Newton High School - Newtonian Yearbook (Newton, MA)

 - Class of 1926

Page 1 of 146

 

Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection, 1926 Edition, Cover
Cover



Page 6, 1926 Edition, Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collectionPage 7, 1926 Edition, Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection
Pages 6 - 7

Page 10, 1926 Edition, Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collectionPage 11, 1926 Edition, Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection
Pages 10 - 11

Page 14, 1926 Edition, Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collectionPage 15, 1926 Edition, Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection
Pages 14 - 15

Page 8, 1926 Edition, Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collectionPage 9, 1926 Edition, Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection
Pages 8 - 9
Page 12, 1926 Edition, Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collectionPage 13, 1926 Edition, Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection
Pages 12 - 13
Page 16, 1926 Edition, Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collectionPage 17, 1926 Edition, Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection
Pages 16 - 17

Text from Pages 1 - 146 of the 1926 volume:

..,X ,X. . , . 1.-1.1 1wLv ?XXl. f 1 4 1,14 11 , "- ,X. - 1' , 4, 1' 1 ,-1 X , ' -1 .l,' 5 4 r' -I , w 1. x .1 N . L ', "1, 1 5 .. :X X X 54. 1 '1 - . I-?1fX.'-1 ax .X E,-n,.,X ' N vu -0' 1 1 ,. 1 . 4 ' .Y 1" .1 'L 5-'X'Xq 1 XXX 'mr 1 , , .1 .Q -W ,-11, ' 7 ff' Lg 5 -' ' . '. - 1 " fs, -' 'MX-11,11 1-V. 1' .. ' -f W'?L-1' ' 1. ,1 . 3,-1 It 1' '13 211 11. Q M ' f.Xg Y, '5.g,X f ,.,.uf ', ., f , -- 1-,LX 5X.X,XX, u, A 1 X . . . 1- v ' . if i 1 Xl. -,1 X' WL "1 ,. .X - X . g ., ar. 1. Q1 1 - ' ' 1r'- 51' ' , ' 1 1' '1 3. Q L17 '-2',+'r' . J- 1. 1. ' Vli-. W .1S'1 f " .li ' X 1.1. I.: Q 1 V 1 X , .. .11 .XXX 'XLXX L: :EX . . , X 1 XX X Xlintl X 1 1. ,. .,. Q, 1.1 . 1 ,. 1111. 1, 1 "--, 1. 3. . 1-11 1 M 1. ,, , X. X, -1 ,XJ. . 11 -11 r .1 '1 K 1, X ,, SAX: ."s,'.,, Q' . ,XII Xl'1'1 ' 1 '1. fv-11' ' ' '1-1- ' ' V ,-111194 ' 1 gg? ,' '- . yX- XX ,fXX .XX XX X' iQ .XX-XVI ' .1 A-, "ZX ' .1 4 LQ X101 EX 7flXQ'1. " ' ' . . 5' 'n . ..' ' -. 1 VG 1. .' , 1 fTvf,' 11 '1 1 . ' ' ' 7, 1, YY." X X .XX XXX 71X .QXXQX ,,.XX.XT1.GX . - . . ,1 , 1 1 1, X ff. .2 ,f 'f,r"X f' 111,52 .93 - --in 1 . -.:- X1 -1 1- WX ' 4 ,H X 1' 1 .- 1 A .p 11 V5 L ' Q" J -. V, ' . . " 5.1- 1. .fi 'ff X 11 11 'XX X, AX ,.i,vX1f-,t:v11.1XX.X 54-XX . 1 nj -WX11 113 .X ,X -1. IX 'gX,XX.1 , .1 1 511.-1. 3.3 -1 . . 1.11. 411- 1' 13' '1:.11',1. Pg.. ' - -v.'f.'4A1..1'1f'," u ' 1 if .' E fXv':'1 '-in , .un . . ' ' '1grT4L,.1- I' '- ' . X , ' XJ, ' ,N ' 1. . f , 1 9.113-IQ v' , ,.j,g.. - 1 ' 1-f 1 ,' .1 1, , X, XX X .,. ' X1 XXXXSZQ., wfr'XiX.':XX'g1X: X, , X1 ', 1 1"X 1 1, ,. , .'X v-",. .-.':Y,p 1' ' . - -X,,- ',1.- . .1 V111 ., Ji .1 FA XX. 11XXXI I. X F Xp: X X AX .XX 1 X ,X :X ani , XW 11 X .X ,XXX X. .X , ,XX, ..,,X X,. XXX 2,1 . .' 5. fX' X, V, 'X .. 1 X 1 'Xf, .L ff' 1 ,' '. N . '.' 1-'.1'1 ' I .X X ,N NX X . 1 , XX cX XIAXJ1 . .XXV 'f-. 1 1 : . ,1'11g 1. -. X1 ' ., .V gf!! v Y. -'L "1, ' 1' ."" W' . , .XX .X .5 XX. ,X X, .X,XX ,1 , 1 ' . A' 1 . 1 ,, 1. . . ' - , 9-4. 1. . f 'I ,Q 137 '1 : nr " ' ' H ' 11 ' 171 1- Uv 17-'411.'.1 X XX XX X X XX, ., .X,,u,,X , aX, , 1 -. v-I .n , ' '. . . A !i.g1.,7:., A ....f1 ,. x., . XX, 1. X X, X X.. . ,X X X . XX .. 'AX' .XX .XXy.,1.X ,X X. , X- .1 . .,11 rg, E, 51 -1 1 , ' f ,' 96 'Xf11 Q 5' l",1 ' , .,X 1 , 1 ' an -.-11151 ,QQ-. . . ' ' fn, -pq' I , Ji ,. ll WX ' V . XXXs, iq , ,X1 ie. XX7. 4' . .1 '1 1, 2,-'v ,11 1 1 Xu X VXJXX XXXQXX XE: XX if XX.1XX. ..?, . .-.- .. T if .f.1'1"1f :1 li -41-J 1- .jg 5 1 ':'.',f 'jk '- 5' :IQ . -. L 1 ' 1 5' J' '1'-x uf .tl 1. WX '51, X NX, my I1 ,X X., 44 1. . 1 1 5. -1 - 1 15, .111 ' 'f 4' "I ' . .s. 'X , Xf ',1-1 X 1-" .'1X fn' 1 1 I X X' 1' 1 -- ., .. 1. Q, 1 rig..-'11 9. , -X, TX 1- 1 'N' , 1 XXX1X, , jf, . 1 if If 'E uf. 1.-,,.-1 . ,f , 1 1 1 1 1 .,- 4 9. . 1 .' 1 1 .11 f1 .11 71.1 11 1. XXX: -.X .XX , .X XX XX1XX X.?XX,X1X ,l 1 11. ,' ,1 . . . X ,uf .'f'. 'I ' . , 1 '1"L . IX., ' , -1 X1 X1 .. 1' .1" g X12 , ,., ch, WX' ,X1- X, ,X X,1.. 1 X1 -.X 'X 7 ' I, .1X1. '1 .1 .,. ff - .1151 12. Q. ,f1,Xf4+ '561 ., X' 1 X' 11 - p, 1. ji LX.,-, X ,I ' 1 1- ' 1 5,1 ,n,'f.' ',1- .Ld 1.1 1 . , - ' -. Ii-' '- .1 N ,l 10,1-, ,. . ,1 .1 '0 . ' 1 1 tr '1- i ai 1 "1 111 '111Yo- '11 Xgfy 1X.'X X ',1.' ,',-,4I4!',x,,X . .11 . -1:- .,X-- 44 .1 '-4 1' i .. '1 -f 17'-. 1. f 1' -1- '-"D " , " r A 1- ,' ' 1 " . .sux .','-up 4 ','.11?-1,-WX. 1.1 X -,1 0 'af' ci ' -1 '1 1 15' '- fda . .1XX XX , X f 1 1" - X .-X 1 , '1' '.'.,,..j"."f1 v,,',"':' , . , Xpy. fr' 92 -V .V 12 !.v,,1",- JF .r .1 1 "'1 1,t1"'1 'Jw-I "lk '14 .1 '1l.nXe V141 15. 9.11.1113 .. 1' 1. 1.1 .-135. 1-1-311 ,.511.11...1. 13 35,1 . A, ',X. "X 11 u XX XX 2:27111-j111.31.'111 1' ' .if F' ' .X,ki:'1'!.'1. 3. If 1.9 'jr' " 3' f'llXr:l Jul qi X, .. x. 'IL -1 X2 c Q. mm 1, J . L ' '1, 'fl ,F I 9311. NWA 'iff' 1 l x Qmesa Lf ?1JJ 55315553 t?7J3 25311 Lr ?5JJ 545563 S33 ?i3 Q T NEW UNH N at it O ll 9 2 62 O at E5 E5 it at s XD up fx: pk V Q Ee is if if sl Q 'EEN 1 E ga - J dl Q45 if is f W it ii ggi The Annual of the Q QW 0 W 5 Newton H1gh School f J J E5 Newton, Massachusetts 22,5 TQ 55 voLUME sEY113N'rle12N fl t J 35 EDITED BY THE CLASS OF NINETEEN TWENTY-slx gg EE a V 5 Eg' Qltasvgfmimltcz 7 j77JJJfMGiJfLV?JfLWGi1LCZ 7'pfmmiJmgJl.fg iraq fsvhwm 5'.v.2J? givin lfidj fPE51J'j f'.vZJ? 5555133 Kraeg UKSLA4 tttttttttttVttttVt'ttt4ttFt'ttWt""'ttt'"tt'4ttWtttttt"tt'tYt't'tUttttFtFtttt4tVt11t1WWFUWUUFTFFUW THE NEWTGNEAN llttttlllllttIttttlttltllltttttlttttUW!FUW!!!ttUtt't1tllltttUtlttltttlltlt44ttllltttttttllttM The Newtonian Staff Editor-in-Chief IJOVVARD B. CHADWICK Assistant Editor Q CATHERINE A. NOYES Business Manager ?F JOHN J. WHITE gi Art Department 2 A BIABCABET HENRY, Editor ?f BIARJORIE W HEATON LOUISE F. SUHR gg ELINOR F. NEWTON PAUL E. NASON ii KENNETH H. BARTON Quin Memoriam" Drawingj Q5 Athletic Department ?Q JAMES B. COLTON, QND, Editor gg NIARGARET H. KENDERDINE FRANCES C. BROOKS Business Department ii Assistant Business Managers gi RICHARD L. LEONARD RALPH PATERSON E Circulation .Wanagers 51 KENNETH K. SPERL JOHN BUSWELL ge Feature Department ge HAROLD CARVER, Editor j VICTOR S. BADGER PHILIP J. NIUBPHY HARRIOT B. SCHELL PRESTON W. SWEETSER 5 g I I istories Organizations 5 HOPE GREGORY, Editor RUTH M. HUTCHINSON, Editor Ei CAROLYN L. POMEROY ELIZABETH B. PARKER JOSEPH L. RUSSO Photographic Department Z. M. CARLTON REDMAN. Editor KATHERINE BONNER RICHARD T. EARLY JOHN BIAYNARD ARTHUR SHUTE Proof Readers Data FAITH WING DORIS C. BARTON 23 NANCY RICHMOND PHOEBE A. BELL IQATHRYN F. SMITH R immIIInumtmmu1mIIiiutttittrztttnxUtumnIrmum1IIIInumIIr11IinIimIIHIitriiiiianumtiiuIitiiiIIiittiiiii1i4itiIiIIiiitiIii1IIitiIIIIiiiutriiHiiuiuh1iiiiitiiimituiiiiitiitittiIiiHi1i4iiidiii1iIiiiI1EiHiiIii1iiiiiIiitIE6i1tiSiiiMiiiiitii11E1iiiiII111Ei1iitiiME6EEiiii16EEEtiiiit1116EiiiithiiE6iHithihhhKEIiii111L16iEtit1hhh6Etiii!t11i1EI1hitihh6E6itit1i11hH1Eiiiih1hhhi11iit1I1h1E1HmthhHhhhAiiitii1h116EiiiiiihhhhHiiiiilkhh1ihhibbiiitlltlitiiiitt W 2 JIHHHH I l1UHHlHWWHHVVIIIIIIIIIHYH1HM4HHtIIIHHHWl'U'I'llllllllllHIt4l!?VV!WVIKIIIIIIIIIII Ir,Nj'2T,3S'1'2gg,'L'f3-5,12-E5'lNjl" UJJWWETKTTYZQSEQQ NIIHHHHHWU WHHHWRHHW MHHHHHHHU llIltNt1HNNH HHH FOREWORD OUR desire has been to make this Annual more cosmopolitan. This has been ac- complished by breaking away from tradition and presenting to the student body a book with a drastic reduction in price. The staff has stressed the lighter side of school days with a noticeable reduction in the number of pages devoted to that section known as Organizations, with the belief that the Feature section is more satisfying to the undergraduate body as a whole. We extend our thanks to all who have de- voted themselves to this publication with the sole idea of helping to produce a Newtonian uorthy in every way of its predecessors. 1mmmrru111uu1u1muuuuuunm114ummm1mmuumun11umlu1xmiiiiiiiiiiiHiiiliiiiiiliLiiiiiiii1iiiiiiiiitiiiitiiii4iiiiiiiiiiiiiHittLAiiiiiiiiiiiiiiiiiiitltiiiiiiiiiiiiiitttiiiiiiiiiiiiiiiiiiMkUtiiiiiiiiiiiiiiiittihiiiihiiiiitidittnnuniluuaU5UmnmnmmmmyUNmuumm44y4yynrayuuisunnmby1tmmmmmwbmwby or rg 3 VW WH WN 1 UM1. WH WNV VYV H15 "2 1111u5W111111HW11115 111V 11 113311!11NQM.VHWHII!lWHWW THE NEWYTQNHAN IIIH111HV?lIlIl11I?HI!!!YV1HHHIIIIH1IWIIIIHIIHVHIIIIHIHHIIIIIHHHHIIIIIWHM HWYHUIIH111HIIIIIIIIHNIIIIIIIIIIIWHIII IWW HH! .1 ,- .1. Ill .-. ,... Q . V J KU 1 f V7 1 V - V Qi V Y . V .' ' 44 1 fluf 1 X I X .. . I7 4 :45 Q V f 'l , - - .gQQ5f,':M -5- V 1 .1 . ' -. - 1LQ'2-f" " 4 :' 3 ' " -' K V if ag ' ir-'. 7 -1 7 1' - 2 3- ', 44fff'5fg,f..j'-2. , A 1 - .f V 1 P 9 1' Q 1 1-4 -1 , 1 Qpisffkzif,-31: V- 'T if 111,-V.-v-'-'. K H-MY, .Q1 l Q , K " . .4-' A .'j3'p'-S -1. ' . . ,,1. ' '.55:b?' pr. ' A . f 1 1-ar-i"'7'?'f.1 PT 1 ' ' - m 7 KZ 4 piafifgg t .I 4, V , D 1, Y, Q1 J , W a. x.Lirb1+Q ., 4 W . .V I 4 1 - . .3 -ix! - :.r-'vjpl--1,1 5 If 4 . ' . '. 1 7 l'.'y!'l'J -I-1-V ,f 1 P - W 1 - 'I V V :'- mfryg- 7., y, A4 .P I 3 5 ,X -:Nm 1r,j ',:,1"1,-- 1?4-.323 ...ga A QV .7 "1 SV .- 11 rg' cf ..:f'," '- Vlkf- fi'Q'31S'Li 1- f ' N 4.5: 3 , " G :' 1.11-Q:"t1',',f-'gi". fy T '1,. V. ' ill".-,iii .?1!:g:1.-gV"lag, V :. - 1. f V '1 J' ' 1 f if ' 4' 'HL 5,111 ,X1 1 " 1 - V -' 1 V: ' ku VQ159 " 71522: F"-'VW ein- 25546 51 f 1 '- . QV - 1,11-:. 1 df Jaw' - f - 'Q ,ff - : V 'X 1 - .T V Lx-A 1,gw'- .1 ' 'fiffiv pia- . V A: " Ur - ' 1. Wgc. V: F 'SW 521215 f P! 2.1 V' '.Z' 'N .r '1 ,-L. ' A . V' ""A'. 1' ,,-,1 ' ' 'Q ", GQ- , i' if Q N !,, V11 U57 ' ,, .- 2,1 N 14 . Qfgg . R ,rig K 1, :Qs 3, Q A 53... . , V 4' VFSWP' . ,i 17?-I 'f X ' ' eo yffl 1 , -'QM' ,if s 1 A .. -1,2 .1 11 -1 J. Vw? .f me - 1 1 . ,qw 'fx ' H Q .wig '- V3-,H 1, V - 1' ' 1 1 L 11' ix - I 5 - I ,Ita fx-1 ji, ' ' -W V, , .i. -l:ljJL."!' ' .Q'3!fQ.f--' 1 v A 5 ' L Yffjfig-A " 'H -V - ' J:-.f . 1' VV , 11--J. :A -- . - 1 ,Q '1 L.-f , ' ,1' g' ,f X 11,5 4 fl Law' ',' ,gf.,,'- ' "e'2'E,fq!::.7" K ' ,, fi ffyyf 1 X X. 'VY ' V '- - , ,.'v.'4 -, V . !V1.1",r-' vi' ' -V W1 W1 ' -- 1 "V " "CW ' Q - .",' -5 "H ' ' ,ff ffl, , . 1 H V 1 1 11: 1 swf-.f' df? P fi If 7 f f 26 f . 12- 1-.mg ff '- .- ' f " 1-f:::f.V11:311,' 'AU V fy ' ' V: jbf-by-,AJr x ,I ' mr.. 1gj"Vi"f'xf4 lu. ,1 Sh if 1 I 1 , -A LHQ71: l 7 .3195-.. . h Iv? V: 1 , . ,I wg: jig- - 2315 0.1 L. siiia. 3. H14 x f 1, fyf 1 ,'3g2?lrL,?r .. 'nf " .3 "AA , .. .' ' ' 1 !, ' T' ,1'- :Hifi 5 .ffl-. 1. H' -vii-nf-'Q .-115--.,'i1QV"'f 1,11 ,f x .- B .'-IV-?j'1g3.,1, vw 1: .1-: 12,1-ff-vs .1 IV' -' - 11: ,Q-rf,-1411. ..g'.- ,, , ,1 ,,..g,,".,4 u . f fa-4 .V X I , pf , .,i'r1,, . 11, . - , v-,a.,q9'1-In . 1 3 X . , I - ,,'..- - . 1.. , g 3, 1 N, V41 5 . lk . . - J 'N L A' -'A-3' YC-if t v' v' --21 " ff +11 . - 1 , 1 'twig V LH . 'CF ,L'i"'?3f 'V 'Pug5531'1f1g3,'V " V- -' -gi, 11 c V 'ark ji, - , I- ,iF:,:1,i,-. 1 I Q .. I '., -. f: eV +V 1 11111 1 1 'rf 1 .1 cz' I-':?1E4f51i-31' fi ',. ' Ja x It I, .7c.,f1:'. li-lf.: 'nf .1.j,'i.'4 -iz, - ,Q 2-x 'Wy' 1 ."5'Q.3" 1 , -K.,,,wg1fYf .1 .,.-JW-. x1-1: -. -,I f 4 ',1 2,-331115. , r Y1'f b-1,'.jg1v'll:? ffLg,'.'- aff. 1 at ir, L .4 Q1 gk 1 Mv- 'l 'v -3'1" AE' ,' -MV: L ,1--3, "' ' - ' nj- 'L-QQ. ' 'jf'-1-ingf 1. ' , ' 'gf M 4- gg 1 . .ef ' ?' ,"'p1v:V.'V iff --I '13 ,Aki-e J: V5K:.,.'1,,.,! ij, 1 , gif. ,VL A '-pn, :Q 1.1,-,, " ,515 A 'Jar 1,71 . " i xi: mai FZ.-2V,1-5 4:11:15-1 L? -5 A1,.L5,-,,- +54-x lifirg 11- f , 'imfff Y ,5:e5w.AV-0- AP T,-4,23 ,iitp .z, . - , N 5-R-r v H I Q , A fu v' tx:-22:11 -1 Am:-.',f. V -1 V 1 :za A -. . 31. if ,:p21'4'Cf'-,1'-. I' 'g..V .11 gk' .. P-!:17y-.1. age - 'aiu--if - 1 r. -U,l3ig.42,'h .V - Nun- - . A1 '3-V 14- Jawf. -1-1 la .Q ,..1.d,ff.J 1.3ff:1?f-, gag' 5:5 VV .V -."'3Xf"?Q5f59?7?'l5ff25 535f6g3A',Ff51 W 'V SPQQKE-fi'-f1L.A ' l5i'?3353fwL '4f?if'31'+d3Y V- f 1 1.421 JA 4'Ww'L9S4if'?f.': mtg' .1 fi,fzf3QHi ff. fgw, A :1.'ggzVg'- V39 1 mg11g1Q1V ..g,-Kg. . gd ' Qfikflfgif lqif 1 '- 1 gh: g-,45,:,.- 1 K V- 1' X5- jd 1-1 1 .,,,e'n,5 'fi gb nf' 1, .X-qs: V'L'4,y,.'.1 go. 1 - L, ,Z-.gb '- 'Wig "112Z?72LrQ 'JMR Tffwzq ' - .dr 'V 5 .Iv 5 " 'uw' '- " - -', -V31 -1.-gg N i.....l-,q-,, h d f-- 1 -x'.v:V K ,.:gf 1-5:4-. - x.:,V.v,. f- . .vmi 1 1 I ,-Lv -.- ' - 1 .ww '- 1- .-V'-11. .f-V-A . 5"!uf,4',, 9' . 4-Cm ,, 1, fz- 4' 71,1 KAI '-A-' , . ,1,'2'iu1'-:3f4f jf 3q.I5 ' ' ,N QQQQ .U 1.1 11 2? 11 1. .,,1.-, -1.1-,,,, . 1 1,,.,, .y, 114 4 ,. .,'. ., , V., :5-.M-x11 iw-11V.11.X?: -1:49 1 '5-Vf:'3V qwqg-f 1. ?'E4M'fK"x -. -5 'VJ' 1-:CN w"fv: . -A-1 ,-'M'--..11""'f rl 'q,. -.A , L, s fq,,1:,.'1gg-Q5 , 1 -' V .1-Q-1-1, . 1- -'.-1 'V1'-.'r- ,'.-..- -' 1 . - 4 V 1f"'!i."c W1,gF5y,.4,:Y'. ,g,v..1.zr1.vfi"1' ,ji ,W-DI, 1, I .ll . -- Vx :ff -wi -'Kiwi-. Hihfizv 'rw-15 +YV5"L1' V. J VV1:-'mmm .- He' 55 ph . .'1yxYQP f'.' 221221 YA Tiff -'HE'QqQQ2f5'3 1 q V 1Sf1+21'nV' ' .zrr-.H Q1 1 5gu'w M135 V .' - V - - ' --. I . 'V.V'e' H " -.amp 1 .7 1. ,gf . 'Fizz .ij!i.g-V: ,Q 9,5-55.15133 3:52, 17 1 . V 3:'f'TQ.S31?v5Q.x H.:-gigf:9Q5fiff:-5j9ffn5a!.f.41g57VX1.1155-if V f1'3?:i1'. .V V' 1 ggifhi- 1 1 e,.p:2:,j'.5st 3 lg: L' Efvfnff - 113 J if . f. V - 3 1 ' ' A" 'lin .4f,'fI- ff.-X 1. I"-111219, nf' .,.-NQT5-," :P1"'zf M, .-.' "1 '. 1 ' 1 rv, 3, - -Q..ip-'-.-f"V ----.,,j: Y.,:: ' v-1 ,V ' as.:2,1.1.41i4Lf23Q1f:M.1.ixf.-11... 1 lx A A L .A A nnmmwmumumllmmwmurrnNummNwnunlmmnunMNunnlmmmnnzmriiiiiiilhiiiiiaNwhmmMiiimMiiiiiiimiiiililmMiiiilmwniilinUJiiiiiiimmiiiinmniiiwiLmimHmliiiiiumiuiih111uhiliiiiiiiiiiiiiiuihiiiiiiiiiiiiiiiiiiimlhiiiMinhidiA1ii5Hlhiii1iMHHHMLhiumi1nhiuiddithhhumirinnmMiluumhHHiiiummnimunulnaluihmmnumunmumunmwmmmmru1umnmurmn1nu 4 I mmxmsnuumww IN MEMORIAM MISS MINERVA ELIZA LELAND BORN OCTOBER 26. 1859 DIED JANUARY 6,1926 WORKER FOR GOD AND YOUTH IN NEWTON HIGH SCHOOL. WORSHIPER OF HIGH IDEALS, SEARCHER FOR THE TRUTH, WHO LEAVES US WITH A SENSE OF HAVING BEEN CLEANSED AND PURIFIED IN THOUGHT, WORD, AND DEED. BY HER UNSELFISH DEVOTION TO THE DEVELOPMENT OF CHARACTER IN THE YOUNG MANHOOD AND YOUNG WOMAN- HOOD OF TODAY. nnnummI41nurrInIIInnnnnnmunnmuI4IIuwuIurunuuuuununumIrnnnmnnmunmmummmuwIIumunnnnnmuuIuwImmnnnmumuwIIuwIIImmunmmnnwIIwIImuwmlm-mmmmww mu I IIIIIIIIHHIIIIIIIIIIIIIIIIIIIIIIIIIIIIHIIIIIIIIIIIIIIHIIIIIIIIIIIIHHIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIPIIIIIIIIHHHIIIIIIIIIIIIHIIIIIIIIIHHHIIIIIIHIIIIIIHHHHIIIIIIIIHIIIIHIIHIIIIIIIHIHIHIHIIIIIIIIIIIIIILIIHHIIIIIIIIIIIIIIIHHIIIIIIIIIIIIHLIHIIIIIIIIIIIIIIIIMNHIIIIIIIIIIIIIhimIHIIIIIIMIIIQI IYYY I IYII Tulum!!! 5 W 3QffE3TSN"fI"QlNj'IA,N IHY1IIIISIii411IIIIIUIFII4HIII 1451WIIIIIIHIUIHIIIIiq?HHINIIIUMINI IIMI+1IHIIIII IIIHIHIIIHHIIHIIIIIiHjjllHIIIIIiHIIHHWNMMXWH? an 5 THE IIIASSICXL BUILDING i THE TEIIIINIIIAL BUILDING ww Im mu IM Mmm uwunuwu w1nmImuIm4mm1mmunImuummummsmumIsummummmmlummmmIsumumriuunambiummmnmmuulmUmmmImummsmmwwIuunmmkiimwwxuilhumlliiklalnIummmukhummlmuuAmmuuImmm1mnmnIummmInrl11ull11mhi1llr41minnnmninlnlmmlluuu4mnummmmnumImmm1mmmUrunlummmllu1u1wmmm M 6 N WM U HmwwimiWNW ilQ"'QM'EE,Nj'LLLJ'fK'-53123, IH N W UHHNUHNMT WWWWHNHWNMNWHMmm WHNHWM wwwuwwwummmwvuuwln T FCHL X , , Y,,, "MV-1-L , , - , , ,.,,4I, VJ, V- --,,Y N Jil M , Q, . ., . - " vw- 1 U. N V' . 'K fl 5-2- 'PUL3' , ,Y . yi -N A A? if-A K 21" '-'ll 7 vjgg2lTA'l"':-f'j":- - f--A-,R-up f ' X Q -- X bf- - . X ff ,-f- K .. -'-- g. L 5? YZ, fl? ff QM-afgig , WHHHHIWWWWWY1HWX PL biIWNIIIIIIIIINHNHHHWHNHHHII!I1ll1hMHN PUIIIIIIINIIU 1 HHllHiirI!i1WWHHHHNHHiIIli1UHWWHIIIIIIINHHHWHNNHIIINIMWWHHHWiIll1llHWHWHMHiiIlm4HWMMNHm?u m +1.uwMm NUHMW H w l mil milIlllull1IllHIIIIIHlHIIIHHIIHIIIIHHWllllHlUIIIIIIIHlIHIHH1HHIIIIIHIlHIIIIHHIIIIIIIIHlHlllllllHIIIIIIIHHIIIIIIHHIIIIIIHHUIIIIIIl HE NEWTQNEAN llllllllllllllllflllllllllllitlllIIIll1lIlllIllllllllllllllllllIlllllllitllIlllllllllIlIIllllllitllllllIllIlllllllllllllIIllllllllllllllIIIIIIIIIIIIINIIIIIIIIII ummm 1 io iii- 1- 1 11 1 11111 111,i:i1.11i11i 1 11' 1 1i1i1u1,1-11 Fnswcls L. BAfzoN . lnvme O. PALMER . M1cH.xEL W. Mmuu Y Alorris ll. Brown . Ernest ll. Caverly , Albert A. Dulac . lfdward N. Grillin . Faculty . . . Director ofSecondarjvEducation . . . Principal Director of Vocational Division Departmental Heads . Pr int in g . . En gl ish . l 1 Y00ltIl'0I'tx' ing . . . fl I us ic ., . 'N -Cll' t.harles B. Ilarrmgton I Hmm' 4 on 0 tgp a l Prcparatorjvj Jeannie B. lxcnrick llorace liidger . George A. Land Maynardhlaxim . Alice A. Alden . Francesco Argento . Abner ll. Bailey . Josephine D. Baker. Nl. Aimee Ballard . Beatrice l.. Bates . Joseph A. Bedard . Blanche F. Bemis . Xlabel F. Bennett . Gladys Al. Bigelow llazel L. Blake . . E. Warren Blue Emily P. Burdon . George K. Burgum Maude E. Capron . Gertrude XY. Carleton A. llortense Church llelen Cotton . . Eleanor L. Cox . . Julia M. Currier . Katherine Curtis Fred ll. Daniels Gladys F. Davis . George XY. Dawson Alfred YY. Dickinson I loaseh old Arts . Social Sl ad ies Charles H. Mergendahl . . Mathematics Gertrude E. Myles ...... French Frances P. Owen . German, Social Studies Edwin Pt. Pitt . . James N. Potter . Wallace E. Richmond Wendell F. Smith . . . Latin John L. Sullivan . . Commercial llarold W. Thomas Teachers Serving, illilliner-v, John Fitzsimmons . Dressnzaking Maida Flanders' French. Spanish Francis J. Foster . . ilIUltH'lI1llll.l7S Cecile E. Giroux . I . . . English . . . English . .llathenzatics Draft ing Assistant gl ish . gl I alhernat ics . . Conzrnercial Librarian. Engl ish . il I at h erna I ics . . English . French . . English . . Chemistry . Social Studies . t Ijfice Practice . . . Latin . . . French . . . Science Science Assistant . . . Design . . Cooking . . English . Social Studies Caroline Doonan . . . English Elizabeth M. Eaton ...A 9 cience Paul E. Elicker . . . lilathemalics Margarita W. Ells . . . Drawing Donald G. Enoch . . lllalhematics Abbie I. Fiske . English. Vocal Expression 'Leave of absence. May Belle Goodwin Buth E. Gray . . Baymond A. Green Ethel llam . . . George E. llardy . Marion B. llaslam . Irene M. llaworth . Emily llazen . . Arthur G. lflildreth Frederick 0. llolmes Mildred llood . . Frederick K. Hussey Arthur C. Jolmson . Helen P. Johnst.on"' Alice L. Jones . . Robert M. Keeney . H. Anna Kennedy . Daniel F. Koughan Grace S. Kuntz . . Peter J. D. Kuntz . Frances V. Lund . Oscar Martin . . Dorothy Matthews' Bertha P. Maynard Ethel W. McGregory Margaret McGill" . Jessica F. Meserve . . . . Electricity . illachine Practice I Science tffollege l I 're pa ra l ory 13 . . A gricalture . Draft ing. Science . . A I1l0lIIOD1.ll' . . . Electricity Physical Ed acation . Social Stud ies . . . French . . . Latin . Science A ssislant . Social Stud ies . . . French . tlilflltlfllllltl-l'S . . Spanish . English . . Latin . . . . Science . . Social Stud ies Stenograph-v. Qjiice Practice. 'Ifvpewrit ing . . lllalhernatics Latin, illathernatics . . 'Ifvpewriling Physical Education . . . English . . . Science . . Social Studies Physical Education . Applied Design . . . . Science Phys ical Education . Mathematics . . French . Drawing . Social Stud ies . . Cooking Illlllll Hllllll iia1iiiuuniiiniiuimmiinitimimiimuuililiinuiinliililiiiuiminliuninHimiliiiuiniliHilliiiilimilnnuwillnHinwilliuiimiuiliuiliiliiiii1in'milliitiliwilliiiiitilliiiuiiiliilliiiiiilliiiiiwilliiIiiIiliIiiiiiiliiiiiiiIiitiiiii1iili1iiiiliiiiiiiliiiiiiiIiliiiiiiilliiiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiiiinliiiiiiiliiiiiiii1innlnnuunlnllmnum Immun llll''lllllll'V'WWlhlllllll4llllllFFll!?l???l?lUlllllFlIPFF!F11!llllllllllll? NENETEEN TWENTYQSHEE Faculty CContinuedD Caroline H. Mills ...... English Catherine A. Murray . Sewing, Dressrnaking Edith E. Newcomb Sienography. Tvpewriling Warren VV. Oliver . Mary C. Owens . Harry J. Patterson . Harriet P. Poore . Rosina C. Rathbone Clara L. Rice . . E. Louise Richardson Vesta A. Richmond. Edith M. Rideout . Cora E. Riley . . Gertrude Robinson Cora W. Rogers . Edna M. Ryan . . Ralph M. Sanborn . Helen A. Savage . George E. Shattuck Maude M. Shippee Charlotte M. Simon Flora M. Smith . Margaret South Elsa W. Stone . Carl L. Swan . t?Leave of absence . . .Commercial Sewing, Dressmaking Science, lwalhemalics . . . . Lalin Physical Eclacai ion . . . . Design . . . English . lllalhemal ics . . English . English . . . English . ll! alhemal ics . . . . French Physical Educalion . Librarian,English . . Social Slad ies f Teri iles, English, 1 Social Slad ies . . . . Hygiene . . . English . . Social Slacl ies . . . . Science lllechanical Drawing Nelson C. Swan . Alma A. Thomas . Samuel Thurber John P. Tilton . . Herbert D. Tinker . Edward N. Tisdale Ralph B. Tower. . Ruth M. Twiss . . Adele Waldmeyer . Ida M. Wallace . Louise VVetherbee . Hazel VVhite . Helen L. White . . Leon L. VVhit.e . . Katherine VVilder . Daniel P. A. VVillard lk llllWlllllllllllllllilililkiIllllllllll Wl llWilllllllllll1llllliiiiiiiillllllllllll HHMHH . .Mach in e Slen ographlv . Engl ish . . English lll1ClilZf'f71LlfI.C.S' Science . . Cornmercial Bookkeeping . French . Lal in . . English Bookkeeping . . French . Drafl ing . . . . . Science Social Slurl ies Lester E. VVilliams English, Social Slzzilies William L. Young , English, Social Studies hlary Danker ...... Secrelar-v Evelyn M. Hammond . Secrelarv Ginevra G. Harvie . . Clerk Daisy Pillman . . . Clerk Clara L. Wlest ....... Clerk Ruth C. VVise ...... Secrelary Easter I. Hamilton . 1 wi ru ri .ti iw- .,...,mu Cafeteria Saperinlendenl lah1rI1ofnrIn1111u11u1uuuuIulliliiiiiiiiiiiiiFiiiiiiililliiiiilliii1i11iiiiiliiiiiiiiiiiiiiii1111lllliliiiii1ii1iiiii1iiliiiiiiiiiiEiiiiiililliili1iiiiiiiiiHlliiiliiiEE1iiiiEiiiililiiiiuiEEiiEi1iiiiliiii6iiii1i6i6iiilili1iHEEEiEEEEE1iiiiliLiiEi1iiiiiiiiiiiiiii1EEEii1Eiiiiiiiiiii1iiiiiiiiEiiiliiiiHhI1HiiuI6E4mx1ixiiilinhuuiuimmmnumummwillmunnnmmmiausumunnmuli4hrulallmiiiiwwnrunrmhHiiilurrnnrvvmllin llh THE LSI EFSWT QZLSTIABFI L- Xliw XllH'I'fHIl H2lk1'Ill1lll lfxlxwzalwl Xllc-n Xluawm' .luhn Ifryn- IRQ-II Il4'Il'Ill12ll'UliIll' XIHIIPI' Jann- Ulixn- lirigrgs John lxnule- Nc-lsun lmmllly l,ixillg's!ml HlIl'llf'l' Xlzirthza Nlilllfilll' NQWNIIIHII .lulnn Xxl'1IjfUIl lillnu-ll f12llIl4'I'iIll' Xlwrel Nuym-s Hlixv fi4'l'll'lllll' f:lll'lil'1' I':I1'?lHUl' Hvl'll'll1l1- U'llz1llurzm I'QIUl'1'll1'1' XlZil'Q'lll'l'l l,2lIlj11'IH fiiiflllfll Unlism' PUIIIITHN lnvx I'1IiZ2llN'tIl Ifusi NN inifrn-Qi liuyrn-1' lin-In Xliw- IIl'lIlt'llXNHf Xlurvl f1Hl'll"Hll llc-rirllzm llm-nry llillwn l:llill'lU'Il' livylmlds Igllfll Xl:n'g1':m'I llmlglllfnl lflizzilwtll Svlnippvr' liia-Imrd lfie-ld llun1,.lr. Duris lfxtlwr Sivlwrl XlJlI'QiH'4'1 H1154-N lX1'llfIl'l'fHlll' IIWIIPIIIIH N irgfinin Stunlvy fiiiI'HIillf' IA-vis lfziiih Simu- .lm-:un Xluvllmlulml Louisa- l"l'4-1l1-l'i4'k Suhr Nwlliv l':I1'2llllJl' XI2l,!l'2lllQ' lfdgzal' 'l'ruin NN llitc-. Jr. lZIl2ll'lt'i Xllwrl Xlf'ff:lrllly Hull! Nl:n'f'l'4-al XXllil1'lllblIS1' Xliw- Nlnriv XI1,-Uurlnlcl lfclifh IlUNY2lI'lIxxiH1'HX liivllznrwl I"l'2lIllxlill Xlillvr Hit'll2ll'll Xuxtin NN inslms fhnmlillu I 7urzml Zim-glvr W H WW W WWWWP'W WHW W WWlNNHVf W uilHHUL W lWWUHHM WWW W 1WMUUW V WW W 1H MWIHHWHfH4NHVHV!f'UHU ''ww'W W .M W, 1 w , 1 U ,N ww, U , ,, , , ,, , , , , 1 ' w ,- ' ' 'ww--x w M' 1, M N11 X"'w',' ,V U, 1 ww! 3' H 'w W, 0, ww' " 1 10 ,X UMW MHHHHNMHHW N W H HHWl??'544WlH QNTZILNIEFQJEETI Tfyvglxifffkfngjljf El P X SHUI R6 I iff? 5 Yxf N S W! K ,If A if + M 1 mp f F K W W X: ' 'g .,1. A U E Mix' 'll1"lEJ ' 4 X H 'b , Jf! ffw' W! ' 'K 'II' J J , A , X W 1 f QP , Q "U 1 - QxiiNxN1 s MX XQNQSN N X Wg 160 mo mud my 501111 HUHHN IIIIIIIIHHI4 H HlbIIIUIIIIIIIIIIIIIIIIIIIIHIU WIllllilllllllllllllli1!1 HlllllllllllllllllllllN ilHH?IZIIlll!111 1 H H FHEIIIIIHU 1 U U EEEIIIIWHN HIIIIIIIUNH U VVN331 H H i HHV'F!WHNHN llWN11H W V l' QWWW 'U H ll TMW WHWWIHNWVMMUWHIE?NWnwMMws?NHHFHIWPNWNHHIIIHHHMMIHQIIHWHIIIIHIUHIIIIUHIUiIl1HWIIIIlW 'IEEE NEWTQNKAN HM limnrnnrnumvrmamnnnmummumm vvmmnnmum nnvumm1mmmnrumm:mlmwnmmmrmum4nnummnnHumnrlllm1mJriuiiirm'ml4ummmmimmnmnmurlnnmmluuun1I1IuHHr1I1IuinnriIinnin11I1I1IIri!1IinHifiiiiihifii1iiiiiifiiiiiiiiiiiiii1iiihiiii1iiiiirilIHIiiliniiiI1in1hiII11unIni1i111n1nr1i1IHHnInu1i1numii1I1HHnHHii1HiHmi!i1i11hmm11iiHmmmhmiiliiihniiiiimnrmmiiiiiuiiiiiiisdimHHhimiiiitiimiiiihhiilihhhiiiikibhhiW I 2 utwwtmmmmmm Ilmi..uwwwm.tt. uwmiwuuuum ALBERT SALVA'I'OHI"I ACETO I5 Magus' Pl.. Nvvst. N6-wton "Good humor nmkns ull lhings I0lf'rublf'." Tootiv: Horn March 1, 1008: Vo- cational AT: Ilvirvv Grammar: Pratt Institutv: Class Basvball. I. 2: Class Hockvy. 3: Class Rvlay. I-. BENJAMIN FRA N lx ADAMS T21 NV?-bslr-r St... Nevdlnam "7'h1' wise and uvlivr ronquvr fl1ffir11llif'.v," Ban. Big Boy: Horn Ovtobf-r T. 1007: Classi1'al2 yrs.. Svivntific Z2 yrs.. I4-C: Kimball Grammar: Middlv- bury: Class Presidvnt. 2. 3, 4: Studs-nt Counril. I, 2: Constitutional Cou- vention. 3: Football Squad. 4: Exovu- tivo Cl0llIIIlIIIf'P', MI-: 'I'rac'k Squad. I. o '3 WARREN SANFORD ADAMS I3 Hoge-rs St.. Nffwton "Spurlsn1unship ulruw' ull olhrfr things." Babe-: Horn Septvrnbvr 4. 1010: Classival l0C:.Iunior Iligrll: Princvton: Football. 4: Indoor Travk Manage-r. 4: Honor Roll. 1. 2, 3. 4-. JOIIN BUCHANAN A K ER I5 Hibbard Rd., Newton "His disposition is us sunny as his hair." Jack. He-dl Horn January 4. 1008: Scientific- IOC: Brighton High. THEODOHA WOOD ALHREE -'I-0 Shaw St... West Newton " Nulure inlr'nrlr'fI you Io br' Ihr' founlu in spring of r'hz'0rgfulm's.s'." Dodie, Teddy: Born November 26. 1006: Classical 2 yrs.. General 3 yrs.. l4C: Peirce Grammar: Corume-ctirut: Class Basketball. I. 2. 3. -I. 5: Varsity Basketball. 5: Class Ilovlwy. 1.2. 3. 4. 53 Captain Class Ilockey. 3: Senior Play, 4. mmm www 1 .1 nt .mmmuuum CAROLINE VIRGINIA ALICXANDFIH 21 Thornton St., Nffwton "EIOrnul jvsl and valleys of per- pvluul pi-ulllf'." Carl: Horn Ortobf-r 25, 1007: Stvn- ograplniv l00'I': Bigvlow Grammar: Portia Law: Commr-rrial Club. 4. Dt DIN VI'IIY ICDI'I'II ALLICN 188 Yvatvrtovvn St.. Nvwtonvillf- uI1lI'l'l' ll'IHIIIfl In lwnrl o honrlf' Dippy. Dot: Born Sn-plvnlbf-r 10. 1008: Classiva. 2 yrs.. Ile-nflral I2 yrs.. 16C: .lunior lliglvz Chandlvr Svvrv- tarial: Spanish Club. 3. L: Frvnvb Club. lt. l'II.IiEHT KICIVI' ALLICN 5.1 Iionad Hd.. Wvvst Nc-wton "Slrnng rvusons mukf' .vlrung actions, " Horn Novvmbvr 3. 1008: Scif-ntilirv lhC1 Lowe-r NI:-rion Ilighz Dart- mouth: Math Club. VI: I"II'PIll'Il Club. I: CIM' Club, 4. DOROTIIY MAY ANDERSON 083 VVasliing.:ton SL.. Nvwtonville "lf IIIIINIII' ln' llwfoozlof love. play on." Dot. Andy: Born .Iuly 1-I, 1007: Classival I8C: Horam- Mann Gram- mar: Nvw England Conservatory: Class llasf-ball, 1: CIW- Club. 3: Or- vlu-stra, 1. 2. 3. -I-. 5: FI't'll1'Il Club. 5. HOliI'II1'l' I'ENSICHS'l' ANDHICS 61 Kirkstall Hd., Ne-wtonvillv "A l'0IIll7Il',' if-vou kunu' hnu' lv rfud him." Bob: llorn May 8. 1007: Svivnlitiv IZWIC: Junior lligllz Football Squad. 31 Ilasvball Squad. 3: Iloa-km-y Squad. fl: 'I'ravk Squad. 3. IINTEWNTTIQNEAN ClllIlS'l'INI'I MARY .'KN'l'UlN ICLLIS '10 Dalby St., lNvwlon " llrr rnusir fillwl us willz d1'liyhl." Chrisi llorn Augusl 26, l008g Sll'llllQ,fI'1lIPlll1' l00'I': .lunior Iligh: Drama Club. lg IlUIllllll'N'l2Il Club. l. Nl YlI'I'l,li STATNIIISII NIWNOUID I5 iIIlIl'IH'l' Sl .. 'Yvwlonvillw' "lI1'l' I'IIllI'IlIliIlfl Inn' uml 4'llIll'lll- ing zruvs nmlu' l-l'l4'II1,N.u Nlyrtic-3 Born Sa-ple-mbvr I3. l04IT: Shwnographic: l00'l': Junior llighg l,a-gislaluro. I: Conslilulional Con- H-nlion. 3: Iolln-y llall 'I'4'aln. 2. Il: Social Commillvv. lg Svnior Play Conunitlvv. -lr. YICTUR SANIIIIICHG II.-XINIEII I6 Bradford lid., Newton Highlands "The millions srflflnm err." Viv: Born January 3. 10083 Scien- tilic 1411: Ilydc Grammar: Frvnch Club. I: Spanish Club. 3, 4: lNvw- lonilv, l. 3, -l: Nvwtonian, 4: S4-nior Play Conuniltvc, 1. ALICIC A'l'lII'IlI'I'UN IIAKHINIAN 3 Hiplvy 'l'c'r., Nr-wlon Cvnlre "A lr1uw'llPl' -l.l'lllII un unliqur' lurid." Ally: llorn lNUVl'IllIlI'I' 18. 10003 Classiual IOCg Shanghai Anwrivan School: Denison: Latin Club. 1: linglish Club, -lg Class Ilovkvy. lg Ilonor lloll, 'lg NlaLh Club, l. JOSEPH W. HALL 26 llarvard Sl., lNalick "Sony r.rpr'r'i1-mv' nmrlz' him xuyr'." Joe: Born January III, l008Z XOVSI' tional AT: Wilson Grammar: Fitch- burg Normal: Class Baseball. 'lg Hrwlay Team. sl. ICLOISFI ADICLINE liAlII3I'II'l 26 Maple Avv., N4-wlon ullllllllilllllll l'll!'I'liliIllIlPNN is II sign of u'isrlnln." Bobby: Born April 26, l008g Classival ISC: Higm-low Grammar: Boston lwnivvrsity: Alpha B1-ta. 1. 23 Nlath Club. 3. I-1 Class Ilovkvy. I, 2, II. -lr: Iarsily Iloulu-y, 3. -I-1 Girls' Class Iiasvball. l. 2: Girls' Yarsily llaseball. ZZ. DORIS CAMl'I3l'Il,I. BAIITON I0 Lmdvn 'll-r.. Nvwton u1IIllllSlV'vV nzukr-.Q ull lhings l'IlSV.u IJ0l1SPlll.0lIlbCI' 12, 10083 Classival 3 yrs.. G1-nvral ZZ yrs.. l6Cg Big:-low Grammar: Boston linivvrsilyg Now- lonili-, 3, 4, 5: 'Ylalh Club. 3, -I: Glec Club. I. 2, 33 Class Xollvy Iiall. 2. 3: Newtonian. 5. Pl IOFIB li AGN ICS ISICLI, ll Ivanhoe Sl., Nvwlon " Happiness rourls Ihee in her ln-sl Ill'I'llAV.u Phoflbg Ilorn Svptclnbvr 2, 1008: General 16C: Bigelow Grammar: Class Ilockvy, I, 2: Spanish Club, 3. l-: Math Club, 3, I: NPWIWOIIIIG, 1: llonor lloll, 2: lNcwtonian. -1. GliIl'l'lIllDl'I IIENYON 35 Carleton SL., Nc-wton "fl Xllllllfl lmlv of lziylz xpiril umltfull :J fun." Bunny: Born July 27. 10081 Slen- ogzraphic' l00'l'1 Bigelow Grammar: Children's Ilospitalg Commercial Club, l. MARJORIE ISABICL BERRY '57 Auburndalv Ave., Auburndale "fl lzmrl will: room fur l"l'PI'VV joy." Marge. Nlidgcg liorn March III, 1000: Classical 18113 Burr Grammar: Simmons: Alpha Be-la. I. 2: English Club. 4: Frenrh Club, 43 Library Club. 3, lug Math Club. -l. TIIEODORE OLOF BJORNSUN, JR. T6 Harvard St.. Newtonville "A good head und indllslriolzs hund are uvorlh gold in any land." T1 Born April 15. 1906: Seientifie 14C: Claflin Grammar: Northeastern: llflath Club. 2: Senior Danve Com- mit.tee, 5. HUVVENA ALIZICIKTA BLACKFOHD 454 Yvalnul St., 1Newtonville "A peach." Bog Born December 13, 1908: Stenographic 109T: North Junior High: Newton Hospital: Declama- tion, 2: Dynamo, 2: Senior Play Committee, 4: Commercial Club. 4. CATIIERINE EMILY BLANCHARD 12 Belmont St., Newton "The quiet win, in lifes lung race." K. Kitty: Born February 5, 1908: Classical l9C: Jamaira Plain High: Vllheatonz Freneh Club. 5: Glee Club. 5: Math Club. 4. 5. ALLAN RUSSELL BLISS 2-lt Somerset Rd., YYaban "High ereclcd lhouyhls sealed in u hear! of m111'lesy." Al: llorn April 18, 1908: Business 1l1T: Haddon lleigrhls. N. J., Rhode Island: Drama Club, 4: Commercial Club, 3, 4: English Club, 4: Spanish Club. 3: 1VIath Club, Il, 4: Senior Play Committee, 4: Legislature. 3: Consti- tutional Convention, 33 Social Com- mittee. 4. BERTHA ANNA BUISCLAIR 81 Dalby St., Newton "A very rlerer girl by nature." Bert: Born August -1, 1908: Sten- ographic l09T: Junior High: New- tonitc, 1: Drama Club, 1: Coln- mercial Club, 4. KATHARINIC BUNNICR 138 Lineoln St.. lNewton 1'1i,-zlxlanrls iLTl1I'l'0 is nothing so lcinyllv us leindness, und fllllhlillfl so ruyul ns lrulhf' Kay: Born August 1. 10063 Classi- Cal 2 yrs.. General 3 yrs., 1hCg llyde Grammar: Boston School of Physical Education: Vive-President Class. 1, 2, 3: Girls' Nice-President Associates. el: Constitutional Convention. 4: New- tonite, 2, Zi, 4. 5: Senior Play. 5: Drama Club, 5: lNewt,onian, 5. 1'II,1ZA15li'l'H BON N EY 36 Parker St., Newton Centre "The qnielcsl minds are gen- erally llze most lzuppbvf' Betty: Born April 1-1. 1908: Classif Cal 10C: Mason Grammar: Simmons: 1W1alh Club, 14: Frenr-li Club, fl: linglish Club. 3. 4: Library Club. -lt: Class volley Ball, 1: Honor lloll, 1, 2, 3, -1: Alpha Beta. 1, 2. MARGARET MARY BULTDHHAII 17 Beach St.. Nonantum "Beneath whose dignily hide wisdrznz and lore." Peggy, Stubby: Born lllareh 229. 1908: General 16C: Junior Ilighg Framingham Normal: French Club, 1: Newtonite, 1: Orchestra. 1, 2: English Club, 3: Class Secretary, I: Constitutional Convention, 1. EARL BURGESS BOUIINIC 45 Mosslield Rd., VVaban "The less we speak of his grrul- ness lhe more we lhinle rj' il." Born February 5, 1907: Scientilie HC: Roger Vllolcott Grammar: Middlebury. ELEANOR ELIZAB1i'1'll 13011 ICN 13 Hillside Ter., NYC-st Newton "Sqft is the musir llml uwulrl charm." Betty: Born November ll. IUUT: Classical HIC: Peirce Grammar: Conneetieut: Math Club, Il. NETW'7lFfLC'DNH4l'ib.N .lUlllN ELLIS llOVl'l'IN 12 Parsons St., Xlrsl. Nc-wton "fl silvnl, shy, pf'ru'f'-lo1'iny num." Pylllagorusg llorn April 27, 1008: liusinvss lll'l': Junior lliglig Boston l'nivvrsil.y: N1'W'l0Ilil0. 21 Drama Club. Il, lg Math Club, S53 Com- uu-rvial Club, 3, 1. CK'l'l l lfll l N li llllClN li llll!Ul.N Y 223 xY1'lDSl1'l' SI... Vlvsl Nl-wlorl "7'l:,x' IIIIIIIFSI-VVS u Flllllfll' of llzkv Illl'l'f,.n ll1'm'1 Illlfll Jlllll' 26. 1007: Ch-rical 20'J'l': l'e-irwf lil'ZlllllIlilI'I S4-uior Play fTlllllIlllll1't', lg film- Club. 21 Com- lllf'l'l'lZll Llub. l. IS-Xlllil. l"l.Ulll'lfNClC llRlClxl'I'l"l' 2110 Mlburuslale- Nvv.. Nuburnllale' "So fI'I'I', so kind. xn upl, so lnffxxwrl ll 1ll'NIPllNlll.lIIl.H lliuky: Born lilvvr-uiln-r l. N083 llc-uvral IIC: Picrvv S4-lnool. Brook- lun-. .INNIC ULIX li HRIILHS ill llillninglon lid., Nc-wlouvillc "Sim has un ulnlrululwc' Qf pnlrr-l'.v." lloru July 30. IO0Tg G4-uc-ral lhllg Croslvy lligll: Spanish Club, 2g lilac Club, I-1 N1-wlonilv. lg S1-nior Play, -lg Drama Club, l. NIAH-l'Il.l,li l"liANCl'IS lililGIl'l'NIAN ITS l'arnu-nlvr Hd., VS est Newton 'Nha' r'unislu'.w Ihc frown from !'I'l'l'AV fm'l'. ' ' 'll-alflyg liorn Dvvmnluwr ll, 19083 Ste-nograplniv l00'l': Peirvf- Grammarg Couunf-rvial Club. 43 lixcvutive Com- niillm-, lx X ice--l'rcsidc-ul, 2, 33 Chair- man Civic- Board, 4. ww .X l ww' .W MAE l'fLIZAlll'ITlI BHOADY 1155 Walnut Sl.. Nvwlon lliglnlauxls "She's here, llwrv. and ezwry- 1l'h1'rv." Born July 31. 1008: Su-nographic l00'l': Mason Grammarg Commvr- 1-nal Llub, l. FHANCICS ClAl'l' HIKUUKS lo Ulf-nmorv 'l'4-r., Nvwl,on lliglllaufls nfl I7Il'l'l'-V lwurl IIlllkPlh ll l'lu'r'l'- ful rwunlcllum-r'." l'4-lv, llrooksyg llorn January lil. N083 Classix-al. 2 yrs., Sc-if-uliliu. 2 yrs.. IUC: SI.. .lolnusbury .M'aclc'rny2 fl0Illl1'1'll1'lIl1 Narsily llaslu-lball. Il, 1: Captain, lg Class llaskvlball Il. l. Captain. Il: 'l'c-nuis. 3. ll liuglisli Club. l: l"re'm'ln Club. li ivllllll Club. l: Nollc-y liall, IS, I-1 lNa-w- Louiau, I-. Hl'IORCl'I TIIUNIAS lillUl'llY ll Howe St., Auburmlale " ll hy u'orr4v?" l'al. Smiliu': lloru Juuu 5. N081 lluxim-ss lll'l': liurr Grammar: llasc- ball Squad. Zi: Football Squad, 3.41 Track, 1: Conuun-rvial Club. bl-1 Junior Y arsily llorlwy, Ii. IHICNIC BLANCIIE liR0llll,l,lC'l"l'l'I 40.1 llalvrtowu SL.. Nvwtouvillc 'NTIS yumlwill nmlevs inlaflli- fll'lN'l'.N Horn Junv lo. N083 Gvue-ral l6C: .luuior lligh: Drama Club, 33 Glue Club. lg Class llockcy, l. DUHUTI l Y Nl lil! liI'I"l' HHUW N ll Dicks-rman llcl., Newton lliglllamls "Tim yrrvzlcxl medicine is u lrnf' fI'il'Ill1.u Dol. Born Juuv 15. I908: Classi- cal HSC. llydu Grammar: Vlbeaton: Math Club. rl-3 Ffvlllfll Club, rl. CLASS AGN ES Ylillt JN ICA BCC Ii LICY 216 ISPIIPYUP St.. N1-xxtuxi "She nrude .vunslrine in lim shady plu f'1' Born SPIIIPIIIIDPI' l. l'-308: Cmn- mprciul 20U'I'g l'z1rlu-r Iirznnlnurg Cnrnlm-rx-iul Club. I. .lUSEl'IlINl'1 Ill CKI,EY 38 YY invlze-str-r Htl.. NPNXIUII " .X-l'l'1'l' lu.r11lfnr xpverlzf' Jo. Jm-y: Burn .lzuiuary 22. IOUU: Clzlssivzil HIC: Junior Iligliz Miss Gibbs' Sm-ra-lnriul: Class Ilcwke-y. l. 2. 3. 4: Xursity llm-levy. I: Frf-nvli Club. 4: Class llaisluftball. l: Class Baseball. 1. IIIiRBliIl'I' lil-INJANIIN BIDDING. J H. 1888 Cl0I1llIlUllV9f'lllIll A ve., Auburnflals- "I pmpuxf In uruuv if nul if il lakes ull rluuvf' Hclrb. Iiurl: Horn .-Xpril 20. 1006: Business III'I': Burr Grumrnar: Sullolk Law: Junior Xursity Iluvkf-y. I: Comnwrviul Club. 4. ICYELYN NIIIDHI-QD Bl'RI'JlCK 312 Lake! Ava, New ton Iliglllanrls "A gum! rnnrrudr. sleadfusl and rifppndrllllef' Bias: Born Fvbruziry 8. 1908: Gffnf-ral IIC: Ilyflv lirzunnmr: Class Xollr-y Hall. l: Xe-xxtnriitv-. lg Alpha Br-ta. I, 2: film' Club. 3. -1. XIARfilfIiHI'I'I'f ELISE Bl'RKl'I 63 flld Ifnglisli Hfl.. Chvsinut Ilill "Of IIIIIIIIIPFS genlleg qf u0'm'- lions mild." l'z-gr: llorn Fvbruary 8. F7083 Clussir-al l8C: Hanson firurnnmr: Ilnsmn 'llf-urlivrs' Collmm: Alplm Hvlzl. I. 2: Urvlwslru. l. 2. 