NYU Washington Square College - Album Yearbook (New York, NY)

 - Class of 1952

Page 1 of 175

 

NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection, 1952 Edition, Cover
Cover



Page 6, 1952 Edition, NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collectionPage 7, 1952 Edition, NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection
Pages 6 - 7

Page 10, 1952 Edition, NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collectionPage 11, 1952 Edition, NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection
Pages 10 - 11

Page 14, 1952 Edition, NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collectionPage 15, 1952 Edition, NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection
Pages 14 - 15

Page 8, 1952 Edition, NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collectionPage 9, 1952 Edition, NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection
Pages 8 - 9
Page 12, 1952 Edition, NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collectionPage 13, 1952 Edition, NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection
Pages 12 - 13
Page 16, 1952 Edition, NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collectionPage 17, 1952 Edition, NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection
Pages 16 - 17

Text from Pages 1 - 175 of the 1952 volume:

Z X C, , 4 C P X V ol XX! . X Xgof, C:-1-:g,4iA W f X In if' ,I fl' - Y. CA A L.: 4 9 Q 4g ff - - Q an 9 :rf -Lis? L 5 ::-as 1 ' -lg X x Q I4 f f ,f- . - n 1,4 U fl N C J - ir. "- ,fu f'1 A ' , -yur-X X 1 5 ,Qu I I "r 'E Q Ml f 'fwmv 'iii .. '1 ' J f tags.. N D -:. MM - 3-mi ,W 1g! +3 ,W',W l -EEE f-nfvvx-vOG'ffviI"fv"3w'Mnnfw 'nm Prvgwffnw tdlswagghmz . ,, DEIIICATIU There is a connotative meaning in the word dedication. And it implies all that we intend it to imply-association, admiration, affection. Thus, it is with sincerity that we dedicate this, the 1952 ALBUM, to Professor Andre Alden Beaumont. To none is his impressive stature unfamiliar. But more important, as Chairman of Student Affairs, he has made our association with him a fr 'tful . H' ui one IS is no simple task. He has done well, and we thank him- for the patience, for the sympathy. For his ability as a teacher and historian, We express the admiration of students. It is primarily to a friend, though, that we dedicate this ALBUM. And, as friends, we leave him with best wishes for a future already assured by the nature of the man himself. -I IHMTIIAW. IIT PIQALTNJE MKMSZXKU 51,2210 -Q .' ' 2 1: wi ,E I- ll' 0Uli mm amos 'On February 1, 1952, Henry Townley Heald became Chancellor of New York University, after resigning his post as president of the Illinois Institute of Technology. Throughout his career as an educator Dr. Heald has participated in civic, professional, and governmental , activities. He served in the Office of the Secretary of Defenseg with the War Manpower Cornmissiong as Chairman of the Mayor's Committee on the Chicago Board of Educationg and as executive advisor to councils on education, engineering, and religion. Concerning his new ' post, Dr. Heald stated in an interview that ". . . the chancellorship of NYU represents an important challenge and opportunity in a broader area of public servicef' ' w Chancellor Henry' Townley iHQald . ' ' Ti 5 'T' WW?" Q' Y 5 4 4 N .f ., f ' TM! QF' ..-I , mE, M, , U ,J , V W fm Q? Q ,QW 4-gp. vi ly ,Q .QQAQQ ., ' .xi M1 1 j ': x ii- ,- ef?4f:'M ' ' , 'fha if Q " Qiifiggf-1i2' ' ww 8 a 1 , N' ' H' ' - Q , x Avg ms w5 iqjw 'MZ 'in .' , Ta" .V -t:5':"i M 51? S355-w - ,... -QV- -' .viffj- X 4 ' ",,, . , 'N ,.,': ,, -. . . ' 121 .,-11111 . - . ' f i - 'L ' ' "vi-1 1' ,-,., - ' ' " - . 15, 1 ,:- "-A ' S 'tw -' 'j , " Ga" f1'f':"" i gm, - -Iz iff "9 "" x ,QLM Q "" k', MQ gm, . , f -'wffikfii Q 'E H .- -5-61 'WSW 1 L' . , ,. L xi .. W. I 'EMR 21'-23 ' 4' qv, ,. . X Qsff, lt: ii -19 ' " ' x NSE, 'Wxi IN m 'Qi-effwzc-rf"": rt." Q f-'U '--ii--' ' fa f . ' L"W"5-lk ' -5-if ,:,i-1,-ff ' 1,x'f:gx,:'- ,sk .. gf . Y ,K Y - 5. M. My ', 1 N QM f "1v5f+1 1 ""'w-.qx,? 5 .si . , X ff '-., ' ww X ' . X5 ff ?Q 'h 1 . MN e 'Wg tm. Syqgix, Ev "' wsu , S I Q f? V ? , it " ' -ww w , - 'W' N f..ii:Ee:Z,. I A A: ' " 'Dx WZ? 'Tk 3,5 3 L 1 H ' H --A-v Q , 5 img- S ' Q - 1, - ' ,,.,Mm, , Ven W - - 1 U V 3 ..N....,.-A . . - Q ' J? 3 T X . , Q4 N 'Q K Ai: ?' 5 K Q , H' Q - 1--my 'smnnmnpgu W 'Q "1 I as ' ' In H 52 wel V , ...A 1 LQQIQ it f In A Ag. :ZI . ..Q - i : -V ' .. 43" , .VQ' :va ,., , ,:. ,, . N Wm 'mm ' N' i'r"'ll A ' W M A! 2 A' an i 'E 'QQ' hfwwiia E. --any-155' ms am M , A 1 'Y 'V V V g 'wwKvgmvmw.m'P4 Awg Q55-v'yfyv,,c ' fm ww: Y! ii' 'f Y '53 - A h- ,mf 4 wfm wW W,Wf QLMMWWWMW , , ,,,.,.,.3'fw"q" . ,. ,M ,,.. ' ' 5 Y ,,g- . , . jr , . - , 'Q 7 ',.....-.1 V Pi I' ' f ,, . -5 V , ,-.-. . ' 'gif ,. ' ..- 9 1 f ' 'fv f.2:gf:g.f.g, 1--.f , Q.-:s'::g.-,e .-,'g f .W '-vw U Z.. L, 3?-q , '-"1 -' ' V , ' V 3Y-?:.,',Z'- V. .f ' " '4 'mf ' 4 -'f"W-Am V - "" " Q - 'I , ' P -,-gli '21 ' ' Q, M ' K " 'H' - ' Q- , , ""1 1-v' " ,wi f- .. ,, 'Tw 3. -' , ,, 4:-5 v- ' ' 1 affgifgwsiv-ff:1f1ff'- ' ' 1-- ' W-:Y A' In 'Q .31 V a4..,. . ,. F: l, ,U v,,::P:,v Z: .,,.. .,..,, I ,.... . J V :N A A ky IV, , A . Sammy, ,M , I M r jghlmv- ug JK Q . 'rfly fi ,.,.- f -. m' 'vii' Four years, four pages to tell the story, A fleeting glimpse, a memory impinging on our consciousness. How best to relate the story of our college experiences-so different, so individual? How best to recall the searching, the seeking, the striving? We do not know. We can only try try and hope. We can hope, in some small way, to capture the meaning, the value, the essence of time spent at Washington Square. Words, ideas, feelings commingle-and another Senior Story is written . . . v ll! Wa. x QTL N so' AW 'Nice HY glorify the Class of V 1952? It is only now past that we have emerged as a unit in the records. Before we were 7 l I y x is , le I ' bv . commencement CXCYCISCS o ' , 5 'W o O Q 9 . ' K ' 0 , WC ' not a unified grou-p' were individual students-some with a purpose, others with none. And we are no longer students-most of us. The Class of 1952, as such, will exist in the future as an expedient. "Oh, you're a graduate of NYU. What class?" Your answer will be a simplification of four years, of three-and-a-half, of three-years spent not as a mem- ber of a Class but of a small group in Commons, on Third Floor South, in the first subway car. There was no Class of 1952 in Chateau, "Chock,', Tilli's. There were merely pre-meds, English majors, music students- eating together because they understood one another's complaints, because they were free the same hour. Each of us can cite other reasons for having banded together in certain spots at certain times. But not one of those motives will bring the Class of '52 to the fore. It has not existed until now! And yet it has been the traditional function of this section of the Yearbook to glibly in- corporate a few hundred individuals into a nonentity and to attribute each special event to the binding power of that nonentity. Reason, you have bowed to senti- mentality. We will nod to sentiment-because three or four years of our lives deserve more than a cynical shrug-and be- cause a cynical shrug is too often a weak substitute for an inadequate explanation. Still, the number of years and the nonappealing qualities of cynicism do not necessarily leave sentiment as the only alternative. We might be realistic-or we might be bitter and complain that our years spent at NYU were not as prohtable as we had hoped. But we must keep in mind that hope requires positive action in order to be realized. And there is only negative action in complaint, in rancor, in criticism. The fault, if it exists, lies in ourselves. As for realism-its greatest value is in objectifying misdirected idealisms-revealing the truth behind them. Realism varies with the individual-the responsibilities it de- mands are personal-the responses we give are distinct. There are other choices, to be sure. We might don the sophisticates' garb and pretend that it all doesn't mat- ter, really. But it does. All of us knew, inwardly, that it was our duty to grow up. Some forgot or couldn't find the time. Those who did mature will remember the sig- nificant stages-perhaps with remorse, for it is often characteristic of young people to run in circles around a square until, suddenly, its four sides enclose them. And here is where sentiment enters the picture-when we attempt to extend the metaphor of maturity by likening those four sides to four years. On the surface it 'is nothing but sentiment-but pierce the surface and surprisingly enough the square takes on definite dimen- sions. We can examine our college years now, only in terms of what has 'happened to us since. Our Freshman apprehension at thinking out had mellowed into calm quiet. or gentle despair by the time we were Seniors. The af A Jgl Il gs-44' an Q 1, 1 I Q 4 Xw via 'Ill University, as catalytic agent, had a continuing effect upon us which directed our growth during the time we spent at school. Conditioned by the passing years, we shall continue to reflect, with a variety of emotions, about the events that shaped and molded our course at NYU. As Frosh, we became part of a system. Our different responses to this system were evident in our varied modes of dress, of behavior. Wearing white buck shoes, grey flannels, rep ties, sweaters, some tried to simulate the dress of campus colleges, while others maintained the dignified, business garb of the City. Diifidently, at first, some of us sought out the clubs, publications, political offices. Yet others were content to hurry home after the last class, and many hastened to their jobs each afternoon. Commons, the lounges, the subway, or per- haps the front of Main became familiar meeting places. There was the thrill of cutting our first class and, soon, of being an upper-Frosh. By the Sophomore year, our routine was established. Being left to our own resources was a new and pleasant feeling for most of us. We studied, we crammed, we borrowed notes. The required courses were being dis- posed of. Many of us found time for fun, too, or we made the time. There were dances in the Green Room and at the uptown hotels. There were dates with new friends from school, or "trips" to the Village, or maybe we just continued on with our previously-formed groups. Somehow, though, a new perspective was be- ginning to order our ideas and actions, whether we realized it or not. The world began to beckon in our Junior year. Grad- uate school requirements added extra hours to the study time of many, the jobs we held became important links to future opportunities. Friendships passed, continued, new ones were formed, as the specialized courses we took put us into more varied classes. The challenge of our growth made many of us aware of new aspects in our physical surroundings. Pride and humility commingled. This ambivalent feeling was described as school spirit, or lack of school spirit, depending on our individual proclivities. A job, graduate school, marriage, the armed forces- these terms were on our lips and in our minds a good deal of the time during our Senior year-consciously or otherwise. The uncertainty of the