYAAA-A.YAAAAAYAAA-Y AAAY-YAAYAAAAAAYAAAAAYAAAAA-AAAAAYA -,A-fY.:A Y.:-A AA-2AAAAA,AA-Av--QYa,-.AYAAY-YM-YAAA-A YAAAAAAAAAAA-YA.YAA-YY,A ,.AAA 1. A-Y-A. AAA.-.AA-ms-AAA A--Y1x..AAA Ye- Esfviiliffsliil-'-A252lS:fYE?S'L3E-V151'5-:AufLglsz'AA:1m?Y.:AA3i:sQAYAAAE.L ,i.:AAfYA::?AEis':YAZMLQSSEE' A9155521i'l.'3iY:L"'Fe-Q7-WLAQETZEQ1'AASSTWA-i7V5'9q'AYAfez:ss 1A:iAQ:5.Q'23325ELSE?EMIS'1t5AAiii:i3A-Egiiqi YA52a2'Q1Q'.i AASAA.As:'z5.s:YA:z:z:-"ii' .,YY.:z:w,. -vA:A-ig, 11Af55Q3fYeAgAYz..A --Y-Yzzs A-zgAgY--Aw , Aggg, W"-H wel25ia4A:?Afg1k5YgeAQAA.,,,AJYAAYAIY'fAfYzAiaAYAfi1Y AASimA2fLgfe2iisL?.i-'ffslffilj-Y Y-ww YAFA LTV' f1.1ssizgfisewgiifizmiiaglAAQYQA-YfggAeigA3is YYs1g1AsfziiA- ,Aw-2 ,.I,gAf:giwgAfA, A.fAYsfA5YAAI I"'gfA-A "'iifY3A AAAMAIAQKAAAIIIAAIAAIYAAAMAYAAQI,IIAA,IsA5Ig55zA QE-Jw-55, AA,5.,A--Y,..AA,.,kAS.IAYA.,,IA,A.,A.,IIA.IIAAAAAAAAAIAI IA.,AAAAIAAAAAIEAIA,I,AI,,zjA5A4gg5jIgdI1Il9vYAggAg5,y,,A,-esgqg ,wg,Q-cggAg'z,AAA--Y,Y,fq5 AASleiAWQAIAAAYYY:szEAigfvt:AAYAS We.,-'fbi.L1-Elwiifq''LU ' Q-Swfiiw k -H-.:z,Awt'AA23YYlAw AJ., sgjAA A..Y,.sV' ',tAw:,..:AAfs,, IIYzz,I Y , HAsw::Y.ff Amery:.s:a:Hgmfi:'1z'.Asfz:z -vflzwzi A5749 YHA. 15. 'Al-sz:AAfLz'YAfv::Ag:vz:w,:e,w.: -we-AAf,AAAY1t: Amt:sfqY.sr5YzA:2f?Y.w-'Aw'LAHWYA-YTYIWAISS LIYYYNY-lv' zzz-YYAAYAA'-YAAAQYYmY.ezAAA YzAgAA,7,A.,-AAAAAAALAIM., AAAAAAAAIAAAI A-,AIAWIIIEIIA , .IIIAAAA ISA I I I AAAIAAAA AAAI A.,.3II5.,III. ,, A AAA,,, ,AIM IIII...AAIA.. I II I III '5E2s5ge:ezzAZSi2YYq2:a-7i'gszAfvA:sA:fw sm ' 6111255 W4 5-3333Liiif5'!vEf5!iT4Li1i17As: ',z-zfsfu.zz:a:w:5':ffsz'ftAs:5lAiLYeA:2A!i:51,,LiiAA:5i1m:f2Q:?L5bET'"Z ' fi4?A74TT5E'7-SYETYISWWIS-535Y7i3iTii5ii7LA-2E'lL-WT'IF-Y-YYWY Afi'YYi12aYiL5S'T3EIUAAW '7 'U AAif1AA,A:A """fg5AqfYg9-fE'.if- 3.2245 A,?,fC221iHgA12Af -4-pf-ff6i:qE"'Y V - ., AIAS.MAAYAAIIA,IgAAAA.,IAS.IIA,.I,IIA my IW-AAAIA AAAI IAEA AAA -AA Y .3 QI, A,p,IIA.A, A' .:a-159-25.21":w,:',:f1.:zu.wez:YiAg:f:mA'z-Aa:v,AAAYAazA-Az A--YYA ,IYL.YY:,fY..Y'YY-.ratAAfYLfv:a:-YY:v.fe-AA--if'Q-5llsf57llb:'LSTfb-' "1"Y-1Sif112l14'TY-1b-Y- Y If "'L"""'Lf v':":fS"AfffA-Hifi' Yr- Yr--:It "A: 1fLY'Y-H421 "YI 1 iii27555532325iSZEYL1s?:'Ll5E4-vigYwis-Ami A-,,,:As:w1wA Agwzzm: 111' AY if A Mi "' ' Y iii? ss22.At'34sAAa'1gfat'u,.1rz'Af:f"':'frr:A',vA::- ' ' ,11kEfAgQ2f'kff21sY'W.armfix:EWS:35:'YT'AWTZb-212" 1fS"T1Wi.2VAY-Wzth "YY" 'W -Y-WS-'Pig '5EiAfAEAwz:Y1cs Aff1s'11A,Y -Y .11:.g-.1A- A 'wi . AIISMSIISWEIIIIISIILIIIAIsIII3wAIgIIAgII5IA,IIIIAIIAAIIIHAA .IIIIAZII AAA Iwi R A, AA YY-A555 Y AQQIAHAT I,A5f53AA?AA55-YQAII AAAQAA5A5,AYgiA:51I'sg.AgainL5A3515L5AA:SzA:AAfi1A.5255A9,im- s5l5if?i5?iii7si3iiZELLL.vA f,AAAW?Li9i5iAff A- Li3573?5fs"iilk--bi-'TY-Sgib-YE.iQ-YA. 52-Y K " IIA--gg .l?',A.llf:A-9 1-3'..A -Mia .AAA:uass' Yzfzz me ag we 'A -:zz-Yew: YY, L' .if--A azffffm -fi" A- .A-YY Afiifsfziilg-fSi1AAelQ:A2515wA:'-:f2A::AAYY:k.Eipw1:AsA?21As7:iie :A:w AAffEi!i?Lii5?z,. W QETAQEE. , QY 'MAG' WA 'fig S, iiLf5f?EAA,. .YL AQSQEQWETWE-W'-W7-YF:"?Y-YWSIW y''9L5537l5V?Y'f''WIWYQTY'f57iS"Lff5i'?1f515f'J:i?T55LiiiEf?LYAKSZZFQESEIQEZQZQEYFTTQA,AZFLEAAY'AAsA5vm:LA:ezm: Iyjg 'zfjigfqgjgjvggggfgb I IIIAGAS AAEYA A,IAgf5:gsgj"fYg5'fi Al,, 511:63 .AAizzsAwiA-eYAa--Y?-,,i,, .,-fA:AY.A .-ta, new ' fgsYz.A-5vYsA,11E'Y:AifW' 252314-W:-Y ,wif2Y1AAYYf25fSfiAE-YffZAi2Ei-f?Li21fsf-Ygfieffziwzffexffgefis-Y1fAAYYZWTAY-QfLYY2'4Y21Y2?-HYYY-ii?iAiW?2'fiAYi'?-ff.,,A5YY?5fYsYsiAs sfAzfs1AYA'v'f"SAA'g4YYS'Y YYY:-YA-A., -fYweYi:'zzzzx-1 A.,.A1ffA- 4251? YYAAAAAII I,.AAAA.fAAAA,aAAALAAA-Y' nga. me -SHik5LYQIYW-YEY2-f2's+22AS5E5E3AAA5QYf2A5iZiYsii?Ae1LAf1eYziA-:iiizA Yzmfzez-A?,maxi-SffWLfffYAAY 2wAs1As -'Ysezwzz-MAA. YQY-Mi Aim:Yw"f1Ags'iA.1:::'z.sAA.vz::AAfe,:s'YA: :Hz:sawf:g:vzA:AA?"zT:':5ASiA3-ii-ifYY.z?QA-ez1ia:w,::zt Agrtzw 'A-YAfw:'AA:vz.A9Y.sz, fzmsigfilafv''xiii5:2559531-i?j5:wfS:Ym 3-mls LAAQ1'--Y 2 waz- :wx-5 'EYWH5 'L"'lbSfW1G-'ff 'aiYA-221Ai'fiwizmiki'-555'-57Aif'Z:Ls-?fr3sWiL:vz:AAY :zAYAf1mA:A.,,, wAYYzmA:aA11:sA,Ae::Avz:vYA.AAfYA.sz:pm:A As::Y1:sAA , ::A,,:.,, AA ' '55 Eb--Wi?--f-'32-V-A 1 ASAE?IIIIAAAAIAIAISAIAIAAAIAIAIAAAHAAAAAAAAAIAAAAA,,AA,AAA.AAIAAAAAAW.AAAAI5A,AAAgYA.AAAA,gsAgAez5g:Q,AAgsAfA-,A,MAAY:AAA.fY.A,YA,AY-A Y,AA-,AAY-AAAAAAAAAA,Aga,AA-:AMg.A,YAAAY,AA-IQAANAAAAIYAA-YA, -YAQAAA-SAYMYQAAAA A,-YAgAA-YgAAAA-,AAAYA.:-QYAAY-AAAYAAAw1YAAAQAQYAAYAAAAQYEAAAA-AAAYYYASAAAYYAAYAAAAYA.A,,,I.AAA-AAAgYAAA-YQ-YAYAAAYA5AAYAA.A-YAA-A,-YAA,A-Amy YAA-AYYY-YAAAA--AA,. ,AYAAYAfffYAA-wAYAA..m-Y ,v, IIIIii'IIIIIAAIIIIIIAIIIIIIIIIIIIUIII LiamIII5IAIIAAI.AIIi,,IgAIRAS.IIIAAA,AAIMAAI,W,IIIIIWIIIIAIIIVIIIIIIIIIIIIIII,I..AIAIA.,M.,QAT.II.AAIQ., I.A5..AA AI5.,IlY..II,IAA.I,5, A,,A.,IA..,LAAIA IAM? AIA.-,,,fAI55:zI AA, , Aa:YY:::AAYYf:e: AAAA, AA, iz-AAAQQL-MQA,AY153:-w,AwgYYA5Avz:s:mY::AAzz:sAAz :sA2mf2mAY,:7:Y5 I:n:fAAg jII.5gAAAQ-Y AL-wAA,YAsz:AAYeAi:wY -9.:2z.5iSYl,ER-YEZW--YYY-"'7i'lW-YY 11'-W:'::p.:AAA.1z' ,A zz., :A iIIAI5AIAIIiA5II,gw IIIIIAIIAAAAAAAIIIAA IIIIIAIIASAAZIIIEIISIIAIEAILIIAAIIAIIIAAAIIAIAAIAAAIIIAAAIA A AIAIIAIILAAIIAZA I IEYIIIQAILIIIAQIAIIIIAA A IIAAIIIWIMAMIIIAAIIL.AIAIAUIAAIAIAAA MIIV, -film. QIEAAIIIgggqlgggggggggspqggIIVAQAIIngmySi:75AQiE7iA:l3?YL35i55225535725719253-??7LSi???L5iEiQLif7Z517A ?i:rAA,gffTiAA:Yi,AY:Y-'Y I:-I ' ,,IA'fggj7,5A3jggAAYQ:f:JailiA-3525921':zfff'Ll57Lf75,A .,I',fif'z-'FFEEYAIIFFETT Yfbzfliiffif -"H IIAAIIIIQIIIIIIIIIIIIAIIIAAAIIIIIIAAIIIAIAAIWIIAAIAAIIAIIIAAIAAIAIAAAAAIIAIIAIAIIIAIIAAIZAIZIIAIIIIEIIA, IIIIIIIIIIIIIAII ,IAAIIIIAAAAIAIAIIAAAI IIIAIIAAAIIWI5 ,.A,.AIA IIAIA,I.A,HAigIAAI,IA- LyY-IAAI-A353-qgAIAAg7IAAA-3LA:73AAAAA7g3AAA3A3t3-LgAggfiAlmz?'542"YEAWLYYEE-Ye4552452522la-513222sivgieiziifevgwlbs-7315-Y gi-ZAEQIA-QAAAYYAAA.fiAg3AYg9iiii-H''s?AA-'---ffYf--YYMf- sag-wi? ,IQAAA -YA-SQIYZ 1,3253 www A115-zz ,Aw:Awf5AsA1zEA:iA:3ZiSfEglWA-l5E"5ffsf2lrAsAf1gffz:Ag:z.s:-Wa:YmA:A::vY:s iw' :iA,f YAfl'ZAfEimz.Si'iesz:Aa A:ff:1g,i1wt:A 'wfr:g.sz AA',,:A:1.v:-.'AYz:i ml-f? W-57-li 5-W5'S-ST1W'l1b1"Y-fs?AwA13-E-Yzigq-wg,-QQAA-myYA.s:AAYAASYAQYYAAAAASAQ-Y3AgAYzgggggegmfAj,.Him,AgA.fczI5gf2AA-fAYgg-,Ugg-SYiL,YY:AE1i,gfYS1'Lim 'A 'LV 'LW' SY "5 SYSSI-UTY 'YYTT' 'Y H311 Ame,Y--w1L.:sg:2Arw:-:A:?Ae:AL::wz.wA,i?wAAf?E:EMRliiiiiiisiiif::4A5ii5iL43SEif'2fQtqfwlgmbg:-1 ',:'5:'YA:zY,.,,Aa3f23l1,fA7Ali1i4?ggiif5gi?1 A.i:iW2A:A-Sig YQIQQYASI ,.zeAAA-Y ,,A,IA.sI,., IA,I5-I5,II 570:AIgggjlgm-Y7I9A:AvLg:A:YYA:A:A'L.Az'.5:3wA:AEf1iAAZAY''k'Z551?iA5-5'if77L?IiA:QE14i5izLQikE7AIMEYEIQAAITF'gwIkE7E,QikA?,A+:1313,lszueziAff:L:5mvzzALA:eivfL.f'' .w?iwisi7L.s "W 'i?'Lf-f':YT'-"1YYY'V' -1 QIAAAIIAAAAIKAAAAAIAAAAIIIA-,AALIYYAAAQAA-AWLAMIAMLAHAAEIAWISIQ-I5AIAAIAAAS-YAIAAAAY--IIwIWYIII - Agqgg Mg-YsgglgggfgggkgggzAAggAg33AAA:A:jg,I:e: z,1AA3:3jA Y QAAMEYQY Wiggbim Mjiggstfgg vgfggfsggg,-21115:-ZYA Iv?fYllsf7g!Qvi'f?Lil5E? -9VWL!!k?TE5E527215157215 iifkzw'SYS-Wi-71552523E727.iLf!EEZi3 --if:LAST252:iAf44ETikf7Q.i5E?2IQz:AmiE7Sis2'iZ.fisAp ,AYLZET---ii1T"?7EE'L' 7 'Til IIAAAIIWII,AIIAAAALAWISA IAIIIIA, AAIAAA,A5,.,,AA5.A A, W, AwA,,I,IIII,,AIII AI Im, ,IAA IEAANIAA IIAA,,,,AA,A MIAA ,ALM ,III , IIAII, .AAIIIIIII AAI, ,. ,A.,,.A ,.A.,,.a,AA zAfA,Y f.A A'::vz,:-WA mu-,Y :fs-YY,:w Y-Y Y Yz Lv-me-Azz" ,,'YNew'm,A7-QA'--Sz,'w:'A . A2zAAa3A:s:Aim-1A:eAYY4weAYY sv'm:'L-SY 'M--wh 1111 - -Y-YYHYY AIAAIWIAAAEAAFAAA.AIAWAIIAAA ,MYIAAZIASAAZIIAAQAEYAEAZIIWIAAIAIA IJIAAAAIVA, 37715 ,,wz,::-YYf2L1rY11::5:.:',1f'-225QE2El5i4?Lifqlif7??3i5i51fi LLJWQZ 'AAQYA A, A..,. A, 3ET5EZf5?IIiifA1S2f2,qg22f'willawg AA'z:',x-5Y.fQA:fY.l, 155921ikEL:5iiLA:51iifYi ::f':EY:,:A25515215:2:s7.vI5AAAei1:L.YE:,, vzimgz:f,sz:m,:z:vY:s:-YYA:Aa-inmai:',:A319:iAA!iiEf"'A-Ya 'HYASZQE' A-"'2J'.ll 'i' Siglzgfjlfza--22.31 'EiiAA54"-"--9771 EIA-2LiAi??9Iis?'L-TEL-f7Eli235?iQA'LQi7'1Yf'- 5:2214 bS1iLi,1i5I?ai'iZiQ:? -viYLi5UQ:fi7.5?'f A4S5:5cL.1QY-Kfi "1" 5" A, EYKQEYLWE' -n'.iwfLi5ilz, -YEQLiTLAY2giEAQf715ii'f1j,lS5Y'fTWQWLST fvbiiiivliiiif?iiYA?YA5?ei'Lf5lkE7LA5sE?L5',1fhiiifEI55E?a5ET3E9LISZLSAV'?55i?EAEAk?L!iifTQ?',f7E5i7z57f57L5?iYi5?iZiLf5?Ef47E51kTf4!5i72fAES5i?'QEQIQA-EA iii-1' KKYAYYYTS AAIAAEAEAAI A, W III IW IIIIIIIIIIIAISIA IAIAAIYLAA, 5AIInI5AIAIII,I..,A I AAAIAIIALA IIA-ALAIAAAIIIAASA-QII IYAA.I,55Ah. AL ..,A,AY3.,LI.YAAgAI..,jg.III Ifjggwggggflgi35.97'Y.HA1z15:7z.:LAv2t1A'- lcxmzi' :ugxiwxmxv'ug-It'wi'Aa4'1z1Yglm,aTs1:-111''1gw1.wL:LA"2,s.-:nib,,'M:,lfz::Aez,,ZA:v .AwZA1'xl:Yi,::f'Aff2E'Y ' ---iii I-YYY' - Y QAQEAAIAAAAQIII AAA. A 'I5gM:IIZggQ3,' -f55,AgmY::',j33I 1353, j7YAiEL--' 'H--J-::'Afv, AfYQ5512552ipgiglggggvviggg-1215 522' LE?LAk2Ai',-fim -2,22351555-v1'Iggfvi As:'?i:sey?ET5:TiYiikiiglikifk'-, 5ffEl5"iY1':TQYEZeESS??5f7EYlis?375551562572iafflkisiiizkiliiiikz 7- .AYZEEQQMA''lWEAiAif'5'Z ' 2-,EiifSI5zfbV7TiiAf-" "A K' M' "47- ,A,,AAA,,AAA,AYA, AAA, A AAAAAA A AAA. -YYYAAA .M-Y A, AAYY-,AAAAYAAA ,AYAA AY,-Y, A,A,.-AYA-- , ,AAA,Y,A,A AA YAfY.AAAm,, YA.-MAAAYYAAA-Y,A AA-Y.AA-YY,.A, A.A,Aw--YAA-YA.A,,YAAAY-YA-YYAAA-SYYAA-YAA-AA-WY--YAYY.-A--YYAAAfY--- YY Y AAY.Y-YA YYA-YYY YY- YY AA AIQIIAQIHSIAAAIQAIATIIIII IIAAAAAAAIAHI FII I575Igw5Ig5gIQAIIWAQAL. AA,I,AI,, I5I.,,IA .AgjL.qAg5Av3A33.yLg515gg5Al5I5A:g5AAYIIAAAIAA, VAR -,AA,AAA,AAgAj5.I,?ggA.sL55jfIA5II 1:ggfbgggggggxglggxizjg. I A-3 AA-39515 -W'ffm'PwEA:wE:LA'2E:fAf2?:s:YALz:LAei:fQQEAf?AAfLA3Yi'.:izVl YA.A, AfA:fA.2EA 457: -5215 ,'L,ifx?if7QiL.,-MT.: f 1W7EEEE"?E1., M' ' ' YY AIAAA?IAAAII,A..IAAAIAIIIII I AAI,IA.IIAAIAAAYIIAAAAIAAAA.7IIAAIAIIAMAAAIAAAAAAAI .AIAAIA,A. YAIAA,-SAAAAAAYIAAYAAQYIA,-gmI,AAAgg.gYIAAgA ,Af-YA., --,gyAAAAQAYYAQSY-AA1sS2fAt3fm -YAAAYY-iws1fAAA2z?AAY1A AA-Yi--tm--1 Yewffia'YfiiAEQifAfQi?LAf'fswLY2ii!f?fFY?-SESYLMYYTN YYfFfYiLi"Llfl4zf' ,A.A--2geA.i' -fYzxi,,, AAAAAAAQIAAAAAIAAAA-MAA II 11-jY.QgggqgAegggfgwgisgsii:ag.fA'sz:A:Y'm,Y1aigAfz- I:zzAaiWivA. :zvfY4fA21Y, Q3-EAW2559eYYEL4Yie1A.sA,wgimmeA-12A-fizweaeA47AwAAwLEW-iff?QL1fiiT4gf'gfglfAA-YAY AAfY,,, A,iz.sasIA-ezf-azAsAY1LAe1AYizAYfY1ALA1Qz?i2fsiiA22aei'.wf "-fi-f Aswf-weQAAWAYS:AimsnewAiYizM5?Yi52if1iH'YYfefk-Hyfwifn-52LYSLY-P1122iffYY4422YWAYfi-1ii2'LAY??s1i2Y7Y2wf1fe-2YWAYA-4222-ff-1-YYA Y faim, fiA:ezzgg25TA'AfY'A2151-A' 'ULYY fgfmgesg H Ffiilkzfizz Z-E273-1 -YYA5QS17Y:QE:aAiQ55f?7lQk5??iQSf?7ii'?E?EZl5::i5'XTiQsA?7Eih YEIHL-5': " ,YEA AQYWITLSSEI.ihi??i57Zi3L?:19?i:fs3?7TiE?iLlEf4YA5iA3 if-AAAS'YYf'55ASSY-5157551531155ELF:-71ikE?2SEiiE?ZZlQk3i"7i5?E3i,p53l1i?L-fi-Wi :5E7iibY'A?f'EY55LTi,:54G775Y7F75559W375"f5IlLWZ9F5ffY955555535571513515'M' 5115515-75iE?',fA' ""2EE'EiE7LEfi zAfLSiZ52i'Ei2'iifA, -IIIIA' EQYA-wg-YgAAAA.,AAA-71 ,I .A,IAA-I5 .IMAYIIAAIAAAIAAAAAZAAAAQEAAAAAAIIAAAAAIAAAAWAAQAAAIYAAAIAAAAAIAAYIAAA HY-YY-.Y '-"Y"W'?15-- -ifL7Q5YfWFli5f'?-i", AQQAYAAAWAAA-,AAYA-w,-.Aw AAA-YA-AYY--QAAAsYAQAAA2AA2A1AaQQAAYAQAAYYAQYQAMLAYAAAA-YA-A,A :AYAY.YY:AMYAAAQAAAYQAAAY1AAAAYYAe:z:Ae,-mmYzvAAseAs -s:Y'A-YYY :YY-SYYY-Yi:sw1:12-A-ReefAw2QYYAA2QA1512Y1AAYzzszgf-MAAA-WAY-Y YYa-wwA-2-sf5YYYYA1wYYA.A-Sw-.2-YYY--YAY:YsYf11iAfLf:Aw1?zAmf2AYzA-'YewffYe2A4.mAfwAYA,1AAeY:fe2A IWIIIWI IIII,IIIIIIAII,.A,IAA AMAMIAIIIWAAAIAIIAMIIIIIIIIII,AIIAIAMIIIIIIAAII AIAIA.,IA,I I,IIAAAWIAAAImWAAIISIWIIIAA,IMIIIIIIIAII IIIIIAAAIIIA II,IAA,wA,I.,H.AAIA.AIAA..,AAM,,AAAI,,,A.AIIAA,.,IA,A,Y.,IAAYA,AAAY5gA,AAfgY5-AAA-,AAAAAA,AAAAQAAA-,A4S,AAAAYAYYAAQ-YYA.AAAAYYAYA,YYAAA-YA-Y,AAA-MYAYAAAYY.A--m,YAAA.Y-YAAAAAYA-Y--YYAA-AA-wxYYYAAAA--,YA AIAAIIAAIIIIIIH Vxii IAA., IAAAIAAAAAAAAIAA,IA,AIA,I,IAI,IAIIIIIAAI,IIAIAIAIII, IAIIIIIIIIIIIAIIA MIAAAIIAAAI,,I,,IIAIAA,IIA,IAAIWIAIAIIIAIIIAIIIIA ,IMA ,1.1 A, IIAAAI,IAAA,A AAAAIAAAAAA,,I,,A,,AA,AAA,IAA.AA,A,,AAAAA.AAIAA.,.,,AAA,AAAA,AA,AAA 111. AAA,AYAAAYAAAAAAAYAAAAMYAYAAYAYAYAAYAAA,AAYYAAAYY-AAAAYA,YAAYAAY,AA.YY.A.YAA-AAAAAA-YAAAA-YAAAAAY AAAAAA, MA-AYYAAA-A.Y -- ,A YY 'LQSZAWAA-Y2'Z42E22.4: iii--25iwAan-f'V'AfY2AAAYiLY:1fA,Az,YAAAAgAAIAgYAAAQAYIAAG1.Ye:AAAsYv:eevz4seszfAfzAYA3AIAAIII .AIIAIMIIIIQIIIIAIIAgA,IA7,IIAAA,MIAA-AA5YIYAAAAAA A.. YYAAAAAYAAIAA-AYAAAA-IAAAAAWAAAAAAAAAAAYYAYAA5AAgAAYswA4tSymA1zAAA5szAfAAfaiA-YYYx2ASYAs-AA22YAAesifwgas2'1AQi7s14esA521An?wills?-ifeiYAfQs?AY9iLfY422755215-fix-lYYwfLifTY11Yifwififwlwl v'2Y2iYl1'YY AAIAA..AAIAA-EAAM,IAAAAYAAAAA?-YAAAAAYAAAAA AYAQAAQYQAQAA WYA52-Y.wi-,WA-YSIL-f .521 YYMfzifszfgssfzfvwif? -52ffJa?LYPifwiQL-Wiz? ,,'Yi'.fz: ,IAAAAIYAAAQ-AA -f2iT'?:AYT' AIA.IAAIIAAAAAIIIAIAAIAQA I IIAAIIEAIAAAAIAA.AIIAAIIAIAAAAIAIAAAAIIIAAII A,IAAAA,,IIAI,IAIIAAAAAIIA.AIIAI.A,IAIIIA A A ,AA.A.AAIAAAA,IA-YAAAAAQA. wAzAeYYAA-z.YgA-YYAY- ,,YA-YAAYII YAAYYAAAA- I IA AWA-YAAYYAAQAYAYAAYY-AAAsezAAAzSA.Y,mAe-me-E1eAY:AAAiwY:eiA2zAfs:2z1AstiLsLsi?zfYviAwf1gY'AYzfYfwYffYYfYfYYwv'wvl-Yrs-YY :WY--Y-YY-fi-YHRYYYSA-we-fWYY2':fs,-f A- LAKSEIQAAIII IIAILAAAIA AAIAAIYALAAA IMILA,A-IALAANAIA55-IAIAA?ISAQIAWIIIIA SE, AAALIIAA II ,I ,IIIIAIEAI ,, A, .IA A, IIAAIAI .IAA5.I,AAAAA,A!A,,,.IIQA5.,AA55I,AA-YI.AAj5A.I,IA.A3iAg55f5,ggAA5-,I553-A55gp5Y,A,nI3YgIggg:5fA3q35Y:qAg5gAggZA:e:ga::ez.3:5UzA.s:YYsz:f:A?z,:Ln22fa:wi5YAEQk5'3Q.5'E1AS??55535552355?TiA:EL?i!E7iZi?Zi5i?E:Eai7'lGL-71i'- k?"?YlWEY7W-W'lla-WW--lib 3"-351' A3AIAA,,,,,A.AIII A IAAIIAZARIAA.IIAAIIAAIAAAAAAIIAAAIAI,AIAAAIAAAAAII,AAAAAQIAAAAIQAIAAIIIAIAMIIAIIII Y. Am-gA.A ,IAAAAAIAAAAYAIAAAAAIAAYAAA3AAAIAAIAAAIAAA5gAAAAAYAAfgQ,AA.qAYA53AIA3AgQAA3AAQQAAAjA3AAAAAI7AA2QA5YAAA:AgiAAYAAAAA3AAfA5gAQ25Qimigfggzg-YfAAeY:zfAzzAA-QYAAQQAQAQY155,. HISALIIIIAZEIAAEAI AAIlIIIIIEEIIIiIWII,IIIIIIAEAIIEIS A, A,A ,..,A, Y,.IiiIIII..AII,I.,, ARAISEAIAA?IfIRAAAZIAAAAIEAIAQAAIYVIIIT IIIIIIIIIIY A?-,AA I II, WAY -A I II 'II, Y-YEIi'IL54.Y-AA-Y-AES? YAYI IYY-Amy-SY:Ay-eLgLA.Yz.:5A:YY-531551515555gl3AgL5AAg3L.l21gYIgqIgg5A3gg5QggigQ.Qgj12QZQQIQQL-LEERSETi5:?EEf5f'AQiiI:2l9E'l .AAi?WL:5Eim3IU:qElQEL'7E1ZifE!i5i2Y Aj, :AAAA-qwYA.IAA,AmAAA.7AAIAAIIIIIA' A- AAAA5-AA A -AMA,-A-AYAA,YAAAAAA,,sAAAAAA,,gAA-Aw AAAA-YAAAYAAAIAIAAAIAIAIIAIIII. III,,g YY Y ,AAQAY A AMAA Af fssggg YY' , A-fYA.atzgzf'Y-tAAAWAIYQwxA33A5Yzisssmsi5Q22--22Y195zAAAiizi?A1Y2Z-2234-52fzisiifv-'W wwf."mezA?As2zAze'EiA-W" :AfA.YAAAffYs,YA.ifs?A-- A4222fsfizlwifwfiatvgiaAefHAiA5isEAsAAYASAAAAAAAAAmi---fi...,.: A ,f KA Y ' -, Y 2-ffY'-2144212225A-Ygs2i'A52AfYfw2'gleam-,YYAYA-Y1EA-i..5:,,f' 112 '- Y- AY' -wif 1'-Wsvfw-mv'A155A-YYAAAA-YYZQ-1.3-EAAQSfiYAfePA.A -w'73Yg1,zf,fYzziAfg.1AYY 'Y ggAY,I,Ag ?:5Z5:"iLsEf'?7.ik1Qiikifi: A.A,,.u:z, YS-egg,-,AHSAIBSAIA Y I, IA.AYAy WQAAAIIIAAA IMIYSS.,EAA-IWAIAIIIAAAIIYI-AYAA Aa, -Y ,Q 'A Kg .,,.5A-3539 -H A, , 115:21 A'V'-"'M':A11A'm.v3:m LA-YA:zrfffzt:m:21.1az-1AfzmAvz::'l.,,Yf.f ii'-9 ' V YY li-'Hi 'Z Y ' A, ., A ,Y'j'Y 'i-"Si'-H1Yl-5Tf55512'Af- "wAg'Y"Y:3i,:A.-it AYwe:7,s:: :2Y,s51YY15'A APY-ff:-.AAs gYY.sz:A4:ezm:YAs,i A :L:TY.:A:i7Y.s YL- ,TY-SY In-Y-if'1W11asIA1StA'-YtAaeYYAazxs,Y.AA, AA.. A Aw-fig, " L A A Y smgvt' : . -1,115 zm -Y -WA'-vz::A-2zAsA Y. :L5v,:gA:Sz,.E ,Mfg-SY YY--YA--Y--YHA-H' 'U ' 7' me A .4 ,A ,A I IA AA.,,.AY A.AAAIAI,I..A,,A.. ,IA A,.. AQLAQAYAQAIAAALAAAAAYlj,AAs3iaAfg5qfE eta-YgAaAwgaiZAY?g Yiifiigslzzffgi A-YY.AYYY.Y,Y--5-.AWEAIA-QMAAAAAAAASAAIAMAA,-,AA,,A.A,,AA:A3AgA, .' LA: .A-sm: --wr ,Y A A W9 ik? Yftfili' KAW,-Y,AAAA,AAA,AA,A,AAAAA.AI.AA,-,A.- YAAA-,AAAAAA,AQAAA-Aw-AAAAYAAAgL.AIA- AAAI,--YA,--IIYYY ,Y A, A, . AAAYAAQY- ,AffAA-fY.Y-YA-Yff--AY.f-YQ.,,AA'A-42212-fA.AeYY-.az?AzgA,,A1xA",zifAAY, , - Y 'grviw AYAYfAuQ1fQAAAYaffzf211-twfew A, ,YAAAAAY ,A.A,.,AAA,.AAAYY.A--YY..A-AA. AA,, AA, A-, Y AA , I ,AAA,AI., A. ,A AA,,,YAA . YA A A AA- A-,AAA AAA. A, ., ,, A. , . ,, .. AAAAAAYAYAAA--,, A-AYAAA -YAA, AAYYAAAAY -, AAAAMY-YYY ,, V' ' ww--YY AYAA-AY,AA-YY.AAYY-YAAA-QwAg.YYAAYY,AAi- 535-QAQQ, ' ww YY A .,,AA-AYYAA A . A -1-Y-wsYgAYg, --AAWAYL --AAA---YgAAeY:zYYAwAw,,:AAA,,.A.A,,. A ,Y Aw AAA,Y A -6 3 AY ', ',--YY-:Aw YA. --mg QAAQAIIIAIIAA-I,AA5gvz1?f,zfA,:',-sw'Agzgfafiwzfizsiisf Lf 1 'E , A AA YYAQAYAI Agfweige'-AAAAAXIAQAAAEI--gsg,2A,,Aww .Az:AAY2is f fY: esZAzs',Y" 1' Mfzfw :WWTFW-ifffl-4vTiIQ2'iA2fYe'AAsYYAfA,A?AA2g.,AA,.,A',A.,A, Av' WY" MWIIAII ,IIIIAA.I5Eg,IAY5,.AA-Ig.A,gA-735AAYgA,Ag-YA-AgAAAI,AgAAA,.,,ALA A AA IAA AMA A. , AY YY AY - QAAA-YYfAA AYAY1q?AA5g?iA2i21Azig517A-e2fA-Ygf--AAA.,ifA. ,.A-fifezf , ', - YYAAQYT LW'-Siff'-?Y'-Q-?L2','WSW'leiLYg51ae2iiY.4QsAAAYzAfAYYA.s-1AQi4A- A ,, YA Y:-'YY. wr' ' 2 A A E ' - YY QwAhi7:AAiLA:7f553211555gi''gifg'AgQAg3jgg:Izg5,3A5-55Ay, AA. A 5AAjIA, 'A Qgfj A' ii sew, 3. AAAj:I:I, A- 3 z" ws! AYUE-YAQAVAALASETZASYZWA,ESkifli-ifELE-zfl5m5i::A-:A , iii' .AfYAY AAAS? Y' 9' A5552 Y af A A' T WT 'S' 'ESV 'l,f2SE"-2?'ibfiiiijisgizijffgjlgiqgiajsyf93575599-Y7'LMA-,L.AAffAfY5i1'Ar9?19 6WY'Ti51fI55?',,A 2:5211 :Wil ' Yi--5-,,, ,S ,, YASAA-AYAYiYY.Aes-L-Yi-SATA,1eiiAs,1eQgfYYsegYA::AswA4AA.YAg2:AwYYAmA,YAAA-,AAYAWYA ,YwYYi.eif-Y' --wz'fY12is-YY'YW-sGv14Yw-Y--YY -YY :HY-feY1'f21YH-M1533,5-AA,-wgYA:qAgA-w::QA-YYAgA:YAf:A:AAYY.Y-.g,f,:AAAfmAYYYfAe-'YAAA- AA2,AAY1Y.a- YYAA--YA,AA-AAA.A-YL-,A ,, . Y Y Y -Y ' -AAYYA AA YA-YYfAYAA,AL-YY::-- .A,AAAsfA"A1AfA-, -f1'Y-AfYY.Aa,-fm. YAAQYA--.AAA Ang. A,SYAY5,A,5-A5-.QAQ5.3, YYs5z,ISg2I..,:gsgeAgg53gA5AAY-gagAAAggAg5yAYAYIAAYAgAg A -awk II ug ATIFIAL. YWAIAAA.AIAAIGAAIAKAASAYZA,Aigy ,A5,II,AA,IYb,L,I,YA.AXAILIAA YI.,AI:I:7,.,gfL3,A5Af3,.g5A-YYQQYgAq11'sSm A'f2z1A"wt1zw:Z.s:AfAA:u:9?:4:2ZA:LA:ez.x-:.iAA4:fYY.As'Avziig-wlu'YAIA-'A'..AE:..,A ,I " H Y?-15952.51 A., ym AYYIAA IAA IAA' I YY :Y .A mI"YY,,,A Y YY' 614--LA Af 'AA ' """"xYi5'Q WY' sffw'-53YAAYt:A-eA:A-AYAAA-vm-YQ.Aezie:?YAgfsaiAAQfAAA22AAAAefZAYQ15?s22YAfAffaAYisYYfAezsYsszz:sAswAsYeA-:AAA-iwYY:A.AA-YAAx-AA-AYAYA-AY:A-QQAQAAAAQAA- we--YA-YY.AA,Y,YsA2AfY2YYzf ,fe 5":e:.zzAA.A IE?2,i3iiQ3i3?Aii5?7515393192A335i:iLGiS?L51lif27!LiWi5i5'5fzv . WEE?iQf?iV?lF'2iSAi5357i5vAAA ,Y:s:?Y.fvi735iZA, YL. ,AV 'EA " Yi- ..: I ' - Y A MSS?'E7'W'T"45i7li5"35-5277'TQQEYTQ5fgi:KggQ2?45z7Q?S3f?Y5552552555555252557ILSSQE'-535973-7LY1lsAzf7Y. A.?Ai:i-if,E'E1QE'7Ll5E'li5AQi'fAi5':Sf25?35'S5-191373-9f?7lf?i19ESki .f:397E's T15 A "':f'7?WfizvY ""fEAHl"' K 'fi Qfi1A271AAAAYs2Q25YK11QA51AQ1AYHifY2wi-Q15Li5lffiff'w5A?w A 4 ' Niggas- AA , zeal YY -2 :AYY Y - AYYA ' lfvwzieaz'VAA2YAf4A2SAQAA-wsizsfesfzssafW-QA--1.Y'--YAsw-f'YYY-Y-Y-fvlwvYMYY2f'i2f7'l4Yif7ii'-wi.YLSYWY- lffwif-f-b' YY-IH 'YYY'-'1YYf , A ' ' " .. - Aa - 15AAAYMAQYQAYWAAA-YAAYAAAAY-AA.AA.sAAAAAAAYAiYiYAaxsSY Aew A-A A Y YWYY- Y Ae - :AA QYAQQSYQQYAAA A fYaf'AfYi'AaYYv"YYssiY12-YYfSYYA- YYAQ- AAA PW -E Y- i 2fffK"W'Y?''51-2-iffff25W5MWfY iff-M-SYYL-Y MffifqvAY-'YH-'Yi YYY-N51'fQ--YM-''FY'-7-Yf-Y "M-ll-YYY Y QEAAIQAAAIIQAAIIAIAAAAIIIIQIAAAIIIIAA WAQ A A AIQEIEIIQII I AIIISQIIQEIIIA Ag I AA my AAIAEAAAAA IIAAAAIIMIAAI3I5I AA?6 I, i n IMI II ASI IIAA ,, I , I AYAYY Y-WY.A?AAsYAAAAg3AAgAAYAAA-AAA--Y,AY4A1AAA,,YA: .Ag'AYYifgAYA-zi.AAg.4wz.AYYfAmszm Am--sv:AAs.Y A,Yzfz. :5Q2zs2YA.AgzAA-AAAAYAAAAAAQYAAAAAAAYAAAYAAWLAQYAQAQAAQQ -A -AY I mfg Y'-'egg ms g 'A Y Y?AzgIYY A A A - AMAA,AAYAAAQAAMAAAAAAAAA ,AAAA,.Az2AA,x A' A -Y mea S ,Yge1AAs:YiA-LYYAAWA-iiYYwifA54'ii-YfYSTQYQY-fiwiiiwffflYYffL-'M---Yi 555412 A,AAAANAAAAAAAAAAAAAAIAAAAAAAAAAAWAYAAAAAAAWIAM Y AAYAAAA Y Y Y .A A.A,A,,AAA,AAAA,AAIAAAgAAg, - Y WA A,,A,AYA,A A AAAAA,A,AAAAAYAAAY-QAYAAKAAAAAA-YAAAWAAAAIIAAAYAAAAS. , AmAAASYAfAYAA.Ae-YwawseAwwsszYY'YY'ss:gAzzA:A-Y:YAA,A:Yw1YvvY1YAY'1A'YYYY1-1 ws- AAAYAAAAYAAAAYIYAAAAAAAAA-A,AA,,.AA,,3.AAAAAAAAQQ.,SWAAUAAA Y A -A .- ,.f-.Y A.- AAAYYY Y Y gf: . wx A, A- AQSAY - AA AAKAQYAYAAAYYAQAAAYA AAAAA1 . A YAAQQQAA A AA QQAYA , , YY.AYAAA.w.eYAAA,AAnAAY:aAAyYA,:m,AAAAJ,AAA-,AAA,AAAYAAYAY-4Y,YA--YYYAA-AYYAYAYAAYA-Ag-2YYAAeY.QYPfYYAwAQY-Y'A-Q-Sf-Y1-SY--Yvvr---uvvws glgms-MAWSYA-A,Y,.A5As.qAASg,A,AAg.,AgAAL.A,xAi,3,E1zA'g,,e5 Am r A , YB SQAAAASAWA AAE- A A A - .- . I. ,: .- A 'fQYg- AQYYL51 Y"Agw'w fw1i.:A,xAs X -pf'-IA: A A5454 K YY YAAAQY 5, AQ A Y 'Y' VA' ' A M-ff" elm-AfzvY'fA,xA,15w,:AYAw1s??fwY-fzzAm:A'gA:vzA57YQA'YYY-1-SW?AM-5sYYYYlbFYlSlSYLf''W-11111---fliwY-lflfif Y- " AAAAAAAAAAI,AAAAAIAAAIAAIIAQIAIIAIA,A,A,,AIAg,AIIAAAAsI I AAIAAAAW BI, II ,AA ,Agn AIAY. ,A.AA,Y A AA .. AAAYYYAYYAAAAAAA -- , AAYYA , A - - - - A -. . AAY2zYAAAe A MAA-YAAAAAAYAAQAAYYYAAAY-YYY.Y-A-WYfx-Aw-wYYY1YY-AewwwwAYYMYYYYYYYYYAYYA ,AIY,AAA,5,AAAA,AIAAAAAIAAAA.AAAAAAAAAIAAAAWGIIAAQQ,AMAA , II .AAAI AAAAAA YAA,gAYAA.3AAA,AAAfAA,AaA AAA Y MA A - AASAAAQAAAAAQAAAAASY- - A AA, , - A A AAAYYAAAA AK-AYAAAYYAAAAMfAAYYAfAwzA-L.2A-TQAYAYQ-As--E-YYYWffYYA-2-Yfaffl-W--ms---KYYSYYYIYH-Y fSAQ?15fF224AeAg51mfilf:1sff'-vwfSYAS9FEiwYS7ffs6?ff-ff AA wp A .ASYF H Y A , Y 5 AAA? II AA I AAA I I I WAAAAAAA AY M. AA AQ ,- .-.II- WY W --YYYYY QA-mAAfY2fA1gs4-AAIAAYALAA,UAAAm A , A A WHA, AA 4iggfxgsfAgAg:5Aw:AA-f:Y:YAg.gYAme::AYKAAAAAgAY2AAi'Af4es32'24iiLS2QAw421521121AA2s44AffAA4emfiZ4azMA 55Agg5ggIAAAAIAAAAAAA,AAIgAAAQIAAAAAIAEIgAAA35?iI5AA I I IISAAIIIA A AM I . 5 A I II 2A5 ,gAIE5 ,, 5AAAIIIAw , AIAII5II I III II QA, Q5 M A A - ,YAYYAYA-siwggggwgxmAfA,AAAAgggAAAASA.gA,AgAQYAEAIAAQAQAAAAQQXAAAYYYAAAwere7gmgzzez52Q1giALAsb2fiAfgelA2A52s11aYm:fAiii1gAAAYwifY3225-Y ,A YAMIAAAS5I,.mxgggggkfb5,S3AggAif'5?5fS1f39!S-A ymf .w,. .Ps Y- my W- ,A5g,,2g,YIg5AA LAIAAAAA A I Im! A. .5 ,YI IAQI I ,. 'gI: A- -x x -bf. -szA AAY:x A xs:A- AAA .f ..":A' A. "- 1'- . A A 'f-I A Y 9 g 1552 ' YY YY 'ASH ' in -T Url- ix? i?':,A:'i7iQiYAl?kiWii?L?55i fiiT'AiIfi?9YATTYiSSZlSYLYZSY51S4S"'-SFVYWTT'Y'T'iT14P2fS-YV AY A Y YK s.Aqglsssliisgs'AwiQ213s1A:Aii1iLE5Z12:?l4Siw5WSxL? A 7:5 2?3fWsfv?WiL,E1-915,AfxiAA,ri:AY'.fE1L3A2125A753255-i-WWHQWWVSSWHY 5E'x'4S5"'WQf WT-A9181 521 '- I AY MLSA 'Sf -Y 4 4: -IEEZA-53 'iw A's1AV1S'sYYi3S5?7-?5zAi59iki:i?2ii'f2?T5+59?E99f5V?LY51?VAQYlWAQ- A Y- I YYY-A A A A ?xe3'31Q321ib?5?593515Ai?is?f2iAa3?im5Yi.AYL:1?Zl652255NES-15216YNY?-'WFYSS-'YZ'19-91215Y11 ,AAAAIAIAIAA.,AWAAEA,,AA.AAA,Ash,,AAA,AAAAAwA ,AQASAAA AWMIUAI MAA.,AAg,A,.AwAAAA5,A,A,A,AAAA,5.,AA,IAI,A,iAA.AA AYAHAQAA ,AQAIAIAAAI3IAAA5gAAA,A,AAAA.AAmAAW. AAAA ,, II ,II , ,I , AAAAA IAAAAAAAAAAAAAAAAAAAARAAAAAAAAAAA,AAAAA.AAA,AAY,AA.AYAAAAAAAwAAAA,AA-AA.AAAAYigAmAyAA5A YAAAA-AYYAYQA-AAAYYAMAAAA.-AAAAY-SAA-A-SYYYMAY-Y--SYYYYZ-YY-ESM-YY---ww-ff1f1wYY-vw-Y-ff AAASAAAQQAAWZAAAA,AYAAsAAAA3A,AAAm,gA5AAs,QAAAwAAY,A.A,AAA-5 AAAAAIAAAA5AA,A,,5AAAAgAYAAAAAA,AAAAAAE-,YAA3AAgAAAAAAAAAAAAA.2pAAAAAA AsA,mg1AA,1qIgQAnAq,AAAAAAg AYAAAAAAAAAAQYAAAAAAAA AAAA AAA III AI,,AAAAAA5AA,,IAg,A,3A,,AAWAAAAA,AAA.AAYAAAA.A-AA-A-YAAAAYAAAAAAAAAAQAAMAAAAAAAAAAAAAAAAAAQAAAQMA-AAQAAAAYYMAAAAYYYAYAYYAY-YAAA?2ssYewwAeYvswY-YfwwYwYvYfY'YYYYfY'Y1YY2-215-K-2 - A-AAAAA-AAAAA-.AAAAY-AYAA-YYA AA-AYAA 2: AMAAAAQYAAAAAYAAAA,qpAAAqAYAA-AQAAAASYAAAAAYAAA-YYAAAY-wYAAAMAMQWEQYWYASQS awafwiwfsfssff-M1'-MY'Yi-Y-fQ1HYYYfawYazY-fag Y A - WYA-A-YMYAAY-AYYAAH:AAAAAA:.AAA-SYAA-.WY.AAAAAAAA-YY,AAAAYAMAYAAA,YAAAAAAAYAAAAAYAAWAAAAA-AAAY-QAAYAAYWAAAAYYAAAAYAAAYYQAYY-AAAAYYQAA--WAYHAAYA-lg-A-A1-YAAYA.AAA-ffm--2Y1A-,AA--YYYYA-, AAQQAAYAQYAAAAQAAAAAEYYQm5Y-AA-2-AAYMA-w.AA4?fAA Y'-AWAYYAY-Am-AAAAAY.Aw-AAAAAQAYAA,.mf AAAYAYAAAAAAYAA-AY.AEA-AAAAA ,wA,AYAem AAAYAAAAAY-K Aww-AYQY--YYYAH-A2f1Y1AefwYYAAsKfQY'f-mesh'We '?'w15iaww1SLw21fw- YYYA--SYAAYMYY-Y-AwYYYK-AYAYMX,AA-QYAQAAQAAAAQAAYAYYAYAY-AAYYYA-AAAASQAAAQYAAAAAYYAAAYA-AfAA-AsYYYA-AAYASIWY-AAAAQY-Y YYYKAAA-ws-AQYf2AsYYfYAsYAAYY:.ASY':wAYY.:AAYAev:AAm,AA AAAQYAAQQYYAA-YAYAm,eYM5AAAeQgAsY5QASTSQAAAss-kjzYY,.wwA-AAAAAAYYisgwiggfxzskuwmzwmips?2Q2AzAYf11wg1sY1gf511mf1ww-MfmggwifwWJQEAAAAAAAAAQKIMAQAAAQZAQYYfmfwYYNAAYYYAQAAQQQAAg91f5iA,YYqgSYAm AfAAKmYAAsYAAA5agALe-QYAAAYQS,wwfgglsvzwAww-AgAwAsAYAs:Agm-AwfAYi2w5YWAQEASAQAYAAYAAMASAAAAAMQQAMAAQKQYQQSYZSYlfa-svns5A4mewY'2wAeY-fsYYYHYYYY-wY::sYSfezwe A . A A AA- A. AA ,A kY.AiAA.AAS'.A2A2AY.AA5YAAAA. YYAAAA-AA-AAAH2AAAAAKQAAA5-sxrxwwfwfg-5YYAswAwAAf2YAfA2w,AY-sY.A,AAAY-YAA-YYAAYYAAYY YuAAAYAAA,AYYY,AA,A-AAAAAAYAAA, AAAAAAAAAAAA AAAAAAAAAAAAALA.A,AA,A.AAA,,AAAAAAAA,A .2A5A,AAAA5A IIAAAAIIAAAAAAIIAAAAAAMAAAAAAAA.,AYA,AA,AA,,AA,,,AAAAAA,ApAAA,,AAAAAAAYAAAAA,AAAAA2A.5A,AYAAAA,YA.A,AAAAA,AAA,AAAAAAAAYAAA-AYA.A.AAA A-AAAAAAYAAAYYMQ-AAYAYY1AA-AAQYAYA-YAYA-AYYAA--YM---SYYY wx,sw-.f,A-AAYYA-Y,A:'Yq3YAQ,fAA.Af-r:"5AwwwfAAwY,-Y.'5A2.AA-fYAA.'-A.A5wfAA::J.A4fAAgn,gAZuA,AYwA,wM5-Af-PSYA-YAY-Aim-ummHAYAXQYJYKYQmvfAA"Wf-YSAYAY.21:WSCWEZ-2'ww'M"-Y'-'ffA'f-sQY1'S-wwiffvgWwA'f-.HMTA.A3'."YY ALI,ISIAAAAAQAAAAIIAAAAIAAAAAAAAAAQAMAAAIQAAIIIIAASIIIIA,.nIAA5AAQAp3AAIII3,AAAGA,AAAAAA,AAAIwI,5,AAIA,IIIAAAAAAAAMIAAIAAIIIAAAAAAAIIAAIEAAAW5TNAIIAAAAIIAAM,AAAIAAAAAAIIAAAAA,IAAAAIIIA5,.AAA,.AI?A,,A5AA Awggg IQIAAAAWAAQAA,A5AgAAYA,A.AYAAAAA7M5331AYA,AA-AAA-AAAAAAAYYAAA-Agfa-AAAQAAAYAQQAAEAAA1AA2AQUL4AAAAQHYAAQAQLQQYQZLAAYYAA1aszYFsaaAw-QYQYYAYQYMHYYYYYYHA-YxfwwWHWY-HWY m4fiY1--MY--I .A,,AA2AA,gSA,gAAAYWY, IAAAAAAQAAAAAAxAQA,gAAgA,MAgA,:AAAANAAA. QQAAAAA-AAAAAWAAAAMAA,AAYWYQAAQAAA,AAAAYWYAABAQYAHIWA,gmY1A5AAA55A,A,gvAAAAAAAAA,A7AqAg7ggAYA,YAsA,AYAEAA1AA Amana, AA 5, AAm.ss,A,,AAgAAA,,7A,Q5.gAAA-,AAYYAA.7,AAA-AAA5AA1AAYAAAAAQAA,AwAAYu4AmA,AAA1AA5AYAAAS2YAAAA QAAAYAAAAYY AAAYYYY-AMY .mise A9212 AsfHseeYfwAZA31s- ASS Yfilsza- Yumei?-Yffsfvss-H-ffwefIf xg?-YYA1I,g95iAsAwA,YYA3? SAAQYIAASIA55QAAAAAEWAQ-A,55eAggi1IA.5AIg3f95Ai5p35A55YAYYY55,Y5fA,YAWSYAQ-WYAgAi3,5AAL,A,A5gAA35ALQ3IgzA-Aagnwg,AA55IW,gQ-455AWYQQAAWYAm6AAAAs.AzA55ASgAAg,sfx,AAg,Qr4gfAgg:,, xg feexfgg fem5A,xgn-5215552155Y1fs1sAYA:fAA?YseiHZAQQAVAQAAA-wnsA54215-511235SA3'?'nfV5zrASW15?Z5SL!?TS37lSAF?51i-wfzliffiiiz'331-WEST!'WW'ff5?F?59'?1W151?5ZSF75'1355'T-55355555562555757753YfZ5l'5 52Q'5fL?2Yi?5J2'ZiAEQv'f-Sflkfw5Qis25SA5?ef?A2:3fqA.-?YQ'i2'-YSAM,EQAIYWTZASmis:ZIQ,i3if:?54TilffIxgfff-'?YI3x'fS,'s'2'S21'f'-'S-'55QHW3-Rifgfigffi-5?f'3'5fQe'-Gif?-5-'J'2YIQ'Yz"'SY2"W:W??'?'1553Y2?iS15f.?13fQ5'f"f'V9"f'5'S'f"J"L5f'fY5SfW'15'f53'fi:fYf"'-:W'Mg-WY" s'IAsAiLAAs1AS15af-Avfis 'mff,,,F'f 1155Sliffb--WAS-AHAAAA-213'A 'KXSx1'Axx 'xvnbv :ASAY A5735fis2:5ETif?'!,ilSiS2L1isY XSSAQSHQS A 'else 'Kam ffsz1'iA,xLwfA1SiWAZQ5 'VASE ?2kfA?ZS915fQi1sxYLfsvYY''Ass ueazsgmsv - vs g.:xs:AYAfivA 'ink A535123Jigga-YAS,jarYkfgsafugz:aA:AssAv:Y.:m:e2x:g5'21xvAgA,rAsA A1se,xYY,rxQfA3ii55iikf wiki''?ISf?7Q?W-351959554 1535 TL?f5'I37559+fTgS5?1L5fYVS'2-lfS1'5?l4Y' --SKSYXY-ffflis--M69YfS1Lis7r k AY,A,A.AA.A,AA,,A AAQ,AnAA,YA.AA-AYAAAA-AAAAAYKAAA AAA,-AY5,A fmAAAsAAALggAAAAAAAA. AAAYAAAAAW MAAAAAAM-QQ. -AAYY-QSYAYAAHYYAA-AHYYYAAAK,,AAAYM, fs YAY, AA.,Y.AAYA-AA.AAYY-Ymmfw-AAAYAAY, 4-2r,A23,AAAA,A.A,AIAAAA,,AAAS AAAA,q AAI IA,AAIAAAAAI,I,A,IA.,AAAA,I.,A,I.,AA,A,,.w,AA,AAAAAgYAAAA,AAA,. Y, AYAAAYAQ, -AYAAAA-MYAYYAAAA,AQYAYAAYAA Am YASA,AAA-YAAYY-SAAYY-ASYY -Y YYYY--YYY AYY-A-YYY A Y YAA-.AY.AAA.,YAYAAAA AAYA-AYAAAw.AAA..2YAA,,AAAA,,A.A.AsAAAA.A,YAAAA, -A-AAAAYYAAHAAYAYAAAA-A,A.AAA,YAAAAA-QAAAYA-YYYA-SYAA Y-QYAW-Y-AAYQAYQQ WAAMY-5AsYY-QYAAAYYAAYY-AQYYY-YY-A-YY-SYAA,-KYAAA-MA -91YwmY wfYMm--wzwYAY-AAAAAASYAAAAASAAAAY-YAYA-AaAY-AYAA-AMA-YYAAYYYAAS AMAYAMY AYAAAAYAWAAAYAAMAYYAA-EASYAAY-,AAYrYAAAY,A.AA--swMYAAY,.AsYAA-YY-AA--QYYAY--XYA-ws AQAAAYYYAAA,sf..AAf.A2-AAA,Y:--Y-YAfA- AAQQY,AwAAYQAAAAAQQAAAAS-swamYfsAYASAQAAAAYAQAA-YAg.AmfiAAmA.aAAA,YAQAYYA-AMQAAAYAAY AAA-ZY-YAAASYAAQAYY.AsYAAAAAAAAAYAA5??fsYAAg,p1,AQWAYYYAQ-215'-AAA Agfa -WaxYfeY5'1aYA?2Hs??A2WfW"Wfwmf'fffv'-A--WWfffW7"YF'H ieiwb-KAW-YlwiiwwfiYH?-wixfwfA-fliwvF21-AY-QYYAEQYYISKSISQY"ffASY?"WifW'WY-W-f'SYYYY"Y1'-YY"'-Sflffflfffl ' 2115255-iw,YAYZQAYeifmZ5'X.mr1ggtS'2Y2m57fsi1-f51zsx'fPiiaqYwAyz:Si1Q-21isAY,'fiAsAgflfgfvmsfk-91f5i2St:sAiwALA?11?zs35YE-Szifsiiifffixg YlXFY'Y-YIBPYQYSXAQQQILSUW-b5Yi2ii'Ai5L1sf52'i?1'621Ln3551S15g:,fi'?1 322"axis-S,X9f9zr5KQ5'WfiS55WS5gXISi5'iSS5'1fSiY?Yfii155'f1575352?A2f5AG552Q5Saf2711if5IQ51L93Li531SYQYfY5ii,iYYKY555ll2g5'li-992-YYISQVIKYWSWAK'HSSY'221157I21e5395i1LGas-Q?233535Z535FZSiA3EW451SW?w:fi5'1::f7T'WU l"" YYYYA--YHA ASYYYW.-MAAYMA-QYYAAQQ-AAAYewAAWAWAY-Yys-mb-YYAAYY-XAAA7 fmf:AaAYYrAYAYA-YAA-YY-A-YYAA-wMYY-fwA,AAAsAA5feYYngA,n-AAAAAYY-AAAA,AmAA2AAA,AA.Q.,A5,AIAA,A5ADA AIQXW AAAII,,IIIIAA,,IIAmAIAAAAAAAAAAAAAAAIAAASAAAA5,AA5AA,A,,AAAAAA,AAA.AAAAA,AY.A,AA,.A1.,,AAAAgAYAAA,,AAAf,A-5-AASYAAAYAAAY-AA-AwYAAAQAAA-MAAAYm2YY-AAAAYzYAAgAAAf-YY-YYAA:.A,Aw-YY--YYYAYYw--1Y211--wf2f1s- X1wwYY2zAwsAAaA9mAXAAYAY-AAAAAAAY AYAAA AAYA,QAA-AAAAYAAAYAAAAAAAAAAAAAAMYAAAYAAAAAY-AAAAAAYY AY-Y-.AAY-QSAAA-wYAYfMYY"fvY fwfi--?Y1Sf?fS1sYW -Y-Y' -'Yi-WY -GHAYRQYYXSZQ ffl' fm- WY Y-YYMYZY--YY-Y'-YYfsYYfYYSY'7ff--W Y'-ff''--5f-2Y1f2HAY2-ff1YA2111Mm-2'-Y-YYws-Y-wfs-QY-gf--YY Q-SSYYY-S-if-sY'fff-YY Ylffiwffm-ffYfYYfY-2 ---Q YA AAAAYYAAA-AMAA YAAQAAAAQYMAAASA-AAY'kwL?AYYIA-MAA,,AAAAAYMYAA-YYAAAAAAAAY-AYAA-mmmfsAAYY-.YYYK-SYAAYQ-isAQHYQA-YYYAa-?hAsElw,2jwAY-YM YALSAXQ-2'--YYY'-SY-1-YQ-YAY-LY1AaYYmfwY WYAQMY MRAQYYAYQAYAmy-AYAAA-QAAA-QAAAAA-AYYANASYYAY.YAgAYA1A-YYAAAAYYAAYYQSAASAASSAAAYAAAAAASHAAAASAAAYY-AYAYY-AYAAAAAAAAA.Y-AAA-2YAAAAAzsAAY-SAA-awAASYYAWQ-YY-:YWQYA-YAYYffv:AAYYA-:::AAYY..:AAYA-YYYA-YY1 Ygg1AfSQYAAAA-Y:siggSYYAqigAYAAAfwAAAAY1AYAAewAAA-asYAYPQAAYQAAAAAYAAAYGFAAAAAMAYAAA-AY-AYAAY-ASAAA-wefwYAAYgs-AAAAAAYAAh,AAAA,AArAAAA?AEAY -YAYYYA Yrgaz-QSQAHAYAAAKKAQY.AaYf1wAw:wY,gwgwYAQBYYAQAAAAAQBKFA-sA,AAAAAzYA,A,A,AAAAgAAAAAI,AA.AA,AAA,A.AAAAA,,A,AA-YAAAAA,AA-AYA2-AYAAAAAA.,AAAAAAAAAAYQYAAAAAAAAYAAAA-AYAAsefAAAAafAAAAAYAAAAYY.A-YYA-QYYYA-AAYWYQQY11AY1-sY-YYYK1AAfSK1A-Y4Y1SYY4Q1wfYYY--ww---wavY-2::A- AMAAAAAAAAAIAA,AAAmAAmS,,,AWAAAAIAAAAAI AANIIIAMAA AAAAAAAAAAAA,AAAIAAAAIAA,AAAAAIAA,AAAAAAAAAIIIAAAAAIAAAIAAAWAAAA AAAIIIAAAAAIAAHIAII,AAAIIAAAAAAAAAAA,AAAAAII,,AIIAA,AIIAQ,AI,AA,AAQIA,AA,AA.AIAAAA,AAAAAAAAA,AAAAAAAAAAAAA,IA,AAA,AAA.AA, AAAAA,AWAAAAAAYYAAYAAAAAAAA AW YAAAAAYYAAAY-AYYAAAQAAAYA-YYAAQA AAAA-SAAAY-WYYfAYYY-W-NYYYY W21-2-YYAQYYYfw----ww---YM-SYYY-Y A2sm.AYYYAggwAAYA.AY-AAYXBAAAASQAAAAAAAAAIYIAAA-QYAAAAIWAAAAAWAQA,AAAAAAAAAAAAHAQQQYAAAYYAAYAAAQ-AAAY'-AYfAvwYYYAsYAWMASYAWHQA-fAnAAf9Yffiwvzmwlwg'-WW-f'1WWfWwf"5'QfWr5fW?1?Y 'fffghfw''W'AMYWIIY-HYKP-2YYWWLY-WSE'-Wfsi-WYiw-2'v'S'1SSi'fS1Y5'Y1-Xffmwlfsfiffnffix1511-211'-211'M'''nfuiigiifs'-fifqfm"UW'f1SW'WSSKSY'-m""' -S' -Lf' sA1sYafafAAaAAs-AAgf5AAs2A21ngmaAAsAi2wAAgwAAAKY1Q1 AQAQYgQ5QAQ5AA,AgwAYaYvAAs2A.wYYA5:AYM2 MYKQAQYIQAAQQAYLQAQSQAHASAAYMWQ2?IAQisYYAiSQYY1QfHiA3A4QYAA2?as221iiAAf4SQAAI2SAYA:YH6Q211Q5HgaSfsi??f1S5wsf51wY1wiv ALYMYYYY -Sf A-SY WY if .5221 if 2S145w15af2Y1fsEw-Q1-YYYY -ww Kiwi :wif f2YYswfs2fSY AAS?-fi2i22Yise2Kus2gS'af AASQQAQQ-fYfYzYY--222 f-- Y-Av' AAAIAAAAQAWAAAA,wAAAAA,A,,AAAAAAAAAAAA I5,A,IgAA,AAAYdAImIIAAA5AIgAAI AAAIA5AAALAA,AI.,AA,A,.,Ig,AAAAAAAIAAAAAAAAAAAA.AIAAAAAAA5A,AQAiAQAYIIaA,IAAgAAIIII,A FAM,A,AII5AAAAAA,AAIIAAAAAAAAAAAAIIAAAAAIAAAAAIMAAMAAAAWIIAIAAAAAAA,AA,Q,AAA3,,,,AA,,A,AAAAAA,,,A.AAA.IA5.IAAAA,,.AIIAA,.AIAAAAAIAAAAAAASAAAAYAAA,A,AA,YAAIAgAYQ.AAY5AYAYAYA.AgAAAY-AAA,-.AA-AYYA-AQAAYAQSQYAQAQYAAAAAAMMAYAAAAYSAAAAWA-YA.AAAYfeAAAfA.AAzfA" ' AIAIIIAII ,AIIAA IAIIIAWAA AAAAA ,A AA A AA ,A A A A ,AAA AA, I, A Y AAA . ,AM ,A A A A, AA ,AAA I ,A AAA, .,AAA,.,, AAA,A, YAAAAA ,A A.,Y. ,YAAYY-YY.A- Y- -JY FFS'w'?'faY'-f"-'-S'W'?wfW?Y'M591-A5gQQH??-T59-'UYQQSA-?eA.5517,-A.s,.AAXAQYAAQY.M-EAAAAYYAAYAA-mn'wx-921'--ww liwf AYIWAQHQYQQHAYSS YAY-WAAS-SYAAA-QQYYYJAH--SgwA,:fA5AQe1A,,imA,1Y,A,,gI5AAg A,,,A, AAAAAAAAIA A,AAA,AAAAAA,A,.A2,,,A,.,A..A,A,.A,.A,,.A, AAAAAAAAQYAYAASSAAAA ,YASAAAAYAAAAAY-YAAA-eYAAAAAYA- AAY-AAAAA YYA3-YYAAAYYAYY-vw 1111 1111 AAA YA A A A AAY A A AA,--A ,A- A AYY A .A -A AA A Y- AY YYAAAAY-is-AAYY-ASAA f2YAAafmA24fYY Sw ISY-IW mxfsYY--Q-AA--fm---AAAY..AA-YY.A,A.A,.AA.A,AA, A,.A,AAA.,AA3A,AAI,,AAAIAIAIAA,IAI A, MAA AA,AAmIA,IA.,,AIAA,I WAS,,AAAAA,,,,mA,,AAA,A,AA,AAAAA,AAAAAA,A,-AwYYAA-YA ,A5,,5A,,AAmAAAA,,,A,,,,WIAAAAIAI,,AA,IAIA,AAIIAhII,AAA,MAAAAAAWAIAASAIAASAAIIAAQAA,AQAQAAAAIAAAAMAAAAI, AQ IA,AIAAAAAAAIAAAAAIAAA,A5S,?AqI,A AAIAQIAIAASIWAAQEHEA QAIQAIAAAI myHISIII2.A,9AII,AAAWA,AIIAA,AAA IMAIIAAAIIIAA ASIAAIIAIAAIAI I, II,A,I,A,AAA A,AAAIAAA,A,,, A2AAAAAI,AA,AAAAA,A,A,.A,,AAA ,AAA.,AAAAAA,., A,,.AA,A.A-,.A.AQY,A,.-AYAAAA-A5-.A-.A-AAA,YAAAY--AAAfAAY-fAAA.Y-A-YAAA,.AA 11111 MYAQAAAAA,AAASAAAAAQAYQAAAAYA AMAA,AWAAAAQAAAAYYAAAYKWAAQ-YAYQAAAKAA-ezYAaFYAQAYYAAYAAAQHA,A,AAAYA-QYAAYAQAAYYY-21AA-AQMQAEYAQQQYYMKQJSHQWYAKW awKf2YWK1"if'UK-WYW1Wf'2"l5fiZmifnffmvwg''W' '-'vfflfwff''S2'W3'f5'1'b'5'4Gf?'ff'fHfW2w'iW'Y 'WH' -'m"l"'4L'G'K5'Wwwf?"-flwwl-fsig'-SS-'WW' M i" YrfesghafAAAAYgfQsA2gAQYAA21yeY51YasasAYYAaAAAf'iYY,AAAAAs2AAAAs2-HSAAAEAAY-A,IY155-AQAAA.5:fYHAewgAAgAsv:gWKQYAYSYA:AYAASQQQAAAHAAAQA YAAQQEAQ-iii'-QAQHAYQAHQwieAYQAIGHQYLAQ-igfxxsairw fw5z4i5a5fH32ff135'M2Hifi-QW?1SfWf'7Y?fSI34E4ii2flfWifi -W'-fiflb-21-5'f2'115'ff5S35Qlffilsfw--iffffliililifWIN-YFMW'-fgifx6f1Yi5'2WW'ff'1's-M7-Y-Wffilie?'--fifbf-WY--PY'-f'V' AAAQA-AYYQEASA,YAAAAAYAAAYAAWAAQAYIAAAYAAYYAAAQSYYAANQQHQQAQQQAY-.5AASASAAYAAAgAAAAA,AAffAAZ-AQYAAAEHAQQALAQ21591QYAA411AYAYH8-A:5XSfaKI2319FW'S2K1fsA'1fi55SK11Q555'S55Hia15'Y5X'Sf'Y5mii1f?'W'bfSW?'W2f5'YWffsmlif'-W1-W1-fi-ff?-14-4-3-5312Q1fiY5?Wl-WW'S'-EW'SW5Slfwfflwflwlfif'-SY -f'4--MGSYH1fSifKA5lf21sY'Sff?W?-'QW iiflgifi'-5:'m""Y "H" ,YA,AAAAAAAAYYAAAAAAYAA,YAAAAY-AAYAAA-AYAAAWAA-QAQ-AHMAAYAAA.wx-.AAAAAAAAAAAMA-AAA.AAA2AAA,YY-fps-YYAAAAAQYAAAMAAAYYAAAAAAAAAYAAAA-NAA, AAA AAA.-AAAYwAAYY.AAAA-YY.AYAAfXYYwYAAMYwe WYYNY-QYYY-fwffYY--SAS-YY-YYY'---YYYAA-YAAYY-YYYYY-YYfYY-AYYYY--fYYew1A-YYYYYY-YY1fsYY-Y1sY-YA-'--YY-YA-YYf--YAY-Y:A-YY1-YY--Y:AMA--YYYAA-ifYYYQYYSYYYY-AY1Y-fYYYY-Y'Y--Y--YYY-My-YYS11---YYY-WYYYY--YY YYY:- ASAAAAAAAAAAA,AAA,A,AI,AAI.AAAAA.AAAA 1111 A IAM. A 11,1 AAAAAAAIWAAAAAAAAYIAAAAAAAAAAAI,AAAAAAAAAA,A,A,A,A,I,,AA AAA, ,,11 A,AAIAA,AAA,A AAI AAAAAIAAAAIAAAAAAAAIIAAAA A AIIA,AAQAA,A,A,AI,AAAII,AbA, ,AAAA,AAAIAJAAAAAAAIAAAAAAAAAAAAAAAAAAA,AA ,,11 A 1,11 A,I,AAA,AA,AA5AA,I 1111 A,AAAAAIAA,AAA,A,,AAAAAAAAWAAAA.AA,,,AAAAAAA,A, 1,,1 A 1,,111 1,,111 1111 A A ,.AY,.,A.AAA,.AAAAAAA,AAYAYAAASAAAA-AAYAAAAYAAAAAYYAAAA-YY, .YAAAAAYAY :Y-AXA --A-AYAAY.AAAYYAAAAAYYAAQ-,,AAAAAAAAAQA,AAm,mm-AAQA -AAAYAAQASYAHAAEYYAsAAA-gg,AYAA,AAszgAAAY.5-A,mgYYAAAAYYAAYYAHAQYXFYH'NYAY -wYY-'MAMA-AAA, 1YYqgGYAgffvAg+unASs:AAXfwAYY-WYHAYAAQ-'MA sm-SKYAAA,2gm,YY-AAWHAAASG.s-wYfAY-fYA.Y-YAY::AA-YYAQYAYAAA.,YAA-YY AMAA-AAAYAAAAAAASSATAMAAAAfAYYYAfgAAAf:YA:A-:AwY,As-YYAAA-,YYAASAAYAAAYAYYAAAS-A,AYAYAAAA--A,Y-AAAAQYAAYAAAA,AAeAAYY-.AY----YA----- ,A .Y- IAAA,5,AAAA,A,AAAAAIAIAASAAAIAIAAAAIAAAAAAAAAAIAAAAAAAQMAAAIASAAAA,,AA,,A,u,AAAIIA,I,A,IAAA.AIMS,IAAAAAAI,Am,AmA,AA, AI,I,AAA,AI5AAAAIg,,AA9II,AKII AIAQAAIIAAIAAAAII MA AIIAAAIAAAIFAMIIAAA IIIA,,,,,IA,IA I,AAA,IgAAAAAAI,AA,A,.AAAA,AAAAA,A,,AA,A,,AAAAIAAAAAA,.A,,A,A.AAI,,,AA.A,.A AA,AAAAAA,AAA-AAYAAQAAAAA.,AAA-YA.2-AAYAAAAA AA-AAAQYAAAAAAAAAAAAQAAYAH-AYAAYAAAMAAYAAA-A-YAAAAAYAAY, - AAmYg.AAAA,AAAAAgYAAAA.,AAAAAIANAIAAAAAAAA,A,AAAAA,,AA2I5A,SAAgmAI?AAAgAAYQ.2-AAAAYYAAAYAAAAAAAAAAQAYAAAYYA,.AAAA2A,AAYAg55AA.A,YAAAA,AAwAAAA,IgAAYAiffQAAAgYAAS1AAAAY-SAA-QHAAYYY-sz-AYwA-YYHCA-AHWYHSYYQSKIA f2Y1A+wAAAAYY:sAY-ms-QYAA-YYAAA,YAAA-SQYAA-AY.AAYAPasAmAYYAmAYr.AAYAAsYA,Y A--AAAAYAAYYAAA-AYAAYAAAAAAYAAAAAYAAAYAAAAAQ AAAYY..A,.-YAAAA-Y-AAAYAAA YA.AAA--A,,,AYYAAMAAA-A-eAsAgYAA--A-AYA--A---Y-, ASAIA AIAIAAAA A,.ImA,,,AIA AI A, A ,AA ,AI ,,I4A,A,,AI,A YI, I IAA ISI ,,A,,A IAA IAA,A..,Y.A.A A A .A,AAAA,A ,A -,,YAw,A,AE-:AY ,, We A,,A ,A.,AAI. ,AI A A A ,A ,JAN Ama IAA,,AI,AA,II.I,A,,,h AASAAA IMIIAAAAA g,,.3amAAs,A.,A.A AAAAAA5 S.A,AA1A.A,A.AA,,Afs.A.,Ys.A.w.s,A e,AAAA:Y-:cAYAffuL:Az1sAA'6z:s :Avg-Y-iw Ywv'--Y-1's-YM''ASW'A'S'V"f5"'H"'fMf 45'-555159'I'-f-IMYYflmf'-Sizvfwxs Y-Q YYYYAI.YA,,IM,A. I AASAAYAJA ,g.AY A, AAAAAA AAQQKAAQAQA QA YXAYQEAAYY AAQALAY YAAAS'Y5AS-AA YAGAAATAQAYAAAAAYY .SYYQAQAYAAQSAAAAAYAQYA-wAAAA Y-AYYAAMJA-91 SQ f19fA5Q5Y?5Wf9?fff1 M151-Wim-Y'-YYJYYEYMY -SY AAAAMA AAAAAAAY:-AAAAAAAY Am AY AWAY -AA-AYAAYAAYY-AY-Y,AAAYAYHAY- AAYY AAAYAAAAYSASYA-YLAYAAYAQ .AAff2,,AAYAAY-AfAfa:YYfYAsYYf.-YAY-sw-AWAYY-YAAY AA-YYAYYY-AAYY--iw Y--MAYY--ffA,,Y-YY.. AAYYAA-AYA A-Y,A YA . AA--. AA-A,A 11 - A MAYA YYYAAAYYAS .AA MAY-wg AAAYMs+sAYAgA,YAAA -EYE AAAAAKASAA ,AAAAAAAAAAAAAAWAAA,AIA.AA,A,AAA,IAA,AAAI IA.mAIAIA,I,AIA.,.IAAAI,AAAAAAAAAg..AAAAAA.,AAA,A.AA.,A.A,A AAA. AA AAA.AA1sAA.AYAAAAY-QYAAAYY .AAAYYYA9YAYAYAAAYAAY--YY-YYYYYY, A YYY Y- IAIAAIIAIIIIIAIIIAIAAIIAIAAIAIIAAAAIIAAAIAAIAAMAAKIAAAAAIIAISAIAIIAAAIAIAIIAAIIIIAAIIIAAAAII,MIImIAA,AAAAIII,ASIII,AQIIIIIAQAAIASAAAAIAAIAAAAIIMAIIIAAA,AW5,AASY,A,AIAmAAI,AAx5AAAAA,IAA,A AMI AAIMEAA ,A,gAA,IIIAAAAAIIAA,,AAAA, A, AAAAAIIAIAAAAAA,AAmAAAA,AQAAAAA.AAAAA,,AAA., ,AAAA,A,A...AAAAAAAA,YA.A.AAYAAAAYAAAYAYA.qYAAAAY-YA.YYYAYYAAAAAAQYYQAAAAAYY-HAYY-Q-AAA--SYYAYY-WYYYYYYA-Y-YYA-2--AY----PAYY----YY .- AYsA,A:AAAAAYAAYWAAAAAAAYAYAAYAA-A-AAAQYAAAAYmYYYsi?Afl:AY--A-AYAAQAQA,,YAAT.mAgAYYYAAfYAAYAA-gAYAAeYA.AYY-QYYMAAAAAAAYAAYYY.gwgg A.AAAAY2AY? -AAf+3AAAAi1AAYAAA,9aAAYAAAAHAAS'-QA, mwQ5w,fA,A,AAAAA,Y:AA-AAAAYYY-AAAY-MAA YAAAAAAY.AQYYAAYAAAAY-.AA-AAA-wwYYAAYYYQQYYAY--z.xYYAf2::wAYYAAAAA-YA-YAAA-YAYAAYAAA-A-QAAWAAAA-.Y--YAA-AAAYAAAA-A-QAAQSWAYYYYYAAAA-5-AYYYAQYAAYAww-fYY,. AAA AAAA.AAA-AAAQY AAAAAAYAAY-AYAAAAA,AA-YAASAAAAQLAAAYAAAUAYAQ AAzfAAA.AAAY-YAQQAAQ,AAAAA,-W-QYAA-AAAYYYAYQLA-AY--YYffH1ffa5fXvsAYH aYf1'Mf2wwY -H158-'llwxz-HHWSS w'f?'1W91wAMmffiW-WWW'W"'5'1FfW15'5"-fmfaf'P'fff"'S""'w'1ff"'W-"i"ffS:5'fS''emi'fm-lsflffqillm-S"-'Y'M-SfslfW'Y?""f""""'S'WW""s"'mf'w'L'WfSW5"fi AAAAAAYGAAA-AAYAQAAAAAAAAA-SAMAAAYAWAYYA-AAY-YAAQAAA,gAA6AA,AAAYAAAAUWA,AYAYA-YYAAQYAAAYYwe-Y-YYYAA-YwAA-YM-YffXYAQYASYAwQA,AQ25,31sYAwwwg2U2rf3m-X'-YAYYHGYAAH saw-YYMYAW Am Mx-?2m?'fsYY-vS:sYY'-EYYYYYMYYYQSASYY'-if-YIQYSYYM 'fWY'fSYw1wY-ww-YfwsA-M--MY:--+.:A-YYAYAYY-Y,fs-YA-2Y-Y--YY- Y-me AwYs2Y1faf2---YZ---AMY"-ULYYYYH2'AYY1:fYEYA:AAAYYY..:AY- .YY-YYAA AYA-YA A, AA IAA AII,AA AAIAAAAA YAA AAA. ,A AEI A,AAAYA, AAYA .AAAAAAAYAA AA. AAA A I A A A- A .A AI AAAAA AA,gsA5A,AA,A,sA,AAA,A,AY AAAAAAAAAA.,AAAAAA-A5A,A1A,YAAYAQAYYYAAAAAY-AA-YY-ss-AY-Am AAAS-A-SAAAYQAAAAAYAQAAA YAY, AA YYY -AAAAQY,.AAQAAAAY,AAAAgAAYA-.QAAAAAAAAAYAAAAAA,AsAAAAAAA,.AA2fAAAY'fAA.A,AAAQAAAA.MAA,AHAAAAAY-AQYA-Af---YAYYAAYMQYH-YAHYYAizfYe.A213mi--SYYA-QAAAAYY-2-Asusww-wfw?Aw55f,Aim NAA-A AAAM-AAA -AYAAYYAAAY..AYYY..gAAAYAAAYYAAAY A AAA .AAA AA. AY.A,AA.A - A AIAAAA AAAAIA AAI, A A, I AAAAA, AA A , IAA ., A AA A IA A A , ALAAQIALAAWI ,AAA,,A AAAIIAAAIAA,,IAA.,,AAIA.IAAAA,AA,AAQ...,AAA,.AA.AA,AAAAAAAA,A.A A,YY..A,AYAAA.AAY.A,YY-AA.A-gY.AY--eAY-Y-SAAYAYYAA--YY-YY.Y---AY--YA-YY- -Y .MA AAAAAA-YYAAAA-YASA-QYYAYY-KYM--sw-AA-SAAASAYAAAASQAAgfAAAAAAf1AAAAs2A.AAAAAAQAYYA2-AYAYAMAAAAAY-fii.:AAYwAAAA2EA.AAA2AAAAAAAAQAAAAQSYAAAAIQYAAQA-AAAYY-AYAAAYYwi-51AA3xgv2?'AaYHi1sA11w?Y wifeMimiXAwwf?YrWAAQQMA--Y:A-EXAMYm-A'fwfYf-sfwfsf--fbiYMYlfwewvwYlwvs51Sfs3Y-ww---1'-f2r.AsA2::AYYAYYAsAQfa-YA-KAY--QS'-YAGYM-1Y-YS-S-W'12-4-S-'YRSLv-fY1Sv-W-wr'YYYYYYYWYY-YY: -smfsAsAzYYfAY AAAAAAAAYQQY-AAAYAYAAAYQYYAAAYYYYAAAQAAA AAQAAYA-smYAESYYAAAQKAAYSY ASAQ2HesAYwrwAY11saYAeA21YYAfl-45412Yfswfwicnfvaqfiflikfgwi W'523?w?ifh5f'5FFG5f"3'AYf'W1m' ffm' W-Qffiffgfxlgwify' 1E5--Q14M1-2-Viiilswifwlffwl'ffwnwm -'5ffmi5"-M91'S-f'1S'4SY 'eff' -Q-f'i-M1243-YY 355145ffx5F112Yff3ff"7'iW'S1W lskmiifwfffw' fs' 4A,AA,SgYA-S2,Y5S.sA,MivaAAA5:,z-zsigmfszx'-fam-2zxA:if:2z?i-fsrAx-YKew-W AASYHx1i?w-mA,Y:1ss13gE".1xsAX-wzsefrxa 1"!5xssr25fsi1"s?T?W19SWffYfxYisf2K IWSNS--f'f SSS A5 Y11"57Asv?WvAfY5x4xAYXPEAAY-fi-YAY--Km YAgAAA2Sv,5Awtme:5:x5AA,NAAAASAASA-AASAAAYfssx1Y-AAAAYYKEAQY--w:swsi-1z1y5?A'A:5?AL5QK''SiQf5'51if5l51SiQYY'T1lg-iflb-WS-Y'-YGHWQSIYUSYH'-SN'MfK1Af2lS1si?'fvsiv:2tAA'-:SYS-iYAf'S:'ifi'-QWS-ifVi7lf1lli'V'11Q-SVS AAsfw--YY,AYA-YfwYA-wY.AYYfe,AA,A-AYAAA,-AfAA.SsAAAAAAxAY,A-AQYYA,A5Y,A-AAsAAg-fA-MAA,YAAAAAYAAYAAY-.AAA-AAfsAAAwA.3,5-SYAAAAWASQAAANAQ aw-AYAAAYYAAAAWA-AAA-fYAAAgpAAAAYAQAwgA- g1AA -wYYAA::fs,A:fAA,sAAAA,AAAAAAZAAW A,AA,AI,AmAQA,,A.AA.,SWAa,gA,AA.AAA.AA.gA ,A,,AA,,.,AAA.,AYAYAAAAASAAAYAQ Am-AAYAAAY-fA.YA.AAYAAAAAQAAAAYYQQYAA.2sAAAA,AAA.AAAAAA,AAA AA.gY,.,,YAAA,-,AA,AA,.A AAYYA AA-Am-..A5--,Y.AA: AA,AAYAAAAAAAAAAAYA. .AA-A AQAAA.,AAAAA.A,AAAA.AA,AAAA,AAA.,YAAAAA-AA AYAAYYAAAAYY AYYAQXY AA-YHSAY -WY HY-YYMYYYK1-A227-YAYA-XAAAAW-H-A-QZHYYY -S1 YAAQ-YQYYAMQW-www- www Y-wHYYAfYAYiYfAf?fM-m-Y'--Aw-YYYQ -A-Y-SYAYfAYwYYYfXY-Yww-WAYWYYMYYYYAA--YS-AA-SAYA-YY -YYA-YY Y'-YY-Y'-fMYYA-Y-WYYAYYY----Af--211-Y-fYAsY-YY--Y-YY-Y:YYYAQAAAY 12- Y.-A--AYA.AYAf-A.-A2.YsAAsA,YAAAA-f-.A,,A.:Yw--AYYA:A-Yu:'YAEYvevYv'wf'Q''AA-Af-A2-AwYw,wY..AgsgAYAA,iAAlm'fYrf'wA-YA-AAA-'LASAMYS.',".2.2ws2':AwAfYAAfA.AA'Y-YAm-wYw-v-fw.-.f'ASY.MA-A w.sAYAAA.b-,A-A-Au-AM'-AYAAA.A.-.-,A-?YfvYY.22Y:fASYYA2AfYSAAMWS510-SWf--'im'-EN'N'xf"W"'WtAHY'wiWwwf--AVA''Y4'1A,s,-YAY.-,YAYA-Sg-,YYAYa2fAYw-QU--.:pY.YA:-'-A:2YmQ'AAsw-A sew-.Aims .AgsAez2f2sAszgYg1eYYAALsA- Az-:JA-AY-.AAAAYAAAAAAYYAAA-QA .AAAgfwtws1sA5Qz f1L2A2QSYQAAQAEAMQAAAYAA-YYYAm2zAsYAAesQYzs2weYAf214sY7ffwYfsewaewfYf212f5'1fv1zw1LY5Lgsiefwg2fW"iW?5lf5?2eE5, FAEQWYQYYAAAQAQAY- ge: AAMAYSAAAAAYAAYYAMAAAAQA Ama ALAAYAYAggAAAAYYAQAA,A2YQAAAAAAAA35AAgAAY-YAA-AYYAAYY AAAA-QAAAAQ AAAYAQAAAYAAAAA AAqYzAssAAAAv AAQAeseYeAYz-525152145222 wggzzfifizzzifs A,-A.YAYYAAAAASQAA-YA2AAAY.,s.-.A-A-.AAA'-.1SY,wAvwAs.'-wivH-.-Yrif-.AQAAAYHAY:A,Awe5YAAA-Y-f,SAYaY,,fA,L-.sA,-Af-A.A'shSAY-,f,gAA,A.,-Q,-YSAA-YASA-YAYUAAfA.fY.vY-:aw-.'.Y.w.',--YMAY-.ASAAY-Y-. Vg-YHemilm:IA,As:fs'e'.2Yw,AAAwz.sA1'fsA:A:Azz.ffa5YsQAAAfJ2LxAi,:291b: liKF'UL-Wil-Ygfbf-Y-fi'':fP21LAsif1:ss1::'AAiAYL--QQYgi2fsY1isGYg3gixL:3gs5,w.Af,AKSYYSAA,AAANAQAMAHAMA,AIA5IIQASHQAQYEAI5,qYAQA5,A,AiAqAAg,AAAm,AY1,g-AIQA5,YAAAS-YAA.AA,1,SAAA,A5Ig.!AAAY,.5AA5g.3A5l5Afsq, 5:s,g:Y5:A,Ag:Azng,msg,zAm,gA5s,aAAA1egg:SYYTAxA?ffm-wwAmA+smQifA:sAS1AsLQ5?5?FN'3TS5Z5f'W42Wff'35::WIISIW739':5755iA5m?::fw'Q:i5:W AAAAAAA-AAAAAA.AAA,,AIA.AAAsAAA,AIAAAAAAAAAAA,,5AAA.IIAAI5AAI,IAAAAI,IAAASAIAAAAAAAAAAAA,AAAWAA,AAAASAAAAAAAAAAAAAAAMAILAI,ASAAIAWA,,AAAAIAIAA,.AAAAAS,A,AA,,AAA,gAAAAAAmAAAA,A,AA5AIAA2IIAA5AgA,YA5,I,,AMAA,AAIAAAAMAAAIA,AA,AA,AAAA,A,A,AAAIA.AA,A.AIAA,IIAAAAAAA,AAAIA.AA-AAAAAAA,YAAAAAYAQAAYAQAYAAQY ASAAAAAQWAYASQAAAAQAAASAYASYAAQAAAAA,ASA,AAQYAAA--QYAAQAQA-eY1AAgAgYA-YYYAAAAAAWAYAAYQYAYYAAAAYAAA- ,YYAAYYYY-YAA.Y , .-.YAA2--AY,AAAYYAAAA--WY.,AAA-AAYYAAAAYfm-A,A.YAA2AAAA,A.S,,,,A.QY A-AA .AAYAYA.AA- AAAY AAA ,YAAYA AAA-YAA2AYAAY-YA-YAA-- YY --SYYY-2' AY- MA--YY QA'-fwg-H11 " MY A-121 .SSW--Krfssffw Y--SYM-YgmeiiwwvYYA,-YYfmfS1eAYY1AeY AA-fs: Aww -sY::AY1fe: AAYYA::A-WAAAYYAAY AAYQYYA-YY -a A-QYY ,521-.Q-weswAQAY-W-Am .AAf-AAAAwAAAAA-- A AQYAAAQAAA-AAYY YfsY-YYASYQMY-YAwYA.AAYYAs:YAAYAYAAYYAAA-.A.QAA-...AfYY- ,3IA,IAA,A,A,A,A,-A.,,AAAAAAAAAA,, A, .gA,AAAA .AgA,AAAAAAAY.AA-AYA A-,Af-AAA-WAYAAAAQ,.AY.AAAAA--,AAAA-YMAAAAA.AAYAAAY,AA.YYAsAYYAAAAAW .SAAAAAAYAAA-SY.AAYAA-SAYAA- AAYY--SYAAYY-SQYYYH-QMHS-YYYQYY'wr'-AWAAAYYYAAA.5,.A,-AAA,YA,,AAA.A,YIA,AA,AAAA.,AAA-MA, ,Aw-,gAAAAYA.A,Y2A AYAYYAQYYAAAQYAASAYYWAAA-YA,AAAY,.2.A,.AAA,YAAQAYHAAAAAYAAA-AAAAA,YY.AAA-.AY-AYAAAA-AAY.AAAAYA -YYYYA.AYYYYY, YAAAAA.AYYAYAA.AAAAA-YY,AA-YAAAAYY SAA,AAAYAYAAAA-AA.AA-AAAAAYA-YAAAAAAYAAAAA-SYAAAAYA-AYY AYAA-Yww-W-fYYAs2-YYYAA-f-Y 1: YAAAY-Y-Y2YfYYff-YYYffYf--Y--aff YYY-S1 WYAYYYMY- '-AY--YYY-YY Af-Ymffwvv -YYY -sw--YY-SYYKYA-A-2Y -Y-W fSYYlfS'AA-fl-Aw Y -SwAYHYYWYY-RYA-YYYYYYYYY-SY-Y-SYSY-fY:w A AAAz1':sA .YY Az'AYi-.,,zfAA 1:,,.A-A,A AYA-2 AA4:AwA,gYfAz::Af:,zA:sA:,.s:A3:-YzswY.s-'A-SAY-5,1 AY--YAAA4 myms-A'4Pz.uA'-5mAs55YfswAvA- AYYY A4521-S-Yiaih ':2:AfAAa1AAs-,YWAHAQAAY:YAASASY-SzAsA5z::' A51?sAYQ:wA -HAA-A555-AY-SAAY-EffVSV-Y1'-Y-fb--T'-ISWYWS'NLG--Z-511491-fs?-1 5S1"Wi1'-YQYLTNH P52-U 'WY'"NWN'l'f5'YVFf-'F'L-WSFYY-SSYYYilHY57AS'2Y'P1AaA:2i AM-A A:-YzpYA-AYAYASAAYAAYAMAA YzY,, xi AA-YAAAA -pwIQASI.A,q..IA1IAI.:I,AYIAI3IA:-I,MnA:III,AYAAAAI3sI5IYI,5:.IAsIIgYIAIgAIIyIA3AI.g,,YIAA..sIAI,A,'I.IAaI,sI.I,sI,5,-AI,YIIA'A1I."IAA'AA'..g.-AwAA'A-ai-Y'AI'gYI,YI.UIAUY'AA3g'SA':'AA'21A-'Q-11,-A'.S1S'ARFQ?-':WzfYF'Y'A'Y ,i2A?Ad5EfYAlSi2w1455-??1w'.HE?lTQi5iiQSAgf2t15fS1Qg1As4AYAA:,:i:wz:f.s?Ai WYE-viiA?L:?5Ef-L?5E?iSf'?FLSYYlAgrAfA:AcAYAA:se-myssE1,:Ae-iA:A:5?AqfYikiiiiiii'L.iQE?E?Qi?xiSE'fs-TILA:,mgAmana:,zAs:AA:et1Ag5:sY1i5 ifiizwii'Y'552151521Y5S?E1?LAf7AiYYg-if'A-Y7Q1lH2ZYis'f Size--w'AafAffiAA.,,zLEY,Y.QEYAY.AEYEQSLEAAYiiigkbggi-YLAgQxif152f55fsjYAg-SgmY1gstfgrvtvzgriizzzsfsirzrYgw-5:ezi:A,zA1AL?::xQE:5YYlQEf:Yl: L'LsYg:YE'i'??1?YiAYl, Y-QQIQYZSYAY 'STWLIAMYWiilslsi.zALi:szx:QY7fbi--122-sf5A??ALs1559iTie?S7?T55TXl5i'Ai35f2EE'Z315-125429vfU1Ai5fi?AQE:5A,Qi5557?E??L:5?ZiE??5?VZ:?S1iilkil-QSWYA'g2tAAzYzA:zAYA:vvL:Yiff:52-5263955352527iSE?5:kEi5?3SE:A2?QiW7:SFi25V552f5f5?S'f2-:A-Y5ss::YAfsALi1Y:siTL 2E'.ilAY?liiiT3iiLSSSAQETAQETAL?S7IQ??2EQx:fLEW:TLEWQSS713795-5-91-li-5 2315 2?iifiis'5EE:s5E.LAS?iiZiL:Q5i5EAyliiz'iL55iLf5?iT:ffL5555927''V' Y 2'-552:EV5'59'TFF':fY-lii'-'Y"1-557 A5ilfi27FEAi53?32A3AfSxAYg2AA5Y.A-:SAYLFYI'3:Yf,1SxsAA:,:Aw'AaAs?AsEi1":wilzfiiifii'11SA5:i1fiV5sfe7Am1xwA15:1vA:z2Yz.sAYyiwsi-Yz.QEYZASETQ-37LQETLSZSQYZHQQFYY'SQSWSTZlb-WSWS'-We-ST15651fifvl-SW'I51555'A5535YAZ55?TSiV4?f'f5ilif57T-WWivs--swf?W'-Sl'i,EYWWlfS'f-ff'I'--5357-55253-97355-flkfiifv :Q--it'zigffmvwiff'-112-5 W5-1S'lL-WSH1293f-fvib'-WifiP-fHfs2i?S3?Ylf5'-5'55!'?5?:-5551? YYY:"?l'f Zf--Siifff-l'fY:f271U 'f'-Y'-Y YVMA,fgf-ws-'iArA.Af.,'L.,AwwYfAsw1Y'A.Y'.m1Ig.3'wA-Y'-'Af-wA:N.gf.fifAYA.',A'AYfA-.Yf.A'.Y'.-Sy.-U.--SAYQ,-,:1,A.SIIAgA',Y,-,AI,AI-I-YI-.YA-,I.1IAY.I.'I-IztwAA-IAM-.A--Y.s.Y,YI-1'-'Y',wA,f.Y'AA'AAY. .A3zAzAA, AYA-,AAQ-A,AAAA-AAAYAA ,AAAA-.YAAQYAQYAA me,AAAAMYQA.AQAYYAAAYWAAAAAAYAAA,,-AgYYYfA-YYYAsA7AAs1ieAzsQz21AsAzY,e:zAAYiYfA--YWA-gg-2:AYAAAAYAAAAYYAQ-YY-YAHYAQQYAAQSQAAs-YQAYAYLQAAAAQAfe-Ygfw--svn-P1-SfY-WA-ffwfSf'YY-fffwffbfi-mf 5'f1f'5flW-W"fF2Wif M'f'm-Wlfsfl"'-Wfqlfff-'TS-5--WA-if?Wf2-'71SWifiYfiffiiligi-Sflfg'ifW-Y?"-S2f"Y'ffW'-Yf"YM -YW-W'--fffffff -fi'7Y-'Yifi-'ffffi 9iAsiZV?s'i52ii?YIL'?l'AmesIqeixsi'-wmvf-ee1:A'v2ziAAA-31155351315551555S7iE?'fH3lzfA2xf?-,zfS51AA5fSxAss-v.s7':YYizsvrglzimiklk?.?5i:L:5i51A5S55iY" 5591:-2TA1SY'7fSH-7459?'A-W-TV-55f'iV-3:53551557llYf?31Ls5HQif'fA2E?-3E?iFYY55Q?'iLQ9?Y55fS'fivliilhfffiWIFI:Iwi?I5.:r!ZLiius2AE2f53I5523ETii23V5EYEASLQSHSSTQTQTLVWY-iSSfllf3fY-KH?Y-YYISWSS'wi'ls1f2ILfeA:r:T1a31vi5'3' 5'ifmii'"2fliii:f?iTif'g3A3Uf T'LIf',1'L"i?i':'L'fYE V1-'VT'l'5SYi'Y AAA,AM,YAAAAEIAAA.gmAIAAAAA3AA,A5AAAAAAgAAA,,gAgAA.,A,,AA,.AAAAAAAAIAAA2,AAAAAAAA3AIAgAwAA,AAAIAAA5,AA,g,AAA,,,AAA,,A,AAAAA,,IAA.IAA,IsAA,AA..g,IAAAgAA,I .AAAAA.5AAA.AAIAAA,,, ,AA ,IAA,II.gAI,I,AIIAA,IAAAAA AAAAAAI,AAAIA.AAI,A,,AAAAA., ,,A2.A,,AAA,IAAA,,.I,IAA.AAA,,AAAAAAA I.AAAA.AAAA,AYAQYAAAAQ-AAA AYYWYAA-YYAAAA.sYAAAYYYAA-AYY.AA--YYYAAY-YAAAA-Q-ZA YYY-A AA - AAYAYfeYA.,fA -1AAwYs:fA- A-S-6AAA-ASYAAAAAAAASAQIAAAYAYAAQHAYAQQK-seiY-Qs-AgY:AAA:5YAYA,Af,-AAYAQSAAAAASAAKA-MAA,.Aw.YfwAeYzAgs:rYAMAAAYYAA-YYAAYAA-YAAAAAAQYAAAAAASYAA-Yi-:YAYLAAYQZAASAAQ-wfifsf1352116-Ykfffa-31-WY-YYYAWQYY-Svffivfll-YYY'--YYY?-SY-H-fifwfqY.1wf2Af4i2wY55Y'-Af-ff-MYS'11YzAwAA-H--effAAfY.A:AfYfw-SYY.Elm-YwfUA.ezAf2Y'waswY145-fP2AsQigY1sYuf-WYY-:As YY-Y-1 .-,H-YY.esYAY af.,w.A,5A,AQAIAWSAQ-gAfII.AggA25fIYwY,:'AfAAfAf',YwAA':S",H.-KAYYA'.u'1YfJ,A'AAfgfYA'AA-:A-A',J2'-"-"4'f'AA'-Gif-5-US'w'9Sx'H'YSf'q'73:Hi'Y'AW-'-A'.mfA'Y3.0,-.'w,w.A-Ag'A-AYY:'AY"S'ffS'AY.fY ,xbiiizkiiivfgfiez:'5?i5i3AYfsf5sAA,AAwf'Y5A,xLs,AS5f35RQYAm2LAE5ii551E'?QsEQ3liE?-'ZFWEAiifiiiez1591YASQYQQ-H14is53Af2iTs:AYiTiEf7YbE?if?XIisf'?ZSiQ3'ETQQQEYAYIZQJYwilg1S9ALGgg2Lfs-AHSSVQASEfi? 1IWZ52ETL33'?ix275Vl!i?Zi3EHL657LQeA553i?QF5?5iSi5f'.ZSSAYQSSFA-WW'-SF:-AL--55'SWZSF7'559553-5737wi55VLSi5i?Li59Y-5fff4:7lTS'l3ii5lfHiTlifff'W7-fi'--25IN'-ii''25F13ii'55:7l-5fS5Z2535?f55YY f5515335UK?lf55A155T3525l53i:7:55Zf5lli5:iQiE9Lf?f'4W'-YE WHY YY YAASIQYAYAAYQ-AAAAAQQSAAAwe-WEQEYAQQQHAQAMY2s14sAAAws5ZSAAQQQAAAASAQAAAAQAQYAAsfmymeswassAHSAAwzafAf--:AAAf:YAYAYA-:AA-Q.AMYfi?-Aaffi-WIYwg214e,i'QYSYAAASAWsw-axis-in-wfsmsz'wwefwig-Ywfgews-YY?"44572-WW?-SfwibiiqiixwWY'h'2W?Y'W-fs?"-5'Y'-fiffffi-Wffffqi-iffqi-NWS?1YYQ?ffwfllfikgliiffi'MKWYY'"-ff'-'if-'fi' f"-'--ffYfYfffW---fi:iff'-W' ASIAAAMAAAAAAIA 535155AIIWAAAA,AQAAAWAMAIQAAAAAQAAAQIIAAASAAAAI AAAAMAAAAAIAAIAS,QA,AAQ52AAAAAIAA,AIA3AA1AAAAAAAAAIAAAAA5AAAWAAEIIAAAIAIIAAAAIIAA.AA,A,AIA.AIAAARIAA.AIAIAIASAAAIAAIAAIAAAIMAIAAAAAAAAWAAIAAIAIAQAIAAAAMEAAAAAEIA,AAAAAA.5AA5.AA.IA,A..,,A,,AI.AAAA.ALAA-AQAAYYMAA-LAAAYAAAIAAWAA-IAWAYYAAY,A-fAAA..,AAgAAAAY:AAYYAA2:YAw.AsAYAYAAAAAYAAQAI-AAA?YAffYA--aimsg-mezigfisziwg .ffffAi.::EAA2sagYAYQLA-,g - A A. YAA-QKYAAAYY-QQAAQLSYAw-AgYAAY:QAAYYAAAA.AYYAAAYYAYYYAQAAYQ-QAAAAYAAAA-SA2sAAAAsAAfAY.sAY2f2YAAAAAA--Q-YAYAA AAYYAQQYAAA-YAAYYYYWAAAAAAAYQAAA-mlmffa'w-YYY--YY1AY-ffl--Y54YYw11wYYa-fYY1fYfYf1fYQfYfA2iY'-Sw-S--WW-WYWWSY'--Sf'--SYY'-W-Y-M21--'Y-YYY-Y1sWYffAYfYfYb?'1fSYi'Yff"-QIYE?-'Sf'WY'-1-ff-2'-SKYWe--S'S-'YY'-1+-f'f'YY--S'-ff 'f-'Y1-v-'YYY'-YY'Yvv'-'Y--Y'wv-fY- A5:3SfS5s:1YY.?f1i?ezzvAs5few581ugs5Ae2:AfYS1:wf51:S1AlSYY5f?XiAg2AS'i:-as?gfsmqyAwYA1-zzrb-5sAsx:nAwi55?A.5YTSfwYg9'.s:A,Ass:fsAYsszimrmY-E1Liv?rife:'ASIQAA-521456AHS-YUSSYY-P15921fmffi'1gevA:AzAsrA4sA:sA5Y.5s:-Ymszgf'fur15421Asv'ASz:L:ALYA:'5f?1:5:'fi'-154-W9M57'-LAWSM-29V'ffYVl:'ffm'-Q19'S'LYWP'-11V1'f2Y'iii'7455W"51ll251ll?fW'i5'W'WW'NWS-i3779'YV""L -YH :ZSTff---WS---fl--1--T-1Sf'-PTY' Y Y. AAAAA,AAAAAY-AYAYAYY.AAAAAYAAAAszA2mYAAA-AQAAAAAAAAA.,AwAA,Y:eAYAAAA--Q-AAAAAA-AYAAAYQAYAAYYY.AYYAQYYYKYY-w1Aef2YAMYAYKHYYMQYSQ-YKvA-fvrAQ2H21YYS1wYm2Yfsf2'ifwwiwfwYYY-MWAAAA-.eYAAffaYWYAAAA-SYAAAAAA.AAAAQA.AY-,,.AYA-YY..,YAAY.AA-.YA.AYAAA.AA,AAA--YYAA-YAAAY-AAAAAAAAAAAAAA,,,,AAAA..AAAYA.gAAA,.,,IA.YAA YYAYAAAAAYWAA-AY,YAAA.AAA-- AEQIAAAAYAAAA2AmeAn5ASAAYAA.Ae--YAAYYAA-swAAA-YAAQYLQYQAYQAYQQYAAAAAAAAYYAAAYAASY-AYYYY,.MASAYA-QYAAYAAAYYAAYAYY-sYfA:YwYYfmfYfAYAYweAAMAAKAAQYY-SAW-AAYAgeYYAAsAYYAf:AAfAYAMSYYA-Y:AAwYAA.,AAAAQYAAYY-BAA,AAAYAQAYYAAYAAAYAAAAA5.AYAfgA-z,Ag-YASAYAY-f-:AYYYAY::AAY::s-YY, AYYAA--Aw-YA-A-AAAAW-YAA.A4zAY.A-YAAAY-YAAs,fY-AAYA-SYYAAWYmepwgvQAY:-.ASM-AYYY:: WAYAAAA- AAAAYY--A-A---AYAA--AA-AAAYAA- X:bI?a?iY?ii1El1fzfJrm.,-2mAYYA:ss-AY51wffsc:'5?fsr'A,i7Afi6wAb-fi'iSAAAP3LisgA,z15lMA,1s-Y-:f2s'A:,:S'2AAsAYYA-Az.swsaws?.EQFSSAWMZC1575'YYW71'AiYY::mA3z4aw:'ima?:miner1Regis-3IW-5?'52'?Efi'ig???Flgi5'1Efff1As,YfxzA'-Efux:-A5MA,aAYA4AaA1Y.exAw:sm:fzzzAims?3:sEifia:i??Egiiik-fSA'L-f7Y.-''fql-Silfliwfiiffgilw-YYYiSY5'f:5'YAIH1'L-P2iiiiwiz'-255lisfiiif?-2?T5Ss?iVSf5??'W-55F:iff'Y, SWWST'Pfff'1-ff-"W--'-'ffl--Si1'-W-ISY'-ills AwA'.-S'AYiAiA"A:Y'z2aYYZ'f5---LYAmy'g!'AIiA-fm-in-TarZimYMF-A-Ajf5fAYfY-iiw1.'SIv'AA-WM.:Y2.A-YAS,-:AYif'Af.-A-Arm-'A?i1'32fAY-Y'AA1f,fAY'A-3:2f'.--u.gAAA'Y-gf.'.'YAY'AY.YA'.AW:-'AYA'AYHSZAK:Yf',-w-'.A'.AY--'A-fn-A'-ffm gA2xw.Lf.AA'2SAYY'A-,'AaAYQ1-A'AA-Zf,ifA.AQMAYQAY-YYAAASQ-Ij:fA'YAYY-'MIA-1.AYf'-1-fAfAf'A2f.gA12--.'.-2150-iwfA1i'-1?'AY1fAfAAf.Y'A',A-'A--'.YA'w-A11Yr-Yu-'A-lewA?'.J'A'.Yi'AAii2'Ag'Y'AY'-'Af-YW-'A-A'-YI-QL2"1'-'SwWffl A,YAYAY-MAMAA2AAAAA,AAs is my :Y-.YL-A AAYAYA,YAAAAAAYAAAAAYA-AQAAA-A,,YA-2z1wAYg ,AAAYAYMAYAA-YW YAAAAYY -AYYAYY-A,AAYYAMYYiLeY Aiea -Aw?GAY--wgAAAYA:A1gAYYmAA2 AYAY-AA--AYAA--YAA3YYY.YYAsAY:AY-YAEAAYSYAAAYYAY-,QA-YYAQYY-fzzwfm:A-Yggvfg-SW'fsffsmwlfif'fffvf-Y-SYAY-AYAAAAAAYY1AsAeYHfAeYYYfA:-YY- :AY-QA:-YA YYAgfe:YAAAAAYA-YY.AA-YAAY.YAYAAAAAA--Y-.AAAYAWY.Y,sAYAA,-AYYYYJ. AYY1YAAff-Y,1azfY-Aims Xx:Ax9?zA::As5ifS:r'YAf2Y,A2AA,,..,zxAAYAs'x 5-AmAsA-AzsaigY,z..rA rss'-5'2rmAQzAAf Aw-M52 ,.Y,,.,A-,z.AAAYAv,.AAYY.cssfwwfw-azAs:S?rxYAf2zfw5'1Y2Y,5YY1xAY4315-.AAAAAG521ew'fs,A':A,.AAAYYu:A::1Aw-AzzAssA?-mis-SY:sv-ef Lg-AYY .s.,,Y.AA2,..-.1.sA.w,.AAAYY.AzYA:A,AA ,..:aA1Aw:s-ws:ALfsx:'sfszA's:5A-HA--?Yfs-Y-YQ'Af5fv'L:f5f'W- Sig'--Milli' Qfm'-XWWWSY''USNSVIW-f'9Y5VT'V'P--Y'"-"W" "'-'""--"M"5-'U""'L" SM 'H' A YAAAAAAAHY-AAAYY.AAAAQAAAAYAYAAAAAA-AAA- AAAAAAYAQAAAY-AmAAAAAAAAAAA,,AAAAAAAA,AA.AAA.AAYAAA- AAA-AAAA-YA-AAQYYAAAYAAAAY-AQAAAAYY.AYA--YAAYYYYffw1wY1Y-- -wr-YNYY--YA'--2AAAYY2Y-:YYY-MYY-YY-A--wYYYY-WY'-ww-QYYY--W--YYY--YYWY-YvwY-ff'--YHA-YY--YA-YYYYYY-YAYYY--2YAY--uwYY.Y-Y--YfY-2wYYYHYYY-YwAYfYYY-Y-Y--YYYY-YYYA-Yvw HAYAY-YYYAAAY-wr:AYS2fA-SA-A-YAY Y -A-.YA-,A AAAAYAAAA.,AAYAAAMAAAAAY-AAAA.A,AAAA-SYAA,AAAAAAA,AAA,AAAAAA,AA,,.AYAAAAAAAAYAAAAYYAAAYYAAAYAAYYAAYAAYA.YYA-9-AYYYJSY-wr:Aegfm-AYYASAYYfu-AASAAAAAYAAAAQY-AA-AY-AYAAAQAAAAYAAAYAAAAAYAAY,.AYIAAAA,AAAAAAAAAAA YY.AAAAAYAAAYAAA-AAA,YYAYAAAAAYAYAAAYY.A-YAY,.YY- ,AAYY-YYAA-:YAAYYY-SYYYA-YYAQYY-fY.A-YAYYAW YAAAA- A-Y-YAA-Y AA-YYAA.YAYA-Y.AAA-.AAA-A--AYAAWY Y-YYYAYYAAYAA AAAAS-AMA-AYAAWAYY-fA2YA-Aw,AAY-AY-AsAAsAAAA,sAA.A-AYAAAAA,AAYYAAfgwn-AYAAAAAYAMA.,,AsAA,A.zY,.A.YAAAAQAAAAAAAwA,AAAAAY-QAAAYAAYAYYAYAw--2Y-wif-i'fbYAQY'f1sfY'ffYYYYf1aYwY'fYff1'AWvISYS-fSK1sY21eY5'Af2Y-Y'--UYYY'-sfHM--M'--YY-'--ifL-YYYYWYY'WS'1'--HY-Y-PHIYYWYAAY--M'YYMQY-Y-Y--YYY-YY-5'-Y '--YYs-Y--ff-WIS-'YYY'Y'--Wfffls-YwA-fYYYWY'Y'11e--YY--Y WY-QAAYYffw-----ww' A,AAAwzgwYAA2AeiAAs9A.AYsYq'.w.awfAgYA-QYYQAAYAYAMAYAAA YA -YYAYAYA-AAQAAAY-451YAAQYAAQYSQAAAAYAAAAYAASYAY-YYAA-:AAAAMA-AYYAAAYYY AAAAYYAQA3Y1AaYwQYAY-sw-mA Y.mYYgfxYAm:AAA :wwAAAASEYAAYYAQAQAAA-AAAQAAY-.warmYAWA-Y-mfr1fAYfwvYfY.AA-YYA.s-A-ezAYASYASAAA-AYAAYAm-AAAYQQAYY.QYYY1AYAYA.sYYYY.A- -WYAAAYAQ:YAAYY-.AQ,Y,:AA--YYYAAYAAAA-AY.AAAYY-SAAAAA-.WYAAAYY., YA ,AYY.5,,YYz,YAYY,YYY,-YA-Y,A:YYAAYAsYY AAAAAAAAAAA - YA, AI AA. .AA,Y.AA,AYAY,AAA.,AAYAAAAAAAQ,AAAAAYYAAAAAY-25AYYA-SYYY-A-YAYYAM-K-fsYsYYfYYw1Ys-YHYYYY-YY-Y-lm-YY--SYAAY-AQYAMYAA-MAY -YYwY--Y-YY--YA-YL-wwfY--YYY-'Y-mf-YYY--ffA-YYASYAAYYYYAA-YYAYA-SY-we-YAY-YY--YY-Y'-we-W--YY-Y--Y--YYYY----Y-Y1-fYY-YY-Y-f-YY:.A-A--Y-YAYAAYSYAAA-WYYYA.YYY-YY Y-1- K ,-sm1Y3z.sf5L A'fireY'gzzA":ss::'-YrAefi'55z:zY-M2-1-fin .. ': . 1 1 JY - 'Afitfv 'Y' W -was Y--:Aw"Y:21rai'HsA4,EKrvg:'511urlsvlsxz'-AASAA':2zAur1fAeA:A-l5AmiEYAz1MSw A3zAfs-3:2112-51 '?Lfe3H5:5W'L?f3K1'LfSwhYLfS'Lffhlea-sr:Iwi?s-A1fAeY?AeA'sAY1A:sAJ:waA'?wA'23YIfiLf?c'Ni?K4YL--Si-YYYHSYY-f211Afff'. 11 "'s-2Y1Aa-?1A1s1:-r1AxYfY1t:awx-Y-Sz::kAA'f:::L?A:f4:i 'Y-YYY", ""iYYT"L-Y ' Y-ffiltf A ,e AY , A25 Y AAZAAAQ -I A ,.- QAA YAS5 fA3is5Y125-as2Q:QA5AAQQA25AAALAQAgQA5AAA26A:gi53AvgAA3QAAAYYAA533AYgiAg-wggiigfggiz-g2zgf2A5fAYQ2YfAAf221QYLAQi55Q5Af21AAAAAY5AAQY?54Y255vsirAALQAALAQESEQSZQEYEQEQSWiiiffiisfiifilfY 2iYifW2LfQ222Mfe2f224Q6AYAA2YAA-Lzigzizu-ssQY:51-E',. Yi?