3: Nlzllll Club. Il: Ifnplisli Club, Al: I"r0nc'ln Club. 3: Ilunor Roll. I. 2: Claw Yollvy Hull. 2. O? 1925 IN JIU VI'llY LIN IXGST1 IN 23 lluxx tlmrne- X BVHNI-1'l"l' wa. -Xuburnrlaulv "Tim rfvjv pink QI' In'1f8rll'nr1." Ilully: Ilurn Se-ptvnibpr lfi. lfltlilz . Y U. 4.luNsu':il Inf 1 llurr Hrzunlnur: Sini- nmns: I-'re-nvln livin. l. 2: Xlul libli Club. Il. l Xmxtulxits-. Il. l.lub, .,. I: Xlpln: .IUIIN NX ICA ll Eliot .Xu-.. XX . ., . , ,J - A- . . .... .p. . . Ll- ,I r: y lu 1. 1 N ION lil SXX l'Il.l, vsl Nvwlnll "BPiny1 lzillilrlrjfnrilrvl. hw 0llll'l1II.V 11. ' Buzz. Bully: IQUT: BllSlIl!'xS Huston I niw-rxi Nlalli Club. I: 'I'raf'k. 2. fl. liurn NHYPIIIIDPI' 41. s .x. lll'I2: Junior lliprlni 8' gig? ty: Ilfiilllll Club, l: Incluor :in4l Uulfluur I: Captain Inmluur 'I'ruvk, 13 Urnngv Iiouly Stull. -5, l. Nvxstmiitv. l. lll-ill llrl Alllf'lllllI'lP lic "F1'ieml lo ll Buxie-. liux: 19071 Clzlsxivul Inur: Dilfllllllllll NIAN Iil'XlSAl NI l.. Newtmlville mn u nd mn inex. " Burn Dvcffrnlmfer 2T. IHC: Mason Iiflilll' English Club, Il. l. .ui I'rvnvli Club. .53 I'ootball. I. .mt 'llravli Squad. l, 5. PAIYL Ifli.-XXCIS CANIl'lSl'fI,L 30 Onlilunal St., Xen lon " llff ix Prev' reudv f1r1du'1'Iliru1." Soup: llurn J unf? 29, 1907: Ilusif ' nvss lll'I': Big:-low flfiifllflliifl Iivul' lf-y's Svliunl uf Arvolintiiigt Clzns I-lmfbull. l. 2: Llziss Buss-lmll. I. 2 Cmnnwrviznl Clul .ll'I.l -X XXI 30 Ps-mbrokv Sl.. "Sim lu uyhx will: lmrf' llorn July IU, IUOT: Junior I li: Cmnnn-rc-izil Clu IT 1. I. N1-xxlull fmrl IIT all luuyllz lilllll: Sllxllflgfflllillll' li: Nliss XXII:-1-Im'k's: lr, 2. 1. 'I' -X CANT!-Ill 5- .fn 5- 5' .4 ina - ' 7 9- A' Q S THE NETWTQNHAN AN INA RICISIN A CARROLL 9 .Iona-s Ct., Newton "Thr lrmple' of our puresl llmuyhls is siIr'ru'P." -Xnnabs-llv. Topsy: Horn Dvva-lllbcr 20. l00T1 Ilousuholrl Arts lull, Uur l.amly'sg Nlass. tiunoral Ilospitalg llm-allh fflub, Il. ll-X R4 DLI! Iiklilxlill CARYICR 301 Lake' Avo.. INPVVIUII Ilighlanmls "Thr ul'yulm'nlx of IIN' Slronyvsl 'HIFI' lllll'll,VS llu' moxl ll'!'I.!Ihl.,' lu-vsp, lv-wpit-3 Horn Fvbruary 23, 10073 Classical IIC, Ilyrle Iirannnar, llrowng Football, l, 2, 3, -13 New- lonilo, l, 2, Ii, 53 Track Squad, I. 23 lfrvnch Club, Il, Spanish Club, 3, -lg linglish Club, ZZ, fi. 41 Math Club, 2, Ii. I-1 NIWYIUIIIZIII. 3: Words of Class llynln, 5. l'RtNI0l'IU IIASTOR IIT Crystal SL., Nc-wlon II:-ntrc: "hilly:-1:l,julI.v, lllIlIll'lIl'Ilt'I1.u Rorn ID:-velnlwr 30, 1000, Classiral IOC: San Antonio Iligh. Nl IRIAM fZA'l'lIl'IRON T9 IQIIIIUFIE St.. lNewton Ifvntre "ll lwn her deli:-ulc frvl fn Ihr' rlunrc lrrinlcll' ruzlrlllf' Nl:-nm, Mini: liorn August 9, 10092 tflassival lfltlg Beverly Ilighg Smith: Drama Iilub, Ii, -1-1 Frvnczlu Club, I: IZIIQJIISII Llub, -lg Math Llub, .L 4, Drama Club l'lay. l. l'l'IRlN.N NIAINiAlII'f'I' CAN ALLO 5-1 Uak Ave., XV-st N-wmn " Young girls will lm young girls." l'lupf'na3 Ilorn April 212, 10085 Slvuographif' l00Tg Ikeirro Iirannnarg ll0IllIllCI'I'l!ll Club, 4. ICILEEN VIRGINIA CAVANAUGII 268 Nvwtonville AVP., lNvwtonvillC "Tried and lru0." Iii: Rorn July 25, N081 Slvn- ograpliic IOQT: Junior Ilighg Corn- mvrvial Club. -1: Constitutional Con- vention, 3, Sf'IllUI' Play Connnittcv. I. IIONV,-XRD RISIIUI' CIIAIDWICK 58 Oak St.. Newton l'ppcr Falls "A good lzurdf and cz greul purdf' Chick, Chad: Rorn March 31, 10083 Scicntilic 1-IC, Enwrson Grammar: Wcsla-yang Honor Roll, 2, 3, Math Club, 12: French Club, 2: English Club. 4, 55 Newtonite, 4, SQ Execu- tive fYiUIIlIIlIttPC. 53 Legislature, 5, Civic' Board. 5: Ilasf-ball Nlanager, 4: lfditor-in-r'luivl' lNf'wt,onian, 55 Musiv ol' Class Ilynm. 5. ANIIHLINE ICLIZABETII CIIAPMAN 208 VYooclwarcl SL., Yvabau Hllluxic is Ihr universe of lhc soul." Betty, Born Novvrnbvr 18, I908g Gent-ral l IC: Ilyde Uranunarg Yvspvr He-orgv Svhoolg Urvhcstra, l, 23 Legis- laturv, -I: IYIFQIIIIZI Club, 3, Al. lNlAlUi:KlII'I'I' SIIICPARD CIIAPMATN 36 Bc-aumont Ava-., lNf'vxtonville "Ship A ,III-V',:l'Il'Ill1S.'l' Billy, Born January 15, 1909, Ga-ncral 24C: Walnut Ilillg Swf-ct Ilriarg llath Club. 1. IQLIDRIINDIC IIICIYUINIC ll20 Reacon St., Nexxton Ilighlands "Rosy rherkx und dimples." Al, Born April lh, 10071 Yocational AT, llynlc Grannnarg Class Rasa-ball, l, 2. 3: Class llovkvy, 2. 3: Class Relay, -I, .Iunior Varsity llovkvy. 3. I. QT? 2.1.9226 , . 1111ttumummm:wwww1w1u111mrwnnunmu.,uwuuuww,wmwwmwu ELEANOR HAPGOOD CLARK 38 Allerton Rd., Newton Highlands "Ari, fell me where lo draw lhe line." Clarkie: Born August 29. 1908: Classical 19C: Hyde Grammar: Skid- more: French Club, 4: Honor Roll. 1. ARTHUR HERBERT CLARKE 300 Centre St., Newton "As quiel as 0 mouse and us wise as un owl." Archie, Clarky: Born June 19, 1909: Scientific 19C: Bigelow Gram- mar: French Club. 4: Nlath Club, -l: Spanish Club, 3: Honor Roll, 1, 2, 3. ROBERT HARNETT CLEMENT 8 Cedar St., Newton Centre "A merryv fellow-consequerztly good l'Olll1llllIj' . ' ' Bob: Born December 17, 1909: Classical l9C: Cambridge High: Yale: Legislature. 3, 4-: Orchestra, 3: Newtonite, 3. 4: English Club, -1: 1Vlat.h Club. 4. ELEANOH IWAHGARET CLoUGII T5 Auburn St., Auburndale "Er1rnesl purpose shown on her Sll'PFlfllI'6,n Jimmie: Born June 29, 1908: Stenographic 109T: Peirce Grammar: Newtonite, 1. FRANKLIN MINEH COBLEIGH 60 Forest St., Newton Highlands "Tn knou' how lo hide one's ubilily is greal skill." Frank: llorn Marvh 11, 1908: Scientilie ll-C: Hyde Grammar: Colby: lntermerliate Football, 5. :wumrauumlwmmmuufm-.,,:,,,m:uumw:vw.u"fum , W. www, ,W ,won ELMEH JAMES COCHRANE 239 Webster SL., YVest. Newton "My days pass pleasanlly away." Al: Born July 4. 1908: Classical 19C: Peirce Grammar. Boston Col- lege: Junior Varsity Football, 5. ELEANOR MACKENZIE COLEMAN 252 Islington Rd., Auburnrlale "A smile for all, 11 greeling glad." El: Born February 18, 1908: Gen- eral 16Cg Burr Grammar. SHERMAN HOWARD COLEMAN 163 Pearl St., Newton " N!l1IIl'P fllI'IIiSlIl'S nll lhe noble- men we hlll'6.U Truck: Born June 30, 1908: Busi- ness 111T: Junior High: Boston University: Class Football, 2: Com- mereial Club. 4: Legislature, 3. WILLIAM GORDON COLGAN 338 Lake Ave., Newton Highlands HA man fu' purpose." Bill: Born January 12, 1909: Scienlilie 16C: Hunkle Grammar: M. l. T.: Math Club, 4: Football Squad, 3. JAMES BYERS COLTON, ZZND 1150 VYalnul St., Newton llighlands Ulflllfjflljl is un url lhnljru' m'q11irf'." Jimmy, Bias: Born September 9, 1908: Classical 18C: llyrlc Grammar: Harvard: Class Track, 1, 2: Drama Club. 3, 4: Newlonitu, 3: Newtonian, 4: Senior Play. l: Xarsily Track. -1: Drama Club Play. 1: tiles- Club, 2, Il, fl. w 1 1 9 TT-IE ZNTEYWTDNHATN JAAHCS FURIXICS CUNNIFF 51 llriclgvs Ave.. Newtonville "Il is fini' I0 have fl girml's SII'l'Ilfll,1.1' Jim. Hrulc-3 liorn Fvbruary 11, 1008: Srie-nlilif' IIC: Junior 11ig:h: TN:-xx' lfngzlancl Cons:-rxalory: Spanish Club, 1: lncloor 'l'r:wk. Zi, -13 Gut- alour 'l'ra4-k, 2. 31. 'lg Captain, Al. 01.11 li C1'1AVl'131 12 Dc-Nh-r lid., Nvwlonvillo U11lll'il',.V'S flu' l'I'l"V xpiz-0 of ll-ff. l'ul1'g Horn Ge-tobvr 210, 10083 Classiral 18C: Junior Ilighg Wbllvs- lvy: Nlath Club, 21. -l-: English Club. 41 Fr:-mrln Club. l: 1NvwtoniI4-. 21, ll: Class Yollvy llall, 111 llonor lioll, 2. CHARLES EDYYIN CRAXYFUIIU 18 Copley Sl.. Nvwton "Zu1u1fls.' zrlml fl mun fill' sprfmliny laughs," Charlie: Horn April 21, 10095 Classival IQC: Bigvlmv Grammar: Darlmouth: Oulrloor Travk. lr: llonor Roll. l. 2. NIAHY YEINJNICA C110UG1l 10 111-:nick TN.. Nowlon ufil'lll'f' IIVIN in ull luv' slrpsf' liuclrlieg Born January 18. 19075 Clc-rival 209T: Bigelow Grammar: Connnvrcial Club. -1. OLIVE GERTRUDE CURTICE 83 Kaposia St., Auburndalc "Qu1'vl fIlIllll'S!.V 1UII1l'Il mos! ln'- mrnes ll uvnnmn." Born April 20, 1908, Slonographio l00'l'g Burr Grammar: Commercial Club, 11, 4. .vwwwzwuww',,www'iiii,, ww uv ww,,fwuw:1mmumwww-iiww, mum www EDITII STICKNEY CURTISS 599 Centre Sl., Nowlon "ll'hf1I curclll she for lwurls whfn onre pn.v.vr'.vsPd."' Tvvnicg Born April 17, 1907: Gvneral l6C1 Bigelow Grammar: Chilclr0n's Hospital: Glas- Club, l. GERTHUDE JORDAN DAY IS 2005 Commonwvalth Ave.. Auburnclalu 'AA rrl4u'1lr'n r11'l'1'r lzofrlf' Dave-, Davin: Born June 18, 1007: Classival 10C3 Burr Grammar: Wlwa- lon: Fri-nch Club, 3, flag Drama Club, 11, -1-Q l,ibrary"Club. 43 Honor Holl. I, 2. SAYILLH HUGHES DAN IS Al-T W indsor Hd., Xvaban ul1',1Hlll silrvrkv langue he lmlhf' Davvg Born April 5, 19003 Classi- Cal 18C3 Angier Grammar: Ylzillianisz Newlonite, 33 Nlanaging Edilor, Al: Alpha Bala. 1, 2: Englisln Club. 21. '11 1N'lathCluh, 3: Prize Speaking, 2, 31, 1. NYILLIAM NASH DANIS 12 Simpson Ter., Nvwtonville M H0 who ix u ffl-Pllll, UIIIVI-VS has lllllllbl' fl'if'nds." Bill. Born January 3, 10083 Scientific HC: Kimball Grammar: Tuflsg Honor Roll, 1: Constitutional Convention, 3: Legislature, 3: Alpha Beta, 1: Glva Club. 2. MYRTLE DOROTHEA DANCKERT 29 Fayolff' St., Nvwtou Myrtg Born February 16, 1909: General I6C: Junior High: Framing- ham Normal, English Club, 3. FLORENCE MARGARET DANGELO 11 Murphy Ct., Newton " Her smile and lovable ways are l'0IIf!I!Il'llllS.u Flo: Born August 20, 1908: Stcno- graphic I09T: Junior High. KATHLEEN DOIIERTY 104 Austin St., Nt-wtonville "lWodc'sl,v has more charms lhun ,7?lIUI.V.,' Bob: Born April ll, 1007: General HJC: Bigelow Grammar, Boston School of Physical Education: Eng- lish Club 2. MARGARET PATRICIA DOIION EY 14' Henshaw St.. West Newton "ll'i1houf her, where is the yung?" Peggie. Peg: Born March 5, 19093 Stenographic l09T: Peirce Grammar: Framingham Normal: English Club, 3, 4: Commercial Club, 4. EMILY EMERSON DOLBIER 20 Jefferson St.. Newton "She hull: a natural, wise SillI'8I'II-V.U Born August 30. 19073 Special 27Cg Bigelow Grammar. CATHERINE LOUISE DONAHUE T9 Oak Ave., W'ost Newton "She is always as merry as her 1'o1'r'e. " Kay: Born July 19, 1907: Clerical 209T: Peirce Grammar: Senior Play Committee: Glee Club, 2, 3: Decla- mation, 2: Commercial Club, 4. JAMES THOMAS DONNELLY 33 Crescent St., West Newton "A jl00dfI'I.f'lld lo eiveryvonef' Jimmy: Born October 23, 1908- Business 111T: Burr Grammar: Boston University: Class Football 1, 2, 3: Class Baseball, 1, ZZ, 3: Com- mercial Club, -L. ANNA ELIZABETH DONUN AN 36 Oakland St., Newton ".-1 core-blue Il'tll6?l'it1l'lIl171f'lf -11'l11'spPr1'nq pines." Dunnie, Born October 6, 1007: Stenographic 109T3 Bigelow Crani- mar. DOROTHY ELIZABETH DOVV 49 Prairie Ave., Auburndale "Hinges of lrue fl'I-6lIdShliIJ ne'er gn ruslyf' Born September 18. 1905: Clerical 20912 Junior High: Commercial Club, 4. MARY ELIZABETH DUANE 216 River St.. West Newton "CheerQfulness is a hubilf' May: Born January Il, 1900: General 1-IC: Peirce Grammar: Boston University: Class Basket,- hall, 1, 2, 3: Varsity Basketball, Il: Math Club, 3: Spanish Club, 3' Club Hockey, 1. EDWIN JOSEPH D UC AY ET 300 Linwood Ave., Newtonville "Lei feminine wifes lead Ihuc not aslrayvf' Duke, Eddie: Born May Itl. 1908: Scicntilic I6C: Junior High: M. I. T.: Math Club, 2, 3, 4: Assistant Mana- ger Baseball, 3: Senior Play Com- mittee, 4. Q y Q1 3- 'TT os. THE NEWTQNHAN wi' w 1 ww www wwwww, wwwwww w,ww'w,,Wwwww: www NYILLIAM HENRY DIYGAN I9 Pennsylvania Ave., Newton Upper Falls "As he llzinkclh in his hmrl xo is hc." liill: lioru Allglllhll 27. 10071 Classi- cal IQC: lime-rson Grammar. lloly Cross: Football, 2. 3. WAIIJUHY CAIHINCHUSS Dl1'l'llll'I 3 lliplvy Sl., Nc-wlon Centre "Tim nulurr' of ll'0lIlt'Il is r'loxr'l'v nlliml In url." llorn Svptc-nxlivr -l. H1081 Classical l9C: llolmvs Grammar: VH-lleslcy: Frvurh Club. 3: lfuglish Club. l: lNvwstouitc-, l. RICHARD .lUSlil'll l'lAlll.Y I0 Fore-st St.. IXL-wton llighlamls " llc who is mr-ly is mww' lalcf' Dick: Born January 19, 10001 Classical l8C: llycle Grammar: Boston llniversityz Math Club, 3: French Club, 33 Newtonian, 4. l',l'IR'l'llA AMICLIA ICISNUR 1,10 Mount lvrnou St., Ncwlonwillc "fl plmsuril rfirl will: ll pleuxunl sn1ll1'." Born August 23. H1062 Sr-ieutilic NIC: .luuior lligh: Normal: French Club. -1-. HELEN BARBARA IQIAX ELL 33 Brewster lid., lNewtou Highlands "Ol slulvly lmuuly, -w'l nalurully lIlPl'I'.V.u Born September 26, 1008: Classi- cal 2-lC: llyde Grammar: Simmons: Math Club, 3: French Club, 3, 4: Newtonite, 3, 4: Orange Book, 3: Glce Club, 43 Class Basketball, 4. ,wwwwwwfwwwuwuww wwvwwwwww-wwwwwrwww.11wt11witw1w,1w1it1wwiwwwwwtiwwi, ANNA MARIE ERICSSON 28 Austin St., Newtonville "A nmidcn should ln' mild unrl rnefkf' Lie-f. Ann: Born Juni- Ill. 1908: Ste-nog:raphiv l09'l'g Bigelow Gram- mar. MILDH ICD IR ICN li ESCIll'll,B.M'TlI 1 107 Vliashington St., Vlvcst Nr-wton " ll il is Ihr' sal! rJc'Ul1l'!'r'x11l1'or:." Millie: Born .lauuary 23. 1900, Clerical 200'l': llledford Ilighg Com- mercial Club. sl. KATIIEHINE lVllLDlll'fD FAlll'Ili'l'Y 1670 Centre St.. Newton llighlaufls "As fair und sweel as Ihc sun lhul shines." Dimples. lllonclie: llorn February l-1, l90T1 Clerical 200'l', llydv Gram- mar: Couuncrvial Club. 11. NIILDIUCD NATALIE FAHEY 2073 Commonwealth Ave., Auburntlale "Slip l1l'l!IlIlPIlS fwery ylomny spol." Nlilo: Born July 9. l908: Steno- graphic l09T: Burr Grammar: Senior Play. Al: Commercial Club, -li. ll A ll BA ll A B UR N RTT FA H N U Nl I0 Prospect Ter., Newtonville "llt'r sl1'nd1'1' nose lip-lilled like fl-fllIll'l'l'lS pelnlf' Barbie: Born February 9, 1909: Classical 18C: Junior High: Wiheaton: Honor Holl, 2: Constitutional Con- vention. 3: Girls' Athletic Board. 4: Newtonile, 3: Class Basketball. 3, il-3 Varsity Basketball, 4: Manager, 43 English Club, 3, 4: French Club. 3, 4: Library Club. 4: Math Club. 4-g Orange Book, 3: Executive Council, -1-. .,1mwwwwwmi lu m - rw v ,.yw::::u..,uww wmrvw-wwillwuwpwwwwuuwuuuwu JOHN VVIIITE FELLOWS 34 Playstead Rd., Newton "The will lo do, Ihr' soul lo dare." Johnny. Jack: Born June 20, 1009: Classical 18Cg Bigelow Grammar: llarvard: English Club, 3, -11: Drama Club, -lg Newtonite. 3: Senior Play. 4: Math Club, 31 Latin Club. 4-1 Alpha Beta. 1. 2. JULIA FICOLA 230 Hunnewell Ter., Newton "Su'ecl is every snunrl-.wreeler llly valve." Julio, Julie: Born September 28, 1007: General 14C: Bigelow Gram- mar: Leslie Kindergarten: Spanish Club, 3, 41 English Club, 3, 43 Honor Roll, 3. RALPII SYLYI-ISTA FEOLA 59 Richardson St., Newton "Oh, lhis learning. wha! ll lhing il is." Born February 5, 1908: Scientific l6C: Bigelow Grammar: M. I. T., Outdoor Track, 3. 441 Class Relay, 4. RICHARD FINEHTY 22 Agawam Rd., VVaban "A man Qf lhe open fields." Dick. Michael: Born August 26, 1907: Vocational AT: Jamaica Plain High: M. A. C.: Agriculture Club, 4-g Secretary-Treasurer, 4. WILLIAM MILES FLIETCHFIR 30 Plymouth Hd., Newton "S1'lenl and unassuming he has been." Bill, Fletch, Born August 7, 1908: Classical l8C: Hyde Grammar: Dartmouth, Math Club, 3, 4: Hockey Squad, 45 French Club, 3. mum,-rw ww' -u4wumw 1 , M l CHARLES FREDERICK FLINT 289 Highland Ave., VVest Newton "Silence needs nu exercise." Charlie, Born November 29, 1908: Classical 19C: Peirce Grammar: NI. I. T., Math Club, ll, 5: llonor Boll, 1, Senior Play Committee, 1: Manager Junior Varsity Football. fl-. JUSICPII LYNN l+'URES'l'AI.L 208 Auburn St.. Aubururlale "Speed: is qreulj bul SI-l6IlCF is yl'e1llr'l'." Joe: Born January el. 1908: Classi- Cal 18C1 Burr Grammar, llarvardg Football Squad, Sl, Football. 4. MARGAIKFYI' IDA FORKNALL 286 Melrose St.. Auburndale "Th-v rnode.wl.v's II candle lo Ihy merilf' Peggy, Born September 23, 19083 Classical 18C: Burr Grammar, Boston University, French Club, 3, 4: Math Club, 44: Library Club, 4, English Club, 43 Newtonite, 33 Class Basketball, 3, 4: Varsity Basket- ball. 4, Class Volley Ball, 3. LI LLIA N ELEANOH FR EICM A N 45 Cheswick Rd., Auburndale "Shui up in measureless conlenlf' Lilg Born April 8, 1908: Classical 18C: Parlen Grammar: Wellesley: Alpha Beta, 1, 2: English Club. -ll, French Club. 3. Al: Latin Club, 31 Library Club, 4, Newtonite 3, -ll: Honor lloll, 1, 2, 3, -l. EM I LY MA E FROST 152 East Side Parkway, Newton H Never lzaughlvv, never proud, popular in every crowd." Em: Born November 12, 10063 Stenographic l09'l'g Junior llighg Boston University, Commercial Club, 4, Drama Club, 2. ,l 23 NEWVLTQNEAN INICZ ICl,lZAlilC'l'lI FUSI 201 Linwoml A wx, INPWIUIIVIIII' "Zruluus, ,vrl llllllIl'NI.u Sin-vm-1 Ilnru Us-tolwr 30, IQO8: Sli-nugrrapliic' l00'I': Burr Grammar: Boston INurmal: Drama Club. I: linglish Club, -li: Commvrvial Club. I: Dynamo. I: lXl'W'l0llll4,'. 2: IIFZIIIQIP Hunk. ZS: Drama Club Play. I. INl,NI.CUl.Yl I'Il.NY fl.Nl.lnXGlll'Ill 202 Crafls Sl., NHNYIUIIXIIIQ' ".'1l:ru.v.s s1lnnAv." Mali llnru Nawornln-r III. IUUS: Classival IHC: lhuw-lwslvi' lliulxz Ililfllllllllllll IN4'VNlUIlll1', li: 'l'r:u-k. 2. II. I: Caplaiu Uutrluur 'l'rac'ls, I. INICISUN Vl l'ISl.l'IY lSAl.I,.-Villlili IfrT Ilummwvll Avo., N1-wlun " ,I lurwr uf Ihr' ou!-of-n'1mrs." Nvllz llurn Uvlubvr Il, I005: Classir val IQCQ lliga-lam Grammar: Nnrlll- I'2iSll'l'llI Nlalll Club. Il: Ulm' Club. 5. ANINA I'Il,I,l'IIX fl.-NIA IN 576 Hrnw' Sl., INPNYIUII lmwvr Falls Ulqllllll' suv S,lI'.S llIll'l'l. llllf U Iiuru Fc-bruary 20. IU08: Slvnu- grapluir Ill9'l': llyrlc- Grammar. ICINX :NIIIY IHIISINSUN IIN Nl NIUNS I9 Mvlrusv Kun. Allllllfllilllll' "In Nlll'll u solrnrn 1:-fly." lid, Iifldivg Horn January 28, 19081 llusinvss I I IT, Burr Grammar: INUI'llll'IlSIl'l'llQ Commvrcial Club, I1 'l'rv:asurvr. I: Class Ilasvball. I. 2: IDI-vlamaliun. 23 Class I"uolbalI.2, H. ...I mm. .U ...ww ii. Ii H. ,wi JOHN WENTWORTII GARDNER 213 Ilunnf-well Ter.. Nc-wton "U silence u'1'rv galflrn, lu' would be ri1'h." Ilorn NIHFPII I2. I008g Svivnlilic l6C: Bigelow Grammar. M. I. 'I'.: Alpha Bvta. I. 2: Ifuglisln Club. -I. IIAIIIU JICROME GlANI"l'IHAN'l'I'I Zlfll Clwrry Sl.. NN 1-st Ncwlnn "Tlw flI'l'!'llSIl'llI'd lmlh fl qrpu' l"IfIl'III.u .lvmyz Burn July 2l. H1083 Ilusi- nvss lll'I': I'f'ir4'v Grammar: Hull. 3. lg Laplam. It Colnlm-rs-lal Club, 'I-1 Prize Spf-akiug. 2. YIIIGINIA HILIKICRT ISO6 Cvntrc- St., Nvwlou lligrlilamls "1 loud humor is wil und rumnmn xmzse I'0IIlhllIIf'll.H Gin. Ginuiv: llorn June' 8, F7081 Classival 2 IC: lie-vvrly lliprllz Sim- mons: Drama Club. 5: l"r1'nr'Il Club. 5: Ill:-1-Club, 3. I. 5. .IUSICPII ICIHNAIIID GILI, SI Nllarvvivk lld., VM-sl N1-wlon "lip Iukrlh num! flvlirlhl in IlIl1SIil'.u .lmzg Burn April 25. N001 Classival IOC: l'r'irr-me Grammar: Ilusluu Col- lvgv: Iiuglish Club. 3: Ilaml. I: llunur Hull. I. 2. 3, I: Urvllvstru. I. CNIIMICN flII.l.II'f 2tl0r1-harml St.. IN1'xxIun " ll 0 ull xhull 1-zvrwrnfmr' her." Camivz Horn Junv 22. l00T3 Com- lllf'l'l'I11I I09'I': Scum-rvillc lligrlig Fivld llm-key, -lg Cmmncrvial Club, flu: I"rc-nvll Club. -I. I M: 'ww .1 .- i,ww,,m,u- 1, Nw .ivww..nmimwuww -1 tw uw www'-ww -'11 THOMAS WILLIAM til LLIGAN 101 Madison Ave.. N4-wtonville "A sound mind in u sound body." '1'om, Tommy: Born January 6, 1007: Classival 16C: lloravf- Mann Grammar: Yalv: Junior Varsity Football, 2: Ncwlonite, 3: Football. 2, 3, 4, 5: Captain, 5: llovkvy. 4. 5: Baseball, 2. 3. 1. 5: Travk. 5: Athlvtit' Committee. 5. JO11N JOSEP11 CLYNN 32 Taft AVP.. NM-st N4-wton UASUIINIIII rrulcrs run alwfpf' Darby: Born Sf-ptmnlwr 9. 1908: tlvnvral 10C: l'Pirc'v Grammar: Boston Univa-rsity: Prizv Spvakiugz, 1. 2: Class Baseball, 1. DOROTHY LOUISE GODDAHD 15-li Lincoln St., Newton llighlantls "l'1'm'ds, words!" Dot: Born August 12. 19073 Classical 19C: Hydv Grammar: VY:-llvslvyg Newtonite. 3. 1: Feature Editor. 4: Drama Club. l-: Senior Play. 4: Baskvtball, 1, ALICE ELIZABIQTH GOODNONV 270 Waban Ave.. VVaban "A lruf' pal and -fll'l.t'lld lo t"l'I'V',VUIIF.N Al: Born 1V1arc'h 16, 1906: Cnneral 16C1 Ilopfidalv High: Milford 110s- pital: Class Vice-President, ZZ: New- tonitu. 2, 3: 1'1calt.h Club, Il. 4: Vice- Prtfsitlenl. 3, ll-1 llomff l":K'UIlOII1lf'S Club, 4: Glev Club. 1: liwvutive Committee. 4: St-nior Play Com- lll11il0l'. DOROTHY GORDON 38 Balcarre-S Bd.. VM-st Newton " IIN' eyes ll'!'l'l' large and dark." Dot: Born S1-ptcrlilwr I, 1907: Classical IQC: Nortlllielcl Svminary: Wheaton: Clm: Club. 5: French Club, S: Spanish Club. 4, 5: linglish Club, 51 Class Baslu-tball, 5: llonor Roll. 5. LOUISE NIAY HONYICLL 519 Crafts St.. Vlrvst Nvwton " Happy as u rlum nl high lirlpf' Swvf-t Atlvlinv, Sww-tg Born Sop- tvmbvr 17. 1908: flvnvral l6C: .lunior High: Boston llniw-rsity: H109 Club. -1-: Class Bast-ball. 2. l1OBl'IB'l' CIINBLICS GRANT. JR. T21 xNlZlSlllIIg1lOIl St., Newtonxillv i'Bel:old.' ll mam for all im- purlunl 1l4'luils." Bell. Bob: Born August 21, 10091 Businvss 11l'l': Brighton lligli: Boston llnivvrsityz Outdoor Travk. 213 English Club, 3. -1-1 Commcfrvial Club. 3, fl: Drama Club. 3, 1: Trvasure-r. 21: 1'rf?sirle-nt, 4-1 Drama Club Play, Il. 4, Dynamo. 2: Prize Spcaking. 2: Svnior Play. -1. WILLIAM JACKSON GRANT 22 Ardmore Bd., Vlbst Newton " Now me and llze Prinre Qf l1'ulf's." Bill, Ht-al: Born January 10. 1008: Scientific IBC: 1Nlason Grammar: Boston University: Junior Varsity Football, 3, -L, Track 2. Il: Math Club. 3. 4. ETHEL '1'1101N'1AS1N E GBHAN EY 40 Old Colony Rd., Clwstmit. Hill "1llhul is uiorlh doing ul all is 'wnrlh Illllillfl well." Creanie: Born October 8. 1008: Classical 18C1 Russell: Whvalon: Alpha Beta, l, 25 Student. Counvil. 1: English Club, 443 Fre-url: Club. -1. IIILDA COATS t11lliANl'IS 12516 Centre St., Newton Cvutrc nl,01'Pll jbr' her f1l'l1Ht' ll'llLVS.U Jingles: Born Marvh 1. 10085 Commercial 1091: Junior High: Commercial Club. 1. Dv by lt: 3 . f 1 rx AQ: 1 -J: ,qu ia' 49.1 x TZEIE NETWT NEAN IIUPIC GREGORY f3TT Walnut St., Newtonville "Hal Hope, Um chnrnicr, lin- qervd slill b1'hIml." Born April 2, 1908: Classical l8C: Choate: Leland Powers: Math Club, Zig lfnglish Club.-IA: Latin Club, 41 N4-xxlonian, -lg Senior Play Commit- lvv, 4. IN IRIS MARY GRIFFITH 56 lfldredge St., Newton "Cond spnrlsnuuiship her aim: populurily her rrouvrzf' Dolly, Dot: llorn March T, 19083 Classical If yrs., General, 2 yrs., HC: Fair llaven Grammar: Sargent: lfnglish Club. Il, 4: French Club, I: Class Nollvy Ball. 2. 3, Class llovlu-y, lg llollor Roll, 1. NI A RY IiS'l'l'lLLN IIADLICY Ol Nlashington Pk., Newtonvillc "Prim-ul lens! in lhe play." Xlollyg Horn July 28. 1007g Com- im-rvial lll9T: l'rovidencv Com- mercial lligh: Commercial Club, -lf, Senior Play. 'I-3 Drama Club, 4. ALNIA I,7UlIU'l'llY IIA FFl'IIlNll'IIIL 202 Langley lltl., Newton Centre "'Ta'ux nulural lo please." Al: llorn lNovember 29, 1908: G4-nt-ral loffg Mason Grammar, Simmons, llomn livonomics Club, 4. Nl ILLIANI VERNON CROCKER lIAI,I. 0 -19 Auburn St , Auburndale "Thr rare is lo ilu' x1uLl'l." Asa, Snatch: Born March 13, IQNIT, Business 11l'l'g Burr Gram- mar: Dartmouth, Class Secretary, I-1 Class Football, 1, 2, Class Base- ball. 1, 23 Varsity Football, 3, 4, Glct- Club. 23 Executive Council, 43 Math Club, 3, 4-5 Commercial Club, 4. MERRILL MILLS HAMMOND. JR. 133 Eastbourne Rd., Newton Centre "There is hope in you." lVlal: Born September 1, 19063 Classical l yr., Scivntilic 2 yrs.. General 2 yrs., 2 I-C, liclward Devotion Grammar, Babson Institute: Swim- ming Team. 1. 2, 3, 4, 51 Newtonite, Ig Student Council, 4: Orchestra, 53 Senior Play, 5, Drama Club, 4, 5. MARY CLAIRE IIAIUN ICY 42 Charlesbank Rd., Newton "Inrlu.wlr,v niulrcx all U11-HHS C'4IS,V.n Mitzie, Born January I, I008: Clerical 20913 Bigelow Grannnar: Commercial Club, 4. PIIYLLIS ICLORA HARRI NGTON 53 Court St., New tonville ".,1xfuir us her hair." Phil: liorn August 18, 19083 General IOCL Junior lligh, Simmons: Library Club, 41 French Club. Il, ll: Constitutional Convention, 3, Social Committee, L. l'iLl'lANORE IIARTEL 2T-l Otis St., West Newton 'Ullwuyvx a helping lmnfl and urilliny Ima:-I." Urnit-3 Born September 2, 1907, General 1bC, Peirce Grammar, Skidmore, Yolley Ball, lg Math Club, II, lt, 5. ISAIJORE HATCH 83 Forest St., Newton lrlighlands "ul look and u smile for all." Izzy, Horn Nlay 21, 1909, Classical 18Cg llyde Grammar: Wbllesleyg Math Club, 2, 4, French Club, 4, lNewtonite, 4. t1tt,,11,1111., 1 11111 11111, 11 1 111111111111 1-1,1 1: , 1 NELSON ALFRED HART 23 Columbus Pl.. Vest Newton "The wise mul arlire conquer dwir'11llie.v." September 3. 1008: Business 1I'l': Peirce Grammar. FRAINCES HAYES IIT Beaumont. Ave., Newtonville " Here, lhere. r'1'e1'y11'lwl'e. dum'- irzgl. f7l'llIIl'l-Nfl. xunbeum fair." Fran: Born July 18. 1007: Steno- graphie 100Tg Cony High. DOROTHY EM MA IIAZEN 946 Boylston St., Newton Highlands "She makes xweel n1usi1'." Husky. Dot: Born July 5, 1008: Classical II yrs., General 2 yrs,. 22'tCg Hyde Grammar: Boston School ol' Physieal Edueation: Drama Club. 53 Orchestra. 5: Drama Club Play, 5. JAMES LAIDLAW IIEGGIE T8 NYarwiek Rd.. Vliest. Newton "Tur'l and lulenl make ll slrong team." Jim: Born August 21, 10081 General HC: Somerville Junior High: Boston University: Honor Roll, 2: Newtonite. 3. 11: Editor-in-chief. 'll Orchestra, 2, 3. -11: English Club. fl. RETA ALICE IIEMENWAY 510 VVaterLown St., Newtonville "A light hcurl Iirex long." Pete, Red: Born November I, 1008: Classieal l8Cg .lunior High: Simmons: Alpha Beta,2: Newtonite, 3. 4: Legislature. 31 English Club, 11: Glee Club. 4: Senior Play Committee. MELBOURNE NYALDRUN IIEMEUN 108 Concord St.. Newton Lower Falls "A fellow of lillfllllilf' jeslf' Mel, Hem: Born November 8, 1007: Seientilie IIC: llamilton Grani- mar: llarvardg Football. 2. 3. -1. lXlARtiAlll'I'l' HENRY 86 Nonantum Sl.. Newton uigiillll' urlixlx lll'I' gunrl: olhrrs I'.l'l'f'l.. 1 Peggy. Peg: Born Alareh 22, 10003 Classieal IHC: Bigelow Grammar: Wiellesleyz Alpha Beta. l. 21 Math Club. 4: lfnglish Club. -lg l"ren4'h Club. -11: Irjfillllii Club, 4: Latin Club. 1: Newtonite, 3: Newtonian. l: Honor Roll, 1. 2. CATIIERIN E AGN IGS IIESSION 1,1 llighland Pk.. lNewt.onville "Nui f7Illl'l1 Iulkg fl gfrml .vzrvrl xil1'llr'e. Y 1 Kay: Born May EI, 10063 Com- mereial 2001: Junior High: Com- mercial Club, L ESTIIER ANN IIIGGI NS 21 Parker Ter., Newton Centre "Be merry if you ure wise." Iliggie: Born April I, 1007: Stenogzraphic 109T: Mason Grain- mar: Senior Play, 4: Drama Cluh. 4-2 Commercial Club, Ol, HENRY IIILLSUN 6211 Walnut. St.. Newtonville " Ile ulluins greul ,ll'l.!llllS.u Slreteh: Born September 12, l00tlg Classieal SIC: Boston l'ing:lish llig:h: Dartmouth, Drama Club, 5: Senior Play 5. vat ,- ..1.. l. .1 fa 'M E I 33531 1'- THE NETWT LUIIISIC MARY IIINICS T0 IXIIIIIPIIIPL Rd.. Newton Centre "ll4'nll1' of spam-li, ,Il'IIlffIl'l.l'lll QI' IIIIIIILU Lu: Horn Srfptvlnln-r 11, l908g tlvnvral 2lC1 NN ellffslvy High. l70ll0'l'IlY lIlNCIxS IT Cross St.. Wvst N1-uton "fl happy ,lI'lll'l lms lnunlv fr I-l'llllS, " Dol: Born Us-tobvr Il. 100153 Cen- 4-ral 2flC: I'eirm-v Grannnar: Miss Wilweloc-k's: lmgislaturv, Il. GUY CUNS'I'AN'I' lltJ1.1iRO0K,JR. I0l Waltham St.. NVest Newton "Tim filllll' lhul ll lllllll wins h irnwl I' ix lmsl . " lied. Jockog Horn January 21, l90T: Classiral IQCQ Horace Mann hrammar: llarvaral: Baseball 2, 3, I. 3: Captain. ll: Football. 3. 5: llovlwy. 2. fl, ll. 5: Captain. 5: Ilonor lioll. ll-: Class Kira--l'rcsiclvnt, 5: Stuclvnt Council. 2. 3: Chairman Atlllvlit' Commiltvv. 5: I':u'Clitivf' Counvil. 5. IIl'll1lil'Il1'l' 01.01" ll0I,MS'l'l1ANlb IT Cyprvss St.. Newton Cc-ntrv " Ill' xloppml lo lil'lll1Pl'lIll'.u Happy. Ilvrbivg liorn INUVPIIIIDPI' T. 10081 liusinvss lll'l': Nlason Gram- mar: Boston llniu-rsityl liusinu-ss Nlanagflr Nvwlonitv, 1: llusini-ss N-I:1ll:igg1-r Svnior Play. l: Nvvwlonilv. 3, I: Cornmc-rrial Club. Il, lg Nlalh t.Iub. J. IVIAIHICNCIC l5l'1I,l,lC IIUIWNOUIJ 181 IlIl2ll'll'SIHlllIk lttl.. Na-xkloll ".-I ynuflfrirlul of I'!'!'l'-Vllllfln llfbllpyi llorn January 12, H2001 Sli-nogrrapluir lo0'l', lligzuloxx liraln- mar. RUTH MAl'1GAHlC'l' I'l01ltlII'l't1lN 131 Hivvrsielc St.. Ntatvrtown uPIl'l.!'IIdlj' and llmuyhlful qi' ol l1l'l'S. ' ' Rufus, Cookivg llorn July 21. 1007: Genvral 1hC: Vlatvrlown Junior High: New lfnglancl liaplist Hospital: Class llaslwtball. 2. 3. I: Yarsily Ilaskvtball. l-: Class Nollf-y liall. 2. Il: Health Club. Il. l: Sf-vrc-tary. Il. l: Home I'If'0llUIllIt'S Club. -1: Ilonor Roll. 2, Il: film- Club, I. IIIQHINIAN A. IIUXYARID 08 llivvrsicla- SI.. XXIIIUFIKWNII " Illlllllfl in -Vl'lll'-Y. in jllllifllllfllf old." llowir-1 Horn ,'Xug.:usl IT. H1083 Agriculture' ll'l': Parkvr llrammar: Mass. .Ngrivulturalg Constitutional Convvnlion. l: Junior Narsity llor- kcy loam. 1. RUSH VIRGINIA IIUGIIHS 181 Cabot St., Newton "The fl'lLlI IIIIIIIJIDIIUXS :gf ll rr'- firfd IlfIlllI'lf.u Iiorn May 1, 1908: Classival IOC: Junior lIigll: St.. IClizabPth's3 Mali: Club. 2, 3, ll: Drama Club. 1: Class llovkcy. 2, 3. lg Class Noll:-y Hall. 2,213 Nowlonitc 2. 3, ll: Ilonor Holl, 2. HICIIAIID FIICLID HUNT, JR. 121 Nvwtonville Ave., IN1-wtonvillv " llis IIFIIIYIN lr-ip ufmul him ul l'llIIlllIllIld.H Dick: Born June 10. 10081 Classical IUC: Junior High: M. I. T.: Ilonor Holl, 3. lill'l'lI INIILIJHICD llll'I'CI'IINSON lllilll Xlasluington St., Auburnclale- "livuulAv is lrullzi lrulh is Imuul-v." llut,1'hio: Iiorn Dccclnbcr 251, 1008: tim-na-ral HC: Burr Grammar: lim- vrson: Nlath Club, 3, lg English t.Iub, 4: Ifrnnch Llub. J, ll: film- Club. -ll: lNewtoniau. 1. H If It ww mmm, I. .mum ml ,H ww., ICUNICE MAY INMAN 9 Troy Hd., NYaban "A 11111401 nzirllz she rlnlh pnxs1's.w.' ' Bunny: Ilorn May 21, 1908: tions-ral 1 IC: Burr Grammar. PIIILII' CIIAUNCEY JACOBS, JR. IZYT Eastbourne Hd., lXvwton Cvntre uflllfl' I nmdv fl bl'!'ll,f.', Jake. I'Izil: Iiorn Sf-plenilmr 21, 1008: Svifllltitiv l6C: Brookline' Iliglig M. I. T.: Nlatlz Club. I. Al: Drama Club. AI. IIUBEHT IiYICRIi'l"I' JHNIQHNS 230 Mvlrosv St.. Auburnclale " Hr' was 1'nflf'1'1l Ihr- glass lllhf'l'Pl-ll lhf' noble .voulh did lfl'l'SS lhr'n1s1'l1'fx." Punk. Jr-nks: Horn lVIarr'Ii I0, 1907: Businvss IIIT: Burr Grammar: Bards-tt: Class Football. 1: 'I'ra1-k. 2: Conimvrvial Club. 5. DORO'l'I'IIfA GRACE JUIINSUN 81 CiI'PSf"f"III St.. Nr-wton Centre "Thr h1'nrf'n xurh flI'tlt'P rlid lend h1'I'. Ullll shr' nziyhl Illllllllfll bc' " Dot: Born Sf'IIIf"IIlbPl' 26. 1008: General I6Cz Mason Grammar: Normal Art: film- Club. -I: llome Evonomivs Club. -ll. WALLACE OSCAR JOHNSON 441- Ilunnr-we-ll Ave., Newton .KAFIIIIJH is P,0!1llPIIl'P.n VVallie. Spike-: Born March 13, 1908: Svientific' HC: Bigvlow Gram- mar: Brown: Nlatb Club, 2: Varsity Football, 4, 5: Intffrmvdiatfv. II: Junior Varsity, 25 Travk Squad, 5: Clerk of Associatvs, 5. it .wo .l tl., ., NIADICLINE BI'IA'l'RICIC JUSSICLYN 3,10 Centre Stl.. lYOVVlUIl "A dinlplv in lhe f'hIYI11dPl'I.l 1l'lllllII.N Buddiv: Born Uvtobvr l, IQUTQ SlPIIO,g1I'llIbIlIt' ItI9'll: Higgs-low Gram- mar. IiYEI.YN NIA RIA N IQ IiI'l'II 13 Clarc-n1lon St.. Nvwtonvillv " II lzlsllrn' llonil lmllzw' ln l1IllIl.u Ev, K1-itlry: Iiorn August SIU, 1008: Slvnograpliir' I00'l': llvirt-1 Gramrnarz Iloslon I niwvrsityi Class Svvrf-tary. 2: Girls' Allxlm-lim' Asso- 1-iation. 41: Lvgislaturv. I: Sf-nior l'lay fi0I'llIIllIlt'fx, Al: lX1'VVltHlIlP. I: Comrnc-rcial Club. -I: Drama Club. AI. DAVID AIIIHA KIil.I,IiY 13 Floral St.. N1-wton IIi,uIilan4ls "SpPe1'h is SI.ll'f'I'. Nlllflllff' is g0ld1'Il.u Davv: Born Uvtober I6. I906: Classival 3 yrs.. S1'if1ntiIi1'22 yrs.. I ICQ Ilyrlff Grammar. RUSAMOND CA'I'IIIiHINI'I li ICNIIIALI. ll Sylvan Ave., NNY-st Newton "Slill ll'IllCI'S run clfwpf' Bos: Born Novmnbvr 2-1-. 1008: Classical IIC: IN-ir1'0 Grannnarg Simmons: Class Baske-tball. I 3 Varsity Iiaslu-lball, -I X IHGINIA I'FI'I"I'IGIIIiW KICNIIIAIJ. ll Sylvan AVO.. Waist Nc-vslon "Thy rrzozlznvl-v's ll 1'r1r11ll1' lo lhqv lfIf'I'll.il tlinniv. Gin: Born April III. IUUTL Classival 3 yrs., Gvnvral l yi.. IIC: Dorvlnf-stef Iligli: Boston linixvrsity: Class Iiaskvtball. 4. xr W' Jin- I . A 1 'ff Xl A ll! QA ll lC'l' l l A Y ES Kl'INlll'Illl'JlfNl'I I5 Fur:-sl Sl.. Nvutun lliglllanmls ul'J1lIll'Sl1Ul1l'l' lu ull lhe winds lhul llllllllu Hubby: llorn Nlay Ill, 1008: Classival l0Cg H1-rmantuwn Fric-mlS': Xassar: l.aIin Club. l: l"r4-null Club. lx linglish Club. -l: Glu' Club. lg Class lluvkvy Captain. -I-1 Varsity lluvkvy, ll: Class Haslu-lball, l: Narsily liaslwtball. 43 llunor Roll, 4: Nvwtnnian, -l. IIICLICFN FHA NCES K l'llN IN ICY l9TT li1'avun Sl.. Waban ".'lu'uv ll'lf'1 lmuksf I will draw mv lIlN1Jll'fllI.0Ilfl'UIII Irfv."' llurn S1'IllPllllN'I' 20, IUUTQ Cum- ms-rvial ZOOT: Rugc-r Wolvoll Gram- marg l.llIllIllf'I'1'l2ll Club, l. lCl,l"llllJA INICVYAIVI' lxlCN0lililnXfN l20 liastbmnrnv lid., Nc-xx ton Centre ",'Uu.vi1' lmlh rhurm.v In xnnflwf' M. Mliv: llorn January 27. H1083 Classival HSC: NIZISOII lirammari Skllllll0l'l'1 Class llur-key, lg linglisln Club. ZZ: FI'l'lll'll Club, Il. ll, 3: 'Nlalh Club. 4. X arsily Orrlwstra, 3. l, 5. NINHY l'Il,lZAlllC'l'll lxll.lilillN 233 lligblaml St.. XYvsl Nvwton "Thr lrue serum' QI' rirlue' is .W'l'1'llll-V QI' nzimlf' lxibbic-. lxib: Burn AIIQJIISL 28, H7033 lie-nvral lhCg Nhnnllaunl Park: Class Hass-ball, l. ANN Nlll.l'Jlll'IlJ lxlNli lllll Crvsvmll Sl.. ,-Nuburnllalv "lJiliyrm'r? ix Ihr' nmlhvl' fd' Nlll'f'l'NX.u llobbyg llurn Uvlobcr l2, lflllllg CI4-rival 200'l'g liurr Grammar: lfrvslunan Prize- Syn-akin::. 2: Cmn- llll'l'4'llll Club. lg lN1'wslollile-, fl, CICCILH LOUISE KINRAIDIC 363 VYalnut Sl.. Nvwtunville "She who 1l4'xa1'I'f'x :WU m'z'4ls Iltll IIIIIIUIPFJS pruixl'." Barn January 5, l006g Special l lCg Lasull Seminary. lll'I'l"l'Y MOIQHISUN KNOWl,lCS 35 f:UlllIll0llN'Vf'2lllll Ava-., Clwslnul. llill "lh'rn11l'0. 1Il'll.fl'. 11 nd winxrmuw lhe 1-mbullirmfnl ag' f'h1:1'r1f:1lrless.' BM: Horn D1-cellllwr I6, H1083 livnvral I Mfg Mason Grammar: Yollvy Ball. lg llle-0 Club, 4, M A ll Y A LICIC Al.lil'IH'l'llNI'1 IACIKUIX 381 W ate-rtoxxn SI.. N1-xstun "Gund humor fx Ihr' lwullh af Ihr soul." Budalyg Horn April IT. lqlllll Classival 2 yrs., llvnvral 22 yrs.. l-IC: Junior lligh: llurclvll Cullvgug l"rvn1'ln Club, I: l"r4'nr'h Club Play. L CUl,l'INl.-RIN .IUIHNSUIX l,l'ffNlUlVl' 132 Plvasanl SL, Nl'NXl0ll Cvnlrc "fix Illf'l'l'AV us Ihe IIIIUV is long." Colo, llUllf'1 Horn Fa-bruary 4, 19083 Srivnlilin- l lC: 'Nlasnn Grammar: l'ralI lllSlllIll4'2 Nlalln Club. -li Glvc Club. Il. 1. 5: Spanish Club, 3. JUIIN .l0SI'II'll LANE ll-T Clark Sl., IN:-xxlnn Cvnlru "Uv hull: lla' lII1lkl.H!IS :J an UI'lllIII'.H Juv: liorn August l. l0llT:3vi1-ntilic llC: llydv Grammar, Track Squad, Il, 1. 5: Math Club. 5. CLASS F 192 iiw1mmnnuinunuummwrwm:1imunuwwwwwwiwiwwuwwwitwuv-1:inuuuuuuuuuiuuuuummmuuluuuuuuuuumnnmnwmwwmx JOHN WOODBURY LANE 139 Mt. Vernon St., Newtonville "Thou arl nol wilhoul ambi- lion." Jack: Born May 30, 1909: Scientific 16Cg Junior High: M. I. T,g French Club, 3: Spanish Club, 3, 4: Math Club, 4: Track Squad. 4g Legisla- ture. 3. MARGARET ELIZABETH LARRABEE 40 Austin St., Newtonville "She floals upon lhe river of lhoughfsf' Peggie, Peg: Born July 30, 19061 Clerical 209Tg Junior High: Legis- lature, 43 Social Committee, 43 Com- mercial Club, 4. ANNA HELENA LARSON 21 Mason Rd., Newt.on Centre "She with all the charms of woman." Lady Larson: Born February 18, 1908: Clerical 209T3 Rockport Ilighg Commercial Club, 4. GEORGE BARTLETT LAUBEN- STEI N, J R. 67 Colbert Rd., West Newton "All musical people seem to be happy." Laubyg Born August. 12, 19061 Classical 19Cg Burr Grammar: Har- vard: Alpha Beta, lg Newtonian, 4: Honor Roll, 1, 2. RICHARD LEACI-I Claybrook Rd., Dover " Happy as lhe day is long." Farmer: Born February 4. 19073 Electrical ATQ Cayrol Grammar, Northeastern, Senior Play Com- mittee, 4: Honor Roll, 3, Class Base- ball. 1, 2, 3. wwwwrwHiwwmmmwwwwwwwwuu1wwurwmmwuwwwuwwwuwwwwuuunnumuuuuwuuuuxxw1xuuwuurumwuumuuwmu ,rw mu . i 1 FRANCES IRENE LEATHERWOOD 32 Orris St.. Auburndale "In fuilh, luafv, you have a merry hearl." Jap: Born February 10, 1908, General 14Cg Burr Grammar, Sar- gent. EVELYN EDITH LE BLANC 265 Pearl St., Newton "A sweel, dainly Iillle miss." Billy, Born November 5, 19093 Stenographic 109Tg Bigelow Gram- marg Commercial Club, 4. HAZEL RUTH LEITH 91 Jackson Rd., Newton "Il's nice to be natural when you're nalurally nice." Born April 1. 19083 Classical 19Cg Junior High, Bridgewater Normal, French Club, 45 Latin Club, 2: Honor Club, 2. FLORENCE LOUISE LEONARD 48 Garden St.. Newton "Your voice robs the bees. leaving them honehvlessf' Flo-Flog Born January 7. 