future for most of us was all too evident in our thoughts and actions. We laughed, cried, joked, harangued-and we all pondered, we all worried. We worked hard and we took it easy by turns, we' were skeptical, optimistic, cynical, pessi- mistic, happy, sad. We felt the need for expression of our individuality, but we could not always End the form for that expression to take. The future called to us, but we were almost afraid to answer. Many of us have answered now, or are still answer- ing, some are questioning yet, and will always question. What matters most of all is that we should have de- veloped and -retained the ability to articulate our ques- tions and answers, and that we remember the questions we must try to answer. AROUND THLV JQUAQE X. ., Q., The hinterlands of Washington Square Park served as the necessary touch of greenery for those p us life. It was here that we came out of t the world was also inhabited by erfectionists who insisted upon camp our ivory towers to realize 'tha organ grinders, errant babies, shoeshine men, and would-be Crusaders ........................... .........,....... , . . And s a brave bunch ready to spea mg deflect from the ranks of the regulars, who frequented such examples of cafe society as Chateau, College Corner, Mother Hubbard's, k' of Crusaders, there was alway d to try all twenty-eight flavors and Eddie's Aurora. They wante at Howard ,lohnsou's in the Village ............... "'.g.,, l 'Wi' ,sa fa iw -ng "F After we feasted at our favorite eatery, we flitted, . some to study, some not to study. Those choosing the latter path usually found themselves at fraternity houses, Where pledgees, paddles., and other remains of Greek culture added to a liberal education. Others stood in line at Judson to get tickets for doings in the , world of sportsg be it football, basketball or track .......... Then, armed with a wallet bulging with tickets, borrowed AA cards, and money belonging to a dozen 2:5 - 1:5394 'A " A f,"Qf'af'tr. V different friends, we half-timed it back to the "front of KMain" where, draped on the steps, eager idlers, cutters, and fresh air ii' enthusiasts waited for their share of the booty .............. besides being the main entrance to the Main Building, the "front of Main" was where we lounged, studied, and romanced. Every hour we streamed out of its doors to Hood the immediate area, and it was only at dusk that we deserted the "front of Main" for the manifold haunts that beckoned to us ............ For many years scenes around the Square didn't change . . i i h N much until, suddenly, new buildings mushroomed. T ,e New 2,1 York University Law School rose to join itsiolder qneig - This also becameie hbors ofbbridlggf W shin ton Square South and limestone along - a g, , Y . r , 4 K H he Catholic Center which was opened early in Y A' the new address for t February. . . ,.................. . . . . .,..........................AndNnoWbeforeleaving1 the Square, let's pass: the lines at the Bookstore, Ji wave to the kids who remain, nod to Garibaldi, and swing, out rner the wisdorn that has never died." through the Arch to "ga Mwf A W2 4 A . fivsaiw l 'il Z E-llwylll ,Q ,U v-- Q V 5, - . NS W- , Q i 'frTffN42iff2 2 . ' , - . J- , if N, 3 f"4:!'!"7 if '11, 55- so 3 f ' iz ,Eg 41 .gm Ms fr Y' is we 'Yi wi 'X 'kwa A1953 W " is I 0' ya., 48355, 25 'TSM Q Q wiv! if LL Q VR 5 . . .1 V-f""kf ,,.e -1 ,- Q 93535 3 i . 1' QIWX fra rf? , , iw . ' 2' 1 lf' vi f N f N fs" 'Pa X 5 tw M 4 ww X Q Kiwi an .-15 " F 'Z 1 +1 we S ' " ' 'A' ff bmi? lg N l' if 1 4- ' ,Ji .f- '. in-, ..:a-1'11s.fg ' V .-, 5 4225 f- - 1 V, .vi 4'-4-Y.: :- ,.::' 'as' -JV, I, :jf . W 1. A , . . , -f'- fm V , , af ' ' ' ff'-um m , ,?'h,,,j,... V., W I H Y' , 3 K qs -54 ,Z Z.. , '- -vw tl ' 5' ' T' Y 'il ' 'W' .E2f"' ' ' .- ' " " ,. .,'- l ' ' ' ff",-sawed-5 :,12w'.':'f:-1- 1- Q Q-.-.M -,.. gag' "'-f -'4u1, 1 ' .. I ' ' .' H f 2 22 , . , 2 LH- ifzlg if Zzhf - jgfw :fig H - QM .- 1 1 V 1 I, - MNv,.,y17GM'7.f',ff?4- gif Q.-' ,5v9gYf"'jgggr-f.rv34gEgJ2-fif. iiasiiaiaaiiv Elgar xr ' 1 " 3-davit. 2 X wiQgj5ff, -s. -iz: u-'Shag -4 1 6 2 ' , "-fn g,.xw ,M .,,1 '-may 3251? .zwsfl-2',g,:.v,1,a.,.f,,g,i-,':,.,2?z.:ff-Qaw., If f 'L ' ' ' K ' 'A ff r iff? " 1-ii' ' 5: Y J.,7,,,a, ,i V., X -A.. f ,,..,.R B, V. tiki 'fied ' r .. , I tug . . . , Wall?-za. Vw, .,.,, -,ik A x 'ln ,M -Q 'GH Y UI N Ugg Bo 5 I! ' EAST SYDEJ lvvfsff Su: -Xi, s E35 K 4 EU ug Ugg in VE. ' 3 U U lg E U i! l Eg U ' Fx. DH U UEIJEP I C U DU I U H D UD A, J 15 H A 1, Ng n UU E' u I1 4 U U j , Q U UUU r--- X E U Du N DU un 'mn U U T Jn U 4 W, , A ,I L V It XM ,,, '? xx ' B ' . f , 1A,A J D ' f' K , I , V'xV m 3 ' wf- "',' ,iw ,V " 2 'f'f.g:Rg.f.' , 31,-'K ' M 1' U ,Q f ,ff ' X -ff 1-1 rv? I U U . XV ",V ' 2 D N 4, H 'A'- --- U D .U D X U U U U ' xx Cl I3 , D lj U A L U I 315 "-Eff ' X V l I-.ff"xiw-L 1 1 X In g r U v i U ' rx . - ! D , 5- 9 UMD CLEAN - x x: N " I GQ.. H 3 may gg , . . - 1 - ' X' -- 3,5 gl 4 ' fb! 1, f 4 O 0 b X l I ' 1, - F5 fl Y - A- "1" - -, A, -42+ -1 '-1a.d, ffh V 5447-5 fYYN 'VVY55'AfhAn,A fi? 1 gy J. f 4' qnfx , ,T UND THE ARC Eff! 32315 2 UU U + 'KX Gunn UQ Mjjfgk ciqgz ing Hum? UD U I D Aff C m U DU bu 'Me eacnee ianen in a eoiieae in academic and Zneineee maiiew ie one inai neede eawefnl enawiinadnaneageezinanci, Seaiecfdemnafine aeiiemznennmnaznnzaeafgiaiagananiai afzeinemenwnaenafufeclineeacneeafine 70aeninaZan Sgnane Zaiiege and amaotned ine wan fan can fam neaze, Samezfimeecaeeaafdzefmioanaafminie- main anin Zn eanina, "Web ine man afna , . . " Keeaaee we eanlci noi zememlm nie name. we zememlezeaf ina!! time nad io de eame man in ,iii ann: ybi 70 :ie nnnnnemnzwa cien- eeiaee,afnaafiiiine7bd'afaenaiaeinf,eaniani ae new ine 7215 mae clone--and it wad afwane eapadin afane. 74-we gniezi efficient men aiiiina Zeninaf ineca afeeae--we naue mei mana of tnem,ae afeane, ae gfiaae aeiuieoze. 14nd fan ine mann we did not meet'--men mia fzemaineel in ine Zaengfionnaf, cane aaa: ia it ina! zegnizemenie wwe mei ana! zfaene aeeanmiiened--ace enaii nal Z4-em eiliez, Acting Dean Palmer H. Graham 1 8 I Dean Thomas Clark Pollock ANDRE A. BEAUMONT, Pl-LD. Chairman of the Student Affairs Committee PAUL EDWARD CULLEY, A.M, Chairman ofthe Committee on Recommendations to Ilfedical and Dental Schools ...fAmg.fva 2' 'Wg x, t ADMI I LIONEL I. CASSON, PH.D. F acultx' Treasurer HOWARD HUNTER DUNBAR, PH.D. FRANK HOW'LAND MCCLOSKEY, P Director of Admissions Associate Dean ,ag da.. H FW X..'-.'-1 "iF'! -1-N, M-"f'5f",11fW5.i7 . ff, A ' ' 192 1 : w : i?11w'ii'i" - ' A ' 'M ,I-VE " -' 1 J qI4f,,,,,6-f'56i,- A W rw " fa-' "' ,Q yw. Q-,ff RATORS Dl7HOTHY MCSPARRAN ARNOLD, A.B. MORLEY AYEARST, Pl-1.D. Dean of Women Director of Evening Studies i KENNETH NEWTON MCKEE, PH.D. ROBERT BRUCE Dow, PH.D. ARTHUR MARSTON CROSMAN, PR.D. Assistant Dean Assistant Director of Admissions Chairman of the Advisement Council PROFESSOR ARTHUR CROSMAN Listen to Professor Culley! Chairman of the Advisement Council The Advisory Center Constantly striving after that elusive entity known as Nmaturityf' students at Washing ton Square College have always had a group of understanding men and women to help then in their quest. Working under the assumption that an advisor helps best those who hell themselves, the members of the Advisory Center tried to instill mature responsibility i1 every student, help him to make independent decisions, and aid him in looking at life objec tively. Counsellors, instructors, friends-the advisors carried on the dual official function of checking class choices at registration time and guiding course selections. ADVISORY CENTER "Now if I were you H Unoflicially, but also important, the group gave the inquiring student advice on choosing a career, on dating and marriage, and on other personal problems which arise during that "growing up" period-college years- The Advisory Center, directed by Professor Crosman, was established in 1938. Chief in its administration this year were the deans of the College, Professor Dunbar, Director of Admissions, Professor Ayearst, Director of Evening Studies, Professor Culley, Chairman of the Committee on Recommendations to Medical and Dental Schools, and the corps of eighteen student advisors who worked in 306 Main. Gripe though he may, the student is forever indebted to his advisor for years of friend- ship, of service, and of guidance toward adulthood. Professors Crosman and Skinner BIOLOGY DEPARTMENT This year the Biology Department, under the direction of Professor Charipper, gave a series of lectures for honor students at Bronx High School of Science. Individual members of the department were en- gaged in a research project on the inHuence of endocrine mechanisms as factors determining the constitution of the blood. PHYSICS DEPARTMENT Under the direction of Dr. Shamos, graduate students in the Phys- ics Department carried out experimental work on cosmic rays, with basic research being done in the laboratory. Work was also started in the fields of microwaves and nuclear physics by other members of the departmental faculty. PROFESSOR HARRY A. C1-IARxPPER PROFESSOR CAREL VAN DER MERWE ,fr RQ PROFESSOR GEORGE M. MURPHY PROFESSOR BROOKS F. ELLIS CHEMISTRY DEPARTMENT Professor Murphy, chairman of the Chemistry Department, wrote a series of articles entitled "National Nuclear Energy Series" for the Atomic Energy Commission, while Professors Vance and King each received government contracts from the AEC for work on processes of crystallization and processes of corrosion respectively. GEOLOGY DEPARTMENT Professor Brooks F. Ellis, head of the Geology Department, worked at the American Museum, studying the life habits of various plant and animal forms, to be applied in the detection of submerged oil fields. Again this season, Dr. Walthier took a group of students to Labrador to work for a mining organization. PROFESSOR EMANU EL STEIN ECONOMICS DEPARTMENT t Projects for the Economics Department this year included the de- velopment of a new elementary text book and the introduction of bi- weekly seminars. Professor Stein, who also devotes time to the Re- gional Wage Stabilization Board, was elected departmental chairman. PROFESSOR ALEXANDER BALTZLY HISTORY DEPARTMENT l A new course, "Men and Ideasf' may he taken as an alternative to History I-2, Professor Baltzly, chairman of the department, an- nounced. Professor Salomone spent the year in Italy studying the political and economic effects on that country of the post-Renaissance period. PROFESSOR RAY F. HARVEY GOVERNMENT DEPARTMENT Professor Harvey, chairman, cited the expanded and coordinated pre-law program, the newly prepared social science studies program, the Russian government courses, and, in general, the enthusiastic tenor of the staff as evidence of increasing activity in the department. r N la PROFESSOR ERNST Rosa GERMAN DEPARTMENT This year's agenda was highlighted by the unveiling of Professor Rabeis new painting, Christ In Gethsemane. Chairman Rose announced the winner ofthe Rose-Schuchard scholarship, determined by perform- ance in a competitive essay contest on "Schiller-Poet of Freedom." PROFESSOR FREDERIC ERNST FRENCH DEPARTMENT ENGLISH Adding a new course in romantic poetry, the French Department, under