-4QEf5'fl!5P Ylxsau 'zAggw:zL1sAYX1wA1g:YY:2i-Ag'lfv1a1Lfi.Ss3'Lfi5w iggiizilgi 42555 K15fA,AxsA7:f:stiifs Asi":,,ZiESf A.sm5,A . A. M 1 ' -A 'mi Hg ' ' : .e,1J?565?WFii,E E95-'lil alfa?lWl4S?Y29f1FSW!lbPYY'1fSSf"fSKY Aiiiiwiiili -Sims ASf1:5?i'W5,W'S TY'-SST'AL-3515?YllSigiYYlsiY?1YLwASVllr55YYifLv'LJi''Y..v,YA.:T5:Y::i? Af:539'i-5253?5515555ki?Wfligg-E-3?"Al-SYSY -'?TV?'W9S"YY'-SVYY1Yds-YA A-2-AQYAAQASYASQMY-AQQQISYASYYYYYASAMYYYYAAAA-YYYAAY :YA - , YWYAAYYW-YA-.YAAAQYAAYAYYYASAALWAWA, NAA YAAAYYY -A :A Y AA-fYYAAA22AYAILYAQHYAAA-QAAAAAAAAAAAAAAAAA,AAAAAIIAAAAAIAAAAAAAAAAAIAAAAA.AAAAAA,,AA,AAAAA,AA.A,AA.AAA,AAAAA,AAA.YY.AAYYAAAYYAAAAAAA,AA-A.z.A,,YYYAAAYAAAAAAA-,,AAAA,AA-AA.YY.AAAYA.AAAY:AAAAAAYAAAY:Y-YY-AYA.sYA.-A- :AY---:YAY--AY.Y-Y:--YYY AAAAQA-AYAYAYYAYQAY-AYYYAQQAAAAAAAAAAAAYAAAAAAAAA,AAAAAAsAAAY . A --YY -A,AAAAAAAA-Y-YYAAAAYYAAAYAAAAAAAXYAYAYY-A-YASUAAYY-wYYz3YAQYYY1A--AYSYY-A---Y A-YYAAYYYY--YA-mx-KY51A--YHA fakes'-SY-SWS!-WWMfW"f'X'm'mm'LS'mmf'WEQWZMWMAwww'Mmm'm"f5'1"M"fm:Hif"-51'-f-ii'-ffif'--YYf'Y- -Y-AYYYYY,.-YYAAAA,-AAA.-AA, .A YA A ffff YAAQAA-QYHA-2-WYAQAAAYAAYYYAAYYY-AAAAAAYAAA-Y,AAAA-AAA AA- AYA - AA AA A AA YAAY AAAA ,AAA AA A,,,A,AAAAAA,,,,AA,AA,A,AAA,,,AA,AAAAAAAA IAAAAAAIAAA,AAA,AAAAA,AA,.I,AAAIAAAAA,..AAA,AA.AA,A,A,,,AA.AA,. ,,AAAAAAAAAYAAAYAA,,YA.AAYAA,AAAAYAAAAY.AAAY..AAAA,A,A AA AAAYAAAA AA A- Y- ,AA ,,,, AAAAQAASAAIAAAAAAAAAAAAIAAA L,.,, AAAAA A,,, AAAAQAA A . A ,IAA AA ,A A, , AA ,AA A,AA ., .I ,W ,AAAAMAA AAA, ,,,A AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA,AAAAA.AA,A.,AAAA,.A,A,AA.AA A,,,.AA,,YAA,,AAA .,,A AAAYYAAAAAY-AYAAAY.AAYAYY.AAAAA..AAAA-YQAAA-AA.A-AY.sA A, AA A ,,,.. AA ,A vfy- YAYAAAAYAAA .-,, A I79m,AAv,,, WA AIS AYAAA AAY-qA,AAA.,,AAYAXY,5A AA Y AI I AAI .AY X z A 5 Y YA, gi A A5 , , A , ,A.n:YY'ff,s1Ag51gYAfQ-af -Yum -AAYY ,AAA5YYA1,,AA5.eg7,A .em asm :'e.A,.-1 sa:Y',fssAA QAQAAM-ve::AA:f2z,1A:?As:Qp'rzAAAf?Avc'sA?Y1'sAf-A v'W'7"f55-4 E ' H-fifvl YK 1 YYIS-L-S1-1'f1-lr'Y-ILSYYSZIILYASWA"-fU"'AfY"4-ffs-3:":5'-YUYLW "W 'WSW Yi!! V A - Lf 1 - Ae YYA "M-fziA'Y -261-1 AYA,AYAAYAA,YA AAAAAAYAYYAA,YAAYAArA,AAAAAAA -AAAY AA AA,--AAA,YAYA.YA,YAYY-AAAAAAYAAAAYAAAYIAQAWAAAAAAAY-AAA,A. ,A-A A .. A AAAAY-AAAwAQYA-szAYA-YL.sYfw1AA:YY-YYYYLY-11--YYW-f-YY+YY1' Yifiiiw-fsifwiwfM-sf"-W'-YY'-WYW--YY1f--H-SY--YYf---2.2 -21- -Y"-f'fffsffYW'WY--W-S-YY'fY'YYH- T7 f-Y-YA-'-YYY fYY'--Y-K -YAYAA52AAAAAQSAAYfs'YSAgAY-.AASASATW-AQYSYAAAAAQAWYA-fi Y-QYAAKHAAAYQHYAAAA-,YAAYAYQAYYAAQY,AAAQAAAAAYYAAAAAY-.AAAQAAAAAA Y Y- YAY-,AAA-2-AAQZAQAAQAL-AYYA-YwLAYY1LYAwf-YflfYYAAf2mA--frfsz3lfw?YQ1wffYx2--QA'fm1"fQAAAS'sYYYAAs2YAgAs:gYYAWA-A:YAfYAAYAAAQYAAAYYAAA-,AYAA-AAA,.AQAAAAAAYAAAAApfAAAA,AAAA,Y.AAA,YAAYA,YAAAYYAAAAY,YYw-,,A.AAAAA,A-AA.-s-AAY, AAA. YAAAAA A... ' .Y--as xx EEKZEQQESEZZQAASAQASZZSAali'QfxsA5A1mQ!3xss65Zfsk?fS1gig' H 1 I-zv S W' 54'-515-VSr?5A'lS9Ei6ES7lSSEWZSQYSSAW-gY2Q1sgfgSw??5e2r1EE2kAsAYYsA5w?Z45ii5155EZA,W9s:F56??f'?75Y'lf5Sifl55EfxfT4WMAL35Vl5F5Wl5i?'LfSi371WSf5QW1135?'liifflfglfiilz59i?i5?4'??ZfsS53E'f:5WW'39ISS'1142231SYLSY15LY?5YlLG?15153255riikiqkiii5':iii'Eg5S5iEf':SEL-255215-:YE'fwiff --A Y-S 'S'.S'1g-'GYYYVYYY'Yhlvtf Gfrii. V i,1sAAAY,-xAAAA.fAfxrzgfvxaeAsifm'-Uzmwfzzg-1-eeAYYfYYAeYYYA A ,lf A - . Asa . - .. 1rYY SW AA.YAA..AA,AAvrAAAYY.sz,rALAsz.AsAAmA:w's-wafer-vizrf,-wx-QSA-NYY MJ-w-WSW A-Xzvffif-YS USY1L4XIlYYY1f21SY'-SW Aw: Wray'-:wAA'::YY-YY-AYYAY Y-G AA--MAAAYAA,AAA.,,AAAswzfmYfeA1Y-YAKAA ,gy-AAS,YYY.A,.AAYAgAYYY.,,YYY.AAA,Y,.A- Y..5, Y..A,,,YA,.Q,AAA.AAA:,z,.AYYY.. -Yzz, .:AzAg -WA: z::Am::f:AAA'. -YY-, Y: AY.AYfQ-AAaYAAYAAA:As-,AA-YAAAAAAAYYYA-YAAAAA.Y,AAA2fsAAAYYw A A-Y A , .AA AA- AYAYQYYAYAAA YA YYAYAYAAYA.A,AAAAAAAApAAA.,AAs-YAA,YAYAAAAYAAAAA-QYY-.YAAAYAMY-SYAAAAAAMAYYSYYY-AYAAYY-YYYYYA-YYYASASYA--myAA-HY-AAYPYY-f-YY-211mYYYWY:sYAY:ffAY.f2-AA A A As:-new--mAAYAwAnf-,A,rAQ:A,YiaAAg.EALsYYfiasAA-:ms-QA ,Sn .. - 1: Ayr .. A4 AY vsmsxf- iv f4?AYY' A-' f V -,4rA:ha-Auezn'AE1Mfisfz-AvAxu?5AssAYAMs-AY?3zfir?1XYFYiWibi??1l?YYYl9i-571-S:'5YTl2Y'lfW'12-YYYISYY-211'IfSH-f'fHx1af21A5'Y1LAkW7Y'ki'5:?fP5'1f'P"l5lH7W'11Y- Yi ' -WwwY'AfS'i'2f'11VYYL1f2'is21f1A-H1AL-Hifi'Y1"':-WAY - 5:f71"'---'W '11 army-WxLA?ecFQ?1r?fn7zi"P1119Yugi--fzzxa-As1ix1Wz1"A1-xg:AY'fw- . Q , A - A WAY' Y fi ,ivwzxsis Y- -A - Af ' Y if w iw s5"sz1AsE:1s:SLszAffcA4 AKEAJAiyfszxz-Qiikiiliim-AAFA'f559fA1E5'f1i-S3189'WYAIAYYHYLAQYYLs11zs5'A'srNeAsA:YL: :YZ-eww?Y'AQASTWS'Lgfkiiivf'-fwtfz 29 ,: '.s":271Lf'?':mPYw :Y2zAza:YsAAA5Af:sAYY-:YA.--rw-. zA.LAi.1"Z.5i'- SHS-'2E21"'WAY"Y 33 YAA+AY1ssasAa1YAAflwAeA5r2sYA'-WAAXASA 'eimfff fs-Y' A xA 4eAA52g1eA:2z1se:2Le5f?"2'-AMAYIAQYA1icf?'P2YAeAaAAeAA AS A -sQaAAszs , ,A 2. A, AA S' A A, -- ,YEA He-meAYr-trees-esxY1gewwffAuwzA5szY14sY-AKIIQYAZMAAYYYQAQQQEYAAA-sz' YQ1ilf?fv+5fYf?'Yff1L?22Asi2124s2AZ-bfLawn-Y2e1:2gafAsa:'Ysmsaz -.AirAyes-xiiin-sSi'iiYI1QiaAAeAAA1:ez'.fAseAAefsgv:fm-Yz,saf AAAAAAAMIAIIAA.,AAAIAI,AA,,IIAAIAAAAAAQAALAAYAAYAAYAAYYA AI II I II I III A AAAYYAAAA .I .. AAAAAIAAAAAAIA, IAAA5AAAAAAYAAA,A AAQAYAAA,AYAAAAAAAAAAAAAAAAAAAAYAAAAAAYAAAWYAAAAYAAAAAAYAA,YAl:,zAAA--Aw 1-YYAWAAMY-YY-Q!MYY-www-MYY1-YYYY-YYAww'Yf2A-YYf-YYY 'GYWY--YfY'f11Y-21-9-Y'Y-W'---QY-SYYYY-YW--YYW' 2'- AKWAAAIIAAAIA,I35AIAIAgAIIIAAAmIIAAAIIIII,IIIIIA,A5AIW I A . I MII I As . IAAAA AAA, AAAEQAQAWAAASAAYAAAAAAYAA-AAAAAYY-AAA.QAAYAAWYQAYAW,A52AA,AA,1AA5AAAAAgYA,AAAAAAAA7AAAgAAAYAAAAgYAQAAAAYAYAAA,AAAYYAAA-YQAYAAAAAAYAAAALAYAAAAQAKA- ,Y - A AAQAAAQAASALQEQ,.QESSYAYAA-Y.sYAA,gA..,.A-AAA.AA-AA-Aw-SAA-A.,AwAAYAAAY,YAYAYAY,,.YAA-AAA. AYAIII A,,,.,AAAA,,g,,AAAAAAAYAAAgYAAA.2YA5,sAAmAAAY5AAAAAAAAAQAAAAAAAAA AAAw ASgYAIIAAAI.IAAA A A, IAA, I Y I A? Am A A AQ AA, Y AI AAAAAAA-,YAQAAQASAAQA,YAAAAA-AAAAAAQAQQAAA5AEAAYA3AA-AAfaAAAAYYAAAAYAwase2YYfA?AAaAAs21nw1ssYzAsmezfs-aAf2zmzAsAAYz-wi fi ' fx 'fff-aw1--fY4fY-Sw-SKY-N-H251.WQYIZEYlisu-SYYYWIQWsavgsvzfx-AffavY---ffw2-fvA AAYAAYWYAAAQ-AAAY-fsAQY-:Sn-YYYQSAAAAIQAAYAAAQAA-AAWAAWY-YYYmYYWYYYAAYA-SYAAAA-Y1ASA,,AAYAYAgY,AAAYA.AAYASA.,A - .A -X A as AAS-Y - Am. Yv YA ser YA YfA AYHQYAA-WAAYYYAYQAQ-YY?-YY-ff"-LYSY1LHFAPwsgAg2Y,AAAyAAAAAAA,A.AAAAYAAAAAAAAAAAAAAAAA,ASAA,A5QA,AIAA,IAWAAAAIAA. A, . A,A5AIAAA,AA,,A,AAAA..,AAA-AAAAA, .AAAYAAfYAAAA+fYYYAfY-sw:YY-YYY-an-YYAY-Af---WY-..1w1Y' AAMQYAAA-AAASAAAYAAAA,AAAAAAAAAAA,AAYAA-AYYAAA-AYYAYAQYYYM AAAYAAAAAA-AAA Am,AAAAAAAYAAAAY-MAAAAAYA-QYYAAA,-A YYA-AA A521 - A Y A , Y Y- A-ffSHfAsf91YfsYYw-921-YYAfsYYYwfA'fY1sYS'-ISS'-YWMW-sfY--Mfg-Yxsfi-QSLXYSY'ffm Y'-MY'wfAe-Y11'A-+111'---m-Y-H -'-YYf-2-WY"f'YYY"ffSY1-fi AAHAAAAAAAYYYnAAaffAYAAgAYAAAA.YY.AAYAA.AAAA-A-QYAYAAAAAYYA A .- WAQEEASYAAAAAYAAAAAAAYAAYAQAAAYYAAAAYYAAAAAAYAAAASYAAYYAQASYAYYQYYYAA- AA.A,AA.AA,. A A YY Y A A A YQQAQQYYYYSHMYQY--AafY1AfA,YAAAAsAAAAAA2fwi'f42YAMAAA-SYAAAAA-AAAY-YQQASEYAEYQQYAYQYY-YASYYIAAYYASA-AAYYM-QYA-YYY-YYYwsfsfis-Y-fsvfk--HY--NYYf-AY-fYiff:-225-SYYY1'"1--QiAYW-WY-ffs---1Y-Y----ff1fYY-H--W WQYAAAAASKSAAAAHYMQYAAAAAAYAQYAAAYYQA,YAAAAAAYAAYAAQY A AYYA--,AAA -YA5AAAYA,2AAYAmYAAAAYYAYAAA-ma,Y-meHAHAWY'-HAAsfwSM1zSYYHf YYAA-Y -Y f Y' SYYSW'-fiiflwfi-5ASfYYAsBms921gYYw1AY2YwwYYAA-QASQYAAAAAAQK-QAAAAASYAAQ-AAAAAYAAQSYAYAAQAAQAQAAAA5YYAA-AYAA-AAYAAQYYAAA-AAAAAAYAAAASYAYAAAAYYAAAAQAAAA-YAAA-A.AA1Y,..A4,-.:,AAA,YAA-YAAAAYASAAA-YA,gYYgYYYA,-AYAfA-AA- AAAAAAYAAAAAAAMA,AgAAAAAAAAAAAAAIIAAWWAAAAAA Ag I. , IA A ,AA QAAAAAAIAA A, AA,.AA ,A,.AAAAAAAAAUAAAAAASAAAAAAAAAAAIAAAlA,A,AAI5AAAAIA,AAg.A5AgAMAA,AQAEAAAAIIAAAAAAA,AAAAAAMAAAAAAAAAAAAAAAAAAAAAA,AIAAAAAAAAQAAAAAMA,,AAAAgAsA,A,AAAA,AAA,AAA,AAAA.IIA.AAAA,A.AAIAAYAAYAYASQAYAAAAYYAAAAW-gAYAA.YY.AAAA.A-YAAAAAAAAAAYAAAQAAAA-SAA-YAAY.AAA-AAAAAY-An-YAAzA-AAf-As-AYY-YAfssAw--2Yss- A5AA,guAAgg1I5Ag,,,xAAA,AsgYAA,iAIAY,AAAAAAYAIAWu,,AAAA,I AA A AAA YA AIAYYAAAA Y A A ,S ., , ,, A, ,A -A AYAY-.sYAA,,,AgAAAA,AAAAAAwAA-AYAQYQWSAAAAYAY-AAAAwr 52Q13-YYAAASY1AasSKX1AQ5HWgmAQYH:eYnH1Y1aa2SY?fWAQ2l+QYwfS'AY?ffGf1l1vYWwwfsrA3515-sYYf1iAf ' 'S 'fSY'f2Hg-21fw-1wY-YYHAAYMY-YAf,YYA-YAAAAQYAYAAAA-Y-.AAAAAAYA3A,AA,AYA..AAYYY AAWAAAAAAA-,AA,IA AfYAAAAAAYAAAAA,AAnA?YAAAAAAYAAAAAH-AAYAswAeAmAAsiEa3SFLA,..,A AAA A -- A ,Y AYAQAAQYA - AAA ,A A -41. YfswAeeAQ:wAY5meYY1AYlfNYAYYY-YYYM?gsfi--glam-'f'YYfA:2'2f FS-5YA':41sf2'XfWw'S-SiY'1fYYYY-waifwALSWY1-S23-Sw--512-YYwffffzf' A 4 GS'221A2fY2ffs:2Yf'f--fwls 'Aff--W-H-YYYYYS-P11-Q-2-'YYYY-WY-A--YY"'-Yi'-SY1 AAeA5Afse1s1A5fwAA5sAAA,A:2rv?mEAA2YAAAAmAYA A6222-fffiSK3ax?9gAsQfgfsQ MAYA. -Am HY? -211 'Y 552'-S'?'Y21fS5W11A'52iffiimgfvifwyfffiv'W'WA25m'55fm'E5393KisbiyfWWMRM?5KH35Wb"'W??nW'WWS'f3W5'm5iGfWL' ' Us'Wiff-Wl39f'fW55'WW'-wk''mfiifwi'QV''AskIT5'iMW'::fffW'-:SYW-CW' i2AAAmAssYAg2A5YYASAQWAAQQ-AYQAYAAAAYAwe1AQAAAAQHQAA-HQYAMAAAAYAQAAAMAAWYAQAYAgfAYYAAA,AfsAY-AMAAY. AAY Yg - '- -' -' YHYYGQQYIWIIWWW"S11m55fY61H'3ff?ff-SM'"S-Siimf'QQGfS1i5Y?'Sf6i WWW"f5W"'m"mW5W'g'3W1"W"fMW3f'm? " V557W'ffSY"ffm"'5"S''QWff':-'Sf'-WW''f'W'w' AAAYYQSAAYAYMQQAYW-MFA-A-A,eA.AA,YAA5AAAYAAQK 3 AAHEAQAYAA AAQYAAAAAA-:AAA,AYAAAAYYAmm-AEYAAAA-AAYYAASYQ AA- -' '-AQQSYHMILSMYYwsfinw'-M61-wiY'fwYY' wif-1 WQYYHAAA QA-YYAQYMSAYNHW ser'-'wfffwAY-ffifw-2-YYZ-AY'-SYQ-SK-SY-ifYYA,Yffmef HA- HA-Y1fsY'f5YwwwYwAYffYAYYY-Y.s-YAHSSYYwif'---sas-2YAc2f2-Yf-'YY AAAAAAYAAAAAAAYYA.,AAAYAAKAAAAAAQAAAAAY-AAAAYAAYAAYAAYA YA YY AAA AAAS-AYAAAAAAAYAAAAYYAAAAAA2YAAAAYA.sYYAAYYAAYAAQYAAAAAAAAAYYAAAAYQ ,AY-AAAYLAAYAm-.gaASAYAAAY-QAAAQAAYA-.AYYA-ms Y YAAWALSQHSAQYWYAAQAAPXHA'-ww'Ymfkmffffsiw-A2-SY-QYKYYYWYY-Y-ms-Y'-XYYAYISYQYwwYYYwSAAwYYw'-SY-SYYY-M--YYYAA--Am-S--Y:-YYAH-Y-WS--YYY--Y-Y-Y YAAQ-Mmsss-:wsuY:g:YAAAYg2AAw-AAAYFAQAAA - :A YE AY- YAY-XMAAAIQSAYAAAYAAAAAQYAAQYAYeYAAwfA51rffYAAfa?AYY41sYAggzwi--SYAQLYSSMY-wwf?-61'-f1fii?':'Pwas Haavmffs-i21fsYE'zYXAYAYAYSAAHY-AAAAAQYQYA5AsY,pm-xnAA5sr5-AgA-eYAA-QA.-AAAg2AAAWN,-AwgmfAAnAAamsAAAAA-2fY.QYAAAAAA-AAs-AY-YAYAASQAASAYAY-2AeYYYsSYAY11YY-YHQYHSYYYYY--2 A-mf AAYQ-AQYYAAYYAAAQAAYAAAAYAAA-AAAS.,AAAAAA2A2AAAA.azYAAAA,3- AAY - Y A52 A AA -- -YYAAS-WAASSQAAA-SKYYQAYYIQYAHDHSY-gyAAmYYwswwAWAY-QSAAAAYIEAQMY QAAPAAezYYHQA-15AA--fS1AQQAMAQQHQ-QHAAAXAAAAQYASA-AAAQAAKAAQAYHAAYK.AAA-Q-sYAYfwAQYAWAEAAAYY-Aw QAY-WSAAAAYQYAA-AYYAAA--fm-YAAAA-SYAAAAYAAA-YAYA.AAY-AAAAYAYAemy,ww-f.-:AAQAYYAAYA-fYYY-YA A AAI,,AmAA,m,,A5,AII,A,,AIIAAAAQAAAMIIAAAIIIAAAAAI .I I I , I II AI A IWAAAAIAIAAAAII,AA,A.AIA,AAIIIAAAAAAAAA AIIAAIQAAAAAAAIAQAMAAAA:,.ASIAmIA,AIAAIHIIIBMAAAIII,AAA,,IIIA.AIAAhA5AIII5AA9w,A A5AgIIIAAAAAAAQ.I,AAA,A,,AAAAAQAAAAAAAAA. MAA WAY.AAA,YAAAYK-AAAAAAQYAAAWAYAAA-AY.YAA-AAA--AwAAAASAA-AAYYAAYAAAAAYYAYAA4YAYYYzsYYAY-f-:AYYY-w AAYA-gzemaz1aAAAg1YAAAsS21e5fA,AQY5wAY15A,YAfAAafzAAA AAAAY-YY -AAA: YA , A AA- YAANGAY 2Y1wY54AvAY1fYQYAYAQ,AAm IIAAIIAAIIQAAIQIIIMIQIIIIII IIIIIIIIIIIIIIUI IIIIIIIIIIIIMIIIIIIZIQMIIIIAAIIIII IIII3AIgA3AAAIAA,,AAAAAAA.,AAAAAAAAAAAQAA-AAwAAAAAAgYAm 5 AAA,AAAAAAQAYAAQ-YAA-AYAAAAQAAAAQAAA-SAAA-QAAAAAAA-ss--YA-SYYYAQY.-AAwAs.--W--ffe.AwYYwYY-f--'-YY-Y A, AAAw,,,A.AAA,IA,.AA,A,,AAA,,AAAA2A,,AA,,IgAmAAAA,,A,AAA,A.A,A,AA2A,A ,,AA.AA,AAAA A , A ,. AIAAAAAAAAAAAHYAAAAAIIIYAAEAAAAAA,IAAAWAAAE MA,,AA,AAAA,AYAW,AAQIIAAAAeIA,AYAIAA,AA A ,AASAAAWA AAIA III AAAAAAA,.AmAAmAfAAA,AAAAAIAAAmAAAAA,AAAAAAAAAYAAAAAAAYZAA- - A,AAYAfAxAAAYAAsAAYYsAAAAYYAAAAAAAYAYY-AAAAAAYYA-ASYAW-AYAYAAAAYAAYYYY--Aw---YY-frm A,,,A.gA,,.AAAAAWAYYAE,AAAY,?AYAAA,A,AA1AAAA,5A,A,AmgQ1AA,wAA,,A, AYAAEAAY ,AAAAAwAAwwAA,AAAA,s,,AA AAA, A,A.AqAgA,AA,A,,aiAYAAgg,YAQAYA,AANAAA,nm-AAse1AAA,A,AAA.guAArA3AAAAAAAAAA AAQWEAAA AYAA AAAIg5ga,5gAf,A AA. AAAAAAAAAAAAAYA A,AAA,AAAsAAA,AAsAAgYAAA5MAAAAY -. -A..' Afefm-SYAA-YYAAAQQY-AA-RmA-SAAAA-WAY-YYY.AAA--AYYYY--SYAY-wY-Yl-YYA-wY-Yw--Y2Afs-Y-fm IAAAAIIIAAAAAAIIAAWIAAAAIIAAAIIIAAAAII,A,,,II,AAAIIrA AIAAA AAAAAIAI AIAAWAIIIAAAIAIAAAM IIUAAM i,,,, AIIAAAIAIIAAAAAIIAIMIIAAAAAIAFIAAAIAMAAAAIAIAA IAAAIIIA,IAIIAIAIAAAAAIIAAAIAAAA ,Ag UIIIIAAIAIIAI AAAbmIAAII,IAAA3,,E5AAIIIIA,AAI,AA,AA,S,A,AEAAA,AAIAAAAI.AAAAAAAAAA. I A,AAIAWAAA,AAYAAAA,AAAA,A,AAA5AAAAA,AY .A,. ,Y..AYA.AAAA.,,YYYAAA.YY.AAAAAAAAAAAAAAYAAAAAQ.AAAAAAA.AAYAAAYAAAA,A,A. :A QWAAAQAAAYAYA,YAQYAAYYwY.YAAASAzAi2w.wYAAAAwsi" -- AAYAAAEA QAAQYEAAYAY-AfYAASQAAYAYAAMAYY1sYAwA5fYmw2YnwWYfmAQAAmfYAY.AAwYAWYKQYY-AQAAQAYWAQ-safYMsn-A AYswA4AgAsfA,g12AA-BYAAAAWAAAAAAPAAAASLAAAYAY-Y-94YAAAAsfmgm,,2rA-AAHFYYAAYAAYSASA-QSAAAAQM X-AQAQAAAAAYAvmAfH5AAYsaAA4seAAma-YAgAYAAzLssfA:A:fsAw:-fAwAsYA-YzwswYA-fmYYYYYY--fvAfsYYgwvAA-YAY,Y Y- AEASQSYYQWQYQWYaYgwgAAgAA:AAAYAwAYAQwAmA5wY - -f ' A A -. - Y YYYQQAQAAAYAAAA-YYAAsAAQAAsAY1A4Qz11wA11w1YAAZfif1Y-5'1W21S5Q'55'wggfgfmrfwvixwwkv Wiwwv?W335''i?Qf"'f3WiW'A5'2'M'1''451S'VK3UAdsWm'5MWW"42'A gm 'WI f6'9'mGm5M5'TWW'"S'MH"'WWi""f-"iwLS'I'WWfflifwibffw WML' .. .AAA A AA A A,AAA A A A , AA .. ,A AAAAAA AA A,,A AAA AAA .A .,A A A A. ,A AAA A- A A AAA AY A .A Am A YA AAAAAAAAA AAA-AYAAAAA,AAAAY.AAAAA AA,A,Agm , ,AAA A AA AAUAAYAAA AA AAA AAAA.AAAA,A.AA..A,YAAAAAAYAAA,YAAAA-Y.AA,-- ,AAAIAIAAAAIIIQAAAA AAAAAAAAAQEA AAAIIIAAQAIIE 5 ,Im A A .A AA,A,AAYAA,A,AMyAA,gAA,,g AAAAAAAAA ASA, YAIAAAAAAAUAAIAAAAH AQAIAAAAAIA AA,AIAAA,AI,,AAA,AYA,QIAgA AA AZIAAAAAAAMIIAAAAAAA,AmggAAAAi:A,AAAAIA,ASASMIIAEAIAAAAAAZH,IWAIA,,AAAA AAAAAI IAAAQIIA 9, HA, IAA,A,AA,AAAAA,,,A,A.,AA AA ,,,, YAAA -YYAAA-.AYAA-YAA AQAAAAM YgAAeAAxx,,AA.AAY.wAAAwAMAAA , .5 .- :AA 1- .A. .- , YYYAgw.AAYAAsAAAAAAQAAAAAMQAAAYQAAA- AAQAAAQAYZAAYAAY A-QAM-wlsrg fAeYQw:mYAA,,Agf,z:1f AA AAAAAAYAAMAAAAAAAQAAAEAAAAAYAAAAAAWAAAAAAAAYAAAA AAAAA.AY,AA,AAAAAAAg AAAAAAAAASAYA AY . AAAAAAA-AAAAAAAAYAAAASAAAAFAAQAAAAAA,YAAYAAAAAAAAAAYAAAAAAAAYAYAAAAAAAAAQAAA-swYAA5YAAYAASYAY-Y-PY ABAAIIAAAAQAAAEA AWA,AAA,,A.5AA,AYAAAAIAA,,gAA,A,gAA IIIAA A I, A, A f AAA,Ama,AAAAA,AAYAAA,AAAAAAA,AYAgYYA,,, A IAQ.YAAAAAAAAQA-AAAYg,sAAAfYAAALgsYYAAA,WY-Aw:AgfAAfsYKKsAg,AiAwYY AAQYAAAQAYAAAA,AAYA,,YAAA.A,A.MAYAAWAAAAAAAAYA-AAAAAAAA1AA5AsYAmASA.AAA-MAA?msmw Agw-AQELQYWHww-wY'SYYAw1wvYYKY1-WY SYSYYH--HSS1'---W-f-21"-QHQYY'-W"P5 ,.,, ,AAAAAAAAAAAASIIAAAIQIQAAMAAAAQIIAAAIAWSAAA,AAIQII AIIIA AQAAAAAAA .. , A ,IEAAAAAAAAAA,AQAAAAAEAAAAAAAAWAWQAAA , IIQAAAAIAAAAAEAASAAAWAIAQAIQI,NAIIIAIAQEIAAIAAWAQA Agni MAA,AAA5AAWW3I?AA,AII,AAAAAQAAQAIAA,A?IAAEAA,A5I,,Amy,AAAAAAAAAAQAAAATAQAA,Y - AAAAA5AYAAAqfaAA,A.wAY,AfsAAYYfm-A,AAAAAAYAAQ--AY,YAYQAA.myYAYA-22YYA:A,YYYAA-SAYAAYYY.QYAAQY-0Y YAAQSSQAYAYAAAYAAWAAAY-sw-KYAA--:AY,AAQYAAAQY AY:AAfw.AA AMAAAYYHQQQAQAAA Y AAAYAAAYAAMAAA,AAAAAAMAAAAAAA IA,,AAAWAA3,,IIIAAgZ,A HI HAIIIAMIIAWEEI IAIIIYIMAAW EIAIIIIIAAAIIIIQIWA h IIIIIASIIAAA ,ZAAAIIIIWIIIAAQAAAZAAAAAAIAAAAAIMAAAAAA,,AAAAAA.AAAA,AAAAAAEAAYAAAAA-A A, AAAAAAAAAAAZ,AAAAAAAYAAQAAYAAY.AAAAAAY-YAA,YAAAASYAA,AAAAAAYAAAY.AAAAA..AAAAAAAAA,A-s,..A.,AA,A,. AAAAA-Q,-YMYAQAYMAAQSAAQYYHSYYHM-HWYMAE-Q-Y AAAY . AefQiY,AfAA-aAAYAAA.A?YYAgA.AYmmAAAY-AYAAALEYAAYA-sYAAaA PHAAAMQAJSAAERKEWH MWA" YN'ffiemYA-mA2ffAwAs35aYAA-QAAA-55-nf 11wf"i?f'13ff5Xf'1Wf'Qw1sYY-M33WSSAAAQ-AAASYYAYAAWAAHAAAWWA-Yfgxuww A, mY-Aw,MQQQAAAAAAAAQAAYAAQAYAAYAAAAAA-wgAA.AYAAAHAQAAYQAAAAQSAAAAKYY-AYAYYAMYYYA--NYY- AAAASY QA- ,A Y 2 ,A5AAAAA:iAAYYAAA,AAAA.AYYAAAAHAYAQYAAAA..AA,,2AAAAAwl,0A5A,,QAYAAAQAAAAAISAAAWQIIIIXAIAAAAAIIAAIAIIAQIAWAI,MIAA AAAAAAAAIIAAAIISIAAAAAIIAA,,,A?mIAAmAA5AAAI,AAAAA,A,AIAsAAA,AA,YAAAAgw,AY,YAAA,szA - nAAsmYASfmk,,AAAA -AAAAAAAAAYAAAAAAAA,Aam.I,IAAA,AAAAAgAA,AAAAA,A,AAA,,...AA.,gAAAA,AAYAAA.YAAAA-AY MAAAAAHYAQATAAAA AA,AA,YAAAAAYAAAA,:A,YAAAA,YAAAAXAA Y . AY ,AAWAAAY-AAY YYAAAAAAAAAAAAY-ASAAAAsKYAAAYwsK- AYY AA? AA-HY-AQQSQAAQWYAAY1QYwf-wwf---A-YY'MYnA Ymifsfsf Sfwwmaylrfw YY-SYM-YYY1fYA-YHYYYWEAY-mf-wb-ifWY-MAWAEYK-HAAA'fY1sA2g,aSHAwYfig fsw2FYY1SS-5-Aw-S2-fwYfw1As-YY:'-wsisffznfsvY"'-YAAMA'-vf'ewY-- :WYYYXAAAAQKYAAASYAAAA51SAAeffwfwflgafus-fv1sY-HY:' 2 A m A Y A A :YY , W- -S w Y AQY5A3+suA,Ag5AQA"ssYAAYsAA,,. HAA,AIgwAQAS,ggrA.A,Q3xng,AgaYAA,Af4gq,,AAAAIIAI ,ff A-15AAQAAAAAAEAHim,gAwAAAfg,WAyAAAA,AgAAAAgIgm,15AAI YEAAYYA IAAAAAAA A-,Wigs AEKMAAAYAAAAA2AYAYAAAYAYA-SYQAAAAAAAAYAAAAQLAAQA-HSAAYYSAYQQf-52AAA3w'ezwAAsYY-sffsff AAQSAQAAAWYAAAAAzAHAaAAA,A5gmA2rAYYgAYAYAYAWgQAA, . Q1 AA AAAWA5 ,YAA AAA A A -K , YA-WYfAHaz.A1AA:A3f1eL-.s.gAaYgYYAY,AAAEAQAIAIAAAAIIAAAW,AAA,,II,AAAIimMfA,AI5.A IIASAAAQIIAIAAIWSII,A,,AA,AA:DAAAAA,A,AAAAQQAYAAAQAAAAAAAI WAAAAAA YA, .AA QAAAAAAAY AY ,A YAQYAAYAAAA,AYA.aAgAAAQA?YAAAyAAAAAAAmg.m?YAYAAYAAAA-YAAASXAAYAAK--AAAgs1AAAAYYXAAAAY-AYAAQSAM-f A- AAAAA,IASAAAQ,AAAAAuA,YAAAAAYwA,,AAAAAAYYAAAHYAAAI ,AAA AAA A -A, YY AA A, A .5 A,gAAAgnA,AAAAAL,,AAAAAAIYQAQAAIEA,A-AA,A,AAAsAAA,AAAAA,giAA,Agw A ,AWAY ,Emu AAAAAAAAAAAAAAAYAAAAA-AAAAABAAAAAAAAYAAA,AAQAAQAAAQAAAEAIAAAAAA AAA E AAAAgAq5AgAAQ.AAYAAAfA.AAsnAAAYAAA,AYAAAASQAAQAAAAA25AAAA2Ymy-AAzYYAAAf'-'KYYAAA2YwAAAA-sm A AAIA53A3I5AAAA,AAAA,AAAAAAA,AAAAAA,YAAAAAAAYYAQAAWASAASAH AAAUAMYAAASAQYAAQQAAYA AYAA. -Q Y. Y .. A A AYAYQSYAAHYHAAYAAQ Q,YwYAfsYrAY1w5gmAYYAMYYYAQSQQAA QQQTQSQMAAAASY AAQQEIAQYAAA-wAAvfYYY-HYQA-YWAAAMYA2K1Aw1wasY"YHs -SF' -Y' WH '13 WAASKHYMYYfvmmz-Ywleiffllusffsv "SYAa'1iY--SKYfwfvwlifinsff--vY'f2fsiY MAMA ,AAWYY-QAAAAYAAA,,AAgYAAfz,AAAYAAAAAAAQAAAAYYwAA5fwwYmwAY-AAAAAdsYAA- AAQfY1YAsY:AAAYA. AA Y YASAHSAAYYQAA-YAmAwAsY,gwA,5w-5YwYA-QusAY2us-.Aww YQAAATSAAY- YAsAf2zwAAYK1AaYmAAA2fA-YYYYAAYAQMA AAAA-AXYYY--YH YS - w51knA45YAA,wYrAA,qw:sgYQAQAYYAB.AAYAAAAWHQAAAAAQHQYA-1SYYAAAKWYYYAAAAYAQAAAAYY- AAQAAMAAAAIAA,AIIIAAAAIAAIMA,AAAASAAMIIAAAIIAY AAAIAAA my ,IIIMIA,AA9,,5AAA,AAAAAAAAIAAA.IAIAA,,AAAAAAAIIAA,, AAAA IIIIAAAA,,ASAA,A.AYAE,e3IAA2,,AAAAAA ,YMQAAQAYAQ-SYAAAYAAYAYAHYAAAAW wage'-YAAA H5,?fAAAYnX,YYgAQAgm-.YWAAAAQAAAAYAAAAAAAAAAAAAAAAQAAAAQYAAYAAQAAAAA-AQAAAYYH If YY WYAYQSYY fm-A ''SK:gw1A5fM'iwrA'A'---www-QYA -myAAAAAAY-JAAA--AQAYAAWYY-YYA-P2 Y AAYAEYAASE-eAf:iYYdAlS-AAHAASAAAAQAASAAAAAAAAQAWAQ f AA ,A AA AEAYQA,AAwA,YmAffYYAAAA2YYAA:SYA2AA-AYAAAWWASAYAAAAKKQYAYYMQYSYYA-ffYYY-wYA'fYv1AY-YHSYYMSY?21wvMYY5'f2s'AYSASES-few'iff-swswwif--ifYYfB'YY-S-WYWLSS-Yffbff'-ml'wA,af5'1ww:wYXfm2'S1'sf a'mwfisYf-YixA-HawLTA?1AA--Y1YN2A5iigAAY-5ASA2YmAgfAYAAAwAge1AAAAAzgAAYMAAAAAYAAWAAYAAAQASAAAAA AAAAYQAAAAAAAIAMAAAAAYAAAQAAYYAAWAAAAAAAYAAAA.,A,AAA,A.Ag, ga AA AAAAAYAAAAAQAAA,YAAAAYAYAAAAAAA-EAAASAAAAAAAYAAAAAAAAAQH-AAAQYAA-AHfwAaYw1Q5Y1QrsvwAfwAYfYSYfSr5H-aQf5'fW'91f'-Ygfs- -YNY-EaAAAffmg?1YA1fwAswYYwQAAgXAYQfA,AAAgAYAAASQAAAEAAA. YAAAYMYAAAAYAAASAAAAAAAAKABQYAA-A-A 1,35 AAAAAA AW-YAAAAAAYAAAS AMAA-AAAAAAYAAAAAAQASAAAW-QHYAAAKYSQAAYIAAAYYYAQQAYYY A AAAA,YAAA.A,AAAA.2f-AAA-SANAAAAAAAAQAAAAAAAAYAAA-AAAA eff Aa -A AmAYaAYA-wwwYY1mfwf-SY 'WA-ww-fmYAfSueY2'-YWAYA-Y'f1AYYA:-SYYYYYY-SAHHAAAYHSYA 'HYYY'-KAAYWSQAY-wigY1-AAPMYYYHQYYA QW-QYY WY'-fY-AYYYY2YYYewAYY12Y1A'-wwAQfY1w Y -AMY -2-1 S ff-AYAYH nIfHfYAfwYsw KHYAYYWEZY-AAwYsY'YfY iffwf-W wY2w?'fY1AAfS WA-AsQAA,.A,A,,.A2.IAAA.AYA.A.,YAA,QA,AAAAAY-AAAAAAYMA - A- AA A AAAYYYA MAAAAWYWAAAA-AAAAA,-AAAAYWAAAAAAAYAAEQA,AA,,A.AAA,sYAA,ASW,LWAAAAAAAASIAAAQIAAAA,AAAAQI,AAAA,AmA,AAAAAAAA,,AA,AAAAAAAYAAAI5sA,AWAAA.Y-AYAAAAAAAA,-AZAAAQQAAAYAAAAAYAQYAA5 Az A ws ff 1 wzAA1aAAAfsYA-wr,Y:AAAA,m QQYAAYYYBQYAAAAQA-YAAALAAJQQKQYQWYYAAAAAAY. YAYAAffYAAAAQAAzgmfai-YAAQAQA-AQAAYA,AAHQWYAAAAQYAYA Aw ,A A YAgf2?kfMYY1fwYQHYYQQYW-5ffSYW1fs?1-211355fffQ'Qi1s42'fssA'fS1AYgwYffm:-YXAYAgfm-SAAQYAQHAYYA21AAA-AYAAQAA-wAg-QYAAAAAWYgn,1AsAA,,AAAAAAeAAAAAAAYAAQA,-AAAAAAAQAAAAAAAAYAS .AAY AAA -AQYYAY AY A AAAAWAAAAAHYAgiAA5.A,AAAAAAAgk,AAAQAAAWAAAAAAAQQ5-KMQQAWAFAAAAASAXYSAQQYAAAAAAAA AAYAWQAAAAAAAAAYYAQAAAY-QQQYAQAAQYQAYAAAA,,,AAAQAAAAwAA,YAAAAAQAYAAAAMAQ-fam,,AAA,nAzYAg4s2fwfsYA-AfAYYYAAQ:A-WAAYMY-SAmYfwl-YAY-f5AAAAivsAeYiAAsAgswfAwwvAgfwYAmi':mmf:YYY-inYWAAAYAHAYQAZYYmf2Y1w1saYf1eSYYMHYYYYIAYA-wfmfww-QW? A 1 J -2 3' AAA 'wfws-A21wY:ew:2wAAYYHAAYAWYAYYYYYQSYYA-Sf :Exim-einv .AAAAfg1AAEH:2A--eAsA'f- AAAAAAAAS.,AAAIA,AmiAA.2,,AI,AI,AA,AQAA,AA.AAAAAAIAAAAAA,QAAAg,A,AAAAAAMAA,AAAA,,5AAA,AAAAIEA,,AAAYAAAAAA,AAAAAAIAAAAAAAAAAA,AMG,AAAIAAQAASAAQAAWIAAIAIIAAA,SAA,AAI,AAA,AAAAAAAAAASIAAAAAAAAAAAIAA, ,AAAAAAAAAQAAA,A3AA,n,AA,AIAAAh,,u5IAAAAAAQAAAAAAAAAGAAQAAAAAAAAAAAAAAAAAAAAAAI,AA,A,A5A,A,,,AAAAAA I AAAAAAA Y Y AAAAQAAAAAYAAAAmA,,AAAA,A2AAA5AAAAAAA,AAAA,iAAA.QAAYAAAA,AAAAAA,AAAASAAAAAAQYAAAAASAYUAASAAAQAAAAAAQ, AAAQAAAWAAAIAAAAAAAIAAQAAAA,AASAAAIAAAAAAAAAAAAAAIMAA ,A AAA ,A .AAAQAAAAgAAA,,AAAAAAAAAAA5YAA5YAAAAAAAYAA,YAAAAAAAAAA,wA,AAgAAAAAAAWAAAAAA5AAAIAAA,AAA,Am5AAAAAAYAAAAAYA-AAAAYAAAAAAAAAWAs5AAAAgmsYYWgeHAAQAAAAAAYAAAAAAAYAAAAQAAAAISAAQAAFAAAA,QAAAKAYAAAAAWAAQYAA.AYAAAYgAYAA.sAAAAA,ASAQQAAAQ ,AA ,AAAA.IA,AAAAAa5A,AAsmAA,A,AAAYAAAAAAAWAAASAA-A,,AAAA.AYAAAAAAA,A5AAAAv,A.,g,AfAAw,AAQf5gAAAssYY.aAA-A A--,AAQAYAAAAA,AAAAAY,AAA,AA..A,AY.AYAAAAYAA,,AAIgAAAAAA,AQA -- ,- Y Y- Y A --AwAAA,AAA,aAAAg,AAA59,A5wAQAAAmAAA,AAAA,gAYAAmm.,x?A,gYA,sAAA,g,YmAA,MA,AgAQ.AYAgAAgAYAAA,,AAAAAYWAAAYAA,AAA,95uAAigAAgssYAmsYAAAALAKQAQYAAAAAYAIAAAQAAAAAA,AAQAAAAW,YASAYgAAAA,5A2YAAAA,A-AAAYAAQAP-SYAAESAYA-is QAQHAQHKYAAAMAHAAEQEIA,1A2fggAYsig.sAA2A,AAAQAQAA,gmQAAAYAAAAAAQAAAAIEYYAAAAAYYAAA,AAQAAAYQAA AQQYYAAAAAYYATAAAYAAAAAAAAS,.AAAAA,g,AAAIA,AAAAI.IIAAMAAAA, . I II A. AIAAAAAAA,AAAAAAAAAAAAAYAAAAAAAAAAAAAAAAAAAYAAAYY AAYAAAAAAQAAAAAEAAAQYYAAAA-AAAAAQAAAAYLQQAYAAQQAAAYYYwmaefA8eQSYYAAYGAAsmffyXYAY-AMYQQH-HY?-QYGQY-wfsw--9fmff1QGYYLQYAHS--A22-YSfAff21S1e5'YHYewSi" 1AswAiSfs-YKAYQMHA5 YST--Yfsiferd-iw2?Ylffes-fi-YYHSYAY'-ismfafYMAY-WPsYffmYmY-K-215-Y AAAAQWAA2YI-w-AAf.YgwAafmAAAAYAAAA4YAAAAAAYYAYYAEA -2 : AY A-AAAYA-SAAAAAYQAAA--SnmsfeawSYYsf2QYYAvgQHHSixAH1X-AAMAQYMYS:-YYAAAS'fm--ssYA-AYYAAAmenYIAQYAMQYYAAA-sYYwY,A:AAYAg?rAAgsYAAAfgYYYAA-Sm-QYAAY-HYYAASAQAA-AQAQAQHAfAQ1AAsYAA2:AAYsAA-ww Y S AYAA33AA52AAAAHAAAQ-s2.AAm-AHAAAAQWAYYYYQQSAQAYQQAQSZ-gsmQAAAAAAHAQYYQSAQAQY1545- YAYYAAAQYAAAQAQYAAHAQAAQ,AQAAYAYQYAAAQYAAAAAAAAAQ,AAAYAAYAMA .. II . AS I A, ,I AAAIIAA.AAAAAIAAAAIAAAIAAIAWAAAIIAEAAIAAAIAAAAIAIISI,5,AEIIIAA,AAI,AAA,A AWA,AAA,AIAAAAAIAAAAAAAAAu,A,AAAAAm,,YA16AA5AAAAAAAAYQAAAAAAYAAAAAAYA-A-YAAAAAA,QAAQ5gAAAA5AAYYAYYAYYSS-AWQQAAAAQIAQAAAHYAAAQYQYQAAMEQH M2 Af we Qfwfg-5HK1fY1wfa2lfYs??118Yfffw"W1wfswffwxiYISWMYYYSKI-Q'-fA2'wSYfiY" AAAWAASAA IAIIMAAIAIIAAAIAIAAA IAAIIWAAAI,AIAAAgIAAA.AgI,A,,AA III II .AMAAAAAAAYAAAYAAA-YA-AYAAAASYAAY-YAAAAQAAAWAY.MAAAYAQYAAQAAAAAAQAAAAIAAAAAAAAAAAAAY.AAAAfAAAAAAQA,A,,AA,AAAA3AYI,A,A5A,AAAmLgAAAAAAAAAAASAYAAA-AAYAAQAYAAAAA,AAAAAAAAYW-wAAAAfAAAAAwAY-MY-SAAAHAAAAAAA-QAYA QA, fsY:AAgAmAgm QASAAYYQYAfAAW-Am4:YAAAsK-AAAAAYAAAAAYAYYAQSAAYA-AAAAAAAAwgwAAAYvAeAY-HYAa-Q AAA1A.g,,9s,,A,5AA,AAAAAA,gfwAAAA,AsYA,-SAYAAAQAAAYAAYAAA -QGYAAMYQYAAA-A-QAAA-YHAYAAYAAY2YAYA- -AAYYA-ArAsY12wYA:sAA-:YYMYYASAAYAQMAYAMAYAYYYAYAAAAYAAYAQAMAAAAAEYAA. Y.,AYA,AAAgA.,Ag.A,AA,AAA,,A,AAA,AAgAA5A,AA,3A,,AA,,,,AAAUAAAAAAAAAIEAMAIAAAAAWYAAAA.5AA.A5AAAAAA,SA,A,gwA,A,AAgA.QAAAAAQAABAAQ, A5 YA HSA,,AAA-A,AAAA.A,YYAE.sa:sA,AYAAAAAAAAAYMYAQSYAAAAQYASA-ffm,YmAsx5AAY,,,A,,YAAAAAAYAAAAAYAAA. AAAAAA,,AmuAAA,IAAAAA?AAA,A,A,AAAAAAAAAQAAAAAA,E,AA5AAA2gw,,,AA,AAAAWIAMAAAA.A.AAAIAA,AAA,AAA,A,?AAAA,IA.,AA,A,AAAqAAA,AAAAAAAAAAAWAAAAKSI,AAAAAAAAAAAQA,A,,,AAA,AA5AgAA55,AMAAAAI,,,IAA,A,AAAA,A,AAAsA,AmAmAAAAAAAAY,ASAQAAWAAAA,AAA,AAA,AAAAAAA,yAAAAA,A,AAAI,MANIAAAS,AAAAAAAAAYAAAAAAAAAAAA AAA A WAQAAYAW-YAAA5AAA,sAA-YASAAAAAQQAWAAAQAAAAYAYAmAW-QHmm-AAsArsAAA:mf,mAYAAYA.A, A AAAAQAA,MAA,AAA.AAAAAAA.wYAAsAAAAQmAA.A,AANAA . YAAAAQAA A AAAAAAA .AAAAA,YAAYAQAA-AWA,,QAAWAAAAAA..AAAA,A,AAuAAAAA,AAAAQ ,YAAAAAAAAYYYAAAYAAAYMAAAAAAAAYAAAAAAA,AAAAAAA.AAA,.AAAAA,A,AAAAgYAA,AA9A,,A,AAWAAAAAAAAAA A IiAA,AAAAAAAAAA,AAAAAAAg. .A,AQ.AAA,AYAA,AAAA,5A,AAA,gAAAAAAsAA2,A,AAAQAAA,AAAAwAAuAAAAA,YAAA-ASYAAAAAAAAAAYAAAAA,YAAAAAYAAAA-YAAAYAAAAYAQAYAAAAAYYAAAASYAAASew-YYAAAY-YwA1wAAAYl-AYYAQQQ-SAWff AAAYY-.Am-QAAAYYAWQAYAAYAYAAAAYAAYAA-AAAAAAAYAAAAAYAAAYA A L A 'L-YYAAYYYYu-:AAAYA2AAAwY.AsY2Yfs,2Y-AYAAAHAAAAA-QAAAAAHQAZYMAY-HYAY-feAAAAAQAAAAYYAAYHYYYAAAY-AwYY.AAY ,AmALSYYAASAAAAAAAAAAAAAAQGAWAQA,AWA,YAAAAA,AAAAAQQMAA,AAAAA.QAAA,gAA,A,.,AAYAAAAAAAAAA5,As.gAAA-AAYAAYQAAAAYS.-YAAAAYAYAAAAWQAYAA5,AAwYAAAAAAYYAA-AAAAA.HYAA-AMAAQA-AAAYYYYYYAASAAYH-QASYAAAQAAYAYYKYYWYAe-Y-wYYafYfSfY1Y AA,AAwAQAYAA5gQ2aQ-AwWY,YAAQAAA-YWAAAA-LSYAAY-ASYAA A5 A Y - A AY-A AY YY YA AYAYAAAAAAQYAA,AAA-AWWAAAg:,,mwAAAA,gsYQYAAAYAAA ,AAAAAYAAAAAAAYAAA51-AYYAAASYAYYKASAQAIMSAAAA,Ang-AfA.A,AAAAAIAAAArAA,A5A,,AIgAAAAA,,AYAAALIAAAAAAAAAAAAIAQAAAAMAAIAAAAAAAAA-AYAAAAAAAAYAAAYAAQA,g5A,AAAAAQQAAAAYAAAAAYAAAYAAYYAAA-AY-SAAAS AAYAAQSYAASSYYAAYYAAAAAYSYAAYAAAAA2-AAAAYme---225,5-AAA,QW-Ylvfa-Y IWAAIIIIAXAIIAAAIIIIIww,IIAAIAAAIIAAAIIWIAAAYIIA 5, I I I I IA ,A D, I,IA,A5I,IAAII5AmmI5AI,I,,myAMA,,A,IAAA,AAAAAAAIgmA5AA,AAAAm,,ISAAAAAA,AAAmi,A5IAMAAAAAAAAWAQAAAAAAAASAAQ,IgA,,,,AAAg.gA,.,,AAAAAAw,A,AAAAAW,AAAAAQAAAAAWAAAAAAAAAAAYAAA, YAA,YY-.AYAY--AAA-AAAYAYA-AAAAAAAAQYAA-AQAAAAAQA-:MYAAAA--mA-.MAALAAYAAQYAYQMZWYYYQYQAYH?-Agfs1SvYM YAAAHY-Aw-Yhs2eYAAvAYi5Y1sSYYA1wYAg:f1AYYYffsYYAY2wYsYMAYYA .- . YM S1 1' Y YQ-wfwwA9SYAAAA-maswwlmmg-vYgw121A.HY1AYYY11eYYi,f2Y:wmYYg2YAQ-iYY:mA2,A-eugw,A2QYA'lsAYzAqAwAggsYQAAgyYAg.AYYAQAAYYAAAAA,AA,?AAAAAAA.AAAQAA,AA,AAAAs,AQAAA,A.AAAAA,AAAM-AAA5xAAA,A 5 YAAfAAAAAAAIAAAAAAA.AAAAAASAAAYAAAWMAAAQYYAAAAi..AAAvYAAAAAewY-MAYHAAAAaAwAffwAAA:sAAa-MAYASY AAAAAAQAAAAAAA-AAAAAAAAMAAAA.WA,AAAA,,AAAAAAA.AAAAAAAA,YA,AAA,AA AAA. ,AAA AI A I- ,A Y-AAQAAAWSA,YA,AA,gAsAA5AAAS,AAAAUAAIAWAAAAAAAAHAAAYAAAQAAAAAAIAAAAAQAAAAAA,A59AAAAAAA,A,AAA,AgAAAA,AAAAAAAAAAIAAAAAYAAAA-AAAAAAAAAAAAAAgmAAA,,.AAAAAAAYAAAA,,AAA,AAqAAA,gAAAAAAAAA,,5YAAA , AIIAAQAYWAAA-,YAYAWYAYAAAAAYYYAAAQAAYAA-,,YYAAA-MA-AAAAQAAAAAQAAAAAYAAAAAAAMYYAAAY.AAMAAQ AAAAYYAAAAY-AY-WAYA.aAAAAYAAA'A5A2AAAQAAAYAAAAAAQAAAAAAAAAA-AY-AAAAAAAQQKY-YAAYYA-YAAAAaY1YYA.AA,AAAAA, AAAAYAKAAAAAAAASAA -AZYAAAYwAA-vYAAAfm---Aw-YxYAgwYYA1wAYmeYfkwfwfswAGES'Ami-wAA-QQAAAYHAASYAw-AMAA-:YAA-AAg5AYAYsfYYAAAA,YAAYAIAAYAAAsx.A,YAAAAAAAAAAAAAAAAAAAAAAAAAAYAAAAAAA AAA A A2A,AAAAAQAA,YAAAA5-,YAAAAAA,.AYASAAAAYAAAAA-AAAS-AYYAAAYYYQAAAYAAAAAAAaA-A-2hYAYA-AaYYAAYYAY-YY-SY--YYY AAAAY-AAQMA-sAAAA.AAAAAAAAAAAAE,AAA-AWYAQAA,YYAYA5YAAAAFYYAAAYAAAAAA-QYQAYAAQHAYYAAAAJA-QA AYA.Yew,AAA-AsAAAAAwAYAAAAuY2'+:2gs1A-w1AAq5YmYYlfwSw 'f2YYAYY1AMYYfw MYfmMAY-ASAAAAY--wmYA2Y-AA-YHA--YHAQYYW-YwsY5A-w1"f-YA'-Y-sY:'YffYYAsYA2::A-f2YfA--YY:AwAYYA-YY-AQYYAAAAWAYQM YH-QYYHAY-fYf1AwYYY:fA1Ywus-Y.w:YYAwfAsAm?-SYAAXAAYAYAYY-AY----AAA A,,AA, AA AA AAAAAA AA AA AA ,A AA , A A , ,.AA,AAAA,AAAAA2,AA,2,AIA,AA,AA,AA,A, AAA AAA AA AA,A,,,AAAA,,A,AAA,A,MAA,A ,AAIAAAAAAA,AAAAAA,AAAA,AA.AAA,A AAA,AA,A,A,A,,MAA,, AAsA,AA,,AAA,As,A,AAA, A -AA..AY5..AAAAAA.A5.AAAA.A-AA-QAAAY-YA. AAAYAAAQQYAA-YYYYAQASYAAMYAYYAAWS AAAAYAAQAQYAAAAAY-A Y QAAASAHMYAAABY A,AYMSAAAMQAAAAY--sAAYAAS1AAAAweQAEAYQAK-AQSAAMASYAAAAAAA,AA,AAAAMAAAQYAAAY-HsAAA-AYASYYA-me-AAAAY--YYYA AYYYA--Y-YAAAY-AY? AAAAAA.,YAAAAYAAAAAAAAAAAAAAAA,AAAAA,AA.,A,AA,,A.AAA,A,AAA,A,A AAA AAAAYA AAYAAAAAAAAAAAAY.AA,AY-AA.- AAAYAYYA- YYAAAAA.AeYY-YYYAA-Y--A YYYYY AAAAAA.AAAAAa2gAAYQAQAAAAAAQSEAAAAYYAAYAAQAAAAAY-AAA-2-Awe .- AAAAAAXYYAAAAAAAmA,YAA,AAA,AA-YAAAAAAA,AAY-AHAAAYYAAEAAAAAYAAAAYAQYAAAAAAQYAAAYYY-AYAAAYAA,AggAsALAsaAAAY1YsYAAY-Y-AAAYYY1AQM-QYYYYYYYY-YY-SYMYAA-f2YAAwr2YY-HYYYAYYAZAH-Azggiwffsi'-QwwYIYWYHwzgkffQGY1fAfwwYwY-2Y1-A-Ms-2YwwYYAYYAYY--WY-YewY-zf5iAYAlQfA2wYY:4r-AYQQLYYY-S-Aw--YY' AQYSAYYYYAYAYYIYAQAAQSQQAYHAAAAAASAYSYLQAYWAAzafxiw -AA Y . -11 .2 - -. A Y :YY YA . WYY-AYAAQAQAIAAA-MA,YAAQQAAWAQYAAQAAAA,AYASAIAAAAAA,mgzAAAAAAQAAAAI,AAAAAAAAWAAAQAA,AAAAAAMAAYAAQAAAAQAAAAAAAAQAAQAYYYA,AIA2AA5AA,s,AuAAA,A,AAA,AAIAIA,AmqAgAAIgmgAAAAg,AWQQAAAAAYASAAA-AAAYYAAYY:gAAggA-AQAASAAAQYYAYAAY-Ag-QYAA-SQAAAAAYYAA-zYY-QYLAKAYAAAY-AYAA1-A44wA-s4iA2EsYA1si'1se-YNY! AAYYAAQSYYAw-YAAAAYYYAAA:-YYAAQYYAAAYAAAAAAAYYYAYSAYYAAYALQY.- A . .- Y A -- Aww f2YY QA HAAAAAA.,AAAAAYA,AAAAAAAi,A,AAA,AA,,AAA,2,,AAAAWAAAAAAAAAAAAIAAAAS AW,A,,AA,YAAAAAAAAAAAAAAAAAAYAAAAQYAAAYAAYWAAA,AAAAAA,AA,,AAA,AAAAY,AAAAAA,AA,AAAA,MA2mA A --,AAAAAAeYAAAAA,AAAAA,YYAAAAAYAS,YAAYAA-Y,Y.A-AA-Aww-.AA-QAAYAQAA-Y-HAA--2YYAYYAYYYYYY-YYA.Y-Y-if--Al-YYfAY AAAIAIAAAEA,AAASAIAAWZAAAAAAIIAA.,5A,AIA,A,W,AA.AAAAAAAAMIAAAIIIISMI A I A A ,.., I , ,A AAMWAAIAAAIAYALAAA,AAS.AI.A.AAIA.AAgAA,,IAAAAIIIAAAAIAAQAAAAAAAS.ISA,Au,AAWAMAAMAA,IIAAAAIIAAQAAIIAAAAAAAIAAAAAAMIIAAAWAAAAA AAWAAAQAAAAAIAQAAAAAAAIWAAA,AMAAAAAYAEYAAAAA AAAA, AQAAYA-5YAAAf.Y,YAAAfeAAYAY-AYQAAM-swYYAAAAA-ASAAAAY,W.AAAzilzYYAAfssY:YAefeeA1esfYAAAYH-1YYYAfY1w AAAIAQAAA-A..,AAYLAAAAA.AYAA,AA.A,m,AAA,A,AAAA,g1AAAA,QYAAA.,f5AA,AA,,A,,.AAALAAA AA A A A A AAAAAAIAAAAS,IAQAAQAAAAAAAAAAAW,AAAAAAAQAAAA,gAAAgAAAA.AYAA.,AAAA,AAAA,AYmmAAAq,,gAA,AygAA,QAAAAAAAA,AAA.AA5A.5A-AAAQAAAAAA,,A,A,A5.A,.AAAA,AAA.QAY-AAAYAAAAAAAYAAQAA As-A A,YAAYAAAYAAAAYAAA,YAAAAAAQYAAAAYAAAAYYYAAYYM--YYAA-AYYAAYAYAYY-2-YAYYY--YY YYYYY -'Y'YY-YYfsf2'f1-Y-YY-f- SIIASAAAIISIEIIAQIZIIA,IZAIIEEEAIISIAmII57Is3,5IIaIA3I:IsI5wIM?IIIISIIEIQIIAKILAMIAAA ,IIAIAIIAIIIAHIIIAIAAQAII JSI I I I IIII5IiIaI5iIAAE5ixE5iIIwIIsiI.gAgIIIII5,I,IvAAQAIISAA,Am,55I8.i,AII8.i5I5cE5AiAAIA5IAASIIIAEAAIWNEEIHXEIEAAAIAIEAEQAA,AQSEAISAAZAAAQAAKIAAARA,AI.A,I5Ag,4AAgggAAk.gxA5,gAggjggfgggiggpgb-5 WQS -fA AsAigz3E,xg.gAAsAS'2Lg:-gwA,-Abizawv:sEAf2zAsEAYA-ffa:-fsfimge1E5E6725Isa55?E2EifgifitigsfiiiiiiifsiiqA ,AAAAA,MA3,AYAAAAAAg-fIA,iAAIIAAYQA YAA5 QYAAAA,-AAQAAAAAYA YA A ,A - - . , YAAAAYYA YYAAYAY--YAAAYAAAHAAAAA-AAAAAAS-AA,AAA,AAAg.A,,AQAA,AAgAgAYAA, AAAYA- ,AAAA,9AYAA,qA,nAA,AAYYAAAASYYAAAAY-wx-fuAA,f?AzAa AA -AYAAAA,AYAAAAI5.,A,,AAAAA,AA,.A,AAA,AAI.AA,AI,AAAAA.AAA,A,g,AQI YQ-Yg-YAYQAA AAAAAHAA-Aw? AAAYQfYA.AAfYYAQAAw-YgA,AAAAA,YAA-.AAA-YYAAAA-AAAAQYYAAYAYAAYYAY A52ig-ffw-3--QAAAQA-A2102few"'A YA Y AAAYAA-AYAAYQ-AYAAYAAAAAAAYQA,AAAYAYSAASAYKAAAQAQAASQA A AA Y Y ,WAAS . Y ,, AA-A -AAYA Y2YAAAAAAmmm-AY-A-wnAww-MYYNAf'-mfYw-Y-S11--YYW-YW5Y1'fYYfffY FYWQSWQVXW-'Lf'-WW QWYYY'-W'-XISYSXMYS'ff1S9'fMYfff2Y1"wf U fx ' 2' 'q"5f-Aff'-Wm"fS'Sfsifw-2f1"fw --Sf-ffbf-W'-Yflmfvfff--S--Y-W'm5l'f"'Y" ""-'i'f3"-21 wiYAAAYA2AaimssswusAL2wf3wYge1YAAGQYYAAAIAAYQQY e- . Y A- A A AA sim A. A asAAAAAAAQWAQSSZAAAAQAYAAAYZQAYAA-ggYAQSFYAQSQHEISAEYieaiigeiiAeES1wif'-iw?-EYYSQ'wwis21162522215Yifif?WwQQii31fw5feiYHPMQQYGYWwwfWQYHSYA49YAAgf:.A,a2?2fesYwe HA is wg-A sas B- -Agfwggfz:sgwggfffiz-.'A-mYAfY1Q-21AA-YAA.11beA-AYYAAA-YAAAAQYsA5AA5Assvsiszstsass-Q1AeYi5sx3552., . AvImW?QSii4,q21sAKQy:wa15f?'siAs,a52x5:1A5Qi453??YAbfiikhzxk-Wig-YAY 11-.SAAAg Ygfszx H fi'f'2Ef5'Qix255Zi2??l5PAE2S?15Y,.QVYAQFQAAg-elfMnfilms?15gfiii5Eiiai'?ffi?E?5E?if?7152-Yiikivgfmsirz515SK1S5?5Yffi5"MSWlfiilzfmffifgs?59ZfsfP3??sfWi:ii?5iA:E?Q?'Li:9l'SWW7?Yifwl 53- YG' Whig '29 S E1L5YI1S55?E2295Ir5Qizi9?33iE3???iS5ff7.59sA7iSifEE'-il5iAf5i7YE7iSv35iEbF'-571?-5-fKY--1iAiiY'lfSZ'1-Siifs-YY W' A5A,,A5A,AI,A,AAA,s.,AAAAAA,AAkWAAAA,,AA.MAA,.AAWIAAQAAIAAAAAIAAA,SAAIA,AAAA,AAA,,AAA,AAII IAAAAMAAAA.,AAAQAAAAAWQ,AAAAAA,,AAg,,A,AAAg,AAAIAm AAA,I,AAAA,AA5A,A,A,AA,,A,5AAAAAAAAAAAAYAAgAAAAA.AYAWgA9AAAAAg-AYAAAAYAAAAAAAYAA,Y-.QAYAYAAAYAAEQAAYYYA-YYASYA--Ag-sYAfe:YYYAfsAYAg-YAA A- YY - AY AY. YA AAASYAAAYY-YYAAAAAYAAWAAAAAAYAAYAAAA-Y-fs-ssY+YY.As-AY.,A-AAAYYAYYAAA.YY,,f..YAYYYAY-,,AAQAAA-YA.A-A.A-.A rum-SeatgregYhgwzizxgwzifxs-AAgsns:SxfssYYYAfs:51S2:eeAzY-f5fi5AYAsAX,fH1AAA.2aaAA1:Smit:1,pA,1AAsA:-izxw5sAv2:??r15fY-ASYAAk5zYe2?A5Y-r5zY15f5YA1SLszY9S-Alfsvg2Im:g!'3m?'txsa1?lszwA55zsaxw-:szwsiviAs5'UPfirU?IQfmQFYWHW-fX5YxLf5WTY4Yf4S5HGS5'fXiA f1fS55'2159sf5Li"5fW3:"-sw-S? xW'39Tlf59'i5fY-Mkf PM i -551-S3'ffF5fX'53F1"fff?'"YffS'1fiY:25'ffYi'1sf7"is-'-f3:55'2'555A5'l:' 55Wi55::5'559::fffS9:mS9155551575-W 'V w.22,AAA,A.AAAsAAY,Aema,QAAYAYAAAAYAAAAYAAYYAAQYYAAAYAAAAAYAAAA ,, AAf-AYAAAYAAAYAAAAAYAAA-YAAAAYAAAYHAAWAYAAAYAAAAYAAaA,gAezAAYYY.AYAgw.:s-AYYAAAAYAAYYAQAYYAA-YAeAAAA,AAA-YY-AAAAAQYAAAA-YAYYAASYAAYYAYAAAYA21YA2SAA3Aywagwxgsmg-YAYAAAAAYAAAAY-Am-AQYAAAQYA- Y-.AAAYAAYQA-mesYf,efYY-AY-Yw Q-YHA-A-14-AAAA,mA-A-AAAAYAAAA YAAAAYASAAAAQAAAMAAAYYAAYAAA AYzAYAAfAYw,zfsYfe-AAY:-SYAAWAAAAAYAAA-YY:A-YAAYYA , AA AAIAILIAQMAAWAAIAAAIAI,,AAAAIAAAAAAAIIWIAASAAAAAASAAI .A A AAA AAA,AI,A2AAA,,,AASAAAAAA,IAAA,ISAIIAAIIIAAAAIA,AA,A IIAA,IAAAAAA,A,AAA5AAA,A5A,A,A,AgAA,AgAq,IIgAAAAAAMAAAAAAAAAEIIIAAIISAQAAIAAAE,,AmAAAAMIA,AIIIAQ,,I,A,AAAIAA,3AAAgAA,A,qaA.AAYAQAAYQQYAAAAw-YYAAQYYYQA,YAAYYAAAAAAA.A-AYAAAAAANAAW,AAAYAAwAAAAfAYAAA2A5AYAAfs:YA-QA,,,AAfYAAeAAsAA.a,.,A.2AAAA.fAAYgA.,Y,AA-A,AAAAAAAYAYYAAA-A,,Y,,A-.AAA-A.,AAA-YA-,AAAAAYY-A Y- IAAA.YA, QAMAAAAYAAAAAAAQAAYAAAQQAYAAAAEYYAAYYAAAAQAAAAYAYAAAS Y NAA QS , ,Y A., ,-WYAAQAAYA,AAA.YYAAAAA-YAAA-A,YAAAA,AAm.A,AAAA,AAAAAA,AAA5?AeYAAm2AASYAAAAAAA.AmY.AYA,ALsAAie1.AAA-HYAAAAAYQAYAAAAEAAQYAMYY-AYYAAMYYASSY.YYAA.AY-AAAY-A-Aw:A-fAAsf:c.A-YYAAYAAAYYAA,AAYAAYAYAYmAYsAAAAY-AAAAYAAAAYAAYAAAAYAAAYAAAAAAEQYAAA-.AAAYAAAAY.,:YAYY.AAAA.:AYAA:,A-YAYYAAQAYAQ-.:AAA,-.AA..AAQAYYAAAAAAAAA.AAA- A- AAAAAAFYAAYASAAAAYYAAAAAAYAAAAAYA-maAA,AAA.A5AAY.gA,,YrA YA A .AQ SAA - Am --A .AYYsfsYYAAYYAAAYAQYA5AwYYAifAYAAAAISAAAAAAAAAAAAAAYAAQYYQAYAAQYAAASYAAAYAYYAA-QAYWAYYfsgY,gQ'f1QYAAs-YQ-W1Aef2Yre,AAAwAAAAQQAAMAAAAAAQAA-AA,AAAAAAQAAAY.AAAYAAAAAAA,AYYAAA,AAYYAAAAAAAAAA-AAASYAAAA--SAA -mAAAsAAAAYAAAsAAA,A-YYAAAMYYAYAAYYAQAYAYA.wY-YvYY-YYYAAAAAY.AYgYA:s1AA,wYYY:.AAYYYYYYVYQ-f1YYY1'--2'wwf HIIIIAAAAIIIIQAAYQAmAIA,AA,IIAiA9,IIMIIIAISWIQIEAI I AAAIS I .III MIA I I II, II, IIIAAIMIAAAAQIg.IIIIW.IWAII,A,AIIwI,AAAAAAA,AA,A,AA5A,.QAASAAAAAAAYA.A5A,AAAAgAAALA,AAggA,,,gA-,MAAYAAAQAAQ-QASAASAQAAQAY-YAgA-fnAAgAY-Ap,ggYxAAA-,YAAAAYAAAAAAAAAA-AAAAYAAQAAAAYAAAQ-A, SA AmAAAAAYAAfAYAA-AY--Y,Y-AAAA-AAA.,A.,.A,Ag-YYA...AAg-MAA:AYAAQYAAYAAYAAA-.AAAAA-AAAAAA-AYAAAYAA.-AAAYAAS, I . ,A AmAAAAAAA..IA,AA,AA,,AAAAWAAA,AAf,AAA,A,AA,,MAAIAAAmIIIAAAAI,AAAAA,AA5,,, I I , AA I IAI AAI I ,AAA,,AQA,AAAAAAA,AAA,A,AA.,AAA,A,AIA,AAIIAAAAAAAAs,A,AAA,AAAAAA,AAAA,AA,AAAAA,AAAAAA3AA,AI55AAIAAAAAIIIA,,AAAAAAA,AG5AA,AIA,A,IIAAm,AAAAAIAgAA,A,A.A,AAAAA,AA,AAAAAYAAAAAAA-AY-AAAAAAYAAA,YYA-YA,AAAAAAYYAAA AAA AAYASAAAAAYYAAAA-YYAAAAASYAAYKAAYmYY.AYA:Y-YY-Y1YY.YYYY-QAYYY-Aw1:11-YAv--HYf111AwY11fsYwfY-1-YAYYY11 1- - Y ,AAAAAAAAAAA.AAAAA5A.mA,AAAA,AAAAAMAAIA.A,AAA,AAAA,,A,AA,,AYA,A,AAAWAAAAAA,,AA.,,AAA,,AI III IA A ,AAAYAMAA.AAYAA-YAIAAAAA,AAA-AAAYYAAAAAAAAAA,-AYAYA-wAAAYMAAAAfsYAA,As.AAAYAA.AsAAYAAAAAAAAAA.AAAAAAAYAW,YAAA,AAAAAAAAAAAAMAY-AAAAQYAAAAAASAYYAAYYYAAAYY-QYAA-YY--SYMww-YLYKYQYF-ww-W - www:'A--wf'Y---Y'Aw--YQ--AY-S'-Q--w---WY'--2---ef-S'--H-S-M"-QfYYYA2YYYw-Q1121-fr' AW AAAAAAAAAAAA,AAAA,AZ5A,AA,AA,AAAIAAAA,A,AmA,A,,ssA,AAQQAAAQYQQAQ-AA-AAYYS.YAAAAAY,AA5,AA,AAA,,AAA,.A,AA.A,AAIAA IA.WA,YAAAAAYAAAA,YAYAAAYAAAAYY-QAYYAAYW-QAAAAYY-QAYASHQYAAAK:WY-sYAQYAY.AA,Afs1QYrw,-YYAAYY,Afs1YYgfQngAmYAAAAAQYYAAA-AAYAsA,AY.Y.ANewMAA-YY-A-,YA-e:YAA-AMAAAAAAAAAAAAAAAAAAAAYQAAA. - AKA51,-AYYA,-A,A.A,,-w,,YMAAAA-YAAA,A.AcAsAMYAAAAYAYYAM,AAAAAYYAYYAQAAAA .... .AAAAAAYY.AAAAAA,AAA,AY- - . YA.AA.S,:A,AAAAAAYA,,YAAAY-QYAAAAAMA-QAAA-Y,A.AA,A,AAYAga-AIAA, AAAAA-A,AA-A-QYAA-Y-IAAYAAQYAAAAYY-WY--SY-AASLASYA--w.AgAAA.AAYY.AAYAAAs,YAYAAAAAmAYAYAAYYY-avAma.AAEAAA.IIAQAAAAAAAAAA,AAAIIAAAAAA,YAAAA,A,AAiw,.A:AAAY,AA,QAA-A,YAAsAA,:AAAAY-LQAAAA-QYme-YY-YA-AQAAAAAfa,AAiAAAAAAA.AAIAAAAAAA.,AAA.AAAAAAIAAAAAAAAAAAA,.AA,.A AA,A. AAQg,AA.,YAAA,,YA.AA.,,YAA.AAYY.AAAAAAAAYY.A,YAA.AAAAA-.YYAAWAAYMAAAQAAAA,,,Y,-vYYYYAYY-YA As-AA-YAAAAYY A..-,Aga AQ-Y Y.YY Yr AAAAAAAAAAAAAQAAAAAEAQAAWAAIAAAAAAAAAAAAQAA-AAAAAAA5AI5.A,AAAY A .AAAAAA,AAAAAAAAAAAAEAAAAAIAAAAAAEAAAAAAAAAAAAAAA,AAAAAAAAAAAAAAA,AAAQIAAAAYEAAAAGQAAAAAAAAQHAAAAAAAAAAYAIAgAYA5AMYAIA,AAAAAAwhAAAAAgAA.AAU,AA,AAQIAAAAAAAAAAAAAMAAMAAAAA?AA3AAALAAAAAAAAAAAg.A,A,AAAAA,sAAAA,AQIAAAAAAAAAAAMAYAQAAAAAAAAAWAAA.AAAAYgAYAAAAAf,AAAA-Y-QA?AmesA-A-AAAA,-A.AA,.AAA.,YA:-YASAAYAY9AA.AAAAAAf.A.AAAAAfAAA-A-.YYAAAYALA . A AYAAAAYA AAAAAAYYAYQAYAYAAAAEAAAAAYAAAAAYYAA-AAAYYAAAYAAAAYYYAAAYAAAYLQAA A A,A Y - - YAXYY- YYAA-YA5YAf52YzAs2AfQfsssYfAYYs11fssA--YYYAefHKAaYwwf-fYYfAY2Y1A-Y1Y1Y1211Y-fYYY1ASwfLY-?'fYKA3MWF-5--Qi-fww-Svff'Iffffk-YM-21'--fifcfflsf'L--52158-'Qfi'SSYYA-21W1W121YYf'1ff2Y-YY?''12YYZ-fSis5Y12?M-f2?YYY-iwff-2-YmifilbffY1YY'2?fY2-'I'--5:12212Y-WAHSS'HY-f-Ifez"-'ff-P21-S-S--Y-1-Y'--'Y ' AIAIMAIIIIIAIIMIIAIAIAAAIQAAIIIAA,A5A?IIIIIm,II5IIIAH ,IA 5 H ,A , SIIAIIIIIWI,IAQAAIA3AAIIAIIgMAAAIAIA,,AgA,AAI,IANA,AAAAAAEA5,EAAAAig,AIIIAAWAYAAQAAAYAAAAAIAIMSQAA5AAAbAI,A,AAAAYA5AAQAAASAAAAAAAAAAAAAAA-A,AWAMEAYYAQZA-YAA.AYuAY--YAY--QAYYAAYAAA.A.--YAfA,YAA-AAYAAAA-AQAAAYAAAA-AYYYYAYAAAAA-AY-sA9iA.AeAY-AAQYM-2'.Qszf21222A522iAse2A4Yf'L szikiikiisv'54ZA7Au,sEAeAL:4YA4L5-YAAEEHE-Si'i4i?z53w.A,.. 3 1 K5-' if -whit'-AY 5 A.s1: - QFY ' ,Yizez YY Qzzyiamg- A . V Ag Y YD-sn'Qi557231Y-E6zL5?31'i525zAiA5i5z12Y5i'i-Yl?sfA,a'Y'9'A-5V1LSF52ffH1W5-Y5YQ5'42Iiswiliwfg'iifiiiiSff"V-591457-WQZFYIQ-SQIQYQASY1g5IA25l21sYZ?l?fS355i :?5A.A QE i5iL??L??i5z35?i'k55?iF1iL4l7lW53131219'NT'115-lllnfif--595-2YPY'g21LfgLffSS---PMS-fwilssilfiin-AiSsfYlA zgggg,-,HY35515921iiiigaiikiflgixifaef:AA9QA.s5-152-sz5f7A1QSii'EUQ3EA2?3iZSi:ii7iEAg lisif? A 143 A ' 3'i"A A, Siilidiikif ' Az A 3 A -gy 5? ggi YA -,AQAAAAASAAQAAAASAAAg,g33Eggsf1:g535gA5159sA,5sjsAAgfg7z1A5!iAAiYYA2A55515A9iliiii-iE7AEZ?LA5-5EAxi5?i,i5Ei57i!iZ45?Gi555lU5S5'Y 555 E Ssfilezv'-Asgzxsiflxf-9?sA1Y-f?AE3L?1??.x55:is5EiiAiA773i5sf3?555Li?555A551523'4!!i53:!iiif'LA?SEZSfE5553-7'lS-Y'1225 A55237ElI:5:i'?-5LSfZg13AiY?:TABS53Z5?I:bf7ZQz1A5?SiiTfL?3E5fT'li gt bgQfk'A"'l3i1'3l:'T-597Q3A?l55?i?Qi?iZQ?f55??kEW5531533532551'Liglkilif-Zzzlk-Q3Qgfez'-6Q.AaAQ5YAAIA,AT " A 'V YA i5iiLi?Eif?2'51E'i35fiSE?f5f5iL3i551Qqf5:s?52i51AgaQ5?iTi5f'?2i5ikfilibiiiliilligii15554WHH'Y3E5??if'3555?l5QZQASEKLWS:iw-isi9'?i!5EiQ9EA553ST55552?ig5A5Q2E?N352Y7'ZggiiiiiiiiiiigigiiY,551S3551AfZlyizgififilflfAMTAAQETLE:Liifidfliiliiiiifili A'g5Effg,3iz-MAE' 1-f?liii3A:3i YQAYQAYQYYAAAQAAAAYAA-QAAmfsssffb-zYssYYAfs1AsAfeQ,'AAYA2-rss,A' :AAA,, Af-.AAAweAwarg-YAAASQAAg.AsSg.AgwAAfA.AaAAAAAAAYAAAAAAAQAAYAYQAQAAaAAYAAgYg1aAAsYgAeAzgzAxAw:sY1gfYAAAYAAA-,AAAfYYAAYYAYY-Q25A-Y2AgfAYYAaAAYiwA.sigeifweAsesY2g4efYA+Y21SYkAs121A2f1ff1A-AYY2Yf2AgQ2fiiifwz-SYZLSSSQSSSSifff2,2ff5'fSf?wf?'-SQfglsfa-We-WE'-iw-5-5'--SSW-Q'?"Y'f'W'W Kff?-W'2Qfff"f'3-LW-'i-'TSW-WiMW'A ""WfiYf"-f V'Yf'---qfffs HA iff-?i1A51a2AAs::i,seA Ag:-'nf'-miiiivi::gf.',i12?YSSi11' 2 SYY 1 a 'msgY-sziaiez'WH,IfJTEAAV.'jgliillg-vain:mann::Aa,m:AAL:z:1':e+2Afg,As:1A,1.,ns-YY-sifbgmais:,AsSiig?7iEQ?'v5ffS,?S:W-Qif,TZ?YY'12SSYffS-AWKAAY ASA'As2z,Azi:,YAfSzf-QESEYY7iSiQ5?WnFy'1-55'--Sf'fYWY'ffSSlhff1N'51iiiAY"T 55" YJ' 5152: Ii?,zTTL6fY,EZHL-32WlSi'5fY'EEZlSqiili---EGF? 159211 "W-MSSYSA was--NYvAafY.xfYfft:5iY1.fS-wiv:":7Ai5j'A -SAIL"-YYYIA 119- 'YW' w?AAA,AA.AYYYAA.,YAAA-YYAYEAAY-.AAf?Y.YAAA,Y.A.,Y,.A,As,AAAA A A ,- A YA A- fs.A,AYYAf,Af-,.AAYAAAAAA-M,AAAAAA-AYAYAAAAAg.AYAYAA-AYAA-AY-AAAQYAAAYAAYAAAYYAAY-AmAAAYYAY-AAAYYYA-YYAYAYYYYAS-S2-YYYYfYfYA-2--SYAww-S1113-YY11swYwahAAYA-AMAA:-YYY---sfAAAYfw.A-AAYYAAYYA-QYAAMAA-AAAAAAAAAAAAHQYYYAAAQSY -QA A A Aw.-AAA-:MAAAAY-.fA:YA--:AYAYYAYYAY,-AAsYAA AAAAW ,AAA,AAAYYAAAAA.AA.q,A,A.3AAAiAAAAAWA3.1.5,-,AAAA,AAA,AA5,,AWIAAAAA ,AIA III,AAAAA,gAA, MAA,AAALAAAAQAAAAAA,AAAA,AAA,A,AAAA,IAAA,,AAAAAA,gA.A,AAAAAAWAAQAAAAAIIIAAAAAAA.YAAAAAAAIgAAAA5AAAYAAAAAAwAA.AAAAA,AAA,,AA,AA5,AAAA.YAA,AAAAAAAAAA,A,AAAAAAAqAIAAAAAAAAAAA,AAAAAAA,AAAA,,AAAA,A,AAAAAXAAAAAAAAAAAAIYAA,, I AQ- I AAAAAAAAAA,AAA.A7,AYA3AAAAAYAAAAAYAAAYAAA.AAAAA5.AAp-A-YYAAA--Y- .AAA.AA-,AYYY--,...QY-AAA-e.AA-A A-AAQYY.AaAYAAAxA-SAW.,-A.A ,AA.AA.YA.A Af- A2-ixlf'Azfksiliki52215515255-AvY:Am-s'13:21lfsiiziivzffilgiiii3531555211552Ys5'X15AA,z'-521AA:sfeA:'A21Lzn-:SAQQEAQE LAil5553!5553552224515?'ELlQiE:'5?Qii57.SSE3Ef57Ziyi?:Q?liSF1lfWlZSSl12-WISYIA-21999'L-PYILSYHQ1555i53??1i55i?Z5511:5532:2iZ55i?'E?iLZlSf5'Wsffiiifz'1Y?a5?E57il?2i55SHA-kii"?ZV?fk:'Z-W2G'VIfYSSw' '5 'Y' H2116-'L-W'-559-5111115525liflvifiifiil' ?Lf11S5-3595555575-Y VA-YISE?53f?Ei??'f??Y?5?27123454157221'-'f-lb-125:'L-5' 217--ii" YY-it "W q'533'L5f?lf 1125: " YL QAAYYARAYAQQAAAYAA-AAYAAAAAYYYAAA2AAAzw-Aa:YA.:--AwQYAAAYAAAA-YYAAAAA1AA?AAmmQsfYA511,fiv?w.Aszi-:1AA-QAQYAAAY-.AAASAYYAYQAAAAAAAY-,Yu-AAA-QA-AYYAAASAAzAAsYzms2YsAs3Ams11AssAwAEg4HsaAAgAaiAssY1Q52'Sawsea-'MW-SWY--21A2vAA2Y?wY2s:Y?'iiawlesisfiwfs-YAf2v:1s571Ai:AVA:i?sYwi:Y2'-ws?-1:?E?Y11sf?YYYIYEAYAAYAYY.A-RQSAAQSWYQKYss-ffm-Ylwvlwzwvvf11gAs1sYYf-ff---f Yi-YA1-:AAf--:,Y---:ffmis-2-2-SKY2?:sY22if222effwis2AY-YY1--fig-' A YAYYY-s1Y-A-f2'---YfYv-1Y-Y -Y-ws- Sham,.iki1f2?,i5fA:QA5'YLSEZQQIEIAAASL-A-3gfSz5593155ziwifiifv U? A17 A 'LT T'M'-1'-Jfeiszraiili'A2-if13f7e9?t',Q:5?iiS3?giYi:L4iif.iS25A5??Q3i5E?Eg?f:EA:2-if1L5?5il55'5SIQiYigkS7ZAf3'iefg,'4ffY5S1YQQ511552Y11531-'E1si55Af5Yil2YY2f5IA5S5535EQ?3TQTE6E7LA5E5?L5Sil5eifgibi-53-Q1s1351fGr7A-7A25I5552lS5I?iIi5i?g53Li5f'LEQ252gSiyigig2593g15S55L1SY9'g1siYigf5fLiYL1si?'fAfiv??YAfSQi?S'2?.53Tgif55521552E5?5??EQA:::giS6f7L!21557QT5YLS?F1?Q.!iiii1iQZ.li2f5' 227355-526-SELATYLQQEYL17451Yggiififf 3? 'YSY?31l,.Qi1EL-5LkTAE!E'iLE gg-YY " Z-Y -'ELM 'fx swiss- ,gygggf wig-,gAY' ""'""i2-YTYZ-ffY,, .A2fA2YY -His-flisf Y i if-m""'-'Q' W f ffs ATT'-1S53YfQ?Q?ffK?f55''f4f45355156Af535'I53'7i51isgii5E?Zg7259L'w'F'i!fL"55Qffi:W5' y'i'i'i5Sf'1'72i'i? kMM"'i?" :mi555,-Wigsflyt1sArA:1ixggY5:wei-gyA151AA131114fiEigij1g5ff55l5t1fAftllsxulsarwlezmgwxxmwsgsiYYA-mA-iA2g2Z3,?S11,g-AY5Q9fgf:7s1i'1jAs,7L5sAA-AYMSAA, Yr, -1' - -ff, Aw-13:,Yn,aWs:m4Azsexiwmwsiiwwf:Lf7fiixgiifiii'fi?i:z2,iA,YL55ETbYg3f9YAQAAMASAg-5YgYLA.5,,gI5g,gglggsxx!g1YrAa1:A:sz1591223.Aswiss.5s1i3fA,:v:Afwi92:eemAf2AAs-,z:fsYg.ef?AA.fis55'?YAZHMFSSFTQs?iifffrgllifbi'WGS?5:7:SEW7Si:if-.5l'Wff.-'ll:f7 9:':77l2?W'b:Y--STIPYTY 'A-"':'5-wi. :ex MW" "" "A-Y1S's'Y-it rY,sz?A.7':4- QIIAIIIAIIQIIEZIAAAAIASLIAZWIAIIIAIIISIISIIIIIIIIIIIIIIIIIIIIAIIIIIIAAIw.IAAAIIIAIIQSIWIIAFEIIISZIIAMISAISIIIIEIIAIAZIWAIIIAIMIIIAI.III?IIAIIIAAIIAIIWIIIAAIWIAQE SVIITIIAIII.,wwII.,AIA.A,Ag,AII,55.A5A,I5.AAAAAIAgAALIAI,AA5,p5,A55A!A,AY,AAAdgAIAQYA-IM-1555. A5-EAAAAAASAY.7ISAYgqfigg-iiL5Q2Y5gg515LA5,A.YAAQQ1-2:51 Y5A:5:AszA5A ALAAAAYAY5-Ariz:Awgg..zz::1A:::s9x:mfsAm-11sAsAfsA:YYzzm,Y.fe5-A-A ,1A,sAL55'f5EAWAYiAizA,55g3A YYX.--AY Y.A,AA.,I.,, I WI MNA IA-LAY, AA-w,AgYY-3,4 355'Hi-ii?FlliifiH321332:5515523523L5SET2EEiETiQi57Z?7QA??24iiEW9?L7if'2511-E513YzzgsiiY?iE?f2lSE'Zs55LSiE5f4i15572255233537.5212-SFHL?iii'-555315-55'Y-Yiff'-S2je-izgmvzz:LQEAQQSSZSQEQYf51Af5E537Q5'Fii'EQsf?Zi?'A555i?SWQiA:i,E55iifsiii2L5635VQSELQTSYQH-522155-YiYfs55515552155W'4!Qi?2E5AiQ2fYLl52Y155135 5595 1 515395.31 s-YA1 3 A5375'Ff?S52i1:5933ifAi5ii:fL5i'.lELi?LT?LS3ET5iY2EE?'f?2EE155532QEYQYL5?L-715-WEEAifiTEiE1'jTTSWQSEU 1 -'qiifiii ', KWYQQELYSE: fansiiiefsaxzmvALQASAQAAAQgfssigs?SASTLAQSQQHQ-isfa:YAASQYZAmzYYYAiAAEYA2eiiA24Ysigs221AQsafe-ZA!Yiaiiwaif-gfggq-EA.AA1EAQZAAL-'wpQLAYYASSHSYL-YYVZAAA,ifYYAQYIAESETASYGASQSYQQQEwEa?3S2A6sS2AAZ924:-55352LQSZAAAYSQQYZQQAQY?gss?as21siAA:iA--221123192Y2YZ!-iwS5Asia-YzgAY22g,A2f?1A5QLYiA' U As SY-'Yfbf-A5222EAW.fsifiiuztizis-2.215-i2AsAsggs-if'szsivffglsmszg1YAezi2YL.af-vzvrfwzffqY-Q21-21-A in-S" Y-vi 'iw IAIAIZIYIAALAIIIYIAIIAILI,IAI.IAI.,III.IIAIAAIIIIMAI,I.,-I.I,AAA.I..II-IAI3I,AI.Y,wj,:InqA-A,Y5.g'-'wi'.YSf'?fffS-Y'A1AALgIiA.ApYIAYAfrA'i'-i-'JAug-H.AYAAQAw,-A'-wQ.YA:zAg'.-If15.5.-A-.-IA.-'.,YAA'A'Y.-'AQAswf:-'f.if.YY'A."1 ' , '-AG.-f"Y:1.AYwY'Y'mAA'A'-'Y'.A'i-'AvYY'uf.-'A-Y'.-'A-Y-AY'-Af-SAYAYLY1,wAY'..-YAzY'AYf'.fAyr,-':ASwAASi'.gASwAuwf.YfA'fAAY'.'A'A'LYAYAS2-'KA'Auf-1w'iSJ'Af-iS.Ym-S'W-2-f'A'1-A.f1'.?'AW-11'w'Y'.-'QA-.YAA2-Y -SY-if? 'S ' --Y--ff YYY-Y' "W 'gifL?25w2g'2.A32421i2AwAAQfs21Aimsfiit'-sig-Asszizeszfigs?ssissifA-sisfYA,gsAi.AA-ii514321-Y A ' Y" -A WA2QsSE321SS2YQEQiEYZ22-YFE2AL2YQ-2YiA4YYAAA15AA-E4ssAf2YA25'ASgAYSA221AA1QsAAAA-Asss.AAgzsaz?gsfA.g'- AAA fl A2QL4QYif7A:2wAs2YY.fAz2-YYWAAASAA',As-TiewwfA211A41A2Y114522-Yfsasimmieszig.AQHA-weeA22-25221wg-isz5YQ4iAfiFLif:3Y2if2L5Sl-iYAL1e2?Z1ffi7L4esYz5sYA5252.5Q1Q2214fa1Y2ea14aaAAAYSAAYYYAAQAQAQQAAAMQQAAQYYam'AffAmsifhifwifiiilffiwfifwiY'-QYEWAQ'-5-f?if'l-5'Qi?4Sf53Lfifizlifzlfvifaiifif-YY41AAAi , s. ff? z2fYY'w.'Y:-1,'A'-fAY'w.."'3-x'-A'.''iYwAf'-3Y'AY'--.Y".Y'AYA1'A'-'AYA1-w.Y'.'"AYA':-Jw.-1Aw.-WAYY-:-2:AA'Jw3.A"A5aIY:'Y',-9:61Y25A'.1z'Af.fA'A'f-'A-.-'A-u-AA'.-A'f'Af'A'.'-Aff?-.i4Hz''w-'A-'AY'.-Aw-fl-'Y23-'AYAA-Y"A'YY'AY'-'AY"NYU-'YV-'A -ffl-52'-Y ww:-AwA1422-4fsA:?LfQ2AfY'saga-.AY-mfwzzAAAAYweM2122-A:z:AfYiQsi?iAYiss? QSAA'A2e21z3Yi'.AA-f'Yiiwafmiis-EAWYA-:gs-AY.f,YY-A-YYAA-YAAYAA-AY:-AYYAASYAAAYYAAQ,Aiesi-qw-Alle-AAASYA Q-A-was,gisYYy4e2tf'isiALAsi2:WS3AYYA mg 1552-Af-g4z2AAaA:AsYYYY-'AYYAS A5QwtY2LEfe2i'w1A'f2x:s-YAQ:ALASSAQWYAAYZESLAQEN'-AezwfiiliizigieiA-AYi.'sYg1AJf22Li4b52Sf?Gif'K52''5f?f155ifi5'f:5f'fWlSY'-'lf'"'A---H'YfA.A-.QQAYAQAAA-siA212'fY'Y.MAPYf'2f 'YY:AsYY. SAY ,iiiy YY Yi-Y-YY. wII,QAIgAA.5HgIAAIAAA,AAIA,.AgIAIAAAAAAAAAIAAAAIIEAIAAIAIAAAIIWIWAAAAAAAAAQAIAAAIAAIAAAQA,AwAAI.IAA,AAI,IIAIIIAAAIAAAAIA,QQIAAAAAAIAAAAAAAAAAIIAAIAAAAQAIAAIAAIIAQIIAAM,QQAAAAAAAAAQIAAIAAQ,IAAIRIQEAEAIIAQIAAAQ,AAZIAAAEAAAAAAAQA35AAAAAAIAA532QA55wgAA2ALYAs3-sysgiQsgfei?zgQ2szAf5zAsfwAgYAA?YAYAQQQAAAAAYAAAY-QQAAYYAA.AAAAQA-AYQIAAA-AYgAAA.sgf4SAAA?AA-AYYQYYAAAAQZAAAYQYAASAQEAQAAA.A-fpssifi sssf:AiigYAgfsSggAfeg:qA A, atGAMMAA-Amgsalm-AYY,:5eY-AY.AAYYY.AA--,YA-A:A,A.AA--,YAAQ-EA:AQAAYYAYAEAYA-QAYAYL-EMASYYQQSYAAQEWLQ,:AzAA,YYA-YY.A-AY-AYAAA-YQAYYA-AYAAAAAY,AA-vm,AAAS-.A-,Af AAA:AMA-QA:--AYAA-AY:AfAAA.,AAA -Aw-,,iA3AAfYAAAaYA'AwYAA".,235-Y2,4A,Y-YHAWA'-211151 -YYY' m5,,a2fiYe2YHYY''YYY'-fm-P'-Ygllf'--SWAC SEEMYAAAAAQAAA-A52AAA2si2LfafiA2AieA2 AA1',sfA,2eLe,QAAAAQALQAIQQQAYSQQAAYQ15'--wygfzgs-YA::AA-YY:A .YAYYYYAYYYAA.Y-AA-YY.AAYAA- 'K .A2fAfiAfA-YYAA .f-zfY- ,Ag 'H-I..3A'AYAiH-1YwfY-,'..'1-"AAAAYMTK--'AYYi-.AM--S.f'YA-'.-,1gY'.Y1YiA'YA-11Y'Y-,Agk'54,Y5.1YvA'A'A-mir'?r5Y1fv-AAfAaif'ALi-':"uf5wA-'Aff'A-'wzwg-.'.:21g-2-'A-hw.-'ww-.mf-w.fS'A'.-'AY'if-W-1'A'A"'.Y1'A'. 'W"""-ff'-1f'-f--WY-1 lm-2-ff-A. we 21rA133Y3'.lY'm".'A-i-fA--AYi1f5AYJA'A'-ifwL'.Y'Aw'--'A'-nY'AiY'-A'1-QA-.'.'.-wr-2-1YYQYwg1,'f'A:fY'.-3.55522-gg-YI'.'f.'2fi2gI45.fi?EIS5S'A1'.'-'A'E-'iwff:S.f'i3-SY-F-'isp-2A'.fY'-fi-'2:,1AQ.22-Z.-'ASA'-'CMT-f'."-.If-Nj,fin- sf"fse:.:As-miA?'?i2E53?3wQL21'1A--w,:AAA-ivE:5A'2i':A5YY9F1As3SiZsLi?i:2E 5555172 Vi'?l55i?A25E7ls559T5i35i1ki5i5iSQyWf5Ss1A,Q :sYzAAS:YY-wEzAAe-Q1A':56:?71:w Abixwiki,2SEf:5i1LEwiI5EA5Y5Y1 AAALQT-i3.Al.s5fYEKQZEASEZZ-AlfAA5i56HA1S5zAAi,EQ?W6YiWl'YYlf511l"3?lf W5Z?5:Wfi5''-5lSSi"AS5112S-A'55K?l57Q?7Z55ET'i2ESA5?gfSf3' Egg-Qfiif gigfail'ifggsiifgkigf'51533-ffggw-7iAff'11s-2131YAfV.AAY1Ag YA52' 1lcv:lsrwi::fi.AYYYAgfLEYYA!E??A"V'EiT 591 Y. lf7ff"--9'4-Y- '- nm-'Y.-AAfAAiA'.lkz'-'"A-Z'YfAYAY'f:z-'A.AA'A1qp'.'AfnAaY.AAzfA'TY'Ae'-'AY1'Y-'.Y3Y'A-i-ia1f.'a,:-I-A1S:AYfgYgA-,mlif-2-we-,mq?,df.YA-'A"5nf5'if,2-3,-in-if'.Y2-E.',-1fifAfizY2w,,YY'4s'YA-'A-Af.Y.-Z-'wit--.-A1HAY'Y-1-' YY2iiYf'Y'ffYHSi X Ysixzsea AYY: Tig. EQYIHA YA'-fwtrsrw ma.,A:AAsA2ra:'ZAwz:fa::z1AqwAiaAA4:i As"-i1Y.fzEQAA QQSEAAAAAAASQSSYS,flagizwY1fss:AA am:-s2Ay,:xAs-e1.:-'AsA:gfvz-.AnusYfAi' myA.AvaA'we-AwrAsfAzA5:1YAa::YA4xz:A,g xA -AYQ sA"e1A1aAsAA'1' AAYWZLIEY' AZZQWLEMYY XS 157311535559 X 5--SFY"5'5lb?YYL1YG11s5'f21ALf2iss'PLfvAE.aLAf2tAQf2i:AAweAAz: zmzziivzgsi2:A,1i:iLgfeE?5mi?:L:-siiig:V1:Q:i!fAA:-Yz -YAi?2Y,.Q'if?T1'- -SSSIJHY--1211 .A::A ' -'A-sw: ,.A-me: YA.,AgY1:sE':Z:fil5- if-SW-12 -TEV:-A 5YAAAAAw13AisYs-fzefzgseiA-AMAA-YW--AAAAAAA,AMAAAAAAYYAAAAAAAYAEAAAQAAYA-AAA-YAMAAQAA-YAAAA2AA1AAA-22-Y-'efSAfaYv1wf-ewzbwfix-YYY211KAA2YYALYfy,-SYAYYisYY-AsY2Y1YY2W-z5fsYA::.ASY2-11AA2YAYYAAiAY5,4213APA:ASYAAA,2-fAAH5AAYLA2?iAsYAesYYAw5sA5wAAAYYAAFAAQHAAQZ-Qxzm-2YfwvAa-:YYYf2:32-s?AAYY:AAA.AfYAgfsAYY-fe:Y3sAgff:1AYf21fAAAfw:g-A:A.YYA:1A-Az:AAA+:YAYY,:AA--YA Y Y-AYA-22A-12T2iAYY'::vY'Yv1 --Y-if -1.2-imc-YYff:AgYAf-:YQ-Y:s,AA.Yf'. YY-:AY ASYQAAQQAAQZAA-AA.asQAA4QA553QA53525isAAA1f2QA5A25.AinM1Aff5QSG5AIfAvi51A4YQYYIAAAAQQYA-wgsAYAAsfAYQfQ2YAAYgfAsYE1P2aiAA25Y2554e22QA22Sg1A222L1Q2ALsf?Y2QfAQiig1Qi?A22A??gP2nSr22feYf553,3eiigeggAA5AQ22seYQAAQ221AASgwssaghggsfsfs-?5feIAgeef2'A2HggAAsswgwf3Ye5AgAQAA2?Q21422255AAYY2ge22353Q5fQ1QQYP22nigAYAA5se2i1A2sfiAAiAsss2AfwnfsEAYwszAAASYA-ues:-QAIQAA-ff'--'wr'--:AA Afwfz--YYY:-'WYYSYA :W-Ys..A, 'zY.Aev2AsA-:YYYA-AYAssYA:Y:vAQY:A-:AAf:-iASzAs:iYA- Aw AAAAAAAAA ,-AYAAAAAYAAAA,AAAYA-AYAAAAAYAAYAAAA -AAYAAYYAA'AYAAA,Y-Y- Y-AAYAYY-YY . ,AA,.AYAAAAYAIAYA.,,YAAAAYYAYAAAAY.WAAAAAYAAAAYAAAAA,,YAAAYAY-AYAAYA-AAAAA-AAA,YYAAAAAA YAAAAYAAAAAA- -AAYAAAAAA,AAA.YAAAA-AAYAAA,..AAAAY.AAA-AY- AAAAYQAAAMA AAA- YAY- AYAAAAAYHYA-wY.AYAY-YYAAA .AAAAAAAA-YYA:A5fAYYAA-- AAAAAAAAY-AA-YAAAAYY-.AAAAYY,YAA-..YYAAAAAA-YAAYYYY-A:AA-..AaA---Y,:Y--YY. AAA-Y.:AAA---AAYYA-f:-A..A-- A-AAAY-YAAAYAA AA-,AY..,zAS,.f .YY--AAf,.-,AA . A.AmAA.Y.5Y..-YAA.QA-YY.PYfSAY'.fYAf-'wwgmtAzz-'YA1.fAwAeAfIASAAY.fA-ArefAA2YAfwA-.Y,-'YA-A-.Ama.AAAQYAYASYAIQYA-AgAYAA'YvEfmmfY3Lf,.:,A-22-Air.-1.2-Ar-'Y-A1,AsAA'-:1AYA'.wf',A+ww'.Aa-'-'--'AYA'AA--'Q ":iAA-Y1:?A"-'--QY:wzffA,Y "Az A?JA?e1Aiii5',ZfAYfAiff-ii'.Af2rA:f,-?YiAfg,f'A-ia5535:':e5Y2Y,'sSAYg.z-5:pfA,YYY-my,-QA'-qeYiQrAsYig.S.'A'AQ'A22Y3.:2Y'Axf,'AA32Y'-i'-'iffAf,gAYJ52:fASgj.YyI'.r.'-SA113255aYYI'Q-2ffw-'-?f-'A-lA-E-5A-1'AY.f2f.Yf-295-52-QA-15A'gAA2jA'Y',-Agn-Y-A'A.YAMYAI1-2-'.YA'AA:-YA-- A -Y,fYeaA-2-fAfSz.YiA AAA. W AxAeAsYAA.. ,Y Yu ,L z,:A1Yr1A A.AZl5i':AL1siAL:i' 5Arfmifyi-'EJ-'1iAA45lf1"MA'fSvA,1AA5Z'fS?A2fQw-3iAAsg MSHA 7L1A'5KfsA:.f2fAs:i':Ass1' ,:Qf2,YAUAssAY4 Y-LfssvAgAxs1LfQ1'fs'hx:'fS1:s'AZA-051921 :Am:.:AAL1sA7'f2s YXLAAAYK' AYL1 Ayr- ng. VLQYA1 A A1 Aiwa A1 IA 5:""l gffYT5V26f5?ZS1 Ys1SSZ1s:"fSis:A115561?g:1:5iiVis-51353AEASAAALAAAASA.,AlssA,1:ig:f,,3':Awi555 7U5:m?W3--liz-fiis Y-51.1255227125 ?A..Will--ilfYWllSf?l12i '-Wiafi' "TIS-Y STAMISLH-2 YYYTi:?..fTA-filisfl-iYY"Nw wil? '25-A.-zSfA:r,.AYY1A1Y:-1ifY.-556,A-Li5A?A,fj,4"AIg5AA2Aj,-A,Ygwsz-A'AA'.YAA'.Af:f2gqAfiY'?-'Af-asget-his'QAYYQAQZ-"Sw,Q:Af.fQAg'-Yi?HfY'33Y-inYi?-AfzHg'1353W3Y'-2.2525YY.-'SA-AAYAYYAAY,-1-,AYAfvAY'.'A'AY'.wA-5,5-.-.',A-HYQAwg-wavWYez-.Y'.f:Y .ea -'Aszim-YYzAiAfYY A-A-YA f--YY2YY:ftf:AA.f:.A, 'AYSQL ,TYsiGA"SSiYis?w1' A1':'21'4?2'sE1Q:2LAi2-'27AY-55435 A '-Qi' limi- Y '- AA'-429-,z2AgfY,iQ9-Ylf SYL1'2Za91i".f21:sAAzsssivmgisrvgs-A'1A,q:i'2xiI51'2ArL'5iiz.vLsAvA2zAAAY,rxsArmNSA' :Q:1sS'LXxxAYYm+i 'img,,A5AY2fsm:92s1z,aAPS1:i::S,'QW 7152-2 IIQAYQAAULQSGSAA5S2LL71s9vA"wZsA'H9si""2lairfw4:51575Fbfiixg-+'A:s:2iiipfssilffzzffsxi'-fsmmlxsss Yi.stviiss-Ufleibsti' Yu?:Agni.wiki:iii-Z:fix5'55-95:-f"?1fST'ffYVlfY-Yi?""""L"""""'--Y .A-YYIA-P11 llitfiils' Iifssiriils'YAf:W':S7'Hf 'QTY'-55-WLLY A-- viii. AMMAAQYAAYAAAAAY5?AAw2AAASYAYYAA--YYAQLYAH-SYAA-YfY?'2wYAs?Av2YP1f??z5A53l-Agg.AAAYLAAA,AQAYYASWAAAAQAAAYAAAYYMQAAAYAAAAYAQYAAAAAAA-AAAAASAAQYAAAAAAYQAYAAAAYAAAAQAAAMSAASAAAAYAAAAAYYQAAQQAA-YAAAYAAYYAAAYAAAAYAYAMAAAAAYAASYAAezgAhAwA:AAYAAAYAwgAAgfsYYYYYQQASQAHAAAS-,YAAAHAYAAAAAAAAYAAAAAAQ.AA,AsYYAAY1sAYYYMAAAAYAAA-AYAA-SAYA-YYAAAA--YYAQAYAAASYAAAYAAMAAAAAAAAAAYA-AAA.AA2zAA.,Yg-QAAAAAA-fw::A-YAAYAAYAAA--.AA.A Y YA Y-YY.A-AAYAAA-AAYAAAAAAAA AAYYAA--YY Y-YYAA- I,A,I,7g,?I.AMAI.I.IA,,Y,IAAE,II,A.IIY,,AA,,-Y,IAIA.YmAYYA-Yay.AA,-A.-A,A.A,.AYA,-.AAAAAAAAfIAaA.g.,AAA.,YMAA:AA:-A3Y,Ag1A.,gAg,Aw,AAyY-A.A,,wYgvY.A-WAYY-.ASAAYAA-.-AA?.N-2YA-.Y-gf.w.,-Y.YA1.A.YA.-YSYYf..,A-'-' ---'Yff-21-YY---f Y 2 Y-Sv-Y'-AY-We-Y'YYYASYYY-1f:AfYY AAYAA- .AYMYAwAAAswA:AAqYALBA-AAAQAAAAYYAQYYAAAAAAYYA-AYAAA-WAAAYYAAAYYAAAQYAAYY-A-AQY-AAQSYA-YYY.sY.g-WAYAAff4.:AYmmA.YYAAAAYA2-.AY::AYwYY.:sAAg.AAmsYAs-YWA-AAAfwAAqAiiAfnAA2usYQAmwAAAAA.YAAAA,A,AAA.AAAA,AA,AM.AAIASAAAAAAA,AAAAAAAWAAAAYAQAAAAAAAAA2A2YAAAAYAAAAAAAAYYAAQAAAAASQAAA-WAY,PYYYKYAAsYAAAA2Y.AAAfAAAAYAA-,YAAA-sY,AAA-fQA-.YAA-YY.AYAYYAAAA-AAAAAAA,-YYY--.AAAYYAAAAAYA-.AAA,YA.AA--... AA-A,YY..-AA.A-AAAYAAYYAAA-A. AA-AAAA.A,.AA-mAA.AYAAAAAAAA.. 21f'21Lf15d"1L5'l2Sf2' Hem' ffiwfsyisi' V93"ew5211235521AAixssi:'w3559XfLi:2"3'lLf?EZw5?gi5i1fg3AA-2L:ggA,5fYezvAAYAAA-YA-5-,AA-SYASAYAm-A,Q,iAAYA,IggYXfgpgyYAwA.AAAgA,WA AGA YQAYY-sw,Yee-AA,AYzszxQ?fsE5rszA fem V52'ms'9?s1AayiLszAQQQAQQAYY ff21xxsi'E?1i5i51i5?:QW?Asi"LeizksewzxsiwAAgfsw5i'LsA513Ef5z5Ef-:six:AgiezzA'-sax'511'-sw-:swYY.:AsAAYAsiAwzsA:1z e::'A:f::s-'1mzvfA:::AAY s:?5Ymi:L:Asiibiisrfi-IW' Q7fYfAzAA,m: ag-Ale--ys1:A,fY.::w.:g-A , mzlabz.-::1AfAz1:vzs:Em:eiA3543 f"E?9lWA:P, Axis? f 5if?97E23fAs1aYz,,ii57S51?7?'7Y5E3535IS1?liif?S2'11A2Ls23AQYf7zr1Efi2fAii115Ys.-Y1.swZ?A,r1i2:,A1251,,iS?7A-wflqzggw.:iwYAAs1w'QAWXQFAZYZAASYGL,izY-fwAAY152I'e2YA1:sz1s:-szwziee-AfQsAALr'f1rssAA927115-21tzAs.2A:2A.LESEAEAEYQAMAA iii,i1xsi2'91??EYAg5f6Y1QYA5g:A.91H5,:1qEf'f1?YAg'ASYisAAzfsA.E,g:2L:iA3SYfEi?25z1x55z:E?lS7Qi1yqfs?S'4i?53i7l52!5iAA3354Ytiafnizs-wifi' fisYYAsixEZi!i:?Z,q5E1i'4iiEA::5EE'Aff2?A:?-32A51-ii?f-T155uggsfsfzzs-fY'A:sAL:iisf"AAZ!sEZ!?i.A-" U' 1552:iAYE?kiAAS5i7L5i??Y--WF"-YEEA- A-QQYIGYYASIIEYHT YL14 - ,AAA,YAA,AA AAAYAAAA .A,A, .AAYQAAAAAAAAASAAYAAA AAA,AAAAAA-exYAAAAAYAQAYYHA--YYA,A.sAAA-AYAA,AY..gYYsAAAS1,AAAAY. YAAAAYAAAAAAYYAAAA .AAVAAAAAAAAYAA .A-YA, AAA, A ,,,, AA-YA,--Y.Y " mAAAAAAAAAg2YAAAA,,YYAAYAAAAAA-,YYYA-QYAAAQQYAAAAYAAAAAA--YAAA-AYAAAQAAAAYY-AAASYAYYAYAAAAYAA-AA,..AAA.5AA.A,AA,AA-AM,A.YA.AAAYYAAA-AAAAA,YAgAAAAEAAAAAA-AQAAYYAAAAAYAAASAAAw,YAAAAAA:A,AAYY!sAAAggA.AgfA1.AASYAAAAQ ,AYYAAQAYAAAAAYYAAAAAWAAAA-ASAE-YY:wmAYAAA.A4Y-AA,q.A,,A-AY-YSAAAAVAAASAAAASAIAYAAAAYYAYAAAMAAYA-AAYAAAYYAAYAAYAYAAA--Aw-YYAYAfAY,YAYA.AA-QAAYYA,MAA.YA-Y:AYf-AAA-ffsz,YA..SAA2AA:YAAYAA--AAA--.AA-f---Af-YAQAYYAAA-YY:s,AA --YAAY-YA 2.13--.A-.A-A-AA-AA AAAAAA-SAA-YA A YA 'J?1'A6'"fffifff-AI:-'-YA,i'A.",1YfS,E.3."f'A5Y?3'Yq',,av"w"gw3',"Y5S2's'fY'."'2's"',AY5-ju-3.,'QV:-Y.'X?'.'Af"S?.'5'1w'w'Z'LfA5.2M,:'E1AAS31iS'XZ?XuA'.1w"f3'.W-151-5g'Ai"Lsi?Zh-XA""AH-S.'Ax'?'r'6"'v1f"."iYuW5W5',.xAf'EA'X5..-'a5f"'.'."AW97,AsS1'.'fkfs?-111 'V -1fiiTS5Y7EW325F?'H V557-fi':2s?L5Ef ZASLKWY- -Y A " AAAAAAAYYAA.,AAAA,AA,IAaAgAg-Ag,,gigAgAYA-AAAAMAAA2gY5YAQgmgA5A5A,AwAgAAg5QAgAAgAAg5-gA5Y-A5-ALYAAQQ-AAA.QAAAAAAAQAAAAA.SAMA35AAAAAAAAAAAAAAYAYAWAAAAYAgwggmAAAYAAQAAAAAgiAA5QAAAAAAAAAAAA,A,g,AAAAA,A,fpIAAAA,A5AQAAggAA5AASgg3AA.g-AAAAAMAAEAAQA-AeAAAAYAAAYAAAAYQ-AQzA1AAAgzzgs5zAswe21ALAAQA2Y-QYALAAAAQAYAAYAAAAAAAAAQYAA-.AY--?YAAYAAAAAAAAQAQQ-Y-YAYAAAA:-AYAAAAYAAAA5sAAYQAQYA-.gm--,,QAAA-AY.AAQAAAAAAAYY..