1908: Stenographic 109T: Bigelow Gram- mar: Emerson, Senior Play, 4: Drama Club, 43 Commercial Club, 4. RICHARD LEVVIS LEONARD 33 Maple Ave., Newton "Here dwells no frown, nor anger." Dick, Born December 16, 1907, Classical 18Cg Needham Highg Har- vard, Math Club, 2, 3. 1: Newtonitc. 35 Newtonian, 43 Band, 4-3 Honor Roll, 2. 6325153 NEWNTTUNEAN lll'Il.l'IN VERA l,l'lYANDl'Ili 10 Grvvrl St.. Nvwton "I?1'pruQf un hw' lips. lmul u xmilr' on hm' l'KVl'.U l.2lYI'llllf'l'1 liorn l"m-bruary 10. l90T2 Clvric-al 200'l': Junior lligh: Com- llll'I'I'I1il Club. l-. CAIKULITXE l,l'I11lS 63 llarvard St., Nvwtonville "Thr innru'a'nl 1ll'I' guy." Horn April ll. 1000: Classival. 10Cg llousv ln Tho l'in1's: YN 1-llc-slvyg Alpha llvta. 1. 2: Novstonitc Il, -lg Library Club. 4: Math Club. 213 llonor , . . . 1 lloll, I. 1, 3, -1: l'.IlgIllSll f.lub, 11-. lllVl'll l'1LLl'IN l.l'IVl'lS ST llyde St., Nm-wton llighlands "Thf'.v nre rirh who hure fI'lf'lIl1S.u llufus, Hunley: llorn Svptvnlber 24, 10073 Classival IOCg llyde Hralnlnar: 1Nlt. llolyoluvg lfngzlish Club. 5g:Nlatll Club. 2. 5. MILDHICD CAMILIA l,UCIIlA'I"l'O 180 .Adams St., Nc-wton " Ilrr brilliumv' ix su1u'rlr." Mill: Born January 4. 1010g Stvnographic l00'l': Junior lligh. MARION FRANCES LOCKH 2180 Commonwealth Ave., Auburmlale "The grace and blush of ll10llPSl.V.H Mac: Born Novembvr 23, 10003 Classival 18C: Burr Gralnmarg NVQIIQ-slay: Class Hockey, 13 French Club, 35 Nlath Club, 3, 4. 11 11- 11 1 11 1 -1 11111,111-,1, 111 1 1, 1, l1:um1:M: .lxLFm:n Lomfxx ll Curve' St.. llbst. Nvwton "ll hum 1-rilirs runnol rrrilif'isr'." llunnyg Born January 2. l000g llusini-ss lll'l'3 l'uirr'c Grammar: Howard University: Class Travk. lg Conunvrrial Club, 4: Nvwtonitv. 2, 3, 11. li A'l'HE1tl'Nl'I Lt Yl'Z 108 l.alu- Avo., Newton Contra nflf'IlllP und good wilh ll smill' for ull." K: llorn Sc-ptvmbr-r 21. 10083 Classical 10C: Mason Granunar: Mount llolyokv: English Club, -111 l'lI'l'l1Cll Club Trcasurvr. ll: New- tonitr-, fl. lg Svnior Play Connnittvu. -l: Class llockvy, 1, 4: Constitutional Convvntion. Il: Lvgislaturv, 3: Alpha llvta, 1, 2: llonor Roll, l. ZZ, Il. -1. l'fl,lZAlll'1'l'll AN RRY IAIWHY 27 Shaw St., YV-st INPNH. ton "Thr blvssnlrzvss of lwiny lilllrf' livttyg Horn October 1 l. l00T: Classival l3C: Carroll lirzunlnar: Skidmore: Spanish Club. I FRANCIS CllARl,l'IS LYONS 111 Nlt. lda 'l'nr.. Nziwton "His good nulurf is wilhoul fill f'quul." Dandy, Sha-ik: llorn Juno IS. l00T: Classival l0C: Boston Latin: Iloston Coll!-go: Football, Il. 1. 51 Math Club, -l-. 5: llonor lloll. 21 llasvball. 5: Travk. 3, 11, W l Ll.l A M A LBICIVI' LYONS C1-ntral A ve.. Needham "To know how In hill? nmfx ullililv is grvul skill." Hill: llorn .lune 27, 10061 Svicn- tiliv 21lC: llunlington Junior llighg North:-astern. 'tr CLASS QF . .M Mml..u:m:.l.mmlwmznl ',., .,l,,w.,iy,1uumnmuuuuuw JOHN JOSEPH MAHONEY 27 VVildwood Ave., Newtonville "Good sense and good nalure are nel-er sf'paraIed." Johnny: Born January 12, 19085 Scientific 14C5 Junior High: Boston College: Orchestra, 3. 45 Track, 2, 3, 45 Math Club, 35 Baseball, 4. GLADYS EYELYN MACBEY 5 Solon St., VVellesley "Readv in hearl, ready in hand." Evvie, Ellie: Born July 8, 19085 General HC: NVelleslcy Junior High5 Art Schoolg Health Club, 35 Glee Club, 4. MABEL MACCAUSLAND 32 Talbot St.. West Newton "I haslen lo laugh al every- Ihingf' Born September 21, 19075 Classi- cal 19C5 Peirce Grammarg M. A. C.5 Glee Club, 4. ALICE ELIZABETH MACDONALD 190 Chapel St., Newton "Fun has no Iimilsf' Born February 19, 19085 Steno- graphic 109'I'5 Junior High5 Com- mercial Club, 4. HELEN LTURNER7 MACLELLAN 4 Avondale Rd., Newton Centre "Good nalure is one of ilu' riches! fruils :J persanalilivf' Born August 3, 19075 Classical 2 yrs., Scientific 2 yrs., l4C5 Girls' Lating Simmons: Honor Roll, 15 Matll Club, 3, 45 French Club, 45 English Club, 4. mwmwWwwlm ul.. ..lu.wlw.l lll, www 1 1 ELEANOR MAGRANE 2069 Commonwealth A ve., Auburndale "Joy is nn! in lhings, il is in us." Len: Born April 25, 19095 Classi- cal 19C: Montreal High: Wellesley: Alpha Beta, 1, 25 Honor Roll, 1, 25 French Club, 45 English Club, 45 Newtonite, Il, 4. TIIEBESA MARY MALONEY 1071 Beacon St.. Newton Centre "A sweel-lempered, bonnie lass." Born December 2, 1907: Steno- graphic 109T5 Hyde Grammar. SIDNEY ARNOLD MARSTON 20 Pelham St., Newton Centre "Call a spade a spade." Sam: Born October 19, 19075 General 111T5 Mason Grammar5 Senior Play Committeeg Commercial Club, 4. JOHN MAYNARD 34 Harrison St., Newton Highlands "Silence is golden, lo be brief is a blessing." Jack5 Born November 28, 19095 Classical 18C5 Hyde Grammar: Boston Universityg French Club, 3, 45 Math Club, 3, 45 Newtonian, 4. ROBERT DANIEL MCCARRON 19 Pearl St., Newton " Ilalh Ihy foil o'er books ron- summl lhc midnighl oil?" Bob, lNIao5 Born June 30, 19085 Scientific 16C: Boston College Highg IW. I. T.: Ninth Club, 3, 45 English Club, 45 French Club, 45 Legislature, 35 Honor Roll. I, 2. 35 Orchestra, 4. THE NEWTQNIAN CIIARIJCS AI,IlI'fIi'I' MCCAHTIIY 52 Channing Rd., Nvwton Centre ulrflllllfl in l1'111l1, in jllll!Il7ll?Ill old." Al: Ilorn lNOV!'lllIN'I' QT, 1900: Classiral IIC: Iloravf' Mann Gram- mar: Boston Colle-gf-2 Sc-nior Play. l-: l'Il'PIll'll Club, 2: Math Club. 22 Drama Club, -l: lNvwlonil,u, 3. -lt: 'l'ra1'k Squad. Il, l: Football Squad. Il, 1: Urvlie-stra. al-. JOHN CAllI,I'I'I'0N MIKCUIIIIOIVGII Ilh Irving St., Nvwton Cvntrc "fl .svmrirl 11111111 in 11 Sllllllll lmllxz" Ilustvr. Mar: Ilorn Nlarrh 0, 1008: Classival l9C: Nlason Grammar: I,1ll'lIllUlllll1 Football, Il. 4, 5: Ilasv- lmll, 2. Il. -lt. 5: Captain. 5: Class 'l'rvasurvr. I. 2, 3, xIf't'-l,l'1'Sltll!lll, Associats-5. 51 Stuilvnl Counvil. 2, 32 Urangzv Ilook, Al, 'I'ra1'k, Il. tillACl'I I50llU'l'III'fA NltiI'JAI'3l'I IKM- Nlvinslow llil., ll"aban "7'lmu11l1lful and wise she ynvs luv' ll'1l,V.U 'll-tlily. Mar: Ilorn July l-. lfltltiz Stvnograplliv ll0'l': Ilyrlv liI'illlllllill'1 Spanish Club. 2: Iinglisli Club, Il. 'lz Conunt-rc-ial Club. l-1 tllve Club. I. 2: ALICIC MAIIIIC 'NlCI7UlNAI,D 50 Farwvll Sl.. N1-wtonvilll' 'UWM' x1111'l1'1l llllll llu' xl1111lm1'.v Ill'IIllI'll'd.H M, Mavk: Ilorn July IIT, H1081 CI1-rival 209'l': Junior llighg Now- lonilc. 33 lillIlllllf'l'i'l1ll Club, 3, lg Drama Club. I: Class Yollvy Ilall. 21 Constitutional Conn-ntion, 33 Sf-ninr I'lay czllllllllllllitf, 111. CA'I'lIICllIlNE ARIN 'Xl KCDONAI.I'l ITS Cyprvss Sl.. Newton Ct-nlre "I.1fr ll'lllI0lll s1111'li11g1 is ll flrerzr-Av l1l1111lc." Kit. K1 Ilorn July IT, 19063124-in-ral l6C, Nlason Grammar. JEAN MACDONA LD 95 Court Sl., Newlonville "Cor1111m11 sense is 11.111 ll !'0Ill- 1111111 ll1i11y." Horn May T. 10083 Slunographic l09'I'g Junior Iliglig Class Vim-- I'rf'sicI0nt, 4: Commercial Club. fl: Iixvrutivv Coinrnittve, lt. VYALLACE ANTIIONY MM1l'III'lIlSON, JR. Il Cllurrln llil., Nvwton "ll ilh ll look uf 11w1'r1'111P11l in his r',w's." linrl. Allivg Born I30c'01lilwr 0. 19063 Svivntilir' IOC. Bigvlcm' Gram- mar: Slutlent, Counvil, I, 2: Base- ball, l, 2, 3. I'fLIZABI'I'l'II TNOYES MICAIKA I224 Boylston St., Newton Uppvr Falls "A spiril ull s1111sl1ine." Ilizz: Born July 9, I0083 Classical 3 yrs..fh-iuvral 2 yrs.. lhCg linwrsou tlrarnmarg Ncwtonilv, l. GICRTIKIJIUIC NIICIIIMAN ILZS Pinv St., Auburndale "Eyes lhul mn .vpvuk lhuuyli luv' lfmgim is Sl.lf'Ill.H Gert, Trudy, Born May IT. I008g Classival 2 yrs.,Gmwral 2 yrs.. llCZ l'eir4'e Grammar: Miss fillillllllvfisl Spanish Club, 3, -1: Mall: Club. 3, sl. I,Il,I.IAN MICILMAN 23 llc-1-cl: St., Nvwlon "A fflll' l'.l'll'V'l'lPl' is ll xilenl rm:11111 lIIl'll flu! inn , ' ' Lil: llorn April T, 10083 Clt-rival iZtIl'I'g Stearns Grammar: Iloslou Univvrsityg Commercial Club, -l. CLASS QF JOHN NIEMYER M EISSNER T05 Chestnut St.. NVaban "An aulhnr in lhe making." Johnny: liorn August 27. 1007: Scivntilic 16C: Roger Vl'olvolt Gram- mar: Prize Spf-aking, 4. ALICE LILLIAN MILLER 108 Newtonville Ave., Nffwlou "She brnughl sunshine u'hem'P she came." Al: Born June 19. 1008: General 16Cg Vllaltham Junior High. RICIIARD FRANKLIN MILLER 30 Grove Sl.. Auburnclale "A lhuughlful man. un. empire in his brain." Dick: Born August 18, 1008: Classical 19C: Burr Grammar: Vliil- liams: Drama Club, 3, 4: Drama Club Play. 3. 4: English Club. 3, -lg Pre-siilent. 4-: Alpha Bela. 1. ZZ: Honor Roll, 1. 2. 3, 4: Nlath Club, 4: Spanish Club. 2, 3: Newtonite, 3. -1: Legislature. il. SARAH LOUISE MONAIIAN 36 Bennington St., Newton " HN' prrsonalily will win her funn-'." Sally: Born July 15. 1908: Steno- graphic 116'l': Bigelow Grammar: Legislature. 3: Commercial Club, 3. DORIS MUNROE 107 Floral St., Newton llighlanils " How merry is a SilIf1i'lIl,S life." Dot: Born May 12, 1008: Clerical 20Ll'l': llyde Grammar: Tillon: Com- merrial Club, Al. LUTIIER SAMUEL MOORE 270 Mill St... Newtonville "A good shnl. and ri lrue unc." Sam: Born Sc-ptnnlber 26, 1907: Svivntilic 16C: Clallin Grammar: Annapolis: Football Squarl, 2. 3: Track 21, 5: Spanish Club. LL, 5: Con- stitutional Convvntion, 4: Logisla- ture. 5: Math Club, ZZ. 3, 1, 5. ELEANORE RLANCIIE MOYNIHAN 53 Cross Sta, WV4-st. Newton "Eluinr Ihr fair: Elaine lhe lm'f1l:lr'." Kitten: Born Svptvlnbvr 3, 1907: Ge-neral llC: Peirve Grammar: Forsythe Dfrntal. CARL ALLEN NELSON 24- Magrue AVP.. VVesl Newlon "Good scnsf and good nrzlure ure' IIf'l'6?l' .wpuruled Sweilv: Horn Fvbruary 19. 1000: Vocational AT: Peirce Grammar: Class Treasurer. 4: Newloniti-, Ii: Senior Play, L. JOIIN KNUTE NELSON 102 Lexington St., Wiaterlown "In COIIIDUIIAV u l'C'l'AV plensunl fellow." Snookie: Horn August 23, 1007: Vocational AT: VVal1-rtown YVf?st. Junior High: Norl.heasI.vrn Uni- versity. lVlARTllA MAURINE NICNYNIAN 4 Belmont SL., Ne-wton "Tn perjfrcl zliligfvnrr Ilflllllillfl ix diUi1'ull." Patty. l'at: Born August 3, 1008: Classical 2 yrs., Gvnvral 2 yrs., llCg Binghamton, lligh: Nliss Gibbsl Nowtonilc, Il: Litvrary liflilor, Il: English Club, 3. lg Spanish Club. 3, 4: Frvnch Club, 4. . 'v A ,f TL-IE l'il.l NUI! l"Al,l'iS N ICNN 'rom II Unk 'l'er., Nt-wtuu lligllluuds "Ul1.' lo dllllflf ull llIf1lI"IIlll rlrvxs ull fifty." Stubbiv: lioru 'Nlurcln 26, N063 tlvuvrul IUC: llytlu Grzumuur: lim- l'I'SlIll1Slb2lIllSlI Club, Ig Nt-wtuniun 5: film' Club, 5 XI A li I .-X 'N FN N N It TULIAZZU 25 Smith Ct.. Ilvsl iNI'VtI0ll nllvltillx muxl lm burn. :mal nr'l'1'r 4'llII lu' llllllfllllfi Muryg lluru .luuuury IS, IQOTQ Gt-ilvrul IIC. IN-irvu tlrunuuur. Ck'l'lllilIlNl'i Nlltlllll NUYICS II Crystal Sl., INPNNIIIII Ct-nlrc " Nvlilllillfl liimlzvxv, nulhiny fluunls In-r" li, llurn I,l'IHll4'l' 9. IINWQ fillISSll'Ill ISIC, Nlusun IiI'1lIlllllZlI"1 Nllwutuui Nlpllu llvlu, I, 2: Pr4'si1l1'nl.. 21 lluuur llull, I, 2. fl. lg lfuglislx Club. Ii. -Ig l.a-gisluturv, I: ljrzuuu Club. I1 St-niur Pluy Cmnlniltvt-, IZ Assist- uut litlitnr Nt-xxtunizui. I: 'Nr-wtouitc. 3. I1 litlituriul lftlitur, I: Ifu-vutivc IiitllllIIlIllt'1'. Ig tlrmigt- Iiuuk, 3. l'ANll'ilA l,lllllY VNUYICS I2 llu1'klt-clp:4- lltl., NPXVIUII lliglllumls "Illini rurrlh xln' flu' lwr1l'lx lI'lIl'H IIlH'l' IIlINXl'N.Vl'lliVi Palm: linru NlDXl'llIlll'l' 5. IINITZ Clztssivznl I yrs., th-ut-rut l yr.. lhCg Sl. Nluryisg Xliss IiiII'llllIll.S1fil04'IilIIlI, -I-2 Piuuisl, I. l'Al'I.lNl'I l.I'IIItIY Olilili III! Hurd SI., New lun Ccutrc U.'Illl'll,VS Qf ll rlwerful disposi- lion." Polly. Puulg lluru August 22. IO0Tg Clorivul Itl0'I'g Mason tlrauumurg Huston Univvrsilyg llrzunu Club, 4: Cmuulvrciul Club, 4, Glen Club, 23 S1-niur Play Cmumittee, 45 Ncwtonite, 4-3 Bziskt-Lbzlll, IS. WWTfQILN3'I.?L.N JOSl'll'llINlC ICIAINIC IVIIIIIICN 378 Clwrry SI-, NYUSI Nvwluu "Fair :J fave, mill: u f1l'IIHf' grime." Ju .lug liorn S1-ptt-lnln-r 28. IQIIT: Stvuugrupllic' l00'l', l'4-in-4: tlrauumurz l'illlI'I"50!l. I'II,I'IANUIi tiI'III'I'Iil 'IHC 0'IlAl.I,0IiAlN 101 Cvutrul Ave.. Nc-wtunvillv "I'Il yiyylr Imluhv, if l0IlIUl'l'dlIl' I die." Vinh, Burn Svplvnllwr QI, N003 Stvuogruphic l09'l'g Junior lliglu: Commercial Club, I: llrzuuu Club. lg I l'fnp:lislu Club, I: lrizc--Spa-ulaiug, I. MARY l':'Vl'lIlClA IYNICILI. 10 llowarcl St.. NY:-sl. Nu-wtuu "ln gliding sluh- shi' wins her crixy IUUAV. ' ' Pi-ggy: liuru .luly ISI. IOIIIIL Clussivul IOC: l'1-irvv Hrzumuznrz llustun llnivvrsilyl l'.I'I'llt'll Club, I1 Draunu Club. lg film- Club. I. IIICOIIGIC IIICNHY 0'Slll,l.lYAN 7 Nvxw-ll lltl.. .Miburmlulc U-gl'l'1.0IlS bul quirk rj wil." Sully: Burn .luly IS, UNIT, Classi- llewkvy. II, -IA. XXILLIANI ICIJIIAII Ifkltlx I5 Winthrop St., NVQ-st Nr-wtnu " Ile slunlls high in C'l'l'I'.VlIUllV.S hl'llI'l.H liill, .luvkg Burn Jilllllilfy 20. I000 Classical 2-IC, Pvirvc tlrzunnlnrz Mn- lmrstg Student, Cnunvil. I, 2: lVl:iI,li Club. 2, 3, Lg l"rvncln Club. 3. -I Pri-sirlcnt, 4-3 Social Coinniittuc, -I llruinzn Club. -Ig Drama Club Play, I- Vursity Orchestra, -I: llunnr lloll, I. val ZIICZ llurr Gruuuuur: llnrvural' CLASS QF 19265 nwwwwiwwwwuwwwwwwwiuri1r-mmwulmmumwmwmrwwumummm ELIZABETH BURDITT PARKER 27 Metacomet Rd., Waban "Cheerfuln0ss, like glimpses of sunshine on a cloudy day." Liz, Lib: Born April 30, 1908: Classical 18C: Roger VVoIcott Gram- mar: Middlebury: Chairman Social Committee. 43 Drama Club, 33 Sec- retary, 4: Math Club, 2, 3, 4: French Club. 2, 3: Class Basketball, 2, 3, 4: Newtonian, 43 Class Baseball, 1. RALPH ARNOLD PATERSON 4-119 Highland St., Newtonville "A general oplimislf' Pat, Harold Teen: Born July 1, 1905: Business l11T: Junior Iligh: Northeastern: Newtonian, 4: New- tonite, 3, 4: Math Club, 2, 3: Com- mercial Club. 3. -I: Drama Club, 1113 Manager of Outdoor Track, 4: Class Baseball. 2, 3: Indoor Track, 2, 33 Senior Play. RUTH PEA RSON 132 Church St., Newton "She halh a way." Ruthie: Born June 19, 1908: General l6C: Bigelow Grammar: Rraglgiottiz Class Ilockey, 1, 2, 4, 5: Varsity Hockey, 2, 4, 5: Manager. 5: Class Basketball. I : Class Baseball, 1, 2. 4, 53 Math Club, 3, -I, 5. EDNA LILLIAN PERKINS 25 Groveland St., Auburndale ulvlIf'l'f'l4V is Ihr' Spire Qf life." Eddie: Rorn January 16, 1908: Stenographie 100T: Middlehoro Grammar: Commercial Club, 41-. LAWRENCE BERNARD PERLMUTTER 11487 Watertown St., Newtonville "A yenllernun in llll1l'!lwVS.l, Lawry: liorn May IS, 1908: Seientilie lltlg .lunior IIig.:h3 Tufts: Newtonite. l: Math Club, 3: Base- ball, 3, -li: Track, 4. IwI1nmmmmuwuwwurmmuitI1inwwwwnwninniummmmmuuuum ,,i, w ELEANOR CARR PHILLIPS 72 Oxford Rd., Newton Centre "As merry as flu' day is long." Onnie: Born August 23, 1008: Classical 19C: Mason Grammar: Mt. Holyoke: Alpha Beta, I, 2: English Club, 3, 4: Math Club, 2, 3, 44: French Club, 43 Latin Club. 4: Library Club, 4: Class Hockey, 1. 2: Newtonite, 4: Senior Play Com- mittee: Honor Roll, 1, 2, 3, 44. ROBERT GREEN PICKARD 253 Crafts St., Newtonville "Il is usually lhe busiesl man who wins." Bob, Pick: Born August 20, 1008: Scientific 14-C: Chelsea High: Uni- versity of Southern California: Science Club, I: Baseball, 3, '14, 5: Spanish Club, fl: Math Club, 3. MARJORIE FRANCES PIERCE 25 Groveland St., Auburndale "Vivacious, jolly, lIlIdfl'!'f' from care." Marge: Born March 6, 1000: Stenographic l09T: H4-neva lligh: Commercial Club, 4. IIILDA LOUISE PISER 155 Mol'I'at Rd.. Riaban "Good IIIUIIUI' ll'l1f'l1l'S rhurms lo lush" Pillyl Born October I, 1907: Classical ISIC: Roger Wolcott Gram- marg fl0I1Ill!l'llClli-I Nlath Club, I, 2, 3, -I-, 5: English Club, 3, -li: Latin Club, 5: Treasurer, 5: Newtonite, 5: Glee Club, 5 CAIIOLYN LOUISE POMEROY Vlfcston Rd.. VVellesley 'iflllililbv and reliuln'lil,v rnulw' her u good sa'lmlur'." Pompey: llorn July 222, 19081 General l4C: Eliot Grammar: Perry Normal: Class Treasurer, I: Class Secretary, 23 Ns-wlonite, 3, -Ii: Drama Club, 3, lt: Constitutional Conven- tion, 3: Senior Play Conunillee, il: Orchestra, Al: Newtonian. il: Drama Club Play, 3: lleallll Club, 3, -lg Honor Roll, 1, 2, 3, I-. wrnmuwwm 'ef 4 , Q-nc. TQ," QQ , -" ly' . . . - ci, .hs Tl-EEE lilfillfklill FHAYNCIS l'Ull'l'l'Ili IIIELEN FRANCES PllRl'l,li 13 lloxu- Sl.. Wvllr-slvy 335 Luke Ave,, Newton lliglllauuls "I um ns SUIFVIIII ux Il ju1ly11'." "ll ho dexf'l'1'1'x zrvll needs nul Dim-kg Horn Uvlulwr ll. IQUSQ """lh""'S 1""'li'W'N lfrngirn-1-rim: ,-X'l'1 NM-ll:-slvy lligh: l"raumi0, lfrzung Born SClll1'IlllN'I' lmluigln l'rvp1 Xzusily lfoollmll. fl, l: LIU, IUUTQHem-r:ll2lK1: Kluson Grum- Nursily 'l'r:u'lx. 3. li: lfluss liusvbull, maui FI'iIllllIlg.L'llillll Normal: Alpha W I, 2, Il. 11 Class llorlwy, 2, 3. lug llc-lu. ll F!'f'llCll Club, 31 SIDillllSlI ' Uluxs ll:-lay. li Svnior l'luy Coin- fflulr, lg llolm' l':1'0Il0llllK'S Club, I: l millm-O. li lllllllll' llull, fl. Svlliul' lllaly, l 'RQ' 'Qilf V HNYIIAIUD Nlklli NNN HHS JQHIN lrglixyqjlg UUINAN ' , I8 lilmsu- Sl.. Nvxx lon C1-nlrc jf, Washburn gl. yN,.wl,,,, N A X "lvf14ll'1' l1v.r.rlll1l:l'll'nl1 lu .ww u A-If ix ,ml u,lH,,.,, ,I ,mm ,.,,,m,S f"""H""' """" Pfmrll Iful zrlml lu' is lhul rn11r1l.w." t, , i lll'il'3 ll""" Nli""'l' l l- llllllk lioruJuuv 12, 10003 Buaiur-ss lll'l'g s Lluisnml ill.: .Hrownv A Nlvhols: J,,,,i,,r lligh: lgosum Uniwrshyi l,4-lugll llnnvrslly: lloc-kvy. -5. li Le-gislulurv, Zig fl0Illlllf'I'Clill Club, l-g ' lllll'I'lll4'lllZllf' lfoollmll Squzul. I, Nm, L,,,,iu.. 3: Busphall Squad L UWNLH IIUWANU 'Ml' x1l1,umm MAHc.ur.nllh 2224 Hrzuxl :Nw-.. lNf'WlUll Ca-ulrv 1,lllNAN "Howl humor uml rff'ru'ruxilv 20 Xhnslilmrn St., Nvwtou ""'.l' UH' 'l"."- "Thr bloom rd 1'n.vAv 11111114-r'l1r'r' llwl Born N-ple-nllwr -L 10063 hw ,lure bmprukx. Clussivnl 2111: Manson Iiraunmurz Minh.: pmm F,,bmu,-y Q. 1908: liflliiill lll1lW'VSlly1 Fwflbflll. 'l- 53 Clvrivzal 20l'l': .lunior llighg lloslou lllllmlr T"i"'k- 55 ll"l'l0"" 'l'rf"'l'l- 53 l'niu-rsily: lYlllIllIIll'l'l'iill Club. l. Social llozlrel. 5. lNlllUlllN hllAl.l'. I'lllN.l-,l,l, lallllul. lfllkklz QUIINN ill! NKNNUIIINIHC Aw .. lNIWlUIlNlllf 00 Wll1lNNU0ll AW-. lNPVNlf0IlVllle .Shi spain unrl ur ull 11411 .1 ,lflll Iilflllvl l-N ll Alllllf p4-1-,vumlf-fl," I'l'l'llIllIllPIllillllillll.U Dol: liorn lNow-mb:-r 2, 1008: Born Fvbruury T, UNIT: Busiuvss Sll'llU,2Il'1lllllll' ll0'l': .lunior lligllg flllllll -lllfllflf lllglll l:0lIllllPl'l'i1ll A llllo If l. ,A . . ll. - JUHN lwfilili Pl HMIY .mum cillxixlmzs mmsmzw Ullllllffllvwilllll AWN 08 llzirvurd St.. Nvwtonvillf- llvhl lxewllm "lf .vniliuy is lhhv unlv -flllllf " 'Urn of-lrll' lI'lll'lIN url' Un' lwxl N,,,jl,- ,,,,." mn" lluppy: Horn l'Jm's'rnlwr 30, 19063 H0512 H0111 NUWPIIIIWF fl- llllliil Busiuvss HIT: Junior lligll: lioslon 9f'i"lllilil' lllll llmfllillllf' lllgll- l'uiw-rsily: Class l'rf-siclvnl. 2: Class liusvbull. 2, .33 Lluss lfoollmll, .., lxuloor und Outdoor 'l'rzu'k. 2, Zi. -lg Football. 3. lg Drzunu lllub, li Nmor ll.ny. I-. I.omrnuu.1l Lluh. I, -siclf-ul, tl-. at t ww: www , W. M- www LUCILLE AHLEN E HATZBURG 83 VVarwick Htl.. West. Newton "A volume if1I'f'llI'l'lld,u Angel Child. Bats: Horn February 2. 1907: Fine Arts l6C: Peirce Grammar: Boston Normal Art: Class Basketball, 1. 2, 3: Glee Club, 4-1 Newtonite, 3, All. VVINIFRICD RAYNICR 137 Lake Ave., Newton Centre "A mndid censor, und ll friend sim'ere. ' ' VVinnie: Born December 3, 1908: Classical 18C: Mason Grammar: Pine Manor: Alpha Beta, 1. 2: Treasurer, 1: English Club. 4: Math Club, 2, 3, 4: French Club, 4: Library Club. 4: Class Hockey, 1: Class Basketball, 1, 4: Honor Roll, l, 2, 3. MURET CAHLETON REDMAN 910 Chestnut. St., VVaban "I am Ihe acme of lhings KIC- complishedf' Red: Born April 5. 1908: Business 111T: Ralph Waldo Emerson Gram- mar: Mass. Nautical School: Spanish Club, 2: English Club, 4: Drama Club, 3. 4: Commercial Club, 3, 4: Drama Club Play, 3, 4: Stage Mana- ger, Senior Play. 4: Newtonian, 4: Senior Play Committee, 4. WENDELL JICWELL REED 35 Ware Rd., Auburndale "On lhcir own merils modes! men. are dumb." Jipper, Oscar: Born August. 29, 1906: Scientific 24C: Burr Grammar: Northeastern. ELIZABETH VVALTEBS REHS 9ll W2lSlllIlfIl.IlH St., Newtonville "Tl1e.v who have friends are rich." Betty: liorn October 7, l9073 General 14C: Da-na Hall: Elmira? Spanish Club, 4. 5: Glee Club, -lr, 5: Class Orchestra, 5: French Club. 5: English Club, 5. MARGA 11 ET ALM A REI LLY 301 River St., West- Newton "Rather lmshful hul lmvrblef Peg: Born December 9. 1908: Clerical 20-IT: Peirce Grammar: Commercial Club. 4. Cl1All LOTTIC li ICY Nl PLUS 83 Central Ave., Newtonville H1iUll'lil'lll'V, delernzinulion. diy- nilv, rmfl swrelrless :gf IlIlllll'L'.n Charlo, Sha: Born March 241, 1910: General 21-C: Tisbury High: Spring:- lielrl Library School: Class llockey. -11: Library Club. 11. RALPII SPENCER HICIIAHDSON 228 Highland Ave., West, Newton "Good humor makes all llzinys i0lCI'lIblC.,, Born January 25, 1906: Scientific 24C: Claflin Grammar: Iowa Slate College: Class Treasurer, 4: Track, 1, 2: Ilockey, 3. -L PAUL KENNICTII RIPLEY 33 NVinnerway St., Natick "A man of Ihe open fields." Born July 21, 1909: Nleclranic AT: Natick High. EYELYN STANLICY ll01llCR'l'SUN 61- Crafts St., Newtonville "Qui0l nzinds are gu'ru'r'ull.v moxl luippvf' llv. ljvy: llorn April 119. l908: Stcnoggraphic 1l0T: Junior lligh: Conmwrcial Club. l-. THE NEWTONIAN tll'IR'l'Rlll11f LOUISE ROBERTSON ol Crafts St., Ncwtonville " llvr rirlues are good, lrue, and lIlSllIlg.n tlvrl. Gcrtyz Born Juno 11, 19063 Clcrival :04.'l', .lunior lliglig Com- uwrvial Club, 4. M ARI li WANDA ROMAN 33 Sullivan Avv., Nowton Upper Falls "llr'auIAv is ils own e1fc'use." lllonily: llorn March 25, 19083 Sli-nograpliia' l09'1'g lfmvrson Gram- mar: lfmlocimlcclz Orclwstra, 1, 2, 3, 4: Comma-rvial Club -I. lll'1l.l'IN litltllllili 178 Albvuiarle Rd., Wvcst Nvwlon "Sunshine in a shady plate." llinlyz llorn August 2, 10083 Slvnograpliiv ll0'1'g Junior lliglig Comma-rvial Club, 4-. IIOIHS MOSlll'IR ROXYIC 002 Commonwvatli Avo., N4-wlon Ce-ntrc "ft rruulvrri Cirre, will: hair' of .vun.w'l har." lint. SllllSt!l1 llorn lllarvli 15. 10083 tic-in-ral HEC: Blason Grammar: Miss llarris'sg 'l'4-nnis, 2, fl, -I-3 Captain 3, lg lilee Club, 3, 'lg Sc-nior l'lay Conuniltcc, -1. .Il'l.ll'I'l' A1Dl'1I,lC ROY 25 Capital St., Nvwton " Newer cross, n1'1'cr sad. always happy, always glad." Julio, llorn July 1, 10081 Clvrival 20Al'l'g Junior lligliz Boston Unl- vvrsity, fi4lIllIll1'l't'l2ll Club, -1. CONSTANCE RUBY 16 llyde St., Newton Highlands "A lighl hear! lives long." Con, Connie, Born March 11, 1908g Classical l9Cg East Jaffray llighg Wellesley: Math Club, 5, Spanish Club, -l, 5: Glee Club, 53 Senior Play Committee, 43 llonor ltoll, 1. TIIOM .AS EDM UN D R USl1FOItT1I 143 Norwood Ave., Newtonvillc "The hcighl of papularilqv knows no hounds." Rushg Born August 31, 1008: Scivntilic 2-IC: Burr Grammar. N IRGINIA DAY RUSSELL 0 Wvir St., Auburnclale "In her alone 'lwas nalural lo plmixcf' fling: llorn November 27, 19071 Clerical 20'l'l'g llurr Grammar: Com- mvrcial Club, -1. ll0llO'l'lll'1'X ISA RRARA RUST 000 lloylston Sl.. 'Yvwton llighlands "QualilAv. nal quanlilyf' Dot, 'l'hora: llorn July 21, 1007: Classival -1- yrs.. tlvnoral 1 yr., LLC: llyila- Grammar: lloston Teaclulrsi Collvgvz Nlatli Club, 3. -I-3 Spanish Club, 3, 43 '1'roasuri-r. fl. VIRGINIA MARY SALEMME 101 Frvvman Sl., Auburndale "Airways happy and r'hccrful." Gin: Horn July T, 1908, Clcrival 20-l'l'g Burr Grammar, Commercial Club. l. K 4 0 HERMAN SALTZ 6 Pelham St., Newton Centre "Good humor is always a success." Hawk, Pep: Born June 6, 1008: Scientific 24C: Mason Grammar: Boston University: Orchestra, 1, 2, 4: English Club, 1: French Club, 4. FLORENCE MAY SAMPSON 40 Cook St., Newton "Good lhings come in small packages." Flo: Born August 26, 1008: Stenographic 109T: Junior High: Commercial Club, 4. DORIS ABBOT SARGENT 15 Perkins St., VVcst Newton "A maiden modes! and self- possessed . ' ' Sirod. Dot: Born July 4-, 1008: Classical 19C: Peirce Grammar: Wlellesley: Honor Roll, 1, 2: French Club, 4: Alpha Beta, 1, 2: Nlath Club, 3, 4: Senior Play Committee, 4. IIARRIOT BROWN SCIIELL 9 Baldwin St., Newton "If is a fl'l.I'lI!1l,V hear! lhul has plcnlbv 0ff1'icnds." Brownie: Born December 12, 1008: Classical 10C:'I'olcdolIig:h:NVellesl1-y: Library Club, 5: President, 5: Latin Club. 5: Drama Club. el. 5: English Club, -I-, 5: French Club, 3. Ll-, 5: llonor Boll, 1, 2, 5: Spanish Club, fl, 5: Senior Play, 5: Newtonian, 5. ELIZABETH SCHIPPER 18 Nlaple Ter., Auburndale "Rich in lhoughl and char- offer." Schippa, Liz: Born June 20, 1008: Classical l8C: Junior High: VVQ-llesley: Public Speaking, 2: Library Club, 44: French Club, 4: 1NIath Club, 11-5 English Club, 3, 4. fll RUTH GRACE SEELEY lfl10 Carlton Rd., VVaban "Proper words in proper places." Blossom: Born July 17, 1907: Clerical 20,1-T: Chatham High: Bur- dett.: English Club, 4: Commercial Club, 4: Legislature, 4. ALAN TORR EY SHAW 66 Bennington St., Newton "A great hear! has no memory for wrong." Honk, Al: Born January 17, 1008: Classical 2 yrs., Scientific 3 yrs., 16C: Bigelow Grammar: Bowdoin: Base- ball, 2, 3. 4, 5: Legislature, 41, 5: Editor Orange Book, 4, 5: Newtonite, 3, -I: Sport Editor, 4: Constitutional Convention, 4: Executive Council Associates. 4: Class Executive Committee. 5. ALICE GLADYS SHAW 8410 Chestnut St, YVaban "She ullains great heighlsf' Al, Alicia: Born December ll, 1008: General 19C: Reading High. KATIIRYN NANETTE SIIEA 298 'llI'f'IIl0lllf St.. Newton H7'hUll!Illl is drrfper llmn ull spcrchf' Kay, Cubba: Born February il, l908: General 16C: Bigelow Gram- mar: Mass. Normal Art: French Club, 2. JOHN PATRICK SIIERIDAN 827 Boylston St., Newton 1Iig.:hlan4ls "I'lI speak in a monstrous Iifllr' wire," Ike: Born January 8, 1000: Busi- ness lllT: Hyde Granunar: New- tonite 1, 2. 3, fl-: Senior Play Com- mittee, fl-: Commercial Club, 4. d ,,' fi ' Q t ...ttf it IZ. K' . ,Asha ,g , Q , J 'm 'LET-.i.lfl?. NETFWTQNEAN l'll,lZ'Xlll'I'l'll AHNICS Sll0ll'l'0N 208 California SI.. Newton "IIN ulnlllm 'll'l'l'f' nnlwrl and III'lliNl'4I.u llorn .Innv IIS, lfltltlg Clvrival l0f1'l'g .lunlor lllglig l.Ullllllt'l'1'IZll Klub. 4. IIUIKIS liS'l'lll'Ilt Sll'IlSl'Ill'l' IIT Floral St., Na-wton lligblantls "Trll hm' lm! mu'1',' xlu' under- slulul.v." 'l'ools. Born .lunv 6, 10081 Stvno- urapllic- ltl9'l'g Mason llraunlnarg Ur- 1-lwslra. l, 2, 3, lg Base-lmll. l. 21 liaxlu-tball. 3: Corllrlwrvial Club. Il: Conslilntional Conv:-ntion. Il: Yollvy llall. Ilg Nvwtonilv. 2, 31 Prim: Spvakingr. l. lllCA'l'lllClC lll'Il.I'IN N Sl 'Nl NIONS 20 Nlarlboro Sl.. Nvwton "The glory :gf Titian hair." lit-vg liorn April 126, lfltlti: Gr-nvral lhCg lligs-lou tlrannnar: French t.lub, .iz iXl'NYlfllllll'. .l. lllllilfllfl' NEW l'll,l, SISSUN ht! Austin Sl., Na-wtonvillc "Silf'm'e isrfl hlixsf' llobg liorn April 8. N082 S1-ivntilirt IQCQ Junior lligln W1-slvyanz Frvncll Club, 2, Ii: Spanish Club. Il. -I-3 Track Squad. l. 2: Football Squad. l, 2: Stuilvnt Council. 3. Zll,lAll GIIACIC Sl.l'1lCl'lCli 222 Nlamlison Avia, lN4-wtonvillc "fl ,x'l.Ildll0l1I'l ix Il fnunluiu Qf glrul1u'xs." Zillapluonn-3 Born Steph-lnlwr 5, H1051 tit-rnvml LHC, .lunior lliglxg Mt. Sinai llospilul. Hlitlllt I li SMITII Z2 ix1t'l'll2llllt' Sl.. TN:-wlon llppvr Falls " llr' Iirvx Inny llml Iirrs well." Smitty: llorn Uclolror 0, 1008: l':lt'l'll'll'lll AT: llyclv tirannnar: Nortlxvaslf-rn: 'l'ra1'k Squad, l, 2. 3. -l: .lunior Xarsity Base-ball, 1. 2, fl: lloz-lu-y Squad. l: Constitutional Convonlion. 3: Class llvlay. 4: llouor lloll. l, 22 Nvwtonilu, 1. lx.-X'l'llllYN l"lll,l.l'Ill SMITH I5 Nloorlvlilfv llrl., Newton lligzhlanrls 'iFul0 Irivrl In r'nm'1'ul hw' by rmminy her Srnillif' kay: Born llc-vt-lnlwr 26. lfltlllg Classival l8C: llyclv llrannnarg Simmons: Class Svvrc-tary. 1: Alpha llvta. l. 2: Fra-m'h Club. Il. lx lfngzlisb Club, Ii, ,lg Nlalln Club. Il, rl: film: Club. Il. tl: Library Club. 1-1 Sven-- tary-'l'r4-asurvr, lt: lNcwlonitf-. 3. li Sr-nior Play Connnittvc. lg llouor lloll. l,12.Il, l. Cl.ll"l"UlllJ lllISSl'1l.l. SVNUW T3 Lornbarrl St., iN1WVl0ll H H0 fllllllf ul llw r1'y1l1l hour 111111 hz' was lhe righl man." Clill': liorn Oc-lobe-r 1, WUT: Classi- vnl 2lC1 P1-irvv lifllllllllllfl liowcloin: Frvnvll Club, Alf: Math Club. l: Junior Yarsity lfootball. l-: 'l'rnc'k, 51 Lvgislaturv. 5. GIADYS lll l'l'Il SN l'Il.l. '18 Faxon SL., N1-wl.on "Swivel uffm'r'. IIIIIIUIIIVIIVS kfwps luv' plumf' lllanl: liorn .luly 8. WUTQ CI:-rival 205'l'1 .lunior lligzln. lx ICN lNli'l'll lx HLSICN Slllilll. T3 liaposia St., 'Xuburrnlalv "nl lll0I'lIl .w'Ils1'lrl1' vnuny lllIlll.H lxvni Horn Uvtobvr 22, lfillli Srivntilic' LII-C: Nlaltlc-n lligll: ll. l State-1 Ninth Club, 2: N1-wtonian. ll EDF 3.9263 TIIELMA VIRGINIA STANLEY 158 Moffat. Hd., VVaban .iMISll'l'SS fy' lzrrself lhnuyh Clufrm jails." Thcl: Born September I, 1908: Classical ISC: Angier Grammar: Oberlin: Math Club, 2, 3, -I-: English Club, 4: Latin Club, 4: Secretary, -ll: Newtonite, "1-. EDWARD WALKER STEAHNS 11 Eden Ave., VVGSL Newton "Silence is goldenf' Ed, Eddie: Born January 22. 1908: Classical ISC: Peirce Grammar: Dartmouth: French Club, 3, 4: Latin Club. -1-: Math Club, 3, 4. MARJORIE LOUISE STEVENS S Jenison St., Newtonvillc "Fil for 0 piflzlref' Midge: Born February 13, 1909: Stenographic 109T: Lawrence High: Commercial Club, 3, 4: Senior Play Committee. 4. STELLA IIARRIET STEVENS 69 Court St., Newtonville "M0sl gentle is she." Bom July 23, 1908: Clerical 204-T: Junior High: Commercial Club. 4. JAMES MATTHEW STEVENSON 329 Newtonville Ave., Newtonville "SiIcnI but deep." Born July 16, 1908: Printing AT: Clallin Grammar: Orchestra, 3, 4: Glee Club, 4. LESLIE HENRY ST. LAWVRENCE 263 Waban, Ave., VVaban "Ile who is well paid is well salisfirdf' Less. Saint: Born June 10, 1907: Scientific 24C: NVolcott Grammar: Vllorcestcr Tech: Drama Club, 3, 4: lVIath Club. 3, ft. FLORENCE SYLYIA STOLLOW T6 Austin St.. Nowtonville "Spr'0f'l1 is Ihr: rnmmnn 0101111111 of mankind." Flo: Ilorn August 31. l908: Ccneral l8C: Junior High: Wore-4-str-r Normal: French Club, -I. FAITH STUNE 53 Elmore St., Newton Centro "A kind hmrl is u founluin of flll'ldIIl'SS.H Born September 23, 1908: Classi- cal 19C: Mason Grammar: Mt. Holyoke: Alpha Beta. 1. 2: English Club, 3, 4: French Club, 3, 4: Secre- tary, -I-: Math Club, 2, 3, MI-: Secre- tary, 4: Drama Club, 4: Newtonite Copy Editor, 3: Constitutional Con- vention, 3: Senior Play Committee. 4. EDWARD AUBREY STIIUM 77 Arlington St., Newton "One 1-anno! know ever-vlh inyf, Eddie, Ed: Born May 4, 1909: Classical l8C: Bigelow Grammar: Vllesleyanz Math Club, 3, 4: Treas- urer, 4: French Club, 3, 4. GRACE MAGDALENE STRUM 77 Arlington St., Newton "Si11cf'ril,v and lrulh are Ihe basis :J Cl'l'l'4V virtue." llcnural lfxC: Bigelow Grammar. " -13 Gracious. Skit: Born .luly 16, 1906: THE NEWTQNMN 11 ELEN STUART 123 Langley Rd., Newton Centre "She lrips Ihr' Iiqhlfanlaslic lov." Pete: Rorn May 15. 1908: Classi- vul I yr.. General 3 yrs., 14C: Mason tlraunmnrz Miss VVheelock's: Spanish Club, 3. ill: Secretary, 41 English Club, 4: Ifrencxh Club. AI-Q Honor Roll, 443 Volley Rall. I, Newtonitc, 2. IDOROTIIY NIACDALENE S'I'lIMI"F T0 River St.. Wiest. Newton "l.u1wl by all who krmu' hor." Dol. Dottie, Rorn November II, 19071 th-nerul I9C: Peirre Grammar: Roslon Ifniversily: Spanish Club, 5: tile-e Club, 5: llonor Roll, 1, 2. L01 HSE FREDERICK SIIIIR 8 Grant St.. Auburmlulf' "fin urlisl in Ihr lIIll'x'iIIfI.n Rorn July I. 19093 General 2ICg llurr Grzunmurz Mass. Normal Ari: Wlzilh Club. 2. AI: English Club, 1: Library Club, -I: Newlonilv. -lg lNl'N'l0IllIlll. I. ANNA CATlll'IllllNl'I SULLIXANI QOT Elliot SI.. Ne-wlon I pper lfulls " lluppy as ll clam ul hiqlz lille." Sully: llorn July IQ. 19071 Steno- ,urupllir Il0'l': Emerson iifilllllllilfl Comme-r1'i:nl Club, ll: llome- Evonomius Club. -I. l"l,Ul1lCNCl'1 Rl'l'A SIILLIIAIN 201' Elliot St., Newton Upper Falls "Sim nuzbv lm Slilllll, lull m'r1'r lirlrnllspfrlzollx.U 'l'm'ny3 Rorn 11041-llllml' 6, 19083 Sll'l1UjJl'IlllllIl' ll0'l': l':Ill0l'SOIl Crzun- l1lilI'1 Conum-rvizil Club. I. FRANCIS EUGENE SULLIVAN 64 Pine St., Relmunt "I srrrrf' Sully: Rom January 28, 19083 Electrical ATL Relmont Ilighz Lowell Tech. FLORENCE EDITH SUTCLIFFE 54 VVard SL., Newton Centre "fl nzrrrhv hrurl mukelh U cheerful l'0Ul1ll'lll1IlCf'.,i Rorn March I-1, 1908: Cleriral: Prince Grammar. FRED NVILLIAM SVVAIN 55 11051 Pina- St., Auburnflule "JI num uffvw words." Rorn August 2, 19011: Business lll'l': Rurr Grzumnnrz Georgia Tech: Constilulionul Convention. 3: Legis- luturv. 3. AI: Math Club. 3: Orange Rook, 33 fi0lIlIll1'l'l'Iill Club, -I, NI.-'tI1Y CI.II'l"0RI1 SIN ITZLER I9 ll:-nniuglon Sl.. Newton "fl Ifillillil lwurl ruldx feulhvr Io Ihr' hw-I." Xluy. Swilzlvrg llorn .Iuly 26. 19075 Classical ZZ yrs.. Gem-rul Il yrs . ZICQ Rigf-low Crzuumur: Gibbs Secretarial: Spanish Club, -I. 53 Treausurer, 5. LEON ARD TAYLOR 95 Dudley Rd., N1-wton'Centre "fl man qffvu' words." Juggur: Rorn .Iuly 17, 1907g Elv4'll'ic'ul AT: Mason Grammar. INIARY ELIZABISTII TILTUN 28 NYaban Avi-., xmbttn " llhen u woman has no llIlSll'l'l', Ihe sea has no wulr-r." Till: Born December T. 1900, Classical I9C: Angivr Grammar: Boston School ol' Physical lixluuationg Alpha Beta, I, 2: Ilonor lloll, I, 23 English Club, -L: Scvrelary, -I: Latin Club, 4: Presiclvnt, -l-1 Class Baseball, 1. 2: Captain. l: Class Baskf-tball, 4: Varsity Baskvtball, -I: I"rc-nch Club, I-. CHARLES EDWARD 'I'I MBI li 295 Highland Ave., W1-st. lNcwl,on "The pen is mighlier lhun lhe sword." Cornie: Born Septvmber 27, 1007: Classival IHC: Ilycle Granunar: Vlil- liams: Math Club, 2. 3: French Club. 3, I: Sf-nior Play. 41 Drama Club. 4. ALVIN RAN DULPII 'l'l'l'l,IS 50 I":ilmouth St.. Bnlmont "Noi lon good. lim-fillxc llic youd die vnungf' Al: Born May Ifl. lfltlo: Agrivul- Lure AT: ANIIICFIUWII llighg Class President, 1: Nvwtonilv. I: Agri- culture Club. fl: Prvsidf-nt, -I: Class Hockey, 1, 22, ETIIEL IWAE TUINRY hi' Nlariou Natick "l,11fv-liurz Juan, mv nmnlillu und ll fllll.u Babe: Born lVIay 18, 1007: Stvno- graphiv IOOTQ Boston Iinglish llighg Boston University: Conunoruial Club, 3. I: Spanish Club, 2: English Club, 3: Legislature. -L: Constitutional Con- vention, 3: Social Coininillf-0, lt: Newtonite, 2. JOHN LATIMER 'I'I III N ICR 61 Brookline St.. Newton Conlre "Sfl'i1'c' und Slu'r'1'1'd." Jay: Born .Iunv Il, IOUTL Sviuntilic 2-IC: Mason Granunar: M. I. 'l'. 3.926 E YA FR A NC ES TWOM IS LY 38 Wialnut Pl., Newtonville "A kI'I1f1l18fll'l is ll fountain of glfulrm.vs." Eve: Born January 27, UNIT: llvncral lhC: Arlington Iligzhg New- ton Ilospital. VIRGINIA ICLINURIC VAN WINKIJC If: Churvhill Tor.. Nvwtonvillo "lndu0d w1'll1 surzrlil-v :J reason . ' ' Gina: Born Svptf-nibcr 18, WUT: llmmral 21C: Montvlair Iliuh. ANNIE MARY VOLANTIC DWI Dvrlham St., Newton Cf-ntre "A good mind possesses fl king- doin." Born June- 15. 1900: Classical I8C: Mason Grammar: Vlfnlloslvyl NOW! tonitv, P1-: Fr:-nch Club, 3: Lalin Club, 3. Ig Library Club, -I. BUSIC XUI.AlN'l'l'i ZWI Ijlxllllillll St.. Nf-wton Contri- UTI11' lf-ue hllDPI.I1t?SS QI' u re- lirwl IlIl1llI'f'.u Rosy: Born Uctobvr I0, IIIIITZ Classical ISC: lllason IIFZIIIIIIIIITI Vliullosloyg Class Baskvtball. 2, il. 'll Yarsily Basketball, 4: Class Ilovkvy. 3, lg Varsity Ilockvy, I-1 linglish Club, I: Class Baseball, 2, Zig Mall: Club, lt: l"r0noli Club, 3. MARY liI.IZABlC'I'II WAIIN lil! I ll Cypress SL.. Newton Cvntrv "Uh ll'hlll u pul was lUur'.v."' Mary Olivm-r: Born July fl, I008: Classival I yr., lion:-ral 3 yrs., BIC: llycla- Ilranunarz Simmons: Spanish Club. Al: Fri-nvli Club. tl. ... gh X., f THE NEWTQNHAN l'Il,liANUll HOBICHTA NYALSII 208 Lungxley llrl.. Nvwtou C4-nlrc "A rlmrnzinq 4'lIIIll7tIIll0Il,' fl lrrm frivmlf' Hobbyg Burn April 16, 19093 Str-nogruplniv lllU'l'g Nlusun Gram- mar: lloslou Univvrsilyg Class Secre- lury, 3: Cmmnerciul Club. lc Secrcr tary. -ll Ncvvlonil,c, 32 liuglisb Club, 3, lg Urvlwslra, l: llnnur Roll. l, 23 Sa-uiur l'luy llUlljllllll1'l'. l. FIKANK ALLICN NN AMISULIDT 21 VVl1illow0 llnl., NN 1-st IM-wlun " ll'e r'un'l miss Nw fun." Iloru Sept.:-nilwr T. IOOTQ liusinvss lll'I'g XYultlxam Nurlb Junior lligbg lifilllllltfffflill Club, lx. W l LLI A M W A NSR EH 81 Berkshire lhl., Nowtonville "Unc'x roridllrl is u lrue mirror." Wim: Vlfilliug lluru August 15, F1083 Scivlitilic' l9Cg llflglllllll llighg Lui- vursily of Nluinv. NX Al,'l'l'Ili lil RHICSS NN AIINICTN. JR. 970 llvzluoll Sl., N0vsl.un Cvnlrv "lJu,vl4v Ilm lrnillulllmil' lnzlflwal his quilurf' Burgn: llurn August IT, IUUTQ Scicntilic Hull: xYllSlllllg!l0Il lliglng liuiversily ol' llenusylvuniag linglisb Llub. l. Nl Klilbli NN ICAX l'Ill III NN:u'wirilm llml.. XX 1-sl TX:-xxluu "4 jmjful xlur nw' yll'lllIIlIlll Irilh lll'l'!lIllIll'XS.H 'llvclclyg liorn June- LII, IOUTL Slvnogruplnic' ll0'l'g l'4-in-v lil'ilIlllllIlI'1 Cmmum-rciul Club. l. SIDN ICY IIASK l NS W l'IBS'l'l'IH IH- Tlmxlvr liil.. N4-wlnnville .. ln IYIIIIPIIIIY 41 rmjv plruxunl ff'llnu'." Sid. Sonny: lluru 'Nuvmnbvr 26. l908: Svic-uliliv llxC: .lunior lligzbg iNurllu'usIe-rug Urvlwslru. 