the leadership of Professor Ernst, exceeded its own expectations in student enrollment. Professor Pauline Taylor, author and lecturer, was the recipient of a Fullbright Scholarship. PROFESSOR OSCAR CARGILL DEPARTMENT Professor Cordon Ray of Illinois was invited to WSC as the first recipient of the Berg Professorship. Among the many books published by department members this year were a poetry anthology edited by Professors Jameson and Rosenthal and a Blake primer by Professor White. I 5' . yu . -5 V V fn l 5 PROFESSOR ARLEIGH B. WILLIAMSON I SPEECH DEPARTMENT After more than twenty-five years as chairman, Professor William- son took his first sabbatical, leaving the department in the capable hands of Professor Fritz. Professor I-Iampton's drama classes pre- sented two programs in the Green Room. SPANISH - PORTUGUESE DEPARTMENT With the granting of two study fellowships at the University of Mexico, the department, under the chairmanship of Professor del Rio, passed another milestone in its efforts to Offer the student a practical application of the language studied. PROFESSOR ANGEL DEL RIO i Although the Italian Department, under the chairmanship of Pro- A fessor Ernst, was one of our smallest departments, it occupied an im- portant place in the curriculum of those WSC students majoring in romance languages. Professor Brussaly was adviser to the Italian Club. PROFESSOR FREDERIC ERNST l 1 I l I l l J Pnomssson PHILIP JAMES USIC DEPARTME T The WSC Chorus and Orchestra gave 'three concerts this past sea- son under the baton of Dr. Frederick Kurzweil. The department, led by Professor James, participated in the American Music Festival radio program which broadcast original compositions by WSC students. I T PROFESSOR l5l. W. JANsoN A new oflice in the Main Building and a new studio at 12 Univer- sity Place helped increase interest in the Fine Arts Department. The Warburg Institute published Chairman ,lanson's latest book, Apes and Ape Lore in lhe Iwiddle Ages and Renaissance. LASSICS DEPARTME T " , Professor Johnson's Classics Department continued to stimulate interest in Latin among high school students through the annual Baird Memorial Latin Contest. A Guggenheim Fellowship for re- search on maritime commerce in the ancient world was awarded to Professor Casson. Puoi-'sssou jo'rnA xx Jon Nsow ,aww-,1-aw., W w:11e-11:1-- 1 .s 1 . .11 ' - - .- 2.4 . N , 1.1.1 .11 . . +-:ess 1. 1' z -1 1 2' ' , -ff " ...wig "li-:E' '-:Ai ' " ' " " ' 1 - .- 1. W A1 H 1,.w .1 1' 1 W 111' 1' .Z -511--.11 1 M- . 1- 3113143321-153 . 1 515' ., L' , ' , .11-,js I 1. a 1 or 4- . . 41 i ' . 11 .,-11s131.+1fQ1. .1 'X ati: 11" 1:1 1 11 ' "'-E i? 11. -1-sep.,-1-4'f i. aa' :ga-. 1 .-: gs ' t.1v1.:1.:s:-2:f:f1z11a:wb wma 1 11, 1 1- 1. 1, W , .-1-1 1- ,1.:a-:afr".w1'..:e:1.f1-:.-1-11:41. 9, :ef ww- gf If - 1, as-an 1... 1,1 1-- , 1 as-1: ,-ffs1f.i:gg1g32W1 w'fi'SEIL. .11 1, 1, 1, .::21.af1.-31: 1111511-n a.: ' -11 ,..:s2111, .- .-4-.S 1 1 ----1 I - 1 1- 1 1 M 9 f 1111 11 M1114-1:-3-'ff'f' '-:fa-1-..-.1.3 ?- WW .... ,,.,.-1.1 11 1. ,f Qt? I V11 f 1 -x'- A 1 ., . 4-' sf ' Z! 4 .4 1 .it 1 . Q 4 Y 1 f w. 1 M I 1 1 f ' X 1 25, 1-4 a .,-.- - f,.,.g1,y1 K fax, tg 1111 :ff ' s ul S .1 , , 1 qi , 1 , 11. .,-, in-11. 1.1 -az gym: . 1 1111. 2511, :gaa i iis ms- 1, ..,..f-:ara ' ' 1'1s:S:i5 1 1115 72 -1.1zffik15' wa.. I y My 1 , 1.11. a . . -. ,,.? .. X.. 44. .1. . J ,B f 11 11111 1 121 gr- 1 ssafesf 1s 11a1'1111111f1'111s 1 - 1: 1 :1'1'1 ? 121 M 8 . 1 11p11am:..'111:.. -111111111 11: 1. 1s11 11 5.1 '1-11L:1a::i:21s 4,4 s A ,, 'xv-11:51 s e: 1 1111.1 .1- 41111 11111 1 111 .-1-1-.:.efm:1:c1-11-1-:. . 1 ':111 15i"fg2j1' i121Fl11 1 1 11-3 ,Q 1 111 :1 11 31 ' ,:-Sf! ' r E311 fl. 5 s f .11 4 A P, . . . 1 ls 342, 5 - - A - sa m ma y .1 vi W - 1 " sf - 1- ,rf f. 1 ygqgiit-431-f-w.4' as 11 U: -. v-I' .i 4 lf' 82 "ff':'z7X9 V1.3 .. '- ffl fy J 4' 111. " ' , .11 S1 6 1 aa:::5f:- 5 ff Q, 1174? 2 .1 . f if . 1. .. 1, 1 1 .1 . 1 i. ,fyf 1. f2w3eq.w,...1. ,.,.1..m.- .vim-,W-.1. .. , A 1. , . 1. 1 1.1. .1 1 , ,-1.,. .0 1f..- . ......1.., ...1....1:.,.. W. A' . . ff ,5? g'.wa,m - H1 11 'Q 1 'NYM 4 'YQ -1 F 4 E 1 1153 Qfxj 4 s , A 4 4 , f' ' as X ' -E1 if - 1 1 ' 1' j f r- ' C1-i1:z:"E1:,t , ' 3 11 11 111151521 ' ' 2: 'ft' 1-.2 f l-'1 111:11f"'11: "1-'f "' Y' 4 -Gif i:bL"'2f5f'.'7?'I FI "f25.:.5:' 3-1 ,:1'1 , ,.1j::'ir5Lj f'f':"f. fit.. " '2.5.: H 11 0 1:12,-.11-ff 1 fi'-:sa14-fa. 1.11, S5 5 -, - f 3-as-11' 11 1 :su ' ' 2 'ffiif 4 if pig 1 3 1 Q ' 5 3' 1 11 1, H s 1-' 1- -1:-a.11aa1f2f.:i.'s-1 '1 . ' H ' . . 1 - .2 ..f1.,1.1.z1e,- ,?2m,111.yf1 .. .- I 1 i1 . wifi .wazf1'a:1f1s.f2za.1-1:21511' .- cf i Q 1:..v I .31 .1 I V ? fa? . 'L 1rE54z2Z2'2'.. .fe' - ' , rx, 432: f f ' , ia , 5 1.552 1' -. 1.11 1 ' 1:11-121-'H'-4154 z f ,:. 41'-1 - 1:fw:1u--4 N Ki-1 1- 3:11, 1 1 11' r 5 gg 551 1' f 31111 5 5 . ,S 3 35515 - ---1 A ' ai if W 92 -' 1 - 12111 'f' Nm 1, ' J V If 'M' f 'we .4 4' if xfy? begs , 9 1., Q f-'fri' 1i."1':1v K A ,vfw , - it-1" Mag , PROFESSOR FREDERICK WALLACE JOHN 34,4 T153 PROFESSOR SIDNEY HOOR MATHEMATICS DEPARTMENT Professor John, chairman of the department, announced that a new curriculum which will emphasize the cultural aspects of mathe- matics is to he formed along the lines of the Math 3-4 course. Professor Klein headed an Air Force project in electromagnetic theory. MOTION PICTURES DEPARTMENT Under the chairmanship of Professor Gessner, the Motion Pictures Department celebrated its tenth anniversary. Olfering the only four- year college motion pictures program anywhere, plans were formulated this year for expansion into the television field. PROFESSOR ROBERT JOSEPH IJESSNER PHILOSOPHY DEPARTMENT This year the department gained additional prestige through its chairman, Professor Sidney Hook, who headed the Democracy Peace Conference, attended the Congress for Cultural Freedom, and wrote several thought-provoking articles for The New York Times. v .1 . A I I if ii' P ' gp Q f . l Pnorx-gsson L1-:LAND Wuirmav CH,u'Ts SYCHOLOGY DEPARTMENT Members of the Psychology Department, under the direction of Professor Crafts, engaged in an extensive program of basic research. Professors Hanna, Brown, and Karlin studied space perception, learn- ing power, and reaction speeds respectively. ADIO DEPARTMENT Professor Emerson revised the program of the Radio Department to include courses in the techniques needed for the operation of video 5 equipment. Department members took an active part in the all- metropolitan Career Clinic for Radio and Television. Puorasson ROBERT S. Emansofv OCIOLOGY-ANTHROPOLOGY DEPARTMENT To the literature in the field of juvenile delinquency, Professor Tappan added his book,'Contemporary Correction. Mr. Thurston, also of the department headed by Professor Chamberlain, prepared a thesis based on his visit to a Mexican industrial area. PROFESSOR LUCY CHAMBEHLMN :ff--xg - . W , . A K . I Q 7 .- f 51 S :ff fi 1 V ---s ., , d il!'sQVgr:f1:2"ff'f,r1?12:22,'33,-"w5rxif,.5 ' A ' 'H . Va-.g q '95-:ggi . . , fgqfg fl . ,Y . ,, , , 1 Wiki? -' 1 - ' A I gif- I. 3 ig. 1 z., -cqSf.4': f , .Lf A V. A-1,1 5 3 f. 2-V .X cg, 7:1 - I-, L PROFESSOR FREDERICK WALLACE JOHN MATHEMATICS DEPARTMENT Professor John, chairman of the department, announced that a new curriculum which will emphasize the cultural aspects of mathe- matics is to be formed along the lines of the Math 3-4 course. Professor Klein headed an Air Force project in electromagnetic theory. MOTION PICTURES DEPARTMENT Under the -chairmanship of Professor Gessner, the Motion Pictures Department celebrated its tenth anniversary. Offering the only four- year college motion pictures program anywhere, plans were formulated this year for expansion into the television field. PROFESSOR ROBERT JOSEPH GESSNER PHILOSOPHY DEPARTMENT This year the department gained additional prestige through its chairman, Professor Sidney Hook, who headed the Democracy Peace Conference, attended the Congress for Cultural Freedom, and wrote several thought-provoking articles for The New York Times. PROFESSOR SIDNEY Hoon L . 1, 5 .5 Mi i' . T' Q I . Paonssson LELAND NVIIITNEY Cu.-xi-"rs V PSYCHOLOGY DEPARTMENT Members of the Psychology Department, under the direction of Professor Crafts, engaged in an extensive program of basic research. Professors Hanna, Brown, and Karlin studied space perception, learn- ing power, and reaction speeds respectively. 7 5,5 IADIO DEPARTMENT ' Professor Emerson revised the program of the Radio Department W to include courses in the techniques needed for the operation of video A r - at equipment. Department members took an aCt1Ve part in the all- i l 17 metropolitan Career Clinic for Radio and Television. Paoifasson ROBERT S. Emsasom , - - ' ' - fx SOCIOLOGY-ANTHROPOLOGY DEPARTMENT To the literature in the field of juvenile delinquency, Professor Tappan added his book, Contemporary Correction. Mr. Thurston, also i of the department headed by Professor Chamberlain, prepared a i , I thesis based on his visit to a Mexican industrial area. ,. l l w , r PROFESSOR LUCY CHAMBERLAIN W 1 'e l 4 l .f-' "Cl A member of the Washirlgtoll Square College Histpry Department for twenty-seven years, Ray Claflin Bridgeman died in November, - 1951. ,. . gf . .I , Ig' I . I L5 I ,.. 1 p f v A 51.5 mg, A 4 if ' ' '60 1. 3: ,J 3, L . , +L ' .V ., . 1,--5 .1 .' G L P - - 5 na-122' : M ..--, . :M , . ,. ZA :V K 1 7 P' ta f . . .fi ,. K 1 ff 'Gr l ' . ,Q ff2?Q,1 4, O 1 , n S 9. X1 . 'Qc an nw 5 4 J ' a 7 'N 5' 943 Q ll s.' qi? N lf, -A I., 1 X"'.'. 9 .NJ Zwrs. Dora W'illl10r, instructor in the Cfullcgrfs flllllllll Dcpartlmlll and an active participant in German Club czvtzvttus dur! Ln Sfp 11 Pliillfiillii K QI 'z X 'lp I1 vol -fm.. F L U fum ii ' As I. Tig.. . AEVQUVND THE T0 ,Q-- r , 'V -, IV. flfi A 1 .I 4 ,..:..V- V V I. - Yr 1 WL i,,,9 9 ' K lir uf ir J' I V '-ff' V ,, VI 134 , ...JV up I N 'I 1 E- ly mr J' , 1 . .r . 4' 5' VV P I ,. ' 3 f 'V 4- T. 'rw' , J L15 .VI -,: ' . V r-,.. . , .V '-V ,. r- 'rl- 'rl P45 -' E" '-" V.. 'r V. fi.:- I V V J' 1.V r' VU lu." V' V V lc , -. ' .IVE Ziff 29,1 B. UU N 5' KV. ? - L... A V Q V , -V, V V .. v,..- fm , V ,,,, 1 59 , U . ' +1-- V5-,J ,.. ' V M ,1 TV: ' .11-: V Q E 0 - ' ' J L . 14 . 1, '.V.V'1.,f-ii. . , V :V .sg-in . .., F' "--,. " I 2 Q. 5 I ' 1' 'J .1 V 3 if pk? -. ' V . H1 . -U V VK -'TV-. .": ff. I ',f.. . 1. . . . , ,M V .. , , A , .. , Q ,, , A , A M . WV CV.-. V -4' VVVVH- - -MV - ..V H r. 5'V""., ' V .. V. V:VVV air' V V 'V' 1 511'-viv'1?"'t-g f' ' VI 1 Q.. V,,.-E-Q V V' V " , V- I . ' . ' 1051. T. J' 2-2 1. "kill, ' ' Q-nga... VV - 'E:55 NV .- -. V V ' V - ' . ' , - ' as --- Vw: ' , V V V 'V 4: "" 1... V ,. ."'T" ". L . . '4f. :1.'V.j'5' rg., "V-- rg Vi git- L ., .. 'iV1'.- 'W' " V V A ' -ai -.fu -V' V Sf- L 1 - "'.,. :,F5H5kV:V-Efgfimha 9MV'Sif 'f" 'ff- Vf f V ' ' . V .-P. V .. ' . V' 'fn ' f f-' '-'Affair , ' ,V V Lf 1' ' V . - -' 'V ' .. ar: ':..' . -V 1.95 I - V , Pr'.::",1f.....,1 ,,, Va- 'V 5-VS V V L.j "' y,Vf ,V : 'V ,g. 'V r , - +:5 ., 1 .p f ' .r V'-j' .,,,. af: " '1' " 1',..,.sf-,f,,::'Vf1'jr. 'V x ,-V, 51? VRF' .' 5, - - V - ' Q . -V gm, "'! V51 ,l'.1-- : ggi fw " ..,,W, 'E i f , ., LV' , 9 Fi. - V ., " V' ' V' VA' ' ""-5 V .1 " 'W T- 1m3"H ?"L ' 'FR V . E ' ': .. 