--YYA.YAAA,.A A, A.AAAAYa,Y---AMAA AAA.,..,,AA.AIfIAIIIAII Af3Z2153111553543-IL5ASY2,zeAmAiYz.Aximw5fyeAssA:Y-szr:':s5Y'5'grsimgxeaxzg-lex?fsAAsfwzrz-2111395111s92ZfAz13-3f1sf??s5Q'1QE7'?5?Adx557Siflkf'fi?ASSE?ss:5:S55fT?12fz9EiAE?Yfibgkigiwiliz6351155325555Ae'2323355-9:A"2Y1s1i"9PxA5f?i-1'A9211A:211se'1251s2?Sw151sHMsiirsiifiifkzfiggai-Wg'WW'-STWW'S1WYllliWf5Sf3FV'555'QZ55fY555:7ZE55i?L?5655fi9i:5iYf:E??l:L5F57555325252-??7A'QYfT53755559 -571S9'5VTF51yy1Y3715?y71Q?ilAMSEEZ-WTS:7-59"-'A -4. Vlf3'lS:YY-19:'v3ll5'- K -5 ff"-5'.w" YY-YYY'-1--T ,A .A,.AmA.AYAYAY--YA.AA:awe-12AviAezimg1smek?AYam:saisAazzwe21222352wass5QAsafzzAeAwz12z?sAagYYQsi?fag-YYis2Hzies2meies?EQsimigAe?AAAeY?'AzsggafAAfYsYAinA53332ageY225Ama?sg?2iii?meYEAQ25223255255553raw?5QingQ25:QEAAAPQff1E2A?i2Aes?sAsaie2ifQifiSWzwgfifif-'fZgkfi5A:z'ssASAA-fSimA2AeYEY2ASe?YYQ2A2Ye-ffMf-wivAim-:ieSA-QiAs2zsAY2YfmYA1z,g,,YYY f--Y:fggl1iffAfS'i1A AAAA-aAAA2gsef2"'view A-A-z1AYYY AAA.,.A-Y--AAAY-AAYAA-AYAYAAMEMYse22QA5-AaiiieaAasqA1wizfaziis-ZA-YGYAYQYAAYAYAg:Y1w2AfsAAAAQ2:AYSW-S-ff'ffE2g1Q5YAsA2Kfeiwiaal-myYHAA2255-PlanYY1AAsAAYsAAfA,-QAMYAQAS--AAA?AQSYAQQSA-si'AA,fAQ21AYfA' MAAAAAAAASYA-YY-Y-f2x.Yaf-fixesAEAAAHYZAEQAQZ-ei2fgb1s:Y1A.AAsA,AYQQAYAAAAQA,,AAA2A4AYAY1fsY-AY--wivAwgeAA.Yz1fgsAAA...ez-A- Yfilw1e?sY2?Sfs5ff4Y2-2'YY222fYf2f221ase'7 fifiwfif 15251-Y2if:YA 'ifk-Ti?-iiikif'Her A-Yaf-511 Sfefigiwz -Y' .A-YrswY-Yfff-AA..:YA,Yz.A -'--gA.AYYA.:AY-YA.A-YzAQYAeaAY-,fAAQAY- AAAAA-Y MM- V-Y-,MA-YAfeY.':YL:??iAAAYZ-F551WVERAAASQY'wttmYYfs1swsAaA1zsmYAe Y'1sAY'fss1A:2'1 1AY1':e,aA inf 52253515 P'dm'5zU'5+25'- 9Y31"f5VF'1QS?.sf V fXF'l"fS1-21533: 5Z?AM'LA'YlASYlfiY'f 'AY4A1SYlSL'1YmyaszAA:- A:A:3AAffIAg57g.gg,AAAAggA,YAA53,AA,5521.53:5t'Y.Afg1g5a,..gg,,:2i,AgA:i'gj5:fAggnew...:g:5wAA,,.qAg5-YAAA- ' -Y A :AAA-z 5:1 V -YYY- YY I,:sv gm YqYY.AY L -YAA-Y-AAAA-YA.AY.AAYYAYe2-AAA2AAAAA3.AgAAQW2QAQ5QAAg5EI5AQ,AAAAigr4sASAY52asAA223YAY2Q5A5,1LS?AAQ5A3Q.4LY3LfSAQrgisY325gAa55Y22:iefi162AQX12AfYAA1YAAAA1:YYAAAsa22Q42if5AeYzzsA22ggA5ASg1.ALAA521Ari222Aez21AAez?:YsQss4asaz21asAzw5?AA-YY-wzigsswzfff-4if?YEEHLSYSLYY A-11A--ii? . - Y-YAYA-,AAYYAA-AAAAEAAAYAAAAAAAYAAAYQAAAAAYYAAYZAYAQYAYAAAAAAAAMAYYA-M-AwAAAAA5-YQYAYAAAYMAYA-Y-YAYAg:f2,Am-?i:AwYYA1fsYA4AsiAee4YAz.sfY1A2f-is-'Y451A-f1f2fYfA-SYYYY---A--wYYYgfSv:fY-A A-A:e:YAAA:::AYgA-llsawsfzvfwY-YA.-, A A AYA- A- AIA3A.IIAImAA,ImIwIIImIAAIIIIN,AAAA,.,AAAIIAA,AAA.,A,,,AIA,AAAAAAAAASAAAAA,AAAAASABHAAA-AAAAAAAM.,AAAAAQAAAAAA.AAAA.AYAAA.sAAYAAASAYAAA-AYAA--,,YAm-,AAA-Y-YAYAYYYAA-YYYYY,YfYYYYY.ArYY.S-Y--Y-YY .YY Y. .YK YY1Y2Y-2 ''M'fame-YYYf1"t:-vYLeYYY 1L41"'AQtsf--sz-'YYzA" Yz L'-YY:--Y-szY'4:e-A Yee-AvgY-ss:--'SAAAzlzzfeszrifrfi, Al-SSYYYZA.AAb14eAggffezx.:.vzigsAf-5.5-:svigffigsvwt uw-:x::':::s,z ---- --fKY1ALfHYlLsYYrA:2,A YYY -s-ff --YM Siwik A ,,,, A- , A.,. -YYAYYYAAAQYAAY,-:ggiQWAQAQQASKA-fvtizssfsvY-fH952'15-582995i2?iiAisiEY?Eiii5z55ELQ?1SiLQ5iYfL--W1--Yiiffiiivff-A2123-ZYL-5-YY'f'-MQ-S--wif-32Ei7A5521525731 YF'1LY'Y55Y.2, .A :3Z533:l5'-- K-L5 537 -- ' 'M' wif-7-PYT '15-EEiEiit:f,E3AA:s:'A mfs:-.YQ.gsAA1vA.:AA:gsz:cfffsiiav,'.f?AA:iiAs-25?7 42-il'ziT5iq:sAT.SSl'U'1A--fii'1YW'-Silii? 5'-'-ifzfff-bfYe-fY-Sw .A.,, "ll-W'-If file-3 YAYYA-Y:A:YAz-weA2A12as522QiP22A42LSi3AAf21zAeYzYifAz,-uf-A-ff.., Y Alf I-me-YA YI- Y--fl., "ez " '-Y-U 'Y'-Y-z':-iz-mcg, 'AA we 'ws Y- Y-I YIZEQEEIZXIL-YHII7115-YA Y-f'2AAz-A Y.-,Af--YTV 7 -57.9-E YSAVA7 -Y- WY A .A .AAAI--Y55-AA4Y3gjg-A,-SXYIY YA.,A.A AAA:-j ':-YEISET-E ,AASQEZ . ..... ,.A,IAII,. AIAAAAA 10- ,f R14 ' ' - fixrvk, i ' ws, .4 A f 6132 ??f5Nf fy? 1, ,..f- - Gazette Photo S I ' VI' . J, 2-"':'-F' ef in-gf-'fr'-,. +:rgL'i?!1'ff .2-nr-sw' N.,-x .1-Av ggi Sei wifzf Q54 in 4' 'I' , irq' 5' L -12, 9 I 1 na' 'aff' A1 V 42 :Sp ft, 'il . i -QI' .e,"T 1 214 .. nrt . L. S "D 'Q L' 1 ffifr, ' .4-Si.. 1'.',kU Q fu ,. -Wy.,-' 5114 11 f-- ,- I9-LW' 1' Q- , 1 fav 47 Z-',9'L"" S -jfkj K A 1 gn, ?,. if 3 1 y.,- ,-r . i -I 1 Qi'i'..' :iff . 'igf .f- f F ,Eff j.!!f7f k 1.193 , ,.,,.-, Q-,735-I' if , . 'Jai '- :Jai 'APLT' "IE-'Fifi ' jik.-"'i. ' ":1l'5l di!-'tw Zi '-'.e1"',--'f I- A-li "' Qs - Wana .Qyfy 5 .4 Ag, -Q 5:5-5' ' - Q, ,xlj Viv . N Wa ' 'Y L "' - lung, ,, 4- . gy gi? 'ifgrr l ff: -a -- ff' P1115 n.f'Q' 1, J 9"'..i' tl ff, '5- s,,. W V Aff . "4-TIF! " , mv 4, -.no 0- , f ,fir 'Q in - ' '- .112 - -r ,.,. ,. at 415' Y , ,U rm Aivg ' 'J f wb J, 'EY' . 5 ,,,ewes:ffixii2Y?Q 104 MR. HUR SHELL BALL President MR. LEON HOLSTED Vice-President Board of Education The North Little Rock School System is operated With the aid of these six directors, prominent North Little Rock business and professional men. They serve their city Without pay so that it may offer the best educational program possible to its students. By selecting the best qualified adminis- trators and teachers for each position, they are continually raising the educational standard of the schools. MR. J. HARROD BERRY Secretary IN SESSION WITH ADMINISTRATIVE PERSONNEL Mr.Fields,Vice-PresidentLeonHo1sted,President , . .Secretary Harrod Berry, Mr, Meredith, Mrs. Hurshell Ball, and Superintendent F. B. Wright Corinne Messenger, administrative assistant, Mr. who serves as treasurer for the Board. W. E. Shelton, school business manager, Mr. Rhodes, MR. MILTON RHODES MR. BRANCH FIELDS Member Member MR. A. O. MEREDITH Member 105 1D6 Supt. F. Bruce Wright Superintendent of Schools Mr. Wright is in his eighth year as Superintendent of the North Little Rock Public School System. He has served as Assistant Superintendent and as Principal of Senior High School. Before coming to NLR, Mr. Wright had been Superintendent of Schools at Foreman, Arkansas, and had been a science teacher and football coach at several other Arkansas schools. He holds a Bachelor of Arts De- gree from Henderson State Teachers College, Arkadelphia, and a Master of Arts from Peabody College, Nashville, Tennessee. At the doorway of the Administration Building, Mr. Wright chats with Mr. W. E. Shelton, District Business Manager, and Mr. Garland Beavers, Director of the Instructional Program. Principal and Deans The man who leads the directors for our play is Mr. George E. Miller, principal. Mr. Miller has served in this capacityfor l2years at NLRHS. This year he was chosen one of five delegates in the United States to de- termine curriculum for secondary schools. Other than leading the dir- ectors in a supervisor role, he is also a major in the army reserve. Mr. Raymond Burnett, vice-prin- cipal and dean of boys has been with NLRHS for ten years. Before becoming dean he coached the Wildcats three years in football. Mrs.Vada Cowan, Dean of girls, is also a teacher of Special English for seniors. She has been at NLRHS for l2 years. MR. GEORGE E. MILLER Principal of Senior High Bachelor of Science, Pennsylvania State Teachers College, Bloomburgg Master of Arts, New York University, New York City. MRS. VAQA COWAN MR. RAYMOND BURNETT DGHH Of CINS r Vice-Principal and Dean of Boys B.A., Henderson State Teachers College, Arkadelph1agM.A., Bachelor of Science in Education, Arkansas State Teachers George Peabody, Nashville, Tennesseeg Graduate Work, Harvard Universityg Graduate Work, University of Iowa. F K x S Z , 912 I 2 .53 f Vfm ' .gffwft 1 College, Conway, Master of Science, Peabody College Nashville, Tennessee. his MWF 'YW' 'Qu MlSS MERDlTH LANDERS Guidance Bachelor of Science in Education, Arkansas State Teachers College, Conwayg Master of Science, University of Arkansas, Fayetteville. 'W-.. MRS. CHARLES L, CARPENTER Librarian Bachelor of Arts, Texas Women's University, Denton. 108 Counselors and Librarians MRS, I-'AYE V. BILLINGSLEY Guidance Bachelor of Science in Home Economics, and Master of Education in Guidance and Counseling, University of Arkansas, Fayetteville. MRS. JAMES E. COOK Assistant Librarian Bachelor of Science in Education, Arkansas State Teachers, Conway. Secretaries MRS. MADGE MILLSAPPS Secretary-Clerk, Prir1cipa1's Office MRS. MARGARET MCCLOSKEY MRS. MARY LOIS MARTIN Secretary to the Guidance Counselors Secretary to the Principal MRS. MOZELLE GULLETT Secretary'-Clerk, Principa1's Office -4" 109 afar A gi-un' 'YOYANCC woum. ul' 2 4 MISS JUDY SESSER English IO Bachelor of Science in Education, Henderson State Teachers College, Arkadelphia. MR. RAY POINDEXTER English I2 Bachelor of Science in Education, Southwest Missouri State College, Springfield. English Faculty MRS. NITA ALLBRIGHT Head of the English Department Bachelor of Arts, Hendrix College, Conwayg Graduate Work at Columbia University, New York City, and University of Arkansas, Fayetteville, 9. mt. vw J'li'l"M""' MRS. VADA COWAN English 12 Bachelor of Arts, Henderson State Teachers College, Arkadelphia, Master of Arts, George Peabody College, Nashville, Tennessee, Graduate Study University of Iowa, Iowa City, and Harvard University, Boston, Massachusetts. MRS. LYNN TARKINGTON English I0 Bachelor of Science in Education, University of Arkansas, Fayetteville. ti f 'ifad JCM, f W fa ., ff s 'f : g i ' ' 1 u. i . yvkk h ifi ' X 1 1 4,,,, filfff MRS. SUE PERRY English I0 Bachelor of Science in Education and Graduate Study, Arkansas State Teachers College, Conway. MISS LINDA KRESSE MR. CIIESTER KING English ll Faculty Adviser for the Student Council Bachelor of Science in Education, Arkansas State Teachers College, Conway. MRS, SUE DEAN English ll and I2 Bachelor of Arts, Little Rock University, Little Rock. MRS. EMOCENE WETHE RINCTON English IO, French I English IO Bachelor of Arts, Little Rock University, Little Rock. Bachelor of Science in Education, Southern State College, l . I X I 1 1 "tw .X ,S X AHQMQA K? Magnolia, Arkansas. MRS. BENNY SWAFFORD MRS. MARY .IO MANN English 10 and ll EI1g1iSh ll Bachelor of Science in Bachelor of Science in Education, Henderson State Education, Henderson State Teachers College, Teachers College, Arkadelphia. Arkadelphi. MR. ROBERT STEELE English 12 Bachelor of Science in Education, Arkansas State Teachers, Conway. MISS DONNA L. WASSON English 11 and 12 Bachelor of Arts, Hendrix College, Conway, Master of Arts, University of Arkansas, Fayetteville. MRS. JOE BUMCARDNER English ll Bachelor of Science in Education, Arkansas S t a t e Teachers College, Conway. fi-wzf1fes :amasvs11s:f. w I Social Studies Faculty MRS. HAZEL RAGLAND Head of the Social Studies Department Bachelor of Arts, Arkansas State Teachers College, Conway. MRS. J. B. PRIDDY American History Bachelor of Science, Arkansas State Teachers College, Conway. 'Sc--" MRS. WILLIAM C. FLEMINC American History Bachelor of Laws, University of Arkansas, Fayetteville. N L 5 L,- - -,--za. - .,., g 1. f . . M- L, .afqg ,. A . aa:: l.,v,.aar1 - - A 1 5 5 . m MRS. PAUL MOSLEY World Geography and American History Bachelor of Arts, Ouachita College, Arkadelphia, Graduate Study, University of Arkansas, Fayetteville, and Ohio University, Athens. isiazifageizifggigisfig, U 'H 'fs 4 unfi wait f. me MR. C. W. MCFALL World History Y 4 ...... A H33-, 5 Z Bachelor of Arts, University of New Mexico, Albuquerque, Craduate Study Highlands University, New Mexico, Wayne University, Detroit, and East Michigan College, Ypsilanti. 5, we ' .5-Q vc my A Ai . if .K ikk il I ,V ,gl ' A ,.." E ' A - 9-QQ My t was -i.- , , , ' t .aff L, , if ,A . W 4 .ipsi- Q. - , hkkryy MRS. GARLAND BEAVERS Human Relations and Coordinator for Audio Visual Instruction Bachelor of Music and Graduate Studies in Guidance, University of Arkansas, Fayetteville. MR. CARL J, MOORE MRS. MAGGIE MAE GREENLEAF American History Human Relations Bachelor of Science in Education, Arkansas State Bachelor of Arts, Hendrix College, Conway, Teachers College, Conway. MR. C. L. NELSON MR, JAY MACK EORTNER Human Relations World Geography and American History Bachelor of Arts, Henderson State Teachers Bachelor of Science in Education, Arkansas College, Arkadelphia, Graduate Study,Oklahoma State Teachers College, Conway. A and M Stillwater. ' A ,Q Languages Faculty MRS. SARAII IIELMS Latin I and II and Iflead of the Languages Department Bachelor of Arts, Arkansas State Teachers College, Conway. MRS. BERNICE B. HUNT Spanish I and II Bachelor of Arts, Hendrix College? Conway, Master of Science in Secondary Education, University of Arkansas, Fayetteville. MRS. MARCIA LAWRENCE French I and II and Iinglish IO Bachelor of Arts, Ouachita College Arkadelphia. X. 5 r I fl Q. 'S l I tw Science Faculty MRS. JAMES E. TAYLOR Head of the Science Department Physics, Algebra ll Bachelor of Arts, Erskine College, Due ,West South Carolina, Master of S c i e n c e in MR. D, H, MANSQN Education, University of Arkansas, Biology Fayetteville. Bachelor of Science and Master of Science, University of Arkansas, Fayetteville, Graduate Study Louisiana Tech., Ruston, and University of Missouri, Columbia. .Sissy 1, MR. JACK WARD MRS. ALBERT HESS Chemistry, Biology, Algebra l Biology Bachelor of Science, Arkansas St a te Colle ge , Bachelor of Arts, I-lendrix College, Conway. Jonesboro. i 1 G Y' Ziil f 1 9? Vi . 'K ytiiiwf- I MRS, EULA L, BLEVINS Q 2 P 3 A4 Bef? B Biology and Algebra ll 1 " , ,J il Bachelor of Science in A - Education, Arkansas S t a t e 12 13 Teachers College, Conway, - 4 , 1, Master of A rts, George 3 - 20 21 P e a b o dy College, Nashville, ' A ' H 2' V, CH Sc Tennessee, Master of Science, it i SEE , University ofArkansas, A ,v, ' 11' 5 Fayetteville. , V b, Cu 30 Zn K Y 31 T, .ycy L 5 gr as y S' i A B' S , iryy 'I MRS. MARY MATTHEWS ' V549 ll! if Chemistry L at A i , Bachelor of Science, , ' S1 ,I University of Illinois, Urbana. ,lg "', , k fin' e A is A Tl A r ff " I . 5' 'J - A A 1 'B' 1, ., if A ' K " .:-. I ' ' --w' .Q "--- ' - , , - A mm' 31... is L L L 4, ryyyyi rirs A i, , A t,,,ix'lf".l. Q . TQ " I' I , is me mf H Mathematics Faculty at -are cg' as M 14 M warm- 5 -in Q 'X MISS JOHNSTON Head of the Mathematics Department Bachelor of Science, George Peabody College, Nashville, Tennessee, Graduate Work University of Arkansas, Fayetteville, Univ e r sit y of Wisconsin, Madison, and University of Denver, Denver, Colorado. MRS. FRANCES CROOM MRS. O. D, LAWLESS Plane Geometry Geometry Bachelor of Arts,Universityofm-kansas,Favetteville. Bachelor of Science in Education and Graduate Studv, ' ' Arkansas State Teachers College, Conway, M Nw -..-eg, MRS HENRY C WHITTING . ' , ' . . MRS, ROBERT WEEKS Gegifilmhgiitgemaucs and Busmess Advanced Mathematics and Algebra Il . - - Bachelor of Science, Arkansas State Teachers Ejggfioixglssgnce' Auburn Umverslty' College, Conway, Master of Arts, University ' ' of Arkansas, Fayetteville. MRS. MARY M, FALLS Algebra l and Geometry Bachelor of Science, Southwestern State College, Weatherford, Oklahoma. K I ' K 7 MRS PATRICIA B. DONAHEY Business Training and American History Bachelor of Science, Arkansas Polytechnic College, Russellville. MRS. MARY LOUISE SCHMIDT Bookkeeping Bachelor of Science, Howard Payne Texas. Commercial Subjects Faculty MRS. W. VV. MILLER Head of the Department of Commercial Subjects Bachelor of Science in Education, Arkansas State College, Jonesboro, Master of Education, University of Arkansas , Fayetteville. gd' MRS. MARY E. HENDRICKSON Shorthand II and Typing College Brownwood Bachelor of Science in Secretarial Science, Mississippi ' ' State College for Women, Columbus. N P 3 'W L. MRS. .IANA DARR FARRIS Business Training and Bookkeeping Bachelor of Business Education, Little Rock ' ' Li R k. Umverslty' me OC MRS. SUE SPITCHLEY Shorthand I Bachelor of Science and Master of Science, University of Southern Mississippi, Hattiesburg. MRS. MARILYN CRYMES Typewriting Bachelor of Science in Education, Henderson State Teachers College, Arkadelphia. MRS. DONNA O'PRY LYNN MRS. PHYLLIS FISHER Business and Business Law Office Practice Bachelor of Science, Ouachita College, A rkadelphia , Bachelor of Science in Education, Arkansas State Teachers Graduate Study, Arkansas State Teachers College, Conway. College, Conway. ,.,l,,,,,,,,,, ,,,:--Q ,W M , V, M. .M,-,,.,v,,,,LMwvWasvmmmmw-Ww f- . f -U . ' . L Ti Homemaking Faculty MRS. .IANIVE BLANCHARD Home Ec. I , N , . , . Bachelor of Science in Home Economics and Graduate MRS' ll RANU15 SMITH Study, University of Arkansas, Fayetteville. Head of Iflomemaking Department Bachelor of Science in Home Economics and Graduate Study, University of Arkansas, Fayetteville, MRS. ANNE W. BROWDER Home Ec. I Bachelor of Science in Home Economics, Auburn University, Auburn, Alabama, Master of Science in Home Economics, Iowa State University, Ames, Iowa. Mrs. Browder helps Lois Morgan sew a fine seam. mv- Vocations Faculty MR. DALE GRADY Electronics and Related Science and Math I Bachelor of Arts, Louisiana Polytechnic 1 Institute, Ruston. MR. EUGENE A. PARKER Auto Mechanics Arkansas Polytechnic College, Russellville, University of Arkansas, Fayetteville, and Sweeney School of Auto Mechanics, Kansas City, Missouri. MR. LONNIE JOHNSTON Mechanical Drawing Bachelor of Science in Education State Teachers College, Conway. Arkansas MR. ROBERT HASTINGS Crafts and Machine Shop L Bachelor of Science, Arkansas State Teachers College, Conway. KW .ac ,fu x".: 5' 5 ' 5 ' MR. WILLIAM R. LEE Woodwork I and II Bachelor of Science in Educatio State Teachers College, Conway. t n, Arkansas In-syn., IDI MRS. SEARCY W. THOMPSON Head of the Art Department Bachelor of Science, M u r r a y State College, Murray, Kentucky, Graduate Study George Peabody College, Nashville, Tennessee, and University of A r k a n s a s, Fayetteville. MISS KATYE LOU RUSSELL Head of the Department of Journalism Faculty Adviser for Student Publications Bachelor of Arts, Ouachita College, Arkadelphia, Master of Arts, University of Arkansas, Fayetteville. Speech Arts, Art, and Journalism Faculty MRS, RUTH P. GRIMMETT Head of the Speech Arts Department Bachelor of Science in Education and Master of Science in Education, Arkansas State Teachers College, Conway. ii Cene Taylor, Donna Colclasure, and Mrs. Thompson give Patty Brown helpful suggestions on another of her masterpieces Music Faculty MR. J. RAYMOND BRANDON Head of the Music Department Bachelor of Music, Vandercook School of Music, Chicago Colorado, Advanced Study, Lewis and Clark Colle ge Portland, Oregon, and University of Arkansas, Fayetteville lllinois, Master of Music, Western State College, Gunnison, , MR. CLARENCE S. WHITE Bachelor of Arts, Ouachita College, Arkadelphia, Bachelor of Sacred Music, and Master of Religious Education Southwestern Baptist Theological Seminary, Ft. Worth, MRS. ELIZABETH BICKFORD Vocal Music Director for School Supply Store Bachelor of Arts, Bachelor of Music, and Bachelor of Public School Music, Phillips University, Enid, Oklahoma. Mi. Brandon instructs Roger Wattam, Betty Qualls, and Mary Jane Ford in the fine old art of tweedle-dee. ,mmf , 'ill lp! M2 . Sy! ., , u a W MTW.- ai... -1-we--W--u-f - COACH KEN STEPHENS Head of the Department of Physical Education Bachelor of Science in Education, State Teachers College, Conway, Master of Arts, George Peabody College, Nashville, Tennessee. COACH JOHN MONTGOMERY Physical Education Faculty COACH HENRY HAWK Health and Physical Education Drivers Education and Physical Education Bachelor Of Arts, Hendrix College, Conway Bachelojf of Science in Education, State Teachers Master of Science in Education, State Teachers College, College, Conway. Conway- COACH JIMMY CULP COACH DON JOLLY Physical Education Physical Education Bachelor of Science in Education, Southern State College, Bachelor of Science in , Education, Arkansas Tech, Magnolia. Russelville. ,,,,,,,,,,W,,,,,,,,,, E E 3 MRS. SYBLE MALCZYCKI Girls' Physical Education Bachelor of Science in Education, Arkansas State Teachers College, Conway, +21 my if f ,Q Qs. ip, 2,13 ha 7.. wx, 4 s' MISS FRANCES LEWIS Head of the Girls' Physical Education Department Bachelor of Science in Education, Arkansas State Teachers College, Conway. Ea vis by gg ?am:.1g il ,Q A F at 4 ra 0 1 --sing: t. 1 I -'x E A 5 -4 ,QE U--urn--um--umph! ! ! 125 Enshrined ---is the memory of our greatest director, President John Fitzgerald Kennedy, assassinated by a sniper's bullet in Dallas, Texas, on November 22, l963. Shocked and saddened by the sudden loss of our national leader, the Wildcats of 1964, l965, and 1966 will forever re- member the tragic week-end which left a vacant place in the heart of every American and filled another chapter of our history. As a leader he led the World in peaceg as a man his popularity was World re- nounedg as an American he guided the United States through crisis. ln his passing the entire World mourns the loss of a friend. John Fitzgerald Kennedy Our 1964 yearbook is published in memory ofthe 35th President ofthe United States. "When a great man dies --- the imrnortals await him at the top of the riearesthilll' --George Meredith -.-:sf -- w 'JY , Ira- 1-'T' -1 . .f 'J . ,fb ,, , . ,I--. fx, 1' ,-1: -7-1 if L,-1fm.r., H+ '- 'J-'-, 1--ff-'-vw. fr- .vi-f.'1.H-m t ,' '-f ,,,f ,- :,,':E."'g ,' ,f-.Lj ..-,fps--, 1. 4.-,,., , ,. ..,y in i YM UV. .fad ff, ."-ff ,qv ,,. vii 5' f T54-. 'Z-1 "2 1 -4 -. 7' 11. 5'-eg- f 3...-' - .,,.. L, W, 6:--, . 'K IN. fya ,f if-. . , A 3. . ffl!" ...4. ,,..N - . ., ' -1 5. ,til fl, -1, 5: . G, .f f "A T11 v -.,-97' . Lf-T' .r 'f' -4 .Nqr , , J, .1 V7 -,. 171--.-.,.f-.if .. 4 - I Q ,,,.:+i,'-L. - ., J.-fz, .-ff Q 'Q QQQ Qu Q QQ S1 Q Q SQ QQ Q WIQQE QQQW S Q QQ, ,QQ Q S Q Sm QKQQ Q Q QQQQQ QQQQQQQQQZQQQQQQQQQQQQQQQIQQQQSQQQQQQQQQSQQSHQS W- QQQSYQQ QSILPSSSQfwSS1ffSf'iF2f1QS'SESQQQSQQSSH'SAQSZMSHQSTIQQIHSQ Q Q QQ Q f QQQ Q QQQWQQQQQQQ Q Q Q QQQQQQQQQQQQQQQQQQQ 2 f ,QQ Q,,..Q,QQWkQQQQiQQ,AQ,,,Q.Q5QQQQQQQQQQQQQQQQ HQ QQQQ Sasaki ixfxwzfztaiizrisf MMS xginmim Q izftiwmas Q pi if xl 3 xeaiztif are EEVESI? Siiiliifii Q Q Q Qi WE are 11332 533321152 as Q QQ mf? make Q is SE REV? M 8115. 153156 buff QQ W QQ QQQQ MS E322 S 2 W Qwi 5328 ilsg Q Q-H1 Bgmkifibili H QQ 3313 S311 3 H2113 QQ Q Q QSQQQQQ Qt is ms fear time wilt er s f1i??xis 8 wi. Q 9 SQQ QQ 1: an it have 562 IE QRS 2 QQ HHCQQE Q 533113351 Q X 3 Q Q QQ Q QQQ Q S QQ QS QQ Q QQ QQ QQQ QQ, HS QQSUS Q Q Q Q QM Q QQ SQ QQQ SKQQQQSS 5 FISHER M 61-Q. QQ QQ, QQ 233525 ii Q QQ: Q Q5 Q QQ vw QQ SU QQ, QS Q QQ QQ 5Q RS QQQ Q Q QQ Q, Q QQ 222 Q QS Q Q GQ HA 5 Q HQ Q f Q QQQQQ Q QQSXQQQQQQQ QQ QQMQ Q fsxg, Xxx QQ Zi' QQ S Q f Q-QS QQQQ Q QQ I Q S QQ. QQ S QQQQQ- Q QQ, Q 02 MQ QQ ff Q S 365562335 QQQQ if J imgvaiiiywwi N51 QQ-QS ,QQ Sw ps QM SQQ Q QQQ f QQ Q QQ Q Q HQ QQ 5 , Q Q ,Q Q QQQQ 2 QLQQQQQ, Q Q Q QW Q QW QQ Q Q Q QQ SQ Q19 Q QQ Q Q IS Q SQQ Q Q51 QQ QQ QB,-QQ QQ J Q QQ Q,Q-Q QQQQQQ QQQQQQQQ Q Q 2 Q Q Qw,Q QQSQ QQ, QS SQ QQ Q Q Q QQ SQ 2Q Q QQQ QW Qfmfff 5 QQ QQQ Q Q Q MQ QQ QQQ, Q ,JS Q12 Q Q QQ Q Q Q SQ Q Q Q PQ! QQ QQ Q 5 Q QQ Q KQQ Q Q SQ sf S Lrsfgb- Q is QQ' sfw Q QQ,Q QM W Q 212 K W, JSSQQ wg S M Q QNX BQ QQQ Q KQ E3-QQ QQ QJQ Q IQQQJSEKY Q Qwm HQ Q4-S QQ Q 19 QQKQ ,LQ Q Q S Qzyufih 5 1 r' S Q QQ af QQQQQQSQ K ei MQ 5233365 QQ QQQ W QEh Q3QQfQQQ 5 QQ ESQ XSWQQQ W H QQQQQ Swv M 2 Q , Q, QQ QQ Q Q 632,54 sx rm QQ.QyKQ Q Q S S4 QQ ,QQQK QQ Q QQ KQQ Q,,,, -W, QQ QQ ,Q Q QQ Q 3211323 Q Q Q QEQMQQ .Q W Qi QQ QQQ QQ Q Qgffqy-Q1 QQQQQQM Q? W , QSQQMQ QQQQQ Q Q V Q Q Q 3 ,Q QQ QQZQL Q 'LQ QQ QS QW, ,Qi QQ Q1 S mm QQ QQ Q QQ QQ QQ 5 QSM W2 W Y Mr" ,Qi-2QfQ,QQ?',,Q QQQ Q MQ W ,QQ ASQMK gl Q 2 QQQQQQQ QQ Hwwalis QQ Q QQ QQQ Q ,ix wr W2 'T Xml NN K' Sw '41 is Q M L, Que QMQ, QQKQQX S 3sQQQ,QQ5 S Q Q in QQ Q Q Q5 SQ QQ R M Q , QQ , QQQQQ Q QQQ QQQ S Q Q SH QQ? QQ QQSQQ S QQ K S S SQQMiQ 1 parm Qieij Q, 33353 QQ QQ QQWQQQQT i Q QSQQQ Q S Q3 Q QQ Q ,Q QQQQQQ Q Q QQQQQQQQ, QQ Q SU? fQ if YQQ QQQW QQ,, QQSP-Q SQ ,Q QQ SQ 5 QQ QQQQQ Q QJQQ QQQQQQSQQQQW Q ,QQ Q-gn,-Q. QQQQQQ Q 21-Q QQQS QQQ Q QHQQ QQ Q Q QQQ Q Q 2 QQQQVQSS QQ Q, S Q Q ci QLQSSSK ' QQ Q,QQ S Qw HQ, if ,QQ QQ ,MQ S Q KQV QQ QQ QW SQ Q ,Q Q W Q QQ Q if Q- QASQ 1. QQ wg gt 9"-4,34 QQ,-Q if Q QQ Q ff Q f :Q Q fe Q QS 2 .LS QQ few Q QQ AQ Q2 QQ QQQQQ Q Q QQ QQ Q QQ QQV,,QQQ,y1Q Q W, inf Fwe S QQSJMQ LQQWQA HSQQ QQ .Qi " 1' QQ QQ QS1 Q QQ -1 xri fm! 3V'3x im Jim QQ Q QQ SQ S f QT QMQ QNQ QQ Q ff, Q HSM' Q KPQQQQQ. QQ Q gQ?ggQQ,Q Q y KJSQM Q 3 Q QQQQLQQQ QQQ QQ QQ Sw Q Q2 QYSQQJQQ YJ QQ QQ Q QQ? QQ QS ilfx f' is K QQ Q a QZMQYQQQSH QQQ QQ, QQ 25 S Z Q S 5 Near! QQQ ,MM WQ N, 1 vw, Dfw -1 lc ies: ,Q QQ Q Q-QQQ 2 Q QQ, ,Q Q ,Q Q MSQQQQ Q Q Q 2,351 S I ww QQQ Q Q QQQSL5 hs QQ M A 3 QQ Q,, 91QQQ QQQ QQQQ, QQ MQQ ,m,?QQ HQ? 1 Q QQ Q Q MQQ QKQQQ YHQSZQ Q, QQQLQ Wi' QQQ Q,Q Q 53 MJ xxfi QM wfwf W QQQQQQQQ Q S'-QZSQQQQ 'SSQQQQQQQ' QQ Q ,Q A Q Q Q21 QQQQ Wa QWQXESQQQLTQS , Q QQ ,mn Ss QQ., QQ QQ QQQ S QS QQQLQ MQ QS Q. Q QS SQ, QQQQ qw? Q QQ QQQ XQSQQ QQ-QM Q-5,Q ,QQ QQ QQ X QQ ,,QQ S 3-S QQQQS Q QQ 12:5 2 ,Q mg Q23 -Q 3 WSW Q -QQ SQQ Q QMQ Q QQQQB QQ- QQQ Q, E Q SQQ QQ? Q 'ff .Q QQ 2 Q 1 Q KQQ QQ W Q Q Q QQ Q QQ Q Q 1 Q Qu QQ QQQ QQ, S QQ SS Q Qrgig' QQ Q, QQQQ Q QQQ UQ Q QQ Q Q. HQ SQ QQ? QQQQ QQQ S Q QQQ Q Q SQQ 252 HQ ,Q S QQ Q, Q Q Q Q23 QQ Q Q K Q- MQ 1 QXQSSLQS SS-QQQ .QQQQQQTHQZJSQ ,, Q QQ ,,A. QW, Q Q Q ,Y QQQQ ,Q QQ- QQQ Q1 Y W if QQ QQ Q 53 QQ Q QQQ Y-'sf s N Q1 Q 149235555 QQQQ QQQQQQWQQ .QQQ Q QQ-QQQ. . Q, QiQEQ,QQQQ?QgfQd'HfK- QQ Q Qi, QQQQQQQQQQHQQQQSQQQQQ QQQ Q QQ QQQQQQQ. MQ QQQQQ-QQQQQQQEQQ .QQ QQ Q bfQSQQ3Q,gfQ,2QQSSSiQSu5QQ25iS fl A Q QQQQ QQQQQHQQQQQQQQQQ QQ QW QQAWQQQQQ Q 5Qg31iiQQ5QQvQQgQQQi:Q L z:QQ5nQ:QQ'?SfQQQS'QuW Q5 3 Qf M QQQQQ ,gi QQSSSQQQQQQ Qwsaisakkiiirs? W SQUSSLQ. Qi QQQQQQQ Q QQS NVT53? Qs "- 55911 ff QQ QQQQQQQFQQQ QQQQQQQQQQQQ QQ!QQ,Q,QQQQm,QQQQQQ3QSQ QQQQ ,eff , S ZQQVQQ Q ,,n Q QQ ,QQQQ QQQQQQ S Q Q Q QQ QQQ Q Q QQ Q Q QQ QM QQ QQ2 Q Q Q ZQS QQ-Q QQ Q WQ Q QQ QQ QQ AQ HQ FQ Q QM QQ QS QQ QQ Q Q f Q Q5 Q Q QQ QQQQQQQQSQQQQ QQQ QQQQQ QQQV QQQQSHQQQ QQ ,GQQ Q 35? Seve QSQSQQQQH S-QQ QQQQQQQQQ QQ., M,,A Q QQ Q. Q, X. Q jQ,1QfQQQQQQQ2z,QQQQQ S QQQQ S Q1 ,SQQQQ ,QQQQQQQ QQQQQQQQQLQQQQ Q QQ1SQwQQ'7,f,,iQQQQQQ QQ, QQ , Q my Q QQ Q Q Q QQ 'M QQ Q X QQ X Q M QQ Q Q QQ, QQ Q, S QQ QQ Q Q Q Q Q QQ QQQQQQQQQQQQQQ Q Qzfs,1QQQ,gsxizsgg - . QQ Q Q, QW QQQTQ-QWSEQQQEQQ Q Q QSQQ QQQQQ-mu' SsQQQQgQS1QQQQQQQQQQQQ QLZJSQ ,Q QQSQYLSQTQQQQQQSKQQ QSQQQQQQ QHQQQQQQQQQQQQQQ ,Q QQQQQQQQQQSQQQQQQQQYQ Q ,QQ 5 Q 2, SQL, Q QLQQQ, QQ-s?5Q,,,, QQ-QQ QQ-Q, Q ,Q S Q Q QQQ QQQ QQ S Q S Q Q QQSQQ Q 2 Q 535, SQQQQQgSgQQiQQgg.QQQ1wi4Q?,3ieQfQ5gs25iQS329YQfi ,QSQQQQSQQQQQQ QQQ,QQQQ.QQQQ,QQ,QQ,,M QQQQQQQQQSQQQSQQQQQQQQQQQQSS QQQQ:Q2QQQS2fQQfS1SSSQ:QQ Q fxs Q Q Q Q QQ QM QQ QQQQ 9' QQ SQ Q f, QQ W., Q, :QQQ SQ JSKKQ-Q SXQQQH-QQ QQ 1 'YS uf. QQ QQ, QQQQ Q QQ, QQ QQQQ QWSQ S Q MQ Q Q3 SHQQ Q Q 9 Q SQQS we QQQQ QQ QSQ QQS Q2 3 Q Q QQQ QQ ,Q is QQQ. S.Q Q Q Q QWQQ QQQKQ QQQQQ S525 Q SWF, QSS-Q-QQQ V S QQ--- Q QQQESQQQEQS Q QQ. Q A Q.,QQ Q fi Q Q ,,,Q.Q Q, vAQ.v Q.,,LQ ,,... Q Q .QQQQQQQQQ-m QQQQQQ QQQQQQQQQQQQQQQQQQQQQ QQ QQQQQQ QQ QQ QQQQQQQQQQQQQQ QS-QQ-Q1 QQ,,QQQQQQQQQQQQQQQQQQQQQQSQQQ1QQQ Q ,QQQQQQ QQ- Q isifqsff 2-1552::fs5fS3'f2E?LQi1S5iL5E5i?E-SEHK''UQiT1E53Z55i?Q?9"TS1 QQQQQ QQ...,QQ-QQQ,,,.QQQ,Qi,QM S 1,4 QQQQ7 QQ QQXQHQSSQQS :S QQQQ Q Q Q3iQQQQQ. Q QQ QQQQQQQ'gQsiQnzKsQQQQQQ:9aQQQhQm QQQQQQQHQSW QQ , Q QQQQQQQQ QQQQQQQ ,QQQQQQQQQQQQQ QSQQ: QQ QQ ,QQ-,Qv,,QQQ,Q,Q,QQQQ Q QQQQQ ,QQQQQQ QQ.,Q,,, - ,MQ fm-Q RWE ,,, Q QQ -QSQQ-SQQQQQQQQQQQ QQQQQQMQQQQSQ-QQQ QSQQQSQQQQQQMQQQQQQQQHQ .Q Q Q 'HQ QQSQQQQQQQEQIQQQ QQQQQQQQQQHQQ-5'lSQ1SQ,S QQQ-QGMQSQQQQQSQQQQQZEQ "Surf Q QZSQQLQQQQQQQQ-Qi QSQWQQQQQSEQQQQSQQSKQSQQ QQQQQQZ QQQWQ ,MQ QQQQQQQQQQ ggQQQ.QQ.QQ,,QQQQQQ1UsQQSQSQQQQASKQQ -SQQMQQQQQQQYMWI-WQMQQ ,www ,QQ , WM QQ,-Q-QQQ,Q,, gQ1QQQQQQQgQQQ-SQQ QHQQQQUQQQQQ -S-QQ QEQwQfQfS!fQwfwQii5f-iMST Q QQQQQQQQ,QQ,QQ,QQQQQQ,QQQQQQ,,Q,QQ QQ .- QQ Q-Qxxssw Qs- .QQ QQ 7 x'SsQQ.,zQ'S:Jlf3: 1-4 We-fx VQSSSWVQ 'Sw QQ QQQQQQQQQQQQLQQQMQQQQQ 'QQ QQ?QQQ'MQ ,L LQQQQQQ QQQW QQQQ ,QMQQQQQQ 3QQQQQQQQfKQgQQQ,wQQQQS P1 QQQQQSSSS-QQ-Q QQSQQQQ Q. ,QQ QQQSQQQQQQQQQQQ Qmlw Q15 ,SEQ-SQYQQQQQ Q QQ' QQQQQQ QQZQQSQK -QSSQQQQQMQQDXQSQQQQQ QQQQQQLQQS .SQQQ QHSQQQQQFQQ QQ-QQQQQQQQ1lvQQQQSQQQQQQQQQSWQQQMMQESSSQQQQ fl-f .QQ-,fs QQMQQQQQQVQQQQQQ QQQQQQ QQQQ SM Q-2:-f'..S, was 1M5fQ.2xSQQ54Q?i11'i:fSS4g'Al Q1s15iQ,E531'K'W' gLQ2':xs1" A . ' 1' Q:Qiiswas-JQQQQQQSSQSQEQQZQQJ Q --.H Q.QQQQ.QQQQQQQQQ my-QQQQQQQQ QQQQQQQQQ QQQQQQQQQQQQQQQQQQaf ,Q ,Q I ,Q , QQ, QQQQQMQQQQ QQ QQ Q.QQ1QQQQ ,Q Q QW - Q-.rn ll xx? N55QiZ?5E5nii?E2l4SiQig5SSQQ4v57A539951,iilggjxkiim 55355 .Q QQKSQQQ SQQHQSQQ- -QQQaiG1SQSiQQ:SnQ?QQ: QKSQSLQQQQQLQQSQ SSS S 'S -, QS Q mg ,wax S ,QMQQQ ..,,QQ - Q. Qm.Q.mQQ,,Q, QQQQ, QQQQQQQQQ, .QQMQQQQQQQQQ QQ QNX. ,Q QQQQQ,Q,QQQQ,QQQ1QMQ,fQQQ 'gf QQQ-QQ QQQQQQ Q JQQ Q Q QQ,'G'mQ:gSQQQ,? . , QQQfS-QQSQQ9I2QQQQQQQQQKQSDQQQQQHLSQQQQQQYQQSSH 'U SLS QSQQQSE EW w Q Q71 Q::fsfj5Q5?wQS'?145QQQQQQSg35I9QQSv'5QW?E5PfS' ".QQQQLQLEQQQESEYQQZQQJQQ..,QQ:m?fe.QA ,QQQQQQ .QQQ1Um,,.5:,,1 , '-EA: MW QQQQQQQ QQQQMQQQQ. QQQQQNQQ QQQQQSQSQQQQ Q QQQQQISQQQQQQQWQ- 3- - QQQQ QQ Q- QQQQQQQQQQQQ. QQ,-QQQQQ,-Q,QQQQQ,QQ, S QQQQ QQ QQQQ QQQQQQQ QQQ Q ,QQ QQQQQH Q 1 QQQSQQ QQQQQ QQQQQQQQ QW-,Q ,QQ .,Q3,9Q,Q.Q.., Q Q ,. Q. M ES QQ E- Qiiglgf 1 Q QQQQQQSSYSEQQ-QQQQQQQQQQQQQQQQ QQ QQ QQQ,QwQQQ,QQQQQQQ' QQQwf2lf'SQ- 11 -QQQQQQQQ-Q, Q SQQQW ,Q X Q .QM , MQQQSQESSQS Q QQQQSQ-QQ QSQQQQQ SQQQQQQ QQ Q -QQQQQSQ SHSSL1' SSSZSSISMSfSiBfiYHS1f"Wf'HSSf Qs .QQ QQ Q SEQFQSQQQQWQQQQ-Q-QQQQ'QQ QQQQQQQQQQQQQQQQQQQ-ff 'W QQQYQRQQQQQQQQQQQQQQQQQQQQQ Q QQ .QQQ3 QQQ Q-QQQQQQQQQQQ ,Q . .QQQQQQQ QQQQQQQQQQQQQQ-QQQSff QQWQQQQQRQQQQQQQQQQQM QQ, -QQQQQS Qfsfiwgilff SQ XQQQQ ilsf 'I Q S Q QMQSQQQQQQQ. QQ .Q Q. . . . .,,. ,Q ,,,, QWQQMQQ Q1??5z?Q5QEw??Qil13iQSQ?QSQQQ! it - ' QQQQeQiQ:Q11:,QQQs1QQQQQQQSQQQSSQQQQQ,QQQQQ-QwQQQ.QQQS1:QQQ QQQ,,QQQQQQQQQQQQ.QQQ.QQQ , 5 HQQQQQN QSQQQQQWQQQQQQQ me QQQQQQQ ,Q QQQQQQQQQQQMQQQQQQQQQ wffm SQQQHQQ-SHSQQS Qff1fQQ:mQQQ?sSQQ:z5QSf QQQQQQQ-QQQQQQ QSQQQQQQQZQQQQQQgg1zQRS21gQ.QQQQ27LQQ RQQQQQQHSQQ Q'gEfsQQ1iQzQQ:Q5fL S2451 TSR QSFKSSSQQQES -SSffQsiQQx-Q QQQQQXQQQQ QQSQQQQ Q. QQ QQHSWSS ,vf Q QQ, .QQWQEQQQQSQQQQ K?Si1QQ2QfQaQ55if' QQ QQ Q, QQ QQ p QQQQQQ QEQQQQ QQQQQQQQQ QQ Q., S 'Wm' SSW QQQQQ Q Q Q QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Q .QQQQQ QQQ-Q. QQQQ Q Q QQQQQ Q, SQ,kfQQQ,,QQQQQQQQ-QQ1QQ- QQ: SQQQQ21' S1222 Q """ 'V,A ,QQ QQ, QQ gQ:SLLS"ii6rf-Mghxsix QQ Asif? Q4 Q QQQQ QFQQQQ Q -QQQQQEQQQQQQQQQQ , Q1QQSQQE!f' SWS ,QQ QQQQQSQ QQQQQ QQQQQM :S QQQM,.,QQQfQQQ,Q- QQ 'Q Q-QQ Q QQQQH21 QQQQQYQ QQQMQ Q1 S S1QQQQQ.5,QQfQ1wQ2fs QQ QQ. Q QQ-Qf ,QQQQw,Q-QWM'-.fQ,QQQQQ.S QQQSQSSQQQQQQQ-s.QQL'CQzz1'SQQQ XKSSLQQQ W .QQ .QQ -Q, ,QQ QQQQ Q QQQs.Q,QQQQQQQQ,QQ-QQQQQQ QQ - QQQQ-QQQQQ-SH SQQQSSQQQQQSQQQQQQQSQQQQQQELSS QQQQ-QQQHBQ Q QQ SS' QQ.QQQQQ.QQ,Q QQQQQWQQQ QQSQQQ . . ,Q Q Qfzflfl HQQQQ QQHKWXXQSQQQS QQQ 152354951 , .. , ..Q, Q QQQQQQQQQQQQQQQQ s-2' my Q QSVSQMQ ,ffmffea Q QQ sxv VQNL. QQQQQQQQQQQAQSQQQV QQSQIQQQQQQQQQQQQQQSQSQQ QQ QQQQQ, -QQQQQQQS my Q Q. ,QQ QQQQQQQQQQQQQHQ ,QQQQQQQQQ .,.., QQQQQQQQQQQQQQQQQQQGQQ QQQQQQQ QQQQQQQQQ ,QQQQQQQQQQ QQQQ is .QQQQQQQQQQQ .Q:Q7 s1"-QW QQQQQQQ S222QQQ32?iESi sy Qsassizasqgy 1 ZT QQ. QQQQQQQQQ Q55 QQQQ Q, MMQQQQQQQQQ Q ., ,Q Q5nQsQ:SfiQQQQ.Q QQQQ-QQQQQQQQQQQQSQfQQQQ4Q1Qs2 as QP ,1Q51,QQSSfSS'Q QQQQQQS QQQQ QQQQQQSQQSQQQQQQQQQQQ Q2 QQQQPYS ,EEQEQQQQQQQQQV Q5Q23i?'5fiQ2'57 -5 QEQQZ SSQQQQSQQQQQQQQQQ Q SQQQQ SQQSQQQQQQS SQ S QQQQQQQQWQ':QgQ'?QaQQQ:'MQQQ?QQQQ QQ212 ,Q Q 52xgrgLE,Qz1zQ1Q5sS15Z?QSssQ4i?Q' QQSQQQQ QQQQQQ QQQQQQQ-.QQQQQQQ QQ::Q.QfQQQQQS:'QQv-QQ Q QQ QQQQWQ QQQQQ AQQ,QQQQfQQQ-QQQQfQgQe.QQ :QQ SQQQQHSQSQ 1 QQQQQQQQ QQQQQQQQQQQS Q Q-,QQ Q Q Q -QQQQQQ QQQQMSQQQS Q Qu QQ QS QQ, EQ S QQZSQQ 1 Q Q Qs QQQQQQQQQQQQQQQQQ sf QQ f Q zQQQzzQfQQQQwQwQQQQf LQ 'Q QQQQQQQQ QQgQQQQQ,QQQQQQsQ',Q X ,Q WQQQ QQ QQ Q,Q QQQ QQQQQQQQQQ, QQQQQQQQQQQQQQQQUQQ Q QQQQAQQQQQQQQQQQQ ,QQQQQQQQ LQQQQQQsQQQWSQQQQQQQQQQHQQQAQQSQ, QQSQSQQQQQQ Q QQQQQYQQQQQQQQQQQQ- Q QQQQQQQQQQQQQSQQQQQQQQQQQQQQ-QQAQQ,a S QSQQSQQQQQSQQ Q Q Q QQSQQQSQ QSQQQQQQQ QQSQQQQQQQSUEY' QQQQQQQQQQQQ Q QQQQQQQQQQQQQQXWQQQQQQ Q .QQQQQ Q ,QQQQQQQ ff S5351f5liZQiQE?Q'Ei5?67'bfXif2if 2292510 ' Q S ,QQ .QQQ ,. wx ,QQ QQQQQQHQQQ QfQQQQ:QQiSQQQQQQQQQQQQQ1QQQQf?fW5?SfQ2i' V W QQQQQQQQQQQLQ,QfeQQQQQgQQSzLfSQQQQQQq g,2QfQQf,QQsQS?3gQ4Q2: . Q , 'QQQQQQVQSQ QQQQ'QQQ,QQQfQ Q1QQQQQ QQQQQSQQQQQQQQQ21ffSf4YQSQQzQaQS'I2I'asa?QQSSQQIQQQQEQSQQQSSE YQ' QQQQSWQQW QQQQQQQQ QQQQQQQQQQQQH-Qu QQQQQQ Q21 my ws QMHQXSZZ WWGQQAZS'if'filS3'Ss1E,liS??5i"4J0EZLEWXSWSHYVZQQA3'i5i4F21I5 Q Q Q QQ,Q,,QwQKQQQ,,,,,QQQQ,,,, QiQ,,Q,,,W ,sawiwmWmMA EQg,iWw3w9mgMWLQQQ,QIQ5QQM5QQQEQWmwmlwwigv QAF5Q5,3QQ?gg5,w,QQ,,4g,wQmM,Q, TQQQQKWMQQAwwwLkVQQ,,,,lQQmLQw,QLQQQQQQQQQQQQQQQQQQQEKQQMQ QQIQQQQQQQQLQQQLQQXKQQ,3L:QQQQQQQQQQQQ55QQQWQQQQQQQQQQQQQQQQQQQQQQQQQQQme,-Q5,1QQQQQQQQSQQQYQQQQQSQSQQQQQQQSQQQQSQQQQQ QQ -QQ-QQQWQQAQQQQ . ,..QQ,QQ QQQQQ , xl, MUVw,.,b:,QQMQQQQQQQQQQQQQQ,-QQQQQQQQQQ.QQ:QQQQ:,QQQ,QQQQQQQQQQQMQQ,QQ.,QQQQQQQ,Q,Q.QQQQQQQQQQQQQQ.QQQQQgQQQQQQ..,.QQ Q1Q-.QQQQQQQQQQQQQQQQQQ.QQQQQQQQ-QQQQQQQ-QQQQQQ-QQQQ,QQQQQQQL,,.,wW,QQQQQAQQQQQQQQQQ-Q,Q,QQQQ.QQQ-QQ-,QQQQ-Q-QQQQQQ- QQQQQQ.-QQQQQQQQQQQQQ:fQQQQQQ.QQ.QQQQQQQQQQQ Q V, .,mQ,,,,Q Ll ,QQQQQ,,Q...,, I-Q,:,,: Vu, QQQ,,Q.L,,,1Q,1..Q.Q ,Q .,,,Q,QQQQQQ QQQQQQQ.-QQ:Q-QQ,QQ,,-,QQ,QQQ1Qff1QQQ1QfQfQQQ-QQ:',SS11QQQQ::QQQ1-QQQ:Q-:S-Q:f-:QQQQQSQSQQQQQ,,Q,Q,Q-f1SfQ-Q,.-QQQQQQQQQ,,QQQQ,QQQQZQS-QQQQQQQQQ,.,,.,Q,,.QQ,vQQ::Q-SQQQQQ-Q-Q.,,,HgQf1:.ffQQQQQz..QQ-:QQ-:.fQQQ.,..,Q-.Q-Q -,QQ-Q Q.QQQQQQQQQQQQQQQQ,.QQQ,Q-Q..QQQ.,MQ-zQ.QQQgQQQ. H SQA .QgQlgg::Q, - ' QQQQQ Q.fQf23QQv,,QQQggQf1QQ22Q UQQQQQQQQSQE1iiSS5QQQQQSQQLQQQQQQQSQQQSQ1QQQQEQQSiQQ4fiiSQ2Q1QQQfQQz1SQQEizfQQ1Q2Qi"Q:if.Q QssfffffflswfIISQQQQLYQQZSQS'E2Q1QQ2g?2QISSQQQSSQTSQVQSEQSSQSHf5f5i2iQf29?flSSffHTS'" Wff1l1f?fQSfSif'Wil-Sf'42v1"4 Q-filf-QQ-S1250 SfSSf?fiQQL??1v5f'f5?AQQ'?i3fffi3f5S2Sf37igSf2fFIS? Q-Q wig,-ui A VQSSSVQQ Ali m.ig5LQiA MQW gggmggiifswmrm,kiffgilw:Q,'MQL4gQMbV vMp,w45QQ, WSQMEQQQISSQQQQQW ,miwigigmI5vQ5gQUAQQg55g5QQ5',L:QQ-' SQY,5fjgQQQQ:Q32z:gigage ' ,uiQ'Q21133221:zgS9FQ575L2:iL1!iiSiiiiilws-,QQw:SQi5iQf:' 5:1111:?Q?QtEQif7QiliYQri1-Q- Q. Sf'-LLQEQQHQ1Q.wzxv1Qigf?Lgj'' 'iQgQQ7Q,Qg1'.1sS1pSM,k4Q gg,gg,QgQQQgQS1? k,QQQQ1Q QQ.--Q -QQQQ QQ,Q,,15,., LWILQQM,QQ,Q,,,,Q,Q,QQQQQQQQQQQQQQQQQQQQQQQQ-QQQQQQQQQQQQQQQZQQQQQQQQQQQQ.QWQQQQQQQQQQQQQ,,QQQ..,,Q1QQQzQQQQQQQQQ.Q...-QQQQQQQQHQQQQ-Q,1Q QQQQQ.,-QQQQQSKQQQQQQQQQQQ QQQQ-QQ-QQQ.QzQQQQQQQQQQQQQQQQ-Q-QQQQ:-wQf2Q-QQQQQQQ Q-QQ:Q:QQS1QQQQQSQQQQ-QQQQQQQQS-SQ: Q Q-.::zQQ:QQQQQQQQQQQQQ.,QQQQQQQ-QQQQQQQ.QQs:zfQ-QQQQQQQQQQQ,QQQQf,QQQQQQQQ.QQQQQQQ, 7, ,Hi ,L,,wHw ,Q Q QQQQQ. ,l,,,,,QQQ,,QQQQQQ,Qm.,QQQ,,QQ.QQ:,M,,QQ,QQMWQQkQQQQ,MmQ,,,QQQW:QQQMQQQQQMQMy,L,QQQ!m.Q,,MMQ7LW,wwf,M.l5,13:QQ.QQ,QQMQQQQQSQQM-.QQ.QQQf,QQQQQ-.QQQQQQQ,QQ QQQQQQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQ QQQQ-M-QQQQQQQQQQQQQQQQSQQQQQQQQQQQQQQQQQQQQQQQQQQQ-QQQQQQQQQQ-QQQQQQQQQQQQ QQ ,QMKQ,QQEQ5QQm23w YQEQQQEH LQ, NLELEMQQQ,jigsawwgQQSQQW,Q,LQ5,g5QQmQgQQQLQMME,wi55QggQgU,QQQgiz:QQQQQ:gayQQQQQEQQSQQQQ3QQai7QQQ::2gaggQsQQQSQQQQQQQQQ QQQQQQQQQQQEQQQQQQQQQQQQQQQQQQQQQQQQSQQQQQQQQ QQQQQQQSgg:QQQQ:vgggggQzQQ1QSQQQzQ QQQQQQQQQQQs1ZP2Q:gQQv1:QSQ:Q:f53gfQQQQf:g:z5Q3QQQQQQQQMQQQQQQQQQQQQQ5Q5Q5giQQQQQQQQQQQQQQQgg555g3QQQ5QQQgQrvif5QQsQQ1Q5gQQQQQgQ5 QQ QQQQQQQQUQQQQQQQQQ1gQQQQzQQQ,Q.. QQQQSQQQQQ QQQQQQQQQQQ, QQQQQQQQQQQQQQQQ-QQQQQQ1QQQQQQQQQQsQ1QQQQQQQ7QQSQQQ11QQQQQQQ5Q3QQQSQQQQQQQQQQQQQQQQQQQQQ-QQQQQ5QQQQQQ1QQQQQQQQQQQQQQQQQQQQQQgQQ1QgQQQggQQQ,QQ:QQgQQQQ-..QQQQQ. '-QQQQQQQQQQQQQQQQQQQQ:QQQQQQQggQQQQ:QQQQQgQQQ1QQQ HQQQQQQSQQQQQQQQQQQQQQQQQgazesQQQQQSw1QQsi1QQ:fff?QQ?2SQQQM2fSfiQsSfQ?SL42i1?Q1IfY255624Q121SS'2Si2i2ESQSi1SMfQK2SHSHS51Qfi1QfwffiQ2iwLSQH1Yiiiwflibli .Q . Q Q .Q 5 QQ ,QQMQQ-.QQQg11g4QQQ,Q Q-QQQQQQQQQ ,QQQQ QQ, QQQQQQQQQQQQQQQQQQQQQQQQSQQQQfQ.QQgQQffQ-QQQQQ QQQQQQQQQQQQQQQ1QQQQQQQQ1QgQQQ,,Qm,QQ:eg,mQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ,,QQQ2fg,,5QQQQQQQ-QQQQQLQQQQQQ1WQQQQQQQQSQQQ-QQQQQQQQQQQQHQQQQQQQQQQQQQQQQQ-QQQQQ QQ:QQIQQQQQQQQQQQWKQQQQQQQQQQQQQQKQQ QQ. ,QQQQQQQQQQVQQQQQwgQQQQQQQQQQQQQQQQQQQQQQQQQQQMQQQQ,QQQQQQggggQ,QQQQQQQ,QQQqQQQ:1QQQ,Q5QQQQ.Qg JQQQQQQQQQ QQ , NQQQQQQQ-.Q,.,QQ,QQQQ,QQQ,Q,QQQQQQQ.,Q,Qg1QQQ,.QQQH .QQQQQQQQQQQ ,Q ,,QL--QQQQ:w11Sv1m--ffQQQQQQQ:Q,:QSQQfSf-QQQQQ,QQQQQQQQQQQQMQQQQQQQQQQQMQQQQQQQQQQQQ,QQQHQQQQQ:QQQQQ,QQ.QQgQQQwQ5QQ,QQQQQQQQQQQQQQQQQQQN,HLQQQQQQMQQ,QQQQQQQQQLQQQQQQQTQQQQQQQQQQQQ.QQQQQQQQQQQQQQ QQ,Q-QSQQQQQQQQQQQQQQQQQQQQQQQQQ,QQQQQQQmQQQ:QQQQQQQQQ1QQ:Q:QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQWQ,QQQQQQQQQQQQQQQQQQQQQQ,QQQQQQQQQQQQQQQQQQQ U ,mm VVWLQQKLQQQ k,m.,Q7 Q,A3I,HQ,iQQQmk ,Q,,S3Q,,,QQ ,,. MQ-W ,,::s'fV-QQQQ-gzQrT1-0' Q-"QQ"-:S1KSQffS7MQQQ:sz:QpQz4Q,Q:nSQQ-QQQWYF?1952-SKQSSVIISSYUKTU5'QSQZZWS'YSzxgfiillfsxzSSSRQEUSSSSSTXSQ1'LASYQEQ'VQSKSQQQQQSIQLXQQQSG1QQQQQQQQLQQ-QQQQQ-S,z4Q.exQIQQQQQQQQQWNQVQQQ QQQQCM,LWQMRQQSQW7ITwgQQQQWQQQ3QzgzzzQigQQ,QgQg,.wQ QQQQ.QQ,15QQ:zS1QQQ,fQ217QsxQQ2Qs2Q.S.QQ.,,QSQQDQQQQQQQSQQQQQIQQ,,wus swffQse1QSiEf5Q'Q:,sQQfYQSQQ2 515.36 QRQQWQQ52WQRIQQQEQQ:q,AgQQQfQg,QQ5:vggg ,Qzz1fF21ii?71S7iQQQ f555fffVffS' Q-wif, 'QU .VSWLQ Q'7Qf?EE73fV1V""'ez QQf759:l2fTlQ1M'fiE5Siif?S1TQiSZ4SEiffWlSiQ53t1QQQzz4Q5QQWLWA5.,,V?Qg5QQQQim7Q34Q5Qg5rQmaggg5,QQgfQSsQQ1gQz45fiiZ5EYL5XEifIQSTQ2LziZW5:lfZlfS3:7il11?,SS?!l???1iSii5S5:LQZQff2sQ-i337fL1QQffQSg57Sf. 119935L?5i:1-29121245211z'Q2LU'1j1gg2?S11QSi'5495252QII55532.i:iitisS59lCiYiE2gf2ZQSZZEQEZLTi2fez2'5V9?E595??T555'Zf2Il2915fZQ2?5iiSQ15fiQii'ESH55 .EQSLSLSSIZQSELQIYSISEESSK Jw, wiqfimwL,QQiQQWL5iLQQaQ, KKAQQQMQQQQgm.QM,LQQQQQQSLM L5QQ,QQlL1,QQQQQQH QSQQQQQ, QMMRQ MQ,QQ,,,Q.,,..,QQQfQQQ gmQQLQQQLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSWQQQQQQQQQQQQQQQQQQQsi?QQQQQg2QziQwQQgQQQQQEEQSZQQQQQQQQQQQQQQSQ?QQQ2QgzeigQQQQQQQQQQQQQQQQQQQgQsQQzg::Q1QQQQg3gSQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSQQQQQQQQQQQQ.QQQQQQQQEQ'ggQS2QQQQQQQQQQQQQQQQQQQQQQQQQIEQQQ1QQQQQQQQQQQQQ1QQQ2ggQQgiQQQQizQQ,,QQQQQQQSQQQQQQQQQQQQiQsgkgqiyQatQQQQQQQQQQSQQQQQQQSQQQQSS 2,5W!gQ,Ma,ZwQmkH M Wm2Qh.QEmM,,WQEEWQIQQWSA Q.QQMMQQM,Q55 Q,QQQi5wwM5,Lv., wim,ZWEmwWQ,,,m,Ql4Q5Q,QQWQQQLQQQQQQQQQQQQQQQQQQQAQQLQQQQQQQQQQQ::QQQQQQQQQQQQQQQQQQ3:Q4QQnQQQQQQQQQQQQ.,Q5QQQQ15QQQQQQggQQQQQ11gs5QQQQQQ1QQQQQQQQQQ52QQQQQQQQQQQQQQQQQQgQQQQg3QQQQQQgQQQQQQQQQQQ ,QQQQ1355SQQQQQQQQQQQSQQQQQQHQQQSQQQ,QQQ:QQQsQQSQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQgQggQQQQQQQQ:QQQZQQQQQQQQQQ-QQSLQQQQQQQQQQQQQQQQQQQQ1Q,QgQQQQQQQsQQzQQgQQQiEQQQ:QQ:Qsg7QQQQgQQSQQQQQ KWH? MQW:QgfQQQQQQQg,QQ345QwQMQigfiiw, . QQQQQQ, 5 EQQEQELQQQQQQMIEQQQQQQQQ, MQQQQQQEQQQQQQQQQQQAQQQQQQQ QQMW, MQQQQQQQQ,WWQQQQQQLQQLQQHQQQQQQQQQQQQIQQQQQQQQQQ5QQ3QQQQgQizQQQQQQQQQQQgQQ21QQ2QQQ3QQQQQQ575eggQQQQ7QQQ21Q2SQgiQ5gQQ22YEQEQQQQQQSQQQQQQQSSQQSSfQQQ21Q2QQQQ2KSLQQ2QQ3QiQeQfQ5SgQQmg2QgggQiQf4iQQZ'iz5Q?SL2QQQQQQ-QgQSQQ1QEfSi5?2Ef2QQ?222Q1QQQ5QQ5S2Sil252QQQ22QQQQ?EQ222ewQ5Q2g1SLQQ2.Q2Q1Q222555SQ?IQLQSQasQQZ2EQSifSZS3Q1QSQ52sG?i53iMS2QQ2Sil?-if? W VS Q 2: 8 8 . ,QLQQWWZQZSQQ VSWQQQSSMQQQQHLEQQEMQ Qgwgif QQQQQQQQQQQQQQQQQQQLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSQQSgs55535552LQ2gs3523Q51Q2Q2iiQQSESZQQQiQQZQQQQQQEQ2YMffiw?QQQ35QQ,,,QQ'2iQWQSSLZEQQQQQQSSQ22:giiisiizeQ2SQigssfgQ3QQQQLQQGQQQ551553EQ242133555215SQMQSQQQQQSQQQSZ'Qif2Q2ZQEFQQQQSQSGQQQZLQQJSZQ52QQQQQQQQQEQZSQQQQQQQQGQEQLQQQQQQQQZQQQQQQQQQLQ3gegsii2iiEfSZf1QgQzQm2QSS , Q is W NQQQQ Q MZQ S SQ QQ f Q S QQQQQQQQQQQ QQ Q QQ QQQQQLQQ WQQQLQQQ-QQ QS HY Q Q Q52 Q ,mm Mb .557 MWW3?WMQLQW ,QMWHMM ImmmIQMMQQQDQUMMQQQ,MQQZQQQQQQQQQQQQIQQQQQQQHWQQQQQQQQQQ,QQ,MQQQQQQQQQQQQQQQQQQQ.QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ4SQQQQQQQSQQQQQQQQQQQQQQQSQQ3QQQQQKQSQQQQQQQMQQQQQQQQQQQQQQQ2QQQQQQQQQSQQQQzQQQQQQQQQQQQe:QzQeQQQQQQQQQ-QQQQQQQQQQQQQQQQQQQQQQQQQ FQ, Q , ,QQQQMQ M,,QQLSQQQQ,MWwMQLQQ,.,QQQA SQ, QQQM 4L,Q,,5Q,l,,Q,m ,MQQQQQI QM,WQ.,,.Q,QQUWW,QQnw.MQ,UQQQHLQQIWQQQWMI,WQQQQQQQLQQQQQ ,QQQQQQQQ,LQQQQQQQ.MQQQQQQQQQQQQQQQQQQQ.QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ,,QQQQQQSQQQQQQQ,k,,,.QQQRQ,QQQQQ,QQ,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQWQQQ,QQQQ,,QQQQQQQ1QwQQQQ,Q:QQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQSQQQ.QQQQ,QQQQQQQQQ.QQ' QQ S , MQ.. ,. . ,Q,,..Q,.QQQQQt1Q:Q..QQQ'SVN M-W3 ,. MQW, QQ.,fQ5QQM,Q Lim Hy: QQ :QHQN QQg1QQlQQ,Q,Q.QQlQ,QQQJSMLIQQIQW?,'fsSVaiW5??TQSQ71f5Z19?y23iiZQErQ,:SQ 3z,gg,,,Qfgm.SgTsi1z4fst45EQ,1?QSrggsSiTfxS:1ZYsQ?QIs:4ziggy',S14iiQf,:t1Q.QkfzgQfSWS!1sf1?2QQi:fH2ZiSg7gfSZ7ZLLQLQsf-,ZQEZQQVQS3LgQZisQ5Qa5iL2YIQ9Q4f?,E2V12ZsfQZQSfr:HiZff155L2iZ.S4xzSQ11j?g5QZb2Qr-,Qpf4S,7gf4i?7g5Zsw1S1QSY" QEQQQQQQQW Qf2Q?Q,Qz1QQ1'W a ,Q ,, km ,WQWRQW mwmwh SSM :L . Wim miaIQQQQQWQQQQQQIIQQMQQQQQQQQQQ,KQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ,QQQQQSQQQQQQQ1,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQMQQQQQQQQQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSQQQ'QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQgmQQ-QQQQ2QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQZQQ -QQQQQQQQQQQQUMQQQQQQQQ, Q Q Q QKQQ QQQQMQQQ QQ, r ,,QMQ5,Q3QQ,QQWQQQQQQQQQQQQQQQQQQQMIQ .g,QgQQQgQzQ,Q,3QQuQzQQQ,QQQQQ,gU QQQ ,QQQMQQQmeQQQQQQQQ3gQQ51Q21QQQQ1QQQQQQSQ2QH1Q311Q3SQQQgg91QQQQ4QQQ2QQQQQQQQQ1QQQQgaQQS22QQ2QQ2QQSQ?QQQQSSQQQQ5Qz1QQegQQ22IQQQSQWQQZQQQQQQQQQQQQQQQEQQQQRQQQQQQ:QQQ5Q1Q4QQSrQgq2gQ2QQ4z:QfQQgQQQ:QQQi QW?QQggQQQSQSMQ,,2QQE3QQQ1QQ2Q25e2QQQQe15f5iSSwzsSQYQSEESfQSaQS25QS?5i5S1QS7QwfQSZQSSLQYWQQQ,QS?445S?1SSQ4QQ5S2iQ??2fZifQiLQ Q f'Q Q2 S Qvf ,XVQNW NMWQH W QQQAQQQ w:5?5Q1gQQ3ggQ33Q35553 k5w,gQQjg?gg55QgV wggwl MyggQSQ5Q3sQjggiVI,,QQQQezSy,iliQj.H:,NjjQ,,25-Q3125252125gi1EyEQi5Z2QS3?Ei?gfQEigQQ3?Q53Z55Q1g5S'fE5Q3gQQi723iQf2ggSESZ4i?155515235S2523Li?gfQiSE7LE593if112555?ZS?iliiiiiiififfif7LQ?Si2EQq5iQ?515323253-Ei?ZQ5LfQ51Ei5??,QE.',fQ7L:,g5?j?QS225Yi5'5?iZLiSiZlEf'fQg?i55fS1'SsS3332AgigESZQESQIZZQQZESZQSZZSZESLQQMiQ?jQQ5gQigQ?,ZLS2QZ2ig,QQEQQQQQELjQ4Sg1Qgga3QQZi5i3Zl535SE5QEZEf5i2Sf3g5?iQQ?QZE51f52iEQi Q ,fx Y S A , fwwifzrgy Jim byQZWQKETQQAQMQQggQQ5T5,Ii3EQQ5g33.gQg5QgQ,g1y5QjgQSL1QqQQisz,:QgSiQQ7zQS?ggSf':5"EQ3:gl 'f!zQg',,j52?SEN4115332'ZQQSQZLE'fgiiflilffiii152.1245552ggggfglin45?Lif7Q1:gfgg5iL4Q2g5EQLi1WLZQQETESSQQeeggaifk-,'TYSg:QggS146?iQL42SZQ4iTi?Qgg4fY4i4j7 S,?Zsx??llQSgggL5QQQ2?Q'335i33YliYLEiZ5?Q?5E1'ZZffggii',7.',132QQ'21 i24?Zf5SYQjiE,Ei7Q13y3EQaiu 1gQQEZEL4-Q?11Q4Lig9WiEiQ?7gQH5222ii1v1gfii545f?iiE?MSAQ,,24?Q,Q155I?1L54gi155?i52ZIfESSLSQQZEEEZQTELLTRIEQE, 'Q Q Q fr Q Q,lui.,,,,wwimg?Wm:,XEQQIAQQQQQQQQQQQQQQQQQQQQQQQQQEQQQQQQQQQQMIWMSAM W,,QQQ,ZQ,QQQQQQMQQQQQQQLMQQQQQQQQQQQQQQQSEQQQQ.QQQQQQQQQQQnQ:QQQ1QQQzQQiQQQ,QQQQQQQQQQQQQSQQQQQQQQQQQQQS,QQQQQZQQQQQQQQQQQQQQQQQQQQQQQWQQQQQEQQQQQQQQQQQQQQQQQ?,QQQQSZZQQQQQQQQQQQQQQQSEQQQQQ,QRQQQQZQIQQQQQQQQQ23Qgs?sigQ55QQQQiiiQQQQQQQQQQQZQQQQQQQQZQQQQQQMQQ QQQQQQQQfgQgQz?QQQQQggQQQQzQeQ1QQQQQQQQQQQSQQQQQQQQQQQQQQQQQQQQQQQQQQ I ,Q 7 Q Qs ,Q :QQQQQQQQQQQ , ,QQ,1QQ7z,QQQQQQ.QQQQQQQQQQQQQQQQQQQQQQQQQQQQ5,QQ:QQQ:QQ5QQQQQQQQQQQ,QQ,g.QQwQ,,,k,Q-QQQQQQQQQQQQ-QQ.,LkH,Q,QQQQ..,,QQ,QL,,,,,,Q,Q11f,Q-Q,Q.QQQQQ-2QQQQQaQQQ1:rQQSQQQ-QQQQQQQQQQWQQQQQQQQQQQQMQQQQf:QQwQQ'1QgSQQQQQQQQMQQQQQFQQQ1QQfS1Q2QQv:QQwsQQSQQQMQQQQQSMQQ3Qw:QSi5w::QQQQSQQQQQQQQQLQQQQQQgwsniwQSQQQQQQQQQQHfwawQQQQQQSQQQQQQQQQQLQZQQQQQQQQQQQQSQQQZQQQQwgQs2QgQQQ5isQwQQQQQWQQQQQQWQ1QQ13QeQQQvQQ::QQQfKQZQQQQQQQQQQevgfgvwf Q QE Q X Q4:Q:,,,gQQQg-QQ: ,QgQS:Qg53QQf,Q sv Q--Qz4Q'Q1'fYlU5p1QS:Q QQf:Q7z:wQQQQS5g3y,Qff Www' '1iLgyQL,QQ4Q,QQQ. MIM.: u.Q:Q:wvQQfSM, ,GQ ,NW-Q Qmyz:Sgg5QyQQ:Q, QQ ' "'QQQM-QQQifvzgqyggzfmfwzwwffkfewzxzas9413:sQE7:'Qa2ifSiIW-Szmwxwiiiks,'f4wwS51:Qz1zsS'ffTiQQyQwzQ1f211QQQzrz Q3QzQ4w1SS4-SQL,HWwasJQwQHSZQQZQSMZQ-WMLSVIISHIiQ:t7tv4sQgQfQQmQQx 7fw,.3QQQgQQQQgQQfQ,I3myQQ ZQ,12VmQQ,..sQs MQQQQQ 1435, if QQQWIQQQV,QWQQQscQQjgg5QQQQgQaz:Q:QQ ,Q Q.,QQ,-fff.11QQQQ..Q.,,Q,mlAmnZ: WMM WWMWKWU YV W3tlwwwxm w,1,,Q5.,,L,, ,.M,,, QQQ,QQ,QQQ,Q,Q,1QQ,MQ UQMQQQQQQQQQ,QQQwQ,Qf1f,QZQQQQQQQ.QQQQQ.Q,,,,Q,QQQQQQQQQfQg34QQ1QQfQ.Q,mQ,QQQQQQQ-QQQQQQQQQQQQQSQQQQQQQQQQQQQQQ QQ,:QWQQQQQMQQQQQQQQQQQQQQQQQQQSQMQQQQQQQQQQQQ-QQQQQWQQQQQQg,QQQQgQQQvm,QQQQQQQQQQQQ,QQQQQQMSQQQQQQQQQQ,,QQQW,QQQQQQZQQQQQQQQQ,QQQQQQQQQQ,SQ,QQ,Q,Q,Q Q , EQ 2 ,Q .QQQSQQSQQ-QQQQQIEQQQQQQQ. QQQQ,QQQeezzQsS?Q4Qq:QQ QQ QQQSQSfQQQmQ:gQ1QQQQf,sQS-QQQQQ:fQ1Sgg1SzfQ-QQQQIWQQQI ,QfQQQS1:QQf45Qfz,1:zfQQf QQQQQQMLSZQQG:-QQQQQSHSWEQQQSQQQSIQQSSZQSSQQQ2LQQ2QQSS12S1QS1QSSL1iSS2QQQSififiZi5Q2WiS?Q5222352255221BQf52fSSSiQ22HiQQE2iff5'IifSQQSif1if2S52?S2QIQSS2352QLQSSQfSSI?25SQ2il9ES3SQ2HSifSEQQ:21QQQQSgggQggQQQQQQQQQQQQQQQQQQQQQQff'QQQXQQKQQQQQQZQQQQQQQQQQS X i Q xy Q SS 3 Q S QW ,QQ Q " " ,. , f,..,Q Q, ' QW-Q.,,QQQQQQQQQQQQQQSQQQHQQQQ11,fQQQQ1QsQQQQQQQQ1QeQ1Qgf:wQ22Q1QQQQQQQQQQQQQSQQQQQQSHQQQQQQQQIQQQQQQQQQwasQ2iQ12QsQQgwQ1Qz7LQ2ZWffwfgfiMW?W-SS2I7YIW?QSY3WfIfS11QiFWSi5ff'fS?i7?'A11fWWHZWSSFZSJM Q Q 2 QS if S i S' V H M, 7,WQ,,,Q.Q, -Q:..Q,fQQQ:..S,.Q-QQQMQQQ W, ,,,.QQ,kQ,1QgQ,Q.Q--WQQ, Q-Q, .Q Q gm Qsxm-Q ,QSQQLQ :Aww fQQf4Q2zrs,Q Q-MMQLSSILQZQQQ,,QQ-QQQQSMQ,QQ-ww-.Q--KQ-Sf q,Q.sQQr1Q-ff-QalsifzfwHQ:2,QQfQQQQmxHsQifS QQSSTAYVQQQ'-WAWIW Siilfwv-'1QxWQQQfQ.s1s Sz1QSfWSS1QSvWQQwsr fries,,Q75,LQ,Q,,,,Q-QQQ4 Qg,QQQ 7 ,egg Q Q-KX5pQyg,zzQQ QQ AQQQer,,,HQQQ S S Q4 2 v 1 2 Q Q my S SQGWQ Sy HQ SEQ' Q LQ QSM ,Q I QQ QJWS -S Q 9' H29 Q LQ -- ,QQ.Q1QfQQ,QLQQQQ,QQ,Q5,QQ,,QQQQQQQ W QQ QQQQQAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ- QQQQQQQQQQQQQQ,,,QQQQQQQQQ,QQQ-,,Qf:Q,gQQLQQ,QQQ,Q1 ,Q,fQQ:g,QQQQ,:Q-gfQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ-QSQQQQQWQQQQQQQHQQQQQQQQQQQQQ-QQQQQQQQQQ,,QQQQQQQQQ,QQQQQ,QffQQQQQ,,QW .-Q, X M, ww,,,k,,:,, mm,wwfQIEQQAQSQQWM,,QQMW MQWgMQ,g,,QQQQQMQQQ,QQQQQQQQ,WZQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ,.QQQQQQQQQQQQQQQQQIQQQQQQQQQQQQQQQQQQQ'QQEQQQQQQQQQQ.. ,QQQQQQQQSQQQQQQ QSQQQQQQQQQQQQQQQQQQZQQQQQQQQQEQQQSQQQQQQQQQQQQQQQQQQQQQQQQQEZQQQ Q M6,W5QQm QMQEEQQQQ,WQQQIQQFXQIWWQQQQLQQMQ,QQQM ,,. QQ,L7Q,,QQgMQQ,QQgQ,QQ,Q,w5Q5QQ3,lQQg1QQQQQQQQ,VQQ3-QQQ.QQgz1Qi7QQQQ:Q5fQQzzgfQQzQsQQ3QQQ2QQQQQQQQIIUQQQQQQQQQQQQQQ.QQQQQQQQQQQSQQQ1QQQQQQQQQQQQQQQQQQQQQ:Qg7Q1i ,aiQ2s1Q:QQgzgQzfQQQQQ5QM5QQQQQQgeS2QQQQQQLQQQZQSQQQQQQQQQQQQQSQQQEQQQQQQ 'Q ,,QgfQQ,QQQzzQQg QQQQQQQQQQ ifQQQQEQQQQQQQQQQQQQQQQQQQQQQQQQ,,,gf'QQQQQ Q-S'S'SQQQQQQSQSQQSQYSQQQQQQQSQZQMSQQQQQQQSQQ.QSatS1fQQSQQQ2QLQQQsQSQP5fSfiQQsgfSQfQzQg'Q SS1QQQLQQQQSSLQSQQQHXWfQSQ1QS2fSQQifQiiZQ?1'QW1SS7ES2SfifSS?fWSWAQS?SfSSQQZQQQQQQQQQZQQQQQQQQQQQMQQQQQQQLQAIQQQQQQXQQQQQQQQQQ QQ SS Q new K w,,w,.HWH mgxwmyisiiVjiQwQLM,ML 153135,lmgmiiEQ,7QQE55QW,L1VMQQQQM Q,5gQ,,kMgQ.:gziL, Qi. ,,Q:Q:3,LzlQf fQ31EZS3i4nzQQSSSZ1EEQ51Z-Y?Sill?:E5Qi1Q?ST6f?W57aWfS?Z5W5iQsQW1l?'?'SS'ISW4gi?7iZi4Qm LQCZSQZIZQSQQEQQQQS522x?EES3li1iLf7ZQinz1fiSQR231fB?5ZlSlWf3r?2S'ffZaEFQij1?f1i?iif3P11iSZEE?iS:QQQSis11Q32?iQWQiQZ5?1Q'1SVfi?WliQ1ff?Y'?S Qhfg K, .QQ ,, Al, u,,,.,Qw,Q QM-Q,.QQ ,,,, . Q QQ--QQQQQQQQQQQ:QQ-QWQQQQQQQQQQQQQQQQQQQQQ,,Q-QQQQQQQQQQQQQQQQQQM-QQQQQQQQQQQQQQ,Q,QQQQQQs..QQ,WQQQQQ,QQQQWQQ,Q,,,fQQ,,QQQQQ,-fQQQQQQ-QQQQQQQQQQ-QQQQQQ QQQQQQQQQQQQQQQQQQ,QQQWQQQWQQQQQQQQQQQQQQQQQQQQQQQQQ-SQQQ ,Q QQQQQ, .H--,QQQQQQQ Q wg-wQQ:Qw4S11227iifQQQQQQSQQ1QW,wwm.,Q ,QQQL,,,1 M,QQ5wyk,k,,,QQ,,Q,A1m.QQqAmg, KHQQMQQQQQQQQQQQQQQg1QgQQQQQQQQQQ.Q,1Q,QQQQQQ1Q3Q5,gQQQQQ.QQQQQQ..QQgQg1QQQQQQQ,QQQQQQQQQQQ-QQQQQQQQQQQ,QQQQQQQQmQg:gQwQQ,sgQ1QQQQ:QQQ2ffQ zg,QQQQQQwSsQQQXQQQQQQWQQQQSQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ,,QQQ,,QQQQQQQQQQg,QQq Q QQ Q ,L,,LQ,QQQ,, I QQ,QQQQQQQQQLQQQQWQEQQQQE,M,w3,QgQy3g,QQgQ QQQ QQQQQ, QQQQQQSQQQQQQQQQQ, WQQQQQ, ,YQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQ,QQQQQQQQQQQQSQQQQQQQQQQQQQQQQXZQQQQQQxQSrQQ35saiQQQQQQQQQQQ1QQQQQQQQQQQz7l?ZQmQzggQQQ2QQQQEQQQQQQQQQQQQQQQQQQQQ:-QQQQQQQQQQQYQQ,QQQQQQQQQQQQQQEQISQQQQQQSQQQQQQQQ:fQQQQQQQQzfQ,QQQQQQQQQQQQQQQQQfQQQ5wmQQQQQ,5 2 Q Q-,, ,,,,,Qfz5M iiigik K,MWbgwigI,ZhQWQQLSJSSZLEQQMWEiijmkizi K: VV5QQZmxQi,:Qk rm ,uqzizw A 7'Lg51657.,lgqagwiiqi1535WQlEMEQL5QZmiQ,limggganaqligiig:fSLQQg:gQQZyQQ?fin-QSL?5lQQ2nQ'e2zgfgg2iTlQQ?xiQQE5Sf?fiS,LgVEIQQLIL-QLg5ii:2vZ4SQ14ZZIiSiifl13E!Sf?QQiiS5EQLlSifQa,'64sf?Q!1SSQL59Ev1QSZkQQ,f?HljQS?Z?EsQQL5-g',QQfZf5QZi3QQQQQSTISQW Q63-'15zQLQZfw12AQQQifi2,f,1 QQ W,m12,Q7QlQQQQQ,QMQQ,IQQQQQEQQQQQQQQQQQSQQQQWQQQ5QQQQ2QQQQggasSilfiQ':QQ5Q5-kfQQlQ.Q QQQQQQQ-QQ zf.:1?gSsQ,g1QQQq:." QQQQQQQ-, gygsz QQQQQQQQQQQQQQQ,ZQQQQQQQQQ1QQEgQ4Q3QS2EQ32QQQQQQ5Q5QQQ2Q4QQ3Q45g4Q215Qt7QQEQQSQE,QQ34QQQQQQLQQQQNQQQZLlfifgmiqgasfQ1QQygQQ9fg1'Qfgmf5QQSg'QQmSgQ5E3QQzQQQKQQQgQ5QgLQkQ2QQSzQzfQS1Qezf1iQQQQHQQQQ QQ QQ,QQ1QQQQ3QQ2Q2QSQQQQQ1LQQQQQQQg5gg5QSQQQQQZQQQQQZQQQQQWS?Pgi 2 QQ -Q -- -,Q.QLIQQQQQQ-,Q,wQ1f,QQQQMQQQQ,QQ.QQQ5,,QQ4Q,-QQ,L QQQQQQQQQ,Q,QQ,Q.Qm,,5QQ! kQ,,QQ,,:1 ww,-if,,f,QQQy.QQ,,QIQQ-QQQQQQQMQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ-WQQQQQwagfaQQWQSSK-QSQQSQ-:wfQSQ,QQQQQf-QQQQQ-fg,fffQQ11f KQWQQQQQQQQ,QQQ1fMSSQSQQ:WQQQQSQMQQQSQIQQQ7JQQQQQQQWQQQQQIHSESQQQQQSZQQQQQQQQQmyQQQQQQQQQQ,fQQ1wg,ffe QMWQMMQ,QMWQQMQWQQWSQQQI:Mw,Q,Q5Qhi, ,QQ WQQxQ,Q3:m7QL:,n ,,,,QQQ,AQQ LQ,yif,MQQMQ,Qm,gQ,WHMWXIMQQQQQQMQQQQ,QQQQSQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ,KQSQQQJQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSQQQQQQQZQQ,QQQQQQQQQWQQQQQQQQQQQQ QQQQQQQWQQQ, QQQQSQQQQQQQwfQ',gQmQf QQQQQQQSQQQQQQQQQQQQQQQQWQQQ 5- , ,.,,1:Q,AQQQQQW,Q,,Qw1,QK,,,5 HMQ,Q,m,5MQQQ, WkQm:,L,,QQQ.QQQQQQQQf1feQQQ,QQ.Q,Q,,. SM,3,,f:WQ,QQ,M,KIWQQQQIWKM:,,:QQ,QQQQQWQQQ,w,Q53m,Q1QQ,Q.,,QQQQQQQQQQ:QQQ,,QfQQQQQQQQQQQQQQQQMQQQ-QQQQQQQQQQQQQQQQQSMi3QQ,QQ1QQQQQQQQQQwv1QQQQQQQQQ-QQQQQQQQQIQQQQ:MQQQQQIQQQQQQQQQQ,QQQQQQQQQQ,QQQAQQ QQQQQQMQQQQQQQQQQQQQQQQSQQQQQQWQQMQQQQA Q' M,MQNM,QMQUQQSMm,,nMwQ,QQ,mQw,, MM,WQQ,,QQW:,kQw,:Q,QQQm Wg,wQm,,,kQ,NWQLQQQQQmkQQ,QQ2QQQQ,QQQQ,Q,QQQQQQQQQQQQQQ ,QQQQQQQQQQ5QQgQ1QQQQQQQQ.QQQQQ2QQQQQQQQQQ.QQ,QQMQQQQQQQQQQQQQQQQQQQQMQQQQQQQQQQQQQQ,Q.QQ,,,QQQ-QQQL,QQ,QQQQQ,QQQAQQQQQQQQQQQQQ,QQQQQQQQQQQQQQQ .QQQQ,QQQQQQ,QQQQQQQQQQQQ,,,QmQ,QQQQ 3,2 u,QmH5QM,, Hmm:HEMWMWwvwkmilM ,MMMls,,,,:Q,QW,Qm,,Qm,.,Q,,MQQQQQQQZQQQ,QQQQQQQQ,QQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRQSQQQQZQQQQQQQQQQQQQQQQQQ,QQWQQQQQQQQQQQQQQQQQQQQQQQQQQQQJQQQ,QQQQQQQQQQQQQQZSQQQQQQQQQQQQQQQQQ,Q -,HQQQQQQQQQQQQQQQQQQQQQQQQQQQ, QI, Z S ,WMQQQQQQQQQQQQQQ-QQSQQQQQQQQQQ- QM,QMQILKQQQ,QQQQQQQQQQQQQQQQQQQQQ.Q,,,,QQ-Q ,QQQQQ,QQ-QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ-QQQQQQZQQQQQQQQQQQQQQQQQQQQ,QQQQQQQQQQSQQQQS:QQgQ-QQQQQQQQQQ51Q5QQSQQ5QQ2Q3QQ2QQQQQSQQQQggQQfQQQ23QQ5QQQQSQ35QQQQQQSQ1Sgi?ifQ1:2QQQ5Q212QQisSzQQQQQSQQQQQQQQQQSSZQWQQQ Q Q Q Q Q Q Q S Q Q SS Q , fQQ X2 Q S ,. S , Q QQ , Q Q Q Q Q Q Q Q Q Q Q Q SQ Q,QQQQQQQQQQQQQ1QQQQQQQQQQQQQQQQQQQQQQSQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSQQSSPQQSQZQ-QSQQQSQQQ2QQQQQQQQvQinQSQQS2ISQQQQQSQQKHQSSESQSZQ-SM'if-- WQTSSPAWQ A Q Q Q S Q, ff r ' zx:QQ:QQQ,,,.Q,:QL Q ,W QQQQLQQ,QQQQQQ3QQQz4QswQrwere-Q QQz11re1r:QQQQQ-Q::sQ,Ms'Qxg1SSSwz1pzfsSv'SfQQw Zlfwsvzmwfls-WWSIIM SQQzf112QfQfQ:1iLfQ QQWSIQ H421 -Ql4,KQ:QQQQSS111fSfQSQ,i SYS VCQQQQ Q21 MQ- 'SJ : -fl- Q S 4 2 .QQ WQQQQQ QQQQQMQQ,QQQQQQ-QQ,SsQ,QQQQ,QQQQQQ QQQQQQ QQ- QQQQ Q--S Q-QQQQQQQQQQQQQQQgQQQQQQQf.QQQQQQ,Q,QQQQQQQQQ:QQ-QQQQQQQQWQQQQQQ..QfQQx51QQW:QQ.Q-QQQQQQQQSQQQQQ QQQQ.,,Q,QQQQQ1Q are,QQQQQ'QQ-:,5aQQvQSQ2Q?QQQQ,wmg'QQQSQQQQQQQQQQQQQQQQQQQQQQSQQQHEEqQQggQQ,Q,.2QfamzgzzfiQQQQQQEQQZMQQsag4QQQQ1331QS3Qas91i1QQQQQQS4Q2QQQQ3Q5QSiQQQQQQQQQSQQQQQQSQQQZQQQQQEQQQQQSQQQQQQQQ,gQ3!4iiQ3y4Qf"QgftiwsKgasSQQSQQQQiiaigQS2:QQQ:QwszQ4QEQg3gQQQ.,ZSQQ:5'iyvSiQQ QsQgfS2zQQ11QSSQQQQQQQQQSQQQQQQQQQQ'A22QQQQQQQQQQSQQQQQQQQQQQQHSQ:QQfQSgssQs-QQ?QQQQQQQQQQQQQ-QQ?QQQQQQQQQQQSIQQQQQQ-QQQQQQQQQQQQQQ-QQQQ -QfazfQQQZQQQQQQQQQQQQQQQQQQSQQ3QQQvQQQQQQzfSQ.QQ Q QQQ ,QQ Q Q Q Q Q Q Q QQ ,QQQ-QQQQQQQ,Q,.Q,.QQQQQQQQQQQWQQW,WWIQQMUWQQQ,QQQQQQ,QQ,QQ,QQ,QQQQQQQQQQQQQ,-QQQQ,QQQQQQ.QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQQQ'QQQIHHQQMQSQQ Q Q S QQ Q ,. ,QQ ,Q , QQ, QQ, Q, QQ,sS:Q QQQSQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQIQQQQQQILWQQQQ,QQQQQQQQQQQQQQQQQQQQQQQ,QQQQQQ.QQQQQQQQQQQQQQQQQQQQQQ QQQ,,,QQ.QQ Q,QQQQQQQQQQQQQSQQQQQQQQQQQQQQQQQQQQQQQQQM .QQ S QQ, HWWQQQE2E5SM5E2QI3Sw3,QQ,lmQ7,m37v ,QQIQwwQ,QQQQQQQQIQQQQQQQQQQQQQQQQQQQQQQQQQSQQQQQQQQQQQSQQQ:QQQQQQQSQ1QQQQ7Q4QQS1Q4QQQQQrg2QQQQQQQQ7QQSQQQQzQQ.QQQQgggQSQ1QSQQQQEQQQQQQQQQQQQQQQQQQQQSQQQQQQQQQQQQQQQ:1SiQf7zQiQQ'4SiU1QiLSQSSSQZSWQIWQQSQZLQQQQQQEIS1 SSQQQHQS1SfQzz2Q4Q:QQQwQQQQQ QQQASW fSQQw4Qff1QSQi2QSf2'Q1WiZS91211HQS?2515AS1Q2zQQSzQQQQQQQQQQQQmQQQg,Q Q QQQQQQQQSQQ-QQQQQQQQQQQQQSQSQIWQKQSsQQ:QS1QQQQfQQ1QQQQQQ-, QQ,,,QQQQQ1QQQmQ,QQQQQQHQQQQQQQQQQQQQQQQ-,QQQQQQQQQQQQgQQQg:1QQQQQQQ.QQQQQQ,,,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ1QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ,Q QQQQQQQQQQQQQQQ1,5QQQQifQQ,QQQQSQQQ-QQQQQQQQQQQQQQQQQQQQQQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQ1:QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ,QQQ,QQQQQQ Q A ywhmwfwlMW,giwwuwwxwwIQQMMWQ,wwfWWQQQQQ5QQQQQQ.QQQQ,QQ1QSQQQQQQMH,,Q,,.QQQ QQQQQ::QQQzg,QQ1QQQQQQQQQQ,QQQQQQQQQQQQEQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQZWQQQQQQQQQQQQQQQQQQQQQQQV QQQQQQQQQQQQQQ QQQQMQ Qu QQQQQQQQ QQQQQQQQQQQQQQQQQggQQQ,, QQQQQQQQQQQQQQQQQQQQ QW,5QQQQQgQQQQ1QQQQQ.QQQQQ - QQ, , S V QSM H -WQSQQQ:S12ffQsiQQff:SQSQfS14Q:Q ISSSQSQQWQS QS:Qf,QQQQ:QQQQQQgQ1QQ Qm,,,LQQ ,,Q,QQQgQ,,QQ,QQQQQQQQQQQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQQMQQQQQQQQQQ QQQ1QQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQ,QQQQQQQMQ QQ fQ3,QQQQ,Q,QQ.QQ,,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ .QQQQQQQQIQSQQQ QQ-QLQQQSQQQQQQWQQQQS QQfSff'1'Q4Qw1QQQfS1Q:QQQQQQQMQQQQQQQQ .. M1,Q,QQMQ,QQ1Q, ml,LQ,QZQWQQKQQQQWQQQQ.QQQMQQQQQQQQ,QQKQQQQQQQQQQAQQQQQQQQQVQQQQQQQQL.,,QQ,QQQQfQ,,..M,QQQQQQQQQQQQQQQ-E.,QQQQQQQQQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSQQQQQ,QQQQQQQQQQSQQQ:fQQQ,.QQ,QQLQ,QQQfQQQQQQQQQQQHQQQQQQQQQQQQWQQQQQQIQQQQQQQQQQQQQQQQQQQw,QQQQfv QQ MS Q1 QQQQSisSmni 11 QQQmQQQfSvQQ QWIQSQQQSQQQQQQ-fQQ:QQQww SQQQQ - :Q L WMMHWQQMSTQMW,MQ,QH5,.LmMWQ,L,,lQkQ,QL,,,,p,,,L,,,L,,,QQ,QQQw.M,Q,,,QQ,, ,,,QQ,, QQQQQQQQQQQQQQQQQQQMQQQQ,,LQQQQQQLQQSQQQQQQQQ,QQQQQQQQ,Q,.Q,QQQQQQQQ,QQQQQQQQQQQQQQ,QQQQQQ,,QQQQQQQ,Q ,Q Q ,QQQQQQQQ ,,Q,,QQQ,QQQQQQQQQQ.Q,QQQQQQQQQWQQQQQQQQQQQQQQQNQQQQQQQQQQQQ QQQQQ-QQQQQQQQQQ .QQQQQQQQ ,,Q-Q,,,QQQQQ,Q,QQQQ.Q QQ QW ,QQQQQQQQQQQQQQQQQQQ SW W,,.,,,,MW,MMm,lwfsWMw,mmHwww3w,:mWMLwww. AWQ W,,Q,WW,Q,WQ,:w..,QQQ,,QQ,,QQQ,,,QQQQQQQQQQQQQQQQQQQQWQIQQQ,QQQQQQQQQ.,Q.,QW,Q,QQQQQ,Q,QQQQ,,,.,QQQQQ,Q.QQQQQWQQQQQ,.QQQQQQQQQQQQQ,QQQQQQ,,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ-Q,QQQQQQQQQQQQQQQQQQQQQQQQQ.QQQQWQSQQQUQQQQQQQQQQQQQQQQQQQQQQQQQQ 9'wg3Qz::S" Q-5551-Sleimffigf.QQS21S5iK24LE2:If2Syf7iQsQz-fS2ZQYil?i,Q-wswgfiQQ.Qz3QSY27LE?3:1t41QSSQigiQz S71-5? JiQQQ?z1:L:Sf7f432ii53?L4SaiPgfSQswv:QS?1fiQiiQQ:S:f1Hiai1f3iiswx:Q:QQ1zQef5gQlQQ1Q3455,3LQQ,Q,QQQ-figgggjgzQ:zS1gf?ZQszQQSSVllQME?QQSzE32'?IwgQ:QwrQQSQLQQMQQSZ5s:QS:3r5SizS?3E'x1srg3QQQQQQQ-LSIIQQQZQLQQQSUSQQ1Q, 155 IQ-'esxglias:s?f71QS2L:2xs:'vggm:Q6sYF1faiLf'QSIQYZSSQQSQQQQSWEEQEFf1'91YWiE35Yf3T ,ESQ S SQQiQSgQSQiQ11 gm?QQSgmzzzzsgSSi3QmQzQSfiQgiQgSgQQ22122QifQQQsQQQQQQLQQQQQQQQQQQQQQQQQ5 ,, QQ,.Q,Q,QQgQ QQQQQQQQQQQQQQQQQ-QQQQQQWwewr-2Q2QS7QSQQQ:SiQfSQQfmQfQQsQQQQQ-:QQQQQQQQQQQQQQQQQQQM!Q5QQ,A:,wWmwQ,5QQLQ,Q,QLQQQQQQQQQQQQQQQQQQQQQQ,LQQQQQQQQQQWQQQQQQQQQQQQQzQQQQQQ.QQQ1Qs,QQQQQ,,QQQQQQQ.,QQQmQQ,,QQQ QQQQQQQQQMWQQQQQQQQQQQQQQQQ,QQQQQQQgQQQQQQQQQQQQQQQQQMQQ Q 1QQQQQQQQQQQQQQQQQQQQQQQQ,QQQQ ,WW . ,. ,,,. , ,QQQQQQQ Q-QLQQQQQQQQ ,QQQQQQQQQQ .QQQQQQQQLQQQQQQQQQQQQQQMQQQQQLQQQQQQQQQQQQQQQffQ,fQQg:QQQggQgQsQ?f-QQQQQQQQQQQQQQQQQQQQ'f:QQzQQQQwQzQg1QgQQgQwasQQQSQQQQQQQQQQ35QQQSQQQQQSQ:2QQQzLQfQQQQQQe'ngQQi1QQQQQSQMLQQQQQQQQQQQEEQQQQQQQQSSEQEQQQ,9QQQQQQQQQQ1QQQggQQQQf1'QQQQQQSQQQZEQQQQQitQQQQQQRQAQQQQ5QQQQQQQQQQQQSQQGQQQQQQQSEQQQqgQgZezQ23gQQ"':,1Q1 SSgfLgQS1QQQ,5 QQQQQi,,QQQQMQQQQQQQQQEQQQQQQMLQQQSQQ QQ, -QQ fff,21wQQQSQQQQQ--:Q 'Sf QQQQQQQQQK QQQQ QQKSISW'-'1f"SSn Sf YQ A ' SQQQ 'WHQ QQQ-QQQQQH gl . Q Q Q Q QQ Q 'QS QQ QQ Q QQQIQIWMQQQ VQQHEQWMQQQ14QQQQQQQQQQQQQQQQQQQQQQEQQQQQQQQQQQQQQQQQQQQJ'QQ'QQQgQQQg4SiQ Q.QQQQQQ1QQQQ,QQQU. QQHQQQQQQQ, MQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQ QQQQ QQ ,Q ,QQQQ ,Q Q Q: m Q Q S. Q Q , Q ,QQ me Q ,QQQ EQ . . , Q, Q -Q ,QQ QQ -Q V QQQQ, Q Q QQQQQQQQQQQQQQQQQ2QQQQQQQQSQQQQQ'PQSQQQHQQQQQSQQQQQ-SQQQQQQQQQQQQQQQQ,,,,l,QQ.QQQQQQQQA1QQ,QQQQ ,QQ :sS7Q::t1gg3,Q.:,4:-, Qgwfsgggf,kevinSQEQ1QStSfVf5i?feS:Qzz:1swf4i,:QiQQ--Qiiis VV 1" ' J-Si V" ' ' ' HSV f' 1" -'Q 5 A 'T 552' - S WS' 'ii ' ' ' 1 K -1 wg .' SQ , Z' ' 3 S155 ,QQ Q ix' - ,QSILSQEQwailFLWiefa?