2. 31 ll-und, ll 'l'rzu'ls. 2. lll'Il,l'iN lll'l'.-K VVICLCII 101 lliw-r Sl.. VU-sh N4-wlml "A quid rlfnwzuwr mzwriruy up lolx qf fun." Divk: Burn January I8. l008: lla-m'r:il Zlfl-C1 P4-ircru Grzunmarz Boston lluivvrsily. NIAILIORII-I liNl'Il.YN Wlilllll 10 Morton Sl., VN vllvslcy "Wil ix II1-v name, url lhy funu'." Nlimlgv, Marge: llurn Junuury 2, 10003 llunvrzil IIC: Vlullcslvy llighg Normal Arlg Ulm: Club, -lg llvullb Llub, .l. ROSA MUND l'IS'l'lCl,LA Wl5N'l'WUll'l'lI 36 l'lVl'l'g!I'l'0Il Ave-,. Auburmlulv "Simpl1'1'il.v :gf f'lmr'm'lf'r' is Ihr' nulurul resull :J Umughlf' llnsic, llossig Burn April 5, N073 Cumlm-rrrial 20U'l'g liurr Hrzmunnrg English Club, 43 Couuncruiul Club, bl. NYILFIKICID ALPIXANIDICIK NYlC'l'lll'llll4lClC 21 Urcbnrcl St., Ncwluu "ln everivlliirly he jindelh lflllfI'1ll'I'.U Hul.: Burn Nlurvll fi, IOU8: Svivnlilic lull: lligelovs llnumnurg Huston University: Nvwluuile. l. ,Y 1 1. 'M "'!N9'P" Q02 oe MAHJOHIE WHEATON 35 Aberdeen St., Newton Highlands "Arlislir but no! painfully so." Monieg Born October 31, 19083 General 2-flCg Hyde Grammar: Nor- mal Artg Newtonite, Ig Newtonian, 43 French Club, 2. EDGAR TRAIN WHITE, JR. 51 Hawthorne Ave., Auburndale " His soul is us while as his name." Ned, Erlgieg Born November 16, 1907, Scientific 2-lCg Burr Grammar, M. 1, T.: Math Club, 1. 2. 33 Con- stitutional Convention. 3: GEORGE WILLIAM WHITE 140 Newtonville Ave., Newton "If he determines he will rule lhe world." Blackie, Born July I4-, 1906, Scientific 16C: Bigelow Grammar: M. A. C.: Track. 1, 2. 3. JOIIN JOSEPH WHITE 67 Cherry Pl., West Newton "A genllemun knows all, bu! shows il noi." Born July 11, 1908: Business 111T: Peirce Grarumarg Class Treasurer, 2, Commercial Club, 4-1 Business Manager Newtonian, 4143 Legisla- ture, 4. RUTII MAEFRED W1II'I'l'II'IOUSE 710 Washington St., Wellesley "My knowledge CUIIILUI be slolen from me." Born November 25, 19083 General 1flCg Wellesley Junior llighg Class Assistant Treasurer, 2, 3, Legislature, 3: llealth Club, 33 President, 3, Orange Book, 3, Home Economics Club, 43 Honor Roll, 2, 3, 4. HULNIES IIINCKLEY WIIITMOHE 51 Carver Rd., Newton Highlands "I came, I sow, I conquered." Whit, Born August 10, 1907: Classical l9C: Hyde Grammar: Harvardg Class President, 1, 2, Student Council. 1, 2, Zig President Associates. 5: Executive Council, 5, Baseball. 3, 41, 5: Hockey, 3, 5. EDITH IIUVVARD VVILLCUX 8 Birch Hill Rd., Newtonville "Her lulenls were of Ihe more silenl class." Bunny, Squeakg Born September 30, 1908: Classical l9Cg Peirce Grammar: Vassar: Class Hockey. 43 French Club, 3. 41 English Club, fl-3 Math Club. lg Honor Holl, 3. ELIZABETH BEHTIIA WILDMAN 33 Summer St., Newton Upper Falls "A good scoul is as lrue ns slcelf' Berth, Libbyg Born December 27, 1907g Stenographic 1l0Tg Emerson Grammar: Prize Speaking, 1. ADELAIDE VICTORIA WILLIAMS 102 Erie Ave., Newton Highlands "There is mrzjeslic grandeur in lrrlnquillily " Vic, Vicieg Born May 24, 1908, Classical l8Cg Hyde Grammar: Mt. Holyoke: Glee Club, 3, 4, 5: Presi- dent, 55 Math Club, 5. MARTHA LINETA NVILLSON 78 Madisoll Ave.,Newlonville "A smile for rz'er,vIuulv." Bom December 29, 1907, Classi- cal 24-Cg Clallin Grammar: Skifllllorvl Constitutional Convention, 3: Class Basketball, 1, 2: Class Hockey, 1, 22 Class Baseball, lg Glen Club. 5: Spanish Club, -lg Secretary-Treasurer, fl-. 'X Y.. LSL 'Q UQ u' W . siiiiigz, L , is 3' A . 1 'fh- TTFIE NETWTQNJIAN ui, ii, ,,:w,.,i,, mlm., , , , Hll'1'l1 AGA'I'1lA NYILSON 1-1 P12119 St., N1-wlon llppvr Falls " IIN' lmir irux nal more sunny Ihun hw' heur'l." liabv lluth: Horn June 18, 1007, Clz-rival 201711 Needham llighg Conunorvial Club, 'L Rlffl IAHD AUSTI N NYINSLOXV l li Woodland Rd., Auburndalc 'Yienlle in manners, bu! reso- lulv in dard." Dirk, Farmer, Born Svptvinlwr 20, 10083 Scif-ntilic LHC: Burr Grammar: 'l'nl'lsg Wlatli Club, 3, -lr: l"rf'nc:li Club, lg Spanish Club, Il, ,lg Yarsity Or- :-lu-slra, li: llanil, 441 Constitutional Conn-nlion, 3. GLADYS NNITIIINGTON T3 Loinbaril St., Newton "fl l'Ill'l'l1fIlI .vpiril is mlm! Ihre AIIINPS low." Glad, Bcanim-3 Horn Decmnln-1' 12, 1007: Classical 1811, Peirce Grammar, Simmons, Glvn Club, -1. MANY l'Il,1Z:Xlil'I'l'll Nl l11Gll'l' T00 lic-ac-on Sl., New Lon Cr-ntre "l'iwv'Il1' is dwul. nom l1'rvj'nr www' jilir, I,I'lIlll'llll,,l liorn January 8, 1900, Classical HEC, 'Xlason Grammar: Simmons: 'Xlalli Club, fl, 1143 Frm-iicli Club, -113 lfnglisli Club, Il, li: Drama Club, 44, Glow- Club. -lg Svuior Play,-1. SAHMI HICNNISON NN RIGHT 19 Nic,-loria Cir., Newton Centre ".Alrull11'r1'oi4'r l1'u.vx11'el'l and low." Sally, Horn .lunc 26, 19083 Classi- 1-al Hill, Junior lliglig Wellesley: Naewt,onit,1,-, l, 41, Glen Club, 4. ,X onli ii 1, W iw ni: Mwiiwi-M LLOYD STANDISH YOUNG 19 VVooclbine St., Auburndale "I '11 laugh Ioduy if iomorrouv I div." Cy, Algy, Born Dfff'f?IIlbCf 1-1, 1906' Business 111'1'g Clallin Grammar, Boston Univvrsityg Nlatli Club, Il, Connnvrvial Club, lg Base-ball, 2, 33 Football Squad, 'lg Ncwtonitv, 2: Track Squad, 3, 11 Manager Class Ilovkcy, 3. ALFHICD ZIEGLICR 580 Vvalnut St., Ncwtonville IKCOIIIIIIOII sense is no! a mm- mon lhinqf' Al, Born January 6. N093 Scivn- tilic IHC: Junior lligli, M. 1. T.: Niall: Club, 3, -ll, CAROLINE DURANT ZIEGLEIK 181 Windsor Rd., Vliaban " 'Tis no luxk for suns lo Slllllllill Carolg Born May T, 1909, Classival 1811, Girls' Laling Wlillfrsluyg English Club, 31 Malli Club, 3, lg Library Club, IQ Newlonilv, -lg Senior Play Connnittev, All, l,IONS'1'ANl1I'I 1llf111l3l'111T ZIEGLICH 181 Windsor lhl., NYaban "fl zlerirlnl opiriinn, ,vrl u clrcwful .vrnilr " Cunning Born Novcmbf-r 21, IOOTQ Classival IHC: Girls' Latin, Miss xYllCl'l0l'k,S1 Glue Club, -L IIICLICN DOROTHY BENN1'I'1"1' 64 YN yolning lid., Newtonvillc " llinges IJ lru1'friendship ne'cr go ruslyf' Dot: Born April ll, l908g Classical 19C, Our Lady'sg Wbllcsleyg Math Club, 3, -1-g l"'rench Club, -lg Honor Roll, 2. N.15.- Nlisplaced by error. W llllllEl5llll5llllFlllFFIllllFPFllllllll!llFllllllllllllllllllllFlFll'FVPFFFFllll11llllllllllllllllli3IllFlFPFllllllllllllllllllll CLASS OF 31926 llllllll1lF?ll1FFllllllllFFll'llllllllllllllFl?'l!llllllllllllllllllllllllllllllllllllililll W FRANCIS T. REIRNE 7 River st., satin. Natick lg "An unassuming youlh who lreads wilh greal men." Ozzie: Born April 24, 1908: Electrical AT: Natick High: M. I. T.: Class Baseball. 3: Senior Play Comlnitlee, AL. JOHN FRYE BELL 9 Maple Pk., Newton Centre "Verilabl,v, a Chinese puzzle." . BorII July 29, 1909: Classical 18C: Mason Grammar: Yale: Math Club, 4. FREDERIC JOHN CALLAHAN 33 Mague Ave., NVest Newton 2 " He was all sunshine." 3 Fred: Born January 12, 1908: Business 111'I': Peirce Grammar: Commercial Club, 4: Senior Play Coniinittef-, At: Class Baseball. 1, 2, 3: Class Football, 1, 2, 3. ALFRED CHURCH so Judkins st., N.-WIUIIVIIIQ "Silent and reserved." l Axe, Al: Born April 16, 1907: Scientific HC: Junior High: University of California j gg JAMES WILLIAM DANIELS 51 Early st.. MSI. Nt-Wien 2 "The lang of Ihe sea is ever wilh me." Jimmy, Dan: Born October 3, 1907: Business l11T: Gloucester High: Commercial Club, 4. i JOHN JOSEPH D'ARCY 62 Court. st., N.-wttmviiita "There is only one proof of ability - aelionf' 2 Jack: Born February 16, 1909: Business 111T: Parochial Grammar: Northeastern: Newtonite, Alt: f30lllI1ll'l'l1llil Club, 4: Class Treasurer, 2: Math Club, 3, 4: Senior Play Committee, 4. MADALINE ANDRoss DOGGETT 504 California st., Npwamviiie g "The quiet mind is mos! happy." 2 Doc: Born February 5, 1908: Classical 24C: Dorchester High: Boston University: Orchestra, -l: French Club. 5, WILLIAM HENRY DOLAN, JR. 342 Lexington St.. Auburndale E I " Happiness is his middle name." 5 Blondie, Bill: Born November 11, 1907: Business 111T: Burr Grammar. 1 E MARGARET HORNBY FAIRCHILD 3 Oak Ter., Newton llighlanrls V " lVil is the salt of eonuersalionf' 5 g Peg, Mig: Born October 30. 1907: Classical 3 yrs., 14C: Hyde Grammar: Simmons: Matin Club, 3: French Club, 3. TALMADGE ECKERT FLETCHER 100 Madison Ave., Newtonville "Men may come: men may qv, bul I lalk on forever I 2 Tal: Born December 13, 1907: Scientific l6C: Binghamton High: Business Manager Newtonite, 3, 4-: Drama Club. -L. Q RUTH ELIZABETH GANLEY 38 oak Ave., xvese. Newton "An open-hearled maiden full of joy." 5 Born April 25, 1908: Stenographic 109T: Peirce Grammar: Commercial Club, ll-. , ANSON GROVER GARFIELD T7 Kaposia St., Auburnmlale "A general oplimislf' Andy, Spike: Born May 23, 1909: Business 11lT: Burr Grammar: Commercial Club, fl: Class Football, 1, 2: Class Baseball, 1, 2. i RICHARD GREGORY GRAHAM, JR. 19 Old Colony Rd., Chestnut llill "Good nalure is slronger lhan lomahawksf' Bud: Born January 15, 1907: General 111T: Mason Grammar: Boston University. BERTHA ESTHER GREENWALD 107 West St., Newton "Silence is golden." E Boy: Born May 14, 1909: Commercial l09T: Junior High: Commercial Club, 4. g ETHEL CAROLINE HAFFERMEHL 84 NValpole St., Canton "Those dark, deep orbs, how we envy lhemf' g Carrie: Born February 12, 1908: Clerical 209T: Mason Grammar: Conservatory: Commercial Club, IS, -L. MARGARET HARVEY 167 Hicks St., West N4-wton 2 " Happiness consisls in aclivillvf' 2 2 Peg: Born May 26, 1907: Clerical 209T: Peirce Grammar: Howard: Commercial Club, 4: Class Baseball. 2. V g ROSAMOND WORTERS HINE 83 Central Ave., Newtonville . "Deeds, not words." 3 Rose, Rozie: Born June 17, 1907: Classical 18C: Horace Mann Grammar: Boston University: Glee Cluh.2, 3, 1: Legislature, 3. i g MERRILL BRUCE HUNTING 147 Hancock St., Auburntlale 2 " Henre, all ye vain deliglzlsf' Mel, Mal: Born May 28, 1908: Classical 18C: Taft: Yale. FANNIE SYLVIA KLIGMAN -156 VVatertown st.. Newtonville g "A kind hear! is a founlain :J gladnessf' 2 Born March 20, 1908: Commercial 209T: Junior High: Commercial Club, -1-. g ESTELLE CLAIRE LACROIX 289 IVatertown St., Newton g "A sweeter girl ne'er walked Ihe earlh." g Born November 22, 1909: Stenographic l09T: JuIIior High: Orchestra, 2, 3, 4: Commercial Club. 4. MitiIIEIiiIEEEEEiEiEiiEEiIiiiiiilIit1IiIiiiii6iiEEiEiIiIEiiiiiiiiiiiiiil1ii1hE1iiiiEIEEE6EitiiiiiiIii11iEiiEHilhMl1iliiiiiIIIIIIhhhhhllhhhhit1iiiliillliillhhhhhhriiltiiiiiiiiiiil11ihh1lII11likiiliiliHhlhiiiiiimwillhit1itiiiiiiilllillHhlhibiihlllillulul11lllliillntiuHIIIititillummmmmmillnnnnmmmI1mrIunmnmmInuIIIIIIInunmnumummmitnntmnnI1mnImu141utItnmmumunnnnuI4IIntttwwunmtml 49 M111'll1111'llll'll1'llllll'1lll'1lll'llllllllllllllT'l''UlQQ1'l111'111lll'1'lllll'lll'U1'l THE NEWTONIAN 1.lllllllllIll'Fllll'.l'F1llllFPWl1llllllllFEF1lllllll'!llllFFllllllllll.llll'!lI'llllllllllllllllllM E2 .louw Jost-:Pu 1.YoNs 14 Lyman st., Newton centre 2 "Willing lo do his parl lhough unobserved." E 2 Born June 28, 1907: Classical 19C: Mason Grammar: Boston College. 2 JOHN MACIVEIK 125 1Vinchester St., Newton Highlands E : "A silenl, shy, peace loving man of veryfew words." 3 Mac: Born September 19. 1908: Business 111T: Hyde Grammar: Commercial Club, 4. E MAHGA B ET MARY MACNEIL 35 Brooks Ave., Newtonville E f " Her likes are as slrong as her dislikes." E Peggy: Born September 10. 1905: General 27C: Peirce Grammar. 3 S JOHN CIKOITKETT MILLA 1lD 1136 Centre St., Newton Centre " He seeks nolfarne, bul harmony. ' E gg Johnny: Born March 23, 1907: General 24C: Mason Grammar: Dennison: Junior Varsity Football, 3, 4: E f Drama Club. 5: Senior Play, 5. e E. E Mnvmnnn LEWIS uoonv 27 Park st., Newton 2 "A man of cheerful ,veslerdays and confidenl lomorrowsf' E 3 2 2 Born February 7, 1908: Classical 24C: Bigelow Grammar: Harvard: Legislature, 5: French Club, 4, 5: Math Club, 4, 5. 3 EDWARD ALLEN MOORE 22 Winthrop St., WValtham "Every man for himseU'." 2 Born .luly 25, 1908: Automobile AT: VValtham High. l'luscu.t.A Momsow Vernon Ct., Newton E "Good nalure is a sign. of a generous soul." E 2 1 Pris: Born October 25. 1909: General 24C: Junior High: Fine Arts and Crafts. E HELEN CAROLINE MULLER 116 Church St., Newton 3 "A maiden modest and self-possessed." 2 2 2 Born November 27, 1905: Business 106T: New Orleans High: Boston University: Newtonite, 3. 4. 2 2 maui' Jostcvu MURPHY 903 Walnut st., Newton Ieligntnnde E 5 "Common sense is nol a common lhing." 2 Phil, Spud: Born July 4, 1906: Classical 24C: Hyde Grammar: Boston College: Football, 4, 5. JOEL MCGIXEGOIK NICHOLS 399 Central St., Auburndale E "Firsl a man, lhen a genllemanf' gi Small Change. Joe: Born May 9, 1907: Scientific 21-C: Burr Grammar: Bowdoin: Senior Play, 4: Math Club, 3, 4. 5 f JOHN NOBDBLOM 1000 Walnut St., Newton Highlands i f " His fair hair my heart enrrhainedf' E E E Jack: Born April 29, 1907: Classical 24C: Boston English High: Harvard: Hockey Squad, 4: Baseball Squad. 3, 4. 32 EILEEN ELIZABETH PABK 3 VVinthrop St., West Newton E "A lillle, liny, prelly, willy, charming darling she." D Nec-lie. Pinky: Bom January 20, 1909: Classical MC: Peirce Grammar: Simmons: Spanish Club, 3. 3 - JAM ES 1"1lEDI'I1K1C POLAND 181 Lexington St.. Auburndale E 5 " He who works hard deserves success." 2 E Jimmie: Born August 12, 1908: Business 111T: Burr Grammar: Boston University: English Club, 4: Commercial 5 Club. 4: Senior Play Committee, 4: Honor Boll, 4: Class Baseball, 3, 4. ? WILLIAM DYSON PROCTOB 45 Elliot St., Newton Highlands 2 "An ine1:pressible something." Goat: Born April 2, 1906: Cabinet AT: Hyde Grammar: Springfield: Class Relay, 3: Class Baseball, 3: Class Hockey Captain. 3: Varsity Football, 4: Varsity Baseball, 3: Varsity Hockey, 4. NEIDBA ISABELLE SMITH 36 Nathan Rd., Newton Centre g "She acknowledged no masler." E 5 Smithy: Born October 23, 1908: Clerical 209T: Needham High. is A1.vA s1'tatN 17 Kenilworth st., Newton E "l'Vhal manner of man is lhis?" 2 2 Born September 18, 1907: Scientific 24C: Andover: Bowdoin: Swimming, 4: Math Club, 3, 4. 2 JAMES JOSEPH STEVENSON 142 Oak St., Newton Upper Falls "Always al work." 2 2 2 Born October 4, 1909: Business 111T: Emerson Grammar. Ei is MARY Acmas sU1.1.tvAN 329 Lexington st., Auburndale E s "Shc's as lighl on her feel as lhe morning dew." E E Tootsie: Born August 12, 1908: Clerical 209T: Burr Grammar: Commercial Club, 4: Newtonite, 4: Declamation, 1, 2. 3 E PAUL JOSEPH TI IOMAS 16 Prospect Ave., Waltham "Don'l worry about lomorrowf il will soon be yesterday." Born May 19, 1906: Automobile AT: Waltham Junior High: Orchestra, 3, 4: Class Baseball, 2: Class Treasurer, 2. HELEN LORD TREADWELL 70 Eddy St., West Newton 2 2 Thai same old smile greels us slill. 5 E ni Tready: Born April 29, 1907: Commercial 209T: Girls' High: Commercial Club, 4: Volley Ball. 1. ' Zi ET IW immnimlllluurlmlilllliillL1i11iiil5i11iiiiin1t11i1iituH1ii1inui11l1i1liiiuiii1will11ilil11i1i1lliiiii1li111iE6ilil1i1iiiiiEE1liiil1iiiiiiliiittill611ElillH6Eill1h66iiiihiUEl1iii1E1ililhiiiihill66iiii1hi1filliiiiiilE1iilil61iEiiiihhhii1iiiiiih6iiiiiii1111iiiiiililiiiillliiiiili1liiiiiilhiiiiiillhliiiill1h1iiiilliliiiiiklilliiiiiilliiiiillliliii1I11IiiiI1lil1iliiii1i11i11illIIl11iiiiiIi1I1IIiiiilllrlliiii W 50 Wttt 'tttt""'t"tH""""'UUUF'!t'tUftWitttttttitVHttttttfF'FUfW!U?F????fWt NHNETEEN TWt7ENTYe33H33 fl4.YitittYtYUVtYVt.titttttttiltllitl44itttYititWttttiflitWWtttt't"'W't'f'tiff The Voyage of The "Shakespeariana" Prologue ONG years ago. the ancient ship "Shakespeariana" sailed the billowing waves of Education. The history of its four years' voyage was long forgotten. but one day an ancient seaman was discovered Who had treasured in his keeping the log of the ship. The manuscript. though faded and yellow. was finally deciphered. and because of its interesting narrative, is herewith published. It is divided into four sections. as follows: A C0ll19dy of Errors ln the year of Our Lord one thousand nine hundred two and twenty. the good ship "Shakespeariana" did set sail upon her voyage. Being manned by a crew strange and inexperienced, she did meet with great difficulty during the first part of' her cruise. A course uncharted and teeming with perils stretched before her. Mighty vessels bearing haughty crews did sail most scornfully by. Others. kindlier and of a gentler spirit. sought to guide the unlried ship o'er the highest breakers. Having battled the stormy seas nigh unto five moons. the youthful mariners did choose for themselves four leaders: William Cummings. captain: Marion Marshall. hrst mateg Kathryn Smith. log-keeper: and Jolm Holt. purser. Guided by these hands. the good ship did clear the shallows of "final exams" and make her first port. hluch Ado About Nothing Two moons having risen and set. the "Shakespeariana" did resume her excursion. Ben Adams was chosen captain: Bette Davis, first mate: Faith Wing. keeper of the log: and John Holt. purser. ln contests with other ships. the "Shakespeariana" did prove her prowess. At sight of the dense fog of 'fhnal exams" a great lamentation arose, but the ship did successfully pass through the cloud. At her second port she did find two other ships. the "Technicalia" and the "X ocationaliaf' which had embarked at the same time as the "Shakespeari- ana." ln the first year's voyage, the crew of the "Technicalia" chose no leaders. but their second cruise was made under the following officers: Jolm ltanisden. captain: Mabelle Brightman. first mate: Evelyn Keith. keeper of the log: and John White. purser. Their journey thus far had been a long and happy one. having included assemblies. a "Freshman Frolicf, and a contest for the best speakers. The crew excelled in athletic feats, and many seamen were of a musical trend. The "Yocationalia," also, possessed a worthy record. The leaders who did guide it over the stormy waters of the first year were: Alvin Titus. captain: Robert Barr. first mateg Dorothy McCullough. keeper of the log: and Carolyn Pomeroy. purser. Meetings were held jointly with other ships and did brighten the days ol' this long voyage. The second yearis cruise was an even merrier one. Oft did they feast and many were the jovial gatherings in which they did partici- pate. The crew chose for its leaders that year: Robert Barr. captain: Xlice t l i' , '--2 . t mtl tttth. iti. tmttiii-ww tuuuut IIIItIIIIIIIIIIIIIItIItIIIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiItItItifLiliIiliIIIIIIIIIIIIIIIIIililIlllllllllllllitltlliiftiffiiiiiiiiiiii liititlifiiitiiiiiiiiiiiiiiiiiiiiiiiiit iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiitiltittttitAtitiiiiiit'til'tlllllli-iliilitiiiiitliiiitiiiiIYifiiiiiiiiiiifiiWW 51 llllllllll lllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIlllllllllllllllllllllllllllllllllll 1-HE NEWTQNHAN Illlllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll llllllllll Goodnow. f'u'st mateg Evelyn Allingham, succeeded by Joseph Ball, keeper of the log: and Edward Jones. succeeded by Paul Thomas, purser. Thus. at the end of two years. the three noble ships did meet and their crews did unite. The Tempest The united crews. after a sojourn of nigh three moons. set sail upon the third part of their voyage. And lol the ruler of the vast seas of Education did summon selected seamen from the many ships to make charts according to which all should proceed. And when this had been done, the three crews were indeed united in every way. The seamen then chose for themselves these leaders: Ben Adams. captain: lllabelle Brightman. first mateg Eleanor Walsh. recorder of the cruise: and Ralph Richardson. purser. Soon the course did grow most difficult to navigate, but at last, having weathered the roughest sea of all up to this point, the "Sl1akespeariana" cast anchor in her third port. All's Well That Ends Well ltejoicing. yet sorrowing that her cruise was well nigh completed. the "Shake- spearianau did start upon the last lap of her voyage. The veteran crew chose leaders once more: Ben Adams. captain: Guy Holbrook. first mate: Jean Mac- Donald. second mateg William Hall. keeper of the logg and Carl Nelson. purser. When the winter sun was sinking low. the older seamen did hold a frolic to which many of the younger fry did come. Later. chosen mariners of the vessel pre- sented a play entitled "Prunella." All too soon, the ship approached her destined port. Afar ofl' was sighted the rock-bound coast whose jutting barriers of "exams" must first be passed. After due maneuvering the jagged rocks were safely eluded. and the faithful ship did sail on a smooth sea into a sheltered bay, with all hands on deck to view the glory of the 6'City of Knowledge." BETA HEx1ENwAY. llllu lllllull1lullllllmllulllllulllullllulln1mul4llI1u1uulll111uumlmH1llI111llllu1nnrlllmllimuIlllllllnu1illulilluuuullIl11lllin1ulllllllllllllnllluIulullll1IIIlillilliilIlillillliliiililllillililillllllluillllilllllllllllllrllllllllllllllluulnllllnunullHIlllllIlmilllllllIlllllllllllllllllllllilillllliilil1H11mmsnulunllllu Illllllllll 52 I W li LHMH muxnxxMHHMHH II IHWHHWNWNW IDTHDIETEQEQNT Ww w v :Q- I E maxima Ima lsmsxsna RHWPHTIOR MW UHMH NH H HH 5HHUlii iIlKNKlKEHIIiIiIIHllU11NNiW1ll1lHW HN 1i Hil 5Hiililllllw NHH H UiHHHHliiIiiWWN H HHHHEIW H N H i UWMlAM MNNNHWHHMWH w4 N U V-W? umHHMm m 53 lllllllllllllflllll llll lllllllllll'llllllllllllllllllllllllllllUWlllllllllllllllllllllllllllllllllllllllllllll NEWNTQNHAN llllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll Junior Class Officers an Q Junior Class Ollicers l',I'l'Sl.lll'lIl. William ll. Cummings I'1'cr'-Prf'xiflf'r1l, Paul E. Nason Svcrelary, Marion B. Bonner i Treasurvr, Alfred H. Guzzi W lim1lvillrilliiiliAiimilli11hill1111rrifHiU1nilli1I11nrrH111irrntm1llllullli1iiuilliul1inrtlri11irrmliliilililumal5iliillllilll1iill6lililiilli1rrruiI1ilHiililiiiilliliiiiililiiiil1liiiliuazlliilmiiiillillihilliiillll11iiiiiiini1EiiiiAlll1iiiiiihllH1iihilliEiiiilli111iiiill1iiiiiIli111I1i1iil111Hi1Hi6ll11hInliiillhiiiillLliuiuillllnilllllllAlllLhHnllllillillllliiilllill1iiillllllllllllli W 54 HIIHHIH tIltII1lIIIIIIIlHtlttlttllttttHtttl11l111111l11111111111111ll1HHIHIIIIllIIIIIIIlllllllllllllllllllllll NINETEEN ttl!tlttlttt111tttttttl111ttttit11711111ttttttttttttttttttt The World War of Education IN the vast domain of Newton High School, a world war of education was being waged. It was during September. in the year 1923, that a call to arms was issued. taking in all those who were trained in the grammar school camps. A mighty throng responded, and was, in time, named the regiment "1927". The recruits were told by the commander-in-chief that the main objective was to master the enemy Education. The plan to follow was to hit every obstacle true and hard. and to let nothing pass by one's post. With these few words, the regiment 1927 began its work. The troops battled bravely with such new and worthy foes Algebra. French, and English. It was after a forced march against great odds that the regiment staged a little practice battle with three veteran regiments in a track meet. The 1927 group came out at the bottom. the only thing to expect from green troops. It uncovered, however. some valiant members in Spain. Stubbs, Warren, and one or two others. Spain and Stubbs. combined with some veterans of the other troops, defeated a band of invading Canadians on the ice. During a brief rest, one-half the regiment chose Edgar Wiarren as commander: Alfred Hartridge. first lieutenant, Virginia Spurrier, recorder of the minutes, and Charles Benson, keeper of the funds. The other section elected John Sullivan commander, Ellen Kenefick. first lieutenant, Edna Laubner, recorder of the minutes. and Paul Shannon. keeper of the funds. Nineteen hundred and twenty-seven attended many social functions which were provided for soldiers off duty. When the last ditch battle against the pestering foe June Examinations was over, the tired troop rated leave of absence. In September, 1921, the well-rested regiment returned to wage the second year of battle. Two other regiments united with Section Cv1927, and with these reenforcements, new leaders were elected. They ranked in the following order: Edgar Warren, Bartlett Jewell, Virginia Spurrier, and Charles Casey. With so many new members, it was decided to draw up a constitution. by which the troops might be governed. As before, Spain and Stubbs performed great deeds and in a special encounter in an old section called DRILL SHED, the 1927 section returned third best. The mighty seniors, 1925, were victorious. Many of 1927's members were rank- ing high in the list of brainy achievements. The different organizations of the war received these heroes on their rolls. Their leaders were a little more practised: they called meetings and much was accomplished. 1927 sent its orators into a battle called "A Prize-Speaking Contest," with much success. During this year 55 IIrIIIIItiiii1iii1IiiiIiiIiEiiii6iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiitnIIiIiiIII11iIIi1IIuuuII111IiiitiiiJttiiiirii111iII1iiiM1iiIi11IIiiiiiiiiitiLiiiiii1ii11hIIuuuIIEnniiiuiiitJitiI1i1iitiiiiitiitiiihttiiLikiii1i1Ii11IIIIIhiI1iii1tititIi1uuIIthtIihhii1tiii1itttiittiiiilnnm111att4t1rrmunmumunutittttmmlnnnmatttttmumunnt:ttttitttttnsmiititttutttsttwwtttttti it it l""'l WN11''NNW1l"HlF!1151llllllWUUUP1lUUlT?1UHlll1I11PFFFFl51?QlllllllllllllllllllP?199FP9Fll!HW!Y?lFUFUPFF!?l? THE NEWTQNIAN 1W19FllllPF9WUEFFFFFF?9FFFFFFFFWFFFFFFFFFP!9F!!!!??!FF!l!!!!!l!1lF!lWW!!F!?WFP?PFFFFFTPHFFFFFFFWUH1?F11"'l""""'l'l"""WW of battles many members were slightly wounded, and a period of rest was in order. 1927 had shown its mettle. It had fought hard and well. Next year great things would be accomplished. With a couple of month's rest, 1927 returned once more. It received many new members from the class of 1926. These combined forces elected leaders in the following rank. William Cummings, Paul Nason, Marion Bonner, and Alfred Guzzi. When the first test of strength came in a third meet, the regiment 1927 emerged victorious, defeating the other three troops. Its individual mem- bers still showed their powers. A social event was sponsored by 1927 in the old drill shed. It was a success, as was to be expected. When regiment 1926 sent out a call for assistance, the doughty boys of 1927 responded, and helped them in their last moments of joy. It was thus that the third year of encounters ended. WILLIADI L. BENGEB. mmuui im11summ111I1unu1iiinkkH11i1illiihiiu'lhliibhiiiilHHiiW1iiis1Ikkiiiiil1I1HiiiEEinkiliiliiikfilmIkifriisinHififin1ifilmi1kFill:EkIfiiiH1luiil'uiuiifliniw1uiiliuili'iii1is'MeinlitfinialWalliniiiliuiiiiiiikiifiiMini11MiiiiIYii:limiiiiiiiuiiiIriiuiiiiuiiiiiiiliuiiiiiiiiniiiiiuiiiiiiiiiiliuiiiiuiiiiiisiini!iiwindmill1'1WI1niuiii'1iiiiiiulliiiiiiliuiiiiiiillliiiiiuHn1uflHfiiiiidilinfnifiiiiiiimmmnmnllllmu IIIIIIIIIII 56 WU16H166HH666H666H6666H666H666W666H666H6H6UUPiV1IiiIiVNIIIIIIIIIIIIIIIIIIIIIHHII4N4HH HHHHW NI QSLQX, H666W66WHwmwww mwwwmmuw m SOPDDIIIO 5 6 X : Fm -' - -- - - - - - f 5 -' f g. Cfgfwg'-s,Qf' Mp ji--n 5- lzfgtl . f ala 2 E' . "'!-ivmuszuv , ,.,g,'4Yf'., -A -- -h"f, 2. 5 1 f. Vflmfffe? ,zyfigyffa-Zvi? X , - , fu , - - "' 'lp ,-35.0 215-1':'2f-Ze", 451 5 'y 'Z wg ik W M4501-'19 -T , I , .4 ,-,L:'f6-'ff- . "': S7 . - , . .- , Qg 4 V . .-f , c ...Il ,- C . . - - A N . S uf .--- - : X X . - ' A 7 g X ' ' -- .. X . fn ' x ,.: - - - - - . . xan., .-- , - ' ,: ,Y H--. K - . - ' s. - , Y .N 3' A l , , is K N f f xx -11 2 -ag ' 2 V fx X - -W X x Wim? ll x 1- 2 f ' 2'-T-1 i f n 7 Y", 7 lf ? ' Zigi?-4' 1 1 ' 2 w? ""'i-1-S'-' ,i 23' 6-A-:s-:a a N -14l -4Q 3 1:-5-L-.-'Vs X f 2:11 ., N V Plum? 4 f f.- . .- 11- .., 1 1 -X 'ist' '. f'k"'4"' ---T :' N -, 1 ' I' "Tl 'E X 2 X - 4f--?-rl- . -- ......... '- Q S ff' fe-'7'f L G -, ,7,si X1 'Z' -ilg - -F ,,-. V-. 1- ,4-- .- L , ' px f - t . A f 1 6 - Lix '..r 'I --N ,wi - . 2-,ff-S-f , 4 '1-1 .E .A ae 6 H - T' A 'f -. Tr :- . 4... diff' L ' H, - ,A .T . ffm N Q' J li?lg s u ' - -' , Y ,D 55 1:11 - .X W: - W . ,, ff- -.2 ,, -and --:x,T,3i 6 , Nm " .5 '-71'--'b , il "WL-. ", k , , 'T 5-:za "ER -, - Q-wt N' X ,Tl , 'f 2 AX 'i+f Ad 4. , -.- ...ax 4' l, xx .N , 'i 11.11, hlb'i -XA.-. 'YN ,L " ' 4' V' :-... .L , 251-jf .us . ' -11 - , X - Qxxxx X -T442 .. , I X X 'Q . ar- . X F I I if f' WW' ' 'ff' ix mr. zo, f WW77f -if W 6 7'fQ -Mfr 'Nfl PS' lfil I ffl ' - " N 125- ' f:ff4V . 79, ,' wxg 5, :S-I-22 ' ' fl N fjfff. I 1 U . - QX X Q SE J .. f , P..- -W' 44' ' 6 W W M N 6 'GQQWFQW' i" 1f"E' p af ' 6 ?fl11:E3DiiQ,.h' N. 'airy g mdyflnni 6 ffff14x..f,,A. nm X My : r-:.- Milk- ! " -E . 4 .k. v .W I W. "Maggy - - N f , gif Piggy xqiyfd uh ff- Ai 07 5 -W PL!! BIN w Eg? -..' 'if' 6 4.1, Tr vi E: " 5" Egg . M7541 ,yn J!4'fL " 1 X .. Rx 5- ' 4 AN , x N IL ,QW lik 6 X 1' 21 .1, - -2 -X "J" ' A' 1 f1?f1z2?12i7?'f24"' '92 Q! QS 1 - any :xxx nnncnnrr . -2. 'NX Hmm 'U' 1? C? H .1 ix GUIHD 5G5Il6 POIIYR, CI16 CSIFCGI6 GSI6 U5 C0 566 OUR56lI5 H5 0CI'16R5 566,115 ,l ci IWW H?IUHI!II?IPVIIIIlIIIIIIIIIIIIIIIIIIIIIIIIIIIIHHllH6HH6N6N66lKlKHIIIIIIIIIIIIIIIIIIIIIIIIHH666H6HiUH6HVIlI!IIIIlll!!llNl1lllH1HHW6U6HHHHIIIIIIIIW6H6H6HHlH6Hl!lIIlllll!WlHH6H6Hi6lHHHHNIIIIIWH6HN6H6M666HrWi!!!HU6H6M666H6N6N6+Mmwuwum+6 wwwwwvww6 57 W llllllWWWFPPllUllllllllllllllllllllllll?llWWFllllll?'llllllllllUWFFFl9FTUUUPFUPUWFFUUF THE NEWTQNIAN FFllll!FFFFlllllFFllllllllll1'!!FlP?,'r'!!!W?l,'rW1'PMWill!llllllllllllllllllllllllllillllllllllllllW Sophomore Class Officers Eg l QQ Sophomore Class Officers President, Robert Tracy Vice-President, Nils Holmstrand Secretary, Jerry R. Angino Treasurer, Ruth J . Holbrook W liiiiIliliiiialliiiiiHilliiiililiiiiliiiiiiiii1liliiiialliiiiiliidiiiiiliiiliiilliiiiiliiiliilliiifliiiiiiiiiiliiiililiiiiiiiiiiiiiliiiiiiiiil1iiiiiiiiiiiiiiiiilliiiiiiiiiiiiliiiliiiiiiiiiiiiiiiiiiliiiiiiiiiiiliiiiilliiiiiiiiiiiiiiiii1iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiiliiiiiiEiiiiliiiiiiiiiiiiiiiiiiliiiiiiHiliiiiiiiiliiiiiiiiiiiiiiiiiiiliiiii1iEliiiiiiiiEiiiiiiiiiiiiiiiiiiiiii1iiiiiiiiiEiiiiiiiiiliiiiiiiiilEiiiiiiiiUi1iiiiiilEiiiiiiiiiiiikliiiiiiiiliiiiiiiiilliiiiiiiiilllW 58 ummmu1I1Hu1Iu1I11luiluuluulqqiqqlmqqqqtqi1111111144WWiiitiiinniitnii1iiiimmiiiiqiiqiiqiqqqquqinqqqlnttr NENETEEN TWESNTY-.s3E3Z iit5qnnmnnniziimnlnuqiiiiitiiiiiiiiiiiiiiiiiiiitnniinnntuivimiuittiiitiiititinniniiniuitvt tt An Old Manis Tale QCGR.ANDPA.,' said a small boy of nine, as he sat on his grandfather's knee before the fireplace one cold blustery night in early February. "Dan is a sophomore now. and says that they have dandy times up at his high school. andef' 'tDandy times. huh!" responded grandpa. as he shook his aged white head. 4'His good times are nothing compared to What we used to do at Newton High when I was a sophomore in 1926. Lad. We were the best class there. and there's no denying it.. l'll tell you about it. sonnyf' Although it was about the four-thousandth time he had told the story. the old man began-"I tell you. When we lirst went up there. We were as seared as freshmen ever were. Hut after about two months We assembled and elected a chap named Robert Tracy to lead us. with Elizabeth Pratt to help him. and Donald Burns to act as secretary, with Elizabeth Curtis to icollect the cash'. "Some time later. we had hockey. football. and baseball games, while the girls had Held hockey. basketball. and a gym meet. Finally the e11d of the year came, and the dreaded final exams. Then-the summer. during which exams and books never once entered our minds. "Although We had a fine time during the summer, We were very anxious to get back as sophomores. We weren't afraid this year and certainly Gheld our oWn.' Some time before Christmas We spent a valuable study period voting. and finally chose Robert Tracy to lead us once more, with Nils Holmstrand as vice-president, Jerry Angino as secretary. and Ruth Holbrook to take care of our Wealth. "Again this year We Went out for athletics, besides Working on the 'Newton- ite' and shining in the prize-speaking contest. In May, we had a party in the gym, and-" A deep breath from Hsonnyw interrupted the narrative. Later. having left the child to his dreams, the old man sat gazing thoughtfully into the merrily dancing flames, living over his life once more at Newton High. FRANCIS A LTIERI. nmnIliiiiiiiiiiiiliiiiiiiiiiiiiliiiiiiiiiiiliiliiiititiiiiiil1iiiiiiiiiiiiiiliiiiilliiiiiliiiiiilliiiiiiiiiiiiiiiiiiliiiiiiliiliiiiiiiiiiiiiiiiiiiiiliiiilffiiiiiiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiliiilliiiiiiiiiiiiiiiiiililiiiiilliiiiiiiiiiiihltitlliiiiilliiiiliittml4ii1tlilimlllluntaitiitmlnnnummtitiitiitnlmsunillntnitiiittnummtiitiiititiiiistitttttttttii it 59 IW'IIII'"N"'III'HWIII"WWI'WWI'NNW4IIWNWI'WH"'IWNWYI"NWNIUWM1II'WNWIWWWVWWW1WNWF'NNW'V?Wl'U" THE NEWTGNEAN WW?FPFFWFWFFU'W'U'UHU'WWWUU?F!!FF!FWlWFUW?!WWWW'FF?!l!!FFUWW'UWWWF!!!'F'FFFF!!IFFFVFUFFFFFFFFFFFPFFFWUW i , " . j ,., , ' ' - Q, 5- . D gi 'ln gi Q TIIIL TI:I:IINII:,xL BUILDING 1 iii 1 f X X ir: E x , 5 E gI TIIE NEW BUILDING W mrIIIIIImmIImmmIHIIIIIIHIUIrihirilhIIIIIIIIIIIIIIIIIIUIIIIIinIIIIIbmiIIIIIIIIIIIIIhhHuhIIIIIhillIInhmIIIIILIIHEMIIEIIIIIMHIIM1Iumhlmm I nHimIIItiiiiikllfrllikiiklliiIkiiikiimiiihiiliIIIIIIIiIIIIiIIIIIIIIII1IIIIIIIIiIIiiIlIIIIIIIIIIIIIIkikIkI!IbI1'1'uIhiIihfnhiMiuIIIIMIIIIII1MinIIIIIMuhhIMIIIkII I 1 n'nIlFIIIIIIIlIiIIinHIinIIlliniIliI l+I u MuIIIIMIIIIIEIiInIIiiII I Iu u u'I3IIiiiIMIIinMis'IiI iIiiiiiIii1iiiiu'inI W 60 11" mmm ummr nrrrrrr11unnuumnunnmmunaarmmmumm nnnuuuuuuumrwmwWqq 5-gyggygmufynslgg H ,WH,,,,W,WW,Wwwmm 511512 me qw W VW 0 ,WA 1 ,J 1 W Hmnnml SUHU. Horwfrmw 5 WWW H H Hi1lH5iHiiHPViiiIFIIIIIIIIIIIIIIIIIIIIIIWH1NIIIH4 HP1H 5HUHIIIIIIIIIIIIIIIIIIIIHWW Hi WIUIIIIIIIIIIIIII41H H H HHIIIIIIIIWNH H H5WHMHHIIHH H H H N iHMHIIIMNI4H H H W UMMHNHM H:4mwuumn l w hl Mll"""lll'lll'WWWFU'll"l'l4llllllllll"ll4lllWlllW'll'lPl'l'l'lll'UUU"'lU"l''lWNWlllllllll THE NEWTQNIAN lF?'llFWl3!lUFFFFF'UWFllll'lF5FFFFFFlFlllFllFFFFF1ll'FFFFFFWUWFFFlFFl'!lll'lF'FFFF1F'lFl!UFFll'FlllFFF'WW5 Freshman Class Oflicers gi Freshman Class Officers : I,f'l'Sidf'llf, Dora Cummings Vice-Pre.s'id0nI, John P. Orr Secrelary, Carolyn Lewis Treasurer, Anna Barrett IW l1111rrrrn111nurrrwu1I11u1murnI1iniirimununn:rimIinnrmuinuu1mu11Inirrllliilmrrllllmllnlurimld1iliiiiidnlfnHfillinlllfililllIilillillII1EfillUliIIIliiiilhfnliiilllliiiiiiklnililiklbllhiiiiiilihlliiiil111tiiiiillhh1liiiiii166iiiiiiiiiiiEiiEiiiiiiiiiiiiiiiili1hiiiiiiiiiiEiEi1iiiiiiiiilii1iiiiiiiiiiiiiiiiiliiii1HiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiiililiiiiiiiiiilliiiiiiiiiiliEiiliiiiiiiiiiiiiiiiiiiinliiiiiiiiillaliiiiiiiilliiiiiiiiiiliiiiiiiiiiiiiiillf W 62 Hlttttt ttttttIttIttIItIIttttttttttttttlltitlltt'ttlttltltlttltltlttltltltltltltltltltltltlttltlttlIXIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIItllltltltlttltltlttttttxtttttttttttll ZIBTENEVGTEEN ittit1tiiititistiisiiiitiiit1iiiitittititmlm1I11I1mI11I11I11Inmlnmnmntitttttttt N ataohee's Story THIN curl of blue smoke endlessly twisted itself towards the twinkling stars above. The great black mountains. faintly outlined by the paling moon. watched over the camp of the Blackfoot lndian tribe. Natachee and all his children were seated around the dying coals. Natachee had just come back from the great white people's land in the east. All the papooses were eager to hear of the white children's learning. This is the story that he told: "Early one rainy day during the first month offalling leaves, great tribes of white papooses came for the first time to the heap big school of wisdom. Newton High. During the time of the harvest moon, the papooses went over many new trails directed by the big chiefs. The papooses held elections. and Dora tium- mings. a squaw. was made head chief. John Orr came next in order of worship. while Anna l3arrett was appointed to hold the wampum. The tribe decided to have another squaw to keep account of the council meetings. Carolyn l.ewis was their choice. "The councils were held in the big hall. and the papooses were conunended on their brave work at the new learning. Some of the braves were skilled in the use of the tom-tom and they played at the council. The heap big noise they made satished all within a mile. "Groups of the young warriors played a game with a pig's skin. They van- quished the neighboring tribes several times. to the huge delight of the coaches, who were on the look-out for future stars in this splendid game. "The squaws also played games. During the hunter's moon. they played hockey on a smooth field. Many came to help in the sport, and all had a chance to get black and blue. "When cold weather came down from the North. the young warriors got their sticks and played more games. this time on the ice. In the lodge. the squaws bounced a basketball. They had much to learn. but it was lots of fun. "Some of these papooses were so wise that they were admitted to secret tribes called Alpha Beta and the Science Club. The older warriors were tricky and they fooled the papooses at first. but the latter soon learned the dope. This digesting of the rules and regulations was found to be necessary for a happy school career. Now I am ended. Some day when Manito so decrees. you. too, shall go to the white man's school of learning." All was still except the crackling of the fire. Natachee and his band rose softly and wended their way to the tents. The twinkling stars looked down upon the sleeping camp of the red children. Man was at rest. RENA S1-AIN AND lv.