1' . ' "An" . f?'77'ff -.,T"fl3.'e':' f f- ?2?.VV4V.1E':-V? -.ll! . IVV? -4 V. VV V . ' V 1 521 f '7 V' .. ' .' ff? .FEV -.4 'V :VQEQM an-. ., , X 151' V. ' . " ' V 1 V 1 ' . V' V ' VV :V V- - Lg. V V V- mv ' V "" .ff . It 3"L?'l ' ' f X 2453-ET'LVKlf ' A l 3511 ET ... iff Qi' ' ?7:.VVffV V' 'fF'iVe"' 'V, fi- - L-' YV V V ' T - . V ' ' VJ " - V. V' ' V .V:.V ' 2 " , -' " in -'. ' L' - " V" FL- 3' B- .' Tl "". Q . -.V E V 41 ' -'Vf.+39"'2 V :::::::::"' QT? . ---- V- V- 'Vffw ,555 7' 'xr . V V Lf V, V V .FY ,' ,.,1 V S. ,iv Y Im . .'.g,LJ, gxgggm, ' 1 NRE, ' -.'zL,gVV 3,24 1' " ' "-.V .- QQ' V " V , ' . A - V . V- -' . V' f , -'CF - VV' ,.fifVfT'V ' fy, A ,. 34... 51- 2 ff :1 -.1 27? "Q 4 ' 2 -V J " .V n m- V .QV V. V.:--Eb .. .M"Va V, V 1".r. ' . .a V"""' . Ev: Vf"Qk -Eg.,V V.. V V . j.. 'L 'VE' PT ' 1-',- if ,.a. VL' g, :fir-2 V , :' al .Q . fi ' V jVF..' E'ufgV.' I L 5' ,- V - J H, . 1. J TEQE1' fjiie' . 5 9 3. . ggi. A . " " ' ' A .. , ' ' :Zi IV- V.g, Lg..VV 115 "lengt: 2. 'Qffi -' -J. .:'1'V.'I. V?5.,.,qf VV.: ,:. V , 'VZ' "T.?' , :I -'Lg jf JV V.V. :rg A E 'A ,Ljj .LL 31 If..E::'1'2':i-Lil.-V.f,f' V ., qui VIZ: . -V V --11' Vp ' . . 5 H . ,V J V, V, ' 4.4. ,L 1. .z... .. V' 'f' ,: 1 ..,. ,. V , . QZVV. V -"if HVf4.1V2V., V.V'i:: .V 1' 7' .5 15.1 N ,..., , Y . 1,2 ,41 1 ' -fe: e-' " gr' ,gf 1.-...aaa-7 .VV .iiafjgxgr4gVV..pV.,2'. ' A?,f?fQ',Q:'.', 'Q1'jJ'52ff1'y'ffi2?247Q5,Q':'ZEgfghggj V. V '-, +21 V 1. V I-"-,' - 5' ' .' ',V f ' . -V . gc:--,vw-..:""T'fV:gr' V 1:5 .s2...::.,5, ,f ,VV-,V,VVg ,,A.VgVV4 ..,....- " Q 'V T '-VY ,V I . A " .UZ Y ' I V' V"-V i' --VH? 57 Pi 5' V' 514- FW .iff ..,, 1 . V ?fQVf'lV V .aff V P.-1.1 .V f ' 1 . 2 V V .. - 2 :MV ri. - . ' 4- ' ' V - V V i":fV1"KiVVV. V . 'IVV .EET gpg" We V,V '-:' 'jllr VV l E .ivff 1.12--Vw "' " . V4 V M..-,V .. "if ' g'..VQ:g,gZ3:,3giV ' V ' V- V' 'P . ' V VVV1-V- V V ' - , V V' - - -. V V+ I wi V 'Va '. ' --. V '.-V J Vw- - V " VV1V 'a'!fV.r.. V' V' QV V ,:..r:f.'::. 2-Aw ' -1 z a? Vf "'f'!4Wfv ' V .iff V I VXVV . 7'-Q: -' V. MJ. 'g 1".' ,5 1 V "V'r.' ' L:,.3LiyV,V.,.V .M , 5.,.V , V 41- .- 1, V it 0. 5.1 -:nv1 gj""'i,!'!!. 462: ,. .g V . gwsggsnvg, xii-. ,.V5.gwz'g.,,aQ.V5g 1 .. -' ' VV 34,-:gg-E53.,Vx5fVV5' , V- Q33 .. . . VV . ...- V : V R : Vw- U' . V w ff:-ff V' ' . . -'!'Vi3'V,' -.V 122' Wu V V V V- Vi: V' "16..-mmf-V"V 'g" 'V ' ff- 'Y f fi , 'FM-' " ' Q WMV ' V vga 5521552 5553 uV--1 ,V V s f' Q V. .V'.VVV.-L ,,,13'7r?'. " V MV' ' 'I '.VQ12'Vi ' V it 55' '.iiig,---Vj,g.,,Vn ',: ,.,V. 51:55, 3 Vaiinwvzh ' V, f' ' Y V: ' 'V, .4555 V. VV- 91. V-,.1?5'.V5? 'af V-VTT'1i2g:. -VV --VV H' 2:23:32 ' V V L' ' I Y -' M V. .V -f. I Vkffiaff' 'Nw' ' '-' Ly - f"'g 'ilfgflv' V...-V4.4- Q " ?f5 Ve gh' 'V' 4gVVVVzw .M ' j V-.V s V" V ' ' , . 'IQ-"Vq.:f? -n V' VV ' "-' 2'-'V gf.,-9'-' V. V, if Va' - V '. ,ia V V ' .V V -V' V -- , wif' 1 ' V 1 ' - ,. V V. . V V Gi fghn. ,4....-.1..'V : Y " 7,44-ZQF. -VV 'V Vfkwf 41-gif -V' 11'-1- S V' 'SV' AV'5'.1'f ff," V i . . V , r --f -rd Q .sv ' ' Z ,IV "M 'fV 4.1, :V--V V '. Vx. " 'A:.'1.fV, ' -Erzsitgiffzr-21'-' ' W 'V V 2'-V ' 'V 4,51 Y " I ., .. V", P' QV 1-42-ia VV 5 , ,L .,', 'i' .. Vg5:..V:V::fu:1V?f"f --'VV V ' 1 . . ",,,' , ' 1' I , ng - -' Vg .ri 4 ' J " -' 'V 'V ' , V' T5.'V'S7!l5.??' 5 4-3-3VVV.1i..1..'Y.V V f f'VE'F2V I V1 VV fl 1 Y " . . RV ' A , 7. V ' V--' , 'V 4 A i 'X' ""' " 50114733 5 X-Vx' .NF 7 5- QT." 0 ' GREEN? ,V Q-fav? 'f":'w +V" . vf""Z', V K' 'V'5"" .,, . ,V . -V 4 V, -VVVSVE MV V 'J 2 VV 'mo V V2 V V52 V -'V V. 'VV-.VJEQWVF ' Aw. ...V . V V- VV? " 5 ' 'Vt Q' V519 "' 2 'a,,bd'1'2' 'V t if ' , PfX'f'?'f ' V' ' ff . . ',Vf-5575 ' ', ' Z . , if' " ff ., .. 141' eg !,..V,' E If-'gli :Tahiti 1 " W'- "ffi'q - , V V t 'A 1" H " V V VVQVW-V: V V. w av 5-JRE '- P .. w- . V YV. V V: 2.52.1 T . . . 'V 'f' J f TL Y Z' A ff! V? Q Lygjgfkm -QE , l g V 'MV in .. ,. . , . 13. 1,5 V , Fi U In gk' V '-'-+6141-ff-V1 . V! V -1 .VV V .V .V VV V33-VK VV .V ,YV ' V. , 2-I . V- "VV 'in 1... f- VV.. .gi . V , -. . V. ?y-MVVHMV, . V N V .V :W V -1. ri.. V 5 ' ' ff. 311. -- A V . ,?Vai:,?VfV'1i ' f ' T V 'Li' 'V 1 VV ' V. 4' ' V Vqzri V.V.Z : .., 'V J V. V . " ' . V 4' . . ..V".. -' .V ,'f,VV,.VV V-'V V V - .Q -u V- f. V:"t .V ,V . A ' ' ' -'1- "ft"'V:zZV5'fiVf,,, :V .-V- -V, V,. A .,,,,m...,ZQV. ,- V 'fE'1,g5'+ . ha f V1 .1354 ., - V. gf-'?1!'ggf',",'V2 . .::':: V V , 5 . '-" 5 - ,ag - 69 V" ,V" i.,...qV . ' '- " V VV. 5.1.51 ' ffVff1li'f " V- ' " "'f2?Sl.?. ff! """"- .'V.V':HEfV 31 VK' V ' VUTVQ5- Z-.IV-vw" fI"'?3 2' X, .V if-5? -41 ff 1' iiiViSPS?:?3"V'?VV'n1 x V' 2 V 'ww V V - VV VUV' V. .Vial ..,, -,VV -4. V, ':fV-54 ' p g VQ ,:,r,...VV:V -V V -f' V : ' 'z' ,- .VV,.." ff ':.V,,'.g.i:-,Vg -V5V"V.'1p, 'V- .' "V - - V IVF ' 'W . E Q V' 'V .-V 414 ' ' 4- f,-.VVVV 2 -:fb if -:ff "f""L"'T,. 1 ' VV QT . .,:,:,-Sw! yu, Y L TV .,,V,,,f- 5...f.V5 . A .S ,,. VV, ::0V GM,-S:::l:z. ,h 15, :V :,. g zz.. g 2: afV-tl, , .-,, . . , .. V,.. V , ,.,, , ,..,.,.,, .. .. , .V ...... ..... . .V V-.. .. ., . . ., -if If MV 1' V HV Y Vw... 1' V VV +..,VV,,. :"Vs-1 'f"S.g .1 VVV'g+-mx ' '..,V...VV.-,Q in V ' ,Q 1.1 E Far. S. .VV -V. V 'Qi VL V ,.V 'I gr. - V1 VW 3 J ,-1 .V .1-ii , ' gqq ftizwi. faVsfVV ,. '94 +,V 2 HH- ,VLT-N4-VJ'gLg.f ni' 1 T V V VV V -1 -.2 .vm VV if' 5 :PWS V. V VV ig ' ' , VV.: 'Q ,V V V VV ' -"gy -'V . , , A' A nlyjar .w i :Vw , - ,VIH VV ' . 1' NV SV V ' V VV ' V V ' .M V , V -I :QV W. Vf 1 ,V ' V .Q 3 Va 'V V. f' .., . ' V ' if '. f V 'V 1 VV V V V H V V WV 'V ' V"' .V NV .VA jf' " ' ri , 'sk ,Q a f f: .,V,, X, .i- -,JV Q.f...g5VV.-iV ' g,73, VL . V VSQWW i'g, 51 V?'T",' V-W-1-wvIV"','-V"! ' !Pfg,2f' 'V 'hy V- . V V IVV - TV I mx ' m e Xfywg V, -VV V f VV P" 'VV' ' ..a - -V:a.,..,.-...V 1122 ' f1?'Wr 'f V AV VV f . .VQVVLLZVQV Z -1V , - V: ' ' V V fii. F V V' ,Q V1 "i S ' Q' ,'V Vi 'u S a , ' Q L 'VVVY3 I. EN! I ? I NV-'5 22- i .2V T. Vf 4 1-VV V' i 'V H ' 7'f..V..- V ' V " . ' ' . V. V ' V VVVV A VV '-2 V ,VV-mz.VV-f M:.V.,.V1.--V V.VV' ...eff . . "V" X---2-' . .a 1-. 114. . - a --.V v-.An V. --VV - - .V 45- .- V 1 Q V ,V x. V- -V ...g .V Q, ,- Vw., .,.. . , V V .. .Wk ,V ,.. 3.. . . V.. mu... M . . V5 M gy: N Cl VV. I V, .,i4,VVV.1.! iv .A .,. v X 5' F V V7FVf' VV V'?VV " ' in ' V " D Iii, hp' Au .. V v V V . V. V . I Vp VPVVVVV -,J ,, - U -I x - V V, V 'V -, 11 fzuglijlxlif' VV-. V VV Ell1 ll i7 1 ' Slum - V V T53 3 V f-P H- 1 'Will I Ill 'Uls- V '-.x.V.1Vg.'...:., -- : V .VL in ' ' r'fY"if W ' - 71' pg - ..-fV-:V V- ' .. 1 - V -A - ' V .4 . . Y . ry rp 'I ,pflff YN F! ,1 rvvq fy fy A .. 1 aka, '1' A , YY ,V '25 A ' fix Vi 1 mv. 4 V V' .Q -VPLEYQV Emame ummzmzwcuw camfefeteda aww an Mmm zedazfdamz, ind an mad awed 46644444 may 44U6'!4f5e6f4'1f40'0f,40244764f60f6wdnf4+. '7z'd6da'ZmcwZmw4eZ4m .yaaZ4ZZq4aaedczZSCcwKemZeaanc6Z4ew6an4,wezeaw4ee6aaaaag4da 4amecKuZ,4maaz!4eclmgae44o,aaJnzfaa DS,az72wZ4wea,Zedz'o7et z4e,ea,ewzade4de,4mez4edeadlme,74ew,aMzmzz4mgw44z44z gaupkdgcdyawzmmgqwapazdcufazactdwtqmaodudea. Aamfqmadanig "7fc"mda4Mm:e4m.yamaMfedc4zeam4wfca w94ddmwa70gw44fAzemmgM:mwmzaeW4mWzwm ,azm4d5awWu. ,efecwcuui Same4aw,gaammc!eda9aeczZde4ZZe4464e4awwa,4-4ome- mmdmmtdugaaiadw-acaffmmcweiawgammalkma, Wempmwafpacanmzdewmuaamawawmmdmgwuzie ffz6ugeafZ4ematm64Z5adci4q5qvlaq,mmecZa4m8at4ecenZez,Z4e wwfqwzpamqcdegalmagmmung-Mepmzzdawaudamm Zumaaaftenqaamedi- mtedandlkencamecwwdddedwwidaqawwhdmdalwddaat qaaa1ffm?waJ4c4aoZwoaZai4czae5ecomeaevzqmucZvlZecL74e,e6cZuze waankfgcedtetiatvfdamadfatdlcmtadafqtookliecaucmtedchdaeaf eaezgcme la Qeqk 94649, 144:65 54625 dpccdalahdue, an eww, 465 ofenm7g,gfzewmtaapa7aaZaz4ZZefJaacew6Z4acief6neciZ0n6Zo1q, Waeddnglan Sgmcme Zaflege-ffzamdtezliqaugfzeeamafze 714 into lie elagea of aaladtiaavd MARTIN COLEMAN President TDET Elusive, intangible, undefinable-service to a school is something more than just being elected to an office, just joining a club. Service, then, doesn't mean-it is, or it isnit. Words like "duty," Nobhgationf' "trust', are only what the individual chooses to makelthem represent. A student council only becomes that-a body of individuals chosen to serve by other individuals--when it truly represents the students. "Truly represents"-another term incapable of definition, except by GRACE MCKEAGE individuals, in terms of other individuals. And, therefore, there is no Student Council at WSC. There are only individuals meeting together to voice, to plan, to execute the felt desires of the students. No Student Council? Of course there was a Student Council! The students might have been disinterested, but there was a campaign. The students might have been skeptical, but there was an election. When all the ballots had been checked and tallied, it was announced that candidates from both major parties had been elected, the vote bringing a split ticket to office. Student Council in Session OUNCIL There must have been a Student Council! Hadn't Council reduced he working budgets of the clubs and publications to meet the de- rease in available funds? Bulletin and ALBUM, among others, were iven substantial reductions, causing them to make alterations in rreviously tradition-bound policies. The move to further cut expenses y eliminating the Student Council Dinner, however, met with stub- orn resistance. Finally, led by Martin Coleman. Council president, he majority of the members managed to replace the extravagant inner with a small beer party, held just after the Block Party. listory was made as Bulletin joined in complimenting the members f Council for their decision. Confused and hindered by tangled, unworkable laws, the legislative ody set up a committee to compile a list of all by-laws which were h vogue at Washington Square. Vllith the committee's lindings and ns as a starting point, an attempt was made to achieve results with less effort. NOEL KLEPPEL Comptroller few -.z' Professor Beaumont, Dean Arnold, and Grace llfIcKeage at a Council Meetirzg l l CLIVE DAVIS Vice-Prestdent Point of Clrder Day Org Elections Committee Voting at a Student Council Election LEN WEINGART AND BERNARD KASPER Day Org Social Committee Chairmen Certainly Student Council must have existed! The Music Com- mittee, a project of the more intellectual Councillors, succeeded in making 766 Wlaverly the temporary home of the Council Music Library. With over two hundred dollars' worth of classical records in the collection, investigations were begun to find the records a per- manent room. Another of the numerous investigations revealed that the clocks in the library were running five minutes slow. The Administration was solemnly informed, and timely action was taken. History was re- peated as Bulletin joined in complimenting the members of Council for their decision. Active support was given to the Red Cross Blood Drive and tllfi fund-raising campaign for a new Student Union building. Individual members of Council served on the Student Activities Coordinating Committee, which supervised the latter project. Perhaps the Student Council existed through the work of its Social Committee. Probably more students came into contact with Council activities through this committee than through any other means. Committee Co-Chairmen Leonard Weingart and Bernard Kasper di- rected the season's events, which were highlighted by a Halloween dance at the Hotel Statler and the financially unsuccessful All-U Ball at the