-J1QTSSsii1lf4VSV4ez4:'SSSSXQV31LizafSWem1Q-5,iiSS:QQJTVT'9 QSZZIQSIM ,,,l5,QQW1,QQQQ,Q,QHQQQQQQQ,QWQ-QQQQQQQQQQQQQQ :QQ ,QQQQKQ-QQ .QQ .Q,WQ,,Q H A QQQQ Q I K L5,,,,,,QQ,,,Q,,Q,, ms.,.,Q4Q,,QQnQ,QQQQ,,,m ,h,Q,QQ.QQ,LQ,QQQQQQQ,QQQQQQSAZQQ,QQQQQQQQQQQQQQQQ,Q,,LQQQ,,sQQQQQ:,QQ1QQ,Q,QQ..Q ..... QQQ,,,QQQkQ,,sQQ Q ,QQQQQQQQQ,,QQQQQQQQQQQ,.Q,QQQQQQ..,,QQQQQQ,Q,,QQQ,2QQQz.,,,.:.Q,QQQQ,,QQQQQQQQ,QQQ..Q,WQ:,Q,,,,Q.,m,,,,k:m,,QQw,MN,,Q,W1Q,,Q,.QQQ,QQ:QQ,.QQQQQQQQQQ,QQ., QQMQQQQQQQQQS .,Q,QWQ,QQQQfQ,QQQ.QQQ Q-,QQQQQQQQQQQQW,QQQQQQQWQQQ,,QQQ,QQQQQQQmQQQQ- QQQQQ,,,:Qn,,,QQQQQQQQQQ,,.QQQQQQ.QQQQQ..QQ,.Q,QQQ,QQQQ,Q3,QWQQ,QQQQQQQ,QQQ.,QQQ ,,QQQQ,,.QUQ.QQ...Q,f.QQQQQQQQQQQQLQQQQ,,QQWQQQQQQQ,,QQQQQ,Q,,Q.m,Q,Q QQQQQQQ ,QQ-Q,QQQ,QQ.QQ QQQQQ -I-QQQQQQQQQ Q .. QQSQQQ-QQQQQQ QQWQQQ vw QQ -SQQSS-Q Q QS -QQQQQQ QQQQQQQQQ QQQQQQQQQQ QQQQQQ.Q,QfQ-QQQQQQQQQQQQQQ Q,,Q:Qm-QQQQ f QQQQSQQQQQS1425231-s:Q'.:i,7QQQm1:fig41 QQQQQQQQQ 55" Q- 'W' f tv' 2 Q' A Q V" 5QQ:',: VV' sm "W 'Wig QSQQQ gf' SQQHQ S5 .H S S QQS1'AS'4Qw:: 1. S AQS711 . S 1 QQSQQ1 - -Q ' S511 : .' H551 UNSW1I1QS4'5'WSSMIQYQ4?.22I VS'1'S?sS"H1'L?5fS'SV'f5VSf?:sz:M'1Qiw-Lf'SWglSKaS?L:Qf QQQQQQQQQQQQQQQQQQQQQQQQQQQQQ3gi2QS1QQ:5gg5iiQQQiqaszgziiga Q8 Q Q Q Q QQ , Q in 1 QQ QQ Q fl 1 E QQSQQQ SZ 2 Q Q f , Q MZ, -'QQ 431 Q QQ. ML V u,,mWyQQQQQQQQQQLQLQS1fQS7QQQyQ1Q:QQfsSu3,5,,Q , gQ,,Q .Q QZQ, WW., MQ MQ, QQQQQ-, iii? zs.Q- ,,..,,1SQQQQQQQSQQQAQQQ-Qfwgisii94:s,Q:QQ ,QQQ1r2Q, .,,QQfff.sz:QwA f'SfSf:Sl1 S" Q31 Q1-w LlSffQ,:I1SS1QQ 'iqzixsf 'GUM ,I Kymlfwie QQ, xx Y - -4' J ' f , ,mf Q LQQQJMQQS- sznlsffi YEQQSQS Mgvfffefssfglv Q :www 2, QQ -13151. S9752 ,ar SZQQYQ-A, 9135115,z,.11zi'iWilErQQQ7LlSSi5f'Q ,e,.Q,Q,yQ5,,Q,Q,,,We-1w,Q,A.,L4QQQ,,,.Q,QQQf,QQQffQQQQQQQS4s.Q-,QQ 7"aQa4fe ,QUYQSQQQ ff!-Sf1s"'LQ mv' YQSuQ:Q.e,,QQ-SQ-Q.,-Q, -QQfQg,Qw,Q.QQ-HQ-QQ,.QQWQQQQLQ3Qz.QQQ JQQQQQQ Q-Q Qiuf'f'Qf' .,z.QQ-Q 5m HQQQQQ, vis QQQQQQ- ws 'aww-Qezzl QQHQS Q QA ZQQQQQQQQ --0 pai f -Hs QQ Q-SXQQWWQ wfsu -QW QQ, 45-QQ QQLQ -MQW QQMQQQQQSQA QYQQQYQQQQAS 21-Q -3' SSQQQ- QS-QQMLQQQQQ ,S Q -QAS1zQyis'! :QS WS'SSS"SfQ SS"Sf2"3"S QWS4EfS fSSSf2Q' '3S"fS"f'ff7' FSM MM SK QQ SEQSS-5 SQ S f W Q QQ 2 f Q1 QQQQQQQ Q , Q QQ Q- QQQ Q A S f 1' 4 Q Q 7 S -1 Q,'SQQ,,QQQQ,gQfQ2Q,: ' LLg5Q7KQ5Q5WmQg5Q53:VQIQHLNQI331QQgQ51iwVgQQ51g,QQ,.QQfQQ,s,11QYi1Ei3fQ QQ-,gg mkmb.,,QJ3yi.Q,S' 2724715-,Q..Q,:Q5, s f1si1QbQQ,zQs:Q.3giQ QQQYQQS SWQSQZQQQQ Qwq,,f.QQfQQQLsQ,1zL4s,Q:QQ Qg,:Q:ez7,J5:2Llev, -SQjQS5QQQQvxQsv,35jKQQ Q-,r1SQgQ,Qyxg1QQi Q,QQQ,Qs 222529 QLSQQQ- QQQsQ,f a1gSVj,f?eQQS,Q4Slxa LWZL 331' bigifiiilrifliisffwi'SLZ5lQ511aS5'fS9 if SASYQQEZZQZXN'WESTgQQSQiZL'QSH55gQZSiQS5 S iQ'3QQ3WSSS1fZi3LiSm' fa QQf4222?QQQQSSSEQSSQSZQLQQQQQQQQQQQQQAQQQQQQQQQQQQQQQQQQQQQMW-iwQQQQQQQQQQEQQMSQ LQQSQMQQQQQWQQQQQQQQQQQQQQQQQQQQQQLQQQQQQQS QQSQQQ QQQQQQQQQQQZQQ, QIQQQQQ:QfQv?g3QQQQQQfSQQiQ -Q SQQQQQQQQQQQQQQQSQ QJQMQQQQQQQQQQQQQQQ s QQ,QQQQQQQQQQQQQ,:QQQQ,EQQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQ Q, ,Q ,- QQ: ,QQQQQQQ Q. .QQQQQQQ - - ,QQQQQ .QQ QQQ Q, QQQQ Q, Q QQ Q Q Q' - ,Q QQvQQQxQQQQ:QQQQQ QSQQQQQS'QQQQQQQQQQQQQQQQQQSQQQQQQQQSSQ1:2ww7QQQ2ff1'QwQQQQsQfQ1 QQQQQQQQQQQQQQQQQQQ,EQQQQQQQQQQQQQQQQQQQQQQQQQSQQQQQQ ,QQ QQQQSQ Q f QQQQQQQ Q Q- Q . QQ, QQ QQQQQQ , Q 'Qu 2 QQ Qi QJQQQQQQQWQQQQZQQQQQQQQQQQQ:QQiQzQQQ5QQzQeQQQQQ-QQQQQQQQQQQQQQQSQQQQQQQQQQQQQQQSQQQSQQQQQQS QSi3?fiSSSVl.SiS37QsxLf?S5ivQQ!S5i?AfQQ,Mg S'Sj3g,.QQlg4QQlQwxyvbk'UN :Si1,yyRaj'JW,QQQ55AQg,,Qn3,qzgQ31g-,HQQ,Q .QQ55lQL,QzQQQ-,L:3gQlg3n,Q,iQQQQ-Ll ,:11aijLi5x3QQ zQ,3ii Q z1fS1gSQQfLzi1L:!L.Q QM mgzlnaQsglsseiss:zg,vQ55:Qs:zzQf penis:::gslgQ1Q2QQ,xS41rQQ ,,SsvpQiijQgwgSz::QA ,ML QQ, jj ,1YsQz1',ggQ,iQ- Min . zu Agl 1 Q1szQ3Z2ELQQ1.::7glV25QMfig3jggfifexrzggg,351::lf:QSfssmiaxaqggliiiiy-1fQ,,Q33Q'U9zQsQSv1aQQg.5i5, ,QSQQQLQQWISQQmyQQQQQWZQMQQQQ SWQQQQQQQWQ:QQmQ,l,mQQQmQgQ,g1QQmQ4Q :wk 7 QT, ZM5355miwlmHWQQQ wg',,,KQQQQQQQEQQlQgQQ3QQQQ?QQQQ1QQQQQQQQQQQQV Q,,g,Q, Q 5 QQQQQQQQSQ QQQQQQQQQQQ.QQQQQQQQQEQQQQQQQQQQQQQQQ,QQQQHQ,sQQQ,,3Q ZL,,,,iQ,QQQ:,,g1.QA ,QWQQQQ QQQ Q Q QQQQQQEQWSQQQQQQQ QQLI5QQQ2QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSQQQQWQQfgQQQggQlQ.QQQQ2 X ,,,.x Q,.QSilQszSQQffSi QfzsSz::1ff1,AQQ:gSV1S'WL:2,:5SS'lsQsQS11Uf2' 'V ' LS ms? H ' ,sf ' -'EQ-QQ? " - 'ffl-, . 'T' Q 12945 Q 'V iStf'QSz4' Q SSS' Sf' sew 14 .4, , SWS ' . - -A5 Q , S Im Q s Q QZSSQ S ' ' QVSILSY'Jhlavf-Qvszxxv'HSSTSSQWFSSQIS123.599,QIIISSMSESIWMQSQQQQQQQwill''Q--55:fSrsSSfliYlQ QQQQQQQQQQQQMQQQQQQQ,MQ.QQQQQQQQ-QQQQQQQQQQQQQQQQ-QQQQQQQQQQQQQW.QQQQ . QQQQQQQ Q ,QQ QQQQQQQQQQ QQ' QQQQQQ QQ: Q Q QQQSQQQQ Q QQQQ S- Q -QQ .Q. Q QQ Q QQQQQQQ Q :QQQQ QQQQ ff .Q Q -QQQ iw. Q -QQQQQQQQQQQQQQQQQQQQQQQQQQQQSQ-QQQQ2QQQQQQQQQQQQQQQQQQQQQQQ1QQQQQQQSQQQSQ?QQQQQQQQQQQQQQKJ QQQQQQQQQQQQQQQQQQQ QQQQ-QQQQQQQQQ-Q,-QQQQQQQQQQQQQQ Q - Q A ,QQQQQQQ Q .QQ Q' ,QQQQS Q , QQQQ Q 1 QQQSQQ - gsm Q. fQQSQQ -- QQQQ Q QQQQQQQ QQ QQQQQQQ-QQQQQQQQQQQQQQQQQQQQQ-QQQQQQQQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQ,QQQQQQQQQQQQQ Q Q gfQffQ--MSLSSQ-Q f Q 'j "-' ,gf " TSM S ' f j v,- QQ ei , , RQ. , 'SQ Q QQ V 1 Q if Q Z ',Qt:Q A 5 Qi: I QQ Q1 S13 QQQQQQQQSQQQQYQQSQQQQQQ-QQQEQQQQQQ Q QQ QQ Q Q 'QQ S14 'Q QQ - - ' QS: A 1 QS A - gg .SM 7 ' A S' ' ASQ, - . 'SSL ,Q S' X Q QQQQQQQ QQ, QJIQ .QQQQ QQQQ255Q1QQQQ151QQQLQQIQQQQQQ2glS:QQ555QQSSSIQISQESLSEEQQQEQQQSQ'QSMQSSSWQSWSQSEP MQQLQQQFNSQQ, wIZEQQQIQQQQQJQQLQQQQQK5QLQQE55,,Q,m.m,K5IQwin vm,,,WQQ,Qmk,gQ,wQQQQ:MQW,QQ,M5,QQmQQg mg QQQQQ QQQ ZQQEQQQ,,QQQQQQQQQ,QQQQQQQSQQQSQQQQQMQ QQQQQQQ: :QQQQQQQQQQQQ-I5QQQQSQQQQQQQQS, QQLMQQQ Q, Qf?5Q,QQQQ1Q,Q Q- Q QQQ Q-QQ QW- Q.,QQ1Q,5,QQQQQQQQ:QQ,Q,3QMg, QQ QU,QQQQ,5QQQQgf,:rQQQf QQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQQQQ QQQQ1 QQ N. QQMQMSWQQQIQQ.w,5QQQ,I,,.QQ,Q,Q, .,QQQQ,QfQ,,1,QQQQQQ ,Y QQ,,QQ.QQQQQQQQQMQQQQQ ,QQQQQQQQQ QQQQQQQQQQSQQQQQQQQ. MQQQQQ'QQ1Q-QQ-.QQQQQQQ-:QQQQQQQQQQ-Qwk ,QQQQQQ-QQQQQ -QQ Q,Q-,QQQQQQQQQQQQQQQQQQQ QQQQQQ- QQQQ QQ Q QQ ,,Q - Q - Q Q QQQQQ -SQ QQQQQQQQQQQQQQQQQQQQQQ-,QQQ,,s,QQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQMQQQQQQQQQQQQQQQQ Q Q Q-SQQQQQ,QQQQQQZQQQQQQ,Q,m,QQQ ,Q , ,,QQQ,Q Q -Q ,Q QQ .Q QQQQQ-QQQQQ A -QQQQQ: QQ Q, QQ-QQ: Q Q QQQ, Q S QQQQ Q ' .Q .Q ,QQ QQQQQQQQ QQQQQ,-QQQQQ.QQQQQ,,VQQQQQQQQ--QQQQQQQQQQQ-QQQQQQQSQS QQQQQQWQQQQ,QQQQQQQ:mQQQ1QQQQQQQQQQQQQQQQQQQQQQ -rf' QQQQQQQ1 ,Q Q QQ Q Q ,QQQQQQQQQQQE Q QQQQQQQ Q A Q .Q Q, A gm Q -.QQQQQQQQ . QQ -QQ A Q , QQQQQQ Q Q QQQXQQ Q . QQ-QQ QQ QQQQ-Q-Q-QQQ SQ- Q2QQQQQQQ,QQQQQSQ:QQQQQQQQQQQSQQQQQQwffz QQMQKQQQQQQQ Q QQQQQQQ,QQQWQQQgQQQgQ,Q,QL,QQQQQQQQQQQQQQQQQQQQQQQQ A. - - .QQQQQQQQQ QQ Q QQ QQQQQQQQQQ Q 'QEQQQQQ Q 7 .QQQQQ , Q QQQQ, QQ 5 SQ , 51" QQQSQQ' - .Q QQ 9 A Q -If Q. Q-- YQ ,QQ fr QQSEQQSQQQQQQQQQQSQQQQ11Q5Q5fiQQQfSSQQff1QSS QQSQQSQWffwfwslxi QQQQQQQQQQSQQ-QQQQQQQQQQQQQQQQQQQQEQQQ,QQQQQQQQQQQQQQQQQS ,QQQQQQQQQQQQ,QQQQQQQQQQQQ,QQQQQQQQQQQQQQQQQQQQ-QQQQQQQQ-QQQQQQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQQQQQQ QQQQ QQ, QQQQQQQQQQQQQQQQ QQ, -fm QS- Q QQQ QQ QQQQQQQQ Q QQ QQQQ QQQQQQQQQ Q ,QQQQQ QQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQEQ2Qif55IEQfQ1S32QQgQ22S2ZS5,QESZEQSSQQMSQQSQQQQQS- 2253 S5QQS2122fggQS1SszQfQQ:QQfHQQQQQ-'QEQQQQQQQQ QQQQQQQ, at QgQ,Q55,,QQQQQQiiQ QQQQ' QQQQQQQQQQQQQQQQQQQQQQQ-QQQQQQQQQQQ weQQPQHQQSSQSQQQQQQQQQ w3g4:,QfSSQQQQQQQf QQQQQQQQQ QSQ QQQQ QLKQQQ-QQQ Q91 QQVQQ, ,Q isj- QQ QQ,3QQ.QQzQ,aQQQQQQQ-QKHQQQ2Q3QQQQQQQQQggQQ2QQQ5Q2Q1QQQQQQYQQQQQQQQQQWGLQQQQSFQSQQS Qfwxvrwifveziaixl,isQQQ4sS1?-I,,1Wl2f9?5'znizaxzesfilvix Q - .I 53551: Q A " Q- fi TY -' ' A A if , SQTQKQ, Q ,iii Q Q , s Q S QU, Q V Q s ,QQQS7 ,Q Q " - ,Q max QQ ,. Q Z' , rex .: Q A '2 gl in QNX Y ,QQQAQSM Q, may grfgy xsQSQ"1 infmg13yfsc1QQYlQz:xSSQQf577. Www 5-'Q QQQQQQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQ QQ QQQQQQ QQQQ Q' 1 - ,QQQQQQ 7 QQQQQQ A Q Q: - ' Q- Q-QQ .,S Q S QQ new-Q:fQQQ:QS-WSQQQQQQQQQQQS:QQ,QQQQQQQQQQ:QQ,QQ,fQQQQQQQQ.QQQe,QQQQ izi?2fQQQQQzQQQQQQQQQQQWQQQQQQ ,Q1QeQgQQgQQQQQQQQ Q g,Q QQ SQSQSS QSQY QS? QQQQQ QQZW1 QQQQQSZSQSS QW'QSLQQSSQQSQQQjSi'wS2fifQiSSQQQQigQQSQ 2525 ,QQSSQQZQQQUQQ1Q22gas1QSS21:QgQQQyzsQsQQQLQQQQISQ 'SSSMQQSTEZQQS i Kiss? S 2QfEfS S"W" WS-gQgQ ' QQ Q 'wi-.Q QQ Q' S ,,, " ,QQ . 1 A 7 :S SHQQ QS QQ QS QQ QSQQ,11a5'-yQQ zQ5QQEQgsgQSQ52Q-,ff 'iw 'i QQ Q3 ,, Q, Q . Q Q QQ S :Q 7 QQQH Q- S QQ - -A Q V3 J Q Q,QQQQ3QQSa1QQQQ3QQgQ:3,QQQQQQQQSZQQQQQQQYQQQQSQQQQQQQSEQQQQQQQJQQQQQQQQMQQFMQQQQQQMQ-QYKAQQQSQQQQQ.QQQgQQQQQQQgQ QQQSQQQQQQQQQ QLQQLQ QQQQQQQQQQQQQQQ LQ, QQQQMMM,Q1Q,.l3Q,QQQ QQQQQMQQQQQQQQQQ5,QQ:QQQQ.QAQQQQQQQQQQEQKQQQQQQW ,QQQQEQEQQ QQ QQQQQ QQQQ,Qg5,iQQ5Q,Q,QQl11Q, QQQQ- pw QQQL,as2QQEQ:QSQQQ,QQQQ3Q2IQQQEQQQQQQQQEQQQQQQQQQQQQQQSQQQZQQQKQEQ,,3EH5:QQQ5,.QQQQ'ggQ: QQQIQQQQQQULQQQQQQMQ H - Q QQ, ,X 1 QQQQSQQQQQ Q QQQQMSQQQQQQQQQQ QQQQ' QQQSQQQQQSSQQSSSQQQQS-SS SHS QYQSMQQQQQ-Elf ,QQ if Q-Qhpgg S1557KQQQQQvzzggg1QQmQQSkgg,Qzf:QQQZYQQQQEQ-xiigSgQ55:2tsQsrN2iSi5-'Q'fiiligfliziailsi' 1 Q MSSIQ 7 749145 Qi IQSU-' 3 Q ,missy . AA :Q:IsSi -Q s Q Q ggiifez H, ss SS Q12 L. fQ- . 15' ,, R12 :S 1 f 12 Z S iii Sh- Q: Q S1SVli.E'A1QILUQ3VQ11gi7ZSZQQQ-Sfigisvsfvf2iQQrSSfS1S2Ef5EQP3Sflf5iE2s1111WL..i5iL'if 1 QQKQQQQQQQQWM ,Q QQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ , QQ-QQQQ 3 ,Q QQQQQQ- Q QQQQQQQ ,Q 'V AHQQ-.QQ QQ Q A Q QQQQQQ Q QQ, Q- :Qi . :-- Q ,Q Q km Q A ,QQ X A QQHQ QQQ3 A QQQQQQQQQQQQQQQQQQQQQQQQQQ,QQQQEQQQQQQQQQQQQSQQQQQQQQQQQQQQQQQQQQQQQQQQQ S QQQQLQQQQQQQQVQQMQ QZQQfQ1QQ1Q.Q,QQ-,,M3Q5QgQQkQQ,QQQ-QQ QQQQQQQQQ QQQQQQQQQQQQQQQ-.QQQQQQQQQQQQQQ Q.Q,QQ-QQQQ,QQQ-QQQQwgQgQ,QQQ-Qfwf-QQSQQQQQQQ Q-QQVQQSY .QW-QQ::QQQQQQQQIQQQQQQ-NQQEQQQQQ. Q K QQ'-QQQ,f1fSwQ,QQw1'7 'Swfa SYW SQQ ff Q-QQQQQ Q Q Q - . .MQ , QQQQQQQQHQQQQQSQQQQQQ,Q.QQQAQ,QQQQQQQQQQQQQQQILKQQKQQQQQLQQQQQSf:QQ1Q-W'EQ-fg,Q1QQfSfew QQQQ,-QQQ,-QQkQQ,,. Q.,,:,,W: ,,,QQQQQ..Q,...,,1QQQQQQ H Q A QQQQQQQQ , . ,QQQQQQQ Q., QQQQQQQQ Q QQQQQQQQ ..Q- A A ,, Q A QQQQQQQQQQ, QQ .Q QQQQ, ,QQ Q QQ , .QQ A ,K ,QQQ A A A QQ-QQQQQQQQQQQQ--SQQQQKQ-QQQQQQQQQQQQQQQQQQQQMQQSmy-QSQQQQQQQQQQQQQQQQQ--QW mwwr , AA QQQQQQ QQQQQQQQQQQQQM,,.QQMQQQm.gs,Qw.,,,QTQQkQ,QQm,,wm,QQQQ5QbMLQQQQQQQQ,QkQQ5iQp,QQQMQ,,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ,HQQQQQQQQQQQQQQQQQQQQQQQQQ QQQQQQ QQQQQQQQQQQQQQQQQQQQQ QEQSQQQQ QQQQQQHQS1QQQQQQQ.QwQQQQQQQQQQQQQiz QQQQQQQQQQQQQQQQQQQQ5 QQQQQQQQQQQQQQ QQ .Q QQ QQQQQQQQQQQQQQWQQQQQZQ5QiQQQQQQ3QQQQQggQQQ,QQQQQQQQQQQQQQQQQQQQQQQZQQQQQ.,QQQQQQQ :MIWQQQTA.yigggzksimwnmmm:QLQ,g5Vs,wQ:5QQrm I Q :W:,,..1, Q . QQ,..Q,Q,'V,,,QQQ .5.,kSik5v AA ,L ,:QQ.Q,,WLW5355Q,.,Q. ..QQ,Q..!gw QQQQ MQQQQQ, ,MQ 1, m y-Q ,HQ S.. XQQQQQQ I. . QQQQQ . ,QQ QQ QQQQQH- Q. -Q Q 1553 , ,131 ,, . :, I all ,JJ 35,5 -.,zqr1QgQyK ,IL'?1QsS1sSflS522vsQ1'ifiikvsxlsllfilimsssfQffiesurfiHSS'MSS QQ AA,A Q A,,,A AA,AAA,A QQQQQQ ,AA,A AAAAAA A . , Q ,Q A A A AA,AAA A Q Q M ,A,, Q, A Q A,AA, Q A Q . Q MQ, A A A A A , A , ,QQ A Q . QQQQQQQQQQQ A, AAA, , AAAA, A,AA,A., Q QQQQQQQQQQQ,...QQ-QQQQ--QQQQQQQQQQQQQQ ,Q,QQQHW,Q U.iw,,M:QQQ,Q,,,sQ,,mQQQQQm QQ QQ, QQQQQQQ 1 QQQQQQQ QQ. QS QQQQQ QQQQQ ,Q L, A .QQQQWQ , QMQQ .Q 5 M Q QQ, L, .M hg h, ,QW,whMQLwQ,5lQQ.QQQQQQQ,QQQQMQQQQQQQQQQQQQQ,QQQQQQQQQQQQ-QQQQQQQQQQQQQQQ,QQ,,QQ 5Qgj5QQQQ-5551255QESSLSQQZQQS1QQQSLQQEZQEQ-:QSLQiifZQQ:,5l:,gX I' mf A , 'd igg ,S N1 A :W is ,ksnhgggg 5 WQUMM, 053533. kQgk,.',, A S2353 ,QV KQQQWQEQ. LQ, .La gzk ,jkQ,.,,Q , QQ ,QI QQQ Q QiQ..,,. SQKVEQQQ- QV LMEISSSWQSQ Q.QQQQfQQ,z.QsS7EZ2S SQQQWQQQQQ- 'QQ-,QQQHAS QQQQ .Q wif sg k QSSQQQ KQQSS QFSXQQ' Qzix' Qhjllk-5225155153saiQif5725252V-ggyfiiiiszsfggzSis222s?1QiLZiEQrrg5gSijiQ53S:sgggfS QS1fQQ-wrifi QQSQQQQQQQNSSQQQQ:QQQQQQQQ- QQ ,Q , Q A v A:QQQQSQIQQSQYQQQz::wQ1zf.QQQQ:QrQQQfQfQ:fQ1n,.QQQQQQ:QQQQ,,QQQQQ,QQQ,LQmQqQQ,,.QQQQQQQQQQQQQQQQQgQQg1,QQQQQQQQqQQQQQ,QQ,QQQMQQQQQQQQQQQQQQQ,QQQQQ,QQQQQQWQQQQQ-,QQQQQQQQQQQQQQQQMQ QQQQQQKQQ QQ-QQQ,Q-,X,Q1Q,,QQgQQQQQQQQQ,gQQ,QQQQ,QQQQMQQQQQQQQQQQQQQASQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQ.QQQQQQQQQQ-QQ,QQ QQQQQQQQQQQQQQQQQAQQQQQQQQQfg:ggfQQgQQggQQQgsS'QQ:QQQQQQQQQQ,g.ggQgQQQQQQQQQ- QQQQQQQQQQQQQ,QQQQQQQ.1,Qgl,QQ,1QQ3QQQ QQ,-QQQQQQQQQ QQQQQQQQQQQQQQQQgf:gzQQQQQzsQSQ1QS QQgzQgQkQ,,QQQgQQQgq QQQQQQQQQ4214'QffQQfm2iQQQ1QQQQQHQQQQfefaiwifxfsvQQ4Qii4SQQQ11QSadQ.QQQQQQQQQSQQQQQQQWQQQQQZSQQQQQMQQSQQQQQQSQQQQ'LQQQQQQ,QQQSSQQQQQMQZEQQQQQQQQQQQQQQMQQQQQQQQQQQQQQQQQQQQQQSQZHQQQS1-QQQQQQ-QQQQQZQ,f:zQQQuQsiQQ,QHQQEQMQQQQQQS few Q .Www,QM:,H,QQ?5miU:wrQnsM:Q,:L:.lXmQ,m iwww,5slLQ,s1W:5Q.u6:Q5Wg,:MQQQQQQHQQQQQQQQQQW 5,-QQwQ,zQQQQQQQQQQ,Q:L,.MQ QQQg,,QQQ,QQQQQQ QQQSQQQQQ,3QQQQQQQQQ,QQQQQQQQQQQQQQ5Q7QQQQQQQQQQQQQQQQQSQQQQQQQQQQSQQQQQQQQQQ QQQQQQQQQQLQQQQQQQQQQQQQQSQQQQQQQQQQQQQQQQ- QQQAQQQQQLQQQWQQQQQWQQQfg,QQQQQ.QQQ Q,QmQQ,,1QQQQ QQQQ ,QQQQQQQgQQQ,,Q,Q.QQQ1Q,Q,QQQQ,QQQQ,QQQQ,,f:SQQQ1QQg,Q,Q QE,iswgQ,QQEwQAQQM,Ml:QQ WQQMQM,WW,,WQWWQQQW,,QQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSQQQQQQQQQQQQQQQQQQQQQQQQQQ-QQQQQQQQQ.QQQQQQQQQQQQEQQQQQQQQQSQQQQQQQ-QQQQQQQQQQQQQQQIQ,.QQQQQQQQQQQQQQQQQQQQQQSQQQQQQQ-QQQQQRQQQQQQQQEQQQQQQQQQQQQQQQQQQQ ,Q HQQQQ.,QQQQQ:QQQQQSQQQQQQQQQQ:QQQQQQQQQQQQQQQQQQQQQWQ,QQQQQQQQQQQSQQQQQQS 1QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQQ Q Qfgkmfsmwsis,QQWW4,35MS.Q:MAl5:i:lQs:,,g:w:QQmhmm,M:QW,Q?:Q,,Q,Q3QQ.ig:QQQQ,,Q:QQQQQQg:gyQSQQQSQQQQQQQQSQQQQQQQQQQQQLQQQQQQQQQQ.QQQQQQQQQQQ-QQQQQQQQQQQQQQM ii,QQ.:QQ,g.QQQmQ,QQQQ,Q1QQQQQQQQQQQQQQQQMQQQ.QQ1QQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQQ QQQQQWQQ Q,, QQQQQQQQQQQQQQQQQ QQQEQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ-as Q-QQQQQQQQQQQQQQQQQQQQQQQQQQQAQQQQQQQQ QQ,QQQQQQQQ,nQmQQsQQ Sf QQSSWSESZEFQSQZQQQ QTQQQSISSSZQQ?EQ:-M93Q5S5?sSStf2SE5'4Si'wlligfgqfz:WV1fSQSYS-JZ-g52?5i.zr11s11fl,ii!Q:QLg2gQEj5f2Qsx4:1,z VQQgu,V,QQg5Qlw:QL,QQ:s 55,,:g:93ifg37:eymsz43515,zrgjggg?Z,:SzpQ.Q:gSg5b,:IQEQQQQQQQQQQaysmzgggigpsSLgQQQZL.QLggQQQsezgggggqz.f1SSLQLQQzQsS1GSig1iQiQggsziggij, QQQQQJQ-Wig QQ5rQQ3f55QKQ3QQ,:' SAjl':fz3r33MQQ,-.Qgif 735 QQ. ,5g'459gQQQ:Q,Z11gSgU1Q.,i5Q,QQQQQZQf1g3g1pQszqgfgvg gQQQeg2gQ5,,,,gzQQ53yQQQQ,gQs msg A WQQQ,,WQQQM,QQQ,,QQQQQ,QQ.,QQM,QQWQQQQ ,Q :QM,,:w,QQQQ.,Q.QQ:QQ,w.,QQQ,QQQQ,QQ.,Q.,M,,QQQQQ,QQQQ,QQQQQ. QQ,QQQQ,,Q:Q,kQa,Q,QQQQQQQ.,.Q,,Q.,,Q,Q , .Q,,1Q,-,QQQQQQQQQHQQQQQQQQQQQQQQQQQQQQQQ-QQQQQQQQQQQQQQQQQQ A -QQQQQQQQ,Q.,QWQQQQQ QQ QQQQQQQQQQQ:wx-QQ-QQQMQQQQQQ-QQQQQQ-Q'QQ-QQQQ---QQQQQQQHSQ ,.WQQIQQQQQQQQ,WQ,Qn,Q,,m,,,,,,Q,,QMQ.,.Q,Q,,QQQQ, Q.,Q,QQ,QQQQQQQQQQ,Q,Q,QQQQQ.QM..QQQ,QQQQQQ QQQQ,,.QQ.Q,QQQQQQQQ..Q,.,QQQQQ ffQQQQQQQQQQQQQ-QQQQQQQQQQQQQQQQQQQQ-,,QQQQQ.Q.-,Q-QQQQQQQM QQQQQQQQQQQQQQQQQQQQQQQQQQQQQJQQQQQQ.,QQQQQQ,QQQQQQ WQQQQQQQQ-QQQQQQSQQSQQQQQHQQQQ--Q rf'ffQQQQQ.QQQQWQQQQQQQQQSQQQQQQQQEQQ-QQQQQ-QQ QQ- Q.QQ,Qf,u1QQ QQ QQQQQ QQQQQ-QQQQQQ-,QQ QQQQQQQQQWQQQQQQ,QQQWQQQQ QMQQQQ A QQQQQQMQQQ-QQ:,QQ,,,Q,Q.,QQQ,QQQQQQ-Q,QQ,QQQQQQQQQWQQQQQMQ,QQQQMQQQQQQQQQQ, .QQQQQQQQgQ,,QQQQQQ, QQMQQQTM:,QQWQQ,LQQQQ,,QQQwQQ,QQQQQQQQQQQQ.,QQQ.,QQQQQQQQQQQQWQQ-QQ IQQQQQMQQQQQQQQQQQQQQQQQQQQQQQQQQ,QQQQQQQQ QQQQQQQQQQQQQQQU -QMQQQQQQQQQQSQ ff ,QQQQQQ QQQQQQQQSQQQQQQQQQQQQQQQQQQQQQQQQSQQQQQQQQQQQQQQQQQQQ. QQQQLQ QQQQQQQQQQQQQQQQQQLQQQ QQQQQQQQQQQQQQQQQMQQQQ QQQQQQQQQQQQQQQ-,,.QQQ QQQQQQQ Qgwwg 5HQQQMQQQQQQQQQM 5 QQQ5QQQQQQQQQQQQQQQQQQQ5QQQLQQQQQ:2QQgQgiQgfQgQjQQgzQQQ52SQQQ51QQQ1QQQQQQQQQQQQQQgQ:QgQQgg1QfQQsgQgsssgQQQQLEQQ-QQSSQQQSSQ.,QQ 5geQs1QQagQ5QQQ3QgQQQQQQQQQQSEQQ1Qgf3Q51QS5QSQQQQ21Q335QQ55QS22155Q:QS1S37QQgfQQQs222QQQQQQQQZQQQQQQQQQQEQQQQQQSQZQQQQQQQQ QQ5QQSgQQQig,QQQQ13QQQQQQQQQQEEQQQQQQQQQ'QQQQQQQQSQQQQQQQQQQSQQQQQQ:QQQQQ1QQQQ5S ,Q5g5Q,fQQqpgQQg7Q:QgQQzQQQQQLQ-QQQ5l5QQi1gQQ,gQQzQgggrgmvp5Qi5glQQQ1Q5i,Q:e1QQQQQzgQq1gg7Qis:s'f-S, 55552Qhzsigg-KQQQQQQQQQ,:gWg13QQQQQQIQQQQQQQQQ:zggjfgnzzggQ5iig4veQzsaQf1QkisaQ'4SQSsiQiE'4S1lwffqiik Q UQSQEHQS,z1s:QQw1'5QEsS 1Q13LiQ2:?Q:eg.QQff 'fiiilisQQ-52!3iQ21fWlSS5?iQQisSS'59i?gqQSQQQzQz'fJLim-QQfDiQz2f4QQrQMiS22z S 115551 Q 14 SIZES 2ESigE-QZLKQMY 1QfsQQ"SvEi3i2?2:sSSQl1N55fs1f2SEi?iQuSQgQfl,iLE1'ASIEQ1QQimsQ:QfQ.3?1Q,,QfQ .,.,QQ,Q,..QQQ,QQQQfQ.Q.Q,A,, ,,QQQ,.Q,Q.Q .QQQQ-QQQQQQQ,Q-QQQQQQQQQQ-,QQQ QQ. -QQQQQQQQ-QQQQQQQQQQQQQQQQQSQQ QQ -QQQQQQQQQQQQ-QSQQQQ -QQ' if QQ QQQQQQQQQQ Q,Q.Q,Q- QQQ.QQ,QQQ,Q,. ,,QQQ,QQ,QQ ,QMQNTQQHKM5,WWQQwWQ.Q3g w,wmW,,Q,QQKWQMQQI? kQL,Q5QLQQ,,QQ.QQQQQf Q:QQQQ5gQQfQQQQQQggQQQ,QQQQQQQQQQQQAQQQQSQQQQQ-A QQQQQQ,QQQQQQQQQQQQQMQQQQQQQQQQQQQ gQgQQQQQQQQLQQQQQQQQQQQQQQQQQQQQQQQQQ,QQQQQQQQQQMQSQQQQQ A QQyQQQ1QgQQQQQ1QQwQQQQQQQQQQQQQQ QwgQ-QQQQQQQ,,QQ3QQQQQQQQQQQ4QQQQQQQQQQQQQQQQQQQLQQQQQQQQQQQQQQQQQQQQQQgggQQQQQQQg, fQwQQQQQQQQQQQQQQQQQWQ Q.QQQQ3,Q QQ, A , QQQQQQQuQ,QQQ,,LQXQ,,fQ1ggQ,Q,Q1Q-QQQQQQQQQQQQQk,iQQ,, ,QQQQQQQQQQWQQQQQQQQQQQQQQQQQQQ,HQ-Q.QsS.1Q,QQQQ:QQ QQQQQQQQ'QSgzQQ,QwQ:Q::QsQQQQ- 'QQQQQQQQ:QQQ-,:1QQQQQ:Q:-QQQQ. MISSfQfS:fS:1QQQ1e-,QIQQQ 'Q-QQQQQMQQ,QQQQQQQQLQQQQQ Q- QQQQQQQQQQQQMQQQQQQ,QQ,QQQQ-QQQQQQQQQs,QQQQQ,QQwk .QQgQQl,Q,,gQQ,QWQQQQQQQQQQQQQQQQQQ-QQQQQQQQQSQQQQQQQQQQQQQQQQ, QM, QQQQQQQ QQQQQQQQ,QQQG,QQ1QQ.Q,,Q,, ,QQQQQQW QQQQQQWQQQQQQQQQWQQQQQ , Q Q. QQQQQQQQQ-QQQQQQQQQ-QQQQQQQQQQQQQQQQQQWQQQQ-.QQ,QQQQQWQQW,QQQQQQQ.QQ.QQ5,QQ,,Q,QQ,fQQQQQ.,..QQSzQQQ. QQQQQQQQQ-QQ QQQQ-,QQ-SQQQQQQQ,.Q,,,,.,Q:Q QQQQ.,QQ,,Q,QQ-,QQHQQQQQQQQ Q-QQQQQ,Q..,L.,Q ,Q,-QQQQQQ.Q-QQQQQQQQQQSQHQQQQQWQQQ-QQQQQQQf'fSKQQQQQQQfSQfQ--QQQSQQQQQQQQQ QQQQQQQQQQQQQQQQQQQ,QQQQQQQ-QQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQwwQQQQQQQ.Q.QQQQQQQQQQQQQQQ.QQ,QQ,QQQQ-QQQQQQQW ,, AAAA ,Q QQQQQQQQQQQQQQQQQQQ. QQQQQQQQ-QQ.,LQ-QQQQQ.,.,,QQQQQ:Q QQQQQ,-QSQQQQQQHQQQ Q,.Q,-QQQQQQQQQQQQQQQQQQQQ -QQQQQ-:QQQQ-, QQQ-QvffsfffQQm:QfwQ-QQQQ,QQQQQQ,QQQQQQ.Q,QQ, ,,,QQ,A:QM.,M KVMQQ:QQRQ,A.QMQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQ,Q.Q,A1QQQQQQQQQQ.,bQQ QQQQ,MQ,QQQQQQQQQQQQQQQAQQQQQQQQQQQQQQQ.Q.QQ,1QQQ,.Q,VQQQQQQQQQQQQQQQQ.Q.QQQQQQ-QQWQQQQQQQQQQ,QQQQ-QQQQ.Q,QQQ,QwmQmy QQ MQ,:Q,Q:QQMs: Ml,k,mhQmW,2, 5T,:,Q,m.,Q,Lk NQQQQQQQQQQQQQQQQQ,QQ QQQQQQQ,QQQQQQ,QQQQQQMQQQQQ-.QQQ:ssQ,.. QQQSSQQQQQQ--QQQQQM,QQQQQQgQ-QWQQQQLQQQKEQibQQQgQgwQe,Q.Q fQ.Q3kQQ-QQQQQQQQQQQQQQ,QQQQ-,LQQQQQQQQQQQ'QQQ-QQ-.QQQQQQQQQQ,QQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQ .QW QQQQQQQQ-QQQQQfQsQQQQQQQ,QQQQ-QWQQQQQQQQQQQQ.QQ55QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQ,wQfggQQQQQQQQQ,,g WEQEQMZQ M ,fQQQfzQQQ. Q5QQ,Q,QL.Q5QQQQQQQQQQQQQQQQQQQQQQLQQQQQQQQQQQQQQ.55QQQQfQQQQQQQsQQ2QQSgQSQzQQQ .,Qityw,.wwQmQL ,kwgigwmiggimiwmiQ5E.1L:wm: MM W,MQ,QQ,,H.. WRQQEM.M,k.,,A:QMg5.,. H.IZVQQQQQQQQM,MHQQLMQRQQQMwill.NQQSQQQQQQLHi5QQ5L...QQlmQQgQQQ,NQQQQQQQQQQQQQEVQQQQQQQ,,QQQQQQQQQQQIQQQQQQQMQHQQQQQQQQQQQQQQQQQQQQSSQEQQQQQQQQQSSQQQQQQQQQQQQQQSzQ5xfQQQQ5zzQfQ,QQQQQQQQSQQSQQQgQem3fQQQ,QQQK3QQQg' QQ H QQ Wibiflf M .Q,,f'ixfZ:s ss- L7?5f:wQf.f1SSfQ-S, QS is ::QzQ:Q1Y-Miz, HQ -J1S'ff-':iQ1fs1'Z?-- SU-erm ASW.,Q1LS"'-i?E?f'SSfQ- -f-5222521551ISIS?ff?,MQWLSSQQQETQ:,ziexisffQQQqQLQ:gzgQg3L,QqQQQ:QzgajiaggQ:SzgQ55Qy:Sx1a11'f5zQQWQS QEi5p:Q:w1HSfJQQSSJQ.,LQQQQQLQQffiset1lSf5lSiiQwz1Q:QQLfQ11Q:1SiifQiiQgels:-7lSsz1sSsSWETst1SS55FlLE::fsQQHQQQSZRSQQQQ-Q' Q AA,, AAAA Q ,AAA,,A Q Q A A,, A A ,AAAA, A,AAAAA,,A A QQ AAA,AA AAAA,A AAA,,A , ,,A,A Q , AA,,AA, Q AA A,,,,, Q A,A, Q, ,,AA,AA, ,AA,A,AAA A A,A,,A ,,AAAA Q QQ, ,A,,AA ,QV AA,AAAAA,AA QQ A,A, ,QQ AAAA,A Q,QQ,,.QLQQ. ., AA,,AA QQ AAAAAA Q-Q A,AA Q,QQ,-,QQQQM ,A,A,A V,.,,,,1 M,,,:,,,,Qu,, .,hQM.Q,QWQQW,. ., Q:Q,:,W,Q.Q,,,,,,QQQ ,M .,QQKV,,Q,:,.,:QQM.Q,,AQQ.,Q:,:,Q,:Q,Qb,.,QL ,:w,QQQQ,QQQQ,QQQ,.Q,.,QQQQQQQQQQ,.Q,:QQQQ,,QQ,QQKQQQQQ,.Q..Q,QQQ,QQQ,QQQQQ,QQQQ-QsQ.,.QQQ.QQQQ,QQfQQ--,Q.Q,.QfQ-QQQQQQQQQ-QfQQQQQ.Q-fQSf.QQQQQQ,QQ ,,,,A ,,...QQ-ff-SQQQQQ A :QQ-QQQQQ ,.:QQff-QQQQQQQQQQQQQQQQQQQ--QQQQQQQQQ-,QQQQ QQQQQQQQ-,, QQQQQQQQQQQQQQQ,Q,QQQ-.Q--,Q Q QQ' QQWQQQQQQQ,QQQQ1QQQ:QQ:QfQ QQQQQ,QQQQQQSQQQ-QQQQQSQQQQQQQQQQQQQQQQQQQQQQQLWQQffim:QQSQQMQQSQQSQQQHQQQ-QQQQQS1fQQSQQQ-S1Q-SQQQQQQQQQZKQQQQQQQQQQQQQQQQQ.QQ QQQQQQQQQQ,--,,,QfQQ:qQQQQQ'QQ1QSQQQQLQQQQQQQQQwQQfQ,1Q QQ A ifif53QQlS:?'H' Hiiiil. SEE? SLQHVQZ Qi ,Q QQSSKWQ SYQNTHE if ,,EiQ':Q :lax ..QQ- -KQQEXQQKHKLHL J Q,NL5km5QL4,mQ. QVNQ. HQ, Q.gifs?LQgQmQQ3LQg5gQ5QQg-5QQQ55WQAQQ,QQXQ5SgQ3Q5Q,zggmggyWQQQLQQQQQrpczgggiigs:4aVgi7lfSSv1f5SiS5551'111LSQZ?!?i1S-795652 QSSYZDQIQEJMEETZSSLWV'lS5f55:SSf7iiiIiL-,zssslwf Wann Www .I ,LW,w7 I, Ml,l5, Amin wg,.,wM QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ.QQQQQQQ-QQQQQQQQ:1:QQQQQQQQ.QQQQQQQQQQQQQQQQQQQQSQQQQQQQQQ-QQQQQQQQQQQ-Q-Q-QQQQQQQQQQQQQQQQQ1QQQSQQQQQQQQQQQQQQQQQQQQQQ QQQQQQQMQQ QQQQQ:fQg-'QQQ Q,gQQaQQQf..:Q:5fQ1Q-.Q QQ1QsQQ QQQ gn HQQQQQ-1 MQQQQQQQQQSQQQQ ,135-QQQQQQQQ--QQQQQQQQ ,QW H k,,,,k: ,.,4Q,,,.Q my mj,,QkMgWQQQQQQQQQQQQQQQQQQQifLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ.QQQQ.QQgQQQQQQQQgQQQQQQQQQIQQSQQQQQ-QQQQQQQ,QQQQQSJQQQQQ-gg: 1QQ:QQQgfgQQQQ1QQQQ:QQ QQQQmgffw..:QQQgg:QQQQQQ,QQX MQMW: QM,,:,,W ,MwQ,,MQm.,H WM,l,L:. Wm. mUQW,W ., M.,QkQHm,Q,kM 5,QUm!M M,:Q,,i,kQzA Q W hw ,LMTQQQWMQQQQQQ,.QQ,QQ7QQMQQmQQQ,QQQQQQQQQQQQQ,QQQQQQQQQQWQQQQQQQQQQQQQQQQQQQQQQQ,QMQQQQQQQQQQQQQQQQHQQQQQQQQQQ.,QQQQQQQmQQ1QQQfQQ.Q,QQ wsWQQQQ-wr11Q1QfQQmQ+ QQQQQQ,Q,,Q.Q QQQQQQQQQQW QKQQWQQQQQQQQQQQQ.,Q.,QQ,Q,,.Q,k1QQQ,,. ,,Q-Q,QQ,Q--Q ,Q,QQQQQQQQQ.Q QQ-QQQQQ, Q-QQQQQQQQQQQQ Q-,QQ Q, Q, ,,,,Q-QQ QQQQQQQQ,QQQQQQQQQQQQQQ Q QM,.MQQQQQQQQQQQ.Q,Q.Q,:QQ,QQ,QQQQQQ---Q,..QQQQQQQQQQQQQ.,Q,Q,QQQQ..,QQQQQQQQQQQ-QQQQQQQQ-Q,QQQQQ-,QQQQQQQQQQQQ.Q-QQQQQQQQQQ-QQ QQ,Q.Q.QQ AAAA QQQQQQQ-QQQQQQQQS QQQQQJQQ-fz Q QQ--, gy-Q54:Away::sQQQ--QQQJLS'SSVQls1SSL'1SQw 'f:sQ1.Q WQQQQ-::1',i"' elisv-SQQ--':::f" QQS-W:-ff, Q, Q-Q-Q-Q 'Q:S1.3,AgQgQQ:z -fQQQ1i2'lL-f9.S1xzq1:,QQ ,QS QQQQzAQQQyQQg,Q,. Nw Qs2:QLQQ3Q:Q'eQ QSQfQ:QQ:Sg1"gSLQ5Qg.Q A IM-Q-MQIQQSS'-QE4Qr'SLHQQQ-Q-wcrsi' --Qzg1Q:Q1QQQ--QQQSHSY-54y:3w:Q.s,HQ-,zt:H2SQ:Qsr1'1i?w'wxsgQ::7QQQ.sSrv:.eQQQ,-S163Q .-Qfetss-S1eS:..,,QQS,s SQSSUQ QQQQ..,Q,,u J,.,uQ,,,QQQQQ QQ.,,QQ.Q -Q Q-QQ--QQQQ-wr A AA Q, QQ - QQQQ A Q,QQQ,QQ-HQQQQQQQQQQQQQQQQ ,QQQQQQ ,Q.QQQQ,fQQQ.QQ-I Q.,--QQQQQQQQ ,A QQQQQQQQQQQQQQQQ-QQQQQQQQQQMQQ,,QQQQ QQQQQQQQQ.,Q,Q-QQ,QQ,Q-QQQQQQQQQQQ,-QQ.Q Q-Q-mg:Qf,QQQQQw:.QQ---ffQQQ:Qf:2Q-Q-Q ..Q1QzQ:fQ,QQQQQ-QQQQ 555-SQSKQQEQQW AWEQMQVKQ ,WQQM MQ, ZQQLQQQKQFMQQQQQQQSW KMEQQMQ,,Q.mQ,4V,,,QQ M AA ,SQA MQW?,i:WQ,Mm QQQQQQQQQQQQQQQQgQggQS21QsQQQ,gQ2?fQQiQngQsg?Q.,QQQQQQQQQQQQQQQQQQQQQQQQQSQYQQQQQS4QHQQQHQQQQSQYQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQZG.gQgQ:2Qr.QQQQgQ3gQQQSQQQQQQQQQQSQQQQQQQNLQQQQ:QQQQLESQQSQQ UggaSz13Qmg3ggsQs2QQQand QZQQQSQQQQS -MQ QQX5MZl:iQLwQ:55Qgigi MQQMKQL5 hw?-,IQ-QM JQQQQ-in QQ: wig' QEQQQQSWZQZQQQRQQQQQQQQQQ QSQQQSYQQSQ12Q53SSYQIQQYQQQQQ3with32221121725QQQQQQQQSSYQESQEQQQQESGQQQQgigsiizf:gsS2QSSQQQQQSQQQQQZQQSQQEQQEQQQQQQEQQAQQRQQQQQS252135Qi1gffQSfQQi7QaxQf2QQgggifgsQiifQQ::QQXSSSQQQQQ3Q2223f3fqza1QQs,ziigiaigkq wi,M.L?,MQg5,,Q,wgQQ ,KQQQQU LH, ..,,TQ.Qg5QmMQW Q.iuQ,Q,,WQfi, QQQgQggQQQQQ QQ QQ,zQQ:QQ , 1fQ1QQQqA ,QQQQ-,gi QQQQQ-QQQ,QQQQQQQQQQQQQQQ AI-iw,QQQ,,gQQQQQgQ1QQQQQQQQQQSSQQQSQQSEEQQSQQQQQQQQQLQ35Q1QQQQQQsSz4QQQQf21gQQSi?iQfw1QSQSQSTQSSQQQ1QQQQQSQQSQQQQQQLILS-QQ:sSasQ?SSHSSSQQQQSQQQQSQQQSSQTZwwg?asQ1fQQQQQQQ2QLQQQQQQqQgsgfQQQQQ:QQQQ:QQQ:fQSf.fJ'!SQQ2KQQ22:EwfQ?Q 7QQigiQQg1S1kQQ:..,QQQ 'HimQQQZQQJWQQ.QQQ::5,QQgQQQ3Q,QQggQf ,5gQ2fQQi12gQQjg,.,-QQQLEM ,,LQ,ifQfs3gQQ. QQQQQQQQ-gfQQQQQ.QQQQQMQQQQQ :QQzfeQQQQQQ:QyQ,QQ QQQQQQQQQQQQQQQQQQQQ,QQQQQ QQ,QQQQQQQQ,Q,m.,,MM,,:Qm,,Q,QQ,L,,QQQ., QQQ,,,QQ,Q,gf.. QQQQQQ QQQQQQQQQQQQQQQQ-5Q:.QQQQ,QQQQQQQQQQQQQQQ-QQQQQQQQQQQQQQQQQQQQQQQQMQ.QQQQQQQQQLQQQQQQ:QQQ,:,QQQ1QQ,QQQ-QQ:,f1QQQQgQ,QQ,QfQ. QQQQQQQQQQQ-3:3QQQQQQQQQQQ'QQQQQQQQQQQQQQQQQQQQQQQQQQ Q'LQQQQQQQQQQQQQ-QQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ ,,QQQ.QQQQ,,,QQQQQQQQQ5 A ' QQQLQ,Q,L55QQQ-kg.IQlLmQ,,:.QiQmQ.MH:m,L.Q5iQ1QQfL5,QVNQQQV,QWQQQQQWQKIQQQ,QQu,.J,QwLQ,.Q,:3:QmQ.kLM QH,.QL,QQ-LQ QM.,Q.QMfQiQLQ QSMgE.QgiQQQQ:QQ:QQiQQyQ.QQ-QQQQQQQQQQQAQQQQQQQQQQQQQQQQQQSQQQQQQQQQQQSQQQQ-SfgSiQQQQQQ.QQgQQ3QQQQggs52:QQQQQQSQQQQQQjliemf12zfQ-7gQQQQQQQsSiQ-QQQQQQQQQQQQQ-.3f1:QQ,iQQ:QSQQQQSQQW-1SQfvgQ1QQyQSf1QSfJTSYQEQ kwwkQiszggiiimzg .NNWQEQQ QQQQQQQQQQQQQQQQQQQQQQQSQQQQSQQQQQQQssfQSfwsiLQ2214QQ QQQQQ QQ-:QQf:z142fQQQl,Q QQ1,?ffQQ-QQ.f,Q N QQQQQQ QQQQQQQQ gQQQQQgqQQSv4QsQQQQQQQQ?Q1QQQQ525QQ21S5SQQ324Q2QQKQQQQQQQ2QaiQQQQQQQ5fQEQQQQQQQQQggQ5QQsgsfisfil-QQQQQQQQQSQQQQfszziizfzQQQQQ3,QSTQ1QQSQEQSHQQQQQQQQQQQQQQQQQQQQQQfSQgQQQ5wSQQQ5Q,ggQQQ1l1QQQQQQSQQSQQQQQQQQQQQ,,Q:QQg'gg1Q,Q -Q Q QQLQQQQQQQQQQQQQMQQ Q,QQQQQQgQgQQ5ai.QQS QQgQQQ52QQQQQgQgQ7zsgfQ-Q5QQ:QwQQQQgQQzQfQQQQQSQQQQ...wwf A Qu.. S-SQQSYQQSZ-Q-S1saiif:1 142:fQ1S2ifESWffSS7QsQSQQ3wQfs1QQSZ5Q11QSQifE4Sii2S2IQSQ4QQQSQ4LSSZafS2QQEQiSH54Q6Q'TSi1QQLQ22S155L521sz4Q5SZ51ii51LS2ifQSSHQQQQLFQFHQQQZSQSSTLESSS Q Q QQ SQ MQMMQLQQQQQQMQQQQ:,lm5Q,,Q,LMQW3,551WQQEQQMQQQLQQQMS,,QEQQQQQLQQQQQQQQQQQQQQQ Qyu K AQQQAQL .QQg1,QeQ5.QQ,Qi,, Q.55QQQQQQ,QQQQQQq5Q.QQfQQQQ3fQQQMQQQQQQQQQQ.wQQQQQQQQQQgzQQQQQQQQQQQQQQQQQ ggiQQQQ5wa:zsf7QQQQ.QQSgQQQQQQQQQQQQQQQQQQQ,3Qw..QQ-,QQQ Q Q Q Q Q QMQQQMQQQSQgQQQQ,QLiQQgQgQQ5wL2QQ:QQQ,Q5QQQQiQiSEf52iesaQfQQ3QQQwQQgQgQQQQQQgQQQQM5:,ii,E.bA MQW :QMQQQMQJWQQQQQQQ QQQQ QQ. .Q ,QQ,QlQQ.iH TQQ5QQQQQQ5QQQQQQQ5QQQQQ3gfQQQQ1QQQQQSQQe7gQQggi,QiQ2zgzzQgms5iQ-QQ3QgQQsgQ22QQQSigggQfQ34QsS?s:2gQQQzQQzQQ3QQQQQgQ? Q QX S Q 2 QQS Q H Qi :Q QQZQ 3 ,Q , QQQQ ig! QS! Q Q Q SQQQQ RQ QQ QQ QQQQQQQQQ, QQQQQQQQNQQQQQQQQQQQQQQQQQQQQQQQQQQQQSQQQQQKLQQQQQ ,QQW,-QQQQQQQQQQQQQ-wg-QQQQQQ-. -ISIQQQQQQQQ-1 Q.QgQQgfzQQQQ:QQQS:em QSM-frQSQQ1SgfQQfQ5sg4SfY"-:SMLmfQQQ111S1?2:w-ISSTGSQYQS:SSH4ssQLQQQ:QSSQQgQQQQQQQQ,Swim?WggggmlwzWKMQQHQQQQQ K Q, S2 S Q QQ' Q Q Q if QQmQ:Q,H!,Q?Q4QQ ,l,QQQF,QJ,,LVQQMQQQ5-QQ,QLQQQ,,.1,Q,l5Ql,,Q,, w,,L:QZQQQQQ,1 Q, QQQQQQ QQLTMQQQQ fQQQQ,KQ,Qf,.QQgg,QQQQQ-:QMQ, QQ,-,QQQQQQQQQQQQQQQ.QQQQQQQQQQQf-f7Q.QQQQQQQgQgQQQQgQQQQQ5QQQQQQQSHQQSSQQQSZQSSQQESQ:wwHQQQQS QQ QQS Q Q Q Q Q Q Q, Q Qs 452155 1QS11f?T'QSSQ5lfS1lLS 'L?Qi1fz-QM Hslyzfixr'HSQSQQWr:QlbSJg:Q1QSSff'HEQESSQ ,gQQ:Q,z5,Au::Q,NN wLQ.,,mk:5 Qi5Q1,Q1ggQz..7kQ 53155,ggQQQQ2fi:QlgqQQ:zgSff,QQQ:2 ,U .1 iliiisziwz,:Q:g53Sf4exQ:.QEQQQ.jQQQQ.LeQQQgirzk,Q zrg5SQQQSQszt1' 5?SzQ13rL:Si1QgQQZQ3Q4QSQ25g5,QQQg.:ffzfQ Q 5 S f QQ. Q S Y 3 QQ x , Q Qs 1 if 2? QS QQQ QQ! H, Q QQ3 QQ QQ , L QQS LS QS QHQQ 'C WQ Qs SQQ, Qi Q S, S ,RQQ X , Q QQ X ,, S W :QTLQQQQQQQQZQQQQ,QQQQQQQQQQQQQQQQQQQQLQQQQQQQQQQQQQQQQQQ-.QQQQSQQQQQQQQQQQQQQQ1QQ3g4Q2iQ,QQQQQSQQQQQQggszQQSQQQQQQQgggsQQQQQQQg2p:QzQQQQQQQQQQQ QQ3QgQQQfQ-Q Qf:Q.QQQQQ:f3sQifQQQQfss22fS2QQQQQQQQZSSYS'HWfszisfwzQQQSQQQQQfsuasiilwQQSSEQPZQSwzifsafes?-SHQQSQQQQ 2 S Qi 2 QQ 1 3 f J S Q S Q QQ 2' KH QQ QQ? QQ,QQQQQQQQQQQQQQQQQQQQQQQQ.QQQQQQ,Q,,,QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ-QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQWQQQQQQQQQQ- QS-:S QQQQQQ., .Q,QQSQQQQQQQQQQQSQQQQQ-.QQQQQQSQQQQQQQQQMQQQQQQQQQQQQQQQQQQQQQQQQQQSQQQ1QQQQQQQQQQ-QQQQQQQQ,Q. -QQ Q Q Q Q QQ QS Q Q Q QQ 1 Q S Q Q S QQ Q Q ,Q MQ Q,.QQ,,QQ,,mu,1gQQAQmiQ,Q,SMAMQWQ,5,QQQwm.Q,QQ,,MQ,5QQ4QQM:QQ,QQQQ.QQQQ,QQQQQQQs,QQQQQQQQQQ,QQQQQQ,QQQQQQQQQQQQQQQ.QLm,.1QQQQQ.QQQQQQ.QQQ ,QQQQQ:QQ-QQQQQQQQQQQQQQQQQQQQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQQQWQQQQQQQQQQQQQQQQQQQQWQVQQQQQQQQQQQQQQQY Q Q , Q Q ,Q S SK Q ,Q Q Q Q SQ QQQ Q Q QQ Q 5 Q L QW ,Q I QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQfQQQQQQQQQQQQQQQQQQQQQQQQQQQQSQQQQQQQQQQQQQMQQQQQQQQQQQzg1QQQQQQQQ:S QQQSgfQQfQ1f1QQsQeQQQQQQQQQQSQQU QQQQQQQQQQQQQQQQQQQQQQQQQQQQQ-QQQQQQQQQQQQQQQQQSQQQQQQSQQQQQQSQQQSQ1MQQSQQQFQQQQSQQM 1212'SQQSwMSSQfSQQS'QQ Q Q 355 L AQ 'S QS S EQ S S LQQ Q sg QS QQQ K Q, S1 Q MQLZLMQQQAWQLQMSWHSQQ:QLWSQQQQMQHWEQQHQQQQQQQQQQQQQQQQQQQQQQ.QQQQLQQQQQQMQQS Q-ffQQSSQQQQQQQQQQQSQQQQQQQQQQQQQQQ5Q:QS1i3QQQQQQQQf-3s:4Q-Q'Q5QQQSSSQQQQQQQQYWQSQQQf:5Qs1fQQQQQz:Qi7SQQQQygSQQQQQQQQQQQQQSQQQQQQ' Q- Q QQQ Q Q Q Q Q Q QQQ QEQQQTQ is pf Qf QQJ QW Q Q QQ QSQ Q ,SQ QQ Q H ff S, gg Q Q,Q,QQQ,::QQQ4,,LQQQQQQGQQQQQQQQgmzew-QQSQQQSSQSLSQQESQSSQQQQQQQQZQQQQ,AWQQQQQgQQQQQQQQQQQQQQQQQQQQQSSQQQQQIQQQQEQS' sfQQSg:QQ-QQQSLQiQQe,QQ522324QQQQQQQQKQSYQSQSQSQQQQ211fQ:QQQ3Q:Si422fQ'fsiiwlfxfQQQQQQ,QQSQfQQQQQrz5QQz:QQQQQQQQQQEQf,igQQQvQ1QQwQQQwQ, Q Q QQ QQSQQ-eggs r 5,5 ,Ki Q X ,Q Q5 M R , if H iQ Q 8 S Q,QQSf SQ fif 1 1:,3hggg7,,KQ3QQQQQg3gQgQQQ13Sg5Q?QLf7Q.1QSQQiiZQ:fii,.Q,12g5i2,Q55iQQgQf21LgQlLQQQztjqSiQSQ:QSQQQ::Q1gE5-,Qg:jggE3iQQSg1s"FQQHEFQ'S77SEi125:Q.QS1flf7Zi11QfS?Ei6E3TrW' HL? Miifiiigrfi?'ffflfifv-9YlT5is3iZ1LvfZINSSQHLQQZ5TiQ45Zg:SSL1ZS2ZIQEiixSflfS2?sS57'2QfQP'5'1lif' 'Vs E Qs T Q N P, A 3 ,QW-QQ-QQQQQQQQ Q QQQQQQQQQQQWQQQQ. QQQ QQQ QQ QQ Q QQ Q QQ Q, QQ Q Q-QQQQ-,QQQQQQQQQ,QQQQQ,.,QQQQQQQQQQQQQQQQQQQQQQQ.,QQQQQQQQQQQQQQQQWQQQQQQQ.,Q QQQQQQ,,QQQQQQQQQ,Q,.Q,QQQQQQ.,QQQ-W,QQMQQQQQ-QQQQQ ,QQQQQQQQQQQQ-QMQQQ-QQQSQQQQQQQQQQQQQQ-Q,Q,,.QQIwQ,,MmW,wQQ Q Q QQ SM QQ S QQ Q Q Q QQQQQQQ,,QQQQQfQ,Q,QQQQ,Q.QQQQQQ,QQQQQQWQQQQQQQQ ,QQQQQQQ.,Q,,-QQQQQQ.. QQQQQQ-fQ,,Q.QQQ-QQ-Q-QQQQQQ-,QQQQQQQQQQQ.QQQ-,Q.1QQQ-QQQQQ:QQ QQQ..Q.,,,QQQ-..Q.,,QQQ-,QQ,QQQQQMQQQQQQ,QQQQQQQQQQQQQ,QQQQQQMQ,QQQQQQQQQQW,QQ ,Q QQQQ QQ QQ 5 Q QQ Q QQ Q QQ Q 1 ,Q ,Q Q Q 5?QQQQ5I3QQQL3QQQQQQQQQQQQQQQQQQQQQQQQQIQQQQQQQQQQSQSQQQEQQQQQQQQQQQQQQQQggqgzQ?QQQQ:qQQQQQQQQ.fQiQsesiQ:-QQQQQQQQQQEQ:fSvSfQfiL"SQQQm1Qi1QQ-fSf'QQ3wQf:iSI' QS2212425w'.QS1QQ2QfSQQQWQEQQQQQSQQQIQSZQ:QmS2gEQ22QQ:mvQQSQQQQQQQQQfSsQQQSXwQgQ'QssSQQQQ,Qgq HK Q Q QQ Qi Q S Q ,Q QS QQ S1 QQ, up Q 1+-Q12 1 Q Q1 S 'fs Q QQ? Q ,UQ QQ 2 XS QQW QS sg if QQ Egg Q zrsxflzfi-SQQKQSQQQXQSSL-5QweY1N4i7,r1as2:QswtxzQQQQSLWQN4Qs14aQQ1QLS1LQ-QzxlcsifQ:5QS11Q:wz.sa-1wx-.141'Hemi'I-MW-WISVFSST,-:SiSf'SiWfQ:w1,.1 fl.-QgQQQf I-QQzQQg-,:QgS,QQQ5QQQQQ:HQ, Q5kQ,QQs14s,15,,gen:Q,1QQgQ-Qzrigziwgifsgvr WQQQQQ ,1IQS5Q,QQ!'22s1aS QQ .1 Q S Qy Lx W Qi 'R S AvA.,,AL ,.,. Q A..L Q Q ,.v,, ,..,,,.A .,,. Q ..,A Q .,.. .. Q. QQ .,,, QQ, . K,LL Q QQ, .QQQQ QQ Q .QQ QQ Q Q Q Q QQ QQQQQQQQQQQQQQQQQQQQQ,QQQQQQQQQQQQQQQQQQQQQQQsQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ-:QQ-.QQQQQQQQQQQQQQQQQMQMQQQQQQQQEQQQQQQQQQQ,QQQQQ2-.fQQ2Q.Q:QQQQQQQQQQfQQQQSQQQSQQQSQQSQEQQQQQSSWQSZQPQHSSfigMQ1MQSSSQYSHQQMQHZSSKQSSEQQSHQQSI3 QQ iw " ,L Q Q Q QQ, S Sw 5 SS Q Q Ka EQ y Q55 H ,Q Q' Q Qgfgggffggsa,QQQQQQQQSQYQQQQ5QQQ5ggQQQQQQQQQQEQQQQZQQQQQQQQQQQLLQQQQ3QQQQQQQSQQSTSQSQQQQQQQQQQQSSQQqgswQQQQQQQ:gQQ,g',,,..,.Qs2'QQefS4QQQQQ:QQag1QQ.QQ5gggQgSf,QQQQQgQQQSQQQQggsqaiasifw1Q2:iQQ?ifSvfQ?-iQSii?fSKsisQQQSISQQQQ-QgsiisSQQQSQQIQSQQQSYYSEQQQifvSQL,i S S Q SS-Q Q2 SK M 5 Q S ' Q Q! S M2 2 S Q2 KS NU' QQQQQQQQQQQQ5QLQQQQQQQQQQQQQQQQQQQQQQSQ,QQ-QQQQQQMQQ,IQQQQQMQQQQQQQQQQQQQQQQQQQQQQQ-QQQQSQQQQQWQQQQQQQQ1QQfQSzg4eS.QQQz1sSiSiQQQQ-Q-fS11sQs-H-fa2QfQfbz::QQQSZQQQSQQSQQQSSLESZ:Sv-15424235251QQQZQQZQfS11SSSH?ifSviQSf22YfSWSY1Sf5Q?1f151191QviQ'4 SQ QQ: QQ SLS Q 3 Q 25 MQ S' Qi Q Q sw SK S 'Y Z ,y,QQ,,,,L3.,QQQQQQQQQQLQ gQf:wfs.S-fQ:QQsLfs.J'2 farm"-SQQ-m:QZZsi1hfiizQsa11hiVQ'QQ:w:f2t1'SS-3Qwz:Qfw,.Q-,5:SQ:gQQrezQ:,3-QQQQQQQS,'SQ-QQ., Q-1:zZ1:QfQUz,.Q--,RQ-gQQzs,155,,:sQ,.QQqQSt1sQ-,z-QQIISYQQSQ.QQ-QQ:?:sat1s5?:f xv'.ek-QQm:?2g1s:Q1,sQQ QQAQQVQ QQQSMQQQ SQ Q 1 Q ,QQQQQQQ3QQ2QQQQQQQsQQiQQ2QQzQQQsEQ:QQQQQQQEQQQQQQSQQQQQQQQEQSQQQQQQQQQQQQQQQQQQQiQQ:?fQQfQQQQ:.QfS2issQQQQQQSSSQQQSQQSSQQEQSQQMISQISSQSSSfff2Sfi!fifiQfSSiSffQSSSSSZQSSZQSQQSYSW'-11QSYQSSHG'-QSQMYSSSQZQSSQSSiiiMSS1QSQ1SQSiSSf5wi?2SS 5 fi il S25Q-WSE 9 Q 'Q Q S HWY' Qi if 'WQQ Q 8 Q 5' 9' 'Z' Q gzgzwwfESQQQQQSQQSQQSXYQQQQQQSQQQYQQQ-,QQQQfQQ3:s1e21Q1QQLQS3z3?Q:g:4Q4iQi?l2izsif2WSv7fQSSQHTZQ55515522'1iSS?fSSEgSQ?i2E52fIQ?LQWSQLQSZLSZQQSQQQQ:7zf11Sf7QQfG22fQ?iQ1S' QSYQWISSQQEQLSSSTLWFQQQSSZHSE5kfizwfSiCSQQQQSYXQHQSQ1QSiQL?5iESiQ?iY1QiiQSQEIMQIQ fa Q Sf Q-Q Q Q Q Q S Qf Q Q, Q S Q 'S Q 1 QQQQQSQQQQQ SM fi Sf Q QQ Q Q1 N " E XX QS SQ Sf Z QQ? Q Q SEQ Q gfQQQQQ1QQQgsz1g5L,,QQQLQQSQQQQHQgifQQQQgnQQQqg35QQgL:f,QgzQscgg531,Qz,iggggklylggyilg53gQ-kUQ4gQ5Q3i:zifSQflfiikivz'-fiiggfwszliM 375S5S?iIi5E:w:QQV,-QzriiifiifS5QSES5TQ?SwQQr1Z5315:12457TT2E3LS51SS555,33?ALEQQQv:2i5wi5fLfS7ilQ:5Z?iSrQ Qs1i5ig,x:G1Ef55li3V1SKX sw N :Q 5 5 F 5 fi S VS 5 if' ISQE-1,3,,4QQ5IQ15QQAQZHWQLQQZQQHQEFQWs51QLQQQQLf,tNLQQg,Q:jggQgggQQQg?LLQ,Q!?Qs1Q,35f'?!,1611Q:ezQQ533QsLx1,3ijLSzQmQ:33 :,Qg1QQ,Qx my 't'swamfgQ:mzt.:Q:Hf:Qsz:QQ:Qg,LQISQQQQSSHQQZYQQLFSQZQQQgQQ5'sQe1QQgHQQQ43-Q:QQQQQLQ:ctssa1,gQQfgQQ:5?L2Q. Q-Qu Hggiw QE? K QQ S Q S K 2 ss' K Q, K Q Q ,M ,R Hb- Q M. QQQQQQQ3QQQQQQQQ1QQQQQQQQQQQQQQQQQQQQQQQgiQQQQQQQQ1QQQQQQQQQQQQQSQQQQQQQQsQg.QQQQQSQQQ-.QQQQQQQQQfQ2S2Q:QQQQ1QQQQQQQQQQQQQQQQQQQQQQQQQQ1L31QQze:QQQQQQQs:fQQQQQQ,QQQQQQQQQ1QQQ21QQ2QQ115Q22QQQQQQaiQSS14QS2Q11QSQQQQQQgQQfQQfSzQQig,:QQfQSsQQQQQQQSQEQQQQS mg QSQQ Q? 4 QQ f QL QS QS QQ QQQQQ ,Q Q Q2 Q Q , Q QQ? 'E IEQQQQSEQQQQQQQQMQQ1gQq3QQQi25gwgs,mg335135A3339QQ5QZ33zgQ15QQgLQ313,QigQQ351z,gQQlL5QLy3. aQQlgQg?iQeSgQQ-i3,iQE:.1:QQQLQQ:QQS:::Sjgg37i,iTiQQQfg55EEYE2:7ti55gf'3QQSf,.5755?ii23?i1iQiiEfEL5S?z:sS-'iSliQ??LQ2x1ge1iE!1EZQE5f-qiQiQ2?ee:55S,ggQ5SgQQ gQi5gifE,:1gS1g,g2Q K Q Q Q, Q Q. Q Q x Q QQ 'eg Y Q X, 3 QSEZQQZ ' S, W , S Q FQ Q if Qf QQQQLQ LE Q QQ.gQQgfQQQ,Q.QQ1QgQ:1QgQQQQQgfgg-,QQ'QSwasQ1QQQQQQQQQQQQQQQQQQQQQQSQQQQQQQg,Q,eQ:-.Q-SQ-QSSQQQQQgQg1QQQQQQQQQQ.QQQggQQ,QQQ:QQQQQQQQ.QQQQ:QQQQQQgyggg,QQQQQ-QLQQQQQQQQQQQgQ-Sie QQQQL,gv211QzvQQQQQQQQQQQQQQQQQQQQQQQZQQwigQQQQQQQQQQISQQQQQQQQQQQQQQQup SQ 1 25 Q X N 1 W Q S1 QQ- Q Q H QQ QQ Q, S QQ Q Q Q kQQ,:Q,x:U,:QQL5QQQKQQQIQQQQAQ, ,IHIQQQQZ5ISXQQQIQIQQQQQM,,.QWQQQWVIW,:SMHulselwQ..J?.QM,,.,QQKQQQQQQW-QQQSQQSQfQ-QQf:Q-:Qld.gQ::2,uQQQQQQQ:1g55ggz:::'-SfeiQQ:e,rfQfT''5E1:aS:'vQ-SW-7Q4QSzzSf'?fZQE:QQW:WGSVQSSQQSS1Q1Qiiw'5S'l1lQf3QfSiQSMW Q " xx NY M 'S S KS K YS Q ,..,,QkQ,WQ.,, V I :QQ -, Q . ,, . , Q- , QQQQQQ Q, Q, Q QQ S Q QQQ S 'Q Q Q S Q ,QQ Q A Q Q QQ. Q,.Q-QQQQQQ, , Q ,. , ,, Q Q. Q Q ,Q Q -,QQQ .QQQQ.,QQQQ.,,QfQQ.QQQ.Q,.Q.Q,QQQQQQWQ.QQQQQ.,QQQQQQQQQQ-Q-SQQQQQ f QS Q Q S Q QS Q1QQ:SxQ.QQQS-QQQJQSLQQH,Iamsm LSSQQQ-QfQQeQgz1s1WQFSAS.11' -wma fs"SfS Qu Skis , 'QQ .fs V ilswss QS GQ -z:'.1'-iff?--HLSSYTYQS'fS:zQS1'lfHQ QSQQQALSSYIQ-SQQ 1SSSQIQQ-Q':SL1SS1'-SQQsL1sSSM-WSf2LfSS1'S57I 'SW'-QQ -S5 5 Q " 5 5 K 5 H 5iQ5Q5Qw3i5wiLwgsmM55MEwQ5QE,gigQiL S. Q QQ : Q55 114- 1 -2 Q Q .Q QQQk5QQQQziQ5QQ,QQ5QSQQ?QQ1QS13QQQQQ:QQQfwjQQQgZQ2QQgQQQQQSQg3QQQQSQEQQQQQQZQQGQESSQQQF M QS M 3 Q G? 5 Q S ,A 'E S Q 3 QS Sf S QQ Qfhfb Q14 Q Q SW Q QQ? QQX SS iifiiiikseigiwf22S22QQ1LQQSQQSZSSSTQQQQQQQQQQSQQSQSZQSQQQQLSQEEQSLQS'fQQSfi1SS1f2QS5iSS1ESSi7?QfS:liS QQQS2?Z21Q2S211QQQQg3gQQQQQk5Q.km5mIWQQQQQ QQ EQ S X Q QE gp? 21 QQ QQ Q, X X QQ? QQKQSS Q Q Q5 K Q13 QQ S S X QQ QQSMQQQQQQQQQQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ:QgQgQ1,QQQQQQ.QQQQQQQQQQQQQEQQQQQQQMQ.:Q,QQQQQQQQQQQQQQQ,Q1.QQQQ'-fS.a1fSQ:f-1 S --QQ.:Q:w,QQQQQ,.Q:fQ1f1QQQfQQfQ QQQQQQQQQWQQQQQQQQQQQSSQQSQQQQHSQQQSQQQQ-WS Q Q QQ Q Q 'QQ Q QQ Q Q Q Q Q M 1fg2QQ:QSS:zQQ:zggLQQQgQz::sSfg2Qfgs::QMQQQmy-f'esz1Sf'QgQQQS1s1!1IQQsszsf'liS9f'?E?seSS'ISS'QQz,1f'QfAfW71:Qg:Q'fl--Sz'zQ.S!1'-ISWSVQ-G'V"L S' "Qi.:Qz-.:f:fmQlg,QQ:QQQ",5SQ:QzfLS'fQ .QQ:f'v1LS1QSZf24QtzzSfY1iSzQ QS' S Y S 5 Q Y QQ SK xx NSQ x 3 QS IQ Q QQ Y Sm Q. .1 Q?'f"Z QQQQSQQQQLQQQQ -QQQQQQQQSSQQQQ5QQQMSQQQQQQQQQQQQQQQE Q S QQS X Q Q QQ f r I S5 Q3 W SQQQ Q, SK 58? Q Q QQ Q 1 M Q JSQQQ QM 5 Q X S 5 ,HJ SQ Q SW, my an S 4 QQQLQSQQS is Qs'Q ' QQ S fu K wg if Q Q S QQ Ki S 5 Q SQ f QS S Q QQQQQQ Q S QQ S Q UQ ,QQQ-QQfQQg,QQ:QQQ:QQgQQQQQ,QQ.QQQQQQg,QQQ,QQw:QgQQQ3gQQ, g, ff' ,g,,QQQQ1QQQQQs,Q1QQ:S QQQSSQQ-Q-SSYQQQQQ SQ -Q2'.fQ:-wrfzafwz-.1 QSQQQQQ Q:QQ'QQQQ2QQSQf:QvS1' 2 Q Q S Q QQQQQSEQQ-QQQQQQSQQQQQQQQQQQQQQQQQ-Q QQQQQQQQQQQQQ-QQQQQQQQQQQQQQQQQQQQQQQQSIQQQQSQQQQQM.QQQQQQSQQQQQQQQ:Q-QQQQQQ-QQ-QsS.fQQ QQ QQQSQ aff QS SS Q-SQQQQSSQSXQS? 5 Q XQQ QQ S Q TQ? Q W SWQ QSK3 ' iw Q9 Q 5 if QQ N Q Q QS QSQ RQ QL Q 'X ' S Q W Q 1 Q QS QSM QS Y QQ SQ fs Tiff? QFQQQ S M SQQ 2 QS QW S CSSQQ QS W WSIS we :'mS'57SMis:g if S2 S Q Q Q S SQ VE, QQ IQ QW L S SW Q3 9? WS Q W QSQ QQQSW S SQ, ESQ QQIQSSQQQSSQQQ QSzgz1fQQi5QgQ:gQgf:fwg.QggQf'QQ QQ-S S QQ- Q 1 -f "-QQQQQQQHG Q11 sv: S: Q QQ f S QQ Q Q Q , Q Q S Q QQ S QQ WK SffffS2g:sQi2Qe. Q.,iQQQSvQQQ2Y2SS'-in'fat' Q Q Q L Q SQ Q! J Q gg S4 Q QQX X, Q QQS4 S S Q82 'fx MQ IQ- Q ji iQ LT f ,QQQ S ffl Wi S Wi ,fw2'.:fQQ-SQ,Qg 7QSQ:QQgfQfzziaQfQ:-my Q Q Q Q QQQQ Q Q Q Q Q QQ Q Q QgfQQ12i'f-SS' QSfQS'f:Se'.QQQ?Q:S'iff'QSf S Qi S L Q Q Q as Q5 Q 3 QS aww S 1 5 Q Q S5 QKS PFW X KZ SQ S QHSS RQ SN S12 R593 sf VX K EM Q S4 QQ' 'Qsiwsaif E'.QzSQ'f2'.fi+iQsSiQQSff.-QW S 1 Q 1 Q 5 Q Q Q QQ Q S Q32 Q S Q Q Q Q QQ QQ Q Q v Q Q Q Q S QQ SQ QQ Q S 'Z , QQ Q K Q Q Q 1 QQ QSQ , Q Q,Q QQ, ' QQSILQQQSQH fiff2.si2SiQQQ Q S S 2 Q ,QS S QQ? S QQ gk Q Q Hg 25 SN Q SQ SQ SQQQS 35 qi Kg 2 XQW QQ HWS S QQ Qf22.QQQQ Q Q Q Q Q Q Q QQ --ff--HQ: Q s S K3 x Kqss 335 Q S Qs K 5 S Q Y 5 K 5 lizlfmx 5 S if. Q Q S- Q,, is sn 9 31? s 5 QQ 5 S M Q X Qsziiiezf Z S Q Q 1 S SSQQSKQ SQS QQSQQSQ QU QM SQ SQQ QM, Q3 f QHWS E ff' , ,QQQQ -.fQ Q Q Q Q S QQ, QSSQ W Q QQSQ QQQ QWQ Q QQQMSQS fQQ QS QSQQ SQKSQQ S215--.EQ Q , K Q K S QQ1 Q? SWS , Sf, QS QMSQQ Q , F SQ Qg S ,QS TQ21iLQf1i2- Q 3 Q QS KLQ S Q L XQS Qi XSQQ 513 S SM Q W' K K2 S Q:QQgyQgQ-QQ. S X Q Q 2 Q A S S S Q S Q1 Q1 SQQ Q S 57'-522.51221 Q , SS Q K Q ,Q Y K SSS S K QS 5 f Q ' X 9 S S . Qilifisx Q Q S Q2 2 Q QS Q SQ SQQQQ SUS Q , Sf Q Q 1'-Qiiff Q S Q SQ QS X S- Q QQ S f Q f7Q:Qt,.1' X s S fS 5 Q 5 SW 'Q L VK K V' 2155-SQL S KQ 3 Q KS ,QKQS 5 Q QS K 3 Q K S S S3 S QQ S Sf S3625 W K S Q S ,S S Q Q Qs Q S Q Q Q Q S l7k.55.!Q 1 9 Q X PS5 HQ S L Q Q Q Q Q-f,.f,.1 Q SS Q QS S Q Sn fi--vgia , Q Q K? QQ S Q5 B QQ 5 S Q g.1Qg1g:-j Q, Q ,Q Q Q Q fm Q Q S Q ,QQ ,.., X Q Q Q , Q Q Q , Q Q:--QQ . ,, X 5 Q S L 5 H- ,, . S X Q 4 QQ Q..Q,,, 7 Q Q liilltf' 5 Q Q R ,1f,.:'r W S Q 3 Q ,flfgjf S X ,Q -,,.-,,, Q Q Q E.f,Tl', N Q 7: -555. , Q ..,Lk QQ 2 9' . ' .fi '- ,tw-:T ifjdI"1' k 'Q 'f1.?.3 . 'i,"" -"'. S 2v2'4:9f" ..f' 4r"'.': , .1"'7'-fi. . gc, , .Lf ig:-, ,Q nt, K 'wi' 4 ' i 'ik- 'E' ,.. . 13 P: 'D- ul' V 1 552 Q ,, . ffl, any ,, Jeff: 25. f iff ,Nh- k:'- A 'A Av .P - . if-J",- 3.-M... kv-QA. :J --' ,,"Y" . me -.- ,. 1 "' 1 an , 5. If 1"f9,f' f!"w C1-f. - 1 fp 105' I .ik 1' ,. ' Y . ff ffl, bfi- nx' 'V f V hff . ,,. ,. L!!!-7. '- if A.-f-atv 3,1341 ' 'f.,s3? , 1 ,gn , i'Z"f',f:-' ,:!'..'. 3332 T 'fgazffz 1.14 ., If V,-1 "7-.uflxf r . ,y-'Ig' ff:-I ,125 l 1 Y ' f .- Hfff QM Q74 "r.,: 1, " IE 4 .,' ai K.- F sv? 1 " , -7' ws, hgfx jig? vi," 945' . S5151 L41 gg. lx- I 'g 'gjtr 'IVQ 3 fi' r" -': ',- 1 sf -A 2,4 ' 15.4"-1-W' ,A-, N.-1 'pf ,-. L4 . J v Class of '64 BOB SCARBORGUCH . . . Senior Class President, Football Letterman, Nationa Honor Society, Home Room Vice-President . . . FRED HANCHEY . . . Senior Class Vice-President, Boys' State, Junior Rotarian, National Honor Society, Youth Center Presi- dent, Mr. NLRHS, Key Club Secretary, Captain and Lieutenant for the Marchingiand Concert Bands, Friendliest Sophomore, Home Room President, Hi-Y . . . CATHY REED . . . Senior Class Secretary, Y-Teens President, Delegate to Mid-Winter, State and Mid-South Y-Teens' Conferences, State Y-Teens Secretary, Y-Teen Valentine Queen, Pep Cat Hand Drill Leader, Catettes, Publications Staff Head Typist, Quill and Scroll, Los Gatos Espanoles, Home Room Officer . . . BOBBY FAULKNER . . . Senior Class Treasurer, Football Letterman, Red Cross Repre- sentative, Bookvvorms, Home Room Vice-President, Hi-Y . . For three long years the Seniors of 1964 have been understudies for their major parts in the North Side Story. The year is at hand when this group attains the highest rating, and top billing on the critic notices. These stars quite often are heard in a chant of "We're the best and even more, we're the class of '64." Vice President Secretary Treasurer Cathy Reed Bob Faulkner ,1 wax F A 1 I In ,N rv' fir' f. 'Agfa' ,fi D, we-'rf ADAXIS, PIQGGY ADCOCK, GLORIA ADKINS, LINDA SUSAN "sig ' , t"I!'?'f'f'Ng. is six ALLEN, LARRY ANDERSON, I-IERMAN L. III ANDREWS, LINDA DIANIZ Class of '64 PEGGY ADAMS . . . Future Nurses, Future Homemakers, Red Cross Representative, Monitor . . . ADCOCK, GLORIA . . . Pep Cats, Future Business Leaders, Future Homemakers, Junior Girls' Chorus, Girls' Recreation Association . . . ADKINS, LINDA SUSAN . . . Future Busi- ness Leaders, Future Teachers, Y-Teens, Theta Science Club, Band Monitor, Careers Club President, National Honor Society . . . ALLAIN, EARL . . . Concert and Marching Bands, All-State Band, Los Gatos Espanoles, Publications Staff . . . ALLEN, LARRY... ANDERSON, HERMAN L. III. . . ANDREWS, LINDA DIANE . Marching Band, Future Teachers, Career Club Parliamentarian, Concert Band, Girls' Recreation Association, Pep Band, Monitor . . . ANDREWS, PATRICIA . . . Band Student Director, Concert Band, Pep Band, National Honor Society, Tri Chem, Y-Teens, Home Room Treasurer, Senior Breakfast Planning Committee, Sophomore Talent Assembly . . . ANTONSEN, NANCY LEE . . . National Honor Society, Theta Science Club, Quo Vadis, Tri Chem . . . ARD, JAMES . . . Marching Band, Thespians, Stage Crew . . . SEX, ALLAIN, EARL 'JPN N' ANDR ILWS, PATRICIA ANTONSICN, NANCY Llili AC' ARD, .IAXILS 6 4 f 'sa xx ""'TQ- ,X , 1 rg 131 Q' "' 't""', , W . ARMSTRONG, RONNIIL ASIIBIIRRY, TIM Class of '64 ARMSTRONG, RONNIE . . . Football . . . ASHBERRY, TIM . . . Na- tional Honor Society Treasurer, Senior Choir Treasurer, Tri Chem, Key Club, All State Choir, Delegate to Choral and Sight Reading Clinic, Usher for Vesper Service, Boys' State Alternate, Junior Choir, The Four Jokers, Wildcat Follies Cast, Musical Varieties Cast, Boys' Chorus, The Gypsy Rovers . . . ATTERBERRY, ARLENE DARNELL . . . ATTERBERRY, LARRY . . . Junior Choir, Film Crew . . . AUSTIN, ANN. . . Career Club Vice-President, Future Homemakers, Future Teachers, Senior Girls' Chorus, Home Room Treasurer, Junior Girls' Chorus . . . DIANE AVANCE , . . Student Council, Girls' Recreational Association, Pep Cats, Thespians, Y-Teens Vice-President, Delegate to Y-Teens Mid-Winter and State Conferences, Catettes, Usher for Vesper Service, Future Teachers, Home Room Secretary, Junior Choir Secretary, Monitor, Senior Choir, Los Gatos Espanoles . . . AVANT, TERRY . . . BACHUS, JEANNIE . . . Y-Teens, Future Teachers, Future Home- makers, Le Cercle Francais, Pep Cats, Monitor, Girls' Recreation Associ'ation, Home RoomReporter,CareerClub . . . BALDWIN, RICHARD . . . Most Valuable Player Award in AA-AAA Tournament, All Big Ten, All State, Los Gatos Espanoles President, Home Room President and Vice -President, Publications Sports Editor,Quill and Scroll, Key Club, Junior Rotarian, Hi-Y, Delegate to Key Club Convention, Delegate to State Press Conference, All District VI Complete Sports Magazine . . . BALL, BECKY . . . National Honor Society, Girls' State, Future Home- makers President, National FHA Committeeman From Arkansas, Future Teachers Treasurer, Red Cross County Council, Red Cross Treasurer, Pep Cats, Thespians, Girls' Recreation Association Treasurer, Monitor, NLR Student Representative to State Mental HealthMeeting, Representative to State FHA Leadership Conference . . . NliI,L IXTTIERBIYRRY, IARRY AVSTIN, ANN AVANCE, DIANIQ ATTIiRl3IiRRY, ARLENE DAR fm' , ff- - I J 1 1 Wi' ff f- . '-2 ' , '. '--t was.. 44 J' 4 . S K g I ' 1 Y I ysst ,. ' s . 5 ,-,- I , . V -L.- 1 -,,.k','-- 5 ,'Ij1g'i-QQQ22' I 1,7 I :AHL AVANT, TERRY , px: H fit tg S f 132 f 'Qc at at I I 9? iii 352355 Al BACHU-S, -IEANNIE BALDWIN, RICHARD ARTHUR BALL, BECKY at an , .gig ,f F I Y if 'iw 'f'w-f'-'r..z- I -Wfwm C .v'V.f Wmq Wildcats hold early morning pep assembly on the front steps. ,-.wf412-f,-s5- ti ' ,.1.1f-:Mm-If f , 'asm zi. ss: K5 R aj We I 45 A fav BARKER, CONNYE BARKER, RONNIE BATES, DAVID BARTON, SHERRYE ANN CI 9 BAUGHER, MICHAEL K, i Vkvy .g ui-,Q, BARKER, CONNYE . . . National Honor Society, Senior Cabinet, Future A A AFAA ' A , Business Leaders, Theta Science Club, Future Teacher, Pep Cats, Y-Teens, tstt Le Cercle Francais, Home Room Secretary, Tri Chem . . . BARKER, it RONNIE . . . Publications Staff . . . BARTON, SHBRRYB ANN . . . y Senior Choir, Future Business Leaders, Junior Girls' Chorus, Los Gatos pyls Espanoles . . . BATES, DAVID . . . Senior Cabinet, All State Band, Home Room President and Vice -President, Los Gatos Espanoles, Concert f i and Marching Bands, Y-Teens and Quo Vadis Assemblies . . . , BAUGHER, MICHAEL K .... Marching Band, Home Room Vice-Presi- dent, Varsity Band, Los Gatos Espanoles . . . BAW, JOHN DENNIS . . . National Honor Society President, Student Council Chaplain, Junior Rotarian, Boys' State Auditor, Forensic League President, Thespians Vice-President, Pulaski County Teens Chairman, Key Club, Los Gatos Espanoles Wildcat Follies Cast, Commencement Usher, Delegate to State Honor Society Convention, Chairman for Student-Faculty Committee . . . BAW, JOHN DENNIS if-Q, 133 BEALI., ROBERT G. III '31 BIQLIIW, LORETTA BENNETT, SELENIA NIONTEZ BERRY, liRNIIi Class of '64 BEALL, ROBERT G. III. . . BELEW, LORETTA . . . Future Busi- ness Leaders, Senior Girls' Chorus . . . BENNETT, SELENIA MONTEZ . . . Transfer from Leslie High School . . . BERRY, ERNIE . . . Home Room President and Vice-President, Football and Track Letterman, Home Room Candidate for Mr. NLRHS . . . BILLINGSLEY, JO ANN.. .Future Nurses,Candystriper . . . BISHOP, DORIS DOREEN . . . Red Cross, Junior Choir, Musical Vari- eties Cast, Senior Girls' Chorus . . . BLACK, SANDRA LOU . . . BLAKENEY, LYNDALL RENE . . . Future Business Leaders, Senior Girls' Chorus, Pep Cats, Future Nurses . . . BOND, JANET . . . Student Council, Future Teachers Vice-President, Future Homemakers Public Relations Chairman, Usher for Vesper Service and Commencement, Quo Vadis, Monitor, Y-Teens, Pep Cats, Betty Crocker Homemaker of Tomorrow Award, Home Room Treasurer . . . BORENGASSER, MARY ANN . . . National Honor Society,HiComet Re-Write Editor, Senior Choir, Quill and Scroll, Student Council, Musical Varieties Cast, Student Librarian, Red Cross Representative, Volunteen, Pep Cats, Bookworms, Junior Choir Reporter, Los Gatos Espanoles, Del- egate to Yearbook Workshop and State Press Association, Delegate to District and State Student Librarians Association, National Honor Society BILLINGSLEY, JO ANN BISHOP, DORIS DOREIZN . X -l'Y"""7 BLACK, SANDRA LOU BLAKENEY, LYNDALL RENE BOND, JANET BORENGASSER, VARY ANN WV' N W, 134 - - ,, -'N W W . 3, ,Z --'g""' , in . L--k in Y ff: I ,- BOSLEY, BILL BOSLEY, SKIPPER BOSTIAN, RON li, ,L i3g"wltlittt, 1-' TA fi A my www' Q YN' ff f Mi t i A., ,N is , wt. i ff ' 'I I . kmh BOWEN, JO ANNA faq. BOWMAN, DARRELL LEE BOYLES, RICHARD ALAN BRISBY, CAROLYN BROADHURST, LARRY JOE Class of '64 BOSLEY, GARRETT LEE QBILLE. . . Key Club, Home Room President and Vice-President, Sophomore asketball, National Honor Society . . . BOSLEY, GARLAND GLYNN QSKIPPERQ . . . Transfer fromMilford Mill High School, Baltimore, Maryland . . . BOSTIAN, RON E. . . . Senior Cabinet, Publications Staff, Runner-Up to Mr. Publicatiions . . . BOWEN, JO ANN . . . Los Gatos Espanoles,SophomoreTalent Assembly, Future Homemakers, Pep Cats, Usher for Vesper Service, Girls' Recrea- tion Association . . . BOWMAN, DARRELL LEE. . . BOYLES, RICHARD ALAN. . . Tennis Team . . . CAROLYN BRISBY. . . Home Room Secretary, Senior Choir, Pep Cats, Ensemble Alternate . . . BROADHURST, LARRY JOE . . . Home Room Vice-President and Re- porter . . . BROWN, CINDY . , . Senior Girls' Ensemble, Senior Choir, Le Cercel Francais, Y-Teens, Future Business Leaders, Wildcat Follies Cast . . . BROWN, DIANE . . . Pep Cats, Junior and Senior Girls' Chorus, Art Club, Future Homemakers, Co-Chairman for Senior Break- fast Backdrop . . . T Q' BROWN, CINDY BROWN, DIANE -Q55 L, nf ': In V ia. - ts - AK :ep , , ig 135 136 BROWN, MARIALICE BROWN, PATTY BROWN, SANDI - ,, .C I 5121 ' -- ' fel! V : . A 3 5 Nagy' WM , p ,, I, '1Tl'.'lfT"" Wigwl. f MAL Y at f' Qfffziiffilifflfl ' f , , fifffffffgfffzf .f 5 I J --iffsfyff 2 ' 65? 55' -'f 15i'f!f'fLf7f' 'ff if ll, ,, sf!,,i1','H N x If X' Yr, iry W, A fO OO Y BUR RIS, BETTY ss' All Class of '64 BROWN, MARIALICE . . . Student Council, Thespians, Wildcat Follies Cast, Arkansas State Ballet Company, Transfer from Bossier High School,- Bossier City, Louisiana . . . BROWN, PATTY . . .Senior Cabinet, Senior Class, Youth Center Board, Senior Choir Historian, Girls' Chorus Vice-President, Home Room Treasurer, Quo Vadis, Quill and Scroll, Usher for Commencement . . . BROWN, SANDI . . . Red Cross Representative, National Honor Society, Home Room Secretary and Treasurer, Bookworms, Los Gatos Espanoles, Future Business Leaders, Pep Cats, Y-Teens . . . BUICE, ANN . . Future Nurses,PepCats . . . BURNETT, LINDA . . . Future Business Leaders, Junior Girls' Chorus, Musical Varieties Cast, Senior Girls' Chorus, Career Girls Club, Y-Teens, Pep Cats . . . BURNS, GARDNER . . . BURRIS, BETTY . . . Publications Staff, Quill and Scroll . . . BUTLER, VIC . . . Key Club Vice-President, Student Council, Wildcat Follies Cast, Quo Vadis, Tri Chem . . . BYRD, PAUL D .... Publi- cations Staff . . . BYRD, TERRY JO . . . Quill and Scroll, Literary Editor for 1964 Wildcat, Exchange Editor for Hi Comet, Le Cercle Francais, Los Gatos Espanoles, First Place NLRHS American Legion Contest, Thespians, Wildcat Follies Cast, Color Day Assembly, Y-Teens, Pep Cats, Catettes, Girls' Recreation Association, Monitor . . . BUICE, ANN BURNETT, LINDA BURNS, GARDNER -4101 BUTLER, VIC BYRD, PAUL D. BYRD, TERRY JO I ii CAGLE, JOHN CAMPBELL, KATHY CAMPBELL, RITCHIE CAPLE, PAMELA mf' WX Y CARLLEY, SANDRA CARROLL, LARRY CARROLL, NINA CARSON, JACKIE Class of '64 JOHN CAGLE . . . Tri Chem, Los Gatos Espanoles . . . CAMPBELL, KATHY . . . Y-Teens, Thespians, Pep Capts, Future Homemakers, Fu- ture Business Leaders, Future Teachers, Junior Girls' Chorus, Publi- cations Staff, Quill and Scroll . . . CAMPBELL, RITCI-IIE . . . Tennis Team, Letterman's Club, Wildcat Radio Announcer, Thespians Program Chairman, Rack 'n Sack President, Wildcat Follies Cast, Art Club, Color Day Master of Ceremonies, Red Cross . . . CAPEL, PAMELA . . . Tri Chem, Theta Science, Quo Vadis, All State Choir, Senior Choir, Senior Girls' Ensemble, Musical Varieties Cast, Wildcat Follies Cast . . . CARLEY, SANDRA . . . CARROLL, LARRY . . . Home Room President, Football Letterman, Junior Mr. NLRHS, Senior Cabinet, Transfer From Sheridan High School . . . CARROLL, NINA. . .CARSON, JACKIE . . . Future Teachers,PepCats, Y-Teens, Thespians . . . CARSON, SHARON KAY . PepCats,Future Homemakers, Y-Teens . . . CARTER, JIMMY NEAL . . . CARSON, SHARON KAY CARTER, JIMMY NEAL vt L is s 4 137 138 ,I -nv cARv13R, TERRY 1 CASTLEBERRY, CHARLOTTE Class of '64 CARVER, TERRY . . . CASTLEBERRY, CHARLOTTE . . . Future Nurses, Pep Cats, Girls' Recreation Association, Junior Girls' Chorus . . . CATHEY, MARTHA . . . Los Gatos Espanoles Song Leader,Trans- fer from Benton High School . . . CHANDLER, BARBARA . . . Future Business Leaders, Transfer from Texas Senior High School, Texarkana CHANDLER, SALLY ANN . . . National Honor Society Vice-President, Delegate to Honor Society Convention, Forensic League Treasurer, Stu- dent Council, Tri Chem, Theta Science, Thespians, Future Teachers, Pep Cats, Y-Teens, Wildcat Follies Committee Chairman, Quo Vadis, Delegate to State March of Dimes Teens Meeting . . . CHAPMAN, KATHLEEN . . . Publications Staff Bookkeeper, Staff Writer, Quill and Scroll . . . CATHEY, MARTHA CHANDLER, BARBARA CHANDLER, SALLY CHAPMAN, KATHLEEN 'QF' ., was ,, - ' :fsixii f . ZA . . f R 1451259532 Anxious Seniors wait in long line to receive their rings, a T -- most prized possession. 