-xTnm'x Senior I-1. 1itimtliliiiillliliiiiiiiiiiiiiiiiiiiiiuiiiii1i11i1iii1iiiiiiiititiliiiiiiiiiiiIiiiiiiliuiiiiiiiiiiiiiillliiiiitliiiiiiliiiiiiiiiiiiiiiiiiiuiiltlitiitiiiitiiiiiiiliiiuiiiitlliiiiiiiiiiinmiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiititttttittttiltiitittt:istttilti wigtttttt- 63 W"1WWW4WWWJ"WFF"'WVWW?WW"'f4WNWPFWV"'WWF""'WU"WWWWV?'UU!U?WWWTWFFUWTFUFWFFPWFW THE NEWTGNHAN F?Wlll?!!FW!l??'l111lY!WlWWUll'WF1111Wll!lWll'l1F!!!UUtU!lE'WWWFWWWFFFFUlUWF!!!FWUW!!T11W'""""H"H"W"'H WW Freshman Statistics A Glimpse Through the Innocents, Hall of Fame Dora Cummings John Orr Carolyn Lewis Evan Collins Rena Spain "Nate" Pearson Fred Burton Yirginia Davis James Spring D,Arcy Boche Ma Ferguson Patrick Henry Joan D'Arc Houdini Atlanta Red Grange Paavo Nurmi Dancing Doll" Julius Caesar Tom Sawyer '6Strangers in a strange land." The Three Bicyclers Cfemj, Ann Baker, Bosarnund Edwards, Dora Cummings. "Emmie" Brown James Cobb Emmett LaCross Jean MacDonald Marian Settle "Bob" Chapin "Bill" Reilley Marie Devlin VValter Warren Miles Standish Einstein Lief Ericson Sphinx Pocahontas Jack Dempsey William Tell Louisa Alcott Sousa When the babies shake their rattles, Boy Baker's bugle makes half the noise. Louis Volpe may be a prison warden some years hence. The room which he's proctor of has a fine attendance record. Where there's a fighting chance on right inside, Marion Mellus will fight for the girls' hockey team. Evidently tllese children want to be heard as well as seen, or why would Faith Foster, Nancy Byther, Evan Collins, and Norman Dewire be on the varsity orchestra? The Science Club is under good marching order, with Fred Wing at the head and Paul Petitmermet and Loring Siegner falling in rank behind. Way, gray-beards, way! ummm um1rummmrmmmummmiii1HHii1iiiii11iuiiluindmrnmmmummriI11ii1iiii1uu1uii111ii1in6iiiu1iiirr11H1iii111i1iiiii1i1iiiiiiiEiiiiiiE6iiiiii1iiiNA1dim111E1iii6EEhiiihh1EE1iiiL1hE6iii116iiiiiih6I6iii1HiiiithiiiiiihhhEiii1Hiiiiiii1hhEEiiih111iiihhh11iiiihih1iiiiiiihhhhiiihHiiihh1iiiiiiihH1iiiiilHh1iiiihiihiiiiliiih1iii1Hhhhiiiiilih1biiiiihhhhbiiiiiiilhlbiiiiihih1kiiiiiIILkkkiibiiii11khiiiiiiiiiiiiiiililulusunnnnsnnmm ummm M! rlrifmfrhIIIIVIVIIVIII3IIIfIIIIIllIIllIllliiW!JN N U mmMumwuwu lNjHNE5fEEEW Y THLETICS wwww www- ,, ,w 1 U, 11 N, ,1 mm mx W 1, , M W Qu Nww,yy','!1W,,w:V. wyywlw ,, f JJJJJUNH1JHmiHlHHW3llHmJNHJJJJmiMIMMW.. Wwwwwm.JWHHHQHMNJWHJJEMHM JJJJHIMJHJHTim1JJJJJMJii NJN JP..QJ JJJJJnilNJNMlm IJJJJJVIIIUHJHIilllli4JJJJHIIIIHHJNIIIIIIIUJVIIIIIIIHMIIIIIIIIHXWIIIIlIIHHIIIIIIIllINIIWWI Football Team '11 W. Mlzuns ll. 'XINIITS P. llrrmn ll. Buxlmum J. lforvstull T. iiilligzm W. Hall G. Ilapgoml li. Hayv:-1 Xl. IIPIIIPUII G. llulhruok Footba I I Tc-anl fjllllffll-VI, 'IJIIOIIIHS Gilligzm .Uun11g1'r. 'Nrthur Shuts- IJUIICII. Hr. eKlf'l'1-il W. Divkinsml L4-I le-r Winn:-re-4 I, I I C P. R C J. NN J . A J. W. Johnson Lyons Nlzwy xl1'CllIIllll M urphy Purim' Pratt Provlor '. Provtm' llmnsdvrl Shute- Stubbs JM H mu MJJJJJJllhJJJJJJHHIHJJHill!1JJJJHHHJJJJJlinJJJJJJ+MJ4JJJJJJiiid1JJJJmlJJJJJJHH!JJJJJJHHJPJJJJHillJJJJJHHHJJJJJHIMJJJJJJJHiIJJJJJHHHJJJJHNIJJJJJPHIEJ1JJJPMn!4JJJJNIMJJJEHIINiJJJHli!!IIJJPJiHHHJJJ6JLIN!JJJJHknHHJJJHHHJJJJJMH1JJJJJIH144JJJTMNHJJJJJHIIII!4PPJHHHIIJJTIIIIIIHIJTIHIHHJJJJPHHHJJJHHiIHHWH!lll1NH?rr MNH 60 mmummmsnmmmaunmmmmn1nnmnnmwmlnmw11rurmllnmumhhnulml IIIIIIIIINIIIII IIIIHIIIII t l tt t tt ttlllllllllllllllllllllllllllllllllllltlttttlttlttlttllfllllllllllllllltltlllllllllllllllllllll QYIHLNTEEIJEIQQT T ltlt ttltttt' F' ig- .1 .1- 'vi-1, l- 1' 1 1 f ...- ,Z- ffl X NJ - 'X-N X 0595049 EWVTON started off with her consistent score against Quincy. Toni Gilligan and his allies scoring twelve points. The following Saturday her colors were lowered in a splendid early season tussle by the score of T to 0. Providence Tech presented an excellent. team while the Orange and Blat-k's hacktield eouldn't SEQHI to function. Recollections of VValtham appeared when Newton plowed. waded. and swam through the minions of Deering lligh from Nlaine by the avalanche slide of ,146 to 0. lf the season had been all muddy weather the tlarden City trucks might. have been the proverbial "point-a-ininute" team. On Columbus Day. liverett. triumphed by the picayune score of 6 to tl. Hut by far the worst. feature was the detinite loss of plucky Frank Spain and "Bo" Hemeon being partially crippled. ln this set-to the light Newton line out.- played and out-gained the reputedly stronger and veteran liverett frontier we a feather in Mr. Diekinsons cap. Cambridge Latin was the next visitor at Newton's Circus tiround and although her unique passing effort was dangerous the Orange and lllack quelled her by stubborn resistance. The tally was chalked up: Newton li. tlambridge Latin 6. The tigers proteges travelled over to VValtham. and aided by fortunate openings felled the Watch tflity's hopes by 9 to T. Tonnny tlilligan. with a perfect. field goal and an equally accurate pass. was the predominant tigure. "Bus, lNlcflul'ough opened up his run of "A Pass a tiame Nleans a Touehdovvn for Me." The line. although weak at times. rose to the occasion and bore the brunt. of the lled's surge. Sad to relate. Waltham. because of an ot'ticial's de- cision concerning Mr. Leary. their coach. has severed sporting relations with Newton. Somerville. after an auspicious start. when her back tore for a score on the premier moment. slid down to defeat by the enumeration of 20 to o. Ililly llllllltll IIIIItIitlIlIIItltllltllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllliIIllllllllllllllllllttlltllllllllllllllllllllltllllllllllllttlllllllllllllllllllllllllllllllllllltlltll lllllllttlllllllllltttwittlllltlltltllllllllllltllllliittl lltt tttttllllttttlllitttltlltllltllttllttltltt it it lttttu it oi' llll 'llll'llll'll'l''lllllll'llllll'llll'lll'llll'lllllll'lllll"lllllllllllllll'llllllllllllllllll THE NEW'-TGNFAN llllllllllFlllllllllllllllll'l'lllllllllllllFlllllllllllllllllFlllFl'l'lllFllll'llFllllllllFllFFlFllllllllllllFlllllll'l'l"'l'l'll l"l"l GILLIGAN IN ACTION Proctor went rampant while Holbrook began his career as the best forward-pass man since "Herb" Garrity. The Blue and White were vanquished by Newton's forces 6 to 0 in the best game of the season. The home team's players were noticeably superior to Med- ford's. Nlctifullough scored the winning points when he speared a snap pass on the goal line and. avoiding Captain Herb's eleven. fell over for the winning points. The feature of the contest was the tackling of the Newton crowd- a man stopped right where he was hit that day. Over at Russell Field. after some postponements. the Orange and Black laid an aerial barrage of almost perfect conception, winning by 21 to 0. llolbrook's pegs were rifle-like in speed and accuracy. while the receivers acted as if catching a football was a cinch. Hemeon shone by his excellent work at end: especially in alertness. a prime requisite for the wing-men. 'lllianksgiving Day was Gloom Day for all concerned except the Wealthy Towners. Newton fell 6 to 0 before the combined team-work of Gentle and Meeglian. Captain 'l'om's injury seemed to dishearten the eleven and though Clark showed latent ability and llolbrook set a mark for completed passes, Newton went down to defeat and played her poorest game of the year. This season. everything considered. was one of the best since championship times and all this was due to Mr. l3ickinson's and Carson Stanwood's energetic and intelligent labors. The green line became a stalwart bulwark and the backs a "ten first-downs a game" set, by their close application to the tutor's advice. In mentioning the Junior. Intermediate. and Freshman elevens. bear in mind that they played a hard schedule and are going to be on deck to plug vacancies next year. llullll llllIllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIllllllllllIIllllllllIIIlllllllllllllllllllllllllllllllllllIllllIIIlllllllIlllllllllllIlIllIIIllllllllllIllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIllllllllllllllllllllllllllllllIIllllllllIIlllllllllllllllIllllllllllllllllllllllllllll'lllllllllllIlllllllllllllllllllllllllllllllllllllllllllllllllIllllllllllllllllllllll luuunr 68 ,ii MNW?FFP!!YF99PF?9F?FYF!99P9FFFFF9!!F!!!!!WWF!FFFFFF11F1FFFFFT9FFFFF999FF999I99F995FFU9?W!U!?F!U!9!!l!! NHNETEEN 'TWENTY HX 1UI!lV VW WWllllllllwl'1ll'1' " ' W fUWW'FPFPWW1WUlll1llllll',ll'N'N1UWWWQ I.. WYi1iunuu111iiiiui1iiiiiiiiiiiiiiiiiJiiiiiJJSiiiiiiiii1ii11EE1i1iEii11E61661Hihi6ii11iiii6iiiiidii4iiiiii1fitiIiiibILkE1ihhhihlhiuiihiiiiiilfillMELi111i1iiiiihihihhhihiiiiillilHLliiiiiiiiihihi1iiiEiiiiii1i iiiiihhhihihihhimUMiilhbi1i1HhkiiiiiiiUUXNn MUhihkhhhihhimumimml1ith1hu1n1iihNnmmiiunumumwwumvn n auwyfzrswmilwwmwww4WWwwwwwl wwwW w w 1 5 60 HMMMMJJ WMIZWV1w5iNNHEMWMMUJIWHWWMW HliiitHHWIIIMWJW WWW! HHNUWIJ WI HIM J M Ice Hockey Team --. N ll. ,'xIldI'i'S S. Brown J. Chipnmn lvv llovkvy 11911111 lfaplain. Guy I lulhrook llarmyffr. Juhn Chipmzm f,'Ullf'l1. Dr. Oscar ff. Hur La-t lc-r Win rn-rs li. Ilnllrlwnmk li. Powvrs J. Proctor I". Spain J. Stubbs J. Thmnpx ll. YVhitn1 M4 UIl'HHUH"14HUWWWIIIHJWMJJWIHH41NJJWHJJHWMl?WHHlfJUJJHPFEMJJHJHIMJJNJEl!!!JJNWiJWPWJJHHHHJJUJ.WJJJHIIHHHHNJWJ MNHJlilii1WJ riHlWHllll1WJNIHJWJJIIIIIWJINIHWPJI!!JJWUIIHNNWillJWJIIIHHUHIIHJWJWUHHHill!JWPUIHHHJIIIIIHHJUIIHHIJHIIIIHJHPIIIIHJHHIIHUWHIIIIHU!I'II'lWVIIIIIHHJUIIIIIHIJHIIIIIH4WIIIIHHHHIIIMHVIIIIIIIHHUIIIIIIIII4PHIIIIHHHPPIIIINHWH WWW 70 ttttt HllllllltllllttttlllllltItIlItIlllIlItItI1ItItItIlI1Ill1IIIIItIIIIIllIIlIIIItIIlI1IIIII1I1'IIIIIIll1IIIIIIIIIIIlyIIIIIIIIIIIIIIiIIIIIIIIIIIIIIIIIIIIItIIIIIIIIIIIIIIVIIIII'IIIIIIlyIIIIIIIIIIlttt,IltKt'tyI't,lKII tttttmtttttltzttll1t1tutnltttutmtettlttutttttttttttttttttzttt11 '?'2 ' T-Z X MASON .7 .--5 HE 1926 hoekey sextet had a erowded sehedule. as about sixteen games were planned for the two months of the hoekey season. The final tally shows a good balanee on the winning side. The premier game was with Brookline. whieh presented a husky outfit. This first league tilt was won by Newton. 241. As the first game. it gave a light on the players. The three veteran forwards. Captain llolbrook. Stubbs. and Powers showed good form. while Andres and Proetor showed exeellent defense ability. A Championship outfit proved to be in the making. The Hrst defeat. and the only league loss. eame from Stoneham. 241. How- ever. Belmont. in a league Contest. sueeumbed 541. Arlington offered stiff resist- anee. and it required an overtime period to subdue this stubborn outfit. 141. Cambridge. loo. was not beaten until the last 230 seeonds of an overtime game, 141. The Arena playoffs resulted in two wins and one loss. Stoneham was taken by a score of 4-l. avenging the earlier defeat. The Melrose game will never be forgottten by those who paeked into the Arena on February 211. The team work eould not be beaten. "Red" Holbrook was everywhere. ably assisted by Stubbs and Spain. Thompson. guarding the net. had a motto like that of the lfreneh at Yerdun. The final tally of 241 in Newton's favor shows how Newton played. Cambridge. however. retaliated by winning with a seore of 34. and as eaeh team in the Hound Robin had won two and lost one. a triple tie between Cambridge. Newton. and Melrose resulted. IIIIIIIIIIIIlllllllllllllllllllllltlllllllllllllltllllllllllllllllllllllllllllllllllllttllllllllllttlll1lll1ttttlllllllllllllll1tllllllllllllllllllllllllllllllllllllllllllllltttl1tttlttlllttttllllllllllllltllflliltltllltltlt1ttttt1ttttt1ttttt11ttttttttttttttttt tttt ttvtttttttt tu t 71 wwmWwwmammHummmulnmwunmmmmmmm4ww1n4nwunmwruammmuu44wuumwmmmmunmwnnlm THE NEWTQNQAN iIWHmIIIIIIIIHmmH!lIl1HmmPIIIUHUmmIWmmilIllllllwllllllljlllVUlllllllljflljIlljIUI1UIjjVI I1jj1jUUQjljjjjjjllllllljjljjjjfiIuljyljjjjwllIjtlqlll W Swimming Team . . . vw lim Sun mlng lm-.lm E fllflflllll. Lloyd fbslllllllt' E 11fmm,.-f. s,wn.-,T D1-Nlillv l v w 1 1 3: flfllllll. Nh. Llwiv 1-. II4-W ,E L1-ll W llllll'l' ' E S. DvXlillc- lx. Nh-rrill J. lfsson l.. 1,SlNlI'Il1' H. f:I'4'2llll'j I". Ps-rrp lf. f:l'4'PI P. Svrkin Nl. llzumnunml Y, Suulv K, ll l,,.n,--.- Lx will E .A h 1.x -1 J. XN.1k4-fu-ld E ge: , ,,,, ,, ,, ,, , , , H , ,w ,, ww ,, ,,,,, ,,, ,, , ,,,,,, ,,, ,, , ,,,,,,,,,,w ,, ,,,,w, ,,,,,w,,,,,,,, m,,,,,,, W ,,,,,,,,,, ,,,- il HW, w w,,,1HHWf4mmmHWillmNmHIIIIHHWJHHHHAHW wwwHM,,wMHNi,,MUMM,1mMu,,w MNH,WMHU,MNH,MW,,HmNmEmHmNHHEJWHWHWVWmHmHmif,HmNMHWkaUHHH,WHmHmHill1HmHHHHmNmlNmNmmmLHmHmmmldmHmmmHZfi!1mmHbUIIHHmN5NIHmHiHHHHmMmMHmHmUIIHHmHHi!HmHmH5HJHmHmLillmHmHmNIMHmUVINNIHIHIIIHHHHmHHHmmmNIIIIIIHImHIIIHHHmHIIIIIIHHHHIIIHHHPIIIIIIINIVIIIII UIIIINW T2 Illlllllll llllIItIlIHItltlIIIlllIIIlIlllllllllllllllllllllllllllllllllllIlllllllllllllllllIlllIIIIlIIIIIIIIIIIIIIIIIIIIIIIHI NHNETEEN IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIllllllllllllllllllllllllIllllllllllllltlllllllltlllllllllllllllllllllllllllllllllll ttlt f -IiIIiuvIriIrIrilrtIirutnut1utinuAtInnnmnmmnunnii11iutAI1I1ItIIIIunIIitIIlnllmlnulumluu 2 .5 MIN " Nnsdftf-f 5 OUR ye-ars ago. Whvn swinnningr was introdut-od into Nr-wton loligh. thorn 2 was not murh of a tram. Hut vyf-ry yvar sinvf- the-n. tht- sport has lwe-n on the int're'asP in popularity as we-ll as in t-oinparatiyv standing with other srhools. During tho past yt-ar. Nvwton was rate-d with the- lirooklinv and Nlaldf-n 2 teams. which wore suppose-d to low tht- he-st in this sc-rtion of thv country. 2 Newton he-ld nine- dual nude-ts and was yirtorious in all hut tlu'c-ti. two o which wvrt- out 0lll1f'I' class. as theyw'0l'c-"p1'cqJ" svliools-l'1xf'lt'i'anti Huntington. E The third. howvvvr. was Brookline-. 2 Two of tht- most exciting me-e-ts ol' tho svason we-rv with Boston linglish lligh. 2 Although Nvwton finally won. in hoth vase-s tho outlook was had for a while-. E In thc- first Inf-vt. Lloyd Osborne- swam and won tlirvf- vyvnts. The- othvr nu-1-ts wvrv easily take-n by Nvwton with usually an oyf-rwlivlniing st-orv. ii Newton obtained third plat-v in tht- Livut. tlvorgv H. Nlt-vhan 'l'rophy E swim. Brooklinv and lluntington just nose-d out thf- tiardt-n tiity natators. 2 The formvr rams- away with 275 points. whilv lluntington won IU and Nt-wton l I. Paul Serkin Won fourth plavv in tht- ltltl-yard hrvast-strokv. while- the- rvlay lt'itlll 2 Composed ol' Loclgv. Soulv. Morrill. and Oshornv. took a third in that mont. 2 hlerrill Hammond rlvsvl'vf's niuvh vrf-dit for his l't'lll2lI'litllJlt' porl'orn1aiu't- in tht- ? plungv. Lloyd Usborne- lwat Nlartin Ford of lirooltlint- hy tlu't-e--lil'ths ol' u sm-oiul 2 in the 200-yard grind. tlwrf-hy' winning: a Ne-w lingrland lutc-rst-holastit- vham- E pionship. Lloyd was tht- H926 raptain. and during thc- yvar at't'umulatt-d 'til 3 points. Illf't'llllgI only two df'f't'ats. hoth ol' whivh wt-rv at tht- hands ol' lfxvtvr. Coacxh "fiom" llf-ss clvsvryf's no little' vre-dit for his faithl'ul work in t-oavliing E the team this last SPHSUII. llc- farvd a hard proposition and Vtllllt' tlirougrli with the goods. mlftlitttttllllltllllltllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllltlltllttlltttllllllllllllllllllitllllliilllttlltllllltllllllllllllttlllt .ltttltllllltttytttttttltlltltttttltt t titttttttlnwtlltull . i it T15 f J W WWW f 1 W T322 NiE.'j,TQNf'fQCD1N'lA,N WWWiI41HWWIIWWIIHW WNWWWWl11WHlll!'!JJJVIIIIIIHJJHIIIIIIN1HIIIIIIII1H5IIIIIIIII1liIIIIIIIlWM N Indoor Track Team .1-I Xml 'J 935, Indoor Trark Team fllllflllll. John Buswvll Umulgvr. Warrvn Ndznns llmnn 11 lx ll N CIJGFIIPS, Nlvssrs. firm-n. linovh and Dickinson I4-nu-r Winn.-rs NY. AIJHIIIS E. NY. Bellgcr ll. 'o I J. Buswe-ll J. MCH J Connilf S. Nloor W. Clllllllliflgl. C Pratt W. Fullerton J. w, swat-y Hillllhd 1 J HH JJJJJNIMHJJNNNHHiIlHHHilUWHU'NHWiINNWHIliJJNWN1JJJWF!!!JJJJHGH JJJJHHHJJJJJH11JJJJHHHJJJJJlllll4JJJPPIIIJJJJVJHH1JJJHHHJJJJJHHHJJIIIHHHJJHHHHHIIE1WHJIINWHIllllJHHH!!!1JHHIIIIJJHHIIHJJVNHII4JJVHillIJJJJJIIIIIIJJJJUlllJJJJIIlllllJJJJHHH1JJJJHEI!JJJJJJHI4HJJJHIIIHJJJVVIIIIHJJJHIIIIHPIHIIIIHIJ?HHIIHVJJHIIIIHIIHIIIIIIIIVlIIIII'HIVHIIIIIHJVIIIIIIIHIHIIIIIWHIIIIIIIIlHIIIIIIIIIIHPIIIIIIIIiHIIIIIIIIIIHIIIIIIIIIHVIHH1 H J 74 lllllll lllllllllllllllllllllllllllllllllIIlIIIllIIIIIIIIIIIIIllllilllllllilllllllllllHllllllllllllllllllllllllllllllllllll llllllHtllllttlUllVi TTlTllt.i.'tltlllliiTV i jfvnsofv HIC eall of the traek team on Deeember l5 brought out a goodly number of aspirants on Whieh to build a squad. Xeterans were few but the fellows got down to serious work. and after vaeation the ehanees looked better when the interelass meet Came around. This was eaptured by the Juniors 37432. whim-h speaks well for next year's team. Some very fine performanees were eloeked for the first meet. Moore in the dash, Fullerton and llannnond in the jumps. and Stuart and Seeley in the distanees were the lights brought to view and they continued to shine throughout the season. When the old-timers returned to do battle with their Alma Mater. they were sent baek on the short end of a 55--22 score. Fullerton led the exhibit by winning the high jump and hurdles. llam- mond looked good in the broad jump. while Seeley stepped the "I00tl" in almost record time. With these preliminaries as a baekground. Brookline was met. The team did very well in holding the aged veterans of the Wealthy Town to a sc-ore of VP28. The visitors turned out strong in the field events and then finished the work with strong men in the running events. The return meet at Brookline showed an im- proved Newton team. This time the sm-ore was IVP29. Lawrenee was the next Contender. and went away with a 30438 verdiet a the same margin by which liawrenee was defeated last year. "VVallie" Fullerton featured the meet by taking four first plaees. The season. earrying some defeats and some vietories. might be ealled medioere. But next year should bring a team eonsiderably above the average. Nlost of the boys will return and the veterans will have profited by this year's experieuee. IIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIlllllllllllllllllllllllllllIlllllllllllllllllIIlIlIIlllllllllllllllllllllllllllllllllllllllllllllllllltlltllllllllllllllllllllltllltllllllllllllllllll lllllllllllllllililllllllllllllllllllllllllt:iitllllltlltliillulttltlit3iiiitlitlltliitii T it A it 75 W mn4rrrnnunqrvumumm11QQp41QQup!upqppun11puwmum4 r11numrvmumnunmj0unmm1QmyWu u u ump1u1myupqnlpW11 1p uW1 1 u 1 ua THE NEWT-QNIAN 11myQugQuu:gn1qqqqmegqqqqqqrlnxlqqqQQQmmm11uuunumuuuumumuunummmu1umum1uuummmuu11mmmIummm1uumumunmulumm uuuwm Outdoor Track Team I ' 'ff 'X 0 1926! ku: Ll Llllf EM ht hd l gf ffwes' 1 5' if F J. H I: , 4. xx w ll S. Burton Brophy Buswcll Cobb Cole ConnifT Dardis Ebvlharo . Fullerton 1 hrcvrl Hammond Harmon E J. llession Outdoor Travk Teanl Caplain. Jzuncs Connifl' Managfr, Ralph Paterson Coaclz. Mr. RHylll0!ld Green r. L4-tic-r W IIIIIQFS D. Waltvr II R J. J. w S. L. IK li C ,N C ll A. Kollmvycr Nlalwy N11-Clwlrlrlvn N1 1' Nl anus Moore IJM1. y Pulvrsr n Porter Prnt t, Spvare Stuart, Stuart Stnnlield Zummnrrrrrrunr14rrmum4rmum1rmumrmmm1rnmmmr1nlmml1numr1num1xmmmsummrmumrnlulhihmenumulI1Y1 shimiillf1il u n1lIuHHufnI11N1WilHH11liHIuin1ii5lru lmfmuuuuf4rVmmmunumiiMninu:Milauuf:iiiu u u'w 1i111Hn n Miiiiu lMa'1 iiiiliu1'1iiliim'aIinumivMiiiilmriuinnnmmm1miiiuiinUiHiiii1n him1i11miiininin1111uunu111uI1uumu1Iuunum1111uunuInnnnnum11nI1nm1nnnmuummnmunmnm ummm: mmm 76 MlllIIIIIIIIIIIllIIIIllIllllllllllllllllllllllllllllllllllllllHHHllllllllllllllllllllHHllllllllllllllllllllllll N111E'2g5'2?E3gj,N ll .tit tt llllw- ..t. VW' E - 7 A 5 E - E '10'5' 'QI S 9 2 - I gg I G Q 5 Na SON "" 21 - ' I 'HE outdoor track team has not. at this date. competed in any meets: there fore. to make any forecast of the season is rather difficult. The dual meets arranged so far are scheduled as follows: T' 30 April May May May May Dorchester at Newton. Milton Academy at Milton. Concord at Concord. Providence Tech at Newton. i: 1 28. Quincy at Quincy. There are also six interscholastic meets: Hay 8. Worcester: Nlay l5. llar yard: May l9. Boston College: May 22. Yale: Nlay 20. Brown: and the season winds up with the State Nleet at llarvard Stadium on .l une 5. The most promising' candidates for the team seem at present to he: Sprints: Nloore. Fullerton. Huswell. liamsden. One-quarter mile: Stuart. liollmeyer. One-half mile: Cummings. NlcXIanus. One mile: Seeley. Nlctifrudden. Hurdles: Fullerton. Snow. liamsden. lfhelhare. liollmeycr. Nloore. Broad Jump: Fullerton. llammond. High Jump: llammond. Fullerton. lihelhare. Shot Put: tlonnillf Pratt. Nlacy. YY. Brown. Discus: tilonnifl. lfhelhare, XY. Brown. llammer: Connill. Nloore. W. Brown. Javelin: Clark. tfonnill. Pole yauli: White. lfmla. llllllll IIIllllllllltlltllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllillwullllllllllllllllllllllllllii .. tlllllt i.d.l.i rmwwwwmnmnmnmmmlnmmnnmwwwwmlirmwarmmnlmlmumnmmmumnuumummmmmmmrrn1unmmm1:4ur THE NEWTQNHAN 1WlIllIlQ1MIIIIlIl1HHIIIIIIHHHllllllllPPlllllllllU1IllIlllU1lIIIIIIIIlllllllIIIIIIIIII1lQQIIlIlUlmQQQlIIl1IllIlllllQlUlmQII1IIllIIlIlllIllllQll1lQHll W i Baseball Team i - vw 'M v f, gl Baseball Team E g Caplain. J. Carleton Mc-Cullough fllflrzrzger, Philip Ahearn if Coach, Mr. Alfred W. Dickinson E Letter Winners II. Andres F. Monahan ge P. Ahearn R. Pickard T. Gilligan J. Proctor N. Hanscom A. Shaw G. llonbmak J. Stubbs S. MeCleary T. Sutcliffe C. McCullough ll. xvhitmore 2 7 XY. McPherson D. VVils0n :W Hunrrmummbhuusr1nhlHkmini!MmlilillmblilurwvunmmumMmumrmulilrmmmvmilmmsHiuliIr'll'lililfnfI1IuIHI15I:IllIHlI1Trr l'ulilh dluililf14r1IuHlilinImifm1I1InlHrinIIHuifiinInmiiimnmcmlnIHlifii1r1HniIiiiil'uInff!ii1 lEn'l'rIiin n lWn liiiifiiiiHhdiiiiiii!!!iiiiHIii!fKiiiiiIifiriiiiH inUiiiiil ilrw11HIIiiifIilifiiii1iifiiIiiIifimiiii1iHiniNil1iiIliii1i1iin'Ifiiiiiiiii1IiiliiiiiiififfiiiiiiiifiHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif W 7 8 ll l 1 llllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllillllllllllllllllllllllllllllll i .w.,llI1l'1lilllll, llllllilll evil it -e If 2 X e Q ff f- X F 'f Q l x ii, X' rxmsotvl HE Newton baseball nine opened its l926 season with an encouraging amount of veteran material. The infield and outfield were almost entirely complete, with the possible exception of short-stop and right field. Nlctfleary was the sole veteran moundsman. while the receiving end was entirely lacking in its stock of receivers. Gilligan and Monahan have advanced to fill this position and both have done creditable work. Newcomers for the box proved the greatest asset to the team. Bob Pickard. Dan Wilson. and Newt, Hanscom promise many vic- tories for the remainder of the season. The nine made its debut with the Swampscott team and crushed the visitors 22-1 in a most one-sided exhibition of the diamond game. However. a week later Lawrence dropped into camp and snatched a win to the melody of 6-3. On the 19th the team again met defeat. at the hands of tlainbridge, 6-3. The jinx disappeared on the following Wednesday and the Orange and Black nine recovered its stride well enough to bury Boston English 5-l. Taking its first league victory April 24, the Newton aggregation humbled Everett 2-1. Pickard hurled this game for Newton and held the Everettites to three hits, Gilligan triple scored McCullough. and PI'OCt0l'lS clever bunt. provided the winning runs for the Newton team. On the following Wednesday. Lynn Classical was easy prey and Newton once again emerged victorious. The final game before this article went to press was tossed or rather most kindly donated to the lNledfordites by the non- support rendered by the Newton infield. The score was 642. The features of the season so far have been the fielding and batting of Nlc- Cullough and Gilligan, while the pitching of llob Pickard has been extremely notable. lllllllllll llllllllllllllllllIIIIIIIllIIlllIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIllllllllllllllllllllllllllllllllllllllllllllIllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllUllllllllllllllll"l"'ll llllllllllllllllllllll. Fflfflllllllll 79 Q'lll1lUPllllllllPFFWWlUl1l1Ullllllllllllllllllll1l1Ull'Ul'l'lllllll'YU111PFT'Ullllllllllll THE NEWTUNIAN lll11??lllFll!'!ll99llUP9lllll?9lll9?1lllllll!F!!!llF!!F'!!llF1llll1l"""lllW1"""'llW"""""ll""""""l""'lH""' Boys' Tennis Team May May May May May May June is June June June Q Boys' Tennis Teanl Caplain. Robert Turner fllanager, Saville Davis Coach, Mr. Wendell F. Smith Letter W inners F. Broughton C. Parker S. Davis D. Scott A. Noble R. Turner Schedule Tuesday Somerville Saturday Worcester Monday Boston Latin Saturday Yale Interseholastic Thursday Harvard Freshman Saturday Loomis Monday Andover Wednesday Huntington Saturday Harvard lnterseholastif' Saturday Offered Harvard 2nd Wednesday Thursday Monday Offered English High Brookline Here There Here There Here There There Here There Here Here Here llllllllllllillllllllllllllllllllllllllllllllilllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIllllllllllllllllllllllllllllllllllIIlIIllllllllllllllllllllllllIIIIIIIIIIIIIIIllIlIIIIIIIllllllllllllllllllllllllIlllllllllHllllllllllllllllllUlllllllllllllllllIIIIIIIIlIIIIIIIIIIIllIIIIllllHlIIIIlIlIllHIIllllllIIIIllIlllllIIlllllIlIIIIllllllIIIIIllIIIIIIllllllllllllllllllllllllllllllllllllllllIllllllllllllllIIIIIIHIIIIIIIIIIIIIIIIIIIllllllllllllllllllllll IHHHHI 80 2 Manager. VVilliam Bc-nger M ln11I11I11I1H1rruHr11rn1nmyn1r1ummnmnulununnnuuaauuuuuzmllnluummllllnlmmrunmwlvllll 3Iyl,ljfjjjjjyww1lylylylylylyiylylyiylylylylylylylyyQlyiyQWQQWllwlyllllllllllllllllllllllggyg35qjgQ3jljyifwll Boys, Golf Team K X. Z, A., ,PAH Boys' Golf Tvani 2 Caplairz. Nicholas tilianferante 3 2 Letter Willller g NY. Benger P. tiianferante 2 P. D.-vlan J. tlilligran 5 J. Gianferante C. Nlannin N. tiianferante J. Stevenson EZ HE members of the team were chosen in the usual manner. by a tournament E5 which was won by this year's Captain. The rest ofthe team Consists of.l. and 2 ?? P. Gianferante. Parker. Devlin. Thomas lXlanning'. and William llenger. The results of the matt-hes to the date of this article are as follows: 2 Fessenrlen. 0 Newton. 5 2 Lowell. 0 Newton. 5 5 St. lWary's. I5 Newton. Exeter. 3 Newton. 2 5 Brookline. l Newton. I 2 zz With suvh an encouraging reeorfl. a vivlory at the State Nlaleh seems very 2 E probable. 2 2 inIIIIIllIIulllmumuumlllllmllllllllluumummammlIIIIIIIIIIIIIInmmvmlmmnumumvvmmlmmmunIIIIIIIIIIIIIIIIIIIIIIIInnnIIIInIIIIIIIIummunnnnnnnnnuIIIIIIIIIIIIIuInnnuumnumuuuiuminriimiiiurmIIlIlIIvn1nInnnIIImmunmmummiiirurirrrlrrrrIIIrIIIIIun-mmmnnmm1ininiiH1it1i1iiimmmmmmmnmmm 1itIIIummmnvumvuvumiililimwwmwuii i lllllllllll IIIIIIIIIIIIIIIIIIIIIIIIIllIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIllllllllllllllllllllllllllllIllllllllIIIIIIIIIIIIIIIIIIIIIHHlllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIlllllllllllllllllllllllllllllllllllllllllllllllllllllllll lft'lf'Wllulfil il yn ill.lMillllllllllllllllllll 81 l THEIMEWTQNHHU Girls, Field Hockey MI, Qu. ' ull. ,,',, 'VLH Li Girls' Fic-Id llm-key fjlllillllll. Virginia llmlda-r ,llfIIIt1!jl'f'. lllllll Pc-:u'son lfnllvll. Xllss Alim- .lunvs In-I le-r W inne-r, l liurlwr l' lfll1'lQll'j l llllzisv Nl. 4 liutun li. XI lfrusl ll . llmlclc-r l' ll. Spain llollis .lvraulcl livmla-rcl im xlK'flll'llHIlCl l'1-nrsoll ll ivlmrflsml NlnilWwlMMMWMWMMMMWMMW WWMWWWWWW 82 tr rw "''l'"Wttllilltllfll"tt3fl1tt!tl"l3Vl3l'l3llll'lt'W""t""t"t't"f'4' t i f. Qi. E -" 4 I 1 Q. I .X ,J Nt X i ' ' ft Vx .f , I l f ff, Af' -i.,t,,: qs! ll Qjlhglvxlkr V,-txt' i an rl 5.4 ,fs W3 'lik QQ A tg- l 1 HE 1925 hockey season. although not as sueeessful as that of last year. is not one of which to be ashamed. Out of the four games played. two were tied and two lost.. Praetiee started September lla. and was Continued for several weeks before any selections were made. After eareful Watching and diserimination. thirteen girls were Chosen to make up the varsity squad. Of these. live were letter winners last year. lvnder the direction and eoaehing of Miss Mit-e .lones. a star of this year's All-American team. the girls developed fine team work and defensive ability. but laeked aggressiveness in shooting goals. The season opened with a game against Waltham at Cabot lfield. Xlthough both teams put up a stiff light. neither was able to break the tie seore of 22. The following Week. our girls journeyed to Needham. where they were over- whelmed by a superior team. and were forced to a CVO defeat. Nlelrose eame to Cabot Field as our next opponents. While this game proved another defeat of 34. Cleaner playing and better hockey was displayed than formerly. thu' last mateh was played at home with Lasell Seminary. Both teams went on the tield equally determined to win. and the result was another tie. tsl. The Xluninae game, scheduled to be played during the Thanksgiving reeess. was unfortunately Called off on aeeount of the poor weather. Capt. Yirginia llodder. at goal. was a great faetor in keeping low the seore of our opponents. liarly in lDt't't'IIlllf'I'. a tea was given by Xiirginia llodder at her home. llere letters were given out. and the two leaders for next year's squad eleeted Nlarion Frost. eaptain. and Yirginia llodder. manager. iiiiiiiiiiimiiiiiiiiiiiiInIIIitIiIivIIIivIvIu1IInIIIiinnmiiminmmtiwiiiiiiiiiiiiitimiiiiiinmtw--wwrawmimiiimitiiiiirimmiitititWtiwmttiwwt.-t tw Wirth, llliltllt it tttllllltlllltllltlllllllllllllllllllllllllllllllllllllllllllllttllttttttttltlttltttnezmitttttttttttttttttmitwtrtittittnt,. trtrirtrtt . rlttttttiiittr S3 W' T313 NEQV9Y'fQNHAN NWWWWM HW HHIl!l1HWH HH Girls, Basketball Team if y T. 'XIlxrva- Nl. 'XIldl'l'VNS lf. l5zn'lwr I". Igrflflki D. limwn lf. ffm'ric'k li. ffhnlnpinll S. Cnllills I". IJVIIIIUU D. Dunlvax y li. l"arnum Nl. Fmkllzall Girls' liaskvlball 'rvanl fvllllfllfll. l"rn11ws Brooks xIllllllf11'l'. H2ll'll2lI'El l"zarnum l,'UfIl'll, Xliss liusinu liullllmm- l.e'l te-r W innvrs NI D. Ii. in. Y NI fy. D li. XI 'K , If lfrosl llogan llolbrfmk .lvrauld lxvmball lu-ndvrdim Pluvv Svhult z Spain Tilton Yulmltv Wzwrvn MMM MU mHNHWHUw HWWIUWM MW www EEHHWWaaaaaaaa14?aaaaaaai1aaaaaaVMHaaaaiarilaaaaHHiaaaaaaaitIaaaaaaitilaHaHH aaaaaaIliIaaaaaai aaaaaaHa14aaaaVU1aaaaaaVall1aaaaHHH1aaaNHHaaHHHHHHHIiWHHHHHHHHHHWHJHHHVIIIWHaaaaHHHPIHIIIHIaaaaW14aaaHHHaIaaaaaIFNaaaaaMilIaaHVaill!!aaaVHi!aaIaaaaHIHaa1aHHH!aaaaH5killIaa?HHIIHaaaVHIIIN4NHHIIIIHHHIIIIHHHHIIINHaHHIIIIHIHIHIIIIHaVHIIIIIHWHHIIIIHWW W lllllllllll 84 Mttttttttttttttittllltllltltlllllllllllllllllllllllllltllllllllllllllllllllllllllltllllllllllllllllllllllllllllllllll GJJTVUWEEYTFPYASIQQ t t 7- , r ,Y ga gi 5 f Z W tt ? I X llll-. its.. 2 V ii HEAT enthusiasm was felt throughout. the basketball season of W26. due to the excellent eoaehing of Miss liathhone. and her introduetion ol' a new System for ehoosing the varsity squad. Instead of choosing a squad of six. as in the past, it was deeided that a squad of twenty-one would he ehosen. . After eareful consideration. the eoaeh. Manager Farnum. and Captain llrooks seleeted elass teams. From these elass teams the outstanding players were 2 picked to form a varsity squad. The sophomores and freshmen displayed a i keen interest hy their large representation. In the results ot' the elass games the seniors headed the list with a total of 90 points. The sophomores. keeping step with their sister elass. eame next with T5 points. The .luniors followed with I0 points. while the Freshmen linished with no points. hut with a keen interest in the sport to he developed next year. E Sinee there was a eonlliet in the l.asell sehedule. it was impossilmle for the Newton game to take plaee. The three outside games were with Needham. Belmont. and Waltham. The seores tell the story: E Needham, ll Newton. 38 E Belmont. I6 Newton, I9 Waltham. 22 Newton. 32 The Alumnae game terminated in a TI6-I6 yietory for the former stars. ii Perhaps the most eventful game was the lfaeully game. in wliieh exen Nlr. E l3aeon's skill was not enough to eurlr the varsity. The whistle hlew with a 258 tl E vietory for the varsity. 2 At a meeting ol' the squad. tlleone Plaee. a wort hy .lunior. was eleeted manager 2 for the following year. The numerals and letters were awarded hy Nlr. Haeon in the usual way at the gym meet. :M llllnllllllttttttttt4tt1ttltu4uuu1utuu11u1tluulIll1llllnnllllllllllltlttlllltIutu1uIIIttIt1IuIIIIIItIIIIttIt1IuI1I1ItuutuHuHtmuuItturtttltltllltlttlllllttl11111111111t1tt1IuI1Iuunulmnlmlltllititttttttttttttttttlttltttllllullllltttit1tttlltlttllltlllltzm.tiifallitttltt.-t. S5 HIIHIIIIHIIIIIIIIIiHIIIIIIIIIIIIIIIPIIIIIIIIIIIVIIIIIIIHVIIIIIIIIHIIVIIIIIIIIHVIPIIIIIIIIIHI!IIIIIIIIIIiIIIIIIIIIIIIIIIIIIHIIIIIIIIIIHHHIIIIIIHHI TL-gflflfj NEWTQNIIAN' IIIIIIIIII!!I5IIIIIIllNIHIIIIIIIIIHIIIIIIllIlllllI!QlllllllllllllllllllIIIIIIUQIIIIIIIIIIHIIIIIIIllllllllllIIIIIHIIIIIIIIIIIIIIIlllllllIIIIIIIIIIIllI!III IMWII . 1 ,Ummm ,.v,w,, , 2 EE i 1 W frmnmmrvmmmummmuuunmnumumr111Innnnulnmwnunnnnun1ruu4Iu11InnnmnumnnuuuumnuumammmsrmmmunnmmrrIIu1n11er1I1mlumunmwmunEmuInurI1n1I11uuI1inIu1unHrun11innunuinran111uis4ri11uulnnrwn1nrnmimu1iimihi1Iunnmmmmaumunmn111u1Imumnmmnunmumu11mm1I1nmnuumuumnu1Immm1mmmmnmliunnnnmnuI1nhiiiilnunmuuuIliiiaiillllllrnvunmmunlummmumW 86 1N!WHHl!lNlHWlKKHKHKKHNHlKHKlHHHHHHlHHlHWHHHWW U W WWHHNHNNWW QYHQXIEQUQJEEN G'ffSj.W'fjENj'?1JffKQQEjIQf 45 f 45 .. Ah lliix ,Qi an XJ f J J ,Ck Qp,: K UK Q N 335 WIIIIIIP IIIIIIIIIiIHlllIiiIllllililHHIHH1WHl11'1llI11III1IIllIlIIlIIIIllllIIIIllllll1llllllllll4ll1l111HHHH H HIHHHHKWHN KliiIIlllll!lllll!!!!Hll1lllW 1HHHH HiHlXK111lXIkllllE!llllllIll!Nl4W1HN HHNWHIIWUEIHIEIIHHHHH H HUWHHWWE!m1!lHHluU N 87 lNfI'EqSfXTif"'Q1r,Nfl'HQQ,Ir,Nj' AI HWWH HH NM M IIIFi1 HH Hill4 I NIHIH llllll1HHUIIIII4 UH!IIIIl1WlIIIllf1f UflllllllwllliW iw 1. if If P .L ' E P' bf v nu Y Y f 1- 5- -, 27 'x w ,ww 11 , ww ,yi ,gn M NNW ,WN W X ,, , U 1 W ,1 ,ww X, ww pw pw-,N W f HWMHWINW N :u i?Ll HMWI5 MHU MHHWMNHH1Ih U4 HHMUn1Hww f W Hii1 HH'i'UM uli'11HWMI uH W1H WibW Sl' HHIM W V1 ll'4 N H1 H11 H 1W44 H NIH H '1 PlllHHMV fl1WHMHrf H HH HNIH VHHH IHH N V H411 1 UHHN H NIH HHIHHI VHIIIIH IVHIIIHH IHIIIIIIHHH!IIIII41lHHHH NHIIII14 ,1m,wH N wx, . Mm! ,mm , H I,N,3,"1M "1-R A A w ml: vw u 1 . 