Hotel Commodore. When Professor Beaumont announced that his secretary, Mrs. Grace McKeage, was leaving, members of Council joined with other student leaders to sponsor a "Goodbye, Grace" party. Grace, through her wonderful work, her friendliness, guidance, and philosophy. had become an important and respected individual in that organization known as Student Council. Maybe there is an answer to this enigma ofa Council which func- tions but doesn't exist. Perhaps it is that Student Council only emerges as a nomenclature-a title given to a special group of individuals banded together to serve the students-to voice, to plan, to execute the felt desires of the students. The leaders of this group, Student Council, were Martin Coleman, 'presidentg Clive Davis, vice presidentg Leonard Mandelbaum, sec- Ketaryg and Noel Kleppel, Comptroller. FLORENCE MOLINARO I Secretary, Student Affairs Commtttee LEONARD lVlANDEl.BA Um Secretary It llillvl Constitutional I Betty Bell and Leona M ilstein LEAGUE OF WOMEN Under President Leona Milstein, the League of Women sponsored Friday afternoon bridge parties and socials in addition to the usual dances and introductory Freshman teas. The highlight of their pro- gram was a cosmetic demonstration, where even an errant male Bul- letin reporter succeeded in getting a few hints on the application of makeup. ALPHA PHI OMEGA Alpha Phi Omega, the Boy Scout service fraternity, consistently exhibited real school spirit. Not content with conducting tours for freshmen, they inaugurated the idea of the popular Book Exchange for Square students. Under their leadership, an All-U Civil Defense unit and a blood drive were realized. On the lighter side, they gave continued impetus to the famous all-Square Tug-of-War. Alpha Phi Omega F Q I Q .4 F' x QR :qu X ,-Mg.. - iii . MX ,J -J X PETER GIGLIO PAUL SKQK President Secretary SENIOR CLASS In an attempt to improve class participation after a belated school election, President Peter Giglio, Vice President Williani D'Angelo, and Secretary-Treasurer Paul Skok sponsored a Senior Class Christ- mas Party in conjunction with ALBUM. This party was the first of its kind ever held at WSC. Shortly thereafter, examinations came along, and it wasn't until February that activities began again. A Valentine's Day dance was held in the Green Room. More than 250 seniors at- tended this affair, which saw the unmasking of Cupid, portrayed by President Giglio. Working hard to maintain the dignity and position of the Senior Class in Student Council, the class officers, together with Goldie Kerzman and Irving Weiss, Social Committee Co-Chair- men, made preparations for the Senior Weekend at NYU's Lake Sebago camp. Traveling by bus, forty seniors arrived at that winter Spot in time for steak dinners and three days of fun, laughter, and healthful play. The final social event of the year, the Senior Prom, was held in the Starlight Roof of the Waldorf-Astoria Hotel. The Social Committee At the Senior Class Christmas Partx JUNIOR CLASS V jurziorifjlass Ojicers Two O'clock jump one O'clock Jump S 1 J P f s? sf ' ' X ' p Uncle Sam, mercifully, went easy on the ranks of our male Juniors this year. So, with enough men around, things just had to be good. The class started off properly by electing Harvey Leibhaber president, Charlie Mangel vice president, and Ben Lamstein secretary. Together with Social Chairman Al Midoneck, they worked for maximum stu- dent participation. A Junior Council was set up to discuss and vote on suggestions. The class newspaper announced the events as they took place-the theatre partyg the dancesg the class night that fea- tured an original showg the athletic eventsg and to climax the year the .lunior-Soph Prom at the Waldorf-Astoria. At the Prom, which featured vocalist Steve Lawrence and Marv Kurz and his Orchestra, New York University's new chancellor, Dr. Henry T, Heald, made his first appearance at an undergraduate function. Sophomore Class Officers Freshman Class Omcers lp: M." .. ,-, 4 L , 1 'IC -M Q 0' 'L F' l FM 'f r . - gh Q-:ss-.iw J l M' 1 A fy rv Q v , ,, i J, N f f '1a s Aga..-. -A ' , .4-!3.. ,a:...-k SOPHGMORE AND FRESHMAN CLASSES ' The Sophomore newspaper, The Dispatch, could report '52 not only as being a successful year, but a democratic one as well. The second year students were treated to a theater party, a rhumba fiesta, several Green Room dances, and the lush Junior-Soph Prom at the Waldorf. President Stan Brody initiated a system of Hlling the major class positions hy qualified electees, instead of by political appointments. Lend by Joel Gluck, Sid Joseph, and Lola Troy, this semester,s Freshman class was one of the most active in recent years. On the political side, the Frosh oflicers played a prominent part in the -fight for a Student Union Building and the elimination of Student Council dinners. A boat ride and several Green Room dances, at which Dick Zil'l"s and Sheldon Winkler's Orchestras were featured, spotlighted their social program, Freshman Orientation The Managing Board fwhere's Bob?J And the Dean cuts the cake Prologue Today . . . a reality. Tomorrow . . . history. That, in effect, is the story of ALBUM. But it is not as easy as it sounds. Putting out ALBUM is an impossibility. We know. We tried it. The 1952 ALBUM was born in 194-9, when Editor-in-Chief Armand Kirschenbaum, Executive Editor Sheldon Winkler, and Features Editor Nona Horowitz, three innocent freshmen unaware of the fate that was to befall them, joined the stali. By 1950, this year's Man- aging Board was in the fold. Managing Editor Roy Azarnoff, Business Manager Mike Newman, Copy Editor Lin Weissbrot, and Photo Editor Bob Gelenter became Albumites. The Symbol of our nightmares ARMAND Kmsczi-usNuAum SIIHLDON WINKLER Editor-in-Chief Executive Editor X X K ffl The Post A- 5 K Z In Se tember, ALBUM was at the ost. We had bi 'lans-the first I " X P P S P I. 1 , three-colored yearbook in the history of Washington Square College, X a new book, and a new policy behind it. Announcements in Square I X I ' 1. Bulletin, a large turnout at the first stafl' meeting, the opening of .N I1 sales, and-the race was on! ' i In October, ALBUM moved from the third Hoor of the South Build- - l ing to the fourth, amidst the higgly-piggly patchwork of the Com- ' X V: , merce Bulletin, Violet Owl and SSO. X, ,,,' -- The First Turn -- ' ,--T14-f - I Rounding the first turn, 'l'RADl'l'lON caught up with ALBUM . . . I take a picture of the Physics Honorary . . . I can't . . . it has no mem- bers . . . if ALBUM gets no space in Bulletin, Bullelin gets no space in ALBUM . . . this copy is obsolete . . . Seymour Rieger was president of' Fauchardian in 1950 . . . if Student Council cuts our budget any more we just won't be . . . where's Sid Gutstein's copy? . . . I don't know . . . AIADELINE Waisssnor Roy Azfmnorr , . . . , Copy Editor Managing Editor we can t even Gnd Sid . . . opening sales again? . . . have to . . . need twelve more seniors to balance the section . . . where's the stall' . . . MNHAEL NEWMAN Nom IIOROWITZ Business Marzager Features Editor what staff? ? ? ALB M , if f-""'. 102 -f' ROBERT GELENTER Photography Editor Those days are gone forever I ' ' I fi" as .4---f- Za ' ' 'fv 1- ' 3' f. - f.Z7:'F'i :':'f:2. if ,a f ff mg .. , V.g555g4,:j 13.3 ff 3 ,jymz K Egg? Alz, 2 Ig . V.., ,... N. - Q 14 Inside the Album Sales Ojice ' X18 ., W . , "And I think .... The Second Turn But when we hit the second turn, BRIGHT SPOTS was running neck in neck with ALBUM: managerial scrambles smoothed out under Royis direction, photo appointments, mis-appointments, leg work, and layouts called forth the energies of Bob and his assistantsg and the rewriting and revising of copy kept Lin and Nona claeking away at the Remingtons for months on end. And then there was the other side of ALBUM-the Sales Office man- aged by Mike and his business staff. Hopeful seniors were bombarded by dozens of letters and postcards, and even an ALBUM-Senior Class Christmas Party. The Back Stretch DEADLINE, on the outside, was catching up with ALBUM around Easter time. But Armand and Shelly summoned their courage. George Heffernan, ALBUM,S printer, wanted the first seventy-one pages by April 15. Together with Lin and Nona, Armand and Shelly spent their Easter Vacation working on ALBUM, and, for the first time in twenty years, ALBUM actually made a deadline! , 4 WL i ' l l l l 1 I Pnoresson ANDRE A. BEAUMONT "Shall we spike iz?" Faculty Advisor 55 s - .-- fr' ,., i ' - e 'L. K x u K Q 1' Q v f A .h A- , X I S4 i ,Q ,f :ze 'T The Home Stretch Seventy-one pages was I10t the whole ALBUM. More work had to be done, and ALBUM really got going! Typists were recruited to do the Senior Section. Charlie Mangel handled the sports, and Maria Bampoucis plunged in with the rest of us. Roy, Lin, and Nona changed the dummy and then spent sleepless nights trying to figure out how to put it together again. And Mike actually made some money for ALBUM by selling ads. Spring passed and summer came to Washington Square Park. In Professor Beaumont's office were several large envelopes from our printer. Yes, they were proofs, and they had to be read. Our friends from Commerce were already in the Catskills. But in the ALBUM ofhce, till the guards threw them out every night, the entire stall' was keeping a promise to get ALBUM to the seniors by July. Epilogue The race was over. The sky had cleared, and the sun was shining. ALBUM had fought off the Hnal challenges and roared home under the wire. Here it is! The 1952 ALBUM! We told you it was an impossibility! The Business Stagg working on copy The printer is on the phone HOWARD FRIEDMAN Assistant Photography Editor Look Ma, no handsfl' 1 SQUARE BULLETIN "Hey, did you read that !g"IQd2794l! Bulletin today?" "Yeah, and theylre absolutely rightf' Although opinions differed on Square Bulletin throughout a senior's four-year stay at WSC, the bi-weekly paper was, for many students, their only liaison with WSC and NYU aside from classes. For subway-moles as well as "joiners" Square Bulletin worked over- time to turn out the latest sports results, news on intra and intersehool activities, and highlights on student life. And when it had to, it took an editorial stand-whether it was popular or unpopular. When the Class of '52 entered in September, 1948, Square Bulletin had gone tabloid. Editors of the four-year period called it the "Best Bulletin everf' citing its rise to an all-American rating among college "Pass The Coke, Sam" 4 EN, , . H,ggz:f,g', 1 2-Ig ff 9 -fa i T4 ,A ,44,,, , I 1 ' N as I, Q 1 z ,'v-,, T X . s 'i1,lll.U47QE V J t -3 65 FOI? ,W 5 , l X ia X L !,,' -V I, , in ,. .,g , - 1 P X .V 1 H if: "" ., C m l VOSTE 15' f 1 f A, 'T if 'I 4 1 ' J 0 "fa Z A, fa-rr' Q1 41, ,-fr: f- a NIITCHELL BADLER lawm Cuavluw Co-Editor-in-Chief Co-Editor-in-Chief l papers. Even its detractors, faculty and student, admitted Square l 5 Bulletin was always interesting. i The 1952 crew helped make four years of Square Bulletin interesting reading. Senior Co-Editor Mitch Badler and Copy Editor Adrienne r Thoet headed a top-notch Managing Boardg Co-Editor Irv Chavkin ll l and Managing Editor Sandy Nemser, both juniors, completed the l if hierarchy. And what were some of the stories that made news in those four lj years? Perennially there were Bulletin-Council feuds. There was the l controversial banning of Howard Fast in 1950, the basketball scandal, l erection of Vanderbilt Hall in 1951, and the arrival of Henry Townly A Heald, newly elected chancellor. 