33 Q J rf, E ,,,,,., A pn fc- 0 ,,,uuv"' CHAPMAN, KERREN CHASTAIN, CIIERYL CHRISP, ED 32" fi CLARK, LINDA CLEEK, MARY MARGARET CLEMENTS, SUZANNE Class of '64 CHAPMAN, KERREN . . . National Honor Society, Tri Chem, Le Cercle Francais . . . CHASTAIN, CHERYL . . . Quill and Scroll, Hi Comet Feature Editor, State High School Press Award for Feature Writing, Red Cross, Junior Girls' Chorus Reporter, Art Club, Future Nurses, Candy- striper, Delegate to State Press Convention . . . CHRISP, ED . . . CHRUCHMAN, RAY . . . CLAIBORNE, CHARLES HENRY . . . National Honor Society, Key Club, Tri Chem . . . CLARK, LINDA . . . Future Business Leaders, Book- worms . . . CLEEK, MARY MARGARET . . . Pep Cats, Senior Girls' Chorus Reporter, Hi Comet Staff Writer, Junior Choir, Senior Girls' Chorus,MusicalVarietiesCast . . . CLEMENTS, SUZANNE . . . Senior Cabinet, Catette Leader, Pep Cats, Los Gatos Espanoles, Y-Teens . . . CLIFTON, GAIL . . . Art Club, Le Cercle Francais,MarchingBand . . . COBB, JAN . . . Catettes, Pep Cats, Key Club Sweetheart Runner-Up, Home Room Secretary, Thespians, Future Business Leaders, Y-Teens, Quill and Scroll, Senior Play Cast, Publications Staff, Junior Girls' Chorus, Senior Girls' Chorus, Monitor, Musical Varieties Cast . . . , ":z,"' -, R 'A 1 4 'ffif , ...Q --11 ll: G fi' -at 5 CIIURCHMAN, R ' , " " VSZEZVSKIW M . 1".:E255?" ' AY ' . , I fi1f11f-wfass ' ,,.,- me M T I vii, J, ' 2- iff f,,, " ' 122 fm xlsia at- 11 4,165 ,W S , LIB? .1 if Q-. flags , f SIAM ,, 1, 51 F S. 'Rigas 3 y 'f X N 522, VJ: s a X 4 3' X 335: Q: iii I W rr,. ,.,. 3, . . . ,. ,- ..,,i-.,,, if :,- + if-W ,l if tl Y .Q , ,I A f K, CLIFTON, GAIL CLAIBORNE, CHARLES HENRY ' 'SE' Ji "25F'?Q5EY'iv?r31S'N9l A5'V51Wi?ii"2k Ai' " I . if-as liqifd " A4 24611-I -' K J , ,. '- if 11574 ' . in TJ I ,,......-.. m i COBB, JAN . szgaswfwwi .zfriw may-S2 f' 139 Class of '64 COLE, BETH . . . Senior Choir, Junior Choir, Glee Club, Future Busi- ness Leaders, Film Crew, Ensemble Alternate . . . COLE, JEANNE . . . Glee Club President, Y-Teens, Pep Cats, Future Business Leaders . . . COLEMAN, MARGUERITE LYNN . . . Red Cross Representative, Pep Cats, Future Teachers, Future Business Leaders, Career Club . . . COLLINS, COOPER . . . Publications Staff . . . COMFORD, CURT . . . CONRAD, KAREN SUE . . . Le Cercle Francais . . . CONWAY, HERB . . . Quo Vadis, Theta Science, Hi-Y, Tri Chem . . . ' COOK, BRUCE . . . Student Body President,OutstandingFootballLeader- Com, BETH ship and Example Trophy, Lettermen's Club, Harvard Book Award, National Honor Society, Key Club Board Member, Youth Center Chaplain, Boys' State, Junior Rotarian, Friendliest Junior Boy, Head Usher for Vesper Service and Commencement,Hi-Y . . . COOK, CATHERINE . . . COOK, SHARON J. 1 . . Transfer from Jacksonville High School . . . CoL1f, JEANNE COLEMAN, MARGUERITE LYNN COLLINS, Coomfu COMFORD, CURT CONRAD, KAREN sun CONWAY, HERB COOK, BRUCE COOK, CATHERINE COOK, SHARON J. is 3 ,ST 140 1-f A adl"""" CORPIER, MARY LOUISE COULTER, MARILYN COURTNEY, PAT JH A ffl ' Qi. 1 ! I ,, 5 -3 fl COX, GENE CRAIG, ANN CRAIG, MARJORIE LOUELLA Class of '64 CORPIER, MARY LOUISE . . .Marching Band, Future Business Leaders . . . COULTER, MARILYN . . . Publications Staff, Futureliomemakers, Concert Band,MarchingBand,Pep Band,QuillandScroll . . . COURTNEY, PAT . . . Junior Girls' Chorus, Senior Girls' Chorus, Future Nurses COX, CRYSTAL . . . Senior Cabinet, Home Room Secretary, Pep Cats, Y-Teens, Girls' Recreation Association, Quo Vadis . . . COX, GENE . . . Track, Publications Staff . . . CRAIG, ANN. . . Los Gatos Espanoles . . . CRAIG, MARJORIE LOUELLA . . . Pep Cats, Y-Teens, Los Gatos Espanoles, Future Business Leaders, Girls' Recreation Associ- ation, Career Club . . . CRAIG, WALTER, JR .... Los Gatos Espanoles, Hi-Y, Theta Science, Concert and Marching Bands, Student Director for Band, Tennis, Letter- men's Club, All-State Band, Home Room Vice-President . . . CRAIN, WANDA . . . Future Homemakers, Senior Girls' Chorus . . . CRANFORD, GLENDA E. . Bookworms . . . if--' Y, ,rs 'I 2 ':-- ',' .J ..,r fir -4+ K ,, , I COX, CRYSTAL CRAIG, WALTER CHAIN, WANDA CRANFORD, GLENDA E. 141 142 .- '. 'Y 146 , - Q L,.. 'SJ -q.-M ,ws f. CREWS, JACK DAN , wen, 11, CULPEPPER, BOB DANIEL, STEVE DEISCH, PETER .X-Q Class of '64 CREWS, JACK DAN . . . Boys' State, Youth Center Cabinet, Key Club, Senior Cabinet, Tri Chem, Hi-Y Vice-President, Usher for Vesper Service and Commencement, Lettermen's Club, Tennis . . . CULPEPPER, BOB . . . DANIEL, STEVE . . . Football, All Big Ten, Most Tackles Trophy, Captain Wildcat Team, Student Council, Hi-Y, Red Cross Representative, Head Usher for Vesper Service and Commencement, Boys' State Alternate, Alternate Junior Rotarian . . . DAVIS, BARBARA . . . Senior Choir, Senior Girls' Ensemble, Los Gatos Espanoles, Junior Choir, Sophomore Glee Club, Y-Teens, Pep Cats, Wildcats Follies Cast, Musical Varieties Cast, Future Business Leaders .. . DAVIS, GEORGE A .... Publications Staff . . . DAVIS, JONATHAN S .... National Merit Semi-Finalists, National Honor Society, Track, Key Club, Los Gatos Espanoles, Theta Science Club . . . DEISCH. PETER. . . DERRICK, WOODY . . . Future Business Leaders . . . DEVORE, DIANNE CAROL . . . Musical Varieties Cast, Senior Choir, Thespians, Los Gatos Espanoles, Junior Girls' Chorus, Sophomore Glee Club, Y-Teens, Home Room President, Publications Staff, Quill and Scroll . . . DIFFEE, CHARLES EDDIE . . . Track . . DAVIS, BARBARA DAVIS. GEORGE A. DAVIS, JONATHAN S. ,IJ C A " att aft Jrt, Q as DERRICK, WOODY DEVORE, DIANNE CAROL DIFFEE, CHARLES EDDIE ,4 S'd if 45- ,R DIV Ll .Y , LIN DA Vice-president Mike Rhodes crowns Wildcat Queen Janice Measeles as escorts Terry Mercing and Steve Goss look on. Treasurer Tap Pritchard prepares to crown Wampus Cat Queen Ann Splawn. rt-s,. DONHAM, JO LYNN Class of '64 DIVELY, LINDA . . . Y-Teens, Transfer from Indianapolis,lndiana . . . DOBBS, JOHN . . . Football, KeyClub,Letterman'sClub . . . DONHAM, JO LYNN.. .PepCats . . . DORNBLASER, BOBBY . . . Football, Lettermen's Club . . . DOUGLAS, FRANK C .... DOWNING, BECKY . . . Pep Cats, Red Cross Representative, Junior Choir, Senior Choir . . . Q ,, M y mi kt gf """--Q-5 . DOBBS, Jouu DORNBLASER, BOBBY DOUGLAS, FRANK C. "5"'1,H"' ws Q .4-.--H" , Vffgf DOWNING B ECKY 1 sl ,ffl it 143 DuBOSE, MARY ELLEN 2 K I -,-- ,',. els' 1, , I , ,V nf--.,f,.,1't - 4 971 - fa il? - 'P , hlffif fli as . DUCKWORTH, NANCY DUNN, JIMMY ELIAS, EVE EMBERTON, .IANIS DEE -Haw 3 -." I if 'if',z2Q ' V I .253 , I " f Vg 5. ' t "I ., -T ',.L , C ' ' , A .1 gg - 9' . ' ta- A "ff I !44 Class of '64 DUBOSE, MARY ELLEN . . . Future Homemakers, Pep Cats, Junior Choir, Future Business Leaders,SeniorGirls'Chorus . . . DUCKWORTH, NANCY . . . Future Business Leaders President . . . DUNN, JIMMY . . . EARNHART, BECKY . . . Future Homemakers . . . EDDLEMAN, WILLIAM W .... Theta Science Club Librarian, Rocket Club . . . EDWARDS, JUDY CAROL . . . Los Gatos Espanoles, Future Business Leaders . . . ELIAS, EVE . . . Cheerleader, Catettes, Y-Teens, Senior Cabinet, Le Cercle Francais, Pep Cats, National Honor Society, Quill and Scroll . . . EMBERTON, JANIS DEE . . . Quill and Scroll, Publications News Editor, Concert and Marching Bands, Band Librarian, Le Cercle Francais Treasurer, Y-Teens, Home Room Reporter, Pep Band . . . ENGELS, PAT . . . Los Gatos Espanoles, Future Homemakers,Transfer from Jacksonville High School . . . ENGLISH, MARY . . . Concert and Marching Bands, Home Room Secretary-Treasurer, Band Head Librarian, Future Teachers, Thespians, Quo Vadis, Student Council, National Honor Society, Y-Teens, Tri Chem, All-State First Band . . . EARNHART, BECKY ILDDLEMAN, WILLIAM W. EDWARDS, JUDY CAROL .Rt 0 ENGELS, PAT ENGLISH, MARY V, ,UQ was mmf? 1 'I Af rw f f v, pw "W, , -wwf fl"""' A 5 Q, ,ist ,...-, 3 1,5-an.. EPPERSON, BUlxI. liSCl-I, BARBARA CLAIR ESCH, PHILLIP EVANS, GEORGE EVANS, SHARON DELOIS EVERHART, DICK EVERS, LINDA Class of '64 EPPERSON, BUEL . . . Publications Staff . . . ESCH, BARBARA CLAIR . . . Student Body Secretary, Catettes, Pep Cats, National Honor Society, Y-Teen Committee Chairman, Delegate to Y-Teen Mid-Winter Conference, Quo Vadis Treasurer, Secretary for Big 9 Sportsmanship Conference, Senior Choir Secretary, Girls' State, Wildcat Follies Chair- man, Musical Varieties Cast, Sophomore Talent Assembly . . . ESCH, PHILLIP . . . Editor of 1964 Wildcat, National Honor Society, Head Manager for Football, Basketball, and Track . . . Key Club, Senior Cabinet, Student Council, Boys' State, Lettermen's Club, Quill and Scroll Vice-President, Monitor, Hi-Y, Quo Vadis, Delegate to State Press Conference, Delegate to Yearbook Workshop, Member of Youth Council on Fire Prevention . . . EVANS, GEORGE . . . EVANS, SHARON DELOIS . . . Future Homemakers, Pep Cats,Y-Teens, Film Crew, Usher for Vesper Service, Usher for Commencement . . . EVERHART, DICK . . . Boys' State, Key Club Senior Board Chairman, Junior Rotarian, Senior Cabinet, Los Gatos Espanoles, President of Pulaski County Hi-Y, National Honor Society . . . EVERS, LINDA . . . Junior Girls' Chorus, Vesper Service Choir Group . . . FELTON, MIKE . . . FERGUSON, PATRICIA ANN . . . Senior Cabinet, Future Business Leaders, Future Homemakers, Monitor, Junior Choir, Senior Girls' Chorus . . . FIELDING, JACK . . . FELTON, MIKE FERGUSON, PATRICIA ANN Vin 5 FIELDING, JACK 1 , ,I An ,M x A 'F 3 QQ.. Q fig. C ,,,. ,I 'QM . 145 ,w w w .A -' , 2' Class of '64 f-if :fast Pi" ' , t -sa ,Nga A w q V 3,2 1 ,fi 'TZQ Q fklf 53535-- K WE? Y ,if ii ffifffllff' 4 FIFI DING, PAULA FINCH, GLORIA FINLAYSON, BARBARA FIELDING, PAULA J .... Future Homemakers Vice-President, Art Club Secretary, Pep Cats, Y-Teens, Girls' Recreation Association, Quo Vadis, Monitor, Musical Varieties Cast, Junior Girls' Chorus, Sophomore Glee Club, National Honor Society . . . FINCH, GLORIA . . . Catettes, Pep Cats, Future Business Leaders, Girls' Recreation Association . . . FINLAYSON, BARBARA . . . Concert and Marching Bands,VarsityBand, Band Librarian, Future Nurses, Future Teachers, Quo Vadis . . . FINLEY, TOMMY. . . FISHBACK, JANE . . . Varsity Band, Film Crew, Future Nurses, Y-Teens, Quo Vadis . . . FLOWERS, RICHARD . . . FORTNER, JEANNE . . . Future Business Leaders, Los Gatos Espanoles, Pep Cats, Home Room Treasurer, National Honor Society . . . FOSTER, JUDY . Future Business Leaders, Bookworms, .Pep Cats, Red Cross Representatives, Future Homemakers . . . FRANCE, JON . . . Student Council, Fransfer from Swanee Military Academy . . . FRENCH, DON . . . Senior Quartet, Senior Choir, All-State Chor, Boys' Chorus, Wildcat Band, Hi-Y . . . FINLEY, TOMMY FISHBACK, JANE FLOWERS, RICHARD . ' 1 J i, 'I - Y t , - its Egg if: -Y ' , :ef RWE .: 5552 " , U -' ' g g Z ,Q t FRENCH, DoN FORTNER, JEANNE FOSTER, JUDY FRANCE, JON 146 ,wi 'ai is ia my QV' w K Ui 'T-fff15i5fI'WL'?Z5o' ,.:.q: " ff ,. 'iii . 1 T 'sa Q 'A ai , 1 " L-5:1 ' was R L-L, na ,iii am rwtw Qfff 5F?T,f?7f5f3Q5? - I -fx wfzzfa -fl fm,'.1ff'Y-4 FVJWP wwwvwdmmwwfw 5 , , J . f:53Lbii'?5 I . 1 W mm aaf if A A ,Sig QM' J iii? 1 s ft S. F HMM? , . Q3 l . dill? 5 fi, H- wtf, .QM 'A N . f FROST, SUSAN FUGATT, JUDI fl E9 GALT, CHRISTIE GARDNER, JERRY DEAN GARRETT, JEANIE CHARLENE Class of '64 SUSAN FROST . . . National Honor Society, Catettes, Pep Cats, Student Council, Forensic League, Thespians, Senior Choir, All-State Choir, Y-Teens, Los.Gatos Espanoles, Usher for Vesper Service, Art Club, Wildcat Follies Cast . . . FUGATT, JUDI . . . Pep Cats, Y-Teens, Art Club . . . FULMER, BETTY . . . Girls' Recreation Association, Future Business Leaders, Red Cross Representative . . . GACHOT, CAROLYN . . . Student Council, Future Business Leaders, Y- Teens, Future Homemakers . . . GALT, CHRISTIE . . . Y-Teens, Pep Cats, Future Homemakers, Future Business Leaders, Home Room Secre- tary-Treasurer, Junior Choir, Monitor . . . GARDNER, JERRY DEAN . . . Transfer from Clarksville High School . . . GARRETT, JEANIE CHARLENE . . . Pep Cats, Y-Teens,LosGatos Espanoles,Girls'Recrea- tion Association, Alternate Red Cross Representative, Future Business Leaders, Junior Choir, Senior Girls' Chorus, Quill and Scroll . . . GASAWAY, PHYLLIS . . . National Honor Society, Future Teachers, Red Cross Representative, Los Gatos Espanoles, Art Club.. . GIBBS, MARCIA LEE . . . Tri Chem,ConcertandMarchingBand,BandHistorian, Pep Cats, Le Cercle Francais, Y-Teens, Girls' Recreation Association, Red Cross Representative, Los Gatos Espanoles, Sophomore Talent Assembly . . . GIBSON, TERRY ALAN . . . FULMER, BETTY GACHOT, CAROLYN GASAWAY, Pl-IYLLIS GIBBS, MARCIA LEE fbi: GIBSON, TERRY ALAN 'WF' 147 GILLEN, JUDY GAYLE 'x 148 GLAZE, JOHNNY C-LOVER, BETTY GLOVER, LARRY fw- GLOVER, MARTHA SUE GLOVER, THERESA A, Class of '64 GILLEN, JUDY GAYLE . . . Tranfer from Emerson High School . . . GLAZE, JOHNNY . . . National Honor Society, Key Club, Wildcat Band, Theta Science Club, Tri Chem . . . GLOVER, BETTY . . . Girls' Recreation Association, Pep Cats, Quill and Scroll . . GLOVER, LARRY . . . GLOVER, MARTHA SUE . . . Y-Teens, Home Room Secretary . . . GLOVER, THERESA A. . . Pep Cats, Y-Teens, Le Cercle Francais, Future Business Leaders . . Some of the memories on Wildcat Hill will be sad ones as this flag portrays the untimely death of our beloved President John F, Kennedy. A iii-- '--Q-...,,..We lvl aa, ra.. ll- svn- li 4... -.. F E , I' ll ,in ,ll ll i 7 GLYNN, JO ANN GORDON, ROSALYN GOSS, STEVE GOTI-IERMAN, JIMMY GOUGH, SUSIE GRAHAM, ALAN Class of '64 GLYNN, JO ANN . . . GORDON, ROSALYN . . . GOSS, STEVE . . . Home Room President, Student Council, Senior Cabinet, Quill and Scroll, Publications Staff, Home Room Treasurer . . . GOSVENER, BILLY . . . GOTHERMAN, JIMMY . . . GOUGH, SUSIE . . . Editor of 1964 Wildcat, Cheerleader, Senior Cabinet, Publications Staff, Quill and Scroll Secretary, National Honor Society, Le Cercle Francais, Pep Cats, Y-Teens, Delegate to State Press Conference, Home Room Officer, Senior Breakfast Committee Chairman . . . GRAHAM, ALAN . . . Theta Science Club, Tri Chem, Transfer from Hall High School . . . GRANDON, CHERYL . . . Girls' Recreation As- sociation, Future Business Leaders . . . GREEN, ORVAL DAVID . . . GREEN, PATSY ANN . . . Future Business Leaders, Future Business Leaders . . . , 35 'Parks U GOSVENER, BILLY, -,g:aa,g:4:,,- - afszsaiu . I a s,.s.s,f1:,.gz,f,,gf,fl,', wi:ipf,gg1:ks,,,255g,,,,, ' -:' 5253175 - O JM ., .W 15-'5f?:S5E5"'r A' NS, . -:zI5jg5s5ng95iu?5?Lisi,i'5g7 f ' .. . 'H f2s5s5.si2iQ??t3?f,f'f:f2-g ' , if f. : ' '.e,. ' W 11,g2g5g3L,5:,: ,19zz!s1'e1:fsQujif,,f 'M A " , 5, r. 1j,:,,m, as "it ,..,- A' Q ,ic 'H l , if ,, ,fe wa' at ' I ' Q14 f f, , , :T .1 1. EI. .-'im I L . , ,ig - . fsilz kibz 5552 eiigiiifipil:-. - i:iif':fsi"ii::f -5?-f'3-ff,-jizl A ' fi- 5 rf: 111 fggggs 1 -- 17. .. ,.-1,fft,m,,.1Q- n is -' 'Ill , 'S "',iTs?i?zl 2, A Q GRANDON, Cl-IERYL GREEN, ORVAL DAVID , ,Ft iifvvfv Vx 1 ' Sq f A I . - .2 ?' f K I ivy, V A s tits, k if S, at its S f- Lpit' ,1 X - - 253' Q, , I K .A f , ,, Eta- -1, . . I 54225 5 f- A GREEN, PATSY ANN 149 150 GREEN, TERRY G. GRIGGERS, SAUNDRA GRIMM, BILL HAAG, JOHN Class of '64 GREEN, TERRY G .... Future Teachers, Football, Transfer from DeWitt High School . . . GRIGGERS, SAUNDRA . . . Student Council Corresponding Secretary, Key Club Royalty, Catettes, Pep Cats, Y-Teens, Los Gatos Espanoles . . . GRIMM, BILL.. . GROCE, PAUL DOUGLAS . . . Student Council, Track, Home Room Officer . . . GUSTUS, J. D .... Track, Football, Art Club . . . GUTHRIE, PEGGY ANN . . . Future Homemakers, Sophomore Glee Club, Junior Choir, Senior Girls' Chorus, Red Cross Representative . . . HAAG, JOHN . . . HAGEY, MURIEL . . . National Merit Semi-Finalist, Delegate to Girls' State, National Honor Society, Red Cross Representative, Student Council, Tri Chem Secretary, Quo Vadis Secretary, Pep Cats, Future Business Leaders, Monitor, Homeroom Secretary-Treasurer . . . HALES, BARBARA . . . HALL, BARBARA . . . Quo Vadis Vice-Presi- dent, Tri Chem, Le Cercle Francais, Wildcat Band, National Honor Society, Transfer from Chapel Hill High School,Chapel Hill, North Carolina GROCE, PAUL DOUGLAS GUSTUS, J,D, GUTHRIL, PEGGY ANN 'wi lfi3 'O HAGEY, MURIEI, HALES, BARBARA HALL, BARBARA -ut V f we ' HALLIBURTON, JIMMY HALLIGAN, RONNIE C. HAMILTON, JUDY HAMMONS, DIANE HARPER, TOMMY HARRIS, ALICIA HARRISON, EVA Class of '64 HALLIBURTON, JIMMY . . . HALLIGAN, RONNIE C .... HAMILTON, JUDY . . . Pep Cats, Le Cercle Francais, Girls' Recreation Association, Y-Teens, Future Business Leaders, Quill and Scroll . . . HAMMONS, DIANE . . . Le Cercle Francais, Pep Cats, Future Homemakers . . . HARPCER, TOMMY . . . Future Tradesmen of America, Art Club Vice- Presi ent . . . HARRIS, ALICIA . . . Senior Cabinet, Key Club Royalty, Future Business Leaders, Y-Teens, Girls' Recreation Association, Quill and Scroll, Pep Cats . . . HARRISON, EVA . . . Future Homemakers Vice-President, Quo Vadis . . . HARRISON, KAY ELLEN . . . Concert and Marching Bands, Pep Band, Future Business Leaders Historian, Quo Vadis, Theta Science Club, Na- tional Honor Society, HomeRoomSecretary . . . HARRISON, TONY MAX . . . HARRISON, VICTORIA LEIGH . . . Catettes, Pep Cats, Red Cross HARRISON, KAY ELLEN HARRISON, TONY MAX HARRISON, VICTORIA LEICH Representative, Usher for Vesper Service and Commencement, Y-Teens A -EA I E A t 1' A ' iri -A I f Q t ,iyt Q + ' 151 152 fa " 145 3. , as 43' . 3 , f t iw -265' rn, J HARVILL, DELORES LYNN wi' HATCHETT, LIN DA HAYES, PEGGY KQV HEAD, HERBERT HEFFINGTON, SANDRA LEE Class of '64 HARVILL, DOLORES LYNN . . . Pep Cats,Girls'RecreationAssociation, Future Homemakersg Future Business Leaders, Y-Teens . . . HATCHETT, LINDA. . . HAYES, PEGGY. . , Transfer from San Angelo Central High . . . HAYNES, GARY. . . HAYS, EMMETT L .... HEAD, CHARMA . . . Cheerleader, Pep Cats, Catettes, Student Council, Y-Teens Vice-President, Delegate to Y-Teen Mid-Winter and State Conferences, Youth Center Cabinet, Los Gatos Espanoles, Quill and Scroll . . . HEAD, HERBERT . . . Football, Future Tradesmen, Track, Lettermen's Club . . . HEFFINGTON, SANDRA LEE . . . HENDERSON, BRYAN . . . Football and Track, Lettermen's Club, School High Jump Record Holder . . . HENDERSON, JIMMIE CAROLYN . . . Future Homemakers, Pep Cats, Future Nurses, Los Gatos Espanoles . . . HAYNES, GARY HAYS, EMMETT L. HEAD, CHARMA HENDERSON, BRYAN HENDERSON, JIMMIE CAROLYN - ,kfLir gj,',,, . 'Vg ' " L is S . rw -1 -wg Y ' ,J .gf A - 1 f -I ,Q pf,-, 4 ,IA Q .WF HERROD, MARY The Mighty Seniors indulge in the Thanksgiving Senior Breakfast. Class of I964 HENDERSON, DAWNEE . . . Le Cercle Francais, Future Homemakers, Pep Cats, Girls' Recreation Association. . . HERRINGTON, DAVID . . . Student Council, Key Club, Los Gatos Espanoles, Home Room Vice- President, Forensic League Vice-President, Hi-Y Vice-President, Na- tional Honor Society, Tri Chem, Theta Science Club, Wildcat Follies Cast, Thespians, Boys' State, Usher for Commencement . . . HERROD, MARY . . . Y-Teens, Future Business Leaders Reporter, Fu- ture Homemakers, Monitor, Pep Cats, Publications Staff, Quill and Scroll, NOMA Spelling Test Award . . . HICKS, CINDY . . . National Honor Society Bulletin Board Chairman, Monitor, Senior Choir, Quo Vadis, Pep Cats, Los Gatos Espanoles, Home Room Treasurer, Y-Teens, Girls' Recreation Association, Tri Chem . . . HICKS, RONNIE . . . Student Council, Key Club, Tri Chem, Home Room President and Vice-Presi- dent, Basketball, Golf, National Honor Society . . . HICKS, OLIVIA . . . Delegate to Girls' State, National Honor Society-Bulletin Board Com- mittee, Office Monitor, Senior Choir, Quo Vadis-Treasurer, Pep Club, Spanish Club, Homeroom-Treasurer, Y-Teens, G.R.A.'s, Tri Chem . . . HENDERSON, DAWNEE IIERRINGTON, DAVID HICKS, CINDY HICKS, OLIVIA HICKS, RONNIE 153 154 I I I HIGGINS, CINDY 'WK' HIGGINS, LEROY HIGHAM, PAT HILLIARD, BOBBY HILLMAN, JERRY M. Class of '64 HIGGINS, CINDY . . ., Pep Cats . . . HIGGINS, LEROY . . . HIGHAM, PAT . . . Senior Cabinet, Pep Cats, Quo Vadis, Art Club, Y-Teens . . . HIGHFILL, MIKE . . . Senior Cabinet,MarchingBand,Concert Band . . . HILL, DAVID . . . HILL, JIMMY . . . Student Council, National Honor Society, Key Club, Quo Vadis President, Tri Chem, Theta Science, Hi-Y, Home Room Vice- President and President . . . HILLIARD, BOBBY . . . Thespians, Los Gatos Espanoles, Publications Staff, Usher for Vesper Service and Commencement . . . HILLMAN, JERRY M .... HILLMAN, RICHARD... HOBBY, LINDA K .... Pep Cats, Red Cross Representative, Future Homemakers, Quo Vadis, Future Nurses . . . HIGHFILL, MIKE HILL, DAVID HILL, JIMMY .1 sw -Te I 4 QI up HILLMAN, RICHARD LEROY HOBBY, LINDA 'N , A,V: A p f in ? R' HOLDEN, SANDRA HOLLOWAY, BUDDY HOWARD, ANITA ' A D Di f 2. E T: 3 r,2'i'flfE ff K gg J ' 1,2 HUBBARD, JON HUFFMAN, JUDITH ANN HUGGINS, CONNIE R Class of '64 HOLDEN, SANDRA... Pep Cats, Future Homemakers . . . HOLLOWAY, BUDDY . . . Home Room Vice-President, Football,Letter- men's Club . . . HOWARD, ANITA . . .' HOWARD, JUDY . . . Pep Cats, Y-Teens, Quill and Scroll, Publications Staff, Girls' Recreation Association, Wildcat Advertising Manager, Le Cercel Francais, State High School Press Writing Award, Cast of "Night of January l6," Usher for Vesper Service and Commencement . . HUBBARD, JON . . . Home Room President, Football, Senior and Junior Choirs, Wildcat Follies Cast . . . HUFFMAN, JUDITH ANN . . . Senior Girls' Trio, Senior Choir, Senior Girls' Ensemble, Wildcat Follies Cast, Junior Girls' Chorus, All-State Choir, Y-Teens, Pep Cats, Future Busi- ness Leaders, Sophomore Talent Assembly . . . HUGGINS, CONNIE RAY ... HUNLEY, JANIS RUTH . . . Los Gatos Espanoles, Sophomore Glee Club, Future Nurses, Junior and Senior Choirs, Red Cross Representative, Musical Varieties Cast, Wildcat Follies Cast . . . IRONS, ANDREA . . . Y-Teens, Junior and Senior Girls' Chorus, Musical Varieties Cast . . ISBELL, TERRY . . . A Y HOWARD, JUDY -cn., HUNLEY, JANIS RUTH 1RoNs, ANDREA ISBELL, TERRY l J,xcKsoN, BARBARA JACKSON, JINGER JACKSON, JOHNNY f .,Q,1,,s-ffezefzk.fg-fi.,.hm asf-Mina ' T' f ' , f.1n1s3fls2fimv -I w-finqgfzi 'ii JOHNSON, CHARLES i1'l"'4' 156 JOHNSON, COR LISS ANN Class of '64 JACKSON, BARBARA . . . JACKSON, JINGER . . . Chapel Presi- dent, Student Council, National Honor Society, Girls' State Lieutenant Governor, Senior Girls' Trio, Senior Girls' Ensemble, Senior Choir Assistant Secretary, Y-Teens Publicity Chairman, Pep Cats, Catettes, Quo Vadis Secretary, Tri Chem Treasurer, Thespians, Future Nurses Vice-President, Wildcat Follies Cast, All-State Choir, Color Day Chair- man . . . JACKSON, JOHNNY . . .. National Honor Society, Wildcat Follies Cast, Home Room Vice-President, Thespians, Key Club, Junior Rotarian, Boys' State . . . JEFFERY, TOMMY . . . Concert and Marching Bands, Fu- ture Business Leaders . . . JENNINGS, TERRY . . . Red Cross Repre- sentative, Tennis, Theta Science Club, Key Club, Thespians, Youth Center Cabinet . . . JENKINS, GLORIA . . . Art Club, Publications Art Editor, Thespians, State High School Press Award for Advertising Design, Quill and Scroll, Second Award in City-Wide Art Show, Musical Varieties Cast, Delegate to State Press Convention, Home Room President, Vice-President, Secre- tary, and Treasurer, Los Gatos Espanoles, PepCats, Y-Teens, Sophomore Glee Club . . . JOHNSON, CHARLES . . . JOHNSON, CORLISS ANN . . . Senior Choir, Senior Girls' Ensemble, All-State Choir, Future Nurses, Los Gatos Espanoles, Future Homemakers, Junior Girls' Chorus, Red Cross Representative . . . JOHNSON,DALE , , , Home Room President, Senior Choir, Boys' Chorus, Future Business Leaders, Usher for Vesper Service . . . JOHNSON, HARRIET ANN . . . JEFFERY, TOMMY JENNINGS, TERRY JENKINS, GLORIA , fif?2QQi..1!7 ' ' ' ff "i'i:7f5S1ffl3Zh' JOHNSON, DALE JOHNSON, HARRIET ANN f -ex ?""?f1li i.- Q iatixatitliiriiva-ffifr is .W x QCA JOHNSON, JANICE JOHNSON, THEEESA JONES, BETTY OLIVIA JONES, CAROL an f pl, ., JONES, JANICE JONES, KATHIE JONES, LAWRENCE GENE JUAIRE, BARRY Class of '64 JOHNSON, JANICE . . . Los Gatos Espanoles, Future Homemakers, Senior and Junior Girls' Chorus, Musical Varieties Cast, Transfer from Hot Springs High School . . . JOHNSON, THERESA . . . Transfer from Mount St. Mary s Academy . . . JONES, BETTY OLIVIA . . . Future Business Leaders, Monitor . . . JONES, CAROL . . . Red CrossRepresentative,PepCats,Y-Teens,Home Room Secretary . . . JONES, JANICE . . . Future Teachers Historian, Home Room Treasurer, Red Cross Representative, Bookworms, Pep Cats, Los Gatos Espanoles . . . JONES, KATHI . . . National HonorSociety,NationalMerit Semi-Finalist, Marching Band, Varsity Band, Tri Chem, Theta Science, Future Teachers, Le Cercle Francais, Monitor, Transfer from Towson High School, Towson, Maryland . . . JONES, LAWRENCE GENE . . . Key Club, Con- cert and Marching Bands, Tri Chem, Quo Vadis, Pep Cats . . . JUAIRE BARRY PATRICK . . . Home Room Vice-President, Tri Chem . . . JUNKIN MARIE Senior Cabinet Student Council Red Cross Count , . . . , , y Council, Thespians, Forensic League, Pep Cats, Girls' Recreation As- sociation, Theta Science Club, Quo Vadis, Junior Choir Treasurer, Y- Teens, Home Room Vice-President, Usher for Vesper Service . . . KARALY, RITA DIANE . . . JUNKIN, MARIE KARALY, RITA DIANE il 71 Q, I 1,7 itlziii. ,ggi .ifftiixxziassffli I, Im,-, 21,2233 f,,,,fIw 157 I58 i fw , I Z WI' anna " , 'www .5 kEA1,Y, JERRY KEGLEY, LORETTA LOUISE KELLEY, RONNIE fri I 03 KETCHER, WILLIAM THOMAS Class of '64 KEALY, JERRY . . . Transfer from Nathan Hale High School, Tulsa, Oklahoma . . . KEGLEY, LORETTA LOUISE . . . Future Business Leaders, Monitor . . . KELLEY, RONALD . . . Future Tradesmen Vice-President . . . KERBY, LINDA . . . Pep Cats Vice-President, Catettes, StudentCouncil, Future Teachers, Y-Teens, Publications Staff, Quill and Scroll, Junior Girls' Chorus Treasurer, Girls' Recreation Association, Monitor, Los Gatos Espanoles, Youth Center Cabinet Board Member . . . KETCHER, WILLIAM THOMAS . . . Football and Track, Lettermen's Club, Student Council, All Big 10, Publications Staff, Usher for Vesper Services . . . KETZSCHER, GERALD . . . KERBY, LINDA Becky Reeves, Jack Crews, Ann Splawn, Phil Esch, and Jane Ann Munnerlyn gather in the hall to discuss the fabulous table decorations at the Senior Breakfast. if S KETZSCHE R, GERALD WFS tad' 547' KILE, PATSY s KUONEN, RICKY LaCROSSA, CAMILLE K. LAMAN, CHRISTY Class of '64 KILE, PATSY . . . Tri Chem, Pep Cats, Transfer from Arlington High School, Indianapolis,Indiana . . . KINCHEN, CHARLES . . . SeniorCab- inet, Home Room Vice-President . . . KIRSPEL, ROBERT . . . Concert and Marching Bands, Theta Science Club, Tri Chem, Quo Vadis, Publi- cations Staff . . . KROUSE, RICK . . . Tri Chem . . . KUONEN, RICKY . . . Red Cross President, Concert and Marching Bands, Band Quartermaster, Boys' Chorus, Hi-Y, Los Gatos Espanoles . . . LAGROSSA CAMILLE K. . . . Girls' Recreation Association President and Vice-President, Home Room Secretary and Treasurer, Future Teachers Parliamentarian, Monitor, Pep Cats, Quo Vadis, Y-Teens, Thespians, Youth'Center Cabinet Board Member . . . LAMAN, CHRISTY . . . Girls' State, Senior Choir, DAR Good Citizen- ship Award, Student Council, Future Teachers Vice-President, Pep Cats, Future Homemakers, Home Room Secretary, National Honor Society, Los Gatos Espanoles . . . LAMPTON, PAUL . . . LANDSMAN, DOROTHY . . . National Honor Society, Future Business Leaders, Tri Chem, Senior Cabinet, Los Gatos Espanoles, Concert and Marching Bands, Home Room Treasurer . . . LANE, EMMETT . . . KINCHEN, CHARLES KIRSPEL, ROBERT KROUSE, RICK K V IN : LAMPTON, PAUL LANDSMAN, DOROTHY ia LANE, EMMETT 159 W. LANIL, MIKE ,fav LANEER, ANNETTE LANGLEY, CAROLYN ANN LAVENDER, MURL JEAN 160 Class of '64 MIKE LANE . . . Track, Future Business Leaders, Art Club, Senior Prom Committee . . .LANEER, ANNETTE. . . National Honor Society, Bookworms Secretary-Treasurer, Girls' Recreation Association, Future Homemakers, Future Business Leaders, Monitor . . . LANGLEY, CAROLYN ANN . . . Future Nurses, Future Business Leaders, Musical Varieties Cast . . . LANGLEY, CLAUDETTE . . . Future Business Leaders, Future Home- makers, Girls' Recreation Association . . . LANKFORD, CASONDRA . . . Catettes, Pep Cats, Home Room Secretary, Senior and Junior Choir Reporter, Y-Teens, Future Nurses, Usher for Vesper Service . . . LASITER, MIKE . . . Home Room President, Senior Choir . . . LAVENDER, MURL JEAN . . . Girls' Recreation Association, Future Business Leaders, Senior Girls' Chorus, Monitor . . . LEDGERWOOD, I-IARLAN WAYNE . . . Home Room Vice-President, Los Gatos Espanoles . . . LEDRICK, DOUGLAS . . . LENON, WARREN E. . . . LANGLEY, CLAUDETTE LANKFORD, CASONDRA LASITER, MIKE 'ffl is ,il ciltstzt 'Xi i w 5 LEDGERWOOD, HARLAN WAYNE LEDRICK, DOUGLAS LENON, WARREN E. R ,.,,, Q Q W s..,M rw I, ,ffm 'P , . 5 4. fl I , .., LEOPARD, JEANNE LESLIE, LINDA LEWIS, BILLY V. .iw 2,5 M , ' . I W S - I ' -I V' i.",.I?-: ' ' 'ii ' . ,f.-3-1Y15'.,. pre Q' '- ' ., - ' -A a slwjizxy - V " A , , . M .R ' - 1 Q ifffsifqgiilj f .Jim QQ' , " 'fp ' W T Ylwf if-f 1 . 'E' as ig? i it ff f z,' 'I', ' - vxy 9 "L' I QI: F ' ..,A 2.41 ' ' 1' ""'lb' , ,.,.- j' I - ,,I,l5 V, , WEE: Ek, what if 6 t I I, I , , t""f tw. Mfl t"u"'3 mg LINZ, CLARENCE, JR. LITTLE, RADFORD LITTLE, JUDI Class of '64 LEGPARD, JEANNE . . . Pep Cats, Future Business Leaders, Y-Teens . . . LESLIE, LINDA . . . Los Gatos Espanoles, Girls' Recreation As- sociation, Pep Cats . . . LEWIS, BILLY . . . LINN, DIANE . . . Fu- ture Business Leaders, Pep Cats, Junior Choir, Senior Girls' Chorus Librarian . . . LINZ, CLARENCE, JR .... LITTLE, RADFORD . . . Publications Staff, Concert and Marching Bands, Boys' Chorus . . . LITTLE, .IUDI . . . Publications Staff, Concert and Marching Bands, Future Nurses, Red Cross Representative, Girls' Recreation Association, Future Home- makers . . . LIVELY, JEANNETTE . . . Future Business Leaders, Pep Cats, Future Nurses, Y-Teens . . . LOCHAMY, ROSEMARY . . . Senior Girls' Ensemble, Thespians . . . LOIBNER, STEVE ALLEN . . . Bausch-Lomb Science Award, Student Council Parliamentarian, Boys' State, National Honor Society, National Merit Semi-Finalists, Wildcat Follies Cast, Musical Varieties Cast, Football, Track, Lettermen's Club, Key Club, Quo Vadis, Tri Chem, Senior Choir Vice-President, Boys' Chorus, Usher for Vesper Service I .rw 5 fatgig , xt, .Q , .. , . . -ffQ1ll5i5:XM - I- -as-. , I , ,,,,., SWE? ,ml 'I it W .f .... 1 '51 ,A if y , 4 .-rw 1' 'X ' QQ, I' .J YK' i.1NN, DIANE Sf 'LW Q I msg? at 4-11- LIVELY, .IEANNETTE LOCHAMY, ROSEMARY LOIBNER, STEVE ,fuss lin' 161 162 Class of '64 LOVE, SARAH KAY . . . Future Homemakers, Girls Recreation As- sociation . . . LOVELL, KEN . . . National Honor Society, Key Club . . . LOWE, DANNY . . . LYNCH, JIM . . . National Honor Society, Hi Comet Editor, Boys' State, Junior Rotarian, Key Club Treasurer, Quill -av and Scroll President, Home Room President, Le Cercle Francais, Monitor Y LYNCH, JOE . . . National Honor Society, Marching Band, Key Club, Tri Chem, Home Room Vice-President, Senior Cabinet, Le Cercle Francais . . . LYONS, DALE BILLY . . . Football, Lettermen'sClub,HomeRoom Vice-President . . . UNE' SARAH K' MABRY, SANDRA JEAN . . . Drum Major for Marching Band, concert Band, Theta Science Club Recording and Corresponding Secretary, Na- tional Honor Society, Quo Vadis, Girls' Recreation Association, Y-Teens, ,y,y Red Cross County Council Representative, Thespians . . . MALONE, TOMMY. . . Football, Track, Tennis. . . MARLER, BRENDA EUGENIA . . . Future Homemakers, Future Business Leaders . . . MASON, DAVID . . . Publications Staff, Quill and Scroll . . . i i ' A ' ,ZR iraal LOVELL, KEN LOWE, DANNY LYNCH, JIM LYNCH, JOE LYONS, DALE BILLY fi 2 Q X 2 Xwf MABRY, SANDRA JEAN MALONE, TOMMY MARLER, BRENDA EUGENIA MASON, DAVID to A ,i,, I itas 2 ,R issii s , VY :L Zi g, -,-fx .. . ' W : P ,." I wb-. MASON, SONJA Senior Ritchie Campbell broadcasts another of the Wildcat football team's road trips. MAYER, ROBERT Class of '64 MASON, SONJA LORRAINE . . . Future Business Leaders, Future Nurses . . . MATTHEWS, JOHN CALVIS . . . Key Club, Boys' Chorus, Senior Choir, Head Drum Major Marching Band, Concert Band, Home Room Vice-President, National Honor Society . . . MAYER, ROBERT MAYHUGH, CAROL . . . MCALLISTER, GWEN . . . Future Home- makers, Future Business Leaders, Future Nurses, Candystriper . . . MCBRIDE, ROBERT . . . National Forensic League, Key Club, Thes- pians, Los Gatos Espanoles . . . . I 3 MATTHEWS, JOHN CALVIS MAYHUGH, cfxuot. MCALLISTER, GWLN MCBRIDE, ROBERT fC' mx 163 MCCLENDON, PAT "UV L f 'ri 164 MCCORD, TERRY Class of '64 MCCORD, TERRY . . . Art Club, Publications Staff, QuillandScroll . . . McCUlN, PHYLIS . . . Color Day Royalty, Home Room Reporter, Future Business Leaders, Future Homemakers, Pep Cats,Musical Varieties,Na- tional Honor Society . . . McKEE, VVANDA . . . Color DayRoyalty,Home Room Secretary, Future Business Leaders, Musical Varieties Cast, Pep Cats . . . MCKELLER, PHYLLIS . . . Girls' Recreation Association, Los Gatos Espanoles, Pep Cats, Future Homemakers . . . MCKIM, SAM . . . MCKINNY, DAN . . . Publications Staff, Theta Science Club, Transfer from Tampa, Florida . . . MCKOWN, PARSY GALE . . . NationalHonor Society, Student Council, Red Cross Representative, Quo Vadis, Theta Science Club, Tri Chem . . . MCLENDON, PAT . . . Future Nurses,FutureHomemakers,JuniorGirls' Chorus, Monitor . . . MCLENDON, DALE . . . MCMORRIS, BRENDA . . . Girls' Recreation Association . . . MCCUIN, PHYLIS MCKEE, WANDA. MCKELLER, PHYLLIS MCKIM, SAM 6' MLRINNY DNN MCKOWN PATSYGXLL MCLENDON DALE MLMORRIS BRENDA ,..,,, 1 U MW My ,RUF ,.,,g-slit!" MCRAVEN, BRENDA MCVEY, BILL MEADOR, RAYMOND LYNN MEANS, NOEL i"""""f MEASELILS, JANICIL CAROLE MEEKS, DONNA MERCING, TERRY Class of '64 MCRAVEN, BRENDA . . . Miss Publications, Hi Comet Assistant Ad- vertising Manager, Future Business Leaders Bulletin Board Committee Chairman, Home Room Reporter, Pep Cats, Quill and Scroll . . . MCVEY, BILL . . . Home Room President . . . MEADOR, RAYMOND LYNN . . . Boys' Chorus, Thespians, Color Day Escort, Usher for Vesper Service . . . MEANS, NOEL . . . Wildcat Follies Cast, Y-Teens, Pep Cats,QuoVadis, Le Cercle Francais, Thespians, Home Room Secretary-Treasurer and Reporter . . . MEASELES, JANICE CAROLE . . . Girls' State Associ- ate Justice Supreme Court, National Honor Society, Senior Cabinet, Stu- dent Council, Wildcat Color Day Queen, Junior Trojan Color Day Queen, Junior Basketball Maid, First Alternate Cheerleader, Pep Cats, Catettes, Y-Teens Valentine Maid, Y-Teens Mid-Winter Conference Delegate, Y- Teens Social Chairman and Treasurer, Los Gatos Espanoles Secretary, Future Business Leaders Yearbook Chairman, Girls' Recreation As- sociation . . . MEEKS, DONNA . . . Future Teachers, Senior Choir, Transfer from West Anchorage High School, Anchorage, Alaska . . . MERCING, TERRY . . . National Honor Society, Key Club, Senior Choir, Senior Boys' Quartet, Junior Rotarian, Home Room President, Senior Cabinet, All- State Choir, Football, Track, Lettermen's Club, Los Gatos Espanoles, Color Day Escort, Boys' Chorus, Cross-Country Track Team, Wildcat Follies Cast, Musical Varieties Cast, Senior Choir Librarian . . . MERRITT, JULIA ANNETTE . . . National Honor Society, Student Coun- cil, Bookworms, Future Business Leaders, Los Gatos Espanoles, Pep Cats, Home Room Secretary . . . MERRITT, RODNEY . . . METCALF, MIKE . . . Senior Cabinet, Los Gatos Espanoles, Home Room President and Treasurer . . . MERRITT, JULIA ANNETTE MERRITT, RODNEY METCALF, MIKE 165 A 166 11' -wi ' "--V..-.aui MILLER, ALBERT G. MILLER, .IANICIQ MILLS, BETH ,QQ MITCHELL, VIRGINIA MONGRIEF, .IUDITH ELLEN MOORE, J. BERRY Class of '64 MILLER, ALBERT G .... Hi-Y, Future Business Leaders,Track,Home Room Vice-President . . . MILLER, JANICE . . . Y-Teens, BandMoni- tor, Future Business Leaders . . . MILLS, BETH . . . Home RoomSec- retary and Treasurer, Senior Girls' Chorus President, Musical Varieties Cast, Junior Choir, Senior Girls' Chorus . . . MILLSAPPS, GAIL . . . Girls' State, Senior Girls' Ensemble, Senior Choir, All-State Chorus, Los Gatos Espanoles, Wildcat Follies, Musical Varieties, Future Business Leaders, Pep Cats, Junior Choir, Glee Club . . . MIRONTSCHUK, NATALIE . . . Glee Club Librarian, Home Room Secretary, Red Cross Representative, Junior Choir, Senior Girls' Chorus, Future Business Leaders,Y-Teens,Future Homemakers . . . MITCHELL PEGGY ANN. . . MITCHELL, VIRGINIA. . . Publications Book- keeper, Quill and Scroll . . . MONCRIEF, JUDITH ELLEN. . .National Honor Society,Future Business Leaders Vice-President, Senior Cabinet, Quo Vadis, Tri Chem . . . MOORE, J. BERRY . . . Marching and Concert Bands, Pep Band, Hi-Y Boys' Chorus . . . MOORE, MIKE O .... Mr. Publications,Home Room President and Vice-President, Monitor, Quo Vadis, Hi Comet Assistant Advertising Manager, Quill and Scroll . . . MILLSAPPS, GAIL MIRONTSCHUK, NATALIE MITCHELL, PEGGY ANN w w 3, 3-' :: .wiki H W, :Iii J' f 4 fs ,, Y , f""'rv I "H 3 ,.t:,YL,t-f" I .Z MOORE, MIKE O. Q ,Q mm, VX Qin-na-if wi 3 ,,: p 1 I 0 5 "Ili MOORE, RAY MORGAN, ROBIN MORING, MARY ANN '31 MUELER, MARILEE MUNNERLYN, BERNARD FORREST MUNNERLYN, JANE AN Class of '64 MOORE, RAY. . . Future Tradesmen . . . MORGAN, ROBIN... Track, School Record Holder in Pole Vault, L-ettermen's Club . . . MORING, MARY ANN . . . Red Cross Representative, Future Business Leaders,Monitor . . . MOSELEY, RANDY . . . FutureTradesmen . . . MULLER, MARILEE . . . Los Gatos Espanoles . . . MUNNERLYN, BERNARD FORREST . . . MUNNERLYN, JANE ANN . . . Hi Comet Editor, National Honor Society, Cheerleader, Thespians, Quill and Scroll Treasurer, Delegate to State Press Conference, Catettes, Pep Cats, Y- Teens, Quo Vadis, Home Room Secretary, Red Cross Representative, Youth Center Cabinet . . . MURRAY, EDDIE . . . Future Tradesmen . . . MYERS, BOBBY . . . Junior Choir . . . MYERS, KAYE . . . Future Business Leaders, Y- Teens, Future Homemakers, Glee Club Vice-President, Junior Girls' Chorus, Senior Girls' Chorus . . . N 2 t ef iam J' 'Av-., yi , l. Q., MOSELEY,RANDY MURRAY, EDDIE MYERS, BOBBY MYERS, KAYE , , - -mf:swi15f,,, 'f 2 sa 3 rgsya ,fs ,,,, fa,u,g,Qyr ' ttf2.fe?Tf?..q?353mg,E wf.w,1:.,s,g95551 9 167 168 Class of '64 NATION, DORIS . . . Future Homemakers,Girls Recreation Association . . . NEWCOMB, DAN . . . NEWCOMB, ROGER . . . NEWELL, PAM . . . Pep Cats, Catettes, Future Business Leaders, Los Gatos Espanoles, Y-Teens, Monitor, Home Room Reporter, Usher for Vesper Service and Commencement, Transfer from San Antonio, Texas . . . I NEWMAN, JAMES H .... NICHOLS, DEEANA . . . National Honor So- ciety Secretary, Student Council, Pep Cats, Y-Teens, Future Teachers, Los Gatos Espanoles, Thespians, Tri Chem . . . NATKnrDoRw NEWcoMB,oAN ship on the entire squad. NEWCOMB, ROGER NEWELL, PAM 'T fx NEWMAN, JAMES H. NICHOLS, DEEANA At the annual Wildcat football banquet Senior Bruce Cook re- ceived a trophy for displaying the greatest amount of leader- an-,S JUL- NICHOALDS, BECKY NOWELL, MIKE OLDI-IAM, JERRY I : m y Gig, 'Riff' EI ORSINI, LINDA ORR, POLLY OUELLETTE, DAVE Class of '64 NICHOALDS, BECKY . . . Senior Choir, Senior Girls' Ensemble, Junior Girls' Chorus Glee Club, Future Homemakers, Future Business Leaders . . . NOWELL, MIKE . . . Football, Key Club, Home Room President and Vice-President . . . OLDHAM, JERRY . . . Los Gatos Espanoles . . . ORSINI, JAMES . . . ORSINI, LINDA . . . Pep Cats . . . ORR, POLLY . . . Junior Girls' Chorus, Future Business Leaders, Monitor, Glee Club . . . OUELETTE, DAVE . . . National Honor Society, Boys' State, Junior Rotarian, All- State Band, Student Council, Senior Cabinet, Quo Vadis, Key Club, Tri Chem, Marching Band, Concert Band . . . OVERTON, JEAN . . . Future Homemakers, Girls' Recreation Associ- ation . . . OWEN, DONALD . . . Band Quartermaster, Boys' Chorus, Hi-Y, Los Gatos Espanoles . . . PAIRISH, SUSAN RENEE . .. Pep Cats, Tri Chem, Home Room President, Monitor, Girls' Recreation Association, Quo Vadis, Y-Teens, Usher for Vesper Service and Com- mencement . . . ORSINI, JAMES OVERTON, JEAN OWEN, DONALD ini PAIRISH, SUSAN RENEE 169 PALMER, ELIZABETH Nd" PARKER, DAVID PARKER, JOHN T. W , , xr... , f .YJ L fagsggl . . .. W , . . 'f- fQ'1: wzsf'75' ' -f ' ,af 455 22,-11 ,- ' mmf' - ,- .aEp,2. R f F PECK, TOMMY www 170 Class of '64 PALMER, ELIZABETH . . . Senior Choir, Senior Girls' Ensemble, Red Cross Representative, Future Nurses Secretary, Junior Girls' Chorus, Pep Cats, Sophomore Glee Club, Monitor, Usher for Commencement . . . PARKER, DAVID . . . Key Club . . . PARKER, JOHN T. . . . PARKER, RALPH WILSON . . . Home Room Secretary and Treasurer, Concert and Marching Bands . . . PATTISON, RONNIE ALAN . . . Los Gatos Espanoles, Transfer from Sewanee Military Academy . . . PAULETTE, JOAN MARIE . . . PECK, TOMMY . ,, . Boys' Chorus PENNINGTON, BETTY LEE . . . Future Nurses, Future Homemakers, Future Nurses Treasurer . . . W. C. PEPPER . . . Thespians, Publi- cations Staff, Quill and Scroll . . . PERKINS, LA JUANA . . . PARKER, RALPH WILSON PATTISON, RONNIE ALAN PAULETTE, JOAN MARIE . S 'wr 46 fn. ,, wma .. x 2 'W ,.. . EW Q. . . PENNINGTON, BETTY LEE PEPPER, W. C. PERKINS, La JUANA 'WW PERRY, JAMES PERRY, RICHARD MARTIN PETERS, GRADY RAY PETERSON, SUSAN ELIZABETH PETERSON, MIKE PETROSS, LARRY C. PETTY, DANA Class of '64 PERRY, JAMES . . . PERRY, RICHARD MARTIN . . . National Honor Society, Student Council, Key Club, Senior Choir, Boys' Chorus, Los Gatos Espanoles Vice-President and Parliamentarian, Transfer from Air Force Base, Madrid, Spain . . . PETERS, GRADY RAY . . . Auto Mechanics Secretary . . . PETERSON, SUSAN ELIZABETH . . . Catettes, Pep Cats, Senior Cabi- net, Girls' Recreation Association Vice-President, Publications Staff, Monitor, Y-Teens, Future Teachers, Home Room Secretary, Quill and Scroll, Usher for Vesper Service and Commencement . . . PETERSON, MIKE . . . PETROSS, LARRY C .... Hi Comet Managing Editor,Home Room President, Red Cross Representative, Film Crew Head Monitor, Quill and Scroll . . . PETTY, DANA . . . Pep Cats, Bookworms, Junior and Senior Girls' Chorus, Girls' Recreation Association, Future Business Leaders . . . PHILLIPS, KATHY . . . Quill and Scroll, Publications Staff, Wildcat Make-Up Editor, Delegate to Yearbook Workshop, Delegate to State Press Convention, Pep Cats, Art Club, Color Day Decoration Committee, Girls' Recreation Association, Future Homemakers, Bookworms, Monitor, Red Cross Representative, Usher for Vesper Service and Commencement, Cast of "Night of January lo" . . . PHILLIBER, JUDY . . . Senior Choir, Senior Girls' Ensemble, Future Homemakers Secretary, National Honor Society, Quo Vadis, Wildcat Follies Cast, All StateChoir . . . PFEIFFER, JEANETTE . . '. National Honor Society, Student Council, Catettes, Pep Cats, Y-Teen Chaplain, Los Gatos Espanoles, Future Business Leaders . . . PHILLIPS, KATHY PHILLIB ER, JUDY PFEIFF ER, JEANETTE 1 , . -"1 iff " ,K ' 3' lg ,, 3 ,, . wg, I, V H J , tt . - 171 Class of '64 PIERCE, WILLIAM DENNIS . . . Future Tradesmen . . . PLUMMER, JOHNNY DALE . . . Football, Lettermen's Club . . . POLK, SHERRY . . . Future Homemakers Vice-President, Wildcat Picture Editor, Pep Cats, Art Club, Decoration Committee for Color Day Royalty, Girls' Recreation Association, FHA Junior and Chapter Degrees, Quill and Scroll, Usher for Senior Play . . . POWELL, JAMES . . . Hi-Y Vice-President, Theta Science Club, Book- worms . . . POWELL, RAYMOND . . . POWERS, RONALD STEVEN . . . Key Club, Art Club, Tri Chem, Le Cercle Francais, Hi-Y, Transfer from Bolton High School, Alexandria, Louisiana . . . PRICE, KENNYE PIERCIL, WILLIAM DENNIS PRIDDY, JANE ELLINGTON . . . National Honor Society, Bookworms 172 President and Historian, National Merit Semi-Finalist, Girls' State, Tri Chem, Theta Science, Quo Vadis, Red Cross Representative, Bookworms, Y-Teens, Pep Cats . . . PRIEST, BING . . . Football . . . PRICKETT, HORACE . . . Key Club, Senior Cabinet, Quo Vadis, Hi-Y, Home Room Vice-President, Basketball, Lettermen's Club . . . 'hu-4 'YW PLUMMER, JOHNNY DALE POLK, SHERRY POWELL, JAMES POWELL, RAYMOND POWERS, RONIILD STLVILN 4 , lgijql-,.3,.-f ,.,,-.sa A-,M I .1 i,f-f s .:-': Q ,,,,I ,- A fl if 5 PRICE, KENNYE PRIDDY, JANE ELLINGTON PRIEST, BING PRICKETT, HORACE if S ' . ' ? ff 1' ,, Q, , dy, 7 l if !3i'c 'qi' The Senior Girls' Trio goes through another memorable per- formance for the Wildcats in the Follies. ZV. . -4' M . . '...,K K A ,," i XX , rf ' PRITCHARD, TAP PRUITT, GARY LOUIS fl PUGH, PAT Pui,1.1.1.M, JANET LYNN C I 9 vuluroxf, RICHARD PRITCHARD, TAP . . . Student Council Treasurer, Key Club, Los Gatos Espanoles, Theta Science Club, Hi-Y State Treasurer, Publications Photographer, Color Day Escort, Quill and Scroll, Tennis . . . PRUITT, GARY LOUIS . . . PUCH, PAT. . . Catettes, Pep Cats, Junior Miss, Y-Teens, Girls' Recreation Association, Track Queen, Home Room President and Vice- President, Publications Staff, Thespians,Quill and Scrol1,Usherfor Vesper Service and Commencement . . . PULLIAM, JANET LYNN . . . Catettes, Home Room President, Pep Cats, Y-Teens, Color Day Royalty, Thespians . . . PURIPOY, RICHARD . . . Concert and Marching Bands, Theta Science Club, Arkansas State Orchestra Society, Pep Band, Honorable Mention Arkansas District Science Fair , . . PYLE, LARKAN . . . ' ,ff Wf PYLE, tllxnkm '5- 1 173 'TA lr . .' 'ii L5 3 - 1 ,J .5 Q 'U be s , ff, gjfy , 174 QUALLS, ELIZABETH RUTH , r-""?' RAMILR, VICKI Class of '64 QUALLS, ELIZABETH RUTH . . . Concert Band, Student Librarian, Red Cross Representative, Red Cross County Council Representative, Youth Center Cabinet . . . RAMER, VICKI . . . Future Business Leaders, Fu- ture Nurses, Y-Teens, Pep Cats, Publications Staff, Quo Vadis, Quill and Scroll . . . RAY, JOHN . . . REAGAN, JERRY . . . Transfer from Lompoc Senior High School, Lompoc, California . . . REEVES, BECKY . . . Cheerleader, Catettes, Pep Cats, Y-Teens, Quo Vadis, Publications Staff, Quill and Scroll, Home Room Officer, Youth Center Board . . . REEVES, SHARON . . . Cheerleader Captain, Catettes, Y-Teens Secretary and Program Chairman, Y-Teens Delegate to Mid-Winter, State and Mid-South Y-Teen Conferences, Thespians, Quo Vadis, Publications Staff, Wildcat Follies Cast, Quill and Scroll, Home Room Officer, Sophomore Talent Assembly . . . REDD, VALERIE ANN . . . Hi Comet Staff, Pep Cats, Y-Teens, Quo Vadis, Future Homemakers, Tri Chem, Quill and Scroll . . . RENFROE, MIKE . . . Transfer from New Diana High School, Diana, Texas . . . REESE, JENNIE LYNN . . . Red Cross Representative, Pep Cats,Junior Choir, Senior Girls' Chorus . . . RHODES, MIKE . . . Student Council Vice-President, Key Club, Wildcat Follies Cast, Color Day Escort, Hi-Y, Home Room Vice-President, Quill and Scroll, Publications Staff, Assistant Advertising Manager for Publications, Sophomore Talent Assembly, Usher for Vesper Service and Commencement . . . RAY, JOHN REAGAN, JERRY REEVES, BECKY REEVES, SHARON 03 REDD, vAi.ER1E ANN RENFROB, MIKE REESE, JENNIE LYNN RHODES, MIKE -4:5 Q'3...., ZR 'F "' if - N ff J iff? li'?l', I jx ,M ,I RICE, JOAN RICE, HERSCHEL E. RICE, PAUL JAMES RICH, WAYNE t ,.. -15 - I '. ' J I X lx I INN 1 , I ri lit I .a RICHARDSON, JIMMY RIGGS, STEPHEN LANE RILEY, DEBBIE Class of '64 RICE, JOAN.. .Transfer from Fuller High School. . . RICE, HERSCHEL F .... Film Crew . . . RICE, PAUL JAMES . . . Film Crew, Junior Choir, Boys' Chorus, Senior Choir, Senior Boys' Quartet . . . RICH, WAYNE . . . Stage Crew, Film Crew . . . RICHARDSON, JIMMY . . . Marching Band, Varsity Band . . . RIGGS, STEPHEN LANE . . . Key Club, Forensic League, Thespians, Cast of "Night of January lo," Wildcat Follies Cast , . . RILEY, DEBBIE . . . Future Nurses, Transfer from Newport Harbor High School . . . RISHER, PHILLIP . . . Football Manager, Film Crew, Home Room Sec- retary . . . RITCHIE, CORKY . . . National Honor Society, Key Club, Tri Chem, Golf, Marching and Concert Band, Los Gatos Espanoles . . . ROBERTS, HAROLD . . . Senior Choir President, Tri Chem President, Student Council, National Honor Society, Key Club, Boys' Chorus, All State Choir, Wildcat Follies Cast, Musical Varieties Cast, Junior Choir . . . RISHER, PHILLIP RITCHIE, CORKY ROBERTS, HAROLD 115 Class of '64 ROBERTS, LOIS . . . Future Business Leaders, Le Cercle Francais, Future Home-makers . . . ROBERTSON, RON'NlE JACK... ROGERS, STEVE . . . Home Room Treasurer, Football,LosGatos Espanoles . . . ROWLAND, KAY . . . Pep Cats, Future Homemakers, Senior Chorus Assistant Secretary, Junior Chorus . . . RUSSELL, BARBARA . . . RUSSELL, LARRY . . . Home Room Presi- dent, Wildcat Follies Cast, Musical Varieties Cast, Concert and Marching Bands, Senior Choir, Junior Choir, Los Gatos Espanoles, Red Cross Representative, Boys' Chorus, Senior Choir Robe Chairman . . . RUSSELL, RICKY . . . Publications Staff, Los Gatos Espanoles . . . RUSSELL, SANDY . . . Future Business Leaders, Junior Girls' Chorus, Senior Girls' Chorus . . . RUTHERFORD, AL . . . Key Club, Los Gatos Espanoles, Boys' Chorus, Concert and Marching Bands, National Honor Society, Quill and Scroll, Publications Staff Head Typist . ., . RYAN, BILL, JR .... Trainer for Football Team, Hi-Y, Home Room Presi- dent . . . ROBERTS, LOIS Mi""e 1- 411 47N QR' ROBERTSON, RONNIE JACK ROGERS, STEVE ROWLAND, KAY RUSSELL, BARBARA RUSSELL, LARRY if 'W Har, RUSSELL, RICKY RUSSELL, SANDY RUTHERFORD, AL RYAN, BILL, JR. 176 - X .wi x-X fi I I I, pw - if 55, WL A LL 5 5 'Ihr ' 1, 'X WK' j"f!"'?PX tix' M , AN'-ft n, N Q51 SADLER, LYNN SALKELD, JAMES SANDERS, BRENDA SANDERS, ED leg 1523! , . ,fi SATTERFIELD, DIANE SCARBOROUGH, WILLIE SCI-IAEFFER, JERRY W. SCRUGGS, PATRICIA Y64 SEIiLliY,BRUCEA SADLER, LYNN. . . Boys Chorus . . . SALKELD, JAMES.. . I President of NLRHS Radio and Technical Control, NLRHS Rocket Club, I I Home Room Vice-President . . . SANDERS, BRENDA . . . Pep Cats, 1 1 Future Homemakers, Quo Vadis, Girls' Recreation Association, Junior ,I 1 Girls' Chorus, Future Teachers . . . SANDERS, ED . . . Publications I S we-'I Managing Editor, Stage Manager, Thespians, Quill and Scroll . . . SATTERFIELD, DIANE . . . SCARBOROUGH, WILLIE... SCHAEFFER, JERRY W .... Student Council, Key Club, Boys' Chorus, Musical Varieties Cast, Film Crew, Cafeteria Monitor, Publications Staff, Quill and Scroll . . . SCRUGGS, PATRICIA . . . Girls' Recrea- tion Association . . . SEELEY, BRUCE A .... Concert and Marching Bands, Transfer from Cheyenne East High, School, Cheyenne, Wyoming . . . SESSOMS, MARSHA . . . National Honor Society, Future Home- makers Reporter, Literary Editor for 1964 Wildcat, Quill and Scroll, Fu- ture Teachers, Los Gatos Espanoles, Pep Cats . . . nqdhv SILSSOMS, MARSI-IA "1-r::'7f Q ti QQ! Iri if i,t,,t, 'AA' f t, ., I if ii. ggfffawe I. f' -1,41 i f , - ,, I f .?'i.p4Li, Wada,-ply if 3' 3641 177 178 Q, Class of '64 'Si 'Q SHEFFIELD, JOHN A .... Marching Band, Boys' Chorus, Publications ' A 5 S Staff . . . SHELTON, LARRY DALE . . . Football, Lettermen's Club af' ' . . . SHEPHERD, MARY ELLEN . . . SHIRLEY, WAYNE F. . . . Con 5' cert and Marching Bands, Band Quartermaster . . . SHOOK, MARY ANN SHLFFILI D, JOHN A. l , 'FIA at ffxx SI ILI .TON, LARRY DAI .IL SIILPIHQRD, NIARY l'.l,I,lLN AYXA tk Q SA . . . Le Cercle Francais, Future Business Leaders, Senior Choir, Senior Girls' Ensemble, Career Club, All-State Choir, Wildcat Follies Cast . . . SIMMONS, FRANKIE . . . Film Crew, Wildcat Band . . . SHIRLEY, WA YNIL SHOOK, MARY ANN SIMMONS, FRANKIL 24 12 , il. WK Noel Means cuts loose with an unforgettable tune in the Wild cat Follies. 3? 1 , ' lifirf ,ffl ws t ' fglfa gf if gff3i-"'f'P, . . - ,-.' . 