88 I E E E E 7 E A 2 P' 2 5-T3 E 7 2 m 5 "' E , 1 , 1 W Nw , N ,ww mzmmuunvwvunrmmxm W' i lllllllllllIItIIIIIIIIIIIIllIIIIIlIIIIIllIllIIIIllIIllIIIIIvllllIIIIIIIllIIIIllIIIIIIIIIIIIIIIIIIIIKIIIIIIIIllIIAIIIIIIIIIIIIIIIIIIII TREE? tHtlttltllttlllllllllHtllllllllllllllltttllHttlllttlllllltltllllllllllllltt ttlttt' The Newtonite FOR four years the Newtonite has occupied a position of ever-increasing impor- tance in the life of the school. It is now an indispensable part of the curri- culum. depended on by the pupils and teachers alike for news of the week's events, Well thought-out editorials. and interesting features. It compares favor- ably with any school or college paper in respect to journalistic st yle, scope. and usefulness. This year a new feature was introduced to its reading public. in the form of full-page articles patterned after the special features of metropolitan newspapers. These included articles about the alumni who have achieved fame: interviews, football, hockey. and special holiday pages. At. the beginning of the year a slogan contest was instituted to find an appro- priate saying to run for the rest of the year in one of the ears in the upper corners of the front page. "Use the Newtonite and let it use you." by Dorothy l.. Burnett, '26, won the prize. In accordance with the yearly custom, George WV. Dawson, faculty adviser: James L. Heggie, '26, editor-in-chiefg and Edmund F. lXlcLaughlin. '27, editor- in-chief elect. attended the Columbia Scholastic Press Association's convention in New York. Where they were afforded opportunity to get valuable information from well-known authorities. The Newtonite party was held February 18, when lirnest Beaufort. cable editor of the Christian Science Monitor, told about the newspapers of five differ- ent countries, on which he had worked. All the same time Catherine A. Noyes. '26, and Heggie were presented with Newtonite charms. in recognition of ex- ceptional service. uwuununumr1umt1nununuutllllllllliltlllllillilIl1lll1ll1llit1l1lllll1lllllllllili1llillllllilllnl11l111l11iiilllllliiillliililillullUlllllnlnulllililllliltt1lllluInlniIllnlulilllaililtnittt1nniI1lilllilllltiltllilinnunmmmnlititittUtminunnmwillitHtwilltmtitltttttl.. it . 80 lllll' "llll'll'llllullll.llllllllllllllllllllll'llllllllll'llllll4lllllllllllllll'lllllllllllllll THE NEWTQNIAN lllll!l?!lllllFllllFllllllllllllFFFllllll!FlllllllllllllF1llllFl99Flllll9lllllllllllllllllllllllll'll' Newton High School Associates Johnson Andres Vlctfullough Bonner NVhitmor President. ll. HoLnEs VVHITNIORE Boys' l'icc-Pr'e.s-1'der1l. J. CARLETON lNlcCU1,I,oUGH Treasurer, HAARIJLD ANDRES Girls' lice-President. KATHERINE BONNER Clerk, WALLACE JoHNsoN Tlell'I Newton High School Associates has been the largest and most active organization in the school during the past year. perhaps for the reason that every "bona fide" pupil of' the school. to quote the Constitution. automatically becomes an associate. The first week in November, representatives were chosen by the pupils in each home room to represent them in the legislature: two from every senior room of thirty or more. and one from every senior room of less than that numberg one from every junior roomg and one from every two sophomore or freshman rooms. This group of students met for the first time on November 12, boards and committees were appointed by the president of the Associates, who in that capacity, presides at the legislatureg and the machinery of the student govern- ing body was very shortly Working smoothly. Among the outstanding features of the year's work was a plan for a Junior Class Council, which was Worked out and put into effect under the direction of a group of junior students. The Associates sponsored the election of the editor for the 1926 Orange Book and arranged and executed a plan for supervision of the lunchrooms and grounds. V lull 1nr11QuuI1uu1nmu1Iuunu11111EuuHEllH11hhLit11uIulllmununlnnuu1wauuuuuuuisi1l1Hlilnuuulm111UllHuuuuuIIIml11illuun1mlH1llin1uliililnnlII1un1will1lwillHullulllllHlIlllllilmlliillll1llllll1illllllhlll1lllllilllllilIlHlllllllllllmlnlilllllllllullniilluliilil'luHinullllilulllllulliillHinlille'ullllllnlilIn'n'iiiiiilllAlfliiiiIll'uliiiiillliiiilllllillllnnnmunanumuunmn 90 MllllllllllllIIllIPIllll1Illl1llFllllll1l1ll1llllFl1llllllllllllllllllllllllllllllllllll NENETEEN TWEWTYQ3333 lllllllFiWIEl'?'!!l!ll!'lllllllllllllll'l ll ll l Senior Play uPrunella,' or uL0ve in a Dutch Gardenw ?? Ry LxwmcNCE HoUsEs1.xN AND Gn.xNvlLI,E BARKEH gi The Cast LOVE. a statue . . FIRST GARDENER SECOND GARDENER THIRD CARDENER Zi BOY ..... E 2 QUEER. a servant . gg PRUNELLA . . . PRIM PRUDE her aunts E. PRIVACY J E QUAINT. a servant . PIERROT .... 2 SCARAMEL. his servant. lVlUlVllVlERS: Hawk E Kennel E Callow . E Mouth . Doll . . Romp . Tawdry . Z Coquette. TENOR . In the Order of Their Apps-aranc Q COACII, Miss Irene M. IIaworth James R. Colton Carl A. Ns-lson Ralph A. Paterson Rohm-rt C. Grant. Jr. John XY. Fclllows Nlildrvd Falwy Vary E. Ytright Nlary lladlt-y Jane- O. Briggs Thi-odora XY. Alln'ev listlivr .-X. Higgins Xlvrrill XY. llanunoncl Alhvrt Xlc-Carlhy Ilvnry llillson John C. Rzunsden Charls-s li. Tinlhiv Jovl Nl. Nivhols Dorothy I.. liomlclarcl Katharine Ronnvr Franvvs ll. Purple Florvnro I.. Lvonarrl John C. Millard WiJi1'1'itn'1inJn'1IIIIlll1Ii1iildiiiiiiiiiifiiiffiiiiifiifiiiifIilnAinCu'lflifiiiiriiiiiiiiiililillillllln'luin'uinteinMliiliiifliiiiHiiiIuiulnllllililiilliillullHIninz1inIniiiiiiiiiiiiii11iiitniitiiiii1i1Illiiiiliiiiiiiiiilt1i1iiiillliliiiilliil1tuI1ii11illiiiiiihiliii1Hlliinnniinilm11iilunIuilulunmnlnmllJknrnuliuinunnmin1141iiunv1111un1Iuuninmmmemmmulellmlumwsmmlwillii IH 91 mins tttlllttttttllttttllttylyttytttillllttgtgttlllttttgtttllllltttttllltttttltttlltttHllllltttttltlllttlllllltttttlllltttttIlllltItttltlllylltttllllllltttt THE NEWTQNIAN itiinyuylyuipuiyuligiliimuuuupiinnut:uintM1initinlulirbqinyqupyliiluuIWmuptimINWIujynnuylytyliqmlmumumiummm nnmun Alpha Gamma Tau President, WILLIAM Ctmxllxtzs l'icc-Pr-e.vI'de1zl. LEONARD CLARK Secrelary. FAITH STONE Second Vice-P1'es1'der1!. YIBGINIA HODDER Treasurer. EDWARD STRUM ALPHA Gamma Tau. the Mathematics Club. began its program for the year by a meeting in October with one hundred and forty members present. the largest enrollment since the club was founded. Those eligible for membership are post-graduates, seniors, and juniors who have attained an average of "B" and such sophomores as have maintained an average of "A" through the first two marking periods. The meetings were varied. but all related in some way to Mathematics. The design ol' the club pin was used as a basis for cut-up puzzles of geometrical hgures to be assembled by the club members. At the November meeting. Edith Stevens and Blanche Walter gave illustrated talks on "Geometry in Nature." explaining the geometric forms of leaves. trees. berries. and uniform crystals. The next meeting was a social. including songs by John Millard. and a "Rec- tangular" dance. or Yirginia Heel. Previous to Mr. Holland lt. Smith's departure from the Faculty Staff. he addressed the club on the subject of 'tlfnicursal Curves." the theory of tracing patterns with one stroke of the pen. ln February. the club had the privilege of hearing Prof. Titus Mergendahl of Tufts College speak on "Mathematics and Mysticism." In the eourse of his talk he discussed Chinese puzzles. which, for a long time, were believed to be magic. but which have now been solved mathematically. The fourth annual Alpha Gamma Tau play, "Scenes from the Lives of the Great lNlathematicians" was presented March 9 and 10 in the assembly hall of the Technical Building. lt was directed by Miss Vesta A. Richmond, and contained six scenes in which mathematicians of different nations, meeting in the Elysian fields. told of their Work on earth. The annual pienic held in May at which the officers for the coming year were elected. iumii iiiimmmiimumiimmmit:ummimlnminmlmimununrunnmrmnmummmIummm:mumisIIIIninIIiIIuin1itIInnIn1ifiIiNitinu1uitIH1uuuuIttnIin1IilIIIIIIuIIIIiIInHiiiIInIn4niiiIIitIInniifiillumiiimnitLIIIituiiii11iniiiiiitili1ii1iiiIiI1init11itiiiii11uniiiIiui1mnI111Iu1IiiiiHH1I111I11Iiii1I41i1HuIIriIiii6i6ir:iaii1iiiiniiiii1iiiiiiiiiiiiiuiiHi11iniuHuiiin1Iunuinitiii1HiiiiitiiIH1iii1iEiiiiiiiiHiIInwunnnlnuanlnuumumm 92 ItlillllllllllltiltitllHtHttttHttHttttttttttttttttttttttttttIHitttLttti5Etiliutiitlifiitm Commercial Club President. JOHN B.u1sDEN Secretary, ELEANOR XYALSH Treu.Q-lzrer. liowxnn tiexylvloxs LTHOYGH the Commercial Club of 1925-1926 did not begin its activities until the second semester of the school year. it has succeeded in attaining the purposes for which it was organized: namely. to raise the standard of scholar- ship, and to help its members to attain a higher efficiency in business methods. The executive board consists of the president. secretary. treasurer. and the following five members of the Commercial Department: John Quinan. Lloyd Young. Dorothy Purcell. Allan Bliss. and John Buswell. Several visitors to the club have given very instructive addresses. among them being Mr. Herbert McGill of Babson Institute. and Mr. ll. C. Bentley of the Bentley School of Accounting and Finance. One of the most interesting features of the Commercial Club is the Dancing Class, held each year under the direction of Miss Grace Kerrivan. an alumnus of the club. The party and dance which was held April lst in the Technical Library brought a fitting close to the most successful and eventful year in the club's history. The Club expresses sincere appreciation to the Faculty Adviser. Hr. Nlay- nard Maxim. whose unfailing guidance and invaluable assistance have helped to make each undertaking a big success. Alpha Beta UBING the past year. the Alpha Beta has accomplished much. and its large membership and long waiting list have shown the strong interest and ex- cellent spirit felt toward it. As the name indicates, only those fortunate ones who have received the marks of "A" or "B" have been allowed to join. The club first assembled for a business meeting. at which time the officers were elected as well as various committees chosen. Doris Eyre. '28. served as Chair- man ofthe Membership Committee, and Mildred Stuart as Chairman of the Entertainment Committee. This year about half of the meetings were devoted to entertainments fur- nished by the club members. and the other half to outside speakers. .-Xt Christmas time a very interesting program was enjoyed. livan Collins. disguised as a Persian magician. performed dazzling tricks. and a guessing contest provided much interest. ln February. members of the club gave a burlesque of "Paul Revere's Bidef' which was most amusing. especially when the noble head of the famous horse unexpectedly fell to the floor. This has been one of the most successful year's history of the club. due to the able guidance of Miss M. Aimee Ballard. the club adviser. tttwtttttvtttttttttt,Mtv-will t 1 it . sv W, t - lllllllllllllllIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIlllllllllllllllllllltltHIlllllIllllllllllllllllllltlttttttttlttlttttttttttttltlltltlttHtHttttttttttllllllltttltttttttttttttttHttlttlllltttItttHI4tItttlttlttzlltilttlltttttttttttttttt till tttt tttttt tttt:t:tttft,t1t 1 tttt u i PM 9 3 Wu lllltllllititllllllllllllllltJll tltlltlltillllttTtttllt'lllllt!illl.tilllllllltttltJllllllllllllllttttltlllt THE NEWTQNIAN IlllllllllllllllllllllllllllllllIIII!llllllllllllllllllllllllllllllllllllllllIlIIIIIlllIllIlIllllIllllIIIIlllllllllIIIIIIIlllIllIIIIlllIlllllllllllllllllllllll lllllllllll English Club Pre.Q1'de11l. llicuxnn F. lklILLER Secretary. BTARY li. TILTON l.l'I'P-PFf'.N'l'liPlIl. .fkoiviis IIARTRIDGE Treaszirer. l'lDNlIllY n F. lMll'LAUGHLIN Tlell'i purpose of the English Club. the oldest club in the school. is to arouse still greater interest in literature in the minds of already eager English students. and to show more clearly the relationship of literature to life. As usual. there have been many on the waiting list. who have been desirous of joining the enthusiastic club members under the able guidance of Miss Louise Bichardson. In the fall. the club opened a contest to the entire school for the best original design for a book plate for use in books donated to the School Library by the club. This contest. which excited much interest. was won by Kenneth Barton. Two interesting and helpful talks have been given to the club. The first was given by Mr. Samuel Thurber. former head of the English Department, whose subject was. 'iWhy VVe Write Compositionsf' and the second, on ."Suc- cessf' Mrs. Irving 0. Palmer. proved very inspiring. ln January. a program under the direction of Miss Drusilla Guiry, one of the club members. was presented. lt consisted of talks, essays, musical selec- tions. and some interesting parodies. Much amusement was afforded the club members and their guests. the Drama Club. This courtesy was returned at the March meeting when the English Club were guests of the Drama Club, on which occasion a play, "The Two Lamps" by Kenneth Sawyer Goodman and Ben Hecht. was greatly enjoyed. This play was directed and coached by John W. Fellows. a member of both clubs. The climax of the year was the Prize-Speaking Contest, held under the aus- pices ofthe linglish Club, and presided over by the President, Bichard F. Miller. The winners. to whom silver cups were presented. were John N. Meissner, John Wi. Fellows. and lidna F. Laubner. Following the speeches, a comedy by John Kendrick Bangs. entitled. "A Dramatic Evening." excellently coached by Mrs. Caroline lol. Mills. was presented by the following members of the club: Catherine A. Noyes. llarriol B. Schell. Miriam li. Hayes. William Park, Marcus B. Bemick, James L. Heggie, and J. Clinton Roper. The proceeds of the evening were devoted to the purchase of books for the School Library. The annual picnic in June formed a delightful conclusion to the activities of this most successful year, and the Junior members are already anticipating another year of club work. I t WUll' lllltlllllllllllllIliilllllllllllllllllllHlllllllllllllllllllllllllllllllllWilllHlllllllllllllllllllllllllllllllllllllllllllllllllllllllllllltlllllllllllllllltltIIIIIIUlllllltlllllllllllllllllllllllllilllllllllllllllllllllllllllll1lllllllllllllllllllllllllllllllllllllllllllllllllHllllllllllllllllllllllllllllllIIIllIIlIHllIIIlIlIlllIllllIINIIIIlllIllllIIlllllIllIIIIIIII1IlllIlIlll!IIIllllllllllllIlIlllllllllllllllllllIlllllllllllllllllllllll 04 llll llllllllllllllllllllllllllllllllllllllllllll liLiLIl!il!Il.?l!lililliillllllllllllllll ti. ..A ...tilllliilll iiii... itllilllllilllllillfislillit .... illllll ul EX-L1br1s Presiderzl. BIARY E. T ILTON Secretary. THELUA STANLEY T-1.00-Pl'PS'I'dPIIf. HARR1oT B. SCHELL Treas-z1r'er. TTILDA P1sER THE Ex-Libris. the Latin Club. consists of twenty-five members. selected from the junior and senior classes. assisted by Miss Ida Wfallace as Club Adviser. who has proven of great assistance in planning the meetings of the year. Part of the years program has been devoted to the discussion of such books as 'Ter- gilicesf' "Ben Hur." 'iLast Days of Pompeiif' 'GA Friend of Caesar" and "Chil- dren of Ancient Bome" by assigned members. Various phases of Boman life have also been topics for discussion. The main feature of one meeting was a "Roman Banquet." at which the members partook of the entire feast "ab ora ad malaf' just as might have been done in Caesars time. From the play "Caesar and Cleopatra" which the club attended. the members learned that both the characters were far different from their established repu- tations. The costumes were especially interesting. showing as they did the Roman and Egyptian style of dress at that time. Some club members who saw the picturization of "Ben Hur" were able to give to the club still more definite ideas of Boman life. i.i...i..i.. .. French Club-Le Cercle Franoais President. WILLIAM PARK Boys' Tvl'CP-Pf'PSl'dPI1f. JOHN BIAYNARD Secretary, FAITH STONE Girls' TYIUCP-Pf0Sl'dPIIf. BARBARA FARNU11 Treaszzrer. IQATHERINE LOTZ AT one of the Le Cercle Francgais meetings. the club was privileged to hear an illustrated lecture on "La Marseillaisef' loaned by Professor Morize of Harvard. Two social meetings were held. and at one of these there were con- tests in the translation and spelling of French words. In January the club presented two French plays. "Le Medecin Malgre Lui" and "Rosalie" The former was coached by Miss Helen L. White. and the latter by Miss Emily P. Burdon. the Faculty Adviser of the club. The pupils taking part in the former were: "Sganarelle." Henry Argento: i'Martine." Albertine LaCroix: 6'Lucinde." Estelle Cyr: "Geronte." Kent Allen: "Lucas" David Scott: "Yalere." Edward Strum: "Leandre." Maynard Moody: and "Robert" Arthur Clark. Those taking part in "Rosalie" were: "Monsieur Bol." Arnold Nichols: "Madame Bol." Eloise Andrews: and "Rosalie" Edith Willcox. The club constitution was amended so that the officers should be elected at the April meeting instead of at the first meeting in the fall. The officers elected for 1926-1927 were: President. Arnold Nichols: Boys' Yice-President. Charles Parker: Girls' Yice-President. Margaret Blunt: Secretary. Marjorie Bolster: and Treasurer, David Scott. llllllllll llllllllllllllllllllllIIIIIIIIlIlllliIlllllllllllllllllllllllllIIllllllllIIIIIIlllIIIIIIIIIIIllIllIIllIllIllIllllllIllIlllllllllllIlllIIlIIIIIllllllllllllllllllllllllllllllllllIIIllIIIIIIIIIIIIIIIIIIIIIllIlllIllIllIllllllllIIIIIIHIIlllllllllllllllllllllllllIIIlIIIIllllllllllllllllllllllllllllIIIIIlllllllllllllllllllllllllllllllllllIllIIIIIIIllllllllllllllllllllllllHllllllllllllllllilllllllllllllllllllllllllllIllIllIlllllllllilllllllllllllllllllllllllllliilllliillllllliiillllllllllllllllllllllllllllllllllll 95 tml llannumvlunmmn111unurnz1r111u1u1rrIrrtm111uunr1umulnmuuunm4mmmmmuumsluuumuuummmrnunnmmnululm THE NEWTQNEAN IllllllllllIIIlllllllIllIIIlllllllllIlllIlllllllllvlylillllllllllIllIlllllllllllllIIlIlllllllIIIlllllllllllllllllllllllllllllllIllllllllllIlllllllllllllllllllllll lllllllll Spanish Club PI'f'Sl'df'Ilf. l.icoN.xnn CLARK Secretary. HELEN STUART lvllff-PI'f'.WI.Ifl'llf. lllciuan XVINSLONY Treasurer. lhIABY SWITZLER Tllli Spanisl1 Club is open to all students. first or second year. who have re- ceived the requisite mark of I3 in Spanish. and have a majority of B's in their other subjects. The club is comparatively small, because the subject of Spanish is elective. The meetings were conducted in Spanish. with occasionally a few words of explanation in English. At three of the meetings. some Spanish plays were given. Two short plays were presented by the first year members at one meet- ing. Another time the entertainment consisted of Spanish games. Mr. Fran- cesco Argento addressed the club-members on the subject HSpain." and at a later date the beautiful Spanish cities were studied in detail. At the April meeting all the students taking Spanish were guests of the club, and pictures of Spain's wonderful art and architecture were enjoyed. Much credit is accorded Mrs. Marion Pm. Haslam, the Faculty Adviser, who has done so much toward making the meetings interesting and helpful. Q..-,.+-L-i. Library Club Presidenl. llfxnmor B. SCIIELL lvl'F6-PfP.Yl.dPllf. ELEANOR C. PHILLIPs Secretary and Treasurer. KATHRYN F. SMITH THIS Library Club is composed of twenty senior girls elected from a group recommended by the linglish teachers for their scholastic ability. The purpose of the club is to give such help as is needed to the Librarian. Meetings were held on the first Monday of each month. The first part of the meetings were spent in doing library work of some kind and a social hour with refreshments followed. At the last meeting of the year the initiation of next year's members took place. These members assisted the librarian in closing the library for the summer. Beside the work done at the monthly meetings, each member in turn helped during the week by taking attendance and giving out books in study periods, or assisting after school. Although in existence only three years, the Library Club is one of the most helpful organizations in the school. ltllllll llllllllllllllllllllllllllIlllllllllllllllllllllllllllIlllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIllllllllIllllllllllllllllllltIIIIllllllllllllllllIlllllllllllllllllllllllllllllllllllllllllllllllllIIllllllllllllIllllllllllllllllllllIlllllllllllllllllllllllllllIIIllIIIIIIllllllIIIIIIUIIIIIIIIIJlIIIIIIIllllllllllIIlllllIIIIIIlllllllllllllllIIIIllllllllllllllllllllllllllllllllllllllIlIllIlllllllllllllllllllllllllllllllllllIIlllllllIlllllllllllllllllllll mnunu 96 llllllllll lllllllllllllllllllllllllllllilllllllllllllllllllllllHHHllllllllllllllllllllIlllllllllylllllllllllllllllllllllllllllI NHNETEEN TWENTYQQQQQ llllllllllllllllllllllHHHIllIIIIIIIIIHHHIllHHHlllllllllllllllllllilllllllltlltllilWil Wi Hill Drama Club President, ROBERT GRANT Secretary. ELIZABETH PARKER Vice-President. FRANCESCA BARKER Treasurer, ERNEST HAPoooD UNE, 1926. closes the second successful year of the Newton High School Drama Club, organized in the season 19214925 to furnish interest in the study and production of plays. The other aims of the club are to provide for an annual production of major importance and to offer means for any minor dramatic activities. Beside producing an annual play, the club has had the good fortune to hear several excellent speakers, and to present three short plays coached and managed entirely by the members. The first meeting in October dealt with the election of officers and soon the club affairs were running smoothly. At the November meeting g'Monsieur Beaucaireu was selected to be the major production of the club this year. The cast was soon chosen. with Richard F. Miller, Miriam Catheron. and Allan Bliss in the leading roles. The details for the presenting of this play claimed the club's attention during December. and it was presented with considerable success on the 17th, 18th, and 19th, of that month, before an audience totalling L200. On January 21 the club was honored when Dr. .l. Edgar Park read an Irish play by John Synge entitled "The Shadow of the Glen." At this meeting the cast of the Senior Play was elected to honorary membership. During the following three months three short plays were produced by the members. The first of these productions was "Overtones" by Alice Gersten- burg, coached and directed by Catherine Noyes and presented in February. The second, "Two Lamps," by Kenneth Sawyer Goodman and Ben Hecht was directed by John Fellows and presented at the joint March meeting of the English and Drama Clubs. The third, "America Passes By," was coached by Merrill Hammond and presented in April. .liglg-T-, Girls' Glee Club Presidcnl. AVICTORIA WILLI.ANIS Secretary and Trea.w11rer, lXlARTHA WIL1.soN HE Girls' Glee Club has successfully completed another year of work. This organization of forty senior girls was under the supervision of Mr. Edward N. Griffin, Director of Music in the Newton schools. As a surprise to the school at Christmas time, the Girls' Glee Club. together with the Boys' Glee Club. sang Christmas Carols in the corridors of both build- ings. In January, at the invitation of the Music Committee of the Community Club of Newton, the girls entertained its members with three selections: "Belle Napoli," i'To a Wild Rose," and '6The Kerry Dance." The club assisted in the March concert of the orchestra by singing two numbers: "The liirdlaud Symphony," and "The Volga Boat-men's Song." The girls also took part in the Annual Outdoor Concert which was held in June. mumw uuIuIuI1IuI1I1I1I1I1lilillilJliiliiliiililihihihhlhiilh11h1hhlhhhhh1111ihihihihililliilnliililliriiIuiII1IiiuuhIllllllliillllilllllullullllllrlwiiii1rEuilinlllmnimlirlllnnununlluliliiiiilimnI1IiI1ii1Wi11iili4lliililuuiunnllll4iimuunumnmiA1l14iillntllszelsiiuiiiiliiiiiiii1uumeesnliiiililuzllfflllilllisflfAwi A lllllllll tw 97 willummmlluuumllumenrrluanrmmuuunlmulnnrummm1mumulmumllnnmlmu11lmunllullnullnmlnnmummml THE NEWTGNHAN ug1willq1QQQ1lggq11qqunumqnQlilly11Q1lilyiqQ1lillyQlillyq1ggrinQqQQqlillylQQtillitQllglllllllmunmnnzlllllmurunnmu Home Economics Club Presidenl. HELEN AICKEE Secretary, CECIL KINRAIDE lil-C'0-PFP.Vl'dPIlf. FLORENCE xlEAD Treasurer, CONSTANCE DORT THl'I members of the Sewing and Cooking classes of the Newton High School have organized a Home Economics Club in order to promote an interest in Home Economics and to establish high ideals in community service among the members. The club is governed by an Executive Board, consisting of a president, vice- president. secretary. and treasurer. The club is limited to forty members- ten from each class. The faculty advisers are Miss Alice Alden and Miss Gladys Davis. who have given many valuable hints to the organization. This being the first year that the club has been in existence there has been only one meeting ol' outside interest. and that was a trip to the Priscilla Proving Plant in Newton Centre. This took place about the middle of March. l.,-Mill.. Boys, Science Club President. FRED XYING lvl'CP-Pf0SI.dPIlf. PAUL PETITNIERMET Serreluryv and Treasurer. l.oRnvG SIEGENER TH li Boys' Science Club. limited to thirty Freshman boys. was reorganized this year by Miss Katherine Wilder, the club adviser. The aim of the club is to stimulate interest in science and research. Several trips were made to various points of interest. one being the Massachusetts Institute of Technology, where many exhibits were explained and discussed. At the monthly meetings. scientific problems were considered, and instruc- tive lantern slides were shown, including microscopic pictures of snow crystals and their formation. and other interesting subjects. alll fill itllfsllllliitllllmllllrullllvnmiiillin11lllrmulllmulllrullAllulnllsulilrrlllilllulm1lllI1llllmllllumllmmullI11HulllluuunmlluuumllnnmllunmrElllluullllilllillnllillllillllllHilllnllillllllllllllllullllimilililnlliilll1llllliuliliiiiililI1ili1lilUiiillilililmili1ii1li1illiiilllillliiiiiiiilllillllllllll1mummrnnmmuuummm 98 llllllllll lllllIIIIIIIIIIIIIIIlIlllIllllllllllllllllllIIlIllIllIlllllllIlIIlllIllIIlllllllllllllllllllllllllllllllllllllllllllllll llllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll llll The Orange Book Editor-1'n-Clzief1926. EDGAR KENT tStaff not chosen at date of this writingj AFEVV years ago. before the unification of the three schools. the pupils of the Classical building felt the need of a handbook of general information for the benefit of the freshmen and other newcomers to the Classical High. Accord- ingly. their student governing body instituted the Orange Book. which had for its purpose to thoroughly acquaint the freshmen with the rules. requirements. and Customs of the school. and to make them more loyal supporters of its activities. Several years passed with the little handbook steadily increasing in size and popularity. Then came the unification. Alan Shaw. this year's editor. was faced with the cry. Hmore, bigger. and better Orange Books." That he. with his staff. fully answered the need is well attested by the fact that the book trebled in size, doubled its publication, and then to minimize the increased cost. it was sold to upper classmen as well as freshmen. Next fall the book will be sold to freshmen and upper classmen with the hope that the school will support the project to the utmost and make the Orange Book a financial success as well as a gem among school handbooks. It is the aim of next year's staff to make the Orange Book a self-supporting institution. for they believe it to be a prominent factor in the proper commence- ment of the school year. both because of its information. and because it is a distinct aid in developing school spirit. IIIIIIIIII 1111111111Inr1nuullmllllllllllll1lll1llHlHHHuul1HHlliliilul1i1I1ilnuunlnulnlll44lrlrllvr1u1ulnlllllllll1lllrliiiilllllillllll1ll1LllluuImlulllllllllllllllllllllllllllmnnmlmlllllllllllmllllllllllllllmlllllllllllllll1llllllllllllllllllll .t.. llllll,'wfllllllllllllw1.I-N' 9 9 ummmHwmnmlrumml115Q1up141lppQ1QIWywlyjplprmnmllnplymymum4mmummnpllmmuuimpmlunplaummmummmQQQQLWW1t 1-Hg NEW-1-QNIAN llljllwillgjljillQljlllj11lWi1jjllll1llllljlllillljlllljlllljllllllllllIllIIIIIHIIIIIIIllilllIIIIIIIIIIIIIIIIIIIIIIIIIIIlllllllllllllllllllllilliillllllll Violins Dorothy Anderson Henry Argento Elizabeth Bicknell Elizaheth Chapman Evan Collins Richard Cummings Norman Dewing Lucille Dewing Anna Doherty Norman Dewire Ralph Fox I .inzee Gifford Virginia Hatch Elfrieda lievorkian Estelle La Croix Hohcrt Lawson John Mahony Thomas Paul lYilliam Park Elizabeth Phalen Alice Pluksne Carolyn Pomeroy Sigmond Roman Eleanor Savage Edward Schirmer Joshua Seaver Doris Seibert Frances Sullivan Band Saxophone Lawrence Bassett Walter Brandt Walter llealey Richard Leonard Harold Root Varsity Orchestra CHARLES B. HARMNGTON, Direclor Tuba John Gill Viola Evan Collins James Stevenson Cello Faith Foster Marie Roman Nancy llyther Eileen Sullivan Bass Alice Heron Bernard Rockwood Clarinet Fred W. Anderson llichard Winslow Flute James lleggie Trunlpets Roy Baker Elsa Brandt Curtis Church Marion Frost llohert Ilayden Gerald Hudson Ned Marion Priscilla Spear Frank Thomas lluth lliford Piano Francesca Barker Dorothy Ilazen Ruth Page Horn Lewis Perry Alden Spear John llitehcock Trombone Joseph Gill David Livingston Organ Ethel Richards Drums Guilford Currier Dru nls and Xylophone Floyd Sawyer Baritone Horn Bernard Rockwood Drums John Sholes Floyd Sawyer Paul Nason nuunm ummmnnmmnmmiiliuliiihiiiiiiilhiE1Eli1hEMii1iihhlnilulhniiiihhlil111hliiihilliilniiiiiiihll1lilh6Eiiiiiihhhiiiiiiiiliiiilihhuiiii1h1iii1Ih1h1iilriliiiiiiillhiiiiiilh11lkiiiihiHhhiiiiihiiiiillllill1hh1liiilihh1iiiiilhiiiiiiilihhkiiiliiiibillhhibbiiillhiiiiillhiiiiillllkiiiiihlliliitiiiIIkkiiiiiiIIIliiiiiiIIIniiiii1hIklEiiiiilIlliiiiIIIIliiiiill11lIiiiiIiIklillIIIIIii:1III1I1I1IlrIIIIIIII1nuunumnumuuunnuuluunumua ummm 100 W NHNETEEN' U5PHHHPmiiiiiillllli40 W W HH HHUiillklfamminium HH HHHH1NHHlr:1iiiii44Q ummm EiuuulmlmuhluHH1111IiiiiiiiiiriiulHHiilkhuiukiidiilliiimuul1IuHH111miihhnu1ulIiIInuIn1IuI1IuIiihHuhIH1urm111iitiiitihittkitiaaiiiiriiibihiiii1i1i1i1311hh1hh11H1iMtH1Iui1I1IIiII1huiilliiiiiliiiiiiiiiiii11nin111iiui1Iuiii1iii1IIIII1II1u11mnutmnihh1ihiiiiiHHIil1iiiHuluillulnmmwmannMnnm1rmriaIin1Inuul ma u1u1a1nm1mumunnnAmv11aim1I1I1nIuaeiuzrnuaasnmmmmuvuv v Hvmummm , t5f gQs, Q1p4,1p 1 p M u +m w I 0 I mmmnmlmv nnrummnnmrmmumrmwwmnmwm mmvvnmmm umuw1mwmm vwmm nwmm14nnmmfmmmluamumun -gg-HE NEWTQNIAN pumngm5III1Irmmum1nursui111W1QWuxigg1111QQ1myn1gmqw1144qQQQpggqqggpqQWgQ11uqqqmm115QU11u11x1mqqqqq1g1gp1q M .T , M, , , ,, V 1, X- ,W ,W ,M W, ,,mw.,,.w, ww ,ww , M, H W Nu ,, MW. 11 H, 1,mmNN,NWIW-uw.,, . M, 5 E 1IIIIIill1H NHIIIH Hiiiiml NNW IE:EU UWMNIINM51 NWNW Wlllw USWH iIIIIIWHlIIIl14lWLIlll! NHEIIHl WHIIH1 HIIIIH1b LIIIIWH HiIlllNHHIM' Wkiiilw HHIIIH IIIIIIHH PIIIIIHWIIIIIU1HHllII!I1NHUIIHIHHIIIIII1 EIIIII44NHHIIIIIH HIIIIIHVHIIIIHHH IIIIIIIHWIIIIIIIHHHIIIIIIWIIIIIII4HHIIIIIII4IHHIIIIIIIHHIIIIIIIIIIIIIIIIINHIIIIIII4IVHHIIIIIH HHIIIH44IWl'IlIIIlHIIIiIIIIIIlUIHIIIIHHHHHIIIIHHHIIIIIIIIIHH WUIIIIIII 102 W NHNETEEN TWENTYQSEZZ WWVHIIIIIHHHHWHNNHHNWVVVIIIIIIHHHIHHNHVVVHHIIIIIIIIIIIIIWWHHHVHIIIIIIIJJ WNW X V X ffffff fyfffyf ff X ! W A fA ff M 7 f ff W f M475 f X W ig 3: ,. ' 1,1 ' ' sig. ',,. ,. it ww1wwww1rwHw,wwww1mmmnumvu-nmmuwuuwwmuuumuwwnmwx ww!,,wu,H, w 1wwuwuumwuwww mmmwmwuww1www,1wummmumrmmvwwwmuwwvuwunwwuu1uuuuwummzwlmw1-1wwInwmmummw,H ww x!'- 1 W ,1 IIIIIIIIIH IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIHIHWV IHVVHHIIIIIIIIIIIIIIHHIHHVWHIIIIIIIIIIIIIIIIIIHHNPI NHIIIIIIIIIIIIIHHH HV Hllillllillllllllll1 W VHIIIIIIIIIIIHHH1H VHIIIIIIIIIIIIIIHII N HHIIIIIIIIIIHH I W HHIIIIIIIIIIIIHH WH5IIIIIIIIIIHI W HHIiIillII44HH NN HHHIOIHHH N W miii11HNHHHW 'QIWHIJH WWHJUHNW WM WHUHMMIIV T IO3 w mimi, MNH f.., 7X , I 61515 1 i' - Y' in ' Q ff 4 J l Ng 719 gl S-1, X-2 fflW',, I " ,f 4 11" 1 . 0 .. 5 A I I" lu Q Ja Aiysaaf 2,19 f If Wg, QQ . 7 W f V I Y ,ll ,IIJIIXIJ ,,, ,. 5, ffff '-f'f""f "ff-I - I tw., - , 13:5 ,f -'gk ' I f B1 lff 'JI il L'-" 'lf Lg ffl: 7 T' rf" 923, af-Z, ,I fr nj X i ' r fr I ll I , '7 I Q if A 6' IN N TDNHAN INI A CI I A Ii I,I'iS'I't JN l'I'I"I'I'i 82 .Mrpl1'salu'v Illl., xxiilbilll "lim us wilrl us I run bv." I'rairiv Flown-rg Iiorn In thx- llam- aftvr: lla:-v Conrsv, Cgrr-vn: The Nngu-I Svhoolg Miss Stitcrlwfs Dre-ssmakinprz Class vlnoristc-r until rvtiringg Cooking Club. l01Z?1 I.nm'h- lloom. Iliff lg Corridor Dm-hating: So:-is-ty, l'lZ2?1 lixpc-lln-cl from all class dam-4-sg Chap:-ronv at I-FPSIIIIILIII clanm-1 Ilonor Iloll toni' tlayl. CI.-'IIIICNCIC lxISNIlC'I' Zio Ixvssilm- Nun. Waban Ixissnwg Iiorn SUIIIUIIIIIPL Soup Course- Illllxg Allgivr Svhoolg I'ossP l'olim-v Muni:-lily: I,un4'h Iloom Iinttvr ilivstvr I, Il, Il. I. 5 lNola-1 hvis not. non l1IllII'UtIlI4'Il0Il Da-laysCommittm- I. 12,1 I. a 0. 5: Dirvvtor of Ihv lianel Armory llop Committvv. 5: 'XII Nightt-rs INI ancl IH1 N1-rxous Wvrvvk. 5, G N Y Ii, 'I' Ii A I W1-lt SI., IN cst IM-xxton "'l'hr' fnilflvs of yuulh um' mv !ll'lllNll'lll'S.N Chinkg llorn Long 'I'im0 Ago: Nuts Conrsv ZZI 21 l.as4:Il Seminary: Ilnrtll'lt's Svhool ol' I,:lun1Iry: Class Wiaslwr, I, 2, Il, Champion Plat? I,it'l-u'r. I: lu-vpvr of Ilonu' l'laI1-, Il. 53 Wasliwl Football Suits. I. 211 Savior ol' Football M1-n, I. 2: Sw:-pt Lovkvr Iloom, I1 .kxxartlval Nlwlal for Nlosl I'niquv If:-al, I: Wash Iloll antl I'ark1'r Ilonsu' llolls. S1 I,4'4l I'it'UIlUIll- ivs Class, Il, I. Ill l.l, XlUN'l'.N'N.-K Anonymous, II. C, uigll'l'l'llll'NS hux fls :urn p1'rjfl1l1w." .lust thv sanlvg Ilorn Ilnknoxxng UI' Coursv 'I'l'or2I: lklovivsg Guvss II:-'ll Go Ilavkg Sheik ol' Svhool. I. 2. Zig lfashion l'Iata-. sl, 53 Dwiivr of Little- Shopg Class Nall-tlivtorian: Iuclitor ol' X1-xxlonitl' I. 2. "IND" lxNU'l"l' 2 Walnut Knoll, Unk Ilill "The lHifl1ll'l' lhvhv ure' Ihr' hurllvr ,lIPvVfllH.U lNaug:hlyg Ilorn Yvslvrflayl Hough Cours!-, News Iluililingz Concord Rc- formatoryg Inlvrnational Svhool ol' Hank Ups-m-rs: Football, I.ZZ, Field Ilockey, I. 12. Zig Crash:-cl gate all his years at Newton: Chvws heavy cut plug tno mort-13 'l'r1-asurr-r ol' Svhool Monvyg Assistant Lo Principals, 1, 2, 3, 41 Cook in Lunvh Iloom. 3. 43 Cemcnt Mixer on New Iiuilclingg CliucrI,1ea1lt-r for Girls' Ilaskctball. MII. IIICINZ Abroad. Dcutsvhlanrl "SIMS Ihr' upplf- of my 0.Vl'.n ST Maria-tin-sg Ilorn 'I'wo Days Ile- fore Monday: Golf Course-. Iligh C3 lN'Iason's Ilniong "Abi:-'s Irish Ilosvf' Captain ol' lit-an Bag: 'IIPZIIIIZ Cham- pion Spagln-tti 'l'uam: I'roclnuur ol' ".MxpIvs:nim'1" 5h N arivtivs of Pvacln-s 'I'vsIv1l3 Arrvstvcl for Ilcing: l'im-klctlg Ile-:ul ol' Studs-nt Police in Iiunch Iloom. M. T. Illi.-KD -I3 Dirty Soc Iicl.. XOIIQIIIIJIIII ulifllllfj' und Ihr' bvuslf' Wisv Youth, Ilorn Sonn't.inn- Ill-mm-3 Gvnvral Course- IIC: Ilig Iilovv Svhool: l"ox's Ilabe-ralaslnfryg Founalvr ol' Ifutnristir- Tivsz Arl- ve-rtise-lm-t for Slivkumg Never lxnown to Wear Som-ks, lluaal lxnovkvr for Svhool, I. 2, 33 Ifclilor ol' IN4-wtonian, I: Iliglwst Hvvorcl for Ifxpnlsiong IN-roxiclsv Ifxponvntg Ixnonn to G4-l a Stirk ol' Gum from "Dov," Itll RIN IC. BUY 612 XX isslom A vw., Wvst, N1-wton " 'llimlx uw' IIIIHIP, nothing nmr1'." I"oot-loose-1 llorn Tomorrow: Fish Course- 'I'Itbhg Ilurial Sc-hoolz Ilryn Nlamr for Gvintlmm-li: Ifzlitor ol' Funny Column. I. 2, 3. I. 5: Yale- mlit-torian. I: l'r4-sitls-nt of Spanish Club. l.1I, Il, Ikon Ilis Imltvrin Corrs'- spoiitlvllm-1 Sall'-'I'-I"oist Club, I, 21 Ifrlitor ol' "Brains NI on Ilvr Love." 53 Smile- a Day Club. ZZ. Il, Ig Fonntli-r ol' Cal lfish Club. 3: 'Iil'l'llSllI'f'I' ol' Drink Nlorv 'Xlilk Hovivly. I, II, Il. IIICDDY 2 Rush I.aner. Ne-wton "Sln1rm'xx in rn'li1m." Ifvvrg Horn 'l'ln' Nvtl Day: Ilvavy Course- C'I': Ile-mmf-r Son Informa- tory: Dry tit-Il Collvgv: Sellvl' at Girls' I4llllt'IlI'U0lll1 Ch:-vk Iloom 'I'1-ll:-r in I01 We-ars I.nmIwr Iiools: Clvans Spikvs for Hall I'Iay1'rsg Nlarrivtl 'liwirv to Ilis Lizziv: XI aiu-rl All Claims to I'1-rrnanvnt Nav-sg Ollim- I'orl0r. I. 2, Il, -Ig Ke-vpvr of Illua- Cards. I. ZS. 5. BNA I,IfNl'l II2 Iliglmay. Nvwton Ilighlantls "Talk unll Ihr' ll'Ul'll1 talks with -wuz." II:-avyg Ilorn Doubtful: Ave-range Course- 'lmsg Walt.vr's Cafvterial lNationaI Svhool ol' Trio a T4-tv: In- trodurvcl thv Charlvstong Smokvs, 7-20 'Is only: Breaks All Dates tmost girls dolg Miss Newton. I. 53 May Que:-n. I. 23 Prcsidvnt Girls' Debating Society, 2, Il, -I, 53 Class Crvw lCoiswainl. I. 2, 3: Life Saver tI'Idmanml's Drug Slorcl. Sc. 101 ' , ,Q 3 1- 5 . .f - Y, xxx i A 1' ""'- ,xx :A x V ' YY , X, 'S xx. F Q33 , . x It It 'll If 0 I I r,' 11' -'a. iff- , , K in fffff, . Expt, , , Z.