1' Square Bulletin was always on the spot to cover the story! li SANDRA Ni-:msisa ADRIENNE Tuom' lllanaging Editor COPQ' fbflllvl' "Good evening, ruciligfalzs . . ." lx 48 Apprentice Nfanaging Board 7 AZ,, f ,f 7.7 1541 fm! Ayub F7 mbsf MQ, M v APPRE TICE WAVE RLY ,QW G, dumb A 1 74 ctw i RJ' 4399! WS F frat ,L S,A"v"'f ff-I ,gig Qfff' WWE vii!!! r EU it sa: ers? '45 N1 '7 -145' L k FQ A+" ca 1 fwsli 1, 5 -'wg' ' - "- s v- '1' 1 v -.5"1 - ':"F:f!S"f"2r. 1 . . . if ,azazwsalfatz iv' V -N 1 Q g f , -,rlzva-'wifi +-1ff:f' f"' 'f'1a1... "li V-J ' sfiwfisf' -'ffl-Y dwg. f -" -"a5wf,wm: V . .fg-,:,.,t- ,fzggglp SHELDON WINKLER Editor-in-Chief NORMAN Con EN Co-Editor-in-Chief Apprentice, WSC7s literary magazine, published two larger and more representative issues this year. Outstanding features were a prose and poetry contest and an article by William Carlos Williams, poet and reviewer. Individual criticisms were mailed to each student submitting manuscripts for publication. Waverly, the Washington Square College guide to Freshmen, was completely revised and rewritten this year. Beside the usual infor- mation on extra-curricular activities, athletics, and college life at NYU, the new 160-page handbook contained a complete story on Greenwich Village. Sheldon Winkler headed the Waverly Managing Board, which included Armand Kirschenbaum and Marty Valins. Waverly Managing Board lf V' f f ff, HARTLEY POLASKY Editor-in-Chief Under the guidance of Professor Harry A. Charipper, faculty ad- visor, and its editor-in-chief, Hartley Polasky, the Allied Science Journal, a semi-annual publication, grew in stall' and stature. The magazine reported research experimentation done by the biology, chemistry, geology, physics, and psychology departments. 1951-'52 saw Varieties undergo three complete managerial changes. Published monthly by Rah-Rah Publishers, Inc., a student-owned venture, Varieties was the only activity on campus not under direct school sponsorship. The new managing board was headed by Bob Lynn, a WSC sophomore, and Commerce's Joel Harris. Varieties lllanaging Board x i ASJ Mdlldgillg Board ALLIED SCIENCE JOURNAL VARIETIES JOEL WILLIAM HARRIS Editor and Publisher Washington Square College Orchestra WASHINGTON SQUARE COLLEGE CHORUS AND ORCHESTRA DR. FREDERICK Kunzwau. Conductor Chorus and Orchestra The Chorus and Orchestra continued to prove its versatility by performing all types of musical works, including Offenbachls comic opera R.S.V.P., which was presented in the School of Education Auditorium. Under the direction of Dr. Kurzweil, the group concluded a successful season with a stirring concert at Town Hall, where the Orchestra featured selections from Mozart's Marriage of Figaro and "Suite Francaise" by Darius Milhaudg the performance of Bach's "Brandenburg Concerto No. 5" was given with Dr. Kurzweil at the piano. Works sung by the Chorus at Town Hall included "Miracle of the Gullsw and the Hallelujah chorus from Beethoven's Mount of Olives. Washington Square College Chorus 1 ----f-1------0--M--A M--f.f.w. :V . . .. , V . ,-my-1:-:c:g,:.rw:1fgsw:a'zr?2'mwfw.,.4,t,sat: E9 -...-.. hi.. ..- '-f Z 1 :I""- - - -' "- lg- T -.aie Q ' 22?-' F HONOR SOCIETIES ':'m::,- qytc Q, A liberal arts college has many functions and obligationsg among these is the duty to develop each student into a mature individual. The curriculum, consequently, includes the ' study of many varied topics, and in the natural course of events certain students will prove to be outstanding in one or more of these branches of study. To induce voluntary expression of the specific abilities of the individual, there are, at Washington Square College, honorary societies for the recognition of superior achievement in the spheres of scholarship, student activities, and special departmental and pre-professional interests. Recognition of talent and educational and social activity comprise the objective of each society. l-:.rvS'1!s5"- "W "if. -N1 y ' , ,X , , , . L. :S-gk 5"'.':a X .' x,-A ?' wif FX" 4 p . ' 'r we ARMA ,R -V 'Q - . x ' ,xxx i yglu, Q-, if' 'X Val "', A,Zf'?5fY Eclectic ECLECTIC SIGMA Selecting its members on the basis of scholarship, personality, ser- vice, and leadership, Eclectic, the women's honorary activity society, confines its membership to the seven outstanding juniors on campus. Gloria Astor, Barbara Diamond, Nona Horowitz, Sheila Katz, Leona Milstein, Adrienne Thoet, and Francine Wattman were chosen from the class of '52. The new members were initiated at the society's annual dinner. The distinction of being elected a member of Sigma is conferred upon those male students at the college who have exhibited excep- tional character, leadership, and scholarship. The six members from this year's class included Mitchell Badler, president, Noel Kleppelg George Schneider, Ira Schneider, Paul Skokg and Sheldon Winkler. Each member's gold key testified to the school's appreciation of the continual contributions by Sigma members to various collegiate activ- ities, including ALBUM, Square Bulletin, Student Council, honorary societies, and clubs. Sigma CADUCEAN Under the leadership of Mark Singer, Caducean, the pre-medical honorary society, embarked upon an active educational, advisory, and social program which included trips to New York City hospitals and a morgue, the presentation of surgical films, and the witnessing of operations at various hospitals. AESCLEPIAD Named after Aesclepias, mythical physician and son of Apollo, Aesclepiad is the pre-medical honor society for women at WSC. Ad- vised by Professor Malvina Schweitzer, the group was able to claim the acceptance of over one-half of its members into medical schools over a period of seven years. FAUCHARDIAN It all started many years ago when the king of France had a tooth- ache. His dentist was Pierre Fauchard, the originator of modern scientihc dentistry. The program of the Fauchardian Society, whose members are the top pre-dental studentsron campus, included lectures, rallies, films, tutorial service, and socials. Caducean Aesclepiad F auchardian l MU CHI SIGMA r D O 2 ln' fl . X HJ lllzzll Mu Chi Sigma Among the many and varied activities of Mu Chi Sigma this year were trips to the atomic laboratory at Brookhaven as well as jaunts to several breweries. During frequent meetings members heard talks by teachers and students on such technical topics as Ion Exchange Resins. Dr. Lewin was made an honorary member at the annual induction dinner of the chemistry honorary society. Under the direction of Donald Casper, Ralph Cavalieri, Solomon Fox, and Professor Harry Charipper, advisor to the honorary biological society, Beta Lambda Sigma aimed to foster scientific interest among biology students. By presenting series of lectures on pertinent subjects, the group attempted to supplement the courses given at WSC and to stimulate interest in biological phenomena. BETA LAMBDA SIGMA Beta Lambda Sigma HONORARY i HISTORICAL S 0 C Honorary Historical Society Activity in the Honorary Historical Society centered about informal monthly meetings where members attempted to draw on history for analogies applicable to the contemporary scene. Led by President Richard Cutler, problems like German rearmament and the Com- munist threat in America were hotly debated. This program was designed to give students an opportunity to present their views outside the history classroom. Edward Tober, president of the Honorary Economics Society, presided over seminar dis- cussions on various subjects in economics which were held by the group. New members were inducted into the society at an informal tea which was held in the Economics Depart- ment oflice and at which members of the department participated in a round table discussion. HONORARY f 4, ,f ECONOMICS SOCIETY Honorary Economics Society Psi Chi Sigma Delta Omicron , , . -.l SIGMA DELTA oM1cRoN The visual appeal of modern writing, the Russian proletariat theory of literature, and the contrast between Greek and American drama were discussed by students and faculty at Sigma Delta Omicron meet- ings. These informal gatherings presided over by President Sheila Katz were culminated by a formal social at the end of the year. PSI -CHI A state dinner at which Professor Thomas N. Jenkins of the WSC Psychology Department was the keynote speaker highlighted the program of the psychology honorary society. President Howard Maker arranged field trips and several discussion meetings which featured talks by clinical psychologists. SIGMA DELTA PI Sigma Delta Pi and El Centro Hispano sponsored plays and dances to raise funds for a scholarship which enabled an NYU student to study in Mexico this summer. The honorary .society and the club also brought Maria F ux, Argentinean dancer, to the school. An active year for Sigma Delta Pi was ended with a party for Professor Hespelt. Sigma Delta Pi l-1-f TAU KAPPA ALPHA Tau Kappa Alpha, the honorary debating society, enlists most of its members from the ranks of the Debate Team, since one of the prerequisites of admission is two years, debating experience. Bruce Goldstone headed this year's group, who participated in debates in the National Forensic Tournament and the National Invitation Tournament. PI DELTA PHI President Sol Fox headed the Washington Square College Pi Delta Phi delegation to the national convention at the Waldorf-Astoria. Upsilon chapter members of the French honorary society also attended a cocktail party at the French Embassy and French plays and movies at the New School. SIGMA PI SIGMA Although an undergraduate organization, Sigma Pi Sigma is the only WSC group to boast of members who are all graduate students. The honorary physics society awarded a prize to the undergraduate with the highest average in Physics 1-2, and, led by Leonard Aron- owitz, members heard speakers on such subjects as atomic moments and microseismic vibrations. Sigma Pi Sigma l r Tau Kappa Alpha Pi Delta Phi rx 5 Qi .m. t'. -I . CLUBS If you totaled the hours you devoted to the activities of Washington Square College,s fifty or so clubs, it became apparent that a sizeable chunk of your college career was spent learning how to work and live with others-every bit as important as learning that the sun is the center of our solar system. Club-time included lectures and discussions by "big,, namesg miles of motion picture lilmg gallons of coffee, tea, and ciderg too many rich cookies, pastries, and doughnutsg and worn out shoe leather made so by marathon dancing. However, our four years at WSC gave us enough time to digest both the food and fun afforded by membership in what those in the know termed extra- curricular activities. fr Le Cercle F ranguis 'l'he unollicial French motto, l'umour toujours, has been replaced, strangely enough, with factivite toujours by the WSC Frenchmen, the LE C members of Le Cercle Francais. Led by President Sol Fox, the club held a variety show for a high school, presented Les ,fours Heureux, and attended dinners and theatre parties. One of the most active of the language clubs at WSC, El Centro Hispano fully achieved its cultural and social purposes under the leadership of Saul Sibirsky. The group joined with the other romance language clubs to form the Romance Language Federation and con- tinued to sponsor a scholarship for an NYU student studying Spanish. El Centro H ispano No one studying German need fail, according to Der Deutscher Verein. To uphold this pragmatic statement, the Verein continued its successful tutoring policy, which was only one facet of its activities for the year. The club again awarded a scholarship to a needy student. On the social side, members held a Spring festival, featuring native dancing and songs, in the Green Room. DER DEUTSCHER VEREIN The annual Gold Leaf F rolic marked the end of another successful IL CIRCOLO ITALIANO year for members of Il Circolo I taliano. Under Rose Marie Mormando the group's activities swept the entire cultural range from attendance at the opera and Italian radio broadcasts to gay pizza parties. During the year prominent Italians addressed the club on various aspects of Italian life in this country. ECONOMICS CLUB In addition to sponsoring the first Minkofl' Lecture on Public Heal th, members of the Economics Club held monthly socials at which prom- inent economists were speakers. Led by Madeline Wcissbrot, the club heard talks by WSB and OPS economists, an RFC loan agency man- ager, and a foreign exchange expert, among others. PsYcHoLocY CLUB The Psychology Club planned this year's program with the aim of combining the theoretical and the practical in the field of psychology. Under the leadership of Bella Lom the group visited Creedmore and other institutions, where members saw theory at work. At socials and meetings films were shown, and lecturers outlined reports. MATHEMATICS CLUB b n Explaining why S f fxj dx : lim 2 f fx D A x 'to dazed calculus a n oo i l 1 i -Q Z students was one aspect of a tutoring program conducted by the mem- bers ofthe Math Club. Mathematical oddities and puzzles and Zlflalh X, the club's publication, also helped keep the pencils of the Math Men sharpened. YOUNG REPUBLICAN CLUB "We will not support any candidate for the Republican nomination for president," announced Michael Mittelmann, president of the Young Republican Club. In accordance with this policy, the club brought speakers for both Taft and Eisenhower to WSC, in addition to holding meetings at which their own members spoke. GOVERNMENT CLUB Speakers from the FBI, members of the faculty arguing about what constitute the basic concepts of government, participation in the model Security Council at Barnard College, film showings, and round table discussions and debates on political subjects were but a part of the Government Club's activities this year. YOUNG DEMOCRATS Unlike its Republican counterpart, the Young Democrats supported all Democratic party policies. Led by ,lim Bayley, the club sponsored Representative Arthur Kleinas talk at WSC and held a Sharkey rally. The year was highlighted by a trip to Washington to see their big brothers in action. i F Q t 'Ql i tfnl Y U 1 RADIO CLUB An unusual opportunity to get practical experience in radio work was offered to students in the club. Members became well acquainted with the activities of the major radio stations and television channels. Skits and full length programs were initiated, produced, and presented by the organization. PRE-LAW SOCIETY Under the leadership of President Bob Horowitz, the Pre-Law Society brought many well-known personalities to WSC, among whom were Judge Irving Saypol and Bertel Sparks, director of admissions to NYU Law School. The Society also showed films on American courts in action and visited the Circuit Court of Appeals. DEBATE TEAM Bruce Goldstone's debators argued the "pros7' and "cons" of the national topic in more than 150 debates against schools from New England to Texas. The team not only defeated squads from Harvard, Princeton, Columbia, and other Ivy League schools but also was ac- corded top rank as a collegiate team in the Virginia Grand National Tournament. 5 Q 2 if S E BIOLOGY GROUP Attempting to offer extra opportunities for biological study, tl Biology Group, led by President Richard Land, provided a series lectures and films for its members, including motion pictures 4 surgical techniques and a lecture on honey bees by Dr. Johansson the WSC Biology Department. PHILOSOPHY CLUB 4 An active speakers' schedule included lectures on truth in al Buddhism, N aturalism, and logic in the social sciences. These prograr were given by professors from the New School for Social Research al Columbia, Michigan, and Indiana Universities, under the direction President Lola Lidsky. OUTDOOR CLUB WSC's "rugged individualistsf' the Outdoor Club, sponsored Sui day hikes, overnight camping trips, weekly meetings, and journej to NYU's Lake Sebago camp. Barn dances in the Green Room, Calle by the famous "Piute Pete," and Adirondack field trips helped 1 fill a year that was both active and successful due to the efforts 1 Bert Lefkowitz. Q1 NEW OPERA CLUB Dedicated to stimulating and fostering among students an interest in the operatic arts, the New Opera Club, led by President and founder Jack Zangara, held lectures, opera movies, group trips to operatic performances, and recording recitals. Outstanding among its activities was sponsorship of a concert by tenor Marco Sorisio. NATIONAL STUDENT ASSOCIATION The NSA of WSC reached a high position in the national organiza- tion this year becaiuse of the efforts of Sam Feldman, Sheldon Winkler, Stan Hoffman, and Al Kramer. Sam Feldman, WSC delegation chair- man, was in charge of the Regional Bill of Rights Committee, while Sheldon Winkler headed the Student Travel Orientation Program. . DRAMATIC SOCIETY Instead of Dramatic Society, the letters "DS" could just as readily have meant "Doing Sornethingn because the members of DS were always active. Under Dolores Ofiitzer they produced "Ah Wilderness" and excerpts from "All My Sonsv and "Mr. Robertsn. Severalof the group also took part in the hit musical "Up An' Atom." Inter-Fraternity Council INTER-FRATERNITY COUNCIL The Inter-Fraternity Council, co-ordinating body of fraternity activity at NYU, con- sisted of twenty non-sectarian fraternities. This year the Council set a smoker schedule so each member fraternity would have an equal chance to obtain pledges, held tournaments in football, basketball, softball, track and field, and bowling, awarding a handsome cup to the winner of each event, and participated in the Block Party. Neil Wilde and Armand Kirschenbaum shared the chairmanship of the Council. ARMAND KIRSCHENBA UM 215, J , 2, 1 ' . 3 'K Nkxai su--..-K .. L fp-, Pan Hellenic Congress PAN HELLENIC CONGRE SS Integrating the activities of the sororities on campus, the Pan Hellenic Congress, under the direction of Dorothy McSparran Arnold, dean of women, served as a bond between these Greek letter societies. Pan Hellenic held a tea and social twice yearly to introduce freshman women to sorority lifeg sponsored intersorority athleticsg and supported a war orphan. LD EVELYN ILARI Secretary 4 l MRS. BEATRICE LEACH Friendly Advisor ,gs mm Fas 4 1. TK 1" XI my Lei: as A col ,, W- - x 5 l ,. " ' . . - i i s Atllq ' - Q E Z!! ' f 'ii' I N1 4 Y SQ? ,ff . " 'N , K L , r ,. 't M QI THIRD FLOOR SOUTH Although it seemed impossible, the mimeograph machine was work- ing smoothly, typewriters were being pounded Cboth by the experts and by the inveterate hunt-and-peckersjg orders were sounded in German, French, Italian, and, occasionally, Armenian, clubs rushed to beat the 4:30 p.m. mail deadline, and minor political rallies were being staged-this was Third Floor South. Despite the heavy smoke screen and general excitement that prevailed on Bulletin deadline days, nobody seemed to get into anybody elsels hair, and once in a while WSC organizations even managed to exchange ideas with their arch rivals, the Commerce clubs. Third Floor South was the one spot at school where even latent leadership ability was developed. You didnlt have to be a big-wig on Student Council to get ahead-all you had to have was printer's ink in your veins andf or the desire to help, to make your club successful. Your talents were soon recognized, and you found a job that fitted your personality. And if you ever had any doubts or needed help, you could always depend on friendly Mrs. Leach for assistance. Busy., aren't we? 68 fl swf gm ff ELOw1TZ ' I Presulent 0 the For Thine LS The Power The celebration of a mass, the holding of a seder-a religious center -means more than that. Our Religious Center meant a place where people of different religious faiths could meet, work together and have fun together-a place designed not for the purpose of teachin 5 a student to be tolerant of another whose faith was not identical to his own, but for the purpose of helping students to understand one another in the light of opposing viewpoints and differing beliefs. ' Catholic Center 5-5:3 X, 151,221 , ,.,1y.,,fl,,g "Q 'W 2 1... A f 'V L' . 9fff lffTi - '?""' fL , f:,,, " owsges'fsfS' ff ' ' 41- f' . ' Jw ., - ' ' H, 'ttf-f A ,:'v:f8,,,,,p-4gg.1.' T25 , 4 of V sr -11 " M' st . Wk, J, 1,7 K .. , . ' 3 -V . . 3 . , , 1 , A 'gi 5 it , ,,. 1 4 1 0 ,Ma E wb ' 12+ . X ,vw 'L-1 ,gf s , -an 5' , , J. v. w.,,q,w,w',,, A, we .f fa e r ,f Q 'nr ,gn Q.. 06 Q75 'v-1, 4, 'fi A 4 ,. ., ,.,, ,: .,1 if v f . , nfs. M ,Q -. ' . mr' ,YW -:map-my.-15. .wage.qtirim-mr-224122tt-tp-4y:-5savf4yF - '- e ' -. ' 4-' H124 td-1 " f' w w fi? , -f "" ' f., Newman Club Ojicers Executive Committee of the Christian Association Jewish Culture Foundation JEWISH CULTURE FOUNDATION The J CF energetically enacted a well-rounded social and cultural program. Discussion groups met every week to probe such topics as "American Judaism Today." Sam Levenson, Irving Davidson, and John Roy Carlson were among the many guest speakers, and semi- annual week-end seminars at out-of-town hotels featured prominent lecturers who spoke on Jewish life and its relation to the world. NEWMAN CLUB To meet the many requirements of the Catholic students at NYU in the social and intellectual realms, the Newman Club vastly ex- pan ded its activities. The events for the early part of the year included communions and masses, while the latter half saw the opening ofthe new Catholic Center, which was officially dedicated by Francis Cardinal Spellman and Chancellor Heald. CHRISTIAN ASSOCIATION Cultural life in the Christian Association flourished during the very interesting coffee and discussion hours held every week. A few of the noted speakers were Mr. Patrick Malin of the Civil Liberties Uniong Dr. Alice Keliher, NYUg and Rabbi Sidney Lindenberg. A carnival and Spring Formal climaxed the social activities of the season. , They have deadlines, too! S ' .y k ltr ix, .ll 1 avu.. jewish Culture Foundation Library REV. T1M0THY J. FLYNN Chaplain of the Newman Club The Christian goes to work Association After hours at the Christian Association - .. I X MARTIN COLEMAN X !i" RICHARD CUTLER , R N ADRIENNE THOET 1 K , 4 it-g 9-L ' 1 l I w N Q w u I , l E - 25 ROB ERT Honownz MITCHELL BADLER 1 LL dy Z 1 LEONA fYIdlLSTElN ,.,f-2 ,Z I, i ir-i V--f ll f .Q , D ' gun L ui, -i fi' ,W , . , .iz ,4-q I, 145 , y -4 ' . iff ' L, 8 1,96 ff A V ,Ax 1:15 fffffffarf '1' 2 ' k f i ' 1 3 i x '- , ' I ,I-'ff' -1, - .. . ' . ' 1 ,,-1n.,fyfnw', V Q I 6 10 1 f f 'Vbf 5 f L. f , C' SX 35' ' , , 71' " ,fi f X 40 Z - ffff ' 'X N .