111 " f , w '- fm' , ' jiri r, 1: 'H-M 5322 'K I sw'- A R fam!! " A a 1- is V 1. I M, 5- aw .1 I . i Z.. is Lf , wsu K S I . f J WV l5""f in S ff -M an I 'AW' Q wc' T Q 'uv' , f-...vw ,3 kk I .,, r I uw, V , 5 1. , ra E it , A 4 SIMS, BOBBY SIMS, JIMMY D. SINGLETON, OMER BERNARD SMALLING, FAY ,, ,ig SMALLING, KAY SMEAD, EARLEAN SMELSER, JOE Class of '64 SIMS, BOBBY D .... SIMS, JIMMY D .... SINGLETON, OMER BERNARD . . . Art Club, Basketball . . . SMALLING, FAY . . . National Honor Society, Senior Choir, Future Teachers, Bookworms Vice-President, Head Library Monitor, Los Gatos Espanoles, Musical Varieties Cast, Wildcat Follies Cast, Pep Cats . . . SMALLING, KAY . . . Senior Choir, Future Teachers Secretary, Bookworms Secretary- Treasurer, Head Library Monitor, Home Room Secretary, Musical Varieties Cast, Los Gatos Espanoles, Pep Cats, National Honor Society . . . SMEAD, EARLEAN . . . Future Nurses, Y-Teens, Quo Vadis,Mon- itor, Career Club . . . SMELSER, JOE . . . Home Room President and Vice-President, Football, Lettermen's Club, Track, Wildcat Team Captain, All Big Ten . . . SMITH, DANA . . . Key Club, Forensic League, Senior Cabinet, Home Room President, National Honor Society . . . SMITH, FRED VERNON . . . National Honor Society, Boys' State, Key Club, Tri Chem, Theta Science Club, Thespians, Track, Lettermen's Club, Home Room Secretary-Treasurer . . . SMITH, HAROLD . . . Future Trades- men President . . . if SMITH, DANA SMITH, FRED VERNON 1 - Alfa ,-I , , 5' ,W ' I mx 2 4 1 ,V . tyyti M 5,3 R ., I SMITH, HAROLD 179 I, Ns I I' ' "" j. . SMITH, JAMES EDWARD SMITH, JOHNNIE F AYE SMITH, PATRICIA ANNE SMITH, PATRICIA FRANCES SMITH, PHYLLIS Class of '64 SMITH, JAMES EDWARD . . . Thespians, Boys' Chorus, Quo Vadis, Theta Science Club, Usher for Vesper Service and Commencement . . . SMITH, JOHNNIE FAYE . . . SMITH, PAT ANNE . . . Wildcat Follies Cast, All-State Chorus, Senior Choir, Musical Varieties Cast, Junior Girls' Chorus, Girls' Recreation Association, Y-Teens, Los Gatos Espanoles, Thespians, Monitor, National Honor Society, Sophomore Talent Assembly . . . SMITH, PAT FRANCES . . . SMITH, PHYLLIS . . . Catettes, Pep Cats Historian, Thespians Secretary, Senior Cabinet, Future Teachers, Y-Teens, Delegate to Y-Teens Mid-Winter and Mid-South Conferences . . . SMITH, SHARON KAYE . . . Junior Girls' Chorus . . . SMITH, TOMMY . . . Student Council, Tri Chem, Theta Science Club, . . . SOUSA, LINDA JOYCE . . . Future Homemakers, Y- Teens, Pep Cats, Red Cross Representative, Senior Girls' Chorus Secre- tary . . . SOUTH, GREGORY . . . Boys' State, Junior Rotarian, Key Club, Tri Chem, Theta Science Club, National Honor Society . . . SPANN, PAT . . . SMITH, SHARON KAYE SMITH, TOMMY SOUSA, LINDA JOYCE V' 180 .NAS SOUTH, GREGORY SPANN, PAT KN I "YAY '.., wr I M 3 5 4 A K., .T 4 fu 3 it A ta in-Q My WW' ,npr fe max W, SPEARIVION, NEAL SPIKES, JIMMY SPLAWN, ANN Y J L M at f 5 -. Vgim k K-A65 Q, JW? l, I F N29 W, . ., .E q ,', R W' -fi QS J l A iw!! ji! If t I' n ' it S15 5 ,A '53 Mx ,M af Q l 5:9 ty xi ? ff I? Q' F' - Q A X STANDRIDGE, JANE f wfgwgaigsp J X wr , 'TES' STANLEY, SANDRA STARKEY, EILEEN STECKS, CARY STEWART, LARRY Class of '64 SPEARMON, NEAL . . . Theta Science Club President, KeyC1ub, Tennis, Home Room President, Tri Chem . . . SPIKES, JIMMY ALLEN . . . Future Tradesmen, AutoShop Treasurer . . . SPLAWN, ANN . . . Color Day Royalty Wampus Cat Queen, Pep Cat President, Catettes, Senior Cabinet, StudentCouncil,Y-Teens,QuoVadis,Monitor . . . STANDRIDGE, JANE . . . Future Homemakers, Girls' Recreation Association . . . STANLEY, SANDRA . . . STARKEY, EILEEN . . . National HonorSoci- ety, Senior Choir, Senior Girls' Ensemble, Wildcat Follies Cast, Student Council, Future Business Leaders, Pep Cats, Le Cercle Francais, Home Room Treasurer, Red Cross Representative . . . STECKS, GARY . . . STEWART, LARRY. . .Future Tradesmen . . . STIRMAN, CARY . . . STOLL, LORA JANE . . . Y-Teens, Future Homemakers, Junior Choir, Senior Girls' Chorus, Transfer from Sylvan Hills High School . . . I STIRMAN, CARY W STOLL, LORA JANE f.. P L, a,"' . , l gtg, - 1, E! S N T .1 1 1' "" 1 , Q Yew! STONE, ELIZABETH H, I In ' wp. V V 9m,E,. . My. ygv gm I - I x gg '52 f- 'If f 1. 5: in 'I' 5f57Z?il "gf" .. I S 49 STORY, JOHNNY STRAW, VICKI -Tl til STROUD, .PAULA KAY 182 Class of '64 STONE, ELIZABETH ANNE . . . Junior Choir, Senior Girls' Chorus, Future Homemakers, Monitor . . . STORY, JOHNNY . . . Thespians, Transfer from Little Rock Central High . . . STRAW, VICKI . . . STRICKLIN, DAVID . . . Boys' Chorus, HomeRoomVice-President . . . STRICKLIN, MARGARET . . . Senior and Junior Girls' Chorus . . . STROUD, JERRY WAYNE . . . STROUD, FAULA KAY . . . Los Gatos Espanoles, Junior Choir, Senior Girls' Chorus, Red Cross Representative, Future Homemakers, Musical Varieties Cast, Head Usher for Vesper Service and Commencement . . . STYERS, SUE . . . SWANN, ROBERT . . . Film Crew, Future Tradesmen Vice-President . . . TAYLOR, JIMMY . . . Senior Cabinet, Hi-Y, Quo Vadis, Publications Staff, Quill and Scroll . . . STRICKLIN, DAVID STRICKLIN, MARGARET STROUD, JERRY WAYNE H' i Eg, yt. . - .t ,A ,,,. , Q . f ' .1 JW ' B ,rf one fd, I 5 TAYLO R, JIMMY STYE RS, SUE SWANN, ROBERT 'fx "7'f..."I'?t wmv I fm F4 Q t 'uv .Nf.7,, 4,5 o r-I f X as 'Q V ,vs-A "' "W 5 a N' "The sophomores are little bores, deep in the heart of Cat- land," sing the Senior Boys' Quartet. THOM P SON, JAME S Class of '64 TEEGARDEN, DAVID . . . National Honor Society, Key Club President and Vice-Presideng Student CouncilCjhaphnn,'Theta Science Club,'Tri- Chem, Junior Rotarian, Hi-Y, Basketball, Lettermen's Club, Boys' State, Outstanding Key Clubber of 1963, Monitor . . . TENNEY, PHILLIP . , . Home Room President . . . THOMPSON, JAMES EARL . . . Senior and Junior Choirs, Stage Crew, Film Crew . . . THOMPSON, JOSEPHINE . . .lloncert and DAarching Bands,'Theta Science CHub,l and Librarian, Tri Chem, Pep Band, Quo Vadis, Red Cross Representative, Future Tmmhms ... THONESON,IJNDA ... Publications Staff... THORNE, SANDRA . . . Librarian, Future Business Leaders, Red Cross Representadve . .. f x-.v as 9 - N, at -. , TEEGARDEN, DAVID TENNEY, PHILLIP tk 1 V 'uv vt ' ' HF' THOMPSON, JOSEPHINE THOMPSON, LINDA sv- V, 111 WK 2 THORNE, SANDRA ww' t, ' Q ra-,sw - .,A.,,, is! 'clcc , t X it an if ' ,SH , -fiyk, ., 1 1 Q- . 4 in aff., Q, as 183 184 A , THORNTON, MARY LOU THRESHER, STEVE TODD, DENNIS W. TUCKER, W. A. Class of '64 THORNTON, MARY LOU . . . Future Homemakers, Y-Teens, Senior Girls' Chorus, Pep Cats, Red Cross Representative, Junior Girls' Chorus . . . THRESHER, STEVE . . . Art Club, Publications Staff, Usher for Commencement . . . TODD, DENNIS W .... Marching Band, Radio Club . . . TOLAND, DENNIS . . . Key Club, Wildcat Band . . . TOLAND, JO ANN . . . National Honor Society, Theta Science Club, Tri Chem, Quo Vadis, Los Gatos Espanoles, Pep Cats, Home Room Secretary . . . TOMKINS, PAUL . . . National Honor Society, Key Club, Wildcat Band, Theta Science Club, Quo Vadis, Tri Chem . . . TUCKER, W. A. . . . Senior Boys' Quartet, Key Club, All-State Choir, Boys' Chorus, Senior Choir . . . TULLOS, JERRY A .... TULLOS, RONNIE . . . Home Room President, Publications Staff, Quill and Scroll, Usher for Vesper Service and Commencement . . . TURNER, SANDRA KAY . . . Future Business Leaders, Girls' Recreation Association Secretary, Y-Teens, Pep Cats, Home Room Vice-President, National Honor Society TOLAND, DENNIS TOLAND, .IO ANN TOMKINS, PAUL 53571 ,asm-I , A-M-vw' TULLos, JERRY A. TULLOS, RONNIE TURNER, SANDRA KAY it wifi' 'V-fr ,-- eww W., , VADEN, GAIL VAUGHAN, CHARLES VERHEUL, MARTY LYNN VIARS, RON VINES, MARILYN VOSS, JIMMY WADE, JOAN Class of '64 VADEN, GAI-L BETH . . . Red Cross Representative, Monitor, Thes- pians, Musical, Varieties Cast, Pep Cats, Future Teachers, Junior Girls' Chorus, Usher for Commencement . . . VAUGHAN, CHARLES . . . VERHEUL, MARTY LYNN . . . Student Council, Le Cercle Francais, Transfer from Wurzburg American High School, Wurzburg, Germany . . . VIARS, RON . . . Transfer from Anahiem Union High School . . . VINES, MARILYN . . . National Honor Society, All-State Orchestra,Band Historian, Bookworms, Future Business Leaders, Future Homemakers, Future Teachers, Le Cercle Francais, Future Nurses .... VOSS, JIMMY . . . Future Tradesmen . . . WADE, JOAN . . . Future Business Leaders, Le Cercle Francais, Pep Cats, Junior Choir, Senior Girls' Chorus, Nationall-lonor Society . . . WAGLEY, JUDY . . . Futurel-Iome- makers, Junior Girls' Chorus, Senior Girls' Chorus . . . WALKER, FREDDY . . . Publications Staff, Quill and Scroll, Thespians, Future Business Leaders, Monitor, Home Room President and Vice-President . . . WALKER, JIMMY . . . WAGLEY, JUDY WALKER, FREDDY ,.-H-"?1a""X, . 'M gay, hwy WALKER, JIMMY ,p., ,,... , V,.. M ff ' Y W . V -Q , QQ gg fi 94" I fwfff' f of 'NJ' WALLACE, WAYNE l WARFORD, WALT WARNER, MORRIS GENE ii i 'Eg' Class of '64 WALLACE, WAYNE . . . Senior Cabinet, Los Gatos Espanoles, Home Room Vice-President, Hi-Y, Publications Staff, Quill and Scroll . . . WARFORD, WALT . . . Tri Chem Vice-President, Theta Science Club, Student Council, Hi-Y, Quo Vadis . . . WARNER, MORRIS GENE . . . WARNER, NANCY MARIE . . . Future Homemakers, Senior and Junior Girls' Choruses . . . WARREN, CHARLOTTE . . . Pep Cats, Y-Teens, Los Gatos Espanoles, Home Room Secretary and Vice-President, Senior and Junior Girls' Choruses . . . WARRICK, PAUL . . . Tri Chem, Fu- ture Teachers, NationalHonorSociety . . . WASSON, PATSY GALE . . . Future Teachers President and Vice-President, Red Cross Vice-Presi- dent and Secretary, National Honor Society, Girls' State Alternate, Thes- pian Treasurer, Red Cross County Council, Pep Cats . . . WASSON, VIRGINIA. . . Future Homemakers, Y-Teens, Los Gatos Espanoles, Girls' Recreation Association . . . WATKINS, SHERRYE , , . Future Nurses, Junior Choir, Senior Girls' Chorus, Girls' Recreation Association . . . WARNER, NANCY MARIE WARREN, CHARLOTTE WARRICK, PAUL A-ie-Mwst f IWC' l86 WASSON, PATSY GAYLE WASSON, VIRGINIA "T'f'.1"7"' x ' WATKINS, SHER RYE WATTAM, MICHAEL ll X I ,Q :.. Q M il f-I ' f I- I Q4 B rx A A 3 ff maxi" . as """ I ,f , , my P, ,M ,R p p A, ei .W --f g 'Wwe' ' t -,-e if-...I fl I si? . 5 , Q WATTS, DAVID WEAVER, BILLY WAYNE WELTY, SHIRLEY SUE aff 36 .... ml WI-IITTLE, JULIE ANN WILKINS, CAROLYN WILLIAMS, ALICE EAY Class of '64 WATTAM, MICHAEL . . . Theta Science Club, Key Club, Quo Vadis . . . WATTS, DAVID . . . WEAVER, BILLY WAYNE . . . Future Trades- men Senior Adviser . . . WELTY, SHIRLEY SUE . . . Pep Cats, Art Club, Publications Staff . . . WESTON, BARBARA . . . Future Business Leaders, Pep Cats, Musical Varieties Cast . . . WHITTLE, JULIE ANN . . . Senior Cabinet, Home Room President, Student Council, Girls' Recreation Association, Monitor . . . WILKINS, CAROLYN . . '. Pep Cats, Future Business Leaders, Future Homemakers, Girls' Recreation Association, Y-Teens . . . WILLIAMS, ALICE FAYE . . . National Honor Society, Future Business Leaders, Junior Girls' Chorus, Los Gatos Espanoles . . . WILLIAMS, KEN . . . Publications Staff . . . WILLIAMS, LINDA . . . WILLIFORD, LARRY . . . 'ii A QA xx as it 1905 WESTON, BARBARA 'fi-9 1 ZH WILLIAMS, KEN WILLIAMS, LINDA WE, Aw"-5' G 'Z , it it 1 ' P, i WILLIFORD, LARRY kg, . gCf.x1u0jz?,!l ' . E K , U Aww - 'N'-9+ 187 O , 'f' V lm ,kr , I , ny, r 188 WILLIS, CHARLES L A . cl lk rugs IQ 'W' ,...M..f"' WILLSHIRE, ROLAND WILSON, JENNIE LEE Class of '64 WILLIS, CHARLES A .... Transfer from Fair Park High School, Shreve- port, Louisiana . . . WILLSHIRE, ROLAND . . . National Merit Semi- Finalist, Theta Science Club, Tri Chem, Concert and Marching Bands, Pep Band, Band Quartermaster, Quo Vadis . . .WILSQN, JENNIE LEE . . . National Merit Semi-Finalist, National Honor Society, Concert and March- ing Bands, Tri Chem, Quo Vadis . . . WIMBERLY, CHRISTINA ANN . . . Senior Choir, Home Room Secretary, Senior Girls' Ensemble Alternate, Red Cross Representative, Red Cross County Council Alternate, Art Club, Pep Cats, Y-Teens, Future Nurses, Junior Choir, Publications Staff, Quill and Scroll . . . WINGEIELD, JENNY . . . Cheerleader, National Honor Society, Color Day Royalty, Friendliest Sophomore and Junior Girl, Wild- cat Basketball Royalty, Y-Teens Valentine Royalty, Delegate to Y-Teen Mid-Winter Conference, Pep Cats, Catettes, Stu.dent Council . . . WINKLEMAN, CAROL . . . Thespians, Girls'Recreation Association, Pep Cats, Future Homemakers, Christmas Plays Mistress of Ceremonies, Senior Girls' Chorus, Junior Choir . . . WIMBERLY, TINA .,,...--ff WINGFIELD, JENNY WINKLEMAN, CAROL 1 1' 'Q Wildcats scream for Tiger "meat" as ,they prepare for the annual meeting between the Crosstown rivals . . . which the mighty Wildcats won, of course. an wap' 'R E , , ll sa in 'V LU1' iii-ufpffi iw Mfg 3 I 3 .,- x nv , Q T 1-a 5 WINN, JANN WISE, RUTH ANN gigs: E . .. , fi- gw is JV .3 A -1-P , r f - v, rg' "M rx ,W l L , A WOLFE, ROBERT LOUIS WOOD, CONNIE MARIE WOOD, DAVID Class of '64 WINN, JANN . . . Thespians President, Art Club President, Publications Staff Artist, Forensic League Reporter, Wildcat Follies Cast, Quill and Scroll, Leading- Role in "Night of January 16" . . . WISE, RUTH ANN Red Cross Representative . . . WITCHER, MURRY KELLY . . . Senior Cabinet, Senior Choir, Thespians, Boys' Chorus, Wildcat Follies Cast . . . WOFFORD, WAYNE . . . Student Council, Usher for VesperService and Commencement . . . WOLFE, ROBERT ,LOUIS . . . WOOD, CONNIE MARIE . . . Pep Cats, Future Homemakers, Publications Staff . . . WOOD, DAVID . . . Publications Business Manager, Quill and Scroll, Le Cercle Francais, Home Room Vice-President, Concert and Marching Bands, Delegate to State Yearbook Workshop, Pep Band . . . WOOLVERTON, HAROLYN . . . Catettes, Los Gatos Espanoles Secre- tary, Pep Cats, Y-Teens, Delegate to Y-Teen Mid-Winter Conference and State Y-Teen Conference, Girls' Recreation Association, Home Room Secretary, Wildcat Follies Cast . . . WORRELL, JAMES LEALON . . . Home Room President and Vice-President, Quo Vadis, Hi-Y Secretary, President, and Chaplain, Theta Science Club, Usher for Vesper Service and Commencement. . . WRIGHT, GWENDOLYN JUNE . . . Senior Cabinet, Catettes, Pep Cats, Miss Outer Space, Wildcat Follies Cast, Y-Teens, Future Business Leaders, Los Gatos Espanoles, Thespians, Monitor, Girls' Recreation Association . . . if A , WITCHER, MURRY KELLY, JR. W, ,,,,'i i ff' 'rv-nf 5 ,AST4 K ,... WOFFORD, WAYNE ,arf Af 'MFI I, WOOLVERTON, HAROLYN WORRELL, JAMES LEALON , 4955 WRIGHT, GWENDOLYN JUNE 189 ' fi ,V f-2529? , , 5'-Wil I . , , 'fiiefaii af ,, - -ji' -- 1 ' Z' H, " . - ' izf- , - 271 " iszwai ' ' A -' -I -: V ' lwikxi f or Ki i -I 190 P ,. 7 WRIGHT, WAYNE lik YAEGER, LINDA YORK, DONALD WAYNE YOUNG, SHARON Class of '64 WRIGHT, WAYNE . . . YAEGER, LINDA . . . Senior Girls'Trio, Senior Girls' Ensemble, Senior Choir, All-State Choir, Junior Girls' Chorus Secretary, Wildcat Follies Cast, Musical Varieties Cast, Los Gatos Espanoles, Pep Cats . . . YORK, DONALD WAYNE . . . YOUNG, BRENDA . . . National Honor Society, Home Room Secretary, Pep Cats, Quo Vadis, Future Homemakers, Monitor . . . YOUNG, DONALD . . . Electronics Club, Film Crew . . . YOUNG, LINDA . . . Pep Cats, Quo Vadis, Future Homemakers, Red Cross Representative . . . YOUNG, SHARON . . . Future Homemakers, Transfer from Memphis Technical High School . . . YOUNGBLOOD, DIANA JEANNE . . . Pep Cats, Girls' Recreation Association, Future Homemakers, Art Club . . . ZERMATTEN, VIRGINIA . . . Senior Choir, Senior Girls' Ensemble,Fu- ture Business Leaders, Junior Choir, Sophomore Glee Club . . . YOUNG, BRENDA YOUNG, DONALD YOUNG, LINDA 'fi' 5448 ' X X YOUNGBLOOD, DIANA .IEANNE ZERMATTEN, VIRGINIA Class of '65 We're the wildest Cats alive, we're the Class of '65. This sound has echoed throughout the hallowed halls of Wildcat Hill during the school years of '63 and '64 and will also be recognized as the class yell of the Seniors in '65. When the class of '65 first came to Wildcat Hill they heard all about the spirit and loyalty displayed by fellow Wildcats. The class of '65 immediately joined with the other classes in this vital essential of school life. It can now be safely and truly said that the juniors have carried the Wildcat tradition onward for another year. The class of '65 has the potential to be one of the greatest classes to graduate from NLRHS. Juniors intend to keep the Cat purring and the qw 'jf' X Abbott, Ronnie Aclin, Dale Adamson, Norman . x 'KA 'X ft' 3 tv . V 3, rv- U T- X. 4:-ii?" tradition living. X N N X1 ve' X' is X x A V , , , K. . ., NN X X K5 L ,X Q, ' il .7 l Adcock, Meri 2- I 6 17 It Alberson, Carroll ' x 5 ., L A -ng, . v , - 5 ak , , 1, f 1 5 K 4:2 t. -1 . ' 1- fi' Alexander, Mary M L f . . ., . .gg f E ,,, f f,,f ff,--,,fvg,a L 'ft Tr ' Ff4S"1 , - Q ,XXI fi Alpizar, Alicia t l i 6 IfV1'f5'jfy - , 'uf 'C 'T Q-11 ke , QL., Qi A , it 1.1125 Alexander, Suzie 'UN Alpizar, Shirley Annette i , "-L1 f I E161 m Of, IW 0,5 a ' - 6 ,, . rv-4' Allen, Dianne Allen, Lois Allen, Sandy 1, . t ff-3 Q7 'Dah ,,,, 'N- , ,,,. is ,f .J Nt 2 Q 3,1335 , Y y JW? 1 ga, A - '- R' 1 , f ! 'U' Anderson, Bobby I ,P Q Ard, Carol Armbrust, Dianna Marie Atkinson, Diane A as Baier, Diane Bailey, Nancy egg ms? 4 ., S. Bailey, Paul Atkinson, Kaye K Anderson, Glenna Anseaume, Lynn Antonacci, Carolyn fiifi-.si'E4ES' ' 7' iffitw' WH l ,,.. n 1 ,W ,f Q50 yu... r , , Austin, Kelley Bagbey, Sharon all Zi Q at . t K -,, A N p .. . .W , A 5: Jlffwb 1. S Bailey, Vikki Baker, Margaret Ballard, Blaine Aldridge, J alynn 7 --??iZgi2LQf2""-WA , ii'11,gm-,fdfigiiig , iw :'..:':sp5tgge:":af: M -I ,M . , ,L .,. ,igjajx Q ' lwgp 1' ff f A Ballard, Ronnie Bardin, Joyce 2 304 1' gk Barnett, Kathy Barnsley, Jim M1552 M411fX?i51iQ22gais53Sgg5gE', L. .,,. .A .. M - ' -- ' iwgzwi ' 1 if if 1 ik X A 5' 'N f ,B if i. Q 4 'Y l ,. Bauer, Sue Carolyn Baxter, Phil Beavers, Phillip Begin, Martha rv! gm ...Q-" Berry, Jerry Berry, Steve Blalock, Bob Bland, Linda ez " 1' 1 : a2f?swi5iz?L1EH59iF?Z" EMM ., r , . ,, ...,. . W , 5'hZ'U53f'f,': " f'f,:H:f1:l5fl5L2 2,43 my we 15: mlm s germ -K fix galil , is ff'-' 1 i fl V ' ix Barnes, Janice Wish ,..,fx,: -wwf . N V' S Bartholmey, Carol ay., Beal, Sharon K fzzegisrgg f 1, :mi frli La.. if Bell, Woody mf Besancon, Charles MF' Blanton, Delores - J 351' ..s. ik- f,,2.flLiv' -I, .4 .a'n'.'a . .gi-A.w,. ,Q I - r2nY1?f?'5?5f,T t .' Barnett, Donna a.-.-.1 a ,Lf Bartlett, Becky , 1 .af 7' si., I CQ29' ,MXH Beard, Donna X' Bennett, Bill -4 . ' 1 1122325 - 45' Q :lf , f a Bilbruck, Mike l Bobbitt, Cynthia Class of '65 .i ,,,,-r I Bates, Becky Bauer, Jerrye We " .3 Beard, Tommy Beasley, Peggy P J asf . f .nw- 'T Bennett, David Berger, Julanne time ws: ,ga L ., .7"' 'fff' .Q ' mf' 71 M. , Wy. X .H -vw ' 1 Jin - a Birchett, Geraldine Black, Johnny ,.m.,X Bolin, Jimmy Boshears, Robert Class ,qs lf, 45 I N "'9!?-me L Boyer, Terry 'Q is . L5 ' v ,vswfy Brannon, Beverly HX, . ,V f 'Xse- Brown, Kenneth -.f Vgr.' 'Q' gf: Q i it Bryant, Donna " y + .V' if l'L , Campbell, Buddy of '65 'W' Bri it ...qi 1, -.-1 if -, Bracken, Bill if " 9 : ,yt i 1,4 , ' ,F gy. XJ . Us Brashear, Jane B rown, Margaret Burnett, Valeria Carmack, Suzie 'Q' Boswell, Suzanne Bradley, Marilyn , 1,3 95 f 1 an f ,.,,, . Brinkley, Carl 'IJ-'WSJ " . Q ' 1 -ty Brown, Paul Q I' 'w"YJx ,,1, .Ky M a 1 Byrd, Johnny L W .5 es 8, I M A.. , . 4- '59 gg? " X filv Carmean, Carolyn .., M Bowman, Diane ,,,, . . it . T ' V 'S' t ,,,, iw wifi- .1 412' Bradley, Paul wr' A Broekinton, Shirley M s Q fs 'Si' 1 ' an if Q 7h 5 Browning, Wayne ,-Q, an Ei, .- Q .S 'e ww" Cagle, David Carpenter, Larry 4,57-. ,W ' Boyd, Nicky YVV, , .. B 1 '55 A E5 V M - M" T 1 L' Mali '- ,r2gs?iEf" Bradshaw, Joe Richard : """'?2'4 ., Brown, Danny V. . . 7 i il M, , 1l.,,1Zfa Bruce, Linda Kaye I fffaez-,arg 1, M ,fm ,an ' E M- al v Cagle, Ralph ve- X fr Carr, Don ag: ar ., .. :,, - wa .ra :-' ,E ,.,.,.. ,Q ,Sim is 556 ' -V , saga? -Cf 555. -AV" 11- M, F I Boydston,Glynn R. ,gh iii: if .if-Y ' . J? 3 , I' Branham, Janice :f25. ?'?Q as M lj N- a Brown, Jerry Brumley, Vicki .V f ..,- fu' - p f Calhoun, Jerry V 4 X A 15-Q ji "' ...M 4' Carroll, Charles 3' a, Vl , W J, lg. sea .Q J Q 3, t ... h, on W 'U Y y"'-fx -Q., , so 1' 1 1 -' , - "' yi 'M , " ,L-, , 21 Carter, Danny Tzv Chrisp, Ray w F' Nw - Codding, Mary agar f r .,L, Q ,N ,K Y ,:. X -.w -' "Wh J I Collar, Jim . 4 ,fi lf N Cooper, Larry Cox, Carolyn Carter, Glenda Ann Christy, Tandy , tw, 1 , , S f, ii Coffield, Cathy Q, N ly n' Conley, Sandra Copeland, Berkeley fi T15 Cox, Judy Cash, Robert Y , ,rr,,. L f f,f11f2:fai ' ' L , 2 B? ,...f. YOU. , -KA -0-' , , ,,aV2,-352. '- ": -is . Q , Clark, Betty Jo ir vii Coker, Shirley l ,', Cook, Hurston ff Corbet, Kay A5 aw' ,Q , WF' ' ,,..,., Crawford, James Chrisman, Cindy Q , U in 1,15 f. fu-'E ,5,. L fvlaux ,7...,, Clifton, Lowell D. wn" ni',, . 2 All i": 'V " Q 'sa Colclasure, Donna Cook, Joe ,fn ri 'f if X 'vi ,ii ' N XV fr Corder, Linda our Creasy, Gloria Cass of '65 , fi re I fe Clifton, R. O. Cockrum, Cynthia Cole, Irma Coleman, Thomas C., i a , a ,, Cook, Ronnie Coomes, Linda Y-1-is 5, JS 1 15 Corker, Mary Coulter, David f - nw? I ,wk V V ' f"'V I ff. J , ' 1, -" , , 'M J' .x ,,. , , 3 :A ,ff ri - Q-'A , , W ZX, . X 1, .5 Creasy, Judy Crews, Robin J Hey Bobby, l heard you won---Paul Bailey, Bobby Mills and David Roberts await the an- nouncement of Junior Dream Boy. ,, K.,- ,, W infix, J ww 4 2 - -fis- .i y , W . 1:21-s',,: g, Crews, Sberry Crow, Judy i f, Ffa View f J A- C 03' 'H+ l J 4 wk ,J fp ,M ,, , , W Lf- ,,,,, , , , M ,,, 0 , , ,i, ,, aw J K sk J Cummins, Brenda Curry, Jackie Curtis, Bobby Cutler, Barbara "':' ' " , JJ Q iifigzgeiiiviif - f' P M M R J . il il yrs .3 - 'fl ga v "2 Z ,1 if? ,A W ,,, A, .Q ,BX ' Q1 5 .. 'yq k 4' J A ' 'Mu 1 N' , ' ,-3 ,ff , Q' Q f iff, . ,, I-Qs, ., . , l lk-. 1 i J' E , Li.. , , ', 'L -' ,yi Davidson, Jerry Don Davidson, Judy Davidson, Linda Davidson, Robert S .. ' ,.., , N ,,,, ,, , Q' ' 7? in 7 R' Qs 4 , , 1 k ,J ' 'A W J ,X ,- ,1 V , .J ..- , 1' -af L, 1' , ai... M, 1:51, 2 +V , A ...W 1 753 my " ?, , .i,,gQ? ' , -, ,,.2 , ' 5 - - ,,', ,. A ' Deaver, Billy W7 it Dickerson, Brenda Dempster, George Derden, Curt Dereuisseaux, Diannia ,345 N... H4 .,. ' K. ,,,+ 4 grimy' 5 W , . if -of . Q,,,-,v Dickey, Dorothy Digby, Bob Dillon, Becky rl 1f39!- N-.... ,X . Hpfx A Croom, Mike 1- :ag:fQ11t:"+ga vim-V A ,t ,ig,,,,-,it,i,a, 5 , Q 3 ,.k5iQ,,l2i,,fQE, Q - 01511142 ' si ifigmlia - "'d?4fii , , .-r 'PN .. ' N , - 5 M,-.. -,Si Crowder, Edward if ,,i, 'Wm fs, 5 Cyr, Tommy A, gg, if Davis, Jeff .,.. - ,-4, . 'r2:55,e: Dew, Linda 1 'Wi as r 'Y J Y IL 5' D- Dodd, Larry 1" fa11g. 3,,, , - Mia, wiwfa, 'Q all Q, ,, -wt ' 'v-"" Cross, Rickey Crowder, James Daniels, Ben Davis, Pam . fi fi ' "R I -iiifli Si?" Si? 5 'L' V :,i,:.,.,,.p:.,,, ., my , , ,rage Y V' fi f 5 H I A ik 1 -'P w Dickens, Joe 'Wm I' So 'N-Q.. Dollar, Margaret Ann Douglas, Dian Duke, Jimmy Earnhart, Linda 25ffQ'.1gf:sE? :,:.a fa: x d , , M .K - w A 'Suu 'X 5 1 1 gf' 'V ?' Q 13 'Ek ma y Q-5, A 'af S' -v 44,5 . W 2 z Dozier, Alice Duncan, Lynda . I 15 n 'S N ' 3 ..,-ff , if .af ,ef East, Larry Joe Q Endsley, Barry Eugene Epperson, Gary ' 1 me .w i if-M--v I 1. - , 'ff mi 'F' 'L' .i ii T Feagins, Mary Jane ,m y rl qi , if Q vsp. Fisher, Charles fx IV Fecher, Melvin bf' Y 1 . Draper, Roy Pam x-15' Edwards, Daryel W F T13 rg fire' ...as .W DuBose, Bobby Class of '65 Fx, boi ..f-2 Dunwoody, Bob Durham, Ronnie Eanes, Tommy f, 'vp-,. , g X 'W q,,f? ry 'tx 6? re: ay, L f A.. ' .,.-.. V iff if if enii Edwards, Paul Edwards, Roy Elders, Jimmy 1533321 bE fx gms vu Lf 1 ,V ,..,W,,Q-w .fry in Wx 3 x af 'Q-"' , 'KRW , .J i if , Evans, Sharon Everhart, Bob Fain, Bobby QI My-'LK Fearneyhough, Ken eff' -375251 '-4 H, ax" ':'s , fame N 'fm f 3 ' F154 X , W ., X' . Af, lf, . 5, .,,., MV, Fields, Candy Finnegan, Bob Finney, Mike Firestone, Sandra ,- :iw .Mu .. ,. J .. ww ,.,, rfzw..-'sau v 4: .,.. . . gi as? rf J lf! :fag as ..,,, X , W fm., ma, ., vipirsgr an W , fm.. A if SP N .. .. 3, .,. Ziiis, L.. af H1 ff 1' J Q' 4 R SQL 33, 3 f all X s P-W-...A ' my ,.,,V Fiske, Mary Katherine Fire, Judy Fithen, Carolyn Fleming, Anne Fleming, Larry Class of '65 ,Is fs ti ' Il' .,-. . if Ford, Larry Forster, Judy wi ir 'ta QPF' Fulton, Lynn Furr No ma Jean THE-i5Ei35l?f" X it V N it 5 is 121 , f"f'k,:h-Q, f Q-gm fr W if K 1, 'lb-f , ff ' 1 f' Fleming, Richard H. French, Carolyn we 5,3 ,if an ,-,,,', ' i o r , nr r f L' F l ? i 2-75 I ..,, ,I A K M We lrr 'if Gann, Leslie Gardner, Becky ,,.:"-an--. W. 4:5 'tl Garner, Pat Garrett, David C. George, Linda George, Bobby Gardner, Don . gf , Ax, fi xg.- A Lai? 'A 5 , iii? ag ' f r Garrison, Phyllis Giger, Lonna Gadberry , Lowell, Jr, 'S Cm , ,, pa.. 'fi it Fleming, Sandra Fleming, Vicki f , la. if 'fl1,f"fJf . fb , W Q , ,,, L ,,,, F, French, Sharyn Frost, Gladys A' ,.,.a-f N. -fm, E ,G N ua fl'- ur i 5 e qt J' . ww 1 -g,ggv,. ,,,, , . , . mfs, f Gage, Karen Gales, Creighton nm, 'Vx fn Gardner, Kathy Gardner, Worth 'D WN 'V -Qt , will 4 Y? 5 , F S: ! HN 1. ,f Q Gaslcins, Brenda Gates, Nancy Kay 5 lf VX C ji: X ik fe ff, fi if Ein? .J '- -. ,5 fm' 'zewsgf mafia Foltz, Louise Slim :1134:.git-',...q,,5,gg,'g,,,- 3 I , . V 22151 twin, 1 , 'Tlx' U" zz ':!:.':.::'..' , ::.mg,f .,,, ,, lif?i'5'E" 1' . il " W , 4: SS 3 .aa 5. ff Xi is nal f' .F S 4 . , . ' , FH 5 F ulford, Margie Ann CITY' Gann, Jim Garner, Janice I Gates, Richard QQ fm- an 1 ,U Gill, Larry Gilliam, Martha Ann Ginocchio, Terry l"WHw,a am. , .-aa, I up F B W., ,,.,. J 'T Glover, Kenneth 1? M 4, , 'KT' , xr! Gore, Pat Graue, Thomas new - V "'w..f' I Griebel, Dale is +11-'Z Guess, Bob ,5 fy is 5 -0 'ffl' 3 Glover, Rickey Hb .gi awk ner Goss, Jimmy f - g 1iigiiiiirfl5Y1S9?7li?ZltW54 ' J- rin. sfzf52!fff'f snrli- '97- -, wg - , , e'-f, 1, 4, I 5. s "Q ,.' 34 , ' Il ,Q Z ,Qs '4' ! 3Y Ex ' ' 'iii I-:.:' -.:?y:ZE'7I,:f:' ug. ,, I-:::'lf35 if' ' 'v Gray, Brenda Griebel, Gary Gunter, Keith H , i,kV 'gg 'k,. A ' K H L ' we-. M V' in h ',,' 11" ff 'vw' 'W' .f A A 3 'F' H ., X x Hale, Paulette Hall, Whit Hallmark, Glenda Goodwin, Buddy HIK Grace, Gwen l Greenwald, Jim Gross, Brenda Hahn, Janice Hammond, Joe Mike is Talley up the "Worth"---of these two performers, Larry Talley and Worth Gardner display their talent in the Wildcat Follies and any other production they can get into. x ga 335 .KQV 1 , ,, gn pplr, .VVV 5 31 "f- :Q"2"a'f I T Harrell, Mary Nell ,SQ nerr'- Hawkins, Gary Helen, Denise , in ,.i. Harris, Susan X 1 'A Q -13' 'vw -T '. ,, 1 . ,ar Y',? M , .., Hawkins, Linda '25 w N- b Heintz, Nicky 5551 vm ,, , . - 'F V AM QQ I i L 3 QQ 'S , we 7' Hern, Pat Her ring, Elizabeth Mala v ' 4 rm .ww , , , Qi? G " H Harrison, Charlotte nl 'J' 'Nr , wx, y "' 'weave f- K f-in if Hayes, Billy r -A img, 1 'H .mrs- llelms, Alfred l yt . - , Q. ty!! 7 'Dx 35, ,XA 'Y' 1 ,,, Le: E if .?,-.,.,. -.qc ,Q , ui . Hicks, Delores 0.1 In , ,, . 4, 3, 'Sw A - K' fifigw' 2 'Y' Hardester, Richard 'ST' Harmon, Cheryl -,-fa" Harrison, Sandra it "I Haymes, Jackie Vi' wg, ,pg L -1 ,wo-ff mmf 14' if 1 Hardwick, Jeff , is ,' Tv" v- 4-5' W 7V,. Harmon, Douglas ,L 9 .ML is A B' , ' Hartwick, Lynda , 'fa ,A K V A-4... , X , ,fs-P "'4"Wrr Hays, Pat wr ' ,M iii, f7" A A 4 ,Q Wk: , it Hargrove, Larry K ,102 4, 'Q t w , is Harmon, Gregory ' AF? '55-iw 15" r M- ,M , Harwell, Eddie l. llearne, Robert fx W I 'few Q G Ki ll. - , ,T .gg lift: ,',. Hendrickson, John Hendrix, Tricia Herlocker, Randy , Ni! , ' ,F Q, 1, sw wa, I ,R ,K r , N. ,, ' ' H, M W' '-L13 .-. g 43, If Nw Hicks, Linda Hiett, Dennis Hiett, Ginger X, as hx W - ar- f W M, Hight, Charles High, Rita Vs -.THQ W, gf V 'K .135 'A eff? -.. ' ...- Hinkle, Kay Hinton, Pat 'IES vs' Env' in fi ,W 4 -nw r ' I 1' , 9 'J' gl .-f:zz,l,..:, - ' Holbrook, Jerry Holden, Pam u.. N f ,-. , "W as , -... , --...., E Hollowell, Tommy Holt, Sandra ef? l all Horton, Kathy Hough, William fs 'S V . ff ,gr gg 1 Q fat M' , aww W I WT .f if fx Hill Hinds, Scott Liz, x Q 55' Hobbs, Carolyn Ann Hoffius, Cecily Holden, Ronald Holland, Sheila ,sil,,.rl ,i ll. , flQ.,gmigi.?e, lf W' ' - , 5 f:15H'1fffff!1l, e' v If 1 l , 3 , ,,,, Li ls V,.d Hooks, Steve Hooten, David ' 'iezfwrmaiffw M Y . '52 If me 'Q' .C se, 7 1, XC' f? J House, James House, Ronald Hugh Rr gl ll, ...f Class of '65 ' wa, 1 .eff t. .. Q Hogan, Gloria " A , ' , f 'i'h ' Ti' M, ':,,, ... Ma , pi ,.,. ,r ,, W , ' Q xii , ,5,,,Pf'4a M ' - . fu gg w,vf,:.,. wig 1iv'i'a,j'?3"'2,5 1 f" Q' Holloway, Dora Hooten, Kinney Houser, Phyllis 1 4, A my lik ,Fl Holbrook, Fred Holloway, Jay Hopkins, Paula C ' f" -vu " Houston, Pat , X , f ,N VW E- Mziirfffis " ' '-if-ffl? S 2 , W' ' wfv Jw Howard, Harvey Huckaby, Randa Hudgens, Larry Huff, Kathy Hughes, Laverne Huston, Mike Class of '65 I '92 lnmon, Steve ' an Isbell, Dale Jackson, Russell Mig Jaynes, Ponzie Yak -sc' M 'W -'k5'e., "99"'? ' W X .Shy c f ' ,W "Tariff 5341 , Johnson, Gary Johnson. Judy TSM Wil- I 153' . ' . .af , . 'gg K iffy . , si c J". -' t i ff c ,waitin aff Jones, Charles L. J Jones, Linda .,,...-,.' g A .avf-'Q' Huston, Sandra Isbell, Jimmy "fv.T, gf' Jayroe, Nancy . 553 "'- Y T ' i'1'f14'z'2zi5! has QQ Johnson, Steve Jones, Pam Kenner, Tgmmy Kempf, Tommy KGHCIIICK, Nancy Hutto, Jerry W2, fx M . -lifygjlgggg ffigiiii- " "L...W....J 3ws??a.afist 1 'V wi K f '- amz -I , 3547 Ivy, Jacqueline 5-,L Wt- V 5 lfiw ,K , 'W' f I Q Jenkins, Dee w,,., 'fuk Johnson, Tommy f-. fill K 145, f ., M fri: 15 -,., Kaiser, Robert C. , ,, . 4' I , ' ' 'W' If 1 ff I . . Ig, Kendrick, Raymond Imhoff, Martha ,nf 1 fr iQ Jackson, James :vmsszezeaaz:Wg,2war" 'mwigewsazrefawfwfww: aw Niggaz ffgmtsg, Q, IW 5 W' - 1 ff K lijs ii fi 2 it Kiih J etton, Max L s . ' " ' , ii I if, .. I 23? , ' " "Q - fr 3 Q. -1, '5 ,j gl A .,,,- ,.,.Vl . Jolley, Jane as L Q... u F I wif-:fait sn 1 - 'Hifi' I v L Kelley, Karen . -W fum ,,,. 963' iii AVV, Q N.. V ii 1' , Kerbel, Rick k V AQ fifwazzssazssazfwagii- ez. lame QA- ,K I 'ali mia K. 44 j .1 wt ,Ji 5 will will . ,, .y Will ilu Ingram, Jeannette Jackson, Judith Ann V +295 15, 5' I 'Ia . M ' 'Q . k Johnson, Brenda ,sf Jones, Carolyn .git ,Q -c Kelly, Jodie if M 1 sl "-+ WU' 9 all 'Sm ' -'-'KV55 A 11zFl,l,i:f's'l JIIYN' Kilburn, David aww - Q K f ., if, 4 QV, ' ,Nr , D Killingsworth, Jo ,M K ,Z 'A at King, Carolyn n."'T Klinger, Susan ,gp Lamb, Nancy Lendermon, Betty H 'ifseilefi LW fem.. --ua .S I X , l I Little, Rebecca at fwafg 10" all tif? M V 1 5 1 . l t M , n x 2, U Killion, Nancy f'Z'.'+1 TI-SSX HT.. ,W Kinney, Reggie .,,. ri r 'S FH K' i 5 I var N 4 A 'Tri Knife, Raymond ,,.,, Landers, Linda Gail Killman, Carolyn Kirby, Joe ,F -. ' , ff' , V, gif ' if t . . ,, a'0F?'l.. Knowles, Lynda Sue ,I-Vi-. ,,.......,, ' Lange, Chuck H 1555 as AHA, View X ', 13 T LeVine, Judy V , 1 S Agia ., ,,.i ii Loftis, Ronnie Lewis, Kenneth f . . -.5 ,,. .,.h,,,, ,s' 9,15-'1 5 Long, Richard W. GO' ,..,-- Kincaid, Jimmy Liv- -was . Kissire, Weldon K T "' 'V,.. 1-il L.. If I 513' , ' H ' Kuehnert, Gail .ws Mb '57 Langley, Anita w e M. , ' I 6 . . X, . . K as - 4,15 r yi 1 fs S2 .- 1 If Lindsey, Nancy i r , "2 -"' Ng 'S L at ey, ., W--f Lowrance, Linda C ass Kittle, Barbara Kuritz, David Alan i: I 5 '-1,525 -1 'ZSBWKKAT ' W- 4, , , , , g - ,, f 2 ..,.. , H - : i N ,,, H Langley, Linda Lindsey, Randy Lybarger, Barbara of '65 Zi ,gi jk ESQ If gl ... air If nfl f 'u rg.- Kittle, Sherry , Mfsvm Li N tiara , I I ph 1, .-,Y , I' r ,. elfilfv' "" ' , Laman, Cynthia Laughter, Rosemary ww Pun-vi Link, F reddie Ann Mansfield, Pat S Weelll---If you must know I copied it from the "Beatles." Merrily Orsini and Buddy Campbell "howl-it-up" for the "Wildcat Follies." fig?--fsv aaaeii,-:' .VR Q61 eg- My KVA, McCollum, Billy , Ltflr .. , -':,,.f':..:- s .,-e: i :-- - rtatt odidi J J G K pi, Sf W ' U K rv W' 5 McKee, Janis 1 I A McRae. John Pemberton, Jr. Meredith, Jerry Q. 59 if McConnell, Marsha McLemore , Sally 'xyifkw " t , 1' f.-,, ww k , , 0 , 14 i McVay, Brenda Et, Miller, Betty 1 ,, Q '-'59 r, 5 iw JY g P 5 by I T Q - McElroy, Garald B, ggi , Ji McMahon, Barbara ,J -ya1- :ui ,Y 'Wim 4 , J il,-fix'-'jj, 'E ,rwwwkaa J ,, ' M ,say Aw ff' M ' Q, ,Q " ' ..,, ,, xi Libr' P if? . waxy, 1, y , Q . . ' Meaders, Pamela Jo Miller, Diane as mwagsgag Marks, Bill irxtaw, Martin, James Paul if J his McElroy, Sue McMillan, Betty Sim Q ya yi :- 1 at M . ,,, .,., W.,-, sa, 'azz it 41 va ' an - - , ,,.- tx 1 Meadows, Wesley IA, ! V X1 M., Miller , Diane Lynn . L , ' 'J 7 -5, ' ' ii , ' ' ra-M ' ' l i , , ,, B at W X' r . ' J Marshall, Brenda Martin, Linda McElroy, Wanda Mcmff, Bill ff' Meeks, Barbara R its ws 1, 'Q Q 'rs- S K J' Miller, Paul W. Martin, Diane McAllister, Linda McElyea, Sue McPherson, Jeannie ,N Q., ,,... as-H 1 , .,,.. . 1 ,...,..f Menlchoff, Dave VR' 'gi 5 ' V 43, .ms K, x J ' Mills, Bob Mills, Jimmy ,4-r an Moncrief, Bob Alyce Munns, Jim EE' :E X' , 'Q nl 'W' -f - ,gt ,Z 5 .35 V is., 5 :. ri, Q? . Q - ' Nakamura, George Newcomb, Randall H nn ,Jx Mills, Libby Milner, Connie Monroe , Ducarrol Montgome ry, Annette '- biiieggiagv Q, 'B 1415 , sf IG ,wp- Moore, Clarence Lee Moore, Elizabeth Ann f Murray, Betty wif?" fr 'sk Q 5 C4 Q' . "" ,l fi.,:,x Murry, Richey Wsitmgfa- I A . ilrfy Jwsnsw-ww ,.,, , V' '33 Saw J 4Qi:',3 we Navra Robert Nelson John 1 1 ll-11' Nichols, Jay 'S NW' Niven, Bill mqyiwm K W.. ,, "' fm, '3ii5i'TQE?' 2, 1'q1f-ffffi: 'Q '14, f, ' V V N... ,,,r 1 Mitchell, Danny R. Class of 65 Montgomery, Carol Montgomery, Joyce N. fb lv-sr vw.. "v-:A-,Q IL Moore, Judy Mullen, Judy Muse, Bill ,JJ Newberry , James bran .ed ow' ,H Nixon, Joe 195. , ..., ,.,, ., , 5 my ., ...m ,.f.4?'52H-.,n- ,- , ,,,, , Egg, ,,.., ,,,,m', Q, - Myers, Linda i ' X klin B ali! il Newberry, Jimmyjf. 1 f-.4 KA x Norman, Larry Joe -4 ,, .as auf' f-.fy Montgomery , . . ,,. FET' f , V, . 'fr 5 - .P if iw I 1 --f , Y, M, A ,c ,1 , K v m Pl g'l,gi1.Y'3I??J?,':,,f'H xx M, mx xx.-N n 1 Sam 4 C .U ,Nm w L 'W oi , N ,,,....f , ,. x... 1 . 3x 'g':i"' 22:59-'.g..'.Q -1. c , if x ut -w u?mJx.?O'v' .Jlw . g u Q- ,141 X wx .Nl ', JN ' vigil .. 'J u M 1 '3 'J NU ummm' . ',,2,.'. A ,,., Munnerlyn, Donna H' 'JSQTE3 9 ' si lk! ai fggg. . , if Myers , Patricia Ann b .T X,'.- A , , Al Newcomb, Brett r .1 ' fs. , x. . V 5, 4? fe 4:51 - " iw . 'hiiiifetfiifsifsill .m f fait Norman, Mary Sue Class of '65 .Img 'Nm Oholendt, Becki Olszak, Thomas ., 'rr 'Q YT-is ...av 'N'-it , Palmer, Steve Papageorge, Alex ""' C Pechoski, Johnny Pennington, Linda EDJ 1-,f --.,,.,. egeglqgzzegfz ,,tsm,, nkl 2 X lgiiiflsl - .Q ' Q 33 'Ox 4-Of -K fri., ,N . t .5 ,J 'P , V 'le W' ff' K 7' ooo nw , J qno af g A " ' ,J 2 5 B , Norman, Martha Nunn, Roger Orsini, Merrily X Parsons, Norma 1-'MWVJ ,,,4? ' Q' 5 f W ,Ww- Penny, Nancy L. Pwr Phillips, Jo Ann Phipps, Dane Pickthorne, Elaine 'L f if 'I' . 'Q J HW mm , A- ' , - . M, ,yi ,I giiilintg K fi 1 I ' as Plunkett, Bill Pohnka, Fred Poindexter, Linda ,vein 1 Osborne, Fred ,Qi Patrick, Linda 'fr - av? it , '. S .. naa Perkins, Otis Dale f"'N w Z ,X ,J . ., wr .npr ., -all Pierce, Sandra Jean . Pollock, Earnie O'Brien, Wayne fQ,,QQj 1 an , f x- , wig? 7 9 ' V' 'Ov -- - V "f ' ph -.. Q1 , - 'im Ostedgaard, Cheryl Paul, Jerry Philliber, Pat W 7 'Vs , . N.. ,- Piercy, Hal L--as Powell, Linda Ann O'Cain, Donna Ann Outlaw, James - - 1. ,a v g ' ie Jef? wwf? S 2 as s r s 5361? 9' as 1 ff if W ,. ..... ,i Q' is Ji vii' 2 A 5 N ,fa 3, Pearce, Janie Phillips, James E. 1-W" Pierson, James Price, David 52 f Q? J 1 1 f , , 't x JF 5 fm at X "' X Q , o- 1, 'L 2 Q us Price, Pat R . .J ,,,,f1, ' .-V , v Purnell, Jimmy L. Qs GW Red, Sandra f fgxi 4 9 it "7--5. cl fn Rennie, James , M 943 .MY JR, Ridling, Dianne Roberts, Linda . --.. . , X 5 1 "" ,., -,., X ifsa Wy, wr ., V, ,,. t at it Q wg., it . 'MSI 'kms lx w ii if Price, Tina Pruitt, Judy Purifoy, Paul PPRP if' Pm ig A 'iw 552' 'W EU agar W, I' ' , ,fs Qualls, Don Ralls, Dianne 'fi ...av Reed, Jay Reed, Ronnie ,-nazi .av-fs Reynolds, Charles Rhoads, Rodger eng L A Rinehart, Joan Roberson, Fred r -3? A., ..,. It, Robertson, Connie Rohinette, Kenneth Raper, Ken e 7, iff?-s N ,Y - f- 'yah 'f., an I Ve xx k"' ' - K 3. lf. M li Reedy, Linda Rhodes, Judy - - - t -W ft A f rw Y 25,5 2' s .,,, . Roberts, David B. Robinson, Barry Class of '65 Ratcliff, Nancy 474 1-'IZ QQ -..,-1.. 1 asf g Reid, Don ..,:,,f,., . , A, ,. so fqdbiw m L Rice, Larry 'fvo'X iw Roberts, David H. Robinson, Betty -,Wim ,Jw J uoit Rea, Delores Jean Q35 Reid, Lee Ridgell, Ronnie Roberts, Kay Robinson, Debbie .-fl tri W W ,- T jj I AI ,, Robinson, Donnie J L I sl SN H55 if Talent --- A perfect description for Barbara Jo Simon's if performance in the Wildcat Follies. If . . 'Mk W' S' W .3 it Q up o' A-"I XV Ross, Sammy Rotton, J, W, f - 'X sw Q 1-A ang., . x ..4 1 ,,,,,.f .- Rush, Mickey Rydel, Ronald E, 3 i 'Q Th-a Sangster, Jackie Schaeffer, Bonita 53f,-f,sxsf5gggg5 i '- Q ,i ,V AVKL. 1. Qatfe fv 1 , ai", 'Q-ff" if dpkg .A-fa Shanks, Elizabeth Shell, Ann Roper, Darlene 9 ,J , 7 fm my -fi 61 "' -. is 'LL-lf .,. A ,.Vk 7 Rowden, Jennifer Rowlett, Marion .WR wg, fx 'wif t Q. N 4, 1 . Sadler, Susie Saenger, Sandra Lyn V ' ha. ' . .f f f vi i" ' Robinson, Marilyn '11 Q-:WJ Rose, Charles Roye, Mickey Sampson, Mary Lou . I kN, -iw1fiW'E V.. ' ' Lat ,gs , 3 an :sf in "" aiiy "' Q 'ii"' wvlfli N 5 'X i Gai at 52 .al 5 Nr 2 fe V "4 - i 5' - ' Rogers, Linda ' .,i,.,.. ..,-.. . as 51253 Y ,L -.. ' 5 vm.. .,,,x ' . Q, .,,f ' 2 Ross, Becky KS' x, flqsm wa QQ... .nf WE- 22 + -Q . ' v- K og, 'ipaq I W Ruple, Jerry Sanders, Gearld Schmitt, Wendi Schoonover, Lee Sellers, Larry Senteney, Eddie EQ k : N, yur - 5, fewer I. N I, - , , .. li l?'+w 7.: . f,,Af,,-' sniff, ' 1 ER ff 'L Shelton, Janice Sherrod, Sylvia Short, Betty Kai Short, Loretta f . J ga? , U Q , K x 3 wi te kts, if V ,V 7,3 4 in 62 .3 t J.,-'xii 9. - was I 64 1, ' fg , ,-if ' VW. I K 6 'Wt ,t ' 2 J Lf.: X4 . i M i - 'wx ' -fel, 5 - t , ti if 1 325552. Shugart. Sue ,, . ,, E , E4. 1,5 w,: W ' C 1, We Wi to ' W f K. L Simons, Barbara Jo Simpson, Carolyn Ann Simpson. Mike , ami xx: Q ' 41. ...J ' .. -vrvf' V kk v It if it S 91 in 'W' gm S5532 1 ,, K -,, :M , s iii 5 f 5, 321 15 fi s ,Z M, fin! " Six, Gail Slatton, Carolyn Annette Smart Jimmie Smartt, Linda L, ,Q- Smith, Jerry Smith, Rayburn ,AM H it n u, . , 3 fx 29 ,. Q . 'uv' v If I+-if xv if ""' TQ ww K 4 Sorrell, Renee Sorrels, Gary may Stafford, Evon Standricige, Ronnie 441 x Q gi Stephens, Gary Lynn Stephens, Linda Smith, Sandi Smith, Sarah Sousa, JoAnn Spoon, Scooter fm? ,dana iw- Stanley, Bill Stanton, Sharon Diane 6.3 Sterne, Rickie Stobaugh, Larry Class of '65 i'f11w:f1, 5 1 .- ,vs y . .igggyqai f' 'lr W. ' . n vs . - ,152 I,,,,jg5,.,, V.: ,R fi, xx ., ' - gig kiiiljm Smith, Dianne fo- vw Snow, Charlotte Springer, Len .vs Stark, Carlos l Stouffer, Donna Smith, James H,, Jr ' tiff Snow, Diane CENA is W' up, y :xi H --MN f '- ' fs- 1 .. i-if S Stacks, Janis Stecks, Mike Stricklin, Judy Class of '65 Swindle, Dick Teague, Bill lhirion, Pat Thompson, Linda i - raw-w. ' Y " -A tgyfii' - was Q 'was ia- in .- x f Vx ar If . N-4' Vail, Roy Sylvester , Gene Ray K K 'Q all Teclforcl, Jimmy . . Thomas, Betty Lee fx' '- -'xr Thornton, Bob ' l"t -Q -ff ff" . , i J 7 Valentine, Barbara life A ' -,,,.a , sf' X All 364' Stroud, Dale Stull, Stanley Summers, Carlos 17- 75' :sl Talley, Larry 'vw V14 Taylor, Don Taylor, Donna V x i rf' , 3 r h , h ?2Wg,,g , e' 1- at 6. 'B , 6, i , . . 2 2+ N ' ,J , '53 , ,- :lf 5 J . wg, 1 Teclfortl, Woody Tharp, Pete Thibault, Felix ...QE e, f 'Jil' sf, 13, M .3 . g X 4 A ,rt 55- ,V M 'T' .r" A Q-H f ,.,,, M I Thomas, Don in f - Q-"If: as a I: V, J if Q ..,,. . ' Tilbury, Shirley VanArsdale, Ronnie Thomas, Emma Lee Toney, Carolyn f J?"'X Thompson, James ,,, ffiagsiia 1 -A, sfiliizwi .V -ffiizit'--Q Q .su 'fl Q 5 fa- - .wwf E f Trammell, Jim nn Taylor, Ron in 3 .N gi .2 " gs 'C '15 fn lqyv In 'r ,form J J.. ii! ill f N15 'Q 'w I I gg f , it-fi if Thirion, Linda fa?" , aafggisii lkxv H 5 K Thompson, John 1 ill. l ,L .- xo f x . if "" 5, ffl - " f is Tucker, Ronnie Vanliament, Nicki VanOverheke. Bettie Velvin, Donna UDV 7 ev' paetva uw Venable, Keith Vogel, Nancy fl 'X' s db .RX 'Y AA Ward, James Webb, Bobby , Wheaton, Darlene Vick, Kristi Walker, Jimmy B Ward, Linda ,W fiee V Webb, Linda White, Michael Mia 31,2431 it A f Vick, Lynnette t V. l f y . as SQ 1 -1 "W I "'9"' .5 Walter, Earl 'mv-rf.. Warner, Robert k 1 . K ., ,, Li' 'ki ii' Weeks, Ronnie K 't 1 ffiii? si Y via ,lg , :fi it pi. y V . .1 A '-. 'iz 7 White, Wanda , 'g,,gg1.1: , Q ' ,Q -'av ' ' .,,,.-J fi ? 'Is Voegele, Sue ,YW Walters, Marilyn .,'-r- c Washburn, Stephen 4: ,- no ' Aan- .ui Weise, Stephen Whitten, Don li Class of '65 W I A ,ig wg, by Er 3 D' ,gn gk 1, R FQ it ,g e in, w gs K Walters, Steve 522 1,15 ..-., rn , k , m, . ,.. , 5 mei? Q " Wasson, Lynda ffv we Wellhausen, Linda Wiegancl, Art Ward, Donna Claire 1 ,r , ,W ,yr 'M Y f 1 , I M, k Watson, Lloyd H , , K. was V 43 . M "' ""' .V it ,f is Va . West, Diane 154.2 i tv ,iit Wiggins, Carol A 'L f f . BMX " i , t ' tit' M ' ' PQ? A ' ' 'C W If., 2 l f 2 V A . ,, fr, W Cf. l f f.:f'l.- W ,I 1-ff aww' W V xl. . b-A , Q V I ay, .:'V. K .r r - 5 ii , QM A 7 VV f 7 xii, M . V ,.,. t A it V t W . as I 1 awp . in ,K ' yi , 'jk ,Q r" A s V . 'V X f fly Wilhelm, Ronnie Wilkerson, Doris Wilkins, Barbara Wilkinson, Nancy Willard, etty Williams, Anne Williams, Beth 5 The Juniors contribute an overwhelming amount in the annual March of Dimes Assembly that surpasses the sophomore total bv a magnificient 47 cents-- Williams, Ronnie 'QV ' ,....-av Wilson, Johnny Wilson, Shirley Wiseman, Charlie Witt, Vickie Woody, Eddie Wooldridge, Larry Wooten, Lindsey Worthen, Butch fir E Williams, Carolyn Williams, Tuck Wood, Gammah Wright, Jeannie tal' r ,, :'-, .Q ff' Williams, Cecil Williford, Diane Woodward, Pat Wright, Joseph L. Wright, Susan Yarberry, Linda Yarbrough, Joyce Yedlick, Karen Yielding, Gary Young, Michael Zermatten, Johnny 212 tr ' ffiiifff .. V U :L ',i, -1 , ' 'W' .le X - ' ,Mi ,ai rv' W 3 - 5 Qi i. ' 1 af if Q,- Abraham, Sammy Acosta, Wayne t .iw ii? is 3 ,E I , -wt. . f K., - .Sag-,,,-. Anderson, Elaine Eugene Eff f V' r f , X 5' KA Eh 7 lfiifvid g I gt if 959' 7 Bahil, Bobby Bailey, Dwight - -, QE,-ew 1 "":'fa5fa.as.':.1: .-Q s il wiv 'J' .kk, i, ...aa-v+:'f 3 ' Baney, Bangert, Nancy John fi Benight, Bennett, Tommy Janie Bivens, Blackwell, Jerry Mike Adcock, Wayne 35 Q , 115 J f 273,151 Q f 3 w g W Anderson, Anderson, Timothy Wayne Bailey, Graham Banning, Sandra Q ttb - W if VAWQ Bice, Becky Blakey, Don S -f .2-. -1'-we? 3? . 'MLISYQS fi, , . 'Mt ' ' DX" 53515 iii GL -. K3 W, . f ,-,, sl, gigs: .ai H , sz fijgsiif fiifff 212:12 519552 'ry v 1 H egg' ua lxwzsi A 2'515?2S'-'35f? if r Blevins, Blount, Sharon Cynthia Bolin, Gary Adkins, Sam Andrews, Lillian Ok' A ' we t ,- J ,, --.W '- f s , ,riif ' f-,nh . H ,, sw' 7' Bailey, Nadine Ba rnett, Sandy ,gf ,. J' ,figs as L, ar f- any :gf .'-.. L 55 L at igtqr, Si 'M ., 2 f J f Biggs, Erskine lr.--M -.mac S? ml W l fjjig,-a R- W Blanchard, Warren N113 Bookout, Kenny Va Ahlquist, John 1.-ras.: - if-Q 'n'i""iP+. 1' -, l 'E Q V f'-.xi , Q ,V 'M-ad? 1 La g, Allen, Diane , 541, ' Class of '66 J, sg, lf Q, V 'C WH, , . - gg an , L ,. f fi ' 'i' 'hi- la' Q, Armstrong, Atterberry, Ault, AVGIY, Phyllis Rodney Rick M1146 jZ5Lg2fis-.- ' :am G:-if A .way ii to g. gggg, ,V 5, Ballew, Bakalekos, Baker, Baldwin, John Rosemary Brenda , eg E z K W2 in Y i-4 ,- .f Anne 7, 2-,fgg,:f,,.,,, 4.-ef, t ' , 1- - ,f -f , .cs ,f QL, A M. J ...gf V Fd: I Barrett, Bartholmey, Bartlett, Beverly Biggs Nina Bland, Shiela an Bostic, Danny Gene Gillis lj Danny Biggs, ha ron X 1 ' Barton, Chuck 1 Q -' f , A z w e V Bise, Bishop, J eanice Larry ' A . 513 f A 114 Wi? ' f fl? ,Q ' I Y A . my ., ,iii ,M .wwf :gf , gf f Q, ' QL , ap. 1 Q- -V , " ff in I ,..,., I, . K- ,,- : H . - an i j Ti, , SUV N Blanton, Patsy Lf., . E -if if .-ff.. 'fam ' if ,. ,, I X fl Bottoms, Charles R. Blasingame, Blevins, Ronnie Jimmy nk ,ag FTW cr Q 4. 1 1. 1 1 ' 'X Bowen, Billy Boyd, Paula CONTROL YOURSELF CHRISTIE . . . just introduce the act, please. Christie Rodman, sophomore card girl for the Wildcat Follies. B 'fly ' Vai - nn- wa Q Brewer, Harold Brown, Karen V ---fV 'V ' 3,3l .ni'2 4 ., 4 . Wi. 1.45 RSM i Burlison, Tommy Butler, Johnny nu il Campbell, Wayne ' gf: my -wx izfzff X25 , Briley, Benny L' .km-,P is xi X fe . 'EFS-V' P if Bruch, Becky Burnett, Bill gs-. , -an ,ii C 'Y' T Tim- A , 9 as N fe N Q - ,. .- 7053. iz .v 1:15 af!" Butler, JO Elaine R' , in , I i, ,.ffwMj ,, if , .V ,M ,. ,. 5 My Candy, Robert .T-iz, ,g t,,. ,, 4' I .41 , , 1, ' O fs 3' A Q - f-if it Brinkley, Gwyn ,,,t, ,,,.,, , Brummitt, Marcia Lee cg 'V sfrx iisshl, VL,, Q, X L X: .f Burns, Laverne i ,,-' Qfgl mf s V4 C, , -at ' ff? Byers, Sara Jane Cargile. A nn ji ' L m,..,,, B rinkley, Kei th nf F B ue rckl in, Sha rron Burnes, Lavonne K , ,pm , at QR .,. 5 ,,,,, -swf' . Cain, William i'ROCky" 'Htl K i A I VV 'W ii lag: r .-Ui ' i Cu rroll, Linda l Brisby, Marilyn .,-, Q - 3 t., U W 5 ,A . SC.:-M Buice, Bill Yi K, "'?" , if Busbea, Sharon 'f1"'fsg-yt, - , ai i- Caldwell, Charles Carson, Linda gs .,..,,., . . .. , ..,it,,,, ,,,,,.,.m V. 'zizim,,,,, H . in , eiiw in 1 sw I-a' ' 1 ' rm Boyer, William Brant, Phyllis Brown, Becky ,, 1-,, , 'fre Bunch, Don W. Lx. , 'ii is ef ,- 1 if -. i Sa Q ii' E g In 3? x ., it fig Busby, Glen if is-f rw Campbell, Bruce fi, mi T Lf., Carter, Johnny in as D , 'ff Ra f is .- K Bradley Jerry Ann B ra tcher, Judy -, eiffgiie iw - . ,H . . "' . K h .Q - A1 sc ii 5112 Brown, Glenda - atifftfsawt l my L, -3 f ,,, B u rk s, Donald , vw- ' ,.4.u3" .QC 5 ' 1 if 12? B u s li, Tommy 'fl Y -.-4 .1 , gi ctw r ' Campbell, Mike ,W . i ., at , C . X i N 'qs- H, gr, if Ca rver, Carolyn iff? ,A ' 9 Bradley, Ronald ,,,E,, I , Qs -X f - 's Y 'KR . 5 - '-' 3, ,, 4' I x B rents, Nelda i 33 gy W 7.3 Brown, Jeannie 'sr' i K ,, ..,A .Z x Burleson, Brenda iii? uk fi., 1 ,i S, e7 F' ft 2' i lar' Butler, Danny ff - s if' , C A' , ' K 5 it ' A Ca mpbell, Sharon . ND- Casto, Wally 213 J" Cave, Carol Clark, Ronnie J. Conbs, William Paul rs' , Cotton, Linda Daniel, Patricia 4, .L Deisch, Sara 1 Q 1 fn- 7' , 4 - 1 mr Dillon, Nancy 214 V , at f 1 455, .- f , , 1 Q i if , 1 ? f " ,S -as 1' , mv, I w 1 ,,g,:,. - - , my p .. A Chappell, Judy me , ,, lf KI Cla rk, Ronny I... ,,f..as gm , su-v, Conrad, Billy . M i up 4? ev- K' 1,-:',.b ' Xi 4' W , Cotton, Patsy ..--f ., ,T Y cf?-2,51 ,J dk Davis, Charles af 41 'l ., .3 ,-.t i -qv Dent, Diane Dillon, Sue as A L, . J' we J J - v-- J . . M 1 ,',i t w' J 11 'ii -'il.l 1 a O 'A , " ' WVDV ' 'I in T K ' A A 4 Chrestman, Christensen, Clardy, Clark, Gay Al Dennis Peggy Jo , '-'l 'Q 'Q 'Q' 6' 3' WJ 5' i f , og' ' -,', 'Liyf VVK, , ",' ff r i Cline, . Cochran, Cohen, Colclasure, Cole, CO11if1S, Sallie Janette Ronald Rudy Johnny Jeff I 1 " JJJ"J JJJJ 3,.,Qi. J Jl': ' -,gp ' , 'res K a -0 "' ' r in - .., ff- 2. ' ' "" "' fee? -, ,,,.. .f M . p "Rr, LN- , .. Cook, Cook, Cook, Coomes, Cooper, Cooper, Barbara Frances Jackie Ra mond H. Beck e Linda Carol Y Y f aslrle X A Su v A V , JM . 'S' 3.1.3, W1 5 4 " 'D "" as ' ' ., , if ,-1, t. ' ' ' f Q E35 J l A . f a ib i . X . ,Aa ,, U CIGHSY, CIOSSIUHU, Crow, Crowder, Cruse, Dales, Jarla Kathleen Myra Kathy Gary Karen 6 . ' P Q EE sre J lscl R . if tw af! J A JM, - ."'.. ,fi . ii 'lf' f r 4' Vfyff ral l y lf ii? 1 Davis, D21ViS, D21ViS, Davis, Davis, Deeter, David Jim Johnny William Larry Wayne Marilyn James pm gk w i z A ' L .H ,v .2 , N, -",,, . . 257.7 ,Q , - 7 . as a ff A "if rl. Derryberry, DerVartanian, DeVore, Dew, Dickson, Diederich, Betty Ray Patricia Tommy Sandra Jeanne ' i a I M Q aa J IV: i Dixon, Dodd, Dollar, Donaldson, Donham, Donham, Shirley Ann Virginia Sherry Joe David Richey Boy!! check out that blond in the third seat. Steve Hitt adjusts the it mirror on his m , , ., at QW' - Bi 5 -we Eastham, Edmonds, Ronnie Norma 3 Qi 4w'3'a-5,5 Fegert, Fewell, Trina Gale Darla . ':-': "H f W -', if, 6 . S""A V rl Fleming, Foehner, Paul Charles Q-F Frazier, French, Tommy Sherry , J 5' C5-1' f Gann, Gardner, James Virginia icroscope in biology lab. Ellis, Phillip Jil. 1+ V yi Fink, Jimmy Ford Ma ry Jane -im . SE J J? yer is rss as ,Q 'uf' ,Q f W f Elrod, David t is 'Q ' Finney, Jan ,1:j:,, ' LF' N i Q F W J 3 4- I 41' 4' X. Ford, Sharon x ,, f' Purnell, Saban. Mice D680 Lewis Edwai , ,,,,,, , .,,,. ,I yu . , .... , V- A Q V QA J a Vi Garner, Garner, Garner, Barbara John Larry A. i95Ei1l1J Gm- , :elsif 1 '1 fy f ,ft X . Dornblaser. Cynthia is jim" R , A 5 G? pi Duke, Dean Dycus, Early, Wanda Kay Karen fi' mi ' h m t, it Engels, Ewing, Vickie Vincent Q VVI: -'-::.' t ,.,,:, is .ps-an S , Fishback, Fisher, Joe James Edward I t r Xiu, Fortner, Fortner, Bobby Jimmy Gadberry, Brady Garrett, Barbara G a d be r ry , Don na ,Z 'X .. . - - e Ga rr e tt, C h a rlo tte iff? Yi fu., .1 ai SW QQ-VSZJE S if T ,Q 4' 'S S J V5 5 1 4: Y x 4.1 1, it , 'if Dull, Daniel A., Jr Frm' East, Alice Faye Farmer, Sandy Fithen, Brenda Fraser, Ricky l Gambrell, Liz Ga tewood, Ha vanna 215 Giier, 216 Gault, Kathey onna Louise 'Milt M ' V 'ts V 1 - 'yik syn- Vi' Q., VS: Goss, Pat wa., an it 5' f 3 I .- Q' -af 1-aj aw Griffe, Marianne I Gazaway, O Gillespie, Dana is .555 :C 4 1 .' W 22 x ' f f i lily.,-Qjl Gosvener, Milton Griffin, Kay th V, Gentry, Becky Gibbs, Sue .:x- ,, i i-'-' Gilles ie Glover Goforth I 7 ! Dona John Gary tt, tm-'I' . 1 A ,V A V ..h lil Rial -E 1 "f"c.,,'y2"-, i ,gy , ,if Graham, Graham, Graham, Bob Lindall Lee Maurice ---:' if' .. J ' V' ' V ,, ,IT N- Griffith, Griffith, Grise, Randy Ronny John 4: or ,,,-nv L Gwatney, Hale, Hall, Hall, Marilyn Ronald Debbie Dianne , it J -I -.J degli, ,,. Q ' 5 ,lgwk V -,A Hammack, Handley, Hardcastle, Hargrove, Donna Lea Sarah Elaine Gary Wayne - 'gf .,r Harper, Harrill, Harrison, Harrison, Phyllis Lloyd Bobby John 5,,.fv Hall, Jimmy Harkleroad, Jim Gifford, Eddie Harrison, Kathy Goforth, Margaret 'Q migiriisfg 255 V' if 5 ' ' X' W, , Graue, Charlotte Grizzle, Carolyn la ' 5 'sv' Q Kyiv J Hamilton, Clay LiL?f,AT,'."4 L 15- 2, . 1 ,WW- Harmon, Rodney 4 , '2 . 1' , . .ga Harshman, Royal ? in Gordon, Brenda i ig i W , S, 9 ,M , 3 - gg f55i1f5L93L5 Xl. 'fE il'ffH: QV ww Gray, John G., Jr. E .145 x Q . , ,Q I' r " f' I , Guffey, Peggl' Hamilton, Linda llarpending, Mike , M, "1 W Hartwick, Terry s of '66 -f.s:w:1 fe fy vgtt y V ' MQEY ' Gorman, Ronnie Gregg, Brenda Gail 2 r -rw Wi . 'L J :lf ,Sa xv Guminsky, Tommy Ki. U lf f 3114559 5,412 H.-W ' Ei, f , an J ii Hamlett, Carl Harper, Charles M555 ei V ,. k Q C1451-vE ' w::,, Harvey, Dale E. s 'ini' ,., me J if 7 if 'Q sri ,,, in P . ,Eh ... P it ' gm "" r. Harvill, I la tch, Sandra Larry Glenn il , . Looks like Mrs. Cowan is on another one of her hem- D line kicks again. But what's this about high-buttoned shoes? Linda Loy and Peggy Sharp do a marvelous job of hating the piano in the Wildcat Follies. ' Hay, Hay, Henry Paulette In E N' -'--"-'- f Q ff , W fp iutut i ref' ff - fx- 'k" Q X "'T"' Heerboth, Helton, Helton, Hennis, Herrick, Hicks, Higginbottom, Esther Linda Nedia Jerry Frances Robert Charles D. s 'Q Q Q- H '91 .Rf r 1155? :Kaz Hillman, Hinkle, Hitt, Hoggard, Hoggard, Hogins, Holliday, Walter Janet Steve Mary Jo Thomas Saundra Melanie "" .,-- ...a J ' H ., 1331 ' P ' 1 f. -" ' - ' - -52:7 ' - ' g j . ki" if K 3 ---. . .J . . 3 tf 7'f'..., ysrsits J ., ' 4 ' S' if-lf, . .af Holler, Holmes, Holt, Holt, Holt, Honeycutt, Hooper, Carl Duane Travis Brenda Glenda Linda Margarett Mike tirg r . T , af X J P 'pf '31 i t .. t ta tw ,-1736 ff, Q- . I Li' gr' fi 'LL'L. -Av I Q' rl ' ,' . , 'rv' .- T' s :. In : A - -f N D iv r, . ? V X nary' , q I lornecker, Hoskins, House, Howa rd, Howard, Howard Hughes, ,-Xndy C.B., Jr. Linda Jeral Linda Kay Virginia Karen - i'i' L - -33. 7 . S V YVVKKK ,.. , , :E b 7 K ,.,.,... M - i ff 'iii ,V IA , W: k,, .- 5 X f S - Q Hunthrop, Hurn, Huston, lson, Jackman, Jackson, Jackson, Diane Alice Marsha Mike Sandra Helen Martha Haver, Gary Hays, Cindy ls, , iw el in Hill, Fred 'if::'-:'E:-agen: ' ' ' " w t f, if K -V... ..,, . Holland, Steve Hopkins Mike Hughes, P585-CY vi. 1 l i James, Kay 'D h 217 Janda, Richard 218 Johnson, Janie Lou ' ,. YEL -,, f 3 Jordan, Kathie Kelley, Carolyn Kooms, Becky Lankford, Jan Linn, Danny S., . ,Aj Q-,icy K 'swag , '- .,, , L Q ' fe- ? N - - .,J?l1-1.-11: ,ii .-.. i9I,nnhn,,,f " ia J Q31 Jatko, Tom Johnson, Lora me , --,fn la, A ww, .E - ff-5'f'fZTl3TV ' .Z:5.bH. ,1 .., J --Q ,L ., we F' 'W' Q' ur if 'ig Josephs, Al ' Kennedy, John iv, -fam .M V- +2'i-fgifewgf , A 27 'final ,fifth ' viz ' lk .Q 5125: 5 . ' . - 1 , -- :LEE 255 an T 7353 M. . az : W' it 4 KX! EF? -f an X 5 , 'VX f 5 Q Korte, Donna Gayle -K M VT' Q We Lankford, Jean Lipscomb, Dewanna 1, i f.,:::a- y Class of '66 , V VV J0hl'lSOI'1, Johnson, Johnson, Bfelida Gloria Jane Ellen t s em . A 7 'U' We Vw-, if l , V., ,ef ,o, 'W "' 'T -ww "" ,-45 , xy Wi, V ,MW V V -.. . ,-.1 5 J -, T NNN. 1 Johnson, Jones, Jones, Jones, Jones, Jordan, Tommy Denzil George Harold Vicki Brenda Jean -- V 4 W A V- - ala- V . J , K l i ,Q 2 ' 50 at 'Ji K L1 A fffuu an qw., 557' 4,0 ,VV3 K -' V ,. , V- ,f:V it - . - V - - ' M' B f I LII, U S Justice, Keathley, Keating, Keeling, Keen, Keller, Lee Jack Margaret Jack B., Jr. Randy Jerry A- ii:'J W J Lu i w M. ., K J A lx J 4 i , Ma ,gif f -'- .,- -, -,...