- ig- 2 ' mlm Q Q N I Zi' . ,6- J TT?'-:AEN T3 f?X"S'- 'il' 1?-A 1 ..- n'!- .ln-I . 1 J X.,-N . 4 ,,g,,:. 'f,fZ '.,. ..,- 'X - -ex , X ,-. X X I -ff' ,li N x ,- . X.! -ww NXN hx fx. A .I Iva N 5 , I f 1 if 'J 144 ,vff 1 ' 1 , , .1 'gfv f X 45151. f ,ffffzff , ,.1 'ff' .' ri' lttllllllllltl ttlttw tt 7 twwtlltllttt uttlllttttllltlt 1 l Illllll IIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIHHIllllHHUllIIIIIIlllllllllllllllllllllllIllllllllllllllilll NHNETEEN tt lllfl In 'Mft fly: Experiences of a Gentleman With a Bid to the Feminine Follies Thursday p.n1. 1.55: Takes out her note and reacts it over again: many sighs and amorous glances. 1.57: Sees her coming: straightens out tie. smooths hair. then bows formally. 1.58: Time out for burning message. 2.0112: Gasps. gazes at departing figure: realizes that he is in for it: he has accepted her bid to the Female Gallop. 2.02 to 6.00: In a dense fog: in which imagina- tion runs riot. he is anything from Sir Galahad to Lochinvar. and George Owen to .lack Dempsey. Olarrowly escapes death as he saunters around Newton Corner mentally pricing chocolates and trying to make improper fractions equal onel. 6.00: Sits in at dinner. Naturally, all dates are forgotten when his favorite dessert is on the table. Needless to say it's lemon pie tthis is not a property but the real thingl. 6.05: Starts thinking of her again. proving that the quickest way to a man's heart is through his stomach. 6.15: Is ordered upstairs to study: obeys. digging out his booklet on how to Charleston as he goes. 6.25: Attempts divers dance steps. much time beating and clogging. pictures the perfect couple they'll be. 7.00: Called before jury of his peers. Upon being asked to explain the noises overhead. replies that he is studying Napoleon's battles and since the teacher asked him for personal reflection he is trying to give it local color. 7.02: Escapes upstairs again softly. 7.05: Pulls out his wardrobe. starts planning. 7.10: Still planning. 7.15: Now smiling. 7.20: Now panting. 72211: Now socking one. 7.23: Now socking other. 72391: To garter or not? 7.25: Collar soft or hard? CThe head decides itj. 7.27: Shakes Slikum bottle. guesses there's enough. 7.30: Looks up shaving kit: it's almost rusty from infrequent use. 7.50: Sound downstairs: dives hastily to hooks: father queries why the foam on his mouth? 7.52: Thinks rapidly, idea comes. 7.55: Explains that in Chemistry they are studying why hydrophobia is intoxicating. 7.56: Duhious moment. but again escapes. 8.00: XYonders what to do now. 8.06: Now "one" dering. 8.10: Gets out "Snippy Stories" and spends breathless moments scanning the pages of romance. mostly lies but he doesn't know so why inform him? 9.10: Comes to. as much as it is humanly possible. listens. emits a groan. 91012: Dives under bed. 9.11: Creeps out: explains to mother that he lost collar button: she says "here it is" and sends him off to bed sans 9.15 to 7.50: Curtain. Friday a.m. 7.56: Hakes. wonders why his cardiac valve is all askew. then remembers. leaps out lightly-he weighs a mere 210. hut has piercing - black boots. 7.57: xvash.-S. tThis advertises Noonan's Rapid Scrub Systeml. 7.571 Q: Combs hair. tThis advertises our combination processb. 7.58: Looks in mirror. 8.05: Continues to look. 8.06: Answers call: rushes down without collar: runs back, puts it on without tie and rushes to table. 8.09: Tries t.o put tie on: finally compromises on bat tie: as a pinch hitter it's right there. 8.10: Slides out of house: catches car in time to he late for school. 8.11: C1Yhile on carl. Dreams sweet dreams of lemon pie. ummm 1IIIIIII1n1I1IuIuIrIrIIIlulinIllininiiiiiilii1iiii6EiiiiiiirirIrIriHiHlu4lmllliiiIiuiuiuIErrli1lm1uIIIlllllluiiiiliiiiiillullmmiiiilniiilIliilmllulmlmlrn177lrl7lri7ummmHulmnumnmm:Att777tulluttrIi1lllmnulhntittmllMttAlinnmt17t77llmmnu11twtt7lltlttultltltltttttlt77t7A1l777ttltltlttttn t,ft. 7 tl 105 MlllylylllllllIll11111Itlililxlill11y1y1y111lllvlllll1y111lIvlllllllylylyllltlblwlliyllllllllrlulllllylyllllllllllllllllylilqlxlllllllhlylIIilylylllllIlyllllyllllllyllI11llllII11lllylllllllllylqllylllllllrlllll 'THE NEWTQNIAN ltlllllllkllilllllllllllilvlvlllllqlvlylllllllllylllyllllllIplylllvlllllllllllIll1111llIlIvllllltlllllllllblylylllllllyllllilllyllllllllllIIIIllllllllililllilllllllllllllllllIllllllllllllllllllllllllIllllllllll 8. 8. 5 a. 8. gs. like 8 gas 2. 8 if 9. Li 9- 9. : 9 W-. 9 5 9 10.13 to 10.21 31: Conductor ends his lemon mirage with brisk. "Say, where you going?" 32: Pondcrs a moment as to where he is going. 33: Remembers: "Female Follies, sir." 31: "Say, you want the bargain counter, buddyl 1lere's a transfer for Boston." 35: Starts walking to school from West Newton: is picked up by a Lizzie and carried on her fender for a few yards. 10: Pockets damages: figures now on what he can buy. 19: Arrives at school. .50: Faces Nlr. Bailey. 53: Fills in his auto-biography Cnot a true one. just a serialj. 55: Draws detention for one hour: pleads an urgent appointment with an important personage: fails: trys bribery: receives only scorn. Chlr. Bailey is only a crook in plays.1 59: Exits, disconsolatc. 01 : Enters C30. 07 to 9.25: Pondcrs on sins of history: won- ders why the past counts at alll' Then recalls yesterday. 26: Gets yellow laundry slip, and no 0.K.g half hour for being late to French class. 39: Translate: "Faire des chatcaux en Es- pagnef' 10: No answer. ell: Still silent. question, "What are you "Dreaming" I 1 lg: Answers doing?" with 15: "Correct" wonders why class laughs. : 11"ell. it's setting-up drill. Nlost of the leaders were set ups and our hero is no exception to that policy. llis exercise is mainly spontaneous when the teacher expels him forcibly from the room with a blue note for inattention. . 10.23: Cools heels in oliicc. 10.231Q: 1Yonders why ol1ices are cold. ' 10.252 Finds out. 10.29: Exits with two weeks in the detention pen. Life is very gay here to the one on the outside looking in. 10.31: Admitted to C16 where he learns while studying in the back of the room be- hind a Ciceronian lecture. how to say, "So's your concrete spatsf' 10.35 to 11.15: Draws pictures of girls' heads CAII blondesl . 11.16: Meets her. 11.18: Treats her. 11.20: Beats--it. 11.21: ll.30: Chemistry begins. Chem. running along smoothly. 1150: Experiment blows up while he stares out window at Frank Spain's new golf hose of the zebra brand. 11.531 The odor of eggs slightly aged per- meates the air. 11.51: Class vociferously express disapproval. 12.00: Drags off to lunch on the lunchroom sandwich. 12 21: Enters English feating sandwichl. 12.26: Answers question. "Are you acquainted with Lady Macbeth?" with pert-"That's not her name, sir." 1236: Listens to Mr. Keeney discourse on -1. "Lord Chestertieldn and another wise guys. 12 50: Replys, "You can't prove it by me." 125011: Exit to oliice. 12.5031 to 1.15 p.m.: Books in ollice interest him: especially "School Curricula.', 1.16: Sent home for misbehavior. 1 1 1 2 2 2 0 2 9 2 2 2 2 17: Arrives there: grabs telephone: gives number. .2 1: No answer after repeated trying so hangs up-his hat. .30: Starts dressing: hot water is not too hot. Curtain. tskdvertising Ptome's Bath Salts.J 10: Ipswich hosiery. C1Yitch wears them.1 .15: Paris garters. tAny Seine man would.j 23: Pants. trou. breeehes, etc.: at all costs they lnust be plural. 26: Tie-symbolizing youths because they are men of courage and little cents. 28: Shoes. Clfinds shoes so large that he has to put on his pants over his hcad.j .36: All set 38: Gets lady on phone. .391 Usual line: melts wire so about 37 people Cthis is a party linej listen in. .39LQ: Agreement. .40: Disagreement. fContinued on page 1091 Ml lm11lilnlllllnmllllllililmlrmill1mintmmmlrummmwillllnummluumlnilllllniilHllnuiillniiiilllmainHlim1limHitlminwillitllllmhllilllwillillLllillllliliililll1lill1lillllillllilll11ili1ill1i1iiiiiillli1iillililill1iilliiiliiiillill1i1lilillliilI1iiillliiilllilill1i1illlllilllllliilllibllllillilllllllllnnnllnmtununuuitr Hlllllllll 106 HHHNH IIIIIIIIIIIIIIIIIiIlIIllIIIIIIllllllllillilllllilllll lH H H H WP HIUI?!IIEIIIiIlIIIIIIHHNHHWHH NHNEGEEEN TWWENWQYQSHX W WHlllllllYW W W HHiHli"W U H H W H61HIIHWHNHNHHHW' Q BWGQBQELMI mzzLza4Q'QxszmE gi dow D-N sPoT- ours!" N F wie? 0 1 NW 'V' fg iflx 12" Q 17- f .W 422299' ' 7 Av4lW.4,1.-,-..f 2 xyiigy ' XX 'bggij vTf'fwWj ,WM ,yjflf xu1,' Q1 i V.,1 L X X' ? 5 32' ,Mfr wliffx HQJQWQQ f "' wf fW, f 5 fllfffff 2 1 , f li f ,hil i : if 2 f ' .Q'1 4 f 2 WS Q?? ' 'lhnf n E4 fi QMETHOLVGHT I HEADD A Q Q4 X vouch CRYXSLEED NO Mom? f f X i f W f ,Z y i v if 'ggi' IAQYQN WTiHHALL6LLii1iii1I1I1iiinnlhiiihunimmuNUUMUnm niiiMihi1lhihlhl1lh44nnnnnnnmmnmmuumummMnHnnHHslihiiiihihlllimlmmmmre1u1mium+Uuwuunnunmmnu miminNmmrmuurnmmwuMmuunwuum Hn n umm11n n Unumumuummmmwuuunamuu n mm vnv n vrmm v vwwummmwummmww ww IOT I W H1 N -V ""U!lu Q IH UVHIIIHNHHIIIIHHHIIIIIIIHHHYWHIIHHHIIIIIIIHHWIIIIII1HHHIIIIIHHWHIIIIIH ITIIIIIIIIIUHHIIIIIHHIIIIIIIHHHHIIIIII4NIH THE AN I1HHIIIIIIllIlfllIIIIIIllIIIIIIIIIIIIIIIQIIIIlklIAIllllllllllljlIlllllllllllIIIIlIIIIIIIIIIIIIIIIIIIIIIIIIIIIIlllllillllllIIIIIIlllllllllllIllllllllllllllllllllW I" Ai!! ff 'HF' Nj N. 'IZ--sn'-,l 'CP' 5 I 4 4' LL : P' Z 2 41, H Y I . V .-'J SA' ' L 's f 'fi ' A' ' E ki'-5. ' 2 I inf ' W QE P' , - W a ig mv' W WWWWUW U VIIWWU f!11 wVw1HHH?iII11 5llIll1HWiIII!HHWF51H !'Nl41lHHllIIl Ill! PHllHWPV!1i HHHNHil!lMWiIIillH llIll1lWPiiIlI14 VHIIIHIH!!lIlllHWIlI41 KIIHI4HWIiIIlHHIIiII4I l IPIIIIIHHHIIIIW UIIIII1 IIIIIIlWWIIIIll HlllllllWIIIIll4HIIIIIIIl4 HVIIIIIHWIIIIIIII HIIIIIH PVVIIIIIIIUHIIIIIII HIIIII4 lllllllllwlilllllill lIIIIIIIWWIIIIII HHIIHHlP?III!IIIINHIlIVIII WWII! IO8 :L gl . 411031 " if 179' ' x I l 1 1 It H11 llllllllllIIIllIlllllllllllllllllllllllllllllllllHlllll1llIIIIIIIlllIIIIIIlllllllllllllllllllllllll11111111111lllllllllllllllll NHNETEEN-TW1E3N'TYa-331122, ' ' ' yyyyyl L I,IIlIlIII l,lA!1 ! 1!1 VVVIIIV, Feminine illlllillllllllllllllllllllllllIi1111111llllilllllllllllllllllllllllllllllllllllll tlllll Follies t C0ll,fI-7IllPd from page 1061 2.40!2I Promise to disagree: break promise: love again. 2.41 to 2.59: On way to her house: gets gate and sits on her front porch while she changes her mind. Of all the changes that women make. this one is the most frequent. Incident.ally. it seems unnecessary because she always looks the same. 3.00: Rides in state with the damsel to the hop: frets over money: wonders if there's enough? Who in time will buy the eats? 3.10: Arrives and proves that the man always pays. The entry fee is one-half buck per person. Insurance at your own risk. 3.15: Critieises orchestra. 3.20: Orchestra plays "She was just a sailor's sweetheart." hittin' all the high Cs. 3.30: Stuck: no partners: must bea wall-flower. 3.311-: Wants to dance. 3.39: Still wanting. 3.50: Nabs dance: tries Charleston: Coach reminds him that suicide isn't a suicide if you kill someone else. 4 3.59 to 1.30: One darn dance after another with the refreshment hill eating its way into his wallet. 1.31: Cheers up as Ihe girl dances with him. 1.32: She leaves him: she's going home with her 3rd cousin. 1.31: Decides to stick around. 1.15 Still sticking: expects to rake in on the ice cream. 1.55: Flops. 1.58: Now flaps: flips. etc.: hecomes a flipper. 1.59: Feints at fainting. 5.01: Miss South calls up police. who seal him up in a nice quiet cell. tThis advertises our home boarding process.J Satu rday-All Day Heturns to the land of Sane living'-"No women allowed." ,. Songs "VVorried About Youw-Tl'e Advisers. "That Red-Headed Cal"eDoris Howe. "Show Me the Way to Go Home"-After Sixth Period. "Then I'll Be Happy"-End of School Year. "There's Nothing on My Mind"-Ituth Pearson Sometime"ASchool Bells. All Alone"-Drusilla Guiry. "There's Only One of You"-"Kay" Bonner. "Five Feet-Two"-+".Ierry". "VVhaddo I Care"-"What'll I Do?"-"Bud" Daugherty. H H as What's the Use?"-When marks come out. "Who"-P P H Mighty Blue"-Cards. Two Blue Eyes"-IIope Gregory. Oh Boy. What a Girlv-Coleman Lamont. That's All There Is, There Ain't No More" -Vacations. Oh, How I Miss You Tonight!"-My trot. Moonlight and Roses"-A in Latin. I Wonder Where My Baby is Tonight,P"- Mr. Kidger. ss as 66 Ln L6 66 llllmnllmlumulmlulllullInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIllmmnlllllmlllmlIIIIIIIIIIIIIIIMIIInIInlnmmvrIIIIIIIIIIIIIIIIIIIIIIIIIIllllllumuIIIIIIIIIIllllllllllllllnllmnt1Ilulnlllnnnllllnlnm us U is Always"-Girls in general. Sweet Man"-Nlr. Dickinson. Sunny"-Mal. tlallager. u Paddlin Madolin Home"-Any inhabitant of VVahan. "The Prisoner's Song"-Class song of 1926. "The Song of the Flame"-Mary Tilton's line. 'Wly Sweetie Turned Ale Down"e.Iohn Fellows. "Just a Little Kiss"-No lights. "Thanks for tlte Buggy Ride"-Tom Cilligan. "IIorses"e"liewp" Carver. "The Hoses Brought Me You"-The Diploma. "I VVish You Were Jealous of Nle"fDoc. Martin. Medley of Popular Nuinhers"- lioops. Tilton. Atwood. Kenderdine. Brooks. and Gregory. "Poor Papavf Mr. Dawson. "Roll 'Em"-".Iunie" Stuhhs in the lockers. Down By the VViniger Works"-Clallin Field. But You Do, I Know You Douftio out nights. as as "If I Ilad a Girl Like Youufhlarion Bonner. nlmmn 1.111I1I1IuI1I1IuInIuIrIurririir1iiinmln1u11111u11I1IrIuIuInIrInIrIrI1Inmullun111111111uuuuu1uuuI1IuI1iuII1I1I1I1IuIuInInIunru1ulllnmmunuum4mrlnuunuuunnnl1ilmi1IIIu1uuuunuu1In11lmuulnuuunllllIIuInIuIillllliiiiiiiiiillliiillliiiiiiiiiiiiiiliiiiiiiiiiiiilillliiiliilliliiilliiiiilllllliiiiEEEiii1iiillilliiilllliliiiiiiiiiiiiilililllliiili1kLEE2E1i31i111111iiiillilllilllllillllll1 it it .1 5.5 M lllllllllllVW1PFFPVlUUUFFlFFll1FFl'Fll'11Fllllll'FFIif''11IlllTl4ll1llTFlll1F''FlT4IlllI9TPll111TTll9lFlFllF'F'UlllFlllllllF THE NEWTUNIB-N FlllP1919FF9lll???91lllll1FF?Fll?P91llll!99P9Fll!Fllll?FPFlllll9!""'l'll'll'l""'l'l""'lll''''"ll""""""'ll"llll"' Excerpts from Los Matadores Our Hero-A Rhapsody and Fountain Pen Colyum Good morning to you, seniors! 2 O sophomores. how do! Greetings. 0 ye freshmen 3 And all the rest of you- ! We'll try to write a column 2 For folks both big and small 2 We hope you'll find it funny: 2 i We'll do our hest, that's all. ig Owed to Mr. Smith t A hook of figures now is out Eg Called Smith's Geometry. The students all together shout A strong and mighty man He loafs whene'er he can- Our hero. Isle studies night and day The feminine styles they say- Our hero. Y 1 llelknows each graceful trick llis hair in plaee to stick- Our hero. And as for fancy clothes Ilis taste he plainly shows- Our hero. But when a game is played Ile in the grandstand stayed- We thank thee reverently. Our hero. e -+- e Latin Teacher Cduring verb syntax drillj: "What mood?" Voice Cfrom the rearb: "The Cow." 'iYou sure are dressed up fit to kill. today. Bowman." it Sfralon: "Sure why not? I'm going down to take my first lesson in driving o an automobile." i'Did you see 'Oliver 'l'wist.' Door Mat?" gi '6Now, mattress. you know I never attend these modern dances." Queer how many study-periods people have the first two weeks that fail to mature later in the season. gp Swimming letters are becoming easy lo win. Lots of S. T. Sfs are 3l0llIldl ge C'l'he wearers seem to he in the swim.j go Hhly word it's raining." remarked the Prince of Wales. So's your old man. A W imwmumim:miiiiiiummsimlm4r:hmmmummmimum1iisF11n14llnulumlnhh1lw1iUinnumlliluiilliluiunlslwillllaillilllillliHimil11HHli11HHIHllEii1llialllllnlllliinhllilnllillinllilliiilllliilniHlilleilillelinkinllliiuluiililleiiillHulniliiimlllliiiillniiiiiiiulliliitiiinliIalllilifiiwilli1iwilliliililllafnun IllIIIIIIIIIll!IIIIIIIIIlllllIIIIIIIIIIIIIIIIIIIIIIIIIIIIII mnuuu 5110 W WW'FP''P'''''''''U'1UW'UU'UUUNI''F1F?F'119WFFFFFF3FF?TFFPFF'UWUI1UUPFFF?FF!UFUWWFFFF NENETEEET "J-'WEEWTYHSEZYZ W'W PW'1IKW14'1'1'1'1l'.ll',','.W','1YYVVVVYVUYIF!lI1I11llllllW!UU'1NYYWWil?lU!FFFV'WWW"WW" -5 1 - --V 3' M HiiiililiiiiiiiEiiiiiEiEEiEEEiiEEiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiEiiEEiiiiiiiiiiiiiiiiiiiiiiiiiii1iiiiiEEiiEEEEEEEiiiIlEELiiiliiiiiiiiiihiihiiiii1Ibili5iLHkiEHiiiiiikk1EEiiIE1Eikill1iiHiiHiikkkii3LHiINXXXXXMilliHMkikI1I1N1r1M1H11I111I1u1m11WmIWuWrWrHrHIH1IMWIfA1nH111in1uHIinklkmkmiiuainlii4MiHiiiiiIim1iu1i1iihMIMiIiiiiiiiiiiiiiiiiiii6MiiiiiiiiiiiiiiiiiiiM666i6iiiiiiiihiiiiiIQQQiiiiMiiiiiiiiiiiiiiilllmMkiEi1iiEiiEiiLLIill i3ii1iMib1iiiLkLLLL1LXiiiiUMEEEJEEEibXYiRiMElEkLEiiii2?ikllMM lll W ll'llll"l'lllllllllll'llllll'llll"llllllllllllll'lllll'llllllllllllllllllllllll THE NEWTUNIAN JllllllllllllllllF5lllllllllllllllllllllll!llllllllllllllllFFFllllllllllFllFlllllFllllllllllllll"W Class Chrlstmas Tree Santy Claus left for: "Boob" Bennett . . Some Quiet Socks "Chet" Pratt . . . . . A Step Ladder is "Johnny" Fellows .... . . A Loud Speaker it James Byers Colton, 2nd . . Pair of Winged Feet Guy Holbrook .... . . An Automobile ii 2 a "Hals" Andres . . Box of Dates Carl Nelson . . . A Pillow Hope Gregory . . . A Mannekin "Bill" Hall . . . . . A Suit of Armor E '6Waxy" Littlefield . is "Dorn Martin . . . . . . A Scythe . Bullough's Ice in June Mr. Swan . . . . Pair of Rubber Boots is Mr. Keeney . ...... A Strait-Jacket gf "Honk" Shaw . . A Year's Issue of The Newtonite Arthur Shule .... A Book of Etiquette HKI-ly" Noyes "Kay" Lolz . . A Glass and a Pitcher of Water . . A Printer's Guide is Helen Elwell . . . . A "No Parking" Sign "Bob" Clement . . . . . A Hair-curler Charles Crawford . . A Beal Laugh "Bob" Clapp . . ...r A n Old Suit "Wally" Fullerton . . . A Few New Records Holmes Whitmore . . A Certificate in Studies 5'Kay" Bonner . . Mal Hammond's Orchestra gi "Phil" Jacobs . "Phil" Ahern . is "Charley" Parker . is Phcobe Bell . . E Doris Barton. . ie "Bo"Hemeon . . is "Carl', McCullough E George Laubenstein S f "Dandy" Lyons . Lloyd Osborne . . Ruth Pearson . . Es "Petei' Brooks . . 2 "Bobbie" Kenderdine See page 135 for appendix. . . . A Bigger Horn A Letter-writing Course . . . . A Self-starter . A New Filing Case . . A Day of Best . . . . A New Joke . . . No Nights Out Edmund Burke's Speeches . . An Hour of Study . . . . Two Mirrors . . Some New Jewelry Bottle of Sleeping Tonic A Sojourn from Athletics 99 M1 lmlwillrlllnllllrilllulllllmumlllulllllulllrummlnnullulllmraI1u1nIllllllulllllullIiflIH111llll1lllllilll1lillllllll1iHHllillllEEEll11lliliiiiilHIllllilIlHEllllllilllllllliililliIllllilllllililllllillIIlIIlllllllllllliillllllllilllllllllllillllllulllllllllllllllllllllllllulllllllllilallliilllnllilllmlnl'liliallllliiiiillullliiiililleIulmlnunuuuuiln umuul 112 IIIIIIIIII IIIIIIIIllIIIIIIllIIIIIIIIIllIIIIHHIIIIIHIIIIIIIIIIIIIIIIIIIllIIIlllllJIIlHillHIHIIIIIIlllllIlllllllllllllllllll NINETEEW Desire I want to be a senior And with the seniors stand Above the little freshies That swarm on every hand. I want to wear an "S, T. S.," And stand upon the stair To boss the under-elassmen round, Let thoughtless ones beware. I want to be on Newton's team And grab an orange "N" To wear upon my sweater front And make the girls attend. I want to study Virgil, And Bassettfs history. And other things that seniors do To pass that "C.E.B." But if I'm to attain these things, It sure does look to me As if I'll have to spend ten years E'er a senior I can be. TWENTYI SZX HHIIIIIIIIIIHH14lHHlIlHllllllllllllllllllllllllllIIIIIIIIIIIIIIIIIIW ' II The Milkman's Revenge I thought that I would write a poem About the birds in spring, About the summeris golden sun And how the steam pipes sing. I thought that I would write a poem Of the lunehroom's fragrant smell. Of the chicken patties' Cheerful song, And the hot dogs' plaintive yell. I thought t.hat. I would write a poem And fill it full of words Of the blithesome flocks of buffalo. And t.he robins' merry herds. I thought that I would write a poem Of algebra and French, And how to solve for X and Y Wit.hout a monkey wrench. I thought that I would write a poem My thoughts don't seem to rhyme I guess I will not write thatgpoem Until some other time. ..l,-+ We Modems "I don't believe in Santa Claus," Said little Tommy White, as If he hasn't headlights on his sleigh, How can he drive at night?" AA I don't believe in Santa Clausf' Said little Silas Phinney, as If he can come our chimney down, Ile must be pretty skinny." LL H This 'Santyi stull' is all the bunk," Said litt.Ie Ella Jane, IIow can the old gent tread on air Without an airyplaneilu I11I111mmmnunmI1uI1I1uI111uIiuiiIiii1iiiiliiiiliiii1i1ii1Iu11iiiiiiil1I1iiliiii5hiillliiiiiliilillitLLiLiiiiiiiiii6ii1ii1iii1ilLLiLLiiih1ih311i1111itiiillLLLii11ihhhhii1i1i1iiiiUliliiiiiiiiiilllliiiLL5iihi1hihih1l1iilliiliiiniiluulmlliliiiililhiiillmlHmlmmumuumrmnmimiiummummrnzlumuwmmznmtmuumummmnunzummuuwrinizaiiuimitwilllimit. i M lllllllllllillIIIIIHIlilIIIIIIllIllllllIIIIIIIIIIIIIIIIIIllllllllIIIIHillIIIIIIII1H!IIIIIIIllllllIllllIlllllllIIIIIIIUIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII THE NEWTQNMLN lllllllllllllllllllllllllllllllllIllllllllllllI' 4IlllllllllllllllllllllllllIlllllllllllllll111llllllllllllllllllllllllllllllllllllll Q Famous Sayings 2 Nliss Bichardson: "Now I will read the bulletin." gl Mr. Tinker: "The square root of 1 is unknown." kg? Miss Waldmeyer: "l'm throo." Mr. lilicker: "Can I interest you in buying a slide rule?" E Miss Haworth: "Now I won't change your seat, Colton. You turn it right around." ? c Miss Goodwin: "Case endings do have a bearing on the translation." i Mr. Mergendahl: "I'll give A to the one who finds the fourth E dimension." ?c Mr. Dickinson: "You bonehead, don't bunt at the third strike." gi How We Know Them ii HBllSl.6I',, McCullough-by his blush. gg Ee "Tommy" Gilligan-by his fight. eg in Mary Tilton-by her looks. gg 2. 'flohnnyu Fellows-by his whispering. 2 Herman Buxbaum-by his laugh. eg ?i Catherine Noyes- by her eloquence. gg i. "K" Bonner- by her smile. eg E "Dodie" Albree-by her bob. eg The Ancients T heywnevcr had a radio. They never danced the Charleston, A limousine or Vic, Or saw the "Babe" at bat- No Pekingese or movies No wonder that the ancients thought Or eats to make them sick. The good old world was flat! A Paramount Production Featuring 'SDoc" Martin in "Sitting Tight." "Boob" Bennet in "What's in a nameili' Vlfhitmore. McCullough, and Holbrook in "What's on for Tonight?" Balph Bichardsonin "The Permanent Wave." Yirginia Hodder in "Amazons" is Warren Adams in "Babes in the Wood." "Tub" Dugan in "The Sylphf' "Bobby" Bryant in "Henk your horn. bo." Spencer DeMille in "Growing Up." "Sheik" Green in "Excuse my smoke." immulnnmxiuuiirI1in1nInI1mlnrIuinunllunmuuumiummmnwmumununmrmnuumnnlunrmmmmmuunui4rIIuHI1isII1Hu11rurinIulumuuuumumlunusr1IuMinimumuHifuinuuuInrunHnr11iiillililinullliiiimnlliu1ru1iliiillmiluiiilhmluuiminMillimu1uHI1nl11unu1mum1inmin1uInrnmliillmmnmmmliiiihmihiiiiiiiiiiiliiilliliilllnlliluliriiidil1HmliiiiiiiIiifiiiiiI11ifiiiiiilliiiiiiiililfiiiiiiili W 1 ll ..: W IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIHIHIIIUIIIIIWIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIlHIIlIIH NENETEEN TTWEMTYQSEZZ Y HW HW !fIIlllllll!ll1I11NH HW HH HEIIIIHWWN1WH HN WH QIIIIIIIIIIIIIIIWHNHHHUHll W l i , ,x,w,wwww,w uwwwwuww ' ' 1 """ ' 5 ii -- F -I - Ii ummmH1iii11i1HHiIi1iiiiiiiiiuiiiiiii1iiiiii1iiiiiiiiiiiiiiiiiiiiiiiiiihiE61iQiiiiiiii1irtlitiiiiiii11i11iE116M6Hiiii1iiiiiiiiiiihiiiHi1E1iEiiEii1iiiiiiiilliiiiii1ii1iE1E1E616iiiiiiiiiiiiiiiiimihihhinilhnildibibihihhiiihhiiihitanwi1 iHhmihhlihlihid4ALiliiiiihhilihhihiiiiiiilLLki1hh1ibhhihhiiiiUimhlhiinihiihhkl Unmunumuniim4 AumunusmhdNv vnnUAxmmmmnmnwmmmlmuun1mmnmmamensexw41Mu vvnmxwmmwl:sw M fw u + H5 lil 'fljlfj 1'H:"'! Mm , f V Mm w w lNHMmu UHHUNM11HM u W M in HAVE TO TRKKLE ARUUN53 3 TO TH'NEwToN1TE omni 1 AN' SUBMWMY -NEST 'PIECE GF POETRY 2 A Y . sz' mm INDEED GLAD To SEE You A- I MJANT You To READ HEGGIE x Howbv Jam 255255 ' N "'iiiiiiiiiii ARE YOU SURE W5 fsagrff JIM ' 9 N SALLY I, DAVIS U!! W U ' ., I a 'WlllIlllIHlll!lI ,, W - X in vw Bw W Umm vgggigiigigggzlf rw own NAME frm QQ gg::::::-- some TO ,uma TH1 2' Bw csopur 27 -"' NAME OF' SMUHA THEmE'LL BE , ARK YGU ' ! LOTS OF GQNG TO 1 15 PEOPLE X -', ,K PUEJUSH THY57 Q ESYIQMED - 7 njsi JLLLL Hi Nil? i2JY?N'15jlNI'1J:j4L51jg -50 YQU THINK 'fgfgggi OUR CONCEIT I6 j ,,.4...7f gal?-XHIEVE A I DO! 2 Qfj'3lE,f1'QQ1LQQUN 22 N E TO 7 'BECQME CQAQH YUUR OF was TEAM NOBODY ll rm A-5203 EH? A5 THE K NEXT 4 FELLCW' H ff xxx-Jff ANDRE E IEE Q "op 'lmmul' - H' if 40' uuuuf xwk " -I M, M v ..- ' "n dw if N ...uv - ---L: '- JUST A MINUTE! WHO iDVD YOUR ANCESTQQS STDRNNGQ FROM? ' A I "'m,,5U x ANSWER ME THAT !! , ,,,,,- 5- T' ' M -" ' my ' ' r C, jf Q THE PRQCVQRS, NEVER' E552-' SPRAMG FTQQM NO - 'wmv 9 T-I EY guvfw SPRQNC1 AT EFI HUYE UKE 'mash N X 1 -V X 1 ff - f X 3 f WI' jg Af' X! l' u . 5 M M+ ww uuuw "11f1f1'M!VHlllW 14 igiggjiifg. mm MMM wUNM MMM wHHHW one BAWL N:2"" --: --fr 'E - 2ER'BAFL'?R':i1 STRHXE ' kl8WA , WHAT IT WASP OL DEAH' mms ff mx 'gif A! JCSXYXQE ' ff' E2 N 2 W HQ H., 'ZW ,f"Af' X ffm :-m fp ' WWC ' ? 'L I xxx xx f lv mx FX 6 . xX " ' X . X SAY5 X51 6 E 7' '? 7 wHmcH?, f 41 ' X ' - o f' 4 "I - X f - A -- sg X .W 1 . - , fig Q5 X -J! , , , Q.:-:Le -151' I ,I 1 - g f 'K E I , f 2 Eg NDOC ' ixix 4 .c-'Q -5 ' MARTIN .. f EN 'V' 7 ff f 'Y " 4 . , '- V , - , f Z. .wus I 0-A NX ' ' , , IXXNXXQ M' 7 f'Q:I51-Q,,- ff , X Q ' L , ':fQ1m2g .Q f , E Cr -N ug 5, 1 LNB' Afflglffl ll F5 X- fQ3Q fy f ESS 500 Q gi gt Q3 A W f ivuessl , I W If? Y f 2 B I Em ' iq f f 1 1 X ' WP! 'I f V X l, V, V,, f 4 . ga". 152 44 , ' ff X WLULLOUQH L V, X' 1 X W- wa 4 if xx 536553 ,q . MX s U M ,.h.,,,,, Aix, ,JQQZL -- ep ,2.,gd2f, f'v,ff.1- z , - X V431 E 35111251 6, f1l'i'?'2l A 1 W Y 1 1 W WW 1W'HHUNf + WiUUW W 1 l QuU M VWill A UWH NW V ill N N ill!!l 1 lil? N HHHl fWiH HINNH VN H HIUH l PHN N UillliI I PHW H iHHN HVH1H ?IIN!N4 HHH b VNIH4 ?HH! N PNH511 IHill1I11 VHIII44 H HHIHH IVIIIHHN HHIIIH1N Hlllllll Will4NIWIIIIIFIIHHWHI'W1lWHIl'1 IIIllli1IM II8 -5-J' ge Thou tantalizest me beyond all understanding, Ei W lIIllIIIllIIllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIlIIIlllllllllllllllllllllllll NZNETEEN' TWENTYQSIX llllllllllllllllllllllllllllllllllll llllllllllllllllllllllllllllllllllllllllllllllllllllllllllll till Ye Ode to Virgil Ee CWitli the usual apologies to friende Williamej E Is this my Virgil which I see before me, The translation yet undone? Come, let me do thee:- I understand thee not, and yet I see thee still. Art thou not, horrible words, capable Of translation into English? Canst thou be but A ciphered jumble of confused meanings, ge Whose taunting phrases dance before mine eyes? 2 E I see thee still, in script as unfathomable EE As Sanscrit, Hebrew, or the ancient Greek: ii And flauntest my poor knowledge in my face? Ei gg Mine eyes are scarce more tired than my other senses, And stupor clouds my brainzgl have thee't last At last thou'rt conquered, done, translated, Into the purest English. Bah. 'tis false, 'Tis a weird case ending, which throws all Into disorder. Now o'er the darkened world, Only the street lamps light the encircling gloom, And only the suburban trolley car, with its freight Of late prowlers, disturbs, with its harsh roar The blessed sleep. And now, the solitary milk-man, Preceded by his cart and sleepy nag, which draws The precious load, thus with his stealthy pace, Scuffling as is his wont. from house to house, Moves like a ghost. Thou stern and heartless teacher, Ee Call not on me, for fear thou learnlst of my unpreparedness And place a flunk 'gainst my long-suffering name, In your record book. I almost fell asleep, How can one, late at night, a fresh mind keep? My work's not done, but sleep invites me to a slumber deep, Illl go, I'll softly to my warm bed creep, Thank Heaven, only two more days this week! ee JOHN W. FELLOWS, '26. ii ..g.l if Can You Remember? Mr. Argento: "If you ever visit Spain, you don't want-" Miss Rogers: "Now this is positive-you'll get an equation of the third degree on that exam." Miss Savage: "Don't we ever get heat? If I were running this place-" Mr. Green: "I will repeat that- z-z-z-t bang!" MllllilllllliliiiillillliililliiiliililliilillllllllllllllllliIIiillil1llallllllIllllllllllllliiliI'lllllllllllnllullllliilillillllllllllilllllnl11llilllillllliiillIulllllilililllll1lllltlllliiiilllilullIEllilllilillllE66lllllliiiillllll1lIliui1IiI1Iuiui1IuIuIun1Illllliilillllllllll1uIliuIuuuIuIuuIllllmlmll11111l1ulunl1uIuImlIlullzllllmnlnnlnlullnllllllllulln1lInuummmallml l I9 li.: 'ffjfj QFIQ-ff,33?iQ7",L"QIi,NQl'1jL1Yj' is i iliilliilllllllllllllllllllllillllllllllllllllllllllllllrllllllllllllllllllllllllll lla fi' "Y H ML ,QVMH U, ,wlgwg EMM.. l lu- Xlwgfaiii Nl:-murizil mulls ln your lxlllil anllf-nliun its i-xvvllf-iii aippmnlnu-nl ul lx. 4-iwirlge-I' Ilzipgiiml us lI'1'ilSlIl'l'l'. 1 ' ' . . ' Xlr. Nlzilf-film lizillziglie-r llzis .Ill5l pulmlislu-il za nf-w sung l IA-ll Xly llc-url in Xiwiiiizx. yn Xliss Suxugi- xiisln-s lu 4-m'i'1-4-I za grain- 4-i'i'm'. slim- is mul. as shi- has lu-e-n rf pulf-fl In lw. 21 pirzili-. William parks luis van' in-au' llw pwlulxps- ul' Ili-li-n ul' 'lirm 1-uvli ww-lx ll is pnrls lmm llu' llIL1'lll2llI1lS uri- vxilvl. l,4-uimwl lflzirls. lln-1-mini-nl svif-nlisl. is slill lrying In Iiml mil il' slill llruulis lllll ill-vp. Nlr. Nli'l'lu-rsmi luis :im-4-ple-il llw zippnirlllm-nl ans lll2lll2ig.1'i'l' ol' Nliss "Palsy lilllll Xlillvris pi'uclli4'li4nis. lilimlxxivlx luis lanlwn up lmiurluii lulvly. lu- is X4'l'f mm-liiiilvi-1-slf-il in Hlmlmlmivs ll.iilll4'l'lll1' Xuy-s mm llw prim- spvulxirig: in Xl1ll'1'll lml slu- slill przivlis lHlHI'l'2lIlillHll1'lI1'4'. Nlr. Nurfllrlmn lines zirlimiiiiw-ml llml l'i2lSl1'I'SllUlIl1l ln- 1-quail In iflirislmus lim :il is llllllllf 's mlzly. , w . 4.115 Iliilln-mils. mir milili- zillili-lv. gyws mi Sll'f'llL1'lll alum- liul pi-rlmps l'ilIlll s S1llIl4'llllllQl'lU1lHXKllll il. llmili F-lmw is lrying In mlggv ull l.llZHlWll'lx s inli-ri-sl in lmlrlm-s. willy luis Is Rl tllll4'I'4'lIl HIIV. Him-in lmiilx Sllg1Ql'SlSlIllllQISZIII illlllltbfllf im llw SlllJ.l1'1'l. Nlr. Williams lillIlllIllIIQS is ull:-nipliiig' In nmlw Xlilmll M-auliiiliy vu filiivailimizil. NM' ln-In-w llml Xlr. l.lu'sl4'l' l'i'z1ll is llu- lim-Iwi' nl llic- Xllvns l'llUl-PUNK ul l,il1- zulu-i'lis4-s so Ire-4-ly. ll,'fmli'1f11f'dfm puyf' l??f lfll Xlr. ll. X. Sliulw lxllHXNx ilu' Xlnlilvn l'Hlll1'l.2lll'lj wi-ll. in l'zu'l. llu- zuilmimliili F! Nilkfgifgfyf i?'SfVE1YI'T'ZJ51jS HIFH Onnnn lll IIJLIIUUL yl Killfljlf' amd "lj 77A A I I fqpp!,,, ' A le., LL 'bw . 0 . NU Luxfgo Q N QS fboxgiii 4 U N4 G Q L ul H X of? f "4 fl 1? ,C-2 5 'Q Qfw, s X tfifwf' my hxqqumn J Y x v -v ,,-,f,AQf .Q LL' J' ' 5 5 W BQ X Us , Ni Fx. Tx N ,xi Gal .'gc,,-fx ., C Q O' Q1 9 vlqff 'Q .X xxxoncxf f 1' w Q1Qf A YU 1-vcyybfli' df "Bcf5"+rQ,Qf 8? 5' 'Nic l X11 5 PQ! Q 1 W 1- UAT 9, QW Lv A550 W1 AIQQQ7 4 - ,MFA X if -'?rf1f' ' N llfw QI H K, WLQQ QW dnl I I Mllllllllllllllllllllllllllllllllllll'lll'l'llllll'llllllllllll4lllllllllllllllll 'THE NEWTUNHHN l5PlllFPllFFFllll1lllF5lllFFFFlFFllFFFllFFlllUlFFFlllllllllll!'l''lll!!l3llFFlllllllllllllll'llll'llllllllllllM Society Notes CConlinuedfrom page 120D Mr. Chipman has a life-long job as Porter at Newton Centre station. Mr. Saville Davis will take the leading role in "Sally.,' g The younger Mr Perry believes in Royal Purple. but Philip, his elder brother, EE appreciates all women. I It is reported that Mr. Millard is accompanying Miss Page instead of EE 2 vice versa. 3 EE "Buster" McCullough is trying to get a hold of one, possibly one with a ring. eg This is not concerning his baseball interests. We believe. 35 "Dodie" Albree and Anson. her brother, announce a course in how to drive a eg beach wagon without the beach. Johnny Procter comes from Samoa according to the Falls. He's quite the "Ukulele Lady." also his patter is exceptional. ie Ben Adams. although a believer in charms both fair and otherwise wise, still Ei if likes the Yirginian wilcls in VVaban. eg Ee James Byers Colton. 2nd announces that he is in the market for an attractive eg 25 offer. He will do anything provided it pertains to sport. gg The Koops girls are interested in rabbit Warrens. Perhaps "Bunnies" or 2 Beaux. too. EZ if Miss tluiry wishes it to be broadcast that it is not true that she is booked Ei :f complete for the next three months. She has two or three dates still open. EE if Only men apply. please. EE ie '6Moose" Lane is back in school. Hot air. alias smoke. put him out, and hot Q2 WEE air brought him back. eg if The Buby girls are gems. but like gems, they cost plenty. sg 22 James Heggie plays the fife extremely well. Too bad the orchestra doesn't Ei 2. work every night. He would see the 6'Dots,' more often. EE E5 Sam Moore is quite some shot but he looks all shot now, i.e., he has shot his ie 13.000, E in1llllululiilllilLiiI16111it1hl111lliillllllulllilmliiululUlinmlmmullllllmumllllLIHhhl111lii11hll1llikhkh1lllllllilll1llli1lhllliiillllll11lililhl1illhl1illiihlhllilhihllliiillihhlhilllilllllilhillillllklil1iiililiihhlilhiin1liiillllillhHiiiiillll1illiHliiiilllllllllhliiilllllliIIilllhiiii1rllllkillIIIIllliiiilllillliillhiiiiI1llllllilihIliillililllllliii W 122 It Www i, 1m Q V'QQ2jfjyjLQQLQLMQAM QQQQ TQSjVQEQ1YIET:fjZuSIfK llnrWmmmmmm f w + l wmuwummmmmm xx t ii l f ' , ' E1fV lu- .mfnflzlllililllllqp JA X Q Q5 Xp Q AHEXYQUSAF3 5, Y0u,Q OFF THE KEY 'eip ' HQH WELLJDONLT C, Q? PLY OFF THE 7' li w fs HAM DL E. 1' if Ji 'N .ff Q 0,5 QQ S f J, .3 K. -"" AHAfTHERE,5 A gn 4" - wowm uv we 1 6 CASE? Z 5.-fe. 43...,A 'H' If Q-..-'if .eeeullllamgw " .' K 11 I -Q H" A 'fr I ,f '- , ' lngnnak , K5 .gb "YES INDEED. 155 A xx t IT S ALL OFF ' NOW llll AW T KYYCHE N BLQCMSIV7 ITHJNOW "QA :SEE-Yon SHOES DE Fuse! " Sf LITTLE NECCO WAC-'ERS AJECVXIMG 7?QU! 0 Ay llillilill Illlllllllllllll1II H HXI5IIIIIIIIIIIIIIIIIIIIIIHIHHIH H I H IHIVIIIIIIIIIIIIIIHHH H IUHIIIIIIIIIIHHN I H I VHHHIIIIIH H HH HIIIIIINH H WUNIIIIIIIHHI H5 HIIIIIIIIHHI H HIHUIIHH1W H HWIIWWHHWHMHWWM H fMUVWIINMWHWVM f MHHFVn f W 1,1 W, A ,ML Wwlh-,,.'w4lx NW!',li!ln4:fx!uNx!w,:, l23 W ItttlltttttttttllltttttVHtltllttttttlllttttHtllllltttttHitt1tttllllltttttHtlllttttlllttttttUtllttttttllttlttttttllllttttlIlltttttttlllItttttttlttll THE NEWTQNEAN 1tmtnqqruttattytlqtItqt1ttpqtqqqttqgttlqqttpqqtitqqtgppgqqggtqqtgqtgatgnnuqpmQ11uqgwuuuluultnlnntvsannnmaaululmnnlmmuuuuunmlum Resume of Newtonis Drama 2 There once was a school so replete 5 T It never a play would repeat 2 So five did enact The play-going pact EQ We gullible folks to escheat. 2 i First. the Frenchman was gaily reviewed The amorous lover ensued 2 llis bright English rose 2 She turned up her nose 2 And home to his France he pursued. The swords were gallantly swung 2 f The barber was sure to be hung E But brothers appeared 2 llis faint heart was cheered E 1 And now his glories are sung. The Captain most honestly sought, E The duel he courageously fought Ee But when he lost out 2 i llis damsel did flout so llis attentions he'd painfully bought. 2 The Seniors then faced the array E A Circus they put on to stay E But Merrillis fierce style i Kept Mary a While 2 From letting her heart's only way. E Jimmy the yiol did embrace 2 While sweat it rolled from his face 2 And Mr-rrill's white rulf E Was dirtied with stuff That aided his sudden grimace. 2 Mary was lovely and gay E She had a bewildering way 2 The jewels were few 2 The ladies were blue 5 The play was successful they say. it The Math was shockingly short is But bright were quips and retort 2 Our sums are sure slow E But now we must know E Why teachers learn Math for support. The faculty play was great 2 e The pirates were most up-to-date 2 The ladies they swore NN hile master did snore 2 And figured romance had to wait. The pirate Chieftain so bold Ilis knees for certain were cold VVhen forward he slipped His breeches were ripped The house didn't need to be told. Fair Poppy her love surely hid And did as Applejohn bid The agent's wise game Showed Ambrose the same And into his arms Poppy slid. The pirates were left to their fate And death for the Chink and the mate While Lush's wide grin XVas a horrible sin For it covered his bow-legged gait. The gurls and the language were rough The tricks they attempted were tough A cigarette burn The tables did turn Till Ambrose recovered to bluff. The English group met on the stage Their efforts enough to enrage A house owner proud Who lives in a crowd And regrets fair kindness wage. The room was violently changed. The garden was safely arranged An old English tub With that amateur club Wias where the fountain was 'ranged. The couples were perfectly paired For ladder-like height was shared And pictures they broke The room filled with smoke And Billy some wild feats prepared. They saved the best for the last For when the movers had passed The maid entered in And said with a grin The time has surely gone fast. The season was very well run The plays were beautifully done But all we can say About each new play It was for certainty fine. M tttttttllllt1tttU ttttHttHlllttttttHtlltttHttlttllttttHttiltttttttltttHttithiltttHtHittttttttllltHttHittttPttlttttittttttlllltttttlltltitittttttltttlttilltlltllllltttllllitiillllttttllllltttililililtltttttiitililtlttllllltlittttlililtttitllIilllilttitttlIIIIIIIAItitlllilllllilitittllillllllliltitlllilllllililtitlililllilIiitttttlililttltlttlllillitititititillllltlVlltlltltlllttitittttlittiltttttlttlititittttlIllitittlttttlillltttittititllttlllittittttttItlltttttltiltttttlltitllIIIIIIIIUIIIIIIIIIIMHIIIIIIIIIIII 2 0F PRIZE-SPENNN G co fw 0NNroNicNL CQNTEST WINNER XGXXY 'lf lylfs, .NNN XX N "IH-rv ro Y 'Ulf pl I 5 . Q 2 'NIR .XXI-ll ,W ll., I XX 'EY7 Ng: 5 f 1 E E f l an 5 . ... I'NMi1IIINI-I 5 -ed? 'H NI, I"""fff. if C ir 7mIIIm'm' I4 ' E I "'.NIJN" NN' g 6 , Av N "N fNi"""'f" iii. Q: in INTED t 111 1 .NN N IHHUHNllllltlilltNNNNHHNHNHIHPHHNNNNNitNNNNNNNNNNNNHNHNINNNNNNNNHHNHNNNINNNINWNHHNHWMNNNNNNiif NItQNEjL'3j'E',1Q'N' 'TTI-QTYE'B,NTQ'iK1? THX UNHNNNNNNNINIIIIIIIIIIIIIIIIIIIIIIHIHH1IHNNINNNNNNHNHNNlIIIIIIHIIIIIIIIIIIIIIIIIIIIIIHIHIHHHHHHHWIHHHWH ...N N .N N . N.,,NNN.N N . d Q , ' Waj 1 -unuuNmuNNNNNNNNNNNNNNNmirNNNNNNNN..N..NNN..NN.NINNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN.NNNNNNNNNNNiNmNNNNun 1 926 In Print 1 JOHN N. NEissNEN is WINNER jj" "f'f31i1i?5EiGli.3CATHERINE A. NOYES NEWTON 0 N 4 I I XY I 63? rhfs N- 85,0 Ag-Bon" " ,Mex .1 ' W ' ' ' i i , . . . " ' ' Contribution to Constitutional Gov- I E 2 . I 1 . W 3 f I ' xi mia S - , 1 1 E .Iohn W,lFeIgoNw is llltlff, o 7SC'C0Df rig . X ,N X 1 3 2 Un I REil:ZIlX:lnt:JIrT1IFl:ieNR0I:X.iiix:X:1Xtr I I lianlake Part i izxcusn CLUB CIVFv ,OI XnXPXannXnXXT0.mfe New man Exawm ' .NXNNJ THIRD - I I !I Not Xe! Sent for Blanks To Be Pi JY It I,II..i.:'Ir.:III 2 III 'fi' 'IIN weft ifff? I. bi.....i.N Do This Al Or-ff' If P r.n.N tm r If ' ' , I ' . N - N N N.. .NI om... 1 N- . 'X .vi ' - N. -N- N N- NNNNNNN. 'W ' "f,,L'N,,, f E I vu! obgagt I F All! Nun I I XSS N11 B CQ 0' I 'iw NHHIII: V 5 5 R 'VN ion ' Jim! 4lI?4 7XSIi,, is 2 I fi,,,' lflzgw 0 XX,1'- if 4-X -,, fg N --N. 5 E , Q 0 vm! I I U If qi Sa 0 Q' 5 3 , Seite X Yo-I , 5 ' fl, l-, 1 . d new .X -'1 ' -51, ,X qi' - Q 3 Q6 X V.-N2 -.NNNNQXXXX ov" 9 NXJ50 'lan 'Zh ...NX-512.23 Xj-jf' " "QQ, 0P"w,,,"'N.. 'of ,M A9 E .RNC X ' Q S . I "',.'1-, .0 S' Fri 1'- fly K1 0, 'lzf,. , 3 X A A, W5 136- XXO' QNN-'I '0 75,4 .1 X 7- p 0 F 'I Q -Il , N 4 5 E ' NN2f"IIf,...W...fS5 5 NNW .. . N NNN il.. N ' 'Q 1 7 ' .. N N 'fN.."'i 44 .1 ww. J' 5 N' 2 E Q- 'oi' S Q96 . -f ' NL 'Inj NNN' X.,.N-- Q i gg , 4' I .-.l'..,, 'Ill 'Nw -5' -P0 .'f'1-' 1 tslmbeq 0 P595 XXVXfN:X3iX X XXX XX. - CHN x,h2XXgf4,- X- - : , Q lJUlf07,,lX IX 1... f1,XfX ...NN MIX ff!-Cb llsu1e,X j ,X E T' WVIIU -Mf"w"., UFNIQN 'I Us-'ff ff 5. 'VNS .- " l"IfN N..""f'. N Lf qt 55 E 1 I , - KYB 'Y'-. -'A 'lf -' RPN ' T"Ufiff 'II' 55 :fw""""2 s.. I TENT 'Az I gif A I 'I N1 5: V E N I mf 171' Qlfzjwffxf F:lXr....,,,,,n go .5 5 wma fr., f 650 0 X XX....f, IL fG.1,,,,X IZQ 5X A E Q ' I I5 " n N' I 1 " I 1 R .N 'N N N XX Q, . X .1 PLANS READY:,f.tgf.,,, ff -ff. ,,.....NNN1f...N.. NX., B ,, 1 . .N -U... - N Qi N' I. - NI I X T-C is-H 11 ' g I H X ,Holi ,UUA ,I"" , QGNIS Xhxlljk Hn" I f? LII' II " V I y' I'N5I Q5 X In , NNNNINWQXKONQ if I I' ' if 'Prnnvlla or Low in ai Dutc-h',,X .us 1 II, .YUNNN FUR X -,NNN X, M ' xt NWA' ,.. -NN' fx- N K5 f - - 3 N - , . , N. A NNI 1- NDI Mtn V Hu- S ' Nw .Ns-f .Q Y 4 - F 1 Gnrtlvn is Play Chown by XVAN II VX IU , X INIIX in 1' 'IIA AA AX wnwt' X we-N. U' ,Qs .xo L ' 5 E ., I Class Committm' ' GIN I ......w NWN ""'N fN..,, ,, , HM "V bxlang , """"'n XNNNNW Z, Nm--N QI xx' :fl - .N ' E d .-...N nom. -fNl..,, I PQ p X N N 1 - x 7 5 - -. i an NX 40,1 - t Q6 3' F 4' Agn N' , i -UT N - 1 - X Nh-9.9" X Xfmim , Y. XNHIN.. . 193 , 'Hn' tt Q 4 JA 5.111 is NN1.N.lN......WXX.3:Q.X.f...,........ , ,X XXX ,,,. Q, ZX 'he llunk 6 ,MMO To .W New F0lT01.1,N IS APPO N N ...www A itti N NNN W ., NQNNNWYS .. I ' -CHIEF I I H? .4 WNNNQK It NNN T2 Fl91gXL?e?lg?g:nd Plck N 5 n rm in UTIIHX sim f 'beta '- . ' 'X' If Q HN, 1 1. V H Assum-9lneSS.Med to S 5 1 - N1 N. n..rI...... mf... 'R "' . f- f' - 1 1 METH e Dur e anager uffeed T ' NNW ' H5 ' " " 'I 47 I . , ':f- -',f', QW , ,-: as 4 OD ny'-S ' . Srflfter LNQW L Jlrnad N' .N.....X..N.i ...N.n.N .i,......N VUNNINXQ -l,,.h-Qf,.,"- 7,52 Q79 tI Y I .X A . Y . i 1 N .. .... LIKSL' , , KN., ', 2, 'Q 'Q "I, 'f ' 1 w.,,,, ,Z QNEH 'Je . 4 cnzven CHOSEN on 7v 0' ...N , 'N f 0 + 'I It for' lic-gmt. ELECT-IV f as: Igseaders 22 51" ' W -N--N. ...L ...-.NUI V..-NNW" qv G ", 1043 4' 70 ' - I 'f 7 f 1 0 ' ' 2 H..1 I 'I'1l'n.' 'TONN , I 5 9 FIVE all Av ' ' f ' ' Q I HXZNX:.....,! .,. ,,,X, jgfNZiXK,dXXmX X ULN. T ALL scuousnc TEAIH "hiya N ' Xej If "di, 'f, E d lnuxi dm' U I "Pixy J ' ' WV ' N cz.. -- .. N ' . 172- - of '1,, Z- I , 'N 4 ' ' - , ,-N -f' dlT5 1' "'4"" I--h N-1. , I 0 " f 'N f, 2 , 5 " 'C ...im "EW , PL CS Heels on Sf to LunCIlh,, .. ...'....... NITE- 5 ,,XX .f ly 0005 , 'Z ,, 0 , TIIIOVI of , H51 Way X.: Ni.-..........JXXX,Z j XX'Xu- ft-Wy,-1 I 0l?j Zi' If ' 'ANI ar on N N f N, VY' - '. 'f y While TTlPPIIZg'14l X X XXXX XX r XXXXX hu, ...,....uxI::N HXXXXXXX X 'XXX' XXX X E, Xr3Xt1.is:!Xh' X ,X r XX . - llff IIJOI it Y I , T1 I - ' ,,,..NN-N NINZNINCNIIIIJ 5 fl 'I mg... vw" .N , , , ' X World 3.85 ,N 1 hom 1 . 41-.N 'I I ff, 1 L 'I , .N NN... N.NN-f-N- It N........ N- ' N S - 'Neue I S' mor If I7 ir lf ' -N NN...-N -f"""""' ' L., ...NN-NN N-N' I NNN- W" N LN' I'-ill 00,111 ?i lat, ,.....g ...NN ...NNN-X XX. .....N.. -'N' -- 0, ...H-. ""' 1 Q , NNN ' .N W "lN.NN C 1, W . xi N. .,..-NM .NN N 4 1 , 1 . . ...NN X .N.. XX.. . 4 1: my T0Nlrf K' f-.N I .. . " 2, fa N f i 5 'Nt 'L' ..N.N U' ...Nia ' f 4 , 5 1 N,,XXX.SC1...1...sh.pX Roizfg? g..f'.EfgfcNNsNN fa ski-M Q X X .N X-- XXXXX ered by ga ecard Shaw Elected President ' "' Win! xff"". " ,. N eww" - NM' ' 'f 'NJ Aa- L'- XNNXZHHSNQYX iJr.,l..Xi5 ele.X.e..BasebaII Carney! ...N 'X if 2 , Q. X ' UM cu " Wu 0.x N Nofotx Itard lp 5-7 I C ' .A .I '70 . L: . X ,xx I r rx X -..1.N5..1......i.... 1 S4 3 S - , 1' I ' I. N. .. ni. :I -E h10ApIi'lI If A T I .N , X FIFA - ...N . X , P5 ...NNN ' . . N' -1 , NV' 1 1 .. X XV... X ,,. N....,N.X.XX :NXXXXXXXXXXX X.. ,XX X 1,,Moo 4, 5 SX NN.......X...XXxX.XXXt . 1 1 X X, , .......- -" ' X'NNfNX I -'N ,XXXX 1 .N 1: :. Xmm. NN' .Q -,N 5 fx Of Hi-Y for Next Year 'flXy,, N' . , " f..,, lfl' .1 2: jf ,.,...N. 'vs-' 0 0 ., ,X v 6 Nl .- s : 3 NX x . X I he .. 5 X N' N N X 4 4- Y K' N ' I 2 031 S 5 Xt NW IF' N "I ' ' 1 ox 1 B N 9 Q K Q .- .. N .s...e....g n-Le, Y X XX. . , 1 .agr.., '-mf... McCullough, Bm X .......N.. hw... 1. 2 'L ova-, mf mi NL-WX N... II S N I 22121.42 'f' LIN' R5CElYElgI3"Sc 'I'AT...N. -N' 1 f-4""INN W 2 42 aw? ' X..-1 ,,..N.,,w 453 f f N'0l1l"""'l Hnlr x11 R0 L...-X LXTU' INN'-N""'I' II.. . ,EV 2 'liz' I f 2 3 E III NEN'T6Qtl:I26' gvnu ...N "I I: A 1 N1 K NI I' III II 7"I"'I2h13, Zi? 1 Q I-A Q 5 1 1 1 N.Nv f - X 4 , - 'Q 'I 2? 1 V UI "' "II De?""s Immun I KSDI :iff I". ,.. tw """'I . 'Y 3 '12 2.7 ice 3 ' JI .fe 9- -1 ...NN-NN Q24 U Nth 0' 5 ci Aw xii . I ,,,...... .- N..-N x"""',. .Num N. NNTONU' K ... Nm...- N N n ix... rum... N.NNl- 7 -N .pa , N '-'- ' ', Z, .N'ff'f'Q.N9f.N.'ll iftif 'f.Nl1'N"' T f'E"'N7I fTAlig4IQ3G '5MANP-GEIENN.-1p..11....gl.151.-.-mi... X- rn... Nz u N Tn... - r..r.nXT 1... N. NN... N.N..... gm... 1 N. N gun... N.......i N N 1 ,..... iN.,N.- Nw-.....N. ai N N .. NNN.. N1 , 11:1 u .i. N I in NNN... "' nr -N .... ', 5 1... - ,rn v.. u..Nwi... I I N N..N.N. ...NN,NNN. Q Y X xiii i i 1. . , X 1 Y N.NN....iN- ix ....... ...... N 5 xt! Ni.. N. ft - FF 4-R I 1 L IU SIIX . .N.. ..,. ... -'N N..,..... 5 N ...mg N... HXXTUR X , XX N.... N-N Q .NN t... . N.N.. ..N.. F is i..N...,. N ..i.... n J...... N... Ni... ii... , W... Me... N... ': -. All Bl IIN-vol .,. N N N 1 v. N N. ii... n..,,... lm., Nh F , N f,,,,,,,,,,,, ..N, .,,., NM... N, N , -.N .Nil 5212, ' ' nn.. N......,.. N ........ X......N NNNXN. - of f , ,. .. . N -N " X r,.... ..,,,,. ,,.N. . N . , . . NN. NN. N N N N NN S' I , XX j ' Slupn XXXXXX,,. -N -. , N .. . .. .N ..,.N., :X X LA" -A 1'-1..-'L -pf' , , Q N .NN 1 -. . . , N u..NNNrw X X, I N-N ..,.. .NN Ni.. .NN .NN Nr.. iN.t.N..NlI .1 ,- 'C' 0 f vsN,..Nt vsi.,.,....N......... Ni.. N. N... .N ......N.NN.....N ..NN.... 1 f 2 r N13 QI. fo .NNN II I N N Ni I ' ' ' I' 97 I-. I L I, X :N N I N NN.. .N...-q..N.i. ...N..Nip It u N, .N x.....N.. ii.. , 1 - f , M , X XX . NN-'-"' , N XI.i..NNN.. N N l..........1N'.N.. . -- N - ,pf - 'Y X I XX I I I ,N I .1 I N .4 nun-bu ' fIuNIII II NI IIN IIAIN IIN N I I Ir III' 5 of K. iii! F""rh- 'I""'11d 5 5. X,-XX LOAF X rnlluc., "ll f? .. N NN- 'H 'DIC f - Q' ,,-N N I.. N N X, ' N. ' XURF Kullo ' 'I NN.. .N .X-X x X , 1' W' NN .0 ., 'f .NU .N ' :X f N Iaplninq of IIaII Tvain' .4351 Q-058 I if 'Jf'+..6f QQ. Ga NN. ..N..N....N .-NN .N , - , 1 , gf. f .X ,, . go . 1 f1 .,, N " 'f I f 1 , f 7 1 1 ' . 6 .N NN nt. f 3 3 1 'Y ."'i VA A . , , 2 5 ,I ha. f, X. N , E sf-N IllllilifVIPIPIIIIIIIIIIIIIIIIIIJIIWWWVVHVVFIIIIIIIFIIIIIIIHIHHHWH?PHPIIiilIlIIlI14lHWVIVINHUIIIIIIHIHWUNN IIIIFWWNNNNHHNNHW NNWIIWMNNNIIWNWNNNNNNNNNTI NNWNHNNHNNNN NNN. N NNNNNNNN if NNN.. I25 "' ..f1N . Q? Q . M" v 'DN 1' A: G H XX...-.,, X XX ..,,X X XX X X X1 ,Xxq ,X Ni I, N, '.,f ... .. NN' -"NNN-, 'fNN 'vi-I Q o N. ,XXX .,, X NH, hWdu,X,X HX .J ,XX H H.. X lb:-N F ' J W QQ xx , ,.,a, 'Qll'F'llWK''ll''''f1PitllPUll'Ff4HIH'''1Hlll"'ll"'llYWlllPlllF!!l'llUPPFWWWFFHHllllllllll THE NEWTUNEAN lllllllllllllllllll'lllllllllllllll'lllllFllllllUlllllllllllllllllllllllllllllllllllllllllllM Can You Imagine Buxbaum giving an oral theme without mentioning his dog? "Doc" bailing out Mr. Dawson who was arrested for failing to produce a permit to leave Boom 19? Mary Tilton walking to school? Johnny Proctor not knocking someone off hisifeet in a hockey game? Mr. Bailey failing to have any "I am lateu slips printed? "Bob" Grants Ford creeping up on anyone? Mr. Tinker without a clean-up squad in the lunchroom? Coleman Lamont dragging "Dodie" to Symphony? The M. SL B. not having an excuse for being late? Chase and "Sully", washing the boards for Miss Owen? "Dandy" Lyons taking a femme to the Senior Prom? "Phil" Ahearn not writing Communications to the Newtonite? "Pete" Brooks and '6Connie" Ruby not giggling? Catherine Noyes acting tranquil? lVlr. Mergendahl not putting in a good word for the Nolan School? ".lerry,' buying a topcoat with J. A. coupons? lrafe Mother: "Tommy, I wish you'd stop reaching for things. Haven't you a tongue?3' Tommy Gilligan: "Yes mother, but my arms are longer." Senior: "Why do boullion cups have two handles?" Freshy: ul suppose it is so one can rest both elbows on the table." rlliss Bideonf: 6'Give me an example of period furniture." Noisy: 6'An electric chair, 'cause it ends a sentence." Mr. Elicker: "lt's a nuisance-these pupils are always late." 1'i6S0lIl'C'fffllI Mr. Bailey: "But my dear sir, what would be the use of the detention room if the pupils were always on time?" Bob : 6'Dear. you shall have the finest engagement ring that money can buy. What kind ofa stone do you want?" Bulb: "Oh, one like David of the Bible used." Bob: "And what do you mean?" Bulh: "One that will knock 'em dead." W imullmmmlmmmUlullllll14llllillllilluillhillrllnilmllluilllnllunllllllull41lellll1lllnlllTlTlTllIilTlllllllllllllillliIl1lTIfialllllIlnllllllllulllllluinlllTlTlllIinlllinil1l1TlTlTlliul4?lJTlTlilull1TlTllnlllIliiwilliKilmln'Illlilliwilllllnllilllliwilllllinilllliii1iiiliiii1lilllliiilll11iihillliiliillliiiIfilllliiiiiiliiiiiiillliiiiiiiilili1iifliliiiiiiiiiIliiliiiiiililliiiiiiiiilililliilliW 126 N WNW U W TH P!FW!I""1W HN W WWIIWIU 1WWNHHHUUHSUQ fTw'3s3Qw3fTi3rQgg3333 wmumu 4+ f wwmw ww 2 255272551-ESE-'S'-41-' Eiifiigk? 55255 3 9 TH? UIRTCUNINB UARYIUBEQ """' ' BY UPDLE-NCHNZZ - Q Gogwmow WHAT no' x CANT THINK OF K7 Q7 QHECKCAN 1 DRAW A Goof: IDEQI-, X 'P - :iff 7'4f L' ZWQ' Q 0255754 Q? C ry. A3 R V Q Q 13" J' mb' 0 5 , V' LsSi91"+jXB OW ff . 0: x?k 1 V my '17 fo Q I' o ' -' I fm f 1 V' xii m p' ' 7 0-o-of Now PvE DONE :T- X P 5- Zz 5555 wer A secofw FOLKS f 7'fNQ f", ff f5,LN,1 Ox' 'A 'Q .Z K 7 THERE, W5 FIN X usa-leo Now I! V fm L0 ffl, OM WE LL CALL, THAT SCENE 'MIDNIGHT IN A Com. NPINEN f ffffff XR N w N!-f X 1 f 1 X 7 ' .I ,ini 4 1 " ' N "W 'K ff' 'NIJ Q, ,511 ' X V v 1 qu' Q f If Ag J HHNHM UWM1H1111H H H HlllliilllillllllYH1 H H NHllliilaliiii H H 1HHIIIIIIH H N i N51,htmlm MHHHNHHlIiIiiHHNHNHHWH 1 Llhhifldl H HMUIIIIMNHHNNLanWMV WMH LV 1 H WWW mm w muuzmu Myliui wHm.If1iiuUHi1' IZT X X61 Avg!! lllillwll IHIIIIIII1llllIIIIIIIIlllllllllllllIlllllllllllllllllHllllllllllllllllllllllIIIIIIIHHIIIIIIIIHIIIIIIIIHIlllllllllllIllllllllIIIIIIIIlllllllllllllllllllllllllllll THE NEWTONIAN Imagining If William only lived today To see the rapid times And we could only hear him say, "The line - it never rhymes! Why modern verse is freaky stuff That clutters up the mind. I think Ill take a pinch of snuff If any I can find. Now my 'Macbeth' is out of place Its value sure is lost I'd never keep the writing pace - I couldn't meet the cost. In olden days the verse was clear With even time and swing, But now the choice of words is dear, Expression is the thing. Meter scarce involves a thought And rhyming is a sin. Now all my work is gone to naught Since Sandberg entered in." Thus William spoke in saddened tones Concerning freedom's verse UF111ll!F!99FF1ll159FllF19FUll!P'1lllll1l?FF'FlUP11lllll119FllFI1llllllll14FFFFFFllllllllllllllllllllllllllll W And bowed his head with grievous groans, And this vile stuff did curse. i...,1+ -. Ur Dawson: "Are you busy tonight?" Rulh Ccoylyl: "No, why?" D llr D "Then you can make up your back themes!" llirtl.. Owed to Gym Oh! mighty hall with shingled peak Nvhose hallowed rafters sweetly creak As lithesome maid and clumsy lad Perform "Doc" Martin's latest fad. Your sacred floor the ages laid With pictured tile the spikes have made And ladies' heels of Alpine height Have splintered up this holy sight. You've filled a hole both deep and dark For all equipment there to park And every nook and cranny dim Each has its own dear creed and hymn The Gym Meet's splendid splurge is seen Before its planks fade mossy green, And track is held in saucer-wise T0 see if man arose from flies. The sacred chamber of "Our Doc." The one they say is hard to lock Oh! Yes! the Barn! we love it so We hate to have some mud to throw. 5 i Illlllllll IlHlllllllillllllllllHllllllllllllllllllllUIIIIIIIHlllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllillllllllllIIIIIIlllHIIIIIll1lllllllllllillllllllllllllllIIIIIIllllIIIIIIIIlllIlIIlllllilllililllIllllhllillllllilIIlllllillilllullllllllllllllllllllllllnlllllllllllllilllllllIllllilililillllililllllllllllllIililillllllllllililillllllllIlllllllllllillllllllllllllllllllllilllllllllllllllIlllllllllililillllllllllllllllllllllililillllllllllllllllllllllillllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllli W 128 E5 Miss Haworth: "Ohl You're such a silly class for seniors!" C EE Paddy from Ireland - Freshman Alley iIllllIllllllllllIIllllIIIIIIIIIIIIIIIIIIIIIIlIIllllllllllllllllIIIIIIIIIIIIIIIlllllllllllllllllllllllllllllllllllll llllllllllllilulllllllllllllllllllililllll llllllllllllllllllllllllllllllllllllllllllllllllll ga Miss Rogers: "Address the chair, please." A EE Miss Hazen: 'iWhat are you doing wandering around the cor- EE ridor without a permit card?" E2 Mrs. Maynard: i'Mes enfants." Q ii Miss South: "What do you mean by filibustering in class?" 22 Mr. Kidger: "Now up at Dartmouth, etc.-" E5 Mr. Johnson: "Open all the windows, boys." Miss Smith: "I think the modern generation lacks, etc.--" E2 Miss Poore: '6Don,t touch those shadeslu Mr. Keeney: "Check!" gg Miss Waldmeyer: "Fm running this class!" Mr. Dawson: "Well, I don't know, -er." 2: ii-L Famous Pictures at Newton Ei A Guy Winning the Myrtle - Corridor North E: Chicken on the Keys - Assembly Hall s ge The Happy Faculty - Anywhere E2 Angels CEU - Girls 5 ge The Kooperage - C23 C Shute if You Must - CI3, near it 1 ze Cleopatra CNot Authenticj Mary Tilton c Three Wise Fools - Alan, Guy. and Chet "BuX" - And His Dog, C18 Happy am I- Opposite Miss Owen's - A Mack Trucks - The Outfield 22 The Quiet Hour- Detention Room E: Home - Where ever you are A 25 Noble Youth - Our Arthur A E5 Stubby - C16 c Ye Olde Inne - The Barn The Morgue - C17 ii Chamber of Horrors - Reception Room I Wee Willy Winkie - Junior Class Genius - The Whole School A ge The Ark - New School E5 The Grave Yard - Parking Space -li iwwlfifiwiiw 1 wwwitvwimnwI,miit-1wmiwmmiw, , iw1mul,twmwwwuviilumviliiiiiwiwi., W ,wwlmiwwi.wl it i,,l,,,,,,wi.W 1 wwww- ,,wwwii11im-li.lwmmuwm,I , W I lllllllillIllllIllIIllIllIllIIlIllllllllllllllllllllllllIIIIIIIIIIIIIIIIIIIIIIIIllllllllllllllllllllllillllllllllllIillIIIIIIIIIIIIIIIIIIllllllllllllllllllllillIillIIIIIIIIIIIIIIIIIIlllIlllllllllllllllllIIIIIIIIllllllllllllllllllllllllllllllIlIIIIIIIIIIIilllllllllllllllllillIllIllIIIIIIIIIIIIIINIIIIIJIIIIIIHllIIIIIIIIIIIIIIIllllllllllllllllllllllIIIIIIIIIIIIIIIIIIIIllIllllllIIllIIIIIIIIIIIIIIIllIllIU1illIIIIIIIIIIIIIIIIIIIJHIII!IIIllllllIlllllllllllllllllliIHIIIllIllllllllllllllllllllIlllHHHlIHlllllllllllllllllllllll l 129 -: Famous Orations 32 Miss Owen: 6'.Iust two or three minutes more, children." M lllWl''lll41lU'llYFWl1Ull'ElUllVllPll'llF''l''"llll'''llll''''ll'I'1W'llU1UlllFlWl'llF1'5U'll'F4'''lflFI'''5''lllllllllllll THE NEWTONIAN lFE1ll!!F!FllllllllllllllllllllllllllllllllllllllE!lllllllllllllllllll4llllllllll!lllllllllW Ti 5 gi Is It Possible? Catherine Noyes -- Not talking? Richard Miller - Flunking? Katherine Bonner - Sitting still? "Pete" Brooks - Being serious? Holmes Whitmore - Wide awake? Yirginia Koops - Not sarcastic? John Meissner - Not positive? VVhat Would Newton be Like with Miss Jones not smiling? with Miss Smith asking something you thought of before? with beds being provided in the detention room? with Mr. Caverly forgetting to say "The fact remains?" with Mr. Dawson forgetting to say "You see it is this way-?" with Mr. Kidger saying, "Go to Brown, my son?" The Perfect Boy and Girl Boy Girl Dick Miller's eyes Drusilla Guiry's hair Gordon Ellis's complexion Mary 'l'ilton's pep Hapgood's smile "Silly" Sylvester's clothes "Mal" Gallaghefs sportsmanship Faith Wing's personality John Fellows's good-nature "Pete" Brooks's smile "Chick" Chadwick's brains We wish there could be an eligible candidate for com- plexion CNaturalJ. Sandy: "1 take great pleasure in giving you 31 in math." Ellis: "Make it a 100 and enjoy yourself!" Mr. il Iaicim: "How many personal pronouns are there?" Buswcll: "Two." Mr. illarim: "What are they?" Buswell: "I" and Qthinks a momentj "she." luiiIlu1lilliiiiilltiliul1illiiiiiIlliiiii1111iiiiiillmimuuiiilu4411iuI1um1uiiiii1ulluluiiilliiiiillmullliilllulllllliiiillrliliitliiiiiillmiillliLLil11iiIisLil1iiill1l11lllliilulullllililllillkilEllliilll6EEiiliiiEliilllEiiliiil1llliiil1illlElill6iiiliil11l6E1lllililll1lllllliiiihlllllll11llhfliiilllillll11hllllii1lillllllllliliiiliilllllllllilllllillllllllllnllllllli iii l 30 M wwwvmw mmm w mmmHmHMb wmmmw ww WWWWN1W1EEEEWWWYNUE1EEWWHHH1W4HHWWYNNNEEEEUmmm1NNNEEEEWWWHmmm WJ M + ww f w lhwfw f -4 EVE Z """"' VH-E X X V g E. i ----- , a 2 gg l:E'f' 'S ' E E X-E Eb 0-0-Pia UAH i 2 Ib, "WHEN THE ONE L ,Q ,2,x ' N You LOVE LOVES j 'Q ' ' . 'QEEEEL my E . J Yow 9066 MQ? L 5 ., SLEEP on PAPA 5 Z O xo ' wlLLJsTRArvGr1.E T75 5Yl9p'ffYx6 ,I X if 5 7 THEE! Q 06 5-E "Q 1 ' 'f cv? Q f 2,-:-2 R Q5 .-l brf Q - r -QWOW wr' 'Z g X 2: En.. A N X 3 b GU , 'fig' 7 N X 4 XX C' 5 S Y Q! ,+ DK2l5oNEr2'5 - "0FT IN THE L- Sewer .. ., ,ly J sTaLz.N E135 NOIZHT H 4. '-5 T E Ju GQ HYES SIR! THAT S MY T 9 wo me Y! 9 . W E W- -E ' 51 2 f..-'as ggfhbi- - f V 'IEE ,X Er-5-1 I N ..--"Zi: X :::::. ,T 1. 0 X wha- M 0, 1 Q T .1 C I L.. ' N' - -240' '97 0 o Q ,ll "Hugh ..., ,.-..g11'.1kk'51jf123.3fl M5 1, I ff vu. SEE You no MY my W DREAMS 'X - mulfUf?So4L 0 WW I5l1111f1eililiiiiHWilUWMUHHWWW5Ylllll1YHHWlLQYlililiuliHMUENEEMEEEEEUEEMEh+MmeE4HWYEHEEUMHm.mm uE.MMlEHEwEuwHHHHHHwmWwww-2 EEEEE Ewwwmwuw ICH M llHlllliillllllllllllllllllllllllllllllllllllllllllllIHIIIIIIIHIIIIIIHlllHIHHHHIIIIIIHWIIIIIIlllllllllllUIIIIHHllllllllllIlllllllllllllllllllll THE NEWTONIAN lllllllllilllllllllllllIklllllllllylallIIllllllllylilyllllllpllllyllllllllllllllvlIillnllllllplIllllllllllllllIJIAIllllllllllllllllllllllIWllllllllllrllllblyllltilllllllIyI'lllllllI,I'IlW Funny Ads "Yalve-in-Head"-Julius O. U9991, Pure"-Lunchroom Hash H32 Ingredients" - "Soup" Campbell "William's" -Billy Park "F, O. B. Detroit"-Guy and Holmes T GG 1 f Sweet Caps"-"Twig" Brush gg if ss E, L i Three-in-One"-Herb Holmstrand 3 gi "I, C. School"-"Drusy" G. "Corona the only Portableu-Sid Webster "Eversl1a1'p"-Mr. Griffin "Atwater"-Ned Kent '6Wrigley's"-Ruth Pearson 22 "Ohl Henry"-Mr. Ford fi "Mellin's"-Marcus Remiek "Absorbine, Jr." - Bud Hayes ?f "Stacomb" - Dick Miller If "Save the surface and you save all" - Ruth Fairchild. it "Jell-O" - Lunchroom floor any time. llolher: "Robbie, come here. l have a surprise for you." Bobbie: "Aw-l know what it is. Big brother's home from college." ill0U1PI'.' "VVhy Bobbie, how did you guess?" Bobbie: "My bank don't rattle any more." Cough - Smith Brothers - Drops Johnny Snzilh: "Say, which one are you?" Bill Smith: "l'm the one on the left." "T" Bjorrzsorz Chearing a noise in his hen-coop and rushing out with his gunj: "Who's there?" CA minute passes and then a weak voice from somewhere within pipes up: "Nobody, only us chickens." This Might Have Been Prevented: Yictor Badger's Mustache. nllr. .flrgenI0: "A Blue-card for you." Sch0Iuslic.' "'l'hat's all right. l'm color-blind." Algebra Student: "Tell me, please, Mr. Mergendahl, how come those two simultaneous equations go together?" it Mr. Mergendahl Calias Lief Ericsonj: "Why, boy, they've always been H together." il.itinliliiifitiillllsleilllummmnulllmlm1xllvumm1ilsmm1lrumm41lllmml1lmumnllmul1LuIiihih11lllllllllllillll11lllunh12Qiillmlllllili1lllilllllllhilllinllllulllllilllllllullJllilill1llhill4lilllllillllllillll4llnnlillinrnl11liiihhiilliilhilJlllilillllillhillllhlhllmlllllllIIiillllllliilllilllillllilllilillinlllIillillaillllinllllii W 132 HlllllllllllllllllllllllllllllllllllllllllllllllllllllllllHlllllllllllllllllWHHHHHlVHHHHHWIIIIIIIIII NENETEEEE QUWENTYQSEEK lt ttllll""llwiiititiiiititiititiiiWtlllllllllllllllllll!t!'ltltlllllllllltTT t ii A Dictionary of NeWton's Terms gi Adviserdflne who guides us. E2 Assembly-A meeting of the clan. Bell-A life-saver at the end of a period. Blind-Used with f'd1-aggingf' Ei Blue Cards-Ticket to a reception. Bust-To fail. un faux pas. Ee Chorus-A group of songsters in training for the outdoor bellow in J une. E5 Cold-Absolute. as a cold goose egg. E5 College-The aftermath of a successful high school career. 2 Credits--Points for college. Ee Curricula-The bane of high school life. Date-An appointment Wherein anticipation plays a bigger part than realization. Dope--N ews. Ee Detention Room-Where all good men go. Drag - A young lady being escortedg to escort a young lady. E Exam-Our Rubicon. Femme-French for young woman. Flunk-To pass out: to get a cold cipher. ge Freshy-The lowest rung of a long ladder. :Z Gym-Period of relaxationg the Barn. Ee Homework-A neglected institution. also worthless. E2 Legislature-Whe1'e the future of the country is decided. 5 2 Lunchroom-A fish hatchery and an onion nursery. Zi Math-A science run by the Alpha Gamma Tau. Office-Newton's shipping room. Ee Oil-A line to be avoided. 2 Pigskin Chasers-Football men. E Puck Chasers- -Hockey aspirants. E Queen--A perfect femme. Ee Reception Room-Court roomg a last resting place. Repeat-Flunk out and take over. Ee Room 17- A place to be bailed out of. E5 Senior Year-The top rung of the ladderg the necessary step before graduation. Stag-A parasite who dances With other men's girls but brings no one but E? himselfg one who has learned through experience not to drag again. ge S. T. S.-Students Taboo Stallingg1Students Try Self-controlg A group of joy ge killers and tete a tete busters. EE Tea Fight-A danceg a gallop, a struggleg a bridge party. 2 Q Woof-To v ocalize. E5 Woofer-One who vocalizes strenuously. : . X--Unknown. Yellow Slips-A dock of one half hour in detention room is presented to the E2 bearers of these slips, gratis. Ea Zoology-A course in monkey-shines. Wiiitilliilliillliiiiiiiilillllilllililillili1I1Iii5ri1s11I1III1lii1I11lllllllrimllitininil1liniiiiiIllHIHHl11lilinillInilllllliiilsiiliIinlililillliiiitliiiIHHu1uHnliirlilllflirllIuuluImilimiiliilnminiillililiiiiiiuliu1uiuiiluunnnlmm44nluunlnuuumulmmmnmmliititimmuiulilnlaiai4itiitminimumiulliluiuiuniuiiuiiitititrmmmumu1iiiiiiiinuuunmmululiimsilit l 33 Mlilll"lillllWNllllllllllllllll'lllllllll""'l''ll"'lUNNN'llllll""'llllllllllllllllllllllllll"'lll THE NEWTONIAN llll'1ll'llllllllll1lllllll1lFFr'r1ll!lll'FlFllllFFFllllFllllllllllllllllllll!FFFlllllFFFFllllllllllllllllllW Senior Class ii CAs it should bel President, "Jerry" Vice-President, Bill Proctor . Secretary, Mary Tilton E C Treasurer, John Turner : Valedictor ian Poet E Carleton Redman E Tommy Sutcliffe E Newtonite Editor E 2 Orator Tom Gilligan E Maynard Moody Literary Editor Funny Column News Editor E Chester Pratt Allan Bliss Ruth Pearson E Copy Editor E -lr E Bob Clapp E E Newton ian Editor E Holmes Whitmore 2 Athletic Editor Foozoro Editor Art Editor 2 Arnold Nichols "Stubby" Newton Catherine Noyes Senior Prom Committee E Banquet Committee : : Coleman Lamont, Chairman E Junior Stubbs, Chairman K Soup" Campbell John Ramsden E Bin Park Goy Holbrook zz "Tub" Dugan "Teenie" Curtis "Dodie" Albree Victoria Williams Z : Athletic Committee Trajfic Squad E Saville Davis, Chairman "Kay" Noyes, Chairman James lleggie Richard Miller George Chase "Fur-Coat" Nivling Charles Crawford "Babe" Adams "Bo" llemeon "Bud" Dougherty Captain of Football Jack Chipman A Captain of Track Captain of Baseball Jimmy Colton John Fellows Janitor "Bus" McCullough Class Yell Struggle, struggle, gallop. Hop, skip, and wallop. W inruu111r11Inu1iliin1linHlilimiluiulillHIummuu1willIin1lmuuuelimHu1nmInnllnriiilu'1m1niiiilliiiilliliiiliiil1iiilil1iiiiiil11iiliiwilliiiiiiiiiili1iiiiliilliiwillliwilliinlliliinllilliiiiiiiilii1iiiiiiiiilllHillilliidallliiwilliuliillilnilmlmtiluiilliiiirniiiIii6ililliiiifiiiiIitliiiiiiiiiiiiiiiiiiiiiiiiilliifiililiiriiiiliiiliiiidliiiiiiiiiilliliiiiiiiiilifiililiiiiiiillliiiiiililiiiiiilE I 34 M llllIIllIIIIIIIllIIIIIIIIIIIIIIIlllllllllllllllllllllllllllllllllllllllIIIlllllllllllllllllllllllllllllllllllllllllllll NHNETEEN TWENTYQSHZZ, llllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll lll Classified Advertisin Columns Rate equals Distance. times Time LOST Three Cicero "trots." Return to Room I6 One lunch room ollicial. Please see Mr. Kidger. E Mr. G. VV. D's new spats. Please keep them. 4 I LO ST Behind the gym, two pint jugs. Finder please refill and replace. E FOR SA LE -if A house by a man with good t.rolley connections. PERSON A LS Will the teacher who took the billiard balls from the "Y" please return them at once? You Never Can Tell Classified Ads WHAT WOULD YOU HAVE DONE? -You discover that you have sent Mabel's letter 3 to Becky. 2 -You have only ten minutes to walk a mile to her -E home and then catch the car. -You interrupted her. DUGAN 81 ALLEN Etiquette Engineers Serv ice Sal isfacl ion Success POWER OF WILL Mzike yourself popular. Ride to the top. h Make yourself a master of men and women. Power ol' will assures that and more besides. PROF. J. WALKER -Are you too short 9 E -Is your success impaired by brevity of stature? -Do women call you Baby 9 M. D. Growing Glands will add cubits to your X-Y-Z RANCH ESPER ANTO Mr. Easterner. here is where you should spend the summer! On the shores ol' Dresser's Pond, next door to the Rockies. Special rates to the class of 1926. Newton High School. Punch cows and learn how to push a peramhulator. "TWO-GUN BEN ADAMS" height. Satisfaction guaranteed. Needham, Espemnm Prepared only by SHAW 81 RRYANTINE Z HELIUM SCHOOL TAKE a Rise in the World. Eat. FLEISCHMANNS YEAST. Lighter-than-air-club. Open to all. See RALPII PATERSON BECOME a Playwright and your future after ig Graduation will be assured. We will show you how. MERRILL HAMMOND s MARY wmcni' NIGIIT VVATCIIMAN of sober habits wants permanent. position, preferably on Pullman. I have the uniform. JERRY INDIAN GUIDE. Intimately acquainted with primeval VVaban wilds. Apply to Spain. SOPRANO BOY: with two years in lligh School Glee Club. Specially trained for broadcasting. tfforilinuedufrom page H2 ull? are Sorry. the Appendix is Henzoved. Slick plf'0l1IId.,,l i-' Em wummuwwu llllllllwl1l111ll11mmluuuummui ' f- i mu uuwmmmuin: l.liilllllutwmruimumw v ul mum i .www mu 1 lmmuuuml lwwvmuuulu umm :lull IllllIIIIIIIIIIIIIIIlllIIIIIIIIIIIIIIIIIIIIllllIIIIIIIlllllllllllllllllllllllllllllllllllllllllllllIllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIllllllllllillllllllllIllllllllllllllllllllllllllllllllllllllllllillllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIllllllllllllllllllllllllllllilllllIllllllllllIlllllllil4HllllllllllilI1Illlllllllllllllill1lllllllllHlllllllllllllllllllllllllllll.. 'lllllllv l35 THE 3FIE.'SiVT O1YTI.All5J' TI N ..X, . . 4 . U .V . n ,- A , ', - , 6, Z2 S : , ,,- :Mu F, ,V ,- ,M ,,m,..Q,'g,,,, x, ,N , , ,,, , , ,W V . !,,,, N, ,,, , ,Nil rw, MM ,L ,u,,, , ,, ,+, , 1W,,,,1, ,1,,,.:,'w1,,,NN:,',w U,,w,L,,,U,, lfifm IHIIIIIIII IIIIINIIIIIIIIIIIIIIIIllllIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIllllIIIIIIIIIIIIIIIIIIIIIIIIIll NINETEEN 'QWERTY'-SEX IIIIIIIIIIIIIIIIIIIllIlllllilllllllllllIIIIIIIIIIIIIIIIIIIliIIIIIIlI11IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIUIIIIIIIII 1, guumlInIumvnnnnlnewlllllwulmnfmmnmlunnmullmlnuuIII1IanInnnrInlumuumuuum mv-wmmmmmmwunnnuuuwwwwmu,nml.nwmmuuuM11mnnmmwmmmmlllnwg 1 Autographs ig X - ! n - EE EE X, A M. EE - ' K - !' 'M-.4 ' -- Xs -- 1 f- 2- 7 'X"- ' ' "z 1 f f A E i l- 3 iz -1 :Z E 5 A-, 5 :- -- gf f X -- E2 ,J V' ' - Q ' ig IQ ,gffxf , 1 Y 'M Sf' ,' 1 ,J i f 'iff 1 : ru WWIFFFFFFFFFFFFFFFFWWWF T5 v si. 'X 5 f iiiiihiiiiiihihhiii 3: Y? 15 df-T ii N Ei gg EE. 2' : D al - Q ,- E ,Pj WEHEEi1iiEiiiiiiiiiiiiiiiiiiiHiiiiiiiiijiiiimiiiiihiiiiiiiiiiiiiiHiHHHHiiiiiiiiiiiiiiiiiiiHihihiiihEMilEiiiiiiiiiiiihhiiiikiiiikii1HiiiiiiiiiiihiiihihiiiMilliiiiiii6ii1HHHiEhiEiiHhilliHiEi3iEHHkiHEiHiiEiiEkiiikiiiiiiiHhiiihiiHlkEkkkiiiiii'nIIiIiiiiiikiiiiiiiiiiHIilikiiiiihibiiiihhIikIkkkkkkkikbiikiiiiihIkikihHiEiiiiiibiil 1 1IIkIHkkkIniiiibkEhiiikIkkhiiliMahlkmhilbiiiihibbikikikikuhhhh3klll iH'ul uIkkH1MiialIiu inlkkkInkHIIffiMidiMifrriiliiifi E 1 37 0' , ' gi -- .7 2? , 'V-V2-M 'Q 'J Axfx' Autographs 1' ' ' ?? aa ' ' 1. 3 Hd' -- I 1 X f ' f- - E2 X Z-'.f.',, ' ' 4- K-C " gg 'sv' F' ' Q ll E I ii E . ' 's' - ' ' E5 ff' 5 :E . ,,, :Q f . 1- N I' E 5 f f JA 1- -J - ' E 5 A f Y- ' f' E5 . ,-, V EE 1'4" rx ik, ' 1 T: , - ' 2-L2 I is , A ig 1' 1 1' Q A P 5 ' 1 gg "J "I 'f ii ii ' -I V " ' ' ' RJLJ-1, K " ' "', N 'QD 'x ' 'f'.J I " - X. . f VX 3 I , g V . KV 'I 4 . 7 L 2 if X i iz A1 1 ' 22 ' 7 -L 5 J7 C? 0 gg ',k if 5 I - -I EZ M' f 5 A g : l A "' I ff "4 ' , 1 ' ' JI Z r , f 1, , .. , ! Ei wr' ' I ' ' 1 1 1- X ' is 1" E s 5 ,R E v . .x , - f! A WE as In ru z E o z hl an z IMMIIIIIMM ? E HM!! IMIIIMWMI IHIIIMIIIIIMMIII lllllllllm IIIIIIIIIINIH I IIIIIIIIIIIHIIMHIHIIIIIHMW IIIIMIIIII IIIIIMI IIIIIIIIIIIIIMI nllnlllll f u ulnmunln III IIIIIIIIWYN 1- -X-' Si v- 7' W MallffirilillliiMil1llh1mfzililillfffliiillh1Hifi:hilliaifffvhmffiiuiilllIifiiiz1Iiiif:ilil1Im'riilTHHHinilliiiiiiiinlifiiiiliihfililhliiiiiiimiiimhliffiiiiiiliiiililhiliiiiIIiimiiimiiiiiiMnliiiiiliiiiiiiiliuiiiiilbiiiiiihiiiiiiiriihiiidiiiiliiiiiiiiilikifiiiiiiiiiiiiiiiiiiiiiiiiiidiiiiiiiiiiiiiiiiiiiiiiiiiiiiliwiiiiiiiiiiiiidiiiiiiiiiiiiiiiiiiiiiiidviiiiidimiiiiiMj1HlEiiiiiiiii15Jiii "1 '1'm " ""1 - ""1111 'Y" uuuw 138 MWi!!!!9!!!!FFFFF!FU!FUUFUFFFFFFF!FFFFFFFFFFFFFFFFF F!!!FF!FFFFFFFFFHFFFFFFFFFFFFF! NINETEEN TWENTYSIX 1'UWiYV4F41Fl??EEE??WUWT5FE111E1111U1UW!!!1F??E1W!l!W!l!WF??U1444UW!QFUUWFFYFYFWM Autographs 19? 1 -v C 6 y EE V EE g X' Z I, Il, , ff --' - N ' ig -- f- x -- ,- f vt 1: ,z :i 1 1A K -- K A 1 : - 5 ii , : 1 E31 ii " --u 15 I N - ' E 1, Ei .." E5 0 Ei ii X Ei N ,L f EE EI-1 i El 22 EE ig :L- W MHHHHkiHIEEEkiiIIiiIiibiiiLiiLliilIikkkliliiiiIiiIL1Iiiiiii1IIIliki3IiIiiiihliliiiiiiiliiiiiiiiiii2iIIk11MilliiiiliIIIIkkHIkEIkkiWEEbiiiiiiiiiiillkimkIiIbliiiiiiiiiilklikIkkkkkfffilllliiiiiiikMmEEiiiiiiiiiiilTuIu uikkkkHkiiiiiiiiihhkinIMiviiiiiiMu u uInkIiiiliiiillillkInIifiidiuliiIklihh 1'l'1'1kkkfffuiiilililbI1HkffmiiishIiu u1u l u 1'finfffrIiiiil1 nIm'u uhkfufiumlelnlin u u hi1ih1Ifffn nMnl 1'1 1rmhiin11izmiumr1kImififfil1hl1 1 u 1kfmInI1HimlllliiHiffffffifilitailhll'm'fr1HnhfuiilfruH 1 39 T2 ' , G' 095 SE X. 'N Q 1 N , f v 'W I A , Yr' ' -1 U xp. WU U? U? H' 1 ! FFPIUPEPWPFWS :U Y P Q B0 'P f' ' q E 5 2 25' us 4 N UQ if ' 5 5 NL 'U 2 if S x "2 H b gh- 2 IIIIIIIHFMWIIIMHIWMWWWWMHWMWIIIIIWHWWF E 1' ih- i Q26 ?E Ii 493 gg tg ' kg B Z ' , 1 A L I iz fy .Q I i gi I X M, J 'Ax z , Q 331+ f 'Lfyi,,A . "-vw ii 1 1 L ft" , -' 1 zz N xxx 'WX 1 5 . , I fl l N x! XFX 4 I, E , ,,, Jw Q I ig ' fr 5 w 4 xx G xl l L 0 -5 g Ei El Ei : 5? g -i Ei- j . E? A ::.- f , -L- X NLM. s gg li ET Ei Z1 I? -ll 21"- -i ' : li :Ii ? if fi' Z.. zi fl Z? , " fry, . . : K, fffo Q' Y .. ff -V' , ii Whfmnnmwwf'M'JWnriiiii1uulnl11 M ' f W1mm1I1Enrrmi1uuuIhmn16uuumiiiiu1Irnnn11uInmilii6rmii1E1Eiinu116iiiiiiiiiiiEiiiiiiiblilllliiiiiiiliilL1iiiillllihiiiiiilliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiiiihiiiiiiihiiiiiiuiiiiiiw''mM 1 1'AH lliiiiiiiiiuriiiiiiu1mmmhiiiiiiiiiiikHiiiiiIiLiiiiiiiiiiilikiiiiiiiiiibiiiiM"M '1'4"' uIluiilriiiiiiiiiIIIImIIIiiii1I lil1MiiiiiliiMiMiHliiM l Y 14 , , X be f , 'vfyk f . 1 4 I s X11 9.1 'Hz' 53 W5 1. ' "P Q 1 H f 1 ,4- 33 11, ' '4' 11 1 1 71, 1 ,., V . 1. . P. .I 1 . V., .-'QW Nr 1,1 1' .f'. rf' U I J V, 1 K 1 . -,ar ' ,iz 1.1 ,,,. 1 X1 -. ' ,w fx '., 41' -3. V, 'X .. , , LT, ,url ' 15,1 1,5 ,Q1 ':',f.' fy ff 1 . ,f - 'I 24" 'Q '51 nw-' -1 rf N"- :-, L- 'R . . , 1 ,,1 .1 1 111, . 'I Y , WA W , 1 A - ,vt ' "1" iii, 3. 'fu , , HN 1: ',', ' QL . ' 1 3" 'M QI ,, ij, ,, 1 I J! QB- :Vi JA" "3 --1. , . al. 5 . ' A ' 'xv' fu' .':. sf 12 1 pg U1 5 -fu. ,-1 ' ,.,--, fi.: L51 '1' in xy 1. -f- '-WMLF, ,kv of 1 . V11 , 1' 1-E. 1 ' 1 1 ' 1 v 1 1 A 1 2 J I 1 1 1 1 1 -95 xx- 'H ' 1 ,S J 1 -, N fy 'J 1 ' 1 fr .-.Li X Y' V A 1,1 wg -1 12 X W! in". Qi ls 411 , . xg., .,. ,. 13' S . Dix 121 ,, ,fl 5,


Suggestions in the Newton High School - Newtonian Yearbook (Newton, MA) collection:

Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection, 1923 Edition, Page 1

1923

Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection, 1924 Edition, Page 1

1924

Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection, 1925 Edition, Page 1

1925

Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection, 1927 Edition, Page 1

1927

Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection, 1928 Edition, Page 1

1928

Newton High School - Newtonian Yearbook (Newton, MA) online yearbook collection, 1929 Edition, Page 1

1929

1985 Edition, online yearbooks, online annuals 1970 Edition, online yearbooks, online annuals 1972 Edition, online yearbooks, online annuals 1965 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.