- -' ' ... - - . - ,-. . V Qf' A 1 "' 5 if, ,pf 1 " .-" in ' ' ,f f fu ' ' , f if K -fx Q, me .Q.?5c:a:1-gf : -. SHELDON WlNKl.Eli It X A, ,ma 9' 'A 9 Q NOEL KLEPPEL V3 gf H 'W' ' 4 ' -..f' 1 I r Y wp X .A f X X A i X l I ,X SHEILA KATZ ps: 4' IP" 'V ii I , w 1 4-7 4 3 QL .Z , f 5' ARMAND KIRSCHENBAUM - ' - - - A - L .., 5 .-xsL- ..., v..- , .. 5-rx i ,f ---.5.: - N -..x-- , "vi v f Q -.. - .- ,,..- ,'-- .1 V n 1 AZl,i :l., ? ' .-fm, , i . - . -zap. f ,A SOLOMON Fox -ff ' 41111, s, by' wwf? K LE0 MCCALLUM 1 I, 1 ,f ,.o 1. N 'R ,- ,- ' , :rt ,:- -- V N , ,,i.,,:'A' . W ' 1 --'- . .. ,N I X. XI. . . - ff" :mfg .,, -., ,A . gg A ' W ' new -A . .,m..:-1 .. ,.-ee 1 . . 13,- .ty ,, .: A N l., ff A - ggi S: Zi .U U, Mu: i .r OLGA ALTCHEK 173 RIVERSIDE DRIVE NEW YORK, NEW YORK Democratic Club, Verity House Plan, El Centro Hispano. BLANCHE ALTMAN 110 DOUGLAS PLACE MOUNT VERNON, NEW YORK ALBUMQ Si ma Delta Omicrong El Centro Hispanog ociology Club, Gehrig House Plan. SOL ALTMAN 248 HEGEMAN AVENUE BROOKLYN, NEW YORK Chorus. JAMES DAVID AUSLANDER 127 WEST 96TH STREET NEW YORK, NEW YORK ALBUM, VARIETIESQ Pre-Law Society: Government Club, Alpha Sigma Chig Chairman, Freshman Athletics, Track Team. fr ,1w2"z.,, ,f 1 ww 1' U' V ' U ' swf -131 5- .....,,,..,, .,, ,, ..,,, I A-W ' , :T awn- Q , f- ,ff ,ffm 43515: 3, 1 - .- '52 ., , V A , 1. . . ' ' Zw'fR:'ft 4111: . .. - - 24413452 1 -Wai ' ' 4- . 4 ,x ff'4 Sf? L xv-Q! --' ,- ' - - 151521. 1, 211- ? fi" , .. .. .- . 1.1, Amina! . ,L K., E . ku, ,M MW M, . ,,,.v.,, 6 r V iq, ' '- ,A i .fm fr, . . . - - - 2:52 . 4 "f:. .-f K z "f',,,mf'ef" ."-fmt 'Gs -1 " - ,gff ., bww - P" -fl- :Y -A FV1:'7'..- " h12?1l:1E'11u.i??G ' ' fn?" 'Z'1E.-1.43: . Y-H-' cs:-S '--'f-, .1.:?'1--nf-ii" , . fl" .. 5 -z-S.: -f -' :"1g:.-ex, . we' S' , my 1 Mya,-e me----. -' - 'ZQWQU Q. 1 H H ""-' , , f f E 'HM ' I ., l:14'.,,ficE,ei5?,sf .'vffq152Q,'+ Q' ,cg f ,T f 1 T f ' .. , Q-1 I ..,.... ?QfPf', 2,Q:+f:Pw.2"-'f- .'1fi ' Wadi'-T3ffaH51l12Q ...W---N-"Y ' 1 , fewe r Mffifawaifs. "'fffsm4f+iQf ' R 1 ., 4,3 E V . " 1 .mg5:eLf1e'v1,5g'1,9Qt1gj,g22i,:-it ffdfifogyaggfg rf. pf 1935322492 QfAi2 Vh., . 11 . 1,2 twmg. . 4,w,1.w,fz , fu A wear . . vw - in .g 4- - 1. , 'v,fX5f"a'WV ,f 1513? fa! '--bmw f. 'S 9594+ ff:2Lv-wJ f-ff ' x'fM"f -. 1 ' -- 2 i'Nf,xg12 ef.-1.1,-nf 1 1 we ' I 1 e . . 4 'iw ,,,:.1Li e. - ' if?-5'2-fg'Y-YYGSSFQQQ,-.?,, :"1,i:e't3-5151:-63.5, ' v'u,,51gEu Q. :vmwx .AE -P r. - - .. , Pg mmm ' .- ' 1 E . 47:2 -rg - ,.,,- 1.1322 W Af . ,. , . f.'f---f 'Nm :J-1 'A-'f's-r-g'1.-?5"- 1 - ,. , f ,"-X nm! ' if -'iq T115-2-zm, -. -.-221.5-2-4. -1- f-'--Q51 if -. .'-'-fa--We , .-R'-if-1:-.. ifv-1212.-WM ak 'mfifllfff' , -1-534-'MQ Ep,-uf-fi, n:rsiNz22f,-5'- 1 Re " 731 W-.salsa---f T-'-'-jfegryi.-Y'-. ..,.g'cS?NCS3,' ,JP' x,P . , 531'-f-" - I ' f'1 f,1:L::1-Qlkfiqi,-is-gif-f?-ggi: "1 -. .L--f -...,'-'ff'i24-1x3"'v- ,,,,f- 1'v3.ga:,.,g- ..f'1:. ' 'fi---z:::sf,w 'Ai:i'.'SrQ .1 i.-4. .-'--i"- -L" -vw .,. ..,.., .. . , ROY S. AZARNOFF 69 HUNTINGTON TE1m.xcE NE11'1ARK, NEW JERSEY Managing Editor, ,xl,lxUM: APPRENTICEQ Election Committee: Freshman Social Committevg Book Club: President, Sigma Alpha Win. MITCHELL M. BADLER 1711 DAVIDSON AVENUE NEW YORK, NEW YORK Student Council: Co - Editor - in - Chief, BULLETINQ Copy Editor, VAHIETIESL Pres- ident, Sigmag President, Nlotion Picture Clubg Photography Club. ROBERT PETER BALLERINI 50-39 39TH PLACE LONG ISLAND C1TY, NEW YORK MARIA BAMPOUCIS 29-06 21sT AVENUE ASTORIA, NEW YORK Assistant Editor, Ausumg APPRENTICEJ Book Clubg Psychology Clubg Delphi- Hellenic Society. PHILIP BARENFELD 2012 68TH STREET BROOKLYN, NEW YORK Phi Beta Kappag Cadueeang Der Deut- scher Vereing Pi Lambda Phi: Junior Class Basketball Team. WILLIAM BARTHOLOMAE, JR. 1570 66TH STREET BROOKLYN, NEW YORK Der Deutscher V ereing Government Club. -r., f '59- . jan, 4""'- YWW' -1 . . .. -:4::v'-M ., 31' ., . -,...,- Y' . , ..,......4 M.- ,,.,. . ,...-... ,. , ,, . , . V,,, N., I 75 ls- :s- 01- .. 1: A ww -Rv-wmv 1- sf . X R K Rc R QR R 3 ' R 4 V ' M 902' 3 ,Kg ,,... ,:.: ,V,,, . , S gif' N56 Address W if s W? 'S Xa Y R N if sexi I? , R v v GERALD CARL BARTON 1306 FTELEY AVENUE NEW YORK, NEW YORK Secretary, Pre-Law Societyg Government Clubg Philosophy Club. GERALD ROGER BEGUN 2758 CRUGER AVENUE N EWYORK, NEW YORK Biology Clubg Der Deutscher Verein Psychology Club. BERNARD BELOUS 1729 WALTON AVENUE NEW YORK, NEW YORK Juniorl Social Comrnitteeg Der Deutscher Vereing Square Show. FELIX BERGER 1051 OCEAN AVENUE BROOKLYN, NEW YORK IRWIN BERGMAN 136 EAST 208'1'H STREET BRONX, NEW YORK Esquire House Plang University Band. HAROLD L. BERKOWITZ 1606 AVENUE M BROOKLYN, NEW YORK Fauchardiang Pi Mu Epsilong Mu Chi Sigmag Upperclass Advisorg Psychology Clubg Der Deutscher V erein. M- fa, ' -,1e5'M'- Fir- 'S-.1 .. . J:r'-Rf'e'vg5f1's!2'F.3?.i,-9b,Qf,'yi,rQ.-:q:Aw1.2-1-'yEfAh - - ,. NHL- Rf-, --fn, , ,-,-, .-'-- -1-2.11:-Mari: g:::.,,k,.:-,Eg 1. -EBT,-:C-'-:ZEC ' cw3"a. ,'1i . .53.v'i'.,v:f:':f:E--- .. - ' V -":.1g.Qf"1g ' -2fE""43gE:'z:1Qs.,-. -if ek-ev LEM: 35 '?5.wx4-'ij-.ri--. 'JEr,:1SQE,"vhl4i PP12'i-Qtffgs -51 -' -555 ,Q val Ee me-QR Rav- ,E 25,5 -' :. 'L' qc. N' , -- 'gf -' . , 'A-1:"ys-if' f'3'C5:44fwf Off? ' A-E, Q...1-1. C-533.2267-N:-C ' . ,, -,. .,.. 1 - Q. ,, .1-.vel Y -- I - 1.-Tj ':'::.,-.-:- .far a'H.J",-F..-?'.2 5.2-Q1 -E :R '--'23, 1' ' ,Rf .V : . Q ,fL"3' 'M 1 Q Ei,-ff gjllhh " Tm, ' " f - 'sz-.. K, Q' 2 m n' . .f y 12' iw" -i "',-. H, ' ' 64 , 4 Qltzygcgizi h - MY " M- l'52'Z e 'nl , ,'w,x-'u - ,,411,.f fffriaffeemsa- M M. W ' vw. .' ,- ..a:!ff-- dw ., An. 4-sikrfpfzrif W., "1 .251 - I N -2273 ,: f,,w 4 ,. . ' -1- -- K .' I , ,?"QIEf. I wif D ,..if-f' ,+:g.2'V' If ' WS, , ' fe-' f , ' , 12 5 f f li 1 M , ., I l eff- if M i " 5 "1 3-' 1-'JIM ' ?' E'1W- - JE? ' .,.yA' ,Q-" 6. Qi, . ,f- ,,.-71.3, "j'1::fgk:55.g '. .,42f1'+ ' i' 4 A ' . ..LM9'?,, ? -3... f., sb: M ' ., F "-f""1'f , ' ' 1" ylX'f4'i-.5512 4. ' J..a"' A, h " N-x'r, 1 Q.:'SL3i4?5j?,-'fL1?,ff' 'iq Y swf 4 ,f fgfgezfiiw 'yr Q : Ncg5ae.1:QfQ'157:' '- ,lf-P6113 1 5 1 , f-.,',",5k3?'g4l'y,1gjgovw -.3 if f 5 F M , - :?2Q5 I. 1 , lg V. f 5 gf if Q 7.j'wfi .. ' g I X if V-'K 'H on V-'Y Q,-'l4?Av-lf. My if 2 W W 1 24?fSf'W'fb1lfWf 'fi' gf Q - f 'g3Q,fiiQM33a5ZQi'g, ff I. ,4 1 -..'.ui,W H W4 -,5 -- ' 5. ." nw- f few- . 1 I 3 fizmgsaiw - 52 Ei , ,of 3f6QTE:v3i.i2Li:Ps':1 ' 'S' I -f 3 E: 1'.:4:g,Qwq FQ - ' 1 ..w4f"sww23:5',.f,., "bf,lf1ff72'1 'ml' Q ' 24? 'if -. " Fei' -21 X-':', , 1 . . 4 . 1 K.-, J , . 1 , ' 6, ,,3.:y4f:ah1q,-.:1.,,,, f,j,?,,?4 . p , i f-S . 2 -' f f xi-1f'!'1m: F- Q 'HH I 'ig Ani 4 A :,1.,,t'-,.uQ,f.,-- - 1 5 4.1 'JUSGQQ7 ', 1 1 , xx 15:24 2" 'ii 139 ,jLf'b',"Wy2 r -- 1 wg ' . 'Z ff.-f1..:',f.w:w ' . .w a was 'Z -'I - 12!f.G'25zIQiigiQ?5i4 . W 'i g jfglfff I 3 , ' 2 Em' - -f -' 1 HF 'LC 'wi T., LAI ' - I ' bf r A .54 12 , , iff-Q57 5- ,gi A 1, 1, -,fm gg W W -.Q H ,agar I, ,,,.4 , 1 , 4,45 ,,- ,M m,...,L... N ,ML My if an high vfgvgf, wgewf RIM' if " .1 Q11 V. f -- ,, ., xvg Lum 5.55113 ,- 51351 Lwwig- W ,f-:gems " av 1- , 'f Gb- ME Qgifav fi- EM.. as ,wa gy' 1 1 Q? 5 ' + Igm,u,9'- aug J' 55,4 4 f , ,, WA, - V- I Wg-' ii ' was fbi I li2f'fQ 1S4g5 'i'N' ' J N " FW1-QE., - -- '."u :ul I-r, -Y ffl 'I b " .1 1 - - " f' ' ,1:'-1.,f-,1-:fl.-- 24."l '7i, -A E ' 'u 5 L, V!-if 'Av 5' 'tx f" nr?-' . :.f,l'jf. ' " ,. -1, "U I '-1' , 5 A".--'Nm -5- ,:'1!.",'f.f', -f-' ' W9 - 554' H "H - . ..x, . , F . ,, . .,. ,. A . . I f . . , , , be-tf5!??3?'?5'?SP?23ibNYd2ii11T1m?2Qf-?f'44'L?Ei5'?'i'?+"1a'I'33ff?rif91v'2ff EMQGJIzs!1aemz.:1 f f -- 'I' - I -4 ' W . , mg- 21- J ,.... : , Lai ' 4 .MV .' :'f,jE'l ' ., az ,:l?:rI, 'Q' ' use- - 1 I PHIL BERKOWITZ ' 87-84 165T1-I STREET JAMAICA, NEW YORK WSC Basketball Team. ROBERT L. BERKOWITZ 607A LINDEN BOULEVARD BROOKLYN, NEW YORK Senior Social Committeeg Vice President, Le Cercle Francaisg Der Deutscher Vereing Il Circolo I talianog Biology Clubg Chorus. ,ff f- .V-..,,::, ,L-,mf-W, K?2144-'-'ea-w:.:v'r'zy ,.., I r f . - .f':4?': 4. "'-+.2",w. V. , L ,.Hg,v, .A V f FLORENCE BERMAN 387 SUMMIT AVENUE MOUNT VERNON, NEW YORK ALBUMQ El Centro Hispanog Retailin Clubg House Plan Associationg ,lewis Culture F ounrlation. ETHEL BERZON 21 BONNEI-'oy PLACE NEW ROCHELLE, NEW YORK BULLETIN? Phi Beta Kappag Sigma Delta Omzcrong Le Cercle F rancais. 1 riii , 7f'?' i: :I,iz" 4' ' . 341'- I' -4' v 12-1' "Yip, :m:,,. . , .- sz f .,.ff-,-.gfef '2 " ' ' "" ..k,,y wg ' . -- . f.. R . if az A , , K 2 uf f- :feta-4 yr W ,RE fi gf X .-1 ,W ,.,,,M,,,. :QM ...,.., , .- . sf- -rw.:-,M-:aQr:f'..p T-wz2'.,:,',:gM,-,f v f . '- .fQm5:f1fs:2-fi-1' Esz .-rv: -' 0- f R . l -' EF' 'Z 1- '21 52" -i ' if - fn RUTH BILGREI 930 GRAND CONCOURSE NEW YORK, NEW YORK BULLETINQ VARIETIESQ Government Clubg Pre-Law Societyg Radio Clubg Alpha Epsilon Phi. DOROTHY BLOOM 1097 EAST 19TH STREET BROOKLYN, NEW YORK Lawrence House Plan. KURT BOCHNER 2076 CROPSEY AVENUE BROOKLYN, NEW YORK Phi Beta Kappag Tau Delta Phi. EDWIN BOKERT 206 HARVEST AVENUE STATEN ISLAND, NEW YORK Psi Chig Philosophy Clubg Psychology Clubg Book Clubg Der Deutscher Vereing Fine Arts Clubg Ehrenkreisg Chorusg Square Show. sf" Algggm . -1 Eiga-zg. - .r,, ,' ,. aw?-Q H avY!.,.:g:4f" E2 -M y 1-3 gl. 'Tv ' 4 ,f 5511, Ria. if tg Li ,. .E 1 - v :,a'w,f is Lf .J L,-M. T -rf " Fffiw - .: 1. 9 -'ffws - - e .f--1 5-few : W - ,g' 'X a fnow- 1, f 1 M ., V 1. , ., wg,-A,Jem-W-x.r,v-.,.1:.,,1,...-fmt:,,J 1,3 '49 5: E E . A 2253 5 -3 R T 1. ., -.f,:v,.,. - , -Q . . I ,vwfl-f' ,y325i""J:g?'?+1x'1 ' -F2 ,. in ee.-9 1 Q-.5-aw... fe- W.,-Q -f .. 1 we 4 - ,, Y ' L' -Af - 'z - .' .:- , L Q4-e. V.-44, Ra .1 M W . -- 1 ' ' :V ' -wt "' 1 3 2 1 m e ? t i qg lfgwk t M cm '- :Z . 3' ' E ' - P , 'www 5 4 :Q .,i?.i1- ? tw5"f,f.,.w' vf3 : i?'X. PM -W .. .. .. x , R 15 V ww E J 4 'N '-'- "-QE T' M' 'L 1. .-.f-'-W" f' Ea? t'-NME, 'YT - .VELWET gating, .' I "qw, gg s - u 3 ni Exam- '- A" ' - 'A jx Egg. , , H . ,fy Q J, V f E55 ' 2 '15 ,S 4 ' - ff" - . .' fff'52w4f4'i?ZN21XS:Y 31 V5-:ft 35:11 Qliff if 1 5915" ' "fivf.Qg' ff. fx ' .5 .M-R-V-"""'X akin. PS4 ' sgw .q.q.-1fg-- -.?-. f v -:.2E..-- sa,fA51,. .-txe:zfwH- .,,...e.--- . v .e .,,. Q f . H mf 4 A?'Z33 cw?', Ea,: a s -f--nf - ' 5 --3,5 x - ,gin H:-2 -J,.,-ps. t- -fn, f 'p we . iff: --f K -- gr' .' V . , 1. , . zz V. -'4:1fe .?...g'5QfENv-M-N-V -N, W. . T g f:35f W.f s?5't.,5, - wgfrff v fe ' - :9v3f'11ffcffw.fg4i -' f'l:'1L7:Mvf,g!a R - 4. 'QL -,mm . g. .J...k . W M ,, .- V' 'new M162 vHf6'5?fP+?'Vvmw Lipgff 1555 V- 'QP wwf' -T' -5MW?'1 ' -Q'5i w f T fi- 3 : rw, 'bm w w 1 'VF-if 0" ' "' ' i " "'P '- 4 ' J .ff ."E.k.., - , ' F "5-35"--.5!'En:2t. w.fI'f1:lJl K 4 ' :!f4."'F'f'.g,,. 1 'f-5.-Val.. V " ' E 2 'f 'f 5?k1Q?f5?ifq' . , ..1-' --" :mm A A t., -n.1,.-A 2. M- "' ' W f -uf ' M.. ,,,A,,- . , , - fe.. r 1- ra w ' "TTT-H155 'iifi-111.42 -, 5""5-- '7'."h?i525'?"""4' !:M :v:f.:i'f5 --e ' . E-,, , 0..--A'-.-V..-.... " - f -- '- - ,ff-, 'as , ""qef... , f-ZJU'-L " '4'7fJ