-- I1 :wird - ,,..,: -P, V:- if 1 1 Ketzscher, Kilpatrick, Kincannon, King, Kirklin, Knigge, Karen Susanne Steve Kelly Kay Tracy Anne .. g .LQ an Kumpe, Kuritz, Kyzer, Lafferty, Lancaster, Langley, Leon Gail Brenda Diane Robbie Dot Diana ' " 'L" J' , L R J J . 'W ,. , J to I-QFXVVV? 5 ,E ,-,V'4:xVVV f 7' ,ilwx fu f 5 YV ,. 5' ' Laster, Ledrick, Lee, Leopard, Lewis, Liles, Jerry Charles Sue Letitia Linda Ronnie fi 5 , , fi' L0gSC10D, Love, LOy, Lubker, Lucas, Lybarger, Dorothy Vicki Linda Sandra Linda Weldon "What the heck's so funny!" says Ricky Colclasure to Mike Robinson and Clay Hamilton as they impatiently await the an- nouncement of Soph Dream Boy. ,. it Q-ff Y S , 'Q ,Q -f ' Massery, Judy ' ik ' rf fi 4,,.Q,, McCarty, Janis it J ,W , fi- if" , McCoy, Britt - .4 !::: 3,5-,P , if 3. 1 2-5, ' H' xi? , Q... All ' - sigjf, ' V. V .. if L, - g -, at . McMorris, Norma F' C as i 3, eg: 'Q' KF' ww .wif Mitchell, Delmar 1, 5 M 19.55 Q I ut,-aw' 45:14 . Matthews, Alice Mae McCarty, Melinda I 5 V ,- g McCraw, William if ',,. K K 44 C, iszvl-,lf ' Er McNeill, Mike ,,...a-- Moore Nancy ' 'XL in t M- , i C Matthews, Cheryl gif., K t i J-I ' Wg, , , , fgm ,gm -is M ,i McClain, Bill McCuin, Brenda McNew, Newton Leor Moore, William Matthews, Drenda McClain, Ruth 4 2 2, 2 is ga Q' f-.-9".ffL it " ' Q g McDonald, Martha 5 +4 I 35, iii glib iett i McPherson, Rickie ' -zgjt, :Q new . I-L7 , s Morgan, Juanita :sizzix L Matthews, Linda 3 i s Y - i i? Q X - HHH 1 -r N S.. f il McCleland, Ricky McDonald, Michael N i R 6 Melton, Presley Manning, Mansfield, Judy Lynn Marks, Martin, Peggy Billy air . agar V ' 3 30 if - 'A' lgfywx- - ga A ,Matz afaakgi al, 15 Matthews, Patricia if N 'if if t h as A X e 3 JF f .ax . figs' 5.51 ttf E553 5 may ll, ff MCClusky, Dianne ,kt . Mauldin, Warren McCord, Bill is is 3 as U2 9 xc S r 6 3 a Q1 :ir qi, 552' 'Si' W tw ig, 5, . .- ael, me a 4' Q. Mansfield, Narcie Y E , Vi ., yy 3, W g . Mason, Ronnie Mayfield, Jimmie b' -,V. f-...-,-se' iii ' A McCorkle, Danny 3? f, 'TL f rw: - f , is , w , i f use 1 YL:5lT'ii f Liiif W 1- " if , :sl a . , . .- - A,-g,,f,f ,V 7 - ,, ILEXSF' Zbssfisfgae Qfsiw lm , -- A VIcElroy, McIntosh, Michael Way Ken ' al .,,. ,NS , fx if S, , . , wi , 'H 5 'ii if GR "' 1 ,, Elf K sy NV :ln T . . -Q-1.4-ld' ' Miller, Alan G. '-ww . -qw. Miller, Carolyn McLaughlin, Gary Miller, Sharon Morgan, Morris, Mueller, Mullen, Lois Ronnie Carolyn Eugene 219 Muncy, Linda rw , 1 r ' L , J ff- Y u 1? Nichoalds, Ronnie Oswald, Susie as ,il 1 iw' fa iz-Z X, Patrick, Kenneth J' .. , 7 ... Petty, Prissy ':" ' Z.. Puckett, Mike L 1 LT. 2- L Murray, Lloyd, Jr. Nicholas, Donna ,.., I ix K .. 'Yi 9 ir J Qi, as wt ,-,V, i - Owen, Mary Anne f - -ix, 1 -?, 'Jia xi , 'fair J 7 X I Pearle, Sherry . 5" ""L 'r1 'S'-'E A Phillips, Wayne K, Prioleay, Linda -P Ray, Reasoner, Johnny Dianne 220 A,-M., l mv -,7. Myers, Groverlyn f..,,,,3 Nichols, Jim Ji. J Q :Q QV ? L M-U7 r Owens, Dwayne Peck, Albert ,J as Pierce, Jimmy LL Pugh, Pam rel ::: r 7' if , f-F ,X Redd, Jimmy Neal, Marion if ai? Norman, Garry fi Owens, William 4 fa. ' Peeler, Gary Pitts, Linda Pullam, Sherion , f "f., Redman, James an :. , ,M N - . lf ,S ax - azrllf gfwr Neighbors, Newcomb, Diana .. .. Wa 'E Eg, , fp W' -: , 'A' a, W- if W,aq13,- Norman, Sonny Palasack, Wayne :ws fy ,. .,.,.,l. mm, 3 Q fzleurs-was ,fl '51 'WT '55 .ff S I f I Xp 'I N fi Penley, Brenda 3, - , 'bsgzfsfg '-""", ...s1 Ev ,L will ami ff, 16 5 4 S Plummer, Lewie .. ,, 1 rr 1314 7 k 9' fe fr r '34 A' Z'-il if fi up 5 Rainey, Donna Ruth .. w.. f J, ll Q ,, A , ia 8 'el 69' , sl 1 'Q W-. fx . ww f , l.,. t, 41,1 r, 'Q rf, x ki Reid, Mike Georgia Marie 'Q 6' . . :if Class of '66 .,,..a,,,., Oishi, Oliver, Sachiko Barbara .:,,:.V .,,,.,., ,,.. , ,,, - E3 G liii A 1 , x if ' , F? if A ' ll?'fx,Xf' 1 'lid A Parker, Parker, .T ill Larry , -1+ M dz l 4' 5 f' ,K .2 . lk, Perrino, Perry, Marsha Robert I , p ,,,,, fa-mf is 1. 4 vi, Porter, Price, Mary Kathy Viann .5 P Rainwater, Rambo, Tan Don ga? ss. W, : l....Ms 4 Reid, Renfrow, Phillip Bill Oskins, Carl Parker, Sharon Peterson, Denise Price, Rick gi , is -, , X aes i W fs is Ray, George Rhodes, Larry Kathy Jordon vocalizes "I Love Paris" as Barbara Hall and student body are stirred by her uncanny melodic tones. i. 1, , me 7' ' a -Mu, J ' lgiw 2 5 i., - ,Hr K, N A M wx? ,.....e i, 1 8552 af Q 3, y it H5 fa if ' S AN" f ' l i f ' S, M 9 if .ef f-- , ,yi T ,,,,,,,, , R 'J , f-iw-We Rice, Rice, Henry Paul z 1 .,,, , 3 'T Ridlon, Riggs, Evan Sally Jane Richards, Linda i Risher, Don K . lilsc 4' 'AA' 5' R A T if I IS ' -': K ' ' Q: w..j" U W i f tug, Robbins, Roberts, Robertson, Robinson, Rodman, Ross, Ross, Ross, Van Eddie Jim Michael D, Christy Chaunita David Jimmy V , : as ' M ' N , , H r , , , ' Qg, P we 4 mv, "" r ,KY4 ,. . ,. A Y . 3 '-:,, J , ,,. 9 ir , ,,, R' , K W .. gi' f R We i..-...Q if- . Airr, 3 ii J is 5 ' K - A lvltll Swv, ,,,, , S , ff S isa Russell, RUSS911, Russell, Russell, Russell, Salkeld, Sanders, Sanders, Danny Frankie James Richard Jim Karen Ginger Lee Bernie Janis Marie ....,-.,,,., .ra ,,,: 1-EE: I.,:: W it V it vw - 'A' 1:23 " ' 45235 , 1415 . I 'K M u , , si e t ,V if gg .-,, J -AV2 R Q' 5 Q ' 'fi Sanders, Sawyer, Scarborough, Scott, Seeley, Segalla, Sharp, Sheehan, Roger Tommy Joey Sally Lynn Sharon Peggy Jean Michael W -Mas, i,.i, , . ,, j' v':I,r 2 t .,. kry., ig, in i ,,V.-, ,,, ,,,,,,,E,,, + R rrr J , if Y in a ,, -," if ,wb ., 'R L , -,W etit,' W-f' . -' fi ,- ,f..-if -"N HW ' F f" ,,,, 2 M0 ' Shelby, Shelton, Shireman, Short, Siemon, Simpson, Simpson, Skinner, Ronnie Doris Rand Freddy J im Eddie Tommy Marti 'V ' , -5 :Z . . 122 - il. ,X V ' I Qi Q 2 Ep 'Z.,,,f-if ty i in "0 3" ia , , ::. i . I Q -f -:' , ,, , , ,, - ,.,, . , 2251 5 7 I ,-.v 34' t We ,V "" ff U V ' , A I - F if Slaughter, Smith, Smith, Smith, Smith, Smith, Smith, Smith, Danny Brenda Kay Byron C., HI Donna Gail Jane Marian Pam 221 Smith, Peggy L75 Q. ,,..fikV Springer, Doris E. Stewart, Alice Story, Theresa Swann, Cheryl Thomas, Judy .E 2. --:- z ,as me I 521337 1 , 1.454 i 5 4, an 5 M A1 Thurow, Ricky 2 2 2 Smith, Richard ll. M-agf' SQ, 1 ' T . V 2 5 .K T' Lf Stafford, Gloria Stewart, Eddie gi 4,- 1 . 2 259 fm , 22.155 K Strayhorn, Linda Swindle, Jill 'W at N. X. 'sf' , 5' Thomas, Sharon , we ' in ' ' -A Tilley, Ca rol 2, K , S99 if xx Smith, Sara T --...AP ' -1- Staggs, Eugene 2 YF:-2 fi 97 Q 2, 5' Z K fm 3 3 fm W, -fgit 4: ' m st- ,x , .gps J up .,..' Stewart, Jackie Stricklin, Charles 'Q V I tf,,l .5 t N:-4? .zi- Taylor, Eddie Thomasson, Brenda 'VZ .- Q "' ' . ,ww , , A f 3? ' Tinkle, Janet T' z IX Sockwell, Souheavcr, Sowell, Sally Sharon Kay 5 .LTL ' y iw It 5 T J Staggs, Stallsworth, Steelman, Rosalee Linda Cathy Stiffler, Tommy Stricklin, Johnny Taylor, Lyla ',-.f , ai 5 a t wits- it 33911 ' I 1, ww aaa'- I K , l,l, ., gi 1' gxmsgg fr : 5' 5:2 Q 1 V' 'Gi .sf A Q?-gnrri T A ,psf Thompson, Eddie Tompkins, Laurie ytfl all W, cg., t Stokes, Brenda Stiles, Payne Strother, Strother, Cecelia Lana A Zi f, K W .gf Taylor, Tennyson, Ronda Edward it I F 1 .S : 2:-in F . 1335? T T .,., in Thompson, Thompson, Elaine Mary Beth Q A 1, Trickey, TI'L1SfY, Don Mike Class of '66 Stephens, John Robert Stone, Danny 1 fs Sullivan, Sharon . ,. ' 'ia gs ' , 4, V ' S, -1 gjgltifi r 5 'S Terhune, Linda if it " . X- A Stevenson, Karen 3 S, W A H, .- 'I 4 in A rr' ff ' an ' ask' , V if' 1 'i int' si .ji -Ja Stone, Ken -...A N. 5. 4 Swaim, Judy Thomas, Bill Thompson, Thurman, Mike Tucker, Dianne Dale Thatchei 'J 'U 1? R yt up .T . .X 5 W ,, lf' k .-,:sx.m.': . . fiiifhi tfisifg M xi 1 ag , . , ........ W. Tucker, Donald "l-lere comes Sophie!" shouts Jim Davis as he introduces another act for the Wildcat Follies. Vandergrift, Vaught, Veach, Venable, Lynne Shirley Anna Donna "" S fE1Vfix'1.,'j",L,,' i S ,Qs Vim, Vint, Wade, Walker, Bobby Gregory Susan Jane oii,,o x 1 Waters, Watson, Watson, Weatherington, Dale Kathleen Nancy Brenda -, gi f , p ill T t W W Welch, Welch, Welch, Wells, Dennis Hobert Cecil Larry James -t" White, Whitfield, Wilkins, Williams, l..1I1Cla C3I'OlyI'l Steven Garry iisihisuitif-,m-iffx' , . ' .. .. ,,,,,,, .... .: :. wt. ,g a 5, a Ellie' V 46, 5 fv 1 f-'wrt , 'K ,ff , ,, if' K .a..e,, , , any - 1 , ,, -11,1 HRW, Verser, Roger aa Waller, Frances .N - I Weatherly, Linda fi f Weston, Ja mes M. Williams, John X sf vi, it Y ra ' at F 4, 4' v xirm 3' Xxx S 'a avi , .. .,.. , 'Q , if Turner, Turner, Joyce Ma ry John 11 ttf- , .s:.:,:': ,lg fn, , 1,5555 -,gm W ' . W ,t "fi '55 ..., ' 1 gg., .......' .. 4 Turner, Robert H. Tyler, Tyler, Valentine, Phyllis Sharon Jean Alma Marie t K ' , "" Vest, Vest, Vim, Billy Deborah Gild 0 r ,, ,.,, 5 f T 1 , i',, ",V Y -vw' ,Mix -- Walter, Ward, Waters, John Edward John Carol :" S , A ,f 6' ii 3 'Y S if "' K-1-fix! Weaver, Webb, Weiler, Donna Toni Bob - 1,--'xr l Wharton, Wheaton, White, Theresa Wanda Jean Kay . ,. 'S' ' ., ' gift- T f ttrt ' sf? H i 'v:1gQ Y V my W of if 1 " -as ' r J 9' if '-'f.k Vb,,....5 i 3 .1 'K h ' Williams, Williford, Willits, Larry Donna James 223 Wilson, Bill 5 ""' ,vt 52 1 t Ml, , - " s L J Woods, Betty , 3 3 -1... h. , rel" . Wright, Scotty 'lb Wilson, Rita y,' .A Mil' YQ sf tk , x, .,.., Woody, Larry Joe . if 2 ' 4529 i . x I ' , .Q Q 'R .',. ,. Q, Young, Jane I , ,V fix! Winkler, Floyd wg, 11212 5 Wooley, Dolphie Edwin, 3K 0. 5 V 11, f 4 lik' ' ,Z ' i3fQl'iiWH 'JK . . . :ii f Young, Jo Anne f.-W..-.wwN,w.,1uWr,.,.,M+,. ,,,.,.,,--M .. .. f W, iffy ivy , Y W MLW. it 7 1, , Class of 66 -1, .4 wan- I 6. x, Wright, Kay 1' If If Wright, Julia Zilgggerr YAWNS, EXCITEMENT AN D BEWILDERMENT . . . ' Y are expressed respectively by seniors, juniors and soph- omores as they begin another school year. mix t Aa is 'T pf Q' if , Ili N-...vw-"I 3. t ,XI 'NN' "wwf" "', " Sv 49 lifts f.,: - - , ..f-, .W X I 'ix Q L """"'1 l -wi- ...,.... f 'S .lk .1 -.1 1 v 4 ' d. 1 r X. -I .J , -J ..' , 4... " f , ,1 .r -v ',. L' ,QL .f s Aa' 11.1-I '1f. .lv .- -5 ., ' iR1f'1". 3. i -Q nfl, .our , YW.- .-..!"' I kv' 1 :aff f . rv- - '3-r 21 A gg' .-Q J.,1, 'K A.. 4ya , -1, gs -Lf, ,3 5' "Lu, -.'.--x--r , 5, "f f Q f V ' ' J x , il G iw iw 'Alb' 1! l .diy s rv ponsors U, My 5 PE Vo' gi if This book is yoursgfwithout youfysupfeme loyaliiy, faith, and financial support, this Wildcat could never have had a being. Your extreme interest and dedication to us provokes a strong sense of encouragement and support most direly required for the piecing together of such an intricate story. In appreciation to you and in an effort to express our gratitude, we can find nothing better than to give touylou our best in return. Many long hours of tedious and meticu- lous work went into this section, undoubtedly making it the best ever. And we think you deserve the best. You we will remember as far as the future goes, and we will meet u in and aga' as our needs and interests take us 5 , i C? j Q tj? Q li :A v its njsi' cg 1 , ADVERTISERS u 1329 a t H -'sw ,, , . A W ., ,ig it as fig s Q -ii I NLEM, k K,- S 2 uTLEi?iQ?Ei3ig - V wggffsiglifg. L f 4 Qgfgfmkf , V 1 'C w i i in sf V - , . ',f 94725 , ,,., - r Q 2-wxgswivgeqfwifeagg Hlfwifgfk ,lwggggfzg 5 . Q ,. ,U :wffgef2glQf 2 v 'J-'71 ,, A: 115.22 i-if,:12ss,2We14fsf::-45-mgmffzii www: - . 'f . L' f ,J-1.5 ,- ,y,wf32, H., 4 A if - iF'i..'fQfF,.. ' Ming 282, .,-...fi V , r 9 .', ,. L. xv u Sw 413- Zxifcfif F A' gr . , 2, 3,-'J3' K 60 wwffegz, -4. , - f -4 ' - A-1 , 1 M-, 4 cfm 43?r?"' S fun if W Q f 5 V - A , MW 6 , f'ffExsx1'A' Y :ai-f212zx96i???2 S rssmsgfpf Tfikaii? -. 35? is uf E'-5 -1 iiszswiiiwazggzsgi 1wmwm,:z, r f 3-'Z' 1' 1, ,, 'I'-r F of-'T- A.,-,,.1wwg1A Ir ' e' -' -p ' 1 'ZF a Gm X Q.. , fgs A 'LL QE' .-r .z',"f 1 F., int?-4' ,ji '-0. -, -D -A pa. 1 - v ' 'Qirf lnvg... Q1 mm, 3., 3 fgigzgf r nf.,- zv Ai. .V ,- ire-Ip' 5 fv'9' ,-'NIP J -4 "V: F' pi' J'-1. 5 A 5.v 5"-c 2:51 Q Qi" ..' zfgy - "TSW mi. i . . f "mf 4. Q 1241? .',S4'i7-' 4. Av, :ff I 2 1 E If -Q." I Q l ?'9a"Je: -..-'E lengnaig an-77, f T-'7' .ef EJ'-H515 f . f "T " ! ., 1 ' ' ' ,F f .,.. is ' '- i . Q .? .' ,f ."f""' , sl 1-a46F':f. gm. . at , il, I, ff ' 3 if w- - 'fp' '1- 1 ', Jil rv' 1 ' :girl Q ,.' nf -5.- wfim' '- v , , . ,:J"", ,Q .N ff EL-it Y . . yin l 4 L- . ,JT Q. -f"'Pg3::2" '- s if ' Q 'W' b fin 14 Li X, 'WQQN Q ?T1wQ1-. W .R g, ...v ,J ,,. K "Hello, Mudder, ..... Hello, Fadder .... " fW5Kijv5 Q9 KQPMQ, My QJQQK wi? wk Qi? SQ xv mm WL may wb Q0 j hgpiagliggzjgxbglrfm M! iiimfglwiw gy Mwiifg? WW 571 X We gO?fg:sOsQ1a22if? ,L 50 X wwf? fdfkvgffff ffl' OMAQQL WL Jcwziczmm aww QA gg, MJ Q22 fx x 120.9 QZQ OX H 230 If X Brown -41 f , I df, L 1. -- X -f,. 1 I If I Fe D 5 Swww Ce ?k7XJoN 4 I I I I mx ive ! w I 1 , V 7 .V ,I . I -lf KIA K C C, KA L :W Q. , M '-6 fm 1 6, 76 . C., V f fn ,f C- ,-:- JIQX, 1,6 4 X C 4 ef: "We're the best, and even more. ..... We're the class of '64!" U . f v I x Lffhy- '-1-I Aw' I rift fkkijxy I If If ,f , ,V a M M I If .meg e,,!.." L ' f , J 'gf fn I 1 I I A i Iwff fif N' 1' " ' 4 K V riff 5 F jf f fll T ,Sf . , R , - K , l I 'ly , ,' In I, I4 LVX vylfy? .' ' 1 A i 1 J' 4 v 1 X "J: ?5 LJ Brown I I If I had a barrel. . . . .I'd Wear it in the morning. . '-bg 231 Several John and Glor1a Bob Fmnegln J1m Satterfleld Charlene Garrett Mr gl Mrs Gene Hogue John E Laman James E Murphy Harold H Baker DDS SlXth Per1od Latln ll H ELLl 3rd Per1od Related Math Mrs Grace Mosley 3rd Per1od Machlne Shop 3rd Per1od Mechamcal Drawrng 3rd Per1od Homo Sap1ens C R Perklns 81 Son Mrs Weeks 3rd Per1od Algebra Rock wlth Ray every Day 3r Fortners 4th Per1od Amerlcan H1story 3rd Per1od Wood Work ll Speclal Engllsh Room l30 Mrs Matthews lst Per1od Ghem1stry Mrs Helms Th1rd per1od Latm Class Three 3rd Per1od Journahsm Salesmen Mrs Lawrences 3rd Per1od Speclal Engllsh 3rd Per1od Spec1al B1ology 308 Mr Mansons 3rd Per1od Blology Thlrd Perrod Bookles Mrs Schm1dt 3rd Per1od McFalls World H1story Mrs Flemmgs Ord Per1od Amerlcan H1story Fortners 5th Per1od Amer1can H1story From a Pr1ddy Good Class 3rd Per1od 3rd Per1od Spec1al Geometry Mrs Lawless Mr Fortners 3rd Per1od Amer1can H1story Bumgardners 3rd Per1od Jumor Englrsh Mrs Donaheys 3rd Per1od Busmess Tralnlng The R1alto Theatre 3rd Per1od Mr Moores Amerlcan H1story x 1 2 -H . . Artiste Beauty Salon Mrs. Tarkingtons 3rd Period English . -H d . 232 Pledged To Progre Congratulations, Seniors! E5 KE Builder Skyline 3-0863 3917 Loohridge Road North Little Rock, Ark. PIKE PLAZA FABR FABRICS - PATTERNS - NUTIUNE Support Your Own Hometown! Located in The Pike Plaza Shopping Center FR 5-6504 ' North Little Rock STERLING STORES 6500 Fontaine Roftn . X at x L ! f 1:1-'gez5N Z , ugulm. - A A, I ff Eno . fit, S , Ly Syl L Q 3 Er Q, fist Q ' , - l gg ..fi,cT'-Q, 1 5? 'gh Q O W I i.x st :bail .Dig I , X, O V. V . .5 H +S-.:5oEEf ll do 'fr Q' tiff f Q W E 5'-Iggf f , 1 9 I t'i' A' gm : -5 -1.41 , Z K . ET I, I 4. 1 ,XV D KD I, 55 Q it QU 'L Q3 " 2 N gbv O : is I U T S H K4 v-5 Q4 ff L Z 5 1 to Q C C gg C75 . 4 i-J S MUD 5 E1 E 3' ' ' 5' O . H E in is 5 L' Q 2. ,E 2 CD Q S so 5 ,fi Q Q -1 4 r-4 Y N' Q Eg S3 Q mfviwmvfswwg g 5 m E V? QQ Q ?f1333l3f ' QQ 0 Q F Sl ,F fgvlilii W 3 ffl 3:1 H5923 as QW: 99 CD ig'-rsyyvvgvv-,,4-..,xX-N-XA. 7 X B 7.1" IQXQQ :S Cm N it QI C X ! V m M uv Q ' 93 I , 7 : f 'X4 234 Need a Car For School? Bring Dad This Saturday And Look Over Our Fine Selection Of Low Priced Used Cars. Everyone Knows The Better Is Available Where The Best ls Sold . . . And The Best Is Sold Good Luck XL Pope- Burkett Motors 24ll East Broadway--N,L.R, Seniors! Hazel :S M argueri te's 3323 Pike Ave. CHARLIE TRAMMELL PLUMBING Installations And Repairs Q Reasonable Prices -in SK 3-7650 2408 N, E, Circle N.L.R. Quad lack. Semiafwf W 1 F to New 'Iwo CONGRATULATIONS TO THE CLASS OF 1 R1 ,A 331133 . Better Traction . Cooler Running it 2 aaiaaa 0 V. SSDI!! z L llli 1 Q 1 at hr L V . More Mileage - Moody 5 1 " -YU . f I I F -v 4507 E, Broadway ',, HH, W l4ff'1'fi North Lime Rock xNs7xl'31'Qff.f.' Tire Service Chicken Shack raps Hill . N x South s Finest Foods 5, , I 700 East Broadway North Little Rock -N 0, Arkansas is 235 I U D7 v o s 5 1 I6 ,Sl U' 1 qffs H I vi .1 js! ,. O an l cf 's..'Q l A Q1 '1 . if 3 : 1 ' ' OX Martin : 3515 John F. Kennedy Blvd. Save More At ,ef .,. .4 B99 Q Gibson's Discount Center 322 East Markham Jluittle Rock .nv 3 A tp O Q9 Q e it QEIQGY t QQQ Q It rx Do Your Shopping At Weingarten's Grocery 2700 Main 5 ah. No. Little Rock 'wx- 1 A ,M X as NZFU i y 4 1? tif' X Wir X A xgmiiti Lewis Photo Studio Business 81 Family Photos 3424 Pike Avenue 48 Problems 17 Bring Them To . . JPN Capital Motors, Inc. Q4 4--X ' . wrlzmf ' 1400 EAST BROADWAY NORTH LITTLE ROCK QTHEY HAVE TO sELLp FR 5-9101 nw ToP QUALITY CARS--PRKJED ll ll Meet Pappy! of qThey Tell Me That ' 4 2 Everything At The ii , A g . .ftf 5 2 5 21: 1 V 74' V ' -- . Pappy s Shoe Store , 1 .--. ' 7 I ' " 1A1-2'1 1 H b N b QQ . ' e Z 0 ' 0 'fn P 1 1 ' 1 206 Main - No. Little Rock Drive-In f 1 Sl Q ,..... .. on FR 2-4140 ' lu-19 3805 Conway Pike A ' Q Red Goose ls Out Of This - I ' Grace Walker - John C. Roberts WORLDH5 s Planters Lumber Huggins D1-ug Co, 410 East Washington Rx Dependable PVS" Prescription N A 3401 Pike Avenue WW , l , I 'W' ' North Little Rock North Little Rock MA . 237 ' . I Wanna Save Money? -1'- I choRcE's Auro SERVICE If 911 Division--North Little Rock If ' T l Fe w 0 He seee The Light e e I'0 Y! You WILL Too Gift I ' ,I "x A ' With ff? ' I ADCOCK y y 1 A - Q-If ' 'M-WXX R Lighting at Supply I 1 f , A XX The WONDE GRILL 4710 W- lm I Q f , I X f Little Rock I f I it I " 0 l3th gl Main Streets I ,fr -to - A lf' '--we-'o '-'CRX SENIORS , I . , o , ' S' North Little Rock iQ9ff"X M Q 1 K X XSL g gg W gggg g v Service Station John F. Kennedy Blvd. At McCain North Little Rock, Arkansas Lakewood Texaco DAN l.,lVlNGSTON X A l I Iliff AUTO SALES SX eta sg StaywiDE WAKE All Day! l Doncrghey Building if- -Sei - Q - It ' ig "Just Look-- y You'll Buy!" Coffee Shop l a" A S V 4ff,!7,rrmwxxXXQQb E. ' N.L.R- QWUBMS A A . DAIRYLAND H Funeral Q -ft. W .--: ' -' :V g Home Q a,,x.-nf v '13 TT J -5'-' , Tl.2l'f1rL' -I few- lc - ' ' :'l2E,:?55 I fi '2fiE4 :" t 1 It 'Is 'pri I : l-.' viii? -I., . I, ii, 'I ' fit-'.:zyqi e z.- Iw 'ffl 'F'-f "5l.T' I It et f f' in J 4 '1' - -. m m "'ft3ii1L f1Q:if1..1 , .r - - 4' T:l"'- - "Distinctive Funeral Service Since l9l0" 90 Days To 90 Years 500 Main - North Little Rock Call FRanklin 4-0312 A I LOOK - ,if I XX ,Lily I Aw' For The Best X"f.'fk, At , . 4 I,5if?,?,E' L . tggjggggffig.gg5,3g3ggg:1ggf5 , egg, Burtons F urnzture C o. ,P 400 E. Washington Avenue 5 North Little Rock, Arkansas 238 ,ml f "X o gg' DRIVE-IN 'Q PJ' ft, Ie, A 4 - 2306 JACKSONVILLE HWY. For A Used cet? fn GEORGE E. BROWN lf Used Cars g tQ j A 612 East Broadway 5 fr A' , North Little Rock " I S I 5085 gazes? 3rd And Maple - N.,L.R. S foie '4 106 East Second, N,L,R, Open All Nite l . '7' - l 1 l . as 1 'W i PAINI . A 'I SO ' H Perma- Stone is lvlaintenanti Free 'il Q ' PBRMA - STONE CO. W 'FJ i.: , X I vi 1 M Phone SK 5-6864 . F iq L 11, ,im , W my WW , f ' W M al , EL A R 1 L1 "Everybody Comes To Us To Sell A Home" Roberts Realiy Company 403 East Broadway, N.L.R. , Anytime For Free, No Obligation Estimate f , Marsh Hardware l 5,5 T 5 1 fi 1' G - lip 1, M Qffrxi if ee at it E st-s Amer f 1 OO 1 is , 1 L l700 1 1 X N A ggi, l 1 ,. 1 , Main Street Q L X U S S t 'v L M A 3 Q Q ' 0 North vo 2 1 : , 1 ang , Little ROCK ' 'K lll, K 1 C 1 'MTA "Between The Two Banks" k ll0 West Second--North Little Rock, Arkansas 0 Call FR 2-l802 Office Supplies Office Furniture Complete Service X E 'sr 7 T' I At ELEMINGHS IT Q Lg, Troy Co111er s SERVICE STATION 1112. 2100 E. Washington-N.L.R. xg. U 3 LANEHJS ' Beauty and Barber BEAUTY ,Q N Shop M snoia l 2621 E. Washington Ave -N.L.R. "X l 3509 West 13th - Little Rock , jlflh Jewelry l l60l Main sr. -NO. ER. l all . Wesf S ..... . 0, .X I ,,s',?,,k:1 1 QQ,LiDedKe'03?" 2 i Department Ns- . - ,. .,.. I f .. Q0 lOK0,,,,5 "Ladies' Ready-To-Wear" y Pike Plaza 420 John F. Kennedy Blvd. - North Little Rock I Shopping Cemey Do Your Saving At 0 0 Q U I -.gg ,., lain: 1 239 Eg! 240 9 I Zyptfgace K-962 N .,Z0,e.6ZA,l.a 444-fC., X i l l l i 1 : 1 ii 2 2 1 1 1 i i f i 2li 5l z l i 5 i 2 i 2f 1 i g f i 2 Q i 2 1 1 l 1 2 . -EZEEEEE Zfgifiiijiiiifjijiifa. i "" , -.1I2,az.I2,aaat,aaiazatatAaa,:aaa,a:,,,.,.,.,. QJD zzlzzz ' Q' l 2 " -aaaassii , """"' , a:a:aE52g''.I,Ijg-'-P?- "-T m ' '-isis...2i2i252i2i2i2i252ifi2i2i ::.. :::i:" J' E221 Q' C0 Vendors in anc' nt times fe wares of lesser value. Choice en. valuable piec re reserved for the jx! manwhokneweno Ll to or .In ourbusiness, 0 N such a practice would be bad in ed. One drug or formula may l ok exactly like another. The quality X' 0 of a I . u al .- can be discerned only by those Cd trained c rs. Responsibility for supplying 4 X l hig -qu ty phar a a ticals rests entirely with the P at . ist. This is a responsibility which we shoulder K5 wi u pride and profound integrity. Our attitude is that xk t esickandailingneedthefinestmedicinals obtainable. X53 That is the kind we always supply. as efa22a52s15a I-6011 H Olsfed Drug '':gagggzgggzgggggggzggggiaai 4610 East Broadway North Lime 221522gfgafa 1 Ilizit lziil Iiiziiilictiizitzz I 544-If Z? loy's Barber Shop Xmtiw LoY ' MONROE 4- " RONNIE SA N 112 East "H" Street ' North Litt1e Rock ' 'l - T'Ei1'XClO1'X, Furniture Co., 1nc. X ,.. fe :-: er f' 1,117 , . FR 4-2960 1 823 West Seventh Street Little Rock, Arkansas STERLI G fd! t any Cojaefazz , I2 vi PAINT 1 Fiomsi AND em su-+oP 1 ' -- laos M 1 W E NORTH time Rock t ' 1 Q STEBBINS 84 ROBERTS, INC. LL 1--. 1300 E ,t 6t1 , , ' 917 Wei? mf Co1a1ann1 Little Rock, Arkansas Piano and Organ Co. G R S 11' Y T1 B - WE X 1 C lflg OU 'le GSIZ Yoljjl HHND? 'gg 2 A11 Your Decorating 7 ' if f Needs ' 1 - BALDWIN - Corner Sth And Main Little Rock 1 FR 5-8141 i L. , ., .. vp el ARC ELECTRIC SERVICE , Zconomq Heating 81 Air Conditioning V 3 ea' WI 5-4103 x L9 W an I 'D 2500 Pike Avenue - FR 2-3338 Rn. 111 -Box 111 -No. Little Rook 'rfei',gg-it 7100 Kennedy Blvd. -TE 54515 u X Home HANSEN s gr. Qf J. ' 1 DRIVE -IN At N , Tw Whoppa- 4900 John F. Kennedy Blvd. Bufgefl , 1 - NLR Frances , , , ifbi ' Y 222 E. Washington HARDWARE 8 FURNITURE f' ' "' 'M ' gg, JS 'f :ffl -ii, rn..-Q, hx, V' if f -5 uv dm FLOWER SHOP Phone FR 2-2203 1222 West Sixth Street Little Rock, Arkansas 'W' 'Y' ' 242 They're Lining Up! . f K and H Motors ' 3rd And Maple ' or lx Vt.' Satisfied Customers " "1 Come From. . . ' V V 1 I fx Modern American Mortgage . 'N I Corporation III.. , ' ll mr ' I I .210 Center Street i I 1 1 I Little Rock, Arkansas IHNIMILUH At U A X iLI i . V 'gg 1 . A L YY lllff' N.L.R. J DIFFLE LUMBER COMPANY GOODNIGHTS GROCERY 81 MARKET I 204 South Clover 1901 East 3rd, N.L.R. No. Little Rook, Ark. Q M FPACSPPMSASMFCY ...,-- ' protho I unction 5211 East Broadway North Little Rook, Arkansas -C -".. ..,..'.. 2 S O. L. EvanS, Owner I , RUAD I SERVICE Qjgl Confused with Your Hair? ARKANSAS ARTISTE NURSERY ar FLORIST BEAUTY SALON I " 5 In T 1519 Mom Sr., North Little Rock 1 3? ' 210 CLF. Kennedy Blvd., N.L.R L it - fmvfa.. Mr. Robert's FR 6 l2l8 FR 5-9151 BEAUTY SALON To Serve Youg Robert gl Sue 4l5 East l5th--N.L.R. 2l2 Spring Street, Little Rock, Arkansas 'N LIFE INSURANCE COMPANY IRST ECURITY POST OFFICE BOX 2978 ' LITTLE ROCK, ARKANSAS Rents -- Sales-- I 3 5 K Insurance--Leases L Qi Realty Company I Want To See Farris Short About The Most Affordable arvln S Ford--Now, Pardnerl At Paint 81 Hardware REBSAMEN MOTORS 815-817 West 7th 321 W. 3rd--Little Rock FR 4-2394 , "Satisfaction First!" L LL-- r ort ho ,Q 2.5 ,V XM ,I ,ffr 1 Diamonds wi, f tiff X 1 1 4th And Main SX A 5' wry" lj! fff ' . '41 y Watches ,Sjgy wif wr f . - y y A , A Streets O 1 ,15 V X X -1'1" No. Littie Rock . is Ni :J 1 1 5 A 1 ,:,A i k Since 1880 G1ffS 3 B xx W 8 A -,1.,, , x 1 Q, - -. 4 Headquarters K 1 y QL f JJ 'f:2- R Q all For All School Books X " W S D Sb ll 5 7 ' .' X I f ' ig . 61. QE And Supplies 1, Q, ,4,,f, t 1. ln!! ..l4Ag . 1 Ask About Our g Q L - j- ' af - 1 Teen-age -5--5 K Z 1 f ' r Credit Cards 4308 New Conway Highway - North Little Rock L D I as I I ff-C! -- h A: Trouble? Save Money S OP t ROY GLOVER Esso I GM 54, X Protho Junction SUPERETTE " we No. Little Rock, Arkansas 228 E, Washington, NLR n Don't Flip Your Lid Q f ."'r Over Plumbing Problems X IIS --if 15 9 Scott Plumbing Co. 4001 New Conway Hwy. I "S I I I ' ' -- "A C "Have Modern Comfort" . , Quality Cleaning . H U I '-. X y, F Friendly Service! y,'i I . rom t 5 STAMPHILL - CRINER I .- A' ' . ' 1 JIM SATTERFIELD CLEANERS Q-.La Fufmfufe CO Q L' l R k 717 Main -NO. L. Rock Ht S OC 243 CROAH'S ESSO Highway 161 Jacksonville, Ark. , 1 x X ' ' . 1 4-3-Xb 65:54 X S i .:aiasis:z:sff2z2eEz2a2s2s 131213 . ,,,:w --gs:agzgags5:.q1s'v1 'pt'- '5:?.,::n ', -157' 1 SQ gi Tie People At BLACKWCOD X4 BEAUTY sonoom J , Q N why, They Gun Up And lx X X Dye For Your K' "'l'l A A"" :11 X 1 109 W. Broadway-No.L.R 3 X . X :XX me Thinking About. . . 2 -A 5 .58 img Eine ltalianiffood BEARD rn D S -T I ' 0 Bal'-B-Q 13151193 Furniture Co. J , ,a 52, 1 Ts? af as - A U y lil - ,Al 301 Main St., NILBRD 320 W. 7th-Little Rock JM if, The Well - Dressed Man A X T I Shops At -- Laundry 81 Cleaners , X if of ,H jf XX' I, X BOB'S MEN STORE 1000 Markham 1 fgkli fn up Jacksonville Shopping Center DEESE hardware and sporting goods , ,,.. . ,. .... ,... , -I 4, . , U , -.-.-:-:--.---:-:-:4:-:-:-:-:-:-:-.-.-.q.:.:-:-:-:-:-:-:-:Az-.-.-.g-:ASW-:A:-:4-.-.--.,9g-,- 1 45,9 , -2- -.:.:.g.g.g.5:-:.:-,,::,y.-:g.g-f--4.-.5 .-.g2:.: .'. .g.-.q,g.-.:5,g4.-44:.g.5g. 4:- Z. .--"',":-:-"5'fl'3""" -':-:-':::::5:::g.-g-1-:2'-1-:-:g:3g15':A:-:-:-'z-:ggi-1:14 .4xr:-1-:-:-:':::::g:5',-:f':I:.-::::q:A' '- . .- :g z-:-3:-5:1 229: - .-rc '- 5.-" -'- 1:51-:3::.:.:.:.:.g.:-:-''f.' .-21111:-, f 1' - .-2-:-t,.::5:5:.:.1.:.g . . Pf?f2'Z4?Qf:Er?s'?'23:fEi4?1?:31?fI-52:1:2E:E:Ei1E2Ei5E13E1:1:f:2:f5"1E'1'1:ZE1E2.-:3:'5:33E-fi-:F::1:2:' ':1:f:51-2i:?1-'.-JC . 51-3:-15:12:19:-1-M1-W-I-22 . ' .e 4132 WASHINGTON NORTH LITTLE ROCK, ARKANSAS gb .. 45 . i sf 04 ie 5 ,V Ar 'f "." K. in v. ' . "' u . , , . Jr, ' Y.. , - 0 .R 12' 1 ,V- iv Rf Ketcher Xi Co., Inc. 6 .gn ."' 4 . ---ANP Fol-IEMOST ! 'M x o I ..- .r e'u""' - ur". -.- ,, JY Q' I MAIN orrlcs a. REPAIR DEPT 721 PoPLAR NLR . mai Fkaiikliii 4-2678 '..., OR Dial Fllanklin 4-9619 'E' -J"- X ,s,"ETr- 'Ji' nj' D, ' 31.-I m7 f 'Raving' - j A 'is ikbly If -1 , ahimk'anm!5i1mf X ! 5 X V5 " JPN f 5 Q-nhl' ar.:- "Head 'em Off At The Pass--They're After Bill F iShe1"S Fine Foods! A , i 3 1 And WI A K 2 i . 1 'F' . . Highway 65 Military Drive my X, , 5 ' , "We're on the run for you." F Q ,QA i BLINDS AND DRAPERIES Q ,S i rnaikli-i 4-9747 . N . w. T. WHITTEN 2 " 11- l09 Maple N. Little Rock FQ. K I 1817 East Washington Ave. . 2 -f l North Little Rock, Arkansas ' - . ,I m ll5 Hartwick ARBER SHOP l Q NORTH HILLS REALTY CO. .5f:'."sg:'N' VT . ll7 Summit Ave. fi N.L.R. ' 'f fm-ff .. i . ..... . Money Troubles? Eiicii Drive--No. Liiiie ROCK 1 1 Come See Us-- THE TWIN CITY BANK 2nd and Main, N,L.R, 'V ', A mil ' :fl-M - Uili x x 1 ' ilk" " Lg ff f 1' ' 245 19 INE IIII-IMIINIIS timeless tribute te love ..... . . . . Our diamonds express your taith in lasting value and enduring beauty backed by our long and proud traditions ot quality and service. Convenient monthly terms Ring I g dt how detail Pfeifers Fine Jewelers PFEIFERS OF ARKANSAS 518 MAIN LITTLE ROCK ' "Meet The Gang" Atg S .' I Roy Fisher's XX Steak House! j i Friendly Service-- A lf, if ' I ' Quaitty Foods-- ni I Come On Cats--The Word Isg I y I 1919 E. Broadway--No. Little Rock QUILLEN Insurance Co. Q eee N l I I Enough i 9 Coverage? . if I 4531 Ark-Mo Highway North Little Rock, Ark. flue feat . . . If ,XSIIU ff f !f'i'rrnN lullllll I ,K w " ' LN -XJ . ff az? I ll' 5 -ui555wiwfjfdE5 f L A - el Ib mers Motors, Inc. Farmers Motors, Inc. Far mers Motors, Inc. Farmers Motors, Inc. F armers Motors, Inc. Farmers Motors, Inc. Farmers Motors, Inc F' rers Motors, Inc. Farmers otors, Inc. F 1355 4 5. ar mer ,Mn N . I OIS1' :49-r Inc. 1200 A "" Far h East Broadway I mers Nolt L1tt e Rook, A1 k, r oters, Inc. Far mers Motors, Inc. Farmers Motors, Inc. Far r I mers Motors, Inc. Farmers Motors, Inc. Farmers Motors, Inc. Farmers Motors, Inc. F armers Motors, Inc. Farmers Motors, Inc. Far HI 'Fri ...QV JaCKPo I AT I ' Arkansas Car et 'I' AND P ' . , .' 421252, Ir Furnrfure fr C v' OYIIPQFIY Q Q 709-715 Main--Little Rock A Q ' 1 f IS 1 , xx ,f I ' J xr 3 '. , tx ,..,,1:1'.,.,x ,X ."'. fur' ll I ,ini llg ... x i s ' Q 0 , 445 I pq Q 'fy' x , nagis V 40.0. ar." ' I 9 .5.'. ,O 1' .:v,'J1. :I 'o' ,Q , oi I 5, -rr If---4f'I 'u -' r Q 'J 2 E W V. Q L 0. for thooe you love! 'isdn' 5446 55 fwmme. , LC. Goff PLUMBING AND HEATING CONTRAGTING AND REPAIRS MUY GRANDE!" If If pun... - .J , Q Q I I 'Ls I Q Hi if --f- . ,QQ 'PY oi , is 94,0 Q ,' aff . .,,. . 9 1 ' r 1- 'I If' of! -mul!! -A oansrwooo I , SK 3-8181 err ' 1 . NLR 247 if :I ' vrv. U if ,lll :5'.!' Rr'- sT1FFT's RoR DIAMONDS I 1 T "-,A 1 1 ,:..,,:,, .'S1NCE isso.. . -"'.. 41': . :', :'- 2 :A' "3 lg' A A 31 F ,AVV 4 ,. . if Arkansas' Most Honored Name In Jewelry... Jewelers '-'i13Z:f'.,V' --.' 'J i51'4"'r2-hw., 4'g3'711.':.'4 .-.jg:gs.r'- 'G' ':1:'.lx.3.jZ:!f:?'g:'3.- "gl-'X ' M A r MECHANICS LUMBER Co. Isave Blg Oney t 600 Main st. ' i t C Fishefs This Cook Came From C31 - .- iwholesale Meats FISHER SANDWICH SHOP f Wx , ,- fs ff Q' V 4 . x X A g O fi L Af the FOOtB2Ag5hg Broadway "' 'Q 1 ' 717 E. Washington f 'XJ' g I, - N L R f , o ' ' ' Q xj NO. Little Rock, Ark. . Q qi, Here It COP ELANDS ESSO 1801 Main Tillaha C 72,1 X FRUIT COMPANY 1 5 300 E. Markham V No. Little Rock' Ark' Little Rock, Ark. A ECONOMY DRUG CQ. There's a Better Vrlifley to Clean Clothes 323 Main Street HENNEBQIRGERS ,''Quagigiglgsggiggfigrgefvifle'' M CLEANERS ai LAUNDRY iff 'Ax7 A P' C S 1522'Main Street Phone FR 4-1675 No. Little Rock mls North Llffle ROCK, Afk- 248 " 0 i, 1, Y . L, A .. : :, 1. - -1- :zz- 1 J' 9 T' 1 ' 'I'1 w 131:15 She's Shopping At-- My Professional Advice Would Be To Eat At x 1 1 1 '1 I 1 e K "LII,-,T ,Xf WCW ' X 1 WHITAKER 5 EDDlE'S CAFE 1 glifrf' GROCERY , X 1 1403 East 6th M 'Kd Rt. l Scott, Ark. Little Rock . f 600 West 7th sr. 1 re-i t fp ,J'id1lll.fflClIl11'Z1'S me Rock WHITNQPIG -f - er rrgfi John H. Rule ture - Q -4 r 1 "" President 5231 Broadway ix fi 4Q'1',, Q ,,. J Herbert c. Rule North Little Reeir 3: 8220 . 1 31: Sec'y-Trea's. " ' g Compliments of lakehill Realty Company North Little Rock's Leading Realtors Offering Complete Real Estate And Insurance Service To A Growing And Prosperous Pulaski County 4501 John F. Kennedy Blvd. t S SK 3-1118 f'gTiwN Ame f My Qut oi 1 .K 'se gt?!gZf SX w, . in imx S9 xx ' ffm '77ZaUe Q4 aiu? 1? 9 p 1 Z i DON'T CRY--JUST ' M Z, ' BUY 1v1oRE NEXT TIME! 'N MADE BY BORDON'S OF ARKANSAS 7900 ASHER AVE. LITTLE ROCK 249 517 Chester Little Rock Nothing Satisfies Me Like Savory Lindsey's Bar-B-Q 201 East 14th--No. L. Rock AMSTAN SUP P LY 406 North Locust Street North Little Rock, Arkansas Rand Wholesale Grocery .7'5rQ'fA M ,, 1' n , V4 , , .llyiiif 'W 3 'f 2 1 , ' m l, M :X kiq 1 ,4 3 ' I ike y ? N LR ROSE CITY ,I N CHURCH OF NAZARRNR I ff S Your Community Church f 1 211 Lynch Dr. -4 51+ J - 1'm Going For A Once Over Ar- Pat's BEAUTY sHoP 2017 W. Long 17th N.L.R. ' ' t'ee Jimmy s 'if 'C N G SUPERETTE R 3015 oak EVN' Jacksonviile AN , From fm- ', , ECONCMY vi9""' ' LAUNDRY F V v Q - Q c 0 I c , l AND CLEANERS , 615 Main--No. Little Rock Ark The Steco Corporation 1 77 ,,, Norlh time Rock nmfs 6 Shop W QW f 'f l U Q Q - X 5623 Kavanaugh 311 Main Street "V7E'. , - EQ? A Freddle's Dairy-Bar U 7- 7 Hamburgers .......... 1993 ' . 3 j ff O Cheeseburgers . . .4 . . .S1.00 French Fries . . 6 . . 1.00 Bar-B-Q ...... .. .5 . . . 1,00 Wg S-P" BOX 701 3314 E. Broadway No.L.R. xg, A Q My , 1 it A gf" Q 1 ", f A- 'W -"E 3 Y 'S COTHAM ' F1 ll ,Q MERCANTIEE Q ' f . SX V 5 A 1 I Jswsisns ROFFG rkvgh- U ft SRO? ' f S xy I' X 1 1 Q 4 l " ' 619 Main St. Little Rock, Ark. ' Q ' ' ' Now lt's Since 1931, it has been our pleasure X P .' to congratulate graduates of North Little ca- eP5l- ' - Rock High, and invite them to visit us for ' the finer, more exclusive for those Wh0 DIAMONDS JEWELRY WATCHES ml , think YOL1113! SILVERWARE CHINA CRYSTAL al nt.g'g,?!?fgf '5i2'g1.f.tws'xgzfgi xg , ':Lf':m'g'?"M"'4'fl'f'7'5557255 . . . and it all started when I fell 1,3 v .V -'fi r, - - fl' ' 'M' H- madly in love with in-'V a gg .4-.t WHTHE E+ ?ti,ATlQ,NA!-1 NYESTORS -1 af" ff' " ' Zfftff HY'-"fie'4' .sg f-pzvcugt-zyqT?S'3f2:4ffgg34I?ffi+ -9 P IKE P LAZA SHOP P ING i?5?'fQY2?f,i'11355- mf"F3ie-335121. 114:11-'A A ifffwwiff '21-115532 ,.tw1g5fP.'i1.:1a'2fx-L16 I C 1 CENTER ,, 35-k..'z11ftL5r2if'ff.L.Airs'"MQfimil-i?Sf15:tinTe,f1-giatarsrafwwi' Q13 '-J' 757551 :Fr 15' ' " f '., - f'A"7S'757 -'if 57 'i""7?f11f-fl f2'7"'i' 1' 'A-'1.-EL-',e11f:' -"3fkf5:f'a1Ar'-f 1- 'x'fE?3.f'.f1.f5l-Q9 f f ' . 1.3.1, f 1 ALDRIDGE iwkiigfii?-fZsfi'lQfiax2-42125233955321aigifiiliffi am" 5' R7 M" -W 6 ff cf 4, 1 MARKET 3' Q" ' f ' QT' !:?3Qfi.x.,A 1' 5 A ,lv lfw . 'gn I" Tl., 'gf-it at ""?g1'5gf 1?.if,5t5E3f?:7,,'25",.'.236 'f'-Q1-Pjj'f"' f.fQM:t:' rr -5 5 ..' ' ' 6 ' 5 ' v fx if N A 1' 200 East Broadway E1 , -- 'f' ' A North Little Rock -a?:,.. -iifkafiiiiaiiftbtiaitt,.ff'2'S2i:xfi3:f1'FfP5fifL ' S5511e,-.'v-s'-SaZfJ'e',-f1-ll 291'-Eifflwfiaiisgft' Jfav.-'Y'M'-" - - fli- 5'm':Tz-L6--P il?5f'5iAY"1f'3fiz3"1Q '-.1-sr. ' ' ' bag ' ' - A , Evans Swd-o 1, A t I ' 1' A Wedding Portraits Q 1 ' fir-I ti , '- - fu- . 'gg A ,F 'qv-. l l - I . 18th and Pnfe, N.L.R. QF V . -.t - -,- 1 ' , 1. A : , IRL- k54..,.v:x .Egg-'. ' . . , " -, i ' FR' 2-1236 -. 1 t 1 - - .. 1- f, ri' 1' fp Sl' it 2 A Q 9 . 1 f T9 it 53. - - 1-la, .. Pull Right ln . . ii' --A .... - .GEM :'ffi.:j?15f?f,-3ZU33'f4 m2,g.x?3k . ,.1 -"' " " mln" ,,.,, t 5,35 1- -----5.11 ' , --53535-'---. affix? Y Starkey's Esso .- 1. ' 4 I g..f?,1:f.3r,2'f+ei-t?5'4.9fP '-.,.-'., Q f ' g.f:.-..."' 4:2-EQQQSQE..5g-L1f-tg'!'2,1-QQ-3. " 1 k . rx.: , -, - -1 ?'Jf,,:YY'EE-:iff A M a N - 1 " - .1 if tts, ' , get ' . N 901 Pike Ave. - .1 aw. 1.15 it-sf . , I 4 j I f5?f1:f'5't t'f':u"' 'Q f' '66 No. Little Rock av--f ws ff? ai-23.92 fi.. -.wr a 7, 151-af,1:::f,14'f . A He's On His Way To R. PIKER GULF SERVICE CENTER BRAY'S il" ' DAIRY CASTLE u:,4,. ' 1 2l0 West 4th Street 262.3 XQHIE I 1 L NO' Llttle North Little Rock, Ark. Mam L jd. 'Wl9' - g Roflk g lt's High Time l Paid . 'T E A visit To "5 . G. W. .TERNIGAN ' VOGUE BEAUTY SALON Store Fixtures gl Supplies 801-809 Washington Ave. I 306 W. 4th, N.L.R. I L Looking For A ,sifl rp: '1,-',. ,':r: 5 1 . -.:.- -. -.-,-.-. o.K. FURNITURE Co. Place To Eat? fl T," 4s 3. 2, LAWRENCE'S li 321 Main sr. A - " CAFE V ..g,,x,, iw A . North Little Rock, Ark. f""'--'IE 1812 Pike Ave. L3 N THE PRINTER PREFERRED BY PARTICULAR PEOPLE E sg A ' Lf 515 MAIN 0 NORTH LITTLE ROCK 0 SlNCEl9l9 252 GOOD HEALTH Is As Easy As OLEMAN P UYING LWAYS DAIRY PRODUCTS Take a Tip! Straight from the Horse's Mouth ! mmts GARAGE ,rr IS THE BEST PLACE IN TOWN EOR YOUR REPAIR WORK 7 1317 POP LAR STREET NORTH 'LITTLE ROCK, ARKANSAS 'SV The Best Bargains--The Finest Clothes MH 45 3. is I Are AE Hall s Men s Wear 224 Main sr., N.L.R. I t A zttqqi xg, W5 I 4 Need A Haircut? ,Qty --E ff'-I L - 1, . A rg, evy 0l'ISf fl, Mf r, Normans Q Q H K ',.,, A - rl 1 . o f Q 3 1 -A ,tel 4003 Conway Hivvay I A Barber 'Rig ,Ingo ,Q 106 Main, NLR Garrison Co. 7, H - Lv H"' i mu my 204 Avenue 3300 Pike No. Little Rock fz X-7'Q7'v?'l f, ' , xv 1 ,W .tt. .i,r I ,N ,W V" MLERPIQIIRYS KAW, 1 1 ER R nu A it iie A A I A fi? CENTER '. "ffm HA- rugrgrrirgr co. , And1S2,3giCDriVe A M E R I CA N Wesffrh St.,LittIe Rock Em fi 1 t 253 254 You Pay for a Business Education Whether You Get It or Not fComparative Life Earnings: - - Institute of Life Insurancej It is estimated that the untrained man goes to work at 14 and reaches his maximum at 40, with a life earning of S178,000. It is thought that more than 50 per cent of the untrained workers are dependent upon others after the age of 60. The high school graduate rises steadily to his own maximum at 50, with a life earning of S243,000, The business school graduate, since his income depends upon his mental ability and training, is con- stantly improved by practiceg his income increases rather than diminishes. The graduate in business administration reaches his maximum at 60, and has a life earning of 3347,000, These estimates and figures are conservative, but the equivalent between each bracket would be in proportion to the dollar value in difference mentioned above. ACCREDITATION OF SCHOOLS The accreditation of a school is universally accepted as a guarantee of educational respectability. It means that some recognized agency has investigated the institution and found I that it has at least the minimum physical facilities, financial stability, and faculty personnel necessary to offer in a satis- factory manner the educational program or programs it claims to offer. LIFE INCOMES At Educational Group Levels MEASURE YOUR ABILITY 1, What does unemployment mean to you? 2. Does your present effort represent the best that you can dofor yourself? 3. Would an extra skill, or additional knowledge, give you a better chance to get ahead? 4, Are you contented to keep on, year after year, doing the work you are now qualified to do? 5. Have you any assurance of advancing to a larger income and greater opportunities without additional specialized training? 6, Will you ever have a better chance to prepare for a busi- ness career than you have right now? 7. Don't you believe proper training will give you confidence and enlarge you to an outstanding job when competition is I greatest? l 8. Don't you think what you do in the months immediately ahead will largely determine the kind of life you are going to lead during the next 40 years? 'The Untrained The High School The Business Grlduste Administration Graduate 9, Don't you think an office position provides a steady income, pleasant surroundings, paid vacations, regular hours, and unequalled oportunities for advancement? 10. Don't you think business training at Draughon School of Business would increase your ability to select your posi- tion instead of taking a job? DRA GHO 22233 Zi 223.255 BOX II 2l6 Wai Sixth Sf. LITTLE ROCK, ARKANSAS Mccouum Keuev fffiiii' 'ix , Q LUMBER AND SUPPLY Co qv---W-.N ? 2522 East B Easy Formula For Great Food WA Q. af 1' i If ' 5, 5" Q6 ' 5-2 J- f2i,' ' V 'i v fy'- xsx Y, -'I T03 256 AVUIIJZ AA f to Tom and Andrew s W. Capitol FURRIE R, mc. ' ' F , , . - 'Z' C?13?Sli?2f2'5uEu5l?25f-.0f Central Butane Gas 5th And Smothers Streets No. Little Rock, Arkansas ' , , cp i a l t o Troublesome City Traffic f. .5 High Parking Lot Costs-- BARBER SHOP Take The Bus And Ride ln Comfort. f. 0 Congratulations Seniors -INTER-CITY TRANSIT COMPANY- U 20, Mm Serving North Little Rock-- Q THE GOODYEAR SERVlCE oth S Main North Little Rock, Ark. Aim For Good Fun At: ' -il.'L W ,Eight I ' North llttle Rock ice f ' ct b K A it Boy s u f .,. l3th and Main sf. Sfein Lamlab i guru 5 f 'ff fe ill' 5519-It will ll2O west 7th .-Few ?"t5illl1i1.f'3HQ-lit Little Rock Williamson Drug North Little Rock l28 Main Street DO YOU KNOW HARRY? Harry is my friend, and Harry is your friend, and Harry likes to share. What Harry shares is brightness. He is not a sunbeam or anything, but He sits at a big desk and pushes light buttons, l bet. You can s ee Harry at 3lll Broadway in North Little Rock. They call him the manager of this building. He doesn't manage the building, but just the workers. But you have to ask for Mr. Oswald, because Harry thinks its more polite. And politeness is important to Harry. He wants to help service your home with light. He says that Arkansas State Electric Co- operative, lnc. Qwhere Harry man agesj is the service association for the l8 electric cooperatives of Arkansas. Now, aren't you glad you know Harry? They ve Got Some Wane, Vac. 5? , V A Hot ldeas At if QU 3, xi ff R200 Asher Avenue v .fm Little Rock, Arkansas a 1 f' Vi XJ Remodeling Service ' . lt Gets Done Right By The 1 X ' -E, 1 ,Q 1 . -X w fi X D asf IydS a I ip mt PLUMBING coiviP ANY VAL f M q IP if gh l6l5 Augusta--N.L.R. A ' ' I " Bd"':"'Yfk I'dgP mn. 'QV Vg ff d I 1 fp I K ? WE lu ' d fdhfg qzsavrzlflt K " 1 I Oo mu y Goa 53' 1 f Uorrroeffenxmc, ii K E as O0 S ' ARGE s. 9 GY ' E 1 3 Wfiisliaziiam I 1 2 a as A A-A A - Sovrfwesizmf SATISFACTION mum' sauna W Iii? 915 w f 23 d Sf 1 tl0'vGYl126dJ N3.1i1Yfiel12f?Ck suwice mia fig' fi- .1 . ami- Entswlitnntus 'T iiiii N M H Y L k Rex Culver 81 Son . O iftewiig if OO 4, X537 lair? jreeze Garage ' R . At 4720 East Broadway lt ls The Best Place To Eat! .Acme ofinofeum gd jife wen Make 923 w. 7th street 1 Your Car Little Rock ' Drive Like A Magic Carpet! 2403 Jacksonville Hwy. North Little Rock L G R A D U A T E S i 8 Compliments Of A FRIEND Q . K M" "od .- 24 v"-GAB iii l709 Jacksonville Hwy. N.L.R. Arkansas 257 258 AQ!! mf .' ,,, ' BILL and oUE'S Q IJHU ll'lgS GARAGE 1507 E. Broadway . No. Little Rock E DRESSED THE -1963-1964 wwe Specialize In ,,,1g?E-A WILDCATS! Transmission Work" f , -. 'Y Good Luck Seniors! Mincey Auto Machine U 2723 E Broadway W15-1206 or W15 1101, N.L.R. Ark. Shoptaw 11 ' iiii JA N' lFb' 1'1. sN-4 aiwna a NCS ,AU Custom- Made Dr apes ii i 2' . 1 702 John F. Kennedy Blvdfl m " Park Hill Y A , 1 I MATTIE FISHER MEAT MARKET ' LX and GROCERY J' W SL 1 106 E. Washington at N.L.R., Ark. If X N 0 w xx .4 c IQ :Tl Rui W iq.-. REAL FROLICSOME RooTEEER 513 CENTER STREET 500 Broadway LITTLE RoCK, ARKANSAS Little Rock, Ark. jg MAKE A DASH- ji For Q I Tolley's Drlve-In .2 X 3200 Fair Park Blvd. i in - David's Drugs Professional Building ! S See Us For All Your Moving mi-"TM" Needs!! ',lW is CHARLIE DIFFEE TX 5 MOVING COMPANY QQJML fl OA 4ni-U 620 E. Washington N A f 'H North Little Rock Shop For Your Furniture Needs At wa fface CZ' ,Henry A FURNITURE CO. Ir l25-127 E. Washington ' N.E.R. , T glvrisf AND GIFT SHOP 718 John F. Kennedy Blvd. Zfarkhill ,cwfliglzf SAVINGS 1 - .,,,:L1.1 llvll I .W. S B u d B ow k e r, I II S U I 3 I1 C B 2222 MAIN STREET NORTH LITTLE Eooli, ' ARKANSAS 259 WINROCK ENTERPRISES 207 West 2nd Street, Little Rock m dl - ' Simply W I About The 1 , D Service At .JA-1' ' I ' 4, V' ji N ,Q Q ,W uncan as W, L- 0 a I' m a C , E E E.tet L ll! X l 11 5 1 ' x V, M 511 Maple Street aw E FZ' - ' qegi North Little Rook E' " '- , ik, X Look To rA"' il as - ,f , ,- N0l'fh Side R X W in Garage E For Car Service X I , Vb., lllo E. Washington Z N.L.R. at 'MW 260 , , ,ff ,.,' I E SAVE ON Pnoros AT Dumas Milner go ig it i - L t , 5 if . Pontiac t irri Mitchell s Color Cenier Has The Car You'-ve Been W 1 " . V 3306 Pike Avenue Ifeggkfffciofofgt 'QQ 'fb Q' North Little Rock Can Afford. ', V .QII V- ig A W Mi f if Nix W. A: .25 f f V X Hu ffW'f f sea Warlef Serx2IiE?hYou Fine Meats v 9 5 il, 3424 Camp E xl 5 I Eii' 2 fkpihm Robinson Rd. l l i i ff i lj I f 1 ,V I 1 E I' V " Ln, a A X Bell' f f' FOR 0 .X I ' 1 C -Nm 9 " ft' Rm t X 401 West 3rd X ":..'z, ' Putnam MANHATTAN Credit Company Littl Q52 e Rock a A.AA A A Mobley Realtors 593 .x .,',- j ,--,, A 'West 6th St. EEK.. L1tt1e Rock g5ZbX9g9," -, 6,260.- Congratulations ,Q A I . .4 3 ,ill H 1 Semors! NL , , Q .,,. -ff! M. ' " '--- -D From I ' "" I ,lv Ml . if. 2' 1. ,ft . H 'Q .1- 5 QA f 5, .L , f' ' .mf , fiifiiiygpfif . , H N a n if "': lll Shelton CHGICE 501 East Bethany Rd., N.L.R. ON TERMS YOULL LOVE MADISON f JU . . ....,..:... .., ...- I Just Can't Look! The Ultimate Name In Pastries 711 Main-No. Little Rock womnfn X Bank and Trust Co. 3 Mil At Main 81 4th Street F 1' Worlds best synonym 3 for quality! ff . 1 Main Street - Little Rook " " 'Yrs 1 tg 1. 262 ii ii .eg gf f ,,A' V , Abkub If -,,-.-- V ' b A-.Lv N A FRENCH miss if Only 15c America's finest potatoes, cooked to crisp golden goodness BRING THE WHOLE FAMILY ' A ' mn ' 1 Q E i az. eef M L , I "1-'R f K ,.A-.171 L K , ' : ' J wi See For Y If "Wh V ourse y f Broiling Makes 4 gf, The Difference' V in the finest - 3 ,K hamburger money can buy ' M d f 1002 In a e 0 Pure beef with juices broiledin - 1 5c Q ' ' 'K f 'fs , I ,IK MORE BURGER BRGIL SPECIALTIES Cheeseburgers ............... Broiled Cheese ................ Coke ...... .... Orange... 2127 Main .20c 15: 10: 10: Root Beer .................... IO: Milk ........................ IO: Coffee ...... .... I Oc Not Chocolate . . . . . . 15: North Little Rock A Milk Shake that only Burger Broil can make. thick and rich, smooth and fresh. A choice of flavors. 55, I' " ,nh COMP LIMENTS OE Amboy . Profes- , A rnnsnn wma? H1 hway Yuuaam CONGRATULATIONS, ce SENIORS!! Xnsgfan ON MAKING IT TO THE ' cy 5310 FINISH Agen I Conway gig BuI1dIng O ONE MOORE FORD SENIORS RONNIE BOSTAIN AND MICHAEL MOORE WITH THE NEW 1964 THUNDERBIRD. 4 Professlonal Bldg Phinis A. Lewis -Pastor- -fljvv NJ! DON'T LET no HAIQAEOQEEMS First Assembly of God Church ' UNPOPULAR! 22nd IxAtLF1i'ank1in 1 It N Louliss "In The Heait Og Lfhe Qi I I . , cn ,with T e 1 , ,f'uI:1!fg ' ,Ib BARBER SHOP A11 :Ieaff-" y I T- ,I 5 , 5 fx A . I,1QS5fss4s IAS I 1800 Maple-Room 108 rx . 263 '- . Q- K X ,if-A 1 X 5 I 1 H A NSE N ' ii i rt em, , .R A: 57021 .r,o ' iiaffga. -9' mf oiiirr -all !!l!'1St Poch's Esso Station SSO U ' WONDER o '- Bread - 0 ' Continental Baking Company . ' 723 west Capital ' "Service With A 0 1 Q SMILE" A Furniture 523 West Third Sr. ff - g'g,,o2 i North Little Rock as mfg' Ni? 9 Browns Barber Shop , 1 4 32 309 East Bethany i 1 J ETT RICKS R CONTRACTOR Specializing in Remodeling TO-85594 26 - T 9 I mmmmwn I In E R AN C H YOU CAN SEE ENTERPRISE The Brake Shoes CLEANNESS Exchahged 4114 E. Washington NLR Of Your Clothes From George's Cleaners 802 Railroad Ave., N.L.R. 1 , KENNETH EILL'S GARAGE 4620 East Broadway ul W QNear BuCl's Supermarketp 4th NORTH LITTLE ROCK I -IN-L-K WI 5-1180 Psst! Pass It Back: 1,5 1 on 1vI FA LIFE A BURGER BASKET, Ng in For The Best Food! 7 ,,,,,.. 2' ' INSURANCE COMPANY 2' ' 5' P 3700 John F. Kennedy Blvd. , Y , E Columbia, MiSSOuri AT Union Motors, Inc. TWO LOCATIONS 1100 WEST CAPITOL 206 WEST BROADWAY No. LITTLE ROCK, ARK. LITTLE ROCK, ARK. FR 4-7575 FR 2-1857 YOUR FQ jjlfhm pg: LINCOLN-MERCURY -COMET DEALER 265 IS A THICK MALT WORTH 2'1" SAVE A GOING ON STRIKE? FORTUNE! Q Yes! If It's From: At at 12 -- A Q -X Hale .Brollflers g w k DAISY QUEEN xx X rm I fifi 1 Wheel Service F. T . "Home Of Q Thick Mans" QD 5' :Q ' 314 E. Broadway, N.1..R. . .. 229 Mcfmhuf PIKE AVENUE I n No Cause 35: , I DEVELOPING For Alarm! CF ' 5 Go. - G xx H v I E f J Billingsley QW73? 2614 Pike Ave., N.LfR. . . X Ceramic Tile N HEY! GET WISE! A Ei Goff? A 'OE-,,i., Is Scuff-Proof! ' Q ' Eddie s I ,gt lounge 8. Snack Bar I ' , 1918 w.L414eV1eW 1111. M 2' 114 west Gap1r01,. Little Rock X My Benton, Afkansas gl ll l 21131585331 Emztns GA, J.- 1 l ii CENTRE l iuriuiurr , , 215 Main X 514' North Little Rock levy Market 3304 Pike Avenue . . .PUT YOUR TRUST IN Qpoot! A 1' A ill 0 fmsr , E.E. Springer f FEDERAL 1110 Supply srvmes A 3200 dd 15 John E. Kennedy iff THE HOTTEST TIP IN TOWN! Blvd-NLR f7'X, 1 . ... h 'F 'lf 0 ll? 0 N, C 0 , fa' 'E rongster ! -We T, lt GOOD LUCK, n -- 1:4 ix l l ' V G. T: W fif th' ' 'X sEN1oRs1 wf'9hf R xx , if 2 Ill M - et - e if . - Grocery Ig ,fy Bird, lange, Always Has ij L ff V' . Mganieqne 5 ,if U Mans, 8 Taylor X nac Lv 5 L l Specials !, li 'J Y "" '! 024 W. ietn 5 NLR y 5 1205 W. ern, Little Rock 'Y , l Buy All My ' - 1 0 ff' Y F .1 y'Eddle8n Harold s wk ami y Limousines L A y I Snack Bar Af 1 V Q 816 Main Street t X2 Little Rock V' Tullos Auto Sales 1422 E. Broadway North Little Rock Join Us At - - Razorback -H3 'g' 2, M 2700 Pike Avenue North Little Rock ' - CAN You PASS geunt ltchle 4' gfxn TI-IE CHIC TEST? SD ru 0 g Y g 6 ,ga e, 1. Do you read Swinburne? K Means Pleasing Service! Q3 f 133533 gvgtilflellggsssgu? s-J 100 Jenn R. Kennedy Blvd-NLR N' 41 is your perfume Dior? 0 L 5. Do you dine on oysters . . d h 'ff e? Ted R' wlllns aS9n 6.llsqyc?u1iaI01cEJil1l:u1refrom AI Sod Farm Vogue Landscaping Service X e 14" , R, tn R . S I n Rt. lil Faulkner Lake Road A t Bea uty G o X-"""l BOX 1488-No. Little Rock Q 306 West 4th, N.L.R. ? X YOUR CAR , , in NEED DOOTORING U 4 UP if f OFFICE FURNITURE ff ll , Cl de Little 0 ' Y ' ffl y "We Can Do The Most For You" J 7 an 1 Lo S 0 IOI'l 6l'VlC6 J ij urns ROCK'S FAVORITE omcs FURNITURE House 0 f 4608 E. Broadway X--ef L NLR. X 301 East Markham - Little Rock, Arkansas 1 1, 267 Studlos "l Say, Have You Looked At REALLY Looked At lt?" "I Gave Mine One Glance And Knew Something Must Be Done." L A I B I I C K Your Automobile Lately, I "So, Natoherally, I Went To Adams Motor Sales l222 East Broadway North Little Rock, Arkansas 820 South University Little Rock, Arkansas A.0. MEREDITH CU. NORTH LITTLE ROCK'S LEADING SERVICE COMPANY FOR HOME LAUNDRY EQUIPMENT, LAWN MOWERS, BICYCLES LOCKSMITI-IS FR 5-4463 200 EAST 13th STREET NORTI-I LITTLE ROCK, ARKANSAS 268 ,.T.T. ...Q-115 ,-5' COMP LIMENTS LAKEHILL SHOPPING CENTER 1 OP LH Ure. Gilliam Drugs PRESCRIPTIONS -- CALL US AT FRANKLIN 2-7534 eAv e Roc -SUNDRIES--GIFTS-FORTUNE'S ICE CREAM- --MEDICAL NEEDS--PANGBURN'S CANDY- --FREE GIFT WRAPPING SERVICE-FOUNTAIN SERVICE --PROMPT FREE DELIVERY- --OPEN 8 A.M.--OPEN SUNDAYS--CLOSE IO P.M.-- I Stanley Q? I gf "THE CROWNING EXPECTING7 Q' jjj TOUCH IN ' 'f f' FINE JEWELRY" To purchase A New Homefl-hat IS. Watches . Diamonds . Silverware Be Sure The Floors Are From ' Charms ' l DOYHIBHY TIVO gm M2I'bI6 3422 John F. Kennedy Bm. 926 West 34th Street--NLR NON1-1 Little Rock 269 THE AETNA LIFE INSURANCE COMPANY IS PROUD TO HONOR E.A. OSTEDGAARD 81 ASSOCIATES GENERAL AGENTS WHO ESTABLISHED IN 1963 A New All-Time Record In National Sales Leadership Aetna Life Insurance Company E. A. Ost 81 Associates, General Agents MAIN OFF LITTLE ROCKX 105 Main Streetf Telephone: FR 6-3281 DISTRICT OFFICES: TEXARKANAX 503 East 6th Street! Telephone: 773-5597 FORT SMITH7 First National Bank BuildingfGarrison at Sixth Streetffelephone: SU 3-S931 JONESBOROf705 Union Streetf Telephone: WE 5-2961 x. gy h' . , U JI-, V-.X - " - j,- 5 r- -' ji. ' figi bf-' 1,1-A "' gs 415' 4- - 'Ani ,Af I' 1 r wk 'sy' b -'ha' 3,3 Fa 1 Sgr " . ' - -ffz'?g'1-fif affair,-si 'E'1" '-ff,Lef"-.ff-f, if 'i flfg 1+-5 t02?ii""- Sf' Fr- A- f'-F111-f-.rw--,--11-5' sf-.ft rigs ' H S Q ' iii., . ' .ly AQVFQL , f gin' M, VA 'R 'oifiifir TK is E, L f 41? 'r :jig le .x yx 'idx gi A rr 5'-inbiv, xg ang, lang? ii A13 M 1 ndly Ser Vi .2 'l.,:1." 1 ,f 4'.,'f1--'Q if ,gh f ,gf .. Eb 'zgvga 3' as J-5-'ie Ce 5 25r .'x"?' :m'+:,f.!vg3i?z'3i52:5 fK52,25Ei54512ii5'i?9qfi',q:SY'f?'fgfiikfsigfflwfff ,si may ft 235125 :ie E,QQFZ-XZLQT-i'1'f3'aA?-!?iM:xs.v. ,.,,,f1-ggyilg -' 1- Y i L-1-51535 Xiwf- W-fi +559-c"rrt'Tir"'ffrwaf1+2ifa-a'?'e1:4'-"'' ,,.. ' - ,' 2 ea 1 - '.-- V- ' as :nf 41 4. K' -.tr f- if-r-25-f ,',K,:.. , .' -5 gag--r.r, .L f . 'cor 3 T -156-3 fa vis? 'XXII iff' J aw 1, 1' C 29 V, 1- , Q 'r 'f " " --u 'Q '-x - 1' 119- , :S 'L-".. on L 'I ry- ri .- . ,.7.l ' -,, .1 1" -5 xi '--' .J ' 11. ' " ,3ff."-'I' Fi. n..-.- J' , s' fu- - ':' - " ' 3. L.-'jg' :fn 'V 4 iv . ' mdk' 'A 'Q 44-3 ,I ':"'lf24"-7k'i'4"-'QF' " Y' '1"'T-'Z-' H' 51115645 23:3 JT' .AP - . 1: ,," - ,., ' 43: f 41, t P in 1- - -3a'.g.riivS'fEf:vQJqfif3 ..f:'fw5iZ'ff?fsaia2'raf:fn4?-:Q '1A'i5-r,f'SgQET:5fE- f, '4 'K' ' 'gig' ,ff .-"5KA'5,f3V,"xZ!- 1.4 ' L, - 1'---'-2,gL"" ."":'Vf"gf,?fLf: . are 5"'iA'-'l35?V--7-52,5 W. if ?'wa-. , .' fig"--lf' , J ' if 7 :- :r if f--e 'V at .fl ' 1 . . ..+.' '1 1 4, . .- 4 .1345 fr "Wifi 3 an kzyirwab PA' 5 3361455 WC mage Glover 8. Co. Food Brokers 1800 East 26, Little Rock, Ark. x Mr. Rush Johnson of WalsworTh helps of A rl , lliw rl Avon ps Esso 26th 81 Main--34th Camp Robinson Rd. staff members plan the 1964 Wildcat. 'Una-Q... 270 Southern Aulo Parls Has Everything For Your Carl 2401 Railroad Ave. North Little Rock 'NFS Publications staffers prepare to greet deleg ' - - ates to the Mid State Press Work for which NLRHS was host EVERYBODY'S Making Tracks LaVigneE Phillips 66 Service 2400 North Main No. Little Rock, Ark. SENIORS RICKY RUSSELL AND WILLIAM KETCHER ADMIRE I THE NEW 1964 CORVETTE STINGRAY F ROM Russell Chevrolet Company "V'1.as,,lb,! ' f iw use . .W-v 271 H614 IGM Studia 205 MAIN LITTLE ROCK, ARKANSAS W If f fly ,bn C J ,Cla ,L 7 ,,,, iam- Q' t,q,4',LU 21 N ? N MC' ' , ,. I 11 ' WMU f LLM? " N f "L 1 , ,.. . nf-4 Tx ,4 .A., .Ly , U , 1 gQ".iM:f J L' Xrfxif'!J?7L'5 fdfypf EX FLLAI' 5 Y C 1 f gf w11Vifff'L:j'jLL i if "'A ' ' TQ '1 'A" Q VZ-gufif. ft YSL 95 'f Efwfiiag' if fa P ' - afjyjj ,,,. L f MW fy yfjg SL! ,f- 1 .!, 4 ,, .q.,. V Litfckkf 3 L', I L ' Vi 'ffsck , ww 1 vw,-Q 93,6265 1 '1i1fQ-g?'k 55, 1?uT2 5 ffzfsrw ' if-vga: .Ai ' . . luv., u s F- . . 3-5.5. . -,fi -' vw, 5 .M 3 V- 4-:gf , im" ,il ' ,F . wwffwwlbj LQLKQQB E M551 x, K , qffilriu f N-+644 x ' iisffii ' ' . ' .hum 38'-s"'3'4 92533 :ga-55:5 3 -2 .251 ,4 nzgfd kj z 3- . iikfffi 'zisliiss' iizhirrf Ffqiugj' Jlwng 'Sli-97'-'-:fe 255-"" 1:13552 55 ' '-is QUALITY YEARBOOKS FOR HIGH SCHOOLS, COLLEGES AND ERSITIES MM MSL MS WA S OW fy , ' q v . . 5 I P0 Box 333 Marcelnne Mnssouru V W Pubhshmg Company Inc PO Box 6091 Wiesbaden W Germany WW A .gg P.O. Box 222 O t t a w a, Ont., Canada 1:3 - - ' , . W aw 273 b if wg W, yfir, f M , X fb 5 . WN ay, K I H jgdnf ' 6 ,QSM b A W W cw , LN if K 4 ZJVOLJ K 1 X K H f L15 3 A Q QJQKQN f ff,siuQ J STX-f'Ub'LO :J U 4 K - C L' . J OJLQUUUH MW , I 11 fwwww W wwlg wmwwww my 4 kivwf f f O9 MWf,w'xN sg? WU we X5 3 M S3563 WWwmW? UW ZZEQQM WW uw , M4 4 lf " 'J 't ' B f MM' 1 If 1" if bw,fx,N , K 'Y lp , -I V y z. ' I 'GE J 'vf V" kd- Qu' fi' VI VJ-1 AU' ' AIJ u W ! .,w , . . ,M 1, A W M ,ff fgj' WWW f Ml 'U' 1 Vgqafe AOQWW QM f f60jZu"755'iQ ' , AL, M- Ji M-5QfwG4a9Wg,Qj QL! KQQXOJL. kuahovue, 6 kf5L QMmmmm qui S GEMM! k?gZ,0.J1,. 7M'G7 'fV ggmuq QQWJMQSMQ ff X fvfwvl QM Md WW W! , X Z I f Q John Thom son CMA ' ' A WQQSE7 ca O if x XJ 14 X.-f J BuddyC lbll N.L.R.H.S. Beatles P B Q33 W gjj?fQ'NgW3fgW 5 My W fljrfx !L' VQQQ f52NfnQOg MQUWO ? kmw Q Wwqj gig Il WWQ5?wi?1ij P35525 WO gpg + Zggggw Qwfw M My BWQJQMMMA WM. N if UM, ' PM U , -,,i,,+1: K-AJ , M w K x I 'pAv:L,. 5-fx , 5" M sbbvx ,A V ,I U ffvw mfg-.v..fy x 1 , . 4 V ,rw ' , .. 'N , K ' NN 2 wi WDM WM ww Wg, X k M MEX? M w WNMX Wwjfw Wfgwziw CEE! 514 QQWQV WW 30,3152 Gy-vJ'3" 94040 1111551 www ffff w iff i ix xfl J X . . 192 . 59,134 192 192 278 Abbott, Abraha A Ronnie . . m, Sammy Aclin, Dale . . . Acosta, John . . . Adams, Peggy . . Adamson, Charles Adcock, Gloria . . Adcock Adcock , Meri . . , Wayne . . Adkins, Linda . . Adkins, Sam . . . Ahliqui st, John . . Alberson, Carroll Aldridge, Jalynn . Alexander, Mary . Alexander, Susie . Allan, Sara .,,. Allain, Allen, Allen, Allen, Allen, Earl . . Diane . . Larry . . Diane . . Lois . . Allen, Sa ndy... Alpizar, Alicia . . Alpizar, Anderson Shirley . Eugene 1 Anderson, Elaine Anderson , Glenna . Anderson, Herman Anderson, Anderson, Timothy Andrews , Andrews, Andrews, Lillian . . Linda . Patricia Bobby . f I Anseaume, Lynn . Antonsen, Nancy . Ard, Carol .... Ard, James . . . Ard, Robert . . . Armburst, Diane . . . Armstrong, Phyllis Armstrong, Ronnie Ashberry, Tim . . Atkinson, Diane . Atkinson, Kaye . . Atterbery, Arlene Atterberry, Larry Atterberry, Rodney' ' Ault, Richard . . Austin, Anne . . . Austin, Kelly . . Avance, Diane . Avant, Terry . . . Avery, Michael . B Bachus, Jeanie . Bagley, Sharon . Bahil, Bobby . . Bailey, Dwight . . Bailey, Graham . Bailey, Nadine . . Bailey, Nancy . Bailey, Paul . . . . 191 . . 212 . . 191 .. 51, 212 131 191 131 191 212 131 . . . 212 . . 212 . . 191 . . 191 . 191 . . 191 . . 191 . . 131 . . 191 . . 131 , 212 . 191 . . 191 . . 191 191 212 .. l .' .u . 1.7, 4O,82, .....g1, . . 4.7 .' ' is, . 63, 37,54, 212 191 131 191 212 212 131 131 191 131 191 131 212 . 191 212 132 132 191 191 132 132 212 212 132 191 132 132 212 . .. 45, . . 132 191 . 212 212 212 212 49,191 . . 64,191 I964 Wildcat Index Bailey, Vikki . . Baier, Diane . . Bakelekos, John . Baker, Margaret . Baker, Rosemary Baldwin, Brenda . Baldwin, Richard Ball, Becky . . Ballard, Blaine . Ballard, Ronnie Ballen, Anne . . Baney, Nancy . . Bangert, John . . Banning, Sandra . Bardin, Joyce . Barker, Connie . Barker, Ronnie . . Barnes, Janice . Barnett Donna . . Barnett Kathy . . Barnett Beverly . Barnett Sandy . Barnsley, Jim . Bartholmey, Carol Bartholmey, Gillis Bartlett, Becky . . Bartlett, Dan . . . Barton, Charles . Barton, Sherry . . Bates, David . . Bates, Becky . . Bauer, Jerrye . Bauer, Sue .... Baugher, Mike . . Baw, Dennis . . Baxter, Phil . Bead, Sharon . . Beard, Tommy . . Beasley, Peggy . Beavers, Phillip . Begen, Martha . . Belew, Loretta . . Bell, Jerry . . . Bell, William . . Bennett, David . . Bennett, Selenia . Bennett, William Bennett, Janie . . Berger, Julanne . Berry, Ernie . . Berry, Jerry . . . Berry, Steven . . Besancon, Charles Bice, Becky . . . Biggs, Sharon . . Biggs, Nina . . Billingsley, Jo Ann' . Billbruck, Mike . Bircheet, Geraldine Bise, Jeanette . . Bishop, Doris . . Bishop, Larry . Bivens, Jerry . Black, Johnny . . Blackwell, Mike . Black, Sandra . . . . 191 . . 191 . . 212 . . . . 191 . . . . 212 . . . . 212 2l,35,4l,86 87,132 44,53,88, 132 . . . . 191 . . . . 192 . . 212 . . 212 . . 212 . . 212 . . 192 . . 133 . . 133 . . . 192 . . . . 192 . 37,93,192 . . . . 212 . . . 212 . . . 192 . 97,192 .. 212 . . 192 521,536,s's, 212 212 133 133 192 192 192 133 133 192 . . . . 192 . . 192 . . 192 . . 192 . . 192 . . 134 . . 192 . . 192 . . 192 . . 134 .. 192 212 . . 192 . . 212 . . 212 . . 212 . . 134 . . 192 . . 192 . . 212 . . 134 . . 212 . . . 212 . . . . 192 . 167,212 . . . 134 - Blakey, Don .... Blaylock, Robert . . . Blanchard, Warren . . Bland, Linda ..... Bland, Shelia . . . Blanton, Delores . . Blanton, Pat ...... Blasingame, Ronald . . Blevins, Sharon . . . Blount, Cynthia . . . Bobbitt, Cynthia . . Bolin, Gary .... Bond, Janet ...... Bookout Ken ..... Bosley, Bill ...... Bosley, Skipper .... Bostain, Rondall . Bostic, Danny . . . Boswell, Suzanne . . Bottoms, Charles . . Bolin, Jimmy .... Boshears, Robert . . Bowen, Jo Anna . . Bowman, Diane . . . Bowman, Darrell . . Boyd, Nickey . . . Boyd, Paula . . . Boydston, Glynn . . Boyer, Terry . . Boyes, William . Boykes, Richard .... Brachin, Bill ..... Bradley, Jerrye Anne . Beadley, Marilyn . . . Bradley, Paul .... Bradley, Ronald . Brant, Phyllis . Bradshaw, Joe . . Branham, Janice . Brannon, Beverly . . Brashear, Jane . . Bratcher, Judy . . Brents, Nelda . . Briley, Benny . . Brinkley, Carl . . . Brinkley, Gwynn . Brinkley, Keith . . Brisby, Carolyn . . Brisby, Marilyn . . Broadhurst, Joe . . . Brockington, Shirley . . Brown, Diane .... Brown, Cindy . . . Brown, Glenda . Brown, Jeanie . . Brown, Jerrt . . Brown, Karen . . . Brown, Kenneth . . Brown, Marialice . . Brown, Margaret . . Brown Patty . . Brown Paul .... Brown Rebecca . . Brown Sandra . . . Browning, Wayne . . Bruch, Rebecca . . . , . . . Borrengasser, Marianne 99, 212 192 212 192 212 192 212 212 212 212 192 212 134 212 134 135 135 135 212 193 212 . 192 65,192 135 193 821, 89, 41 is, 135 193 212 193 193 212 135 193 213 193 193 212 212 193 193 193 193 212 212 212 193 212 212 135 212 135 193 135 135 212 212 193 212 193 136 193 136 193 212 136 193 213 Bruce, Linda . . Brumley, Vicki . Brummitt, Marcia Bryant, Donna . . Buercklin, Sharon Buice, Anne . . . Buice, Bill . . . Bunch, Don . . . Burks, Don . . . Burleson, Brenda Burlison, Tommy Burnett, Bill . . Burnett, Linda . . Burnett, Valerie Burns, Gardner . Burns, Lavern . . Burns, Lavon . Busby, Glenn . Bush, Tommy . . Butler, Danny . . Butler, John . . . Butler, Vic . Byers, Sara . . Byrd, John .... Byrd, Paul .... Byrd, Terry ,Joe C Cagle, David . . . Cagle, John . . . Cagle, Ralph Cain, Rocky . . . Caldwell, Charles Campbell Calhoun, Jerry . Campbell, Buddy Campbell, Bruce . Cam bell Cathy . P , Campbell, Micheal Campbell, Ritchie Sharon Candy, Bob .... Caple, Pam . . . Cargile, Ann . . Carmean, Carolyn Carmack, Susie . Carpenter, Larry Carr, Don .... Carroll, Charles . Carroll, Linda . Carroll, Larry . . Carroll, Nina . . Carson, Linda . . Carson, Jackie . Carter, Danny . . Carter, Glenda . . Carter, Jimmy , Carter, Johnny . Carver, Carolyn . Carver, Terry . Cash Robert -. . Castlyeberry, Charlotte' D. Casto, Ronnie . . Cathey, Martha . Cave, Carol . . . Chandler, Barbara Chandler, Sally Chappell, Judith . Chapman, Kathleen Chapman, Kerren Chastain, Cheryl Chrestman, Gay 193 193 213 193 213 136 213 . 16,212 213 . 63, 213 213 136 193 136 213 213 . 213 . . 30,651,213 . . . 213 16,213 136 213 . . 21, . . 41, .3 -.. 42163, --. ' ' '37,59, -- an 193 136 136 193 137 193 213 213 193 193 213 137 213 137 213 213 137 213 193 193 193 193 193 213 137 137 213 137 194 194 137 213 213 138 138 138 213 138 214 138 214 138 139 139 214 Chrisman, Cynthia Chrisp, Ed .... Chrisp, Ray . . . Christensin, Alfred Churchman, Ray . Claiborne, Charles Clardy, Dennis . . Clark, Betty Jo . Clark, Linda . . . Clark, Ronnie . . Clark, Ronny . Clark, Peggy Jo Clark, Sharon . . Clawso, Linda . Cleek, Mary . . . Clements, Gary . Clements, Suzanne Clifton, Gail . . . Clifton, Lowell . Clifton, Raymond Cline, Sally . . . Cobb, Gary .... Cochran, Janette . Cockrum, Cynthia Codding, Mary . . Coffield, Cathy . Cohen, Ronald . . Coker, Shirley . . Colclasure, Donna Colclasure, Rickey Cobb, Jan .... Cole, Irma .... Cole, Jeane . . . Cole, Johnny . . . Coles, Edward . - . . . - . . - . . 1 . . - . . Q 3 .- . 1. - 1 . . . . 3 . . 3 . . . - 194 139 194 214 139 139 214 194 139 213 213 214 214 214 139 194 139 139 194 194 214 214 214 194 194 194 214 194 . . . . 194 . . . . 100,219 139 --.. I I . I '66,3e, 194 140 213 Coleman, Marguerite . . . . 140 Coleman, Thomas . . . . 194 Collar, James . . . . 194 Collins, Cooper . . . 140 Collins, Jeff . . . 214 Combs, Paul .... . . 214 Comford, Curtis . . . 140 Conly, Sandra . . . . 194 Conrad, Karen . . . 140 Conrad, William .... .... 2 14 Conway, Herb .......... 140 Cook, Barbara .......... 214 Cook, Bruce . . . 34,35,59,86,87,140 Cook, Cathy . . ....... 89,140 Cook, Francis . ........ 214 Cook, Fred . . . . . . 197 Cook, Jackie . . .... 214 Cook, Joe .. . . . . 17,22,194 Cook, Ronnie . . . . . . . 194 Cook, Sharon .... . . 140 Coomes, Linda .... . 194 Coomes, Raymond . . . . 214 Cooper, Linda . . . . 214 Cooper, Larry . . . . 194 Cooper, Rebecca . . . 214 Cotton, Linda . . . . . 214 Cotton, Patsy . . . . . 214 Coulter, David . . . . . 194 Coulter, Marilyn . . . . 141 Courtney, Pat . . . . 141 Carol n Cox, y . . Cox Crystal . Judith . . Cox, Cox, Gene . . Craig, Ann . . . Craig, Margie . Craig, Walter . ..44, ... ...- .. 81, 194 141 194 141 141 141 141 Crain, Wanda . . Cranford, Glenda . . Crawford, James . Creasy, Gloria . . Creasy, Carla . . Creasy, Judy . . Crews, Jack . . Crews, Robin . . Crews, Sherry . . Croom, Mike . . Cross, Rickey . . Crossman, Kathy . Crow, Judy .... Crow, Myra . . . Crowder, Dana . . Crowder, Ed .... Crowder, James . . Crowder, Kathy . Cruse, Gary .... Culpepper, Bob . . Cummings, Brenda Cunningham, JoeBob Curry, Jackie . . . Curtis, Robert . . . Cutler, Barbara . . D Daniels, Allen . . Daniels, Steve . . Davidson, Jerry . . Davidson, Judy . . . Davidson, Linda . Davidson, Robert . Davis, Barbara . Davis, George . Davis, David . . Davis, Marilyn . . Davis, Jim . . . Davis, Jeff . . Davis, John . Davis, Jon . . Davis, Larry . . Davis, Pam . . Deaver, Billy . . Deeter, James . . Deisch, Peter . . Deisch, Sara .... Dempster, George . Dent, Diane .... Derden, Curt . . . Dereuisseaux, Diane Derrick, Woody . . DerryBerry, Betty Dervartanean, Ray . Devore, Diane . . . Devore, Pat . . . Dew, Linda . . Dew, Tommy . . . Dickens, Joe .... Dickerson, Brenda . Dickerson, Sondra . Dickey, Dorothy . . Diffee, Eddie . . . Digby, Robert . Dillon, Nancy . Dillon, Becky . Dillon, Sue . . Dively, Linda . Dixon, Shirley . . Dobbs, John . . Dobbs, Paul . . 89, . 61, . 49, -. .. .. 17, ' ' '53,37',9'7, . 214, ' ' ' 93,l67, . 58, 141 141 194 194 214 194 142 194 195 195 195 214 195 214 142 195 195 214 214 142 195 142 195 195 195 195 142 195 195 195 195 142 142 214 214 223 195 214 142 214 195 195 214 142 214 195 214 195 195 142 214 214 142 214 195 214 195 195 214 195 142 195 214 195 214 143 214 143 195 279 Dubose, Bobby . . 280 Dodd, Larry . . . Dodd, Virginia . . Dollar, Margaret . Dollar, Sherry . . Donaldson, Joe . Donhamg David . . Donham, Joe Lynn . . Donham, Robert . . Dornblazer, Bobby Dornblazer, Cynthia Douglas, Diane . . Douglas, Frank . . Downing, Becky . Dozier, Alicia . . Draper, Roy .... Dubose, Mary Ellen Duckworth, Nancy . . Duke, Dean .... Duke, Jimmy . . Duncan, Linda . Dunn, James . . . Dunn, Pam . . . . . Dunwoody, Bobby . Durham, Ronnie . . Dycus, Wanda ' . . E Eanes, Thomas . Early, Karen . . . Earnhart, Becky . Earnhart, Linda . . East, Alice . . . East, Larry . . . Eastman, Ronnie . . Eddleman, William Edmonds, Norma . Edwards, Daryl . Edwards, Judy . . . Edwards, Paul .... Edwards, Roy Lee . . Elders, James . . . Elias, Eve .... Elias, James . Ellis, Phillip . Elrod, David . . . Emberton, Janis . . Endsley, Barry . Engles, Pat . . Engles, Vicki . . English, Mary . . Epperson, Buel . . Epperson, Gary . . Esch, Barbara . . Esch, Phil .... Estes, Robert Evans, George . . Evans, Sharon . . Evans, Sharon . . Everhart, Dick . . Evers, Linda . . Ewing, Vincent . . Everhart, Robert . F Fain, Bobby . . . . . . - 1 . . Q . - n . . 167, . . 167, ..- ' 16160, . . 167, ..61, . . . . f . . - ..41, . . . . 91, . 97, .-. a...- 28 89 351881 ' ' '4S,Ese',s'8, . .-...3.5, ..... Farmer, Sandy . . . . . . . . . Faulkner, Bobby . . Fearnevhough, Ken Fergert, Trina . . 11,37,59, 195 214 195 214 214 214 143 214 143 215 196 143 143 196 196 196 144 144 215 196 196 144 196 196 196 215 196 215 144 196 215 196 215 144 215 196 144 196 196 196 144 215 215 215 144 196 144 215 144 145 196 145 145 145 196 145 145 145 215 196 196 215 130 196 215 Felton, Mike . . . Ferguson, Pat . . Fewell, Darla . . Fielding, Jackie . Fielding, Paula . Fields, Candy . . Finch, Lee . . Finch, Gloria . . Fink, Jimmy . Finlayson, Barbara' . Finley, Tommy . Finnegan, Robert . Finney, Jan . . . Finney, Mike . . . Firestone, Sandra Fishback, Jane . . Fishback, Joe . . Fisher, Charles Fisher, James . Fisher, Joe Guy ...... . Fiske, Mary Katherine . . . . Fite, Judy . . . Fihten, Brenda . Fithen, Carolyn Fitzgerald, John Fleming, Ann . Fleming, Larry Fleming, Paul . Fleming Richard Fleming, Sandy . Fleming, Vicki . Flowers Richard Foehner Charles Foltz, Louise . . Ford, Francis . . Ford, Larry . . . Ford, Mary Jane . Ford, Sharon . . . Forester, Judy . . Fortner, Jeanne . . Fortner, James . . Fortner, Bobby . . Foster, Judy . . Foster, Lester . 145 . 145 . . 215 145 . 41,146 . 44,196 215 . 146 42,97, ... . . . f. 215 146 146 196 215 196 196 146 215 196 215 196 196 . . 196 . . 215 . . 196 . . 146 . 196 . . 196 . 215 . . 197 . . 197 . . 197 . . . 146 . 63,215 . . 197 . . 215 . . 197 . . 215 . . 215 . . 197 . . 146 . . . 215 . 65,215 . . 146 France, Jon . . . . . 146 Frazier, Rickey . . . 215 Frazier, Tommy . . 167,215 French, Carolyn . . . . . 197 French, Don .... . . 88,146 French, Sharon . . . 215 French, Sharlyn . . . 197 Frost, Gladys . . . . 197 Frost, Susan . . . . 147 Fugatt, Judy . . . . . 147 Fulford, Margie . . . 197 Fulmer, Betty . . . . 147 Fulton, Lynn .... . . 197 Fulton, Delores . . . 215 Fulton, Sandra . . . . 197 Furnell, Alice , . . . 215 Furr, Norma . . . . 197 G Gaban, Louis . . . . 215 Gachot, Carolyn . . . . . 147 Gabberry, Brady . . . . 30,215 Gadberry, Donna . . . . 215 Gradberry, Junior . . 197 Gage, Karen . . . . . 197 Gales, Creighton . . . 197 Galt, Cristie . . . . . 147 Grambrel, Liz . . Gann, James . . Gann, Jim . . . Gann, Leslie . . . Gardner, Becky . Gardner, Worth . Gardner, Kathleen Gardner, Virginia Garner, Barbara . Garner, Janice . . Garner, John . . Garner, Larry . . Garner, Pat . . . Garrett, Barbara Garrett, Charlotte Garrett, David . . . Garrett, Charlene Garrison, Phyllis Gaskins, Brenda . Gassaway, Susan . . Gates, Nancy . . . Gates, Richard . Gatewood, Havanna Gault, Kathy . . . Gasaway, Susan . Gentry, Becky . George, Bobby . George, Linda . Gibbs, Sue .... Gibbs, Marcia . . Gibson, Rebecca . Gibson, Terry . . Gifford, Eddie . Giger, Donna . Giger, Diane . Gill, Larry . . Gillen, Judy . . Gillespie, Dana . Gillespie, Dona . . Gilliam, Martha . Ginocchio, Terry Glaze, Johnny . . John . Glover, Betty . . Glover, Glover, Kenneth . Glover, Larry . Glover, Martha . Glover, Rickey . Glover Teresa Glynn,'Joann . . '. Goforth, Gary . . Goforth , Margaret Goodson, John . . Goodwin, George . Gordon, Gordon, Brenda . Rosalyn . Gore, Patsy . . . Gorman, Ronnie . Goss, Pat .... Goss, Jimmy . . Goss, Leigh . . Goss, Steve . . . Gosvener, Billy . Gosvener, Milton Gothermen, Jimmy Gough, Susie . . . Grace, Gwen . . . Graham, Alan . . Graham, Robert . Graham, Carolyn Graham, Kay . . . Graham, Lindall . 4 0 . . - . n . . ' 2.2, 93, u u 167, fn. v . ' ' '21, 61, v n i7 I' 215 215 197 197 197 197 197 215 215 197 215 215 197 215 215 197 147 197 197 147 197 197 215 216 216 216 197 197 216 147 216 147 216 216 197 197 148 216 216 197 197 148 148 216 198 148 148 198 148 149 216 216 198 198 216 149 198 216 216 198 198 149 149 216 149 149 198 149 216 198 198 216 Harshma 1 Grandon, Cheryl . Grave, Charlotte . Grave, Thomas . Gray, Brenda . . Gray, John . . Gray, Pat . . . Green, Arvil . . Green, Patsy . . . Green, Terry . . Greenwald, Jimmy Gregory, Artie . . . Grice, Bernice . . Griebel, Dale . . Griebel, Gary . . Griffe, Marianne . . Griffin, Kay . . . Griffith, Randy . . Griffith, Ronald . . Griggers, Sandra . Grimm, Bill . . . Grise John . . . Grizzle, Carolyn .I . Grizzle, Sandra . Groce, Paul . . . Gross, Brenda . . Gross, Martha . . Grubbs, Mike . . Guess, Robert . Guffey, Peggy . . Guminsky, Thomas Gunter, Keith . . Guse, Leslie . . . Gustus, J. D. . . Gutherie, Peggy . Gwatney, Marilyn H Haag, John .... Hagey, Muriel . . Hahn, Janice . . Hale, Edward . Hale, Paul . . . Hale, Paulette . Hale, Ronald . . Hales, Barbara . Hall, Barbara . Hall, Debbie . Hall, James . . . Hall, Richard .... Halliburton, James Halligan, Ronald . Hallmark, Glenda Hamilton, Hamilton, Clayton Hamlett, Carl . . Hammack, Donna Hammond, Joe . . Hammons, Diane . . . Hanchey, Fred . Handley, Sarah . . Hannon, Sidney . . 1 Hargrove, Larry . . Hargrove, Gary . Hardwick, Jeff . . Hardester, Richard Harkelford, Jimmy Harmon, Cheryl . Harmon, Douglas Harmon, Gregory Hamilton, Judy . . Linda . . . . . 149 . . 216 . . 198 . . 198 . . 216 . . 198 . . 149 . . 149 . . 150 . . 198 . . 198 . . 198 . . 198 . . 198 . . 216 . . 216 . . 216 . . 216 . . 150 . . 150 . . 216 . . 216 . . 198 . . 150 . . 198 . . 198 . . 198 . . 198 . . 216 . . 216 . . 198 . . 198 . . 150 . . 150 . . 216 fists, 150 150 198 198 198 . . 198 . . 216 . . . 150 . . 150,221 . . . 216 . . 216 . . . 62 . . 151 . . 150 . . . . 198 . . . . . 151 . . . . . 216 . 64,216,219 . . . . 216 . . . . . 216 . .... 198 . . . . . 151 l1,35,37,86,89 100,130,151 . . . . . 216 Q... .-. . 167, 198 199 216 199 . . 199 . . 216 . . 199 . . 199 199 Harmon, Rodney . . Harpending, Mike . Harper, Charles . Harper, Phyllis . Harper, Tommy . Harrell, Mary . . Harrill, Lloyd . . Harris, Alicia . . Harris, Susan . . Harrison, Eva . . Harrison, Charlotte Harrison, John . . Harrison, Kathy . Harrison Harrison , Robert . , Sandra . Harrison, Tony . Harrison, Kay . . Harrison, Vicki . n, Royal . Hartwick, Terry . . Harvey, Dale . . . Hartwick, Terry . . Harvill, Lynn . . Harvill, Sandra . Harwell, Eddie . . Hatch, Larry . Havens, Terry . . Haver, Gary , . Hawkins, Gary . Hawkins, Linda . Hay, Henry . . Hay, Paulette . Hays, Peggy . . . Hayes, William . Haymes, Jackie . . Haymis, Gary . Hays, Cindy . . Hays, Emmett . . Hays, Pat . . . Head, Charma . . Head, Herbert . . . Hearne, Robert . . Heerboth Ester . - . - f . . . . . 167, ' '9i,69, Hedgegrdve, Micheal 1. . . 1. I 47, Heffington, Sandra . Heien, Denise . . . Heintz, Nicky . . Helms, Alfred . . Helton, Linda . . . Helton, Nelda . . . Henderson, Bryan . Henderson, Carolyn Henderson, Dawnee Hendrickson, Johnny Hendrix, Tricia . . Hennis, Jerry . . . Herlocker, Randy . Hern, Patsy .... Harrick, Francis . Herring, Elizabeth Herrington, David . Herrod, Mary Beth . Hicks, Delores . . Hicks, Ronnie . Hicks, Linda . . Hicks, Cindy . . Hicks, Robert . Hicks Olivia . Hiett, Denis .... Hiett, Ginger . . . Higginbottom, Charle Higgins, Cindy . . . . f . S .- ... . 64, 61, a5',67, 239, ..- Q Q 0 -.- 538557, 216 216 216 216 151 199 216 151 199 151 199 216 216 216 199 151 151 151 216 216 216 216 152 217 199 217 199 217 199 199 217 217 152 199 199 152 217 152 199 152 152 199 217 217 152 199 199 199 217 217 152 152 153 199 199 217 199 199 217 199 153 153 199 153 199 153 217 153 199 199 217 154 Higgins, Leroy . . Higham, Pat . . . Hill, Jimmy . . High, Rita .... Hight, Charles . . Hill, Fred .... Hill, David . . Hill, Judy .... Hillman, Buddy . . Hilliard, Bob . . Hillman, Jerry . . Hillman, Walter . . Hinds, Scott . . . Hinkle, Janet . . Hinkle, Kay . . Hinton, Pat . . . Hitt, Steve Hobbs, Carolyn . . Hobby, Linda . . . Hoffius, Cecily . . Hogan, Gloria . . Hoggard, Mary . . . Hoggard, Thomas . Hogins, Saundra . . Holiday, Melanie . . Holbrook, Fred . . Holbrook, Jerry . Holden, Pam . . . Holden, Ronald . . Holden, Sandra . . Holland, Shelia . . Holland, Steve . . . Holloway, Dora . . Holloway, Jay . . . Hollowell, Tommy . Holloway, Buddy . . Holman, Kenneth . . Holms, Travis . . . Holt, Sandra . . . Holt, Linda . . . Holt, Glenda .... Homan, James . . . Honneycutt, Margaret Hooks, Ateve .... Hooper, Mike .... Hooten, David . . Hooten, Kenny . . Hopkins, John . . Hopkins, Paula . . Hornecker, Andy . Horton, Kathy . . Hoskins, C. B. . . Hough, William . . House, James . . House, Linda . . House, Ronald . . Houser, Phyllis . . Howard Harvey . Howard, Jerald . . Howard, Anita . . Howard, Judy . . . Howard, Linda . . . Howard, Virginia . . Hubbard, Jon .... Huckleberry, Randa Hudgens, Larry . . Huff, Kathy ..... Huffman, Judy . . . Huggins, Connie Ray Hughes, Laverne . . Hughes, Karen . . . Hughes, Peggy . . . 35, ...- ..97, . .Si .' .' 167, . . . - . f . - Q . . . 0 . . . . . Q . 0 . 154 154 154 200 200 217 154 200 154 154 154 217 200 217 . . . 200 200 215 200 154 200 200 217 217 217 200 200 200 200 200 . . 155 41,200 167,217 ...200 ...200 . . . . 200 . . 60,155 . . . 217 . 167,217 . . . 200 . . 217 '. '62, . . 167, l1,100, .--.. ..p. .. ..88, 217 200 217 200 217 200 200 217 200 217 200 217 200 200 217 . . 200 200 200 217 155 155 217 217 155 200 200 200 155 . . . 155 . 200 . . 217 217 281 282 Hunley, Janice . Hunthrop, Diane Hurn, Alice . . . Huston, Sandra . Huston, Mike . . . Huston, Sandra . Hutto, Imoff, Inmon, Irons , Isbell, Isbell , Isbell, Jerry . . Martha . Steve . . Andrea . Dale . . Jimmy . Terry . . Ison, Mike . . Ivy, Jackie . . . Jackman, Sandra Jackson, Jackson, Jackson, Jackson, Jackson, Jackson, Jackson, Jackson, Barbara Helen James J inger Johnny Judith Martha Russell James, Kay . . Janda, Richard Jatko, Tom . . QQ QQ Jaymes, Ponzie Jaymes, Nancy . . Jeffery, Tommy Jenkins, Dee . . Jenkins Gloria Jennings, Terry Jetton, Max . . Johnson, Johnson, Johnson, Johnson, Johnson, Johnson, Johnson, Johnson, Johnson, Johnson, Johnson, Johnson, Johnson, Johnson, Johnson, Johnson, Johnson, Brenda Brenda Charles Corliss Dale . Diane . . Gary . Harriet Jane . Janice Janie . Judy , Lora . Steve . Terry Tommy Tommy Jolly, Jane . . . Jones, Jones, Jones, Jones ! Jones, Jones, Jones, Jones, Jones, Jones ! Jones, Jones, Jones Betty . . Carol . . Carolyn . Charles . . Denz-il . George . Harold . Janice . Linda . . Kathy . . Gene . . Pam. . . Vicki Josephs, Al .1 Q Q Q Q Q Q Q Q Q Q Q Q 28,37,54, 93, 44,49, . . 49, . 42, Q Q Q Q Q Q Q Q Q Q Q Q . 17, . 45, '.' 61 ..53, 155 217 217 201 201 201 201 201 201 155 201 201 155 217 201 217 156 217 201 156 156 201 218 201 217 218 218 201 201 156 201 156 156 201 201 218 156 156 156 128 201 156 218 218 218 201 218 201 157 201 218 201 157 157 201 201 218 218 218 157 201 157 157 201 218 218 Juaire, Barry . . 157 Junkin, Marie . . . . 157 Justice, Lee . . . . . 218 K Kaiser, Robert . . . Karaley, Diane . . Kealy, Jerry . . . . Keathley, Jack . . . . . Keating, Margaret . . . . Keeling, Jack . . . . . Keen, Jack .... . Kegley, Loretta . . . Keller, Jerry . . . Kelly, Carolyn . . . Kelly, Jerry . . . . Kelly, Ronnie . . Kelly, Jodie . . . Kelter, Tommy . . Kempf, Tommy . Kendrich, Nancy . Kendrich, Raymond. 1 1 Kennedy, John . . Kerbel, Rick . . . Kerby, Linda . . . . . . Ketcher, William . Ketzscher, Gerald Ketzscher, Suzanne Kile, Patsy .... Killingsley, Joe . Killion, Nancy . . Killman, Carolyn 201 157 158 218 218 218 218 158 218 218 218 Kelly, Karen . . . . 201 158 201 201 201 201 201 218 201 158 158 158 . . . 87, f I 218 19,159 . . 202 . . . . 202 . .... 202 Kilpatrick, Steve . . . 167,218 Kincannon, Kelly . . . . . 218 Kinchen, Charles . 159 King, Carolyn . . . 202 King, Kay . . . . 218 Kinney, Reggie . . 202 Kirby, Joe . . . . 202 Kirklin, Tracy . . . 218 Kirspel, Robert . . 159 Kissire, Weldon . . 202 Kittle, Barbara . . 202 Kittle, Sherry . . . 202 Klinger, Susan . . . 202 Knife, Raymond . , . 202 Kniggs, Anne . . . 218 Knowles, Lynda . . 202 Kooms, Becky . . . 218 Korte, Donna . . 218 Krouse, Rick . . . 159 Kuehnert, Gail . . . . 202 Kumpe, Leon . . . . . 218 Kuonen, Rickey . 44,159 Kuritz, David . . . . 202 Kuritz, Gail . . . 218 Kyzer, Brenda . . . 218 L La. Grossa, Camille . . . 53,159 Lafferty, Robbie . . . . 218 Laman, Christie . . . 159 Lamb, Nancy . . . 202 Lampton, Paul . . . 159 Lancaster, Dot . . . 218 Landers, Linda . . . . 202 Landsman, Dorothy . . . 159 Lane, Emmett .... . 159 Lane, Mike ..... . 160 Lancer, Annette . Lange, Chuck . . Langley, Anita . . Langley, Carolyn . Langley, Claudette Langley, Diane . . . Langley, Linda .... . . . Lankford, Casondra Lankford, Jan . . . Lankford, Jean . . Lasiter, Mike . . . Laster, Jerry . . . . Laughter, Rosemary Lavender, Jean . . Le Vine, Judy .... Ledgerwood, Wayne Ledrick, Charles . Ledrick, Douglas . Lee, Sue ...... Lenon, Warren . . Leopard, Jeanne . Leslie, Linda . . Lewis, Billy .... Lewis, Kenneth . . Lewis, Linda . . . Liles, Ronnie . . . Lindsey, Nancy . . Lindsey, Nancy . . Link, Freddie . . Linn, Danny . . Linn, Diane .... Lintz, Clarence . . Lipscomb, Dewanna Little, Judi .... Little, Radford . . Little, Rebecca . . Lively, Carol . . . Lochamy, Rosemary Loftis, Ronnie .... . Longsdon, Dorothy Loibner, Steve . . Long, Richard . . Love, Kay . . . Love, Vicki . . Lowell, Ken . . . Lowe, Danny .... Lowrance, Linda . . Loy, Linda . . . Lubker, Sandra . . Lucas, Linda .... Lybarger, Barbara Q Q Q Q Q Q Q Q Q Q Q Q QQQ QQ QQ QQ QQ QQ QQ QQ QQ QQ QQ QQ QQ QQ QQ QQ QQ QQ QQQ QQQQ 160 202 202 160 160 218 . 210 28,160 218 218 160 218 202 160 202 160 218 160 218 160 161 161 161 202 218 218 202 202 27,202 218 QQQ QQ QQ QQ Q QQ QQ QQ Q QQQ 28,l6l, . 167, QQQ QQ QQ QQQ '.' 215, Lyberger, Weldon . . . . . Lynch, Jim . . . Lynch, Joe ..... Lyons, Bill .... M ..21 Mabrey, Sandra . . . . 42 Malone, Tommy . Manning, Judy . . . Mansfield, Lynn . . Mansfield, Marcie . 1 Mansfield, Pat . . Marks, Bill . . . Marks, Peggy . . Marler, Brenda . . Marshall, Brenda . Martin, Billy . . . Martin, Diane . . . . Martin, James Paul Martin, Linda , . , , ..17 161 161 218 161 161 202 161 218 202 218 167 202 162 218 162 162 202 218 218 218 202 218 162 162 162 162 162 219 219 219 202 203 219 162 203 219 203 203 203 1, Mason, David . . Mason, Ronnie . . Mason, Sonja ..... Massery, Judy . . Matthews, Alice Faye . Matthews, Cheryl . . . Matthews, Drenda . . Matthews, John . . Matthews, Linda . . Matthews Patricia Mauldin, Warren . . Mayer, Robert . . . Mayfield, Jimmie . Mayhugh, Carol . . McAllister, Gwen McAllister, Linda f f . McBride, Robert . . McCarty, Janis . . . McCarty, Melinda . . McClain, Bill . . . McClain, Ruth . . 204 McCleland, Ricky . McClusky, Dianne . . McCollum, Billy . . McConnell, Marsha McCord, Bill .... McCord, Terry . . McCorkle, Danny . McCoy, Britt . . . McCraw, William . McCuin, Brenda . . McCuin, Phyllis . . McDonald, Martha . . McDonald, Michael McElroy, Gerald . McElroy, Michael Wayne 1. . McElroy, Sue ...... McElroy, Wanda .... McElyea, Sue . . Mclntosh, Ken . . McLaughlin, Gary '. . McKee, Janis . . . McKee, Wanda .... McKeller, Phyllis . . McKim, Sam .... McKinny, Dan . . McKown, Patsy . . McLendon, Pat .... McLemore, Sally . McMahon, Barbara McMorris, Brenda . . McMorris, Norma . . McMillan, Betty . . McNatt, Bill . . . McNeill, Mike . . . McNew, Leon . . . McPherson, Jeannie McPherson, Ricky McRae, John .... . McRaven, Brenda . McVay, Bill . . . McVay, Brenda . . Meador, Raymond . . Meadors, Pam . . . . Meadows, Wesley . Means, Noell . . . Measles, Janice . . Meeks, Donna Melton, Presley . . Mekks, Barbara . . Menkloff, Dave . . Mercing, Terry . ' 16.7 35, 162 219 163 219 219 219 219 163 219 219 219 163 219 163 163 203 163 . . . . 219 . . 49,219 .. 167 . 41, 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ' 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 22:99, 111 .61 37,81 .28 219 219 219 219 203 203 219 164 219 219 219 219 164 219 219 203 219 203 203 203 219 203 164 164 164 164 164 219 164 203 203 164 219 203 203 219 219 203 219 203 165 165 203 165 203 203 165 165 165 219 203 203 165 Meredit h, Jerry . . Merritt, Annette . . Merritt, Rodney . . Metcalf, Mike . . Miller, Alan . . Miller, Albert . . Miller, Betty . . . Miller, Carolyn . . Miller, Diane . . . Miller, Diane Lynn Miller, Eugene . . . Miller, James . . . Miller, Paul . . . Miller Sharon Mi11s,,Beth . .' ' Mills, Bob . . Mills, Jimmy . . Mills, Libby .... Millsapps, Gail . . Milner, Connie . . . Mirontschuk, Natalie Mitchell, Delmar . Mitchell, Danny . . Mithcell, Peggy . . Mithcell, Virginia . Moncrief, Bob . . . Moncrief, Judith . . Monroe, Ducarrol . Montgomery, Annette Montgomery, Carol Montgomery, Joyce Montgomery, Jan . Moon, Alice .... Moore, Barry Moore, Clarence . Moore, Elizabeth . Moore, Judy .... Moore, Mike . . Moore, Nancy . . Moore, Ray .... Moore, William . . Morgan, Juanita . . Morgan, Lois . . Morgan, Robin . . Moring, Mary . . Morris, Ronnie . . Mosley, Randy . . . Mueller, Carolyn . . Mullen, Eugene . . Mullen, Judy .... Muncy, Linda . . . Munnerlyn, Bernard Munnerlyn, Donna . . Munnerlyn, Jane Ann Munns, J im ..... Murray, Betty . . . Murray, Eddie . . Murray, Lloyd . . Muse, Bil . . . Myers, Bill . . . Myers Bobby . . . Myers Groverlyn . Myers, Kaye .... Myers, Kaye .... Myers, Pat ..... N Nakamura, George . Nations, Doris . . . Nava, Robert . . . Neal, Marion . 203 165 165 165 219 166 203 219 203 203 219 166 203 219 . . 166 . 93,203 204 203 11, 166 204 166 219 203 166 166 204 166 204 204 204 204 204 204 204 204 .'. ' 69,166 219 11 1 1 1 1 1 11 1 1 91, 21,91, 1 11111 111 1 1 1 1 1 1 1 167 219 219 219 167 167 219 167 219 219 204 220 167 204 167 204 204 167 220 204 204 167 22 1 167 167 204 204 168 204 220 Neighbors, Diane Nelson, John Newberry, James Newberry, Jimmy Newcomb, Dan . . Newcomb, Georgia Newcomb, Roger . Newcomb, Brett . Newconb, Randall Newell, Pam . . Newman, James . Nichoalds, Donna Nichoalds, Ronnie Nichoadl, Becky . Nichols, Deanna . Nichols, Jay . . . Nichols, Jim . . Niven, Bill . . Nixon, Joe . . . Norman, Norman, Garry . Jim . Norman, Larry . Norman, Mary . . Norman, Martha . Nowell, Mike . . Nunn, Rodger .... . . O O'Brien, Wayne . O'Cain, Donna . . Ohlendt, Becky . Oishi, Sachiko . . Oliver, Barbara . Orsini, Jim . . . Orsini, Linda . . Orsini, Merrily . Orr, Polly .... Osborne, Fred . Oskins, Carl . . . Ostegard, Cheryl Oszak, Thomas . Oulette, Dave . . Outlaw, James . . Owen, Donald . . Owen, Mary Ann . Owens, Duayne . . Owens, William . P Pairish, Susan . . Palasack, Wayne . Palmer, Elizabeth Palmer, Steve . . Papageorge, Alex Papageorge, David. 1 . Parker, Jill . . . Parker, Larry . . Parker, Ralph . . Parker, Sharon . . . Parsons, Norma . Patrick, Kenneth . Patrick, Linda . Pattison, Ronnie . Paul, Jerry . . . Paulette, Joan . . Pearce, Janice . . Pearle, Sherry . . Peck, Albert . . Peck, Tommy . 1 11 11 . 220 6 8.7 , 167, 220 220 168 220 168 220 220 168 168 220 220 . 168 168 204 220 204 204 220 220 204 204 205 205 205 205 205 205 220 220 169 169 205 . 169 . 205 . 220 . 205 . 205 35,169 . 220 . 169 . 220 . 220 . 220 . 169 . 220 49,170 . 205 . 205 . 170 . 220 . 220 . 170 . 220 . 205 . 220 49,205 170 . 205 170 205 . 220 220 170 205 Pechoski, Johnny 1. . 1. . 283 284 Peeler, Gary . . Penley, Brenda . Pennington, Betty Pennington, Linda Penny, Nancy . . Pepper, W. C. . . Perkins, Dale . . , P erkins, La Juana Perrins, Marsha . . . Perry, James . . Perry, Richard . Peters, Grady . . . . Peterson, Denise Peterson, Susan . Peterson, Mike . Pertross, Larry . , Petty, Dana . . . Pett Priss Y, Y . . Phillips, James . . Philliber, Pat . . Philliber, Judy . . , , Wayne . . . Phillips, James . . Phillips, Joanne . . Phillips, Kathy . Phillips Phipps, Diane . . Pfiefer, Jeanette Pickthorne, Elaine Pierce, Dennis . . . Pierce, Jimmy . . . Pierce, Sandra , , , Piercy, Hal .,., , Pierson, James , . Pitts, Linda , , , Pohnka, Fred . . Plummer, Johnny Plummer, Lewis Plunkett, Bill . . Pollock, Earnie , . Porter, Mary . . Powell, James . . Powell, Linda . . . Powell, Raymond Powers, Raymond Price, David , , , , Price, Kathy . . . Price, Kenny . . Price, Pat . . . Price, Rick . . . Price Tona . . . . Prickett, Horace . . . Priddy, Jane , , , , Peiest, Bing . . . . Prioleay, Linda . . . . Pritchard, Tap . Pruitt, Gary . . Pruitt, Judy . . Pugh, Pam . . . Pugh, Pat .... Pullam, Sherion . . Pulliam, Janet . Purfoy, Richard Purnell, Jimmy i Pyle, Larkan . . Q Qualls, Betty .... Qualls, Don . . . R Rainey, Donna . . Rainwater, Jan . . ' ido, ..220 . 220 49,170 . 205 . 205 . 170 . 205 . 170 . 220 . 171 . 171 . 171 . 220 53,171 . 171 . 171 . 171 . 220 . 215 . 205 . 171 . 205 . 205 . 171 . 220 205 171 215 171 220 3.7 , . . 205 35,220 . . 205 220 -4 --. 167, - n 0 a Q . 68, 314, 8.2 , 205 172 220 205 205 220 172 205 172 172 205 220 172 206 . 220 206 172 172 172 220 173 173 206 220 173 220 173 173 206 . 173 . 174 . 206 . 220 . 220 Ralls, Diane . . Rambo, Don . . Ramer, Vicki . . Rapes, Ken .... Ratcliff, Nancy . Ray, George . . Ray, John . . Ray, Johnny . . Rea, Delores . . Reagen, Jerry . . Reasoner, Diane . Red, Sandra .. . . Redd, Jimmy . . . Redd, Valerie . . Redman, James . Reed, Cathy .... Reed, Jay . . . Reed, Ronnie . Reedy, Linda . . Reese, Jeannie . . Reeves, Sharon . Reeves, Becky . Reid, Don . . . Reid, Lee . . Reid, Mike . . Reid, Phillip . . Renfrow, Mike . . Rennie, James . Reynolds, Charles Rhoads, Rodger . Rhodes, Judy . . Rhodes, Larry . . Rhodes, Cricket . Rice, Henry . . . Rice, Herschel . Rice, Joan . . . Rice, Larry , , Rice, Paul . . . Rice, Paul . . . Rich, Wayne . . . Richards, Linda . Richardson, Jimmy Ridgell, Ronnie . . Ridling, Diane . . Riggs, Sally . . Riggs, Steve . . Riley, Debbie . . Rinehart, Joan . . Risher, Don . . . Risher, Phil . . . Ritchie, Corkey . Robbins, Van . . . Roberson, Jim'. . Roberts, David . . Roberts, David . . Roberts, Eddie . . Roberts, Harold . Roberts, Kay . . . Roberts, Linda . . Roberts Lois . Robertson, Connie Robertson, Jim . . Robertson, Ronnie Robinette, Ken . . Robinson, Barry . Robinson, Betty . Robinson, Debbie . Robinson, Donnie Robinson, Marilyn Robinson, Mike . Rodman, Christy . Rogers, Linda . , - . . . 1 . . 206 220 174 206 206 . . 220 . 174 . . 229 . . 206 . 174 . . 220 206 I 167,220 . . .61 ' .'. 111,372 174 220 174 . . . . 206 206 206 174 37,91,99,174 . . . 91,174 206 . . 82,206 . . 61,220 . . 17,220 174 . . 206 . . 206 . . . 206 . 17,206 . . . 220 . . 99,174 . . . 221 . 175 . . 175 . . 206 . 175 . . 221 . . 175 . 221 . . 175 . . 206 . 206 . . 221 . 175 . 175 . . 206 . . 221 . . 175 . . 175 221 . . . 206 . . 63,206 . . . 206 . . 221 .. 82, 175 206 206 176 206 . . . 221 176 207 206 206 206 207 . . . . 207 . . 219,221 . . 213,221 . . . . 207 Rogers, Steve . . Roper, Darlene . Rose, Charles . . Ross, Becky . . . Ross, Chaunita . . Ross, David . . Ross, Jimmy . Ross, Sammy . . Rotton, J. W. . . Rowden, Rowland, Jennifer . . Kay . . . Rowlette, Marion . Roye, Mickey . . . Ruple, Jerry . . . Rush, Mickey . . . Russell, Barbara . . Russell, Danny ..... Russell, Frankie .... Russell, James Richard Russell, Jim ...... Russell, Karen . , Russell, Larry . . Russell, Ricky . . Russell, Sandy . . Rutherford, Al . . Ryan, Bill . . . Rydell, Ronnie . . S Sadler, Lynn . . Sadler, Susie . . . Saenner, Sandra . Salkeld, Ginger . . Salkeld, James .... Sampson, Mary Lou . . Sanders, Bernie . . . Sanders, Brenda . . Sanders, Ed ..... Sanders, Gerald .... Sanders, Janis Marie . Sanders, Roger .... Sangster, Jackie . . . Satterfield, Diana . Sawyer, Tommy . . Scarborough, Bob . Scarborough, Joey . . Scarborough, Willie . Schaeffer, Bonita . . Schaeffer, Jerry . . Schmitt, Wendi . . . Schoononver, Lee . Scott, Sally .... Scruggs, Pat . . Seeler, Bruce . Seeley, Lynn . . Segalla, Sharon . . Sellers, Larry . Senteney, Eddie . . Sessoms, Marsha . Shanks, Elizabeth . Sharp, Peggy . . . Sheehan, Mike . Sheffield, John . Shelby, Ronnie . Shell, Ann . . Shelton, Doris . . Shelton, Janice . Shelton, Larry . . Sheperd, Marry . . Sherrod, Sylvia . . Shireman, Randy , 44, . Q . . . Q . 47 1.1 61, . . 0 o . 1 1 . 21, . . 217, 177 207 207 221 177 207 221 177 177 207 221 221 207 177 221 174 221 177 207 177 207 207 221 177 177 221 221 207 207 177 207 221 221 178 221 207 221 207 178 178 207 221 176 207 207 207 221 221 221 207 207 207 176 207 207 207 207 176 221 221 221 221 221 176 176 176 176 176 207 sy, Shirley, Wayne . . . Shook, Mary Ann . . Short, Betty . . . Short, Freddie . . Short, Loretta . . Shugart, Sue . . . Sieman, Jim ..,, Simmons, Frankie . , , , Simons, Barbara Jo Sim son Carolyn . .. . .. P , Simpson, Eddie . , Simpson, Mike . . . Simpson, Tommy , Sims, Jimmy .... Singleton, Bernard . Six, Gail ...... Skinner, Marti . . . Slatton, Carolyn . . Slughter, Danny . . Smalling, Fay , , Smalling, Kay , , Smart, Jimmie . . Smart, Linda . . . Smead, Earlean . . Smelser, Joe . . . Smith Brenda , , Smith Byron . . Smith Dana . . . Smith, Dianne . . Smith, Donna . . Smith Fred . . . . . Smith Smith Smith Smith Smith Smith Gail ....... . Harold ...... . James Edward James H. Jane . . . . . Jerr y .... Johnnie Jay . . . Smith Smith, Marion Smith, Pam . . . Smith Pat . . Smith, Pat . . . Smith, Peggy . . . Smith Phyllis . . Smith Rayburn . Smith Richard . . Smith Sandi . . Smith Sara . Smith Sarah . . .gn . .- Smith, Sharon . . Smith, Tommy . . Snow, Charlotte . . Snow, Diane .... Sockwell, Sally . . Sorrell, Renee . . . Sorrels, Gary Souheaver, Sharon . Sousa, Jo Ann . . . Sousa, Linda . . . South, Greg . Sowell, Kay . . . Spann, Pat .... Spearman, Neal . . Spikes, Jimmy , , Splawn, Ann . . . Spoon, Scooter . . . Springer, Doris . . Springer, Len . . Stacks, Janis . . . Staggs, Eugene , , , Staggs, Rosalee . . Stafford, Evon . . 61, 61, 178 178 207 221 207 208 221 178 208 208 221 208 221 179 . 179 208 221 208 221 179 179 208 208 179 179 221 221 179 208 . 221 19,179 221 . 179 180, 180 208 221 208 180 221 221 228 . 180 . 222 . 180 . 208 . 222 . 208 . 222 . 208 . 180 180 . 208 91,208 . 222 . 208 208 222 208 180 180 222 . 180 4 l, 181 181 181 208 222 208 208 222 . 222 . 208 Stafford, Gloria . . . Stallsworth, Linda . . Standridge, Jane . . . Standridge, Ronnie . . Stanley, Bill .... Stanley, Sandra . Stanton, Sharon . . Stark, Carlos . . Starkey, Eileen . . Stecks, Gary , , Stecks, Mike . . Steelman, Cathy . Stephens, Gary . . Stephens, John . . Stephens, Linda . . Sterne, Rickey .... Stevevenson, Karen Stewart, Alice . . Stewart, Eddie . . Stewart, Larry . . Stiffler, Tommy . . Stiles, Payne . . . Stirman, Cary . Stobaugh, Larry . Stokes, Brenda . . Stoll, Lora Jane . . Stone, Elizabeth . Stone, Danny . . Stone, Ken . . . Story, Johnny , , , Story, Theresa . . Stouffer, Donna . Straw, Vicki . . . Strayhorn, Linda . . Stricklin, Charles . . Stricklin, David . . Stricklin, Johnn Stricklin, Stricklin, Margaret Strother, Cecelia , Strother, Stroud, Dale ...... Stroud, Jerry Wayne Stroud, Paula . . . Sttill, Stanley . . . Styers, Sue ,,,, Sullivan, Sharon . . Summers, Carlos . Swaim, James . . y . . Judy . . . Lane .... Swaim, Judy , , Swann, Cheryl . . Swann, Robert . . . Siendle, Dick ...... Sylvester, Gene Ray . . 222 . . 222 . . 181 . . 208 . . 208 . . 181 . . 208 . . 208 . . 181 . . 181 . . 200 . . . 222 . . 87,208 . . . . 222 . . 37,208 . . . 208 ....222 .. 16,222 ...222 .. 187 ff'45, 222 222 181 208 222 181 182 222 222 182 222 208 182 222 222 182 . . 222 . . 208 . . 182 . . 222 . . 222 . . 209 . . 182 . . 182 . 209 . . 182 . . 222 . . 209 . . 209 . . 222 . . 222 . . 182 . . 209 209 T Talley, Larry , , , , 209 Taylor, Don . . . 209 Taylor, Donna , , , 209 Taylor, Eddie . . . 222 Taylor, Jimmy . . . . 182 Taylor, Ron . . ..... 209 Taylor, Ronda . . .... 222 Teagarden, David . 35,54,68,l83 Teague, Bill . . . ..... . 209 Tedford, Jimmy . . . . 209,217 Tedford, Woody . . . . . 209 Tenney, Phillip . . .... 183 Tenneyson, Edward , , 46,222 Terhune, Linda . . . . . 222 Tharp, Pete . . . . . 209 Thibault, Felix . . Thirion, Thirion, Linda . . Pat . . . Thomas, Betty . . Thomas, Bill . . Thomas, Don .... Thomas, Emma . . Thomas, Judy Thomas, Sharon .... Thomasson, Brenda . . Thompson, Eddie . . Thompson, Elaine . . Thompson, James . . Thompson, John .... Thompson, Josephine Thompson, Linda . . Thompson Linda . . Thompson: Mary Beth Thompson, Mike .... Thorne, Sandra . . . Thornton, Bob .... Thornton, Mary Lou . . Thresher, Steve . . . Thurman, Dale . . . Thurow, Rickey . . Tiburg, Shirley . . Tilly, Carol .... Tinkle, Janet . . Todd, Dennis . . . Toland, Dennis . . . Toland, Jo Anne . . Tomkins, Paul . . . Tompkins, Laurie . . Toney, Carolyn . . Trammell, Jim . . Trickey, Don . . Trusty, Mike . . . Tucker, Dianne . . Tucker, Ronnie . . Tucker, W. A. . . Tullos, Jerry . . . Tullos, Ronnie . . . Turner, Joyce .... Turner, Mary John . Turner, Robert . . Turner, Sandra . Tyler, Phyllis . . Tyler, Sharon . . . V Vaden, Gail .... Vail, Roy ...... Valentine, Alma .... Valentine, Barbara . Van Arsdale, Ronnie . . Van Dament, Nicki .... Van Oberbeke, Bettie Vandergrift, Lynne . Vaughn, Charles . . . Vaught, Shirley , , Veach, Anna . . . Velvin, Donna . . Venable, Donna . . Venable, Keith . . Verheul, Marty . . Verser, Rodger . . Vest, Billy .... Vest, Deborah . . Viars, Ron . . Vick, Kristie . . Vick, Lynnette . . 209 . . . 209 22,209 209 222 n .Q -. no u so nf - .Q - - Q . . 0 0 u . 1. no . 63, .- o . no ....4.2, 19 0 n . Q . . . . . . 1 . 0 - ' ' 2253, . Q - . . . . . . . . . . . . . Q . . Q Q . . . . . 0 . . . . . . . ' .' 214, ..16, 209 209 222 222 222 222 222 209 209 183 209 183 222 222 183 209 184 184 222 222 184 222 222 184 184 184 184 222 209 209 222 222 222 209 184 184 184 223 223 223 184 223 223 185 209 223 209 209 209 209 223 185 223 223 209 223 210 185 223 223 223 185 210 210 285 J - .--i,,..1--. . , r Vg ' gig N Sth cnunlrff , s . I A xyaotfx. ,QMOKQ 4' 1 ' GQAL-FDA V' s, Marilyn . . 185 Webb, Linda . . ...... 210 Willshiref Roland ........ ' t, Bobb . . . 19,223 Webb, Toni . . . . .' . . . 223 Wi son, ennie . . . . . . . . . . 'nt, Gilday . . . . 223 Weeks, Ronnie . . . . 210 Wilson, Johnnie ..... . . . . 211 int, Gregory . . . . 223 Weiler, Bob . . . . . 223 Wimberly, Tina . . . . . . . 188 Voegale, Sue . . . 210 Weise, Stephen . . . 210 Wingfield, Jenny . . . 91,931,188 Vogel, Nancy .... . 210 Welch, Dennis . . . . . 223 Winkleman, Carol . . . . . 188 Voss, Jimmy . . . 185 Welch, Hobert .... . . 223 Winn, Jann .... . . 41,189 Wellhausen, Linda . . . . 210 wise, Ruthcli .1. . . . . . W Wells, James . . . . . 223 iseman, ar ie . . . . . Welty, Shirley . . . . 187 Witcher, Murry . . . . 46,189 Wade, Joan . . . . . 185 West, Diane . . . . . 210 Witt, Vickie . . . . . 211 Wade, Susan . . . . 223 Weston, Barbara . . . 187 Wofford, Wayne . . . 189 Wagley Judy . . . . 185 Weston, James . . . . 223 Wolfe, 1-01116 - - - - 189 Walker Freddy . . . 185 Wharton, Theresa . . . . 223 WOOC1, Connie . . . . 189 Walker, Jane . . . 223 Wheaton, Darlene . . . . 210 Wood, David . . . . 189 Walker, Jimmy . . 185 Wheaton, Wanda . . . . 223 Wood, Gammah . . . . 211 Walker Jimmy . . 210 White, Kay .... . . 223 Woodward, Pat . . . . . . . 211 Wallas, Wayne . . . . 186 White, Linda . . . . 223 Woody, Eddie ..... . . . 61,211 Waller, Francis . . . 223 White, Michael . . . . 210 Wooldrigde, Larry .... l7,62,21l Walter, Earl .... . 210 White, Wanda . . . . . . 210 Woolverton, Harolyn . . . . . . 189 Walter, John .... . 223 Whitfield, Carolyn . . . 223 Wooten, L111dS6y . . . . . . 211 Walters, Marilyn . 210 Whitten, Don .... . . . 210 Worthen, Butch ..... . . 211 Walters, Steve . . . . . 210 Whittle, Julie . . . . 16,187 Worrell, Lealon . . . . . . . 189 Ward, Donna . . . . . 210 Wilgand, Art . . . . . 210 Wright, Gwendolyn Jane . . . . . 189 Ward, James . . . 210 Wiggins, Carol . . . . 210 Wright, -163111119 ------- - - 211 Ward, John . . . 223 Wilhelm, Ronnie . . . . 210 Wright, Joseph ..... . 167,211 Ward, Linda . . . 210 Wilkerson, Doris . . . 210 Wright, Susan . . . . 211 Warford, Walt . . . 186 Wilkins, Barbara . . . 210 Wright, Wayne . . . . 190 Warner, Bobby . . 210 Wilkins, Carolyn' . . . . 187 Warner, Nancy .... . 186 Wilkins, Steve .... . . . 223 Y Warren, Charlotte . . . . 186 Wilkinson, Nancy . . . 41,210 Warrick, Paul .... . . 186 Willard, Betty ..... . . 210 Yaeger, Linda . . . . . 28.190 Washburn, Stephen . . . . . 210 Williams Alice Fay . . . . 187 Yarberryy Linda . . . . . . 211 Wasson, Patsy . 44,186 Williams Anna Lee . . . . 210 Yarborough, Joyce - - . - - 211 Wasson, Gin . . . . . . 186 Williams Beth .... . . 211 Yedlick, Karen - - - - - 91,211 Wasson, Linda . . . 49,210 Williams Carolyn . . . . 211 Yielding, Gary . . . . . 211 Walters, Carol . . . . 223 Williams Cecil . . . . 211 York, Wayne . . . . 190 Watus, Dale .... . . 223 Williams Garry . . . . 223 Young, Brenda . . . . 190 Watkins, Sherrye . 186 Williams John . . . . 223 Young, Don . . . . . 190 Watson, Kathleen . 223 Williams Ken . . . . 187 Young, Linda . . . 190 Watson, Lloyd . 17,210 Williams Larry . . . . 223 Young, Mike . . . . . 211 WHCSOI1. Nancy ..... . . 223 Williams Linda . . . . 187 Young, Sharon .... . . 190 Watts, David ....... . . 187 Williams Ronnie . . . . 211 Youngblood, Diana . . . . 190 Weatherington, Brenda . . . 223 Williams Tuck . . . . 211 Weatherly, Linda . 223 Williford, Diane . . . . 211 Z Weaver, Billy ..... . . 187 Williford, Donna . . . . 223 Weaver, Donna . ' . . . . . . 223 Willis, Charles . . . . . . 188 Zermatten, Johnny . . . . . 211 Webb, Bobby . . ........ 210 Willits, James ....... . 223 Zermatten, Virginia . . - - 190 I Q N , f f' ffX,o'ff!7I xx AQ I ,I f J ' ,X j ar-v'f -7 -fy! 1 E si S ff 4 ff ,,,f ,fj -fp fr-6 I ,N jjj, Ji, 2 I7 A I , , 1 J if ., Qi -.1 ,D A 7 'V' A 1 ' 2 I I , ,fl 7 M1 C-XX X y ' X 1 1 3 1 1 J 7 Q18 QW' ,M 'ye C 'I Ury M tc 1 zes ll Publications Staff Wildcat Editors . ............... ......... P hil Esch, Susie Gough Hi Comet Editors . . . . Jim Lynch, Jane Ann Munnerlyn Art Editor ..... .............. G loria Jenkins Photographers . . . . Tap Prichard, Mike Finney, Joe Kirby Business Manager . . .............. David Wood Make-up Editor . ..... Kathy Philips Re-write Editor . . . . Marianne Borengosser Picture Editor . . ............ Sherry Polk Literary Editors . . . . Terry Jo Byrd, Marsha Sessoms Managing Editors . ................... Ed Sanders, Larry Petross Staff Artists . . . . . Sheila Holland, Patty Brown, Larry Talley, Jan Winn, Dee Jenkins Feature Editor . . ........................... Cheryl Chastain Sports Editor . ................... Richard Baldwin Bookkeepers ..... .......... K athleen Chapman, Virginia Mitchell, Cathy Reed Advertising Managers .... Judi Howard, Steve Goss, Mike Rhodes, Brenda McRaven, Mike Moore News Editor ..................................... Janis Emberton Head Typists . . Al Rutherfore, Brenda McRaven, Cathy Reed, Sandy Allen, Sharon Reeves GENERAL STAFF AND STAFF WRITERS Tina Price, Becky Ross, Marilyn Coulter, Leigh Goss, Vicki Ramer, Mary Cleek, Mary Herrod, Bobert Davidson, Judi Hill, Kay Roberts, Casondra Lankford, Betty Kar Short, Jim Munns, Bob Digby, Dub Pepper, Mike Metcalf, Peggy Beasley, Jim Trammell, Susan Peterson, Cindy Chrisman, Rebecca Little, Cynthia Laman, Cheryl Osteguard, Linda Bland, Pat Pugh, Linda J ones,.P aula Hopkins, William Ketcher, Betty Burris, Wayne Wallace, Charlene Garrett, Mike Highfill, Ronnie Tullos, Tandy Christy, Kathy Campbell, Susie Alexander, Becky Reeves, Kathy Huff, Eve Elias, Jan Cobb, Glenna Anderson, Charma Head, Carol Montgomery, James Thompson, Marialice Brown, David Mason, Brenda McVay, Linda Rogers,Nancy Wilkinson,Noel Means, Buddy Campbell, Freddy Walker, Bobby Hilliard, Rosemary Laughter, Judi Little, Pam Holden, Ronnie Ballard, Lonna Giger, Terry McCord, Chuck Lange, Dan McKinney, Ken Williams, Ron Bostain, Carolyn French, Ann,Wiggs, Connie Wood, Diane Williford, Wendi Schmitt, Ricky Russell, David Mason, Radford'Little, Dan Hampton, Gary Epperson,.George Davis, Joe Broadhurst, Albert Miller, Robert Kirspel, Alicia Harris, Judy Hamilton, Buel Epperson, Mike Baugher, Earl Allain, Ronnie Barker, Linda Kerby, Jane Brashear, Becky Bartlett, Dianne Devore, Tina Wimberly, Jerry Schaeffer, Steve Thresher, Mary Lou Sampson, Debbie Robinson, Richey Murry, Paul Byrd, Cooper Collins, Betty Glover. . Q I Xmxli 2 X CHX Q WX f ,z Q0 A G W X K - l QW ,Q L5 ,XQQWXQNX Q00 69,0665 J if fi! o' ow kewl X U32 OS C69 " Om 6 L Q 4, A ,X . , ,self ADXJUXX ADD 50 XRD? LD Xp QQKQOGX O XX QXlQ' f Q0 we X4 V Qxllj 'XXX C5 Q0 V ,.l.., 53 KW f N MQW, ' I Q ' ' ' U2 1 WMA vff My IN, A N M W Af ' MF UA f ,Q 11 WML , Jfjckuv' X' K I. IL: 'I AV 3 K Wfwff WZMM w1w , M19 My ,Z X L, g p,L,,, 'fj7 3"i'5 ik" EW SEX ' 3 i ffl!! ,fir--f ' ,U X5 ' awk V956 X Airl Lili I QI- a 0 XX-!,fix..,f1,, 1 .Y',,f,,44,!., W- xglxlx if ILT' 5 , Xf f-U ' ' N- -fs ffq--A, XBQQWX '-,,f, '-'f.'7' HMV' f' yrv . OTA :Xia ',I' A f,,,.f ,. ff. x, .,!,'! V,',-'XJ . , W f 3 - U! ' JQCUQA 611, rg, 1,1 " NJ CQOUQ 5-Q pm? Lf- , DI. ', , " tl , ulib MCL? LQLQCQMP ligxewxlb 10 CQQVJ- I 5 QL JQJVKQLUJ 1,2-JLV1 1421-L5 K.u3f9 U... LJ! Mufjff LUQ , Q fmpfma ilpn? fvQ0emz.. imeaq Zsdffff, uyfwfpbxiocu ww " gwmgd qw L. . ZX. QOL J SW UW' ,DWJL y 0011 N Q QL 2 f W N 1 fiigfe WA L S W 0 R T H Lmwgwphed 5 Emma by WALSWORTH f Jffiifb Qafififw ufefjbf 1jEGVQE?vC5wLQ'V wi ffOwgCLU 2,fw NL CFMMQ Q W7 2 EWW MXW Ag ,f if 59,551 WWW CUQUJ 1' GQXWQJQO jg? J rw fain:-L4..L.,..,..,L............... J. . LW . MU, .,,.,AqL,,,.,g....Adhnnn-- 94,31 J ' E Q5 I QF' Ck. g,KaqZt?cQ- - nun-nr' A"--- '- h.. -A ., - .A.:gVL,a,.,..-, M , , M , ,, .,. n 1 V w A ' Ji -- p...,.,-.,L.M. QW .40 W1 4- X WWW in-nn 626 W1 1 14,5 3:f1:zmmwmvf-Lv- 4 .M-nM.w1.wm-M mx- iff , 4 . 17: 6, Q qvfjw -M6 fo? V I Li' 0 ,N'El" 'Q V E, l C? in . 1 'T Nz W W Q, . XQLSLI, nay!! V ,f 9 , K , N x aw Cf f , Mf' CZ' A Q.- 5 Q wJ Ki WS ?'5sfikigig1.1s5x2'vf,Q QIIVQLSY h f 4 ' ' . 3, 5, yg1e.Kh+ E ll. LLL 1' Us 1 jyygvizif kf'Wf "'?W: V: 'M . 4, ,W ye 5151.-0,32-5 'gin 119,21 'Env Q' If" ?x3.fg.jI t7n---ah, -Vxlif Z, WPfnKf3?,5s,?S.i5,if1" -x. ' 1 , 4 ,. ' 'ff9tat,iiE7:f'f'yi,S23,3iZ:3 lu A , ,"1'bifif,Wl"2'?'A''V X.. G' 5:1 1852753 'f Z, . . ylfexwr i h:',riiJ',,.' 'F JPG U 'K' ASYW A'lih.Q!, ??:Yp ' -I" ,' ,F wil 0 A Fw li in. 3 Zvvfu, ,FQ JA. qw: -9 ,, .5 ' 'gllimrzfx' "flh'r,!w gf ,ki 31,3 f' ' .fn 1' 1 L J 1 0 5 5 ,-J. . f ,. 's...i.4' ,aim3gfQ2Pf15'sE:QQj?1?1fqifg 7 fww f 'fifZW 'f4f',wGw: ' Nr,-'v Arm ? ,J-f - JL - ,5,X1z',,1f,.,,.3-,if4,!. x g: .An vt w-Q7"-.- Q' n z 52 q-6 Z5J?5ulg'.:I 'gi'n5"r4!"z'," - Hg 3 JW -I . ,2c4i., QF gy.. isjf, I' "f 4 'jf' -. ,AC ..m ,33'N.?1 f,-,,, A. Gr . . -I .ax - ' "'-P Q2 . W .,-fx, A . Q... fav .QD N eff N ., Q 2, X 5 iw il. , 1 in xv, K x, K .V M X X ! fx 2.1 .J V Ji ,f Q E ' . -1 X... xg X 2, Y 3 mf-'14 'QM ...SQ ia... mf mf,w.W xx 5 xx, I- t g 4 ' 4 4 , I X, 1 M- R wk 5 .., K -K X., L, . A. 4' A. -. ' f. X . X .4 f s ., .4 ., A ?Ykagxx! 'K 2 if xi ' fx X Vx Vk S M X 1 W 'K t N R X Q f x xjyx .xv xf .1k , f N 1 if X H53 .N 0 f x 'af xx V, M x, .HL f x fmt X fx X ffk .A 1 f Wy 34 1 in ' N . s A . , 2 ,A w K., ,mf ., Kwik fx 3 ww .f f M., A X . X. ., ff" V. x xy ' Ya, x X, QQ' .1 of 354 +3-. .. A- ,as g . an -Q 'YM 54 '.:'V'.2'. "H, 'N .. T - L- yu X grfrflv E F IS 121 fi!! . 1. au- an .Apu f-6k"l""',:5' 1 N "'-' 'fv- v -v ' E NV' a-. ..r 4-. a ,.. QA- , 4' . 1' ks,


Suggestions in the North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) collection:

North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection, 1959 Edition, Page 1

1959

North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection, 1960 Edition, Page 1

1960

North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection, 1962 Edition, Page 1

1962

North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection, 1966 Edition, Page 1

1966

North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection, 1968 Edition, Page 1

1968

North Little Rock High School - Wildcat Yearbook (North Little Rock, AR) online yearbook collection, 1970 Edition, Page 1

1970

1985 Edition, online yearbooks, online annuals 1970 Edition, online yearbooks, online annuals 1972 Edition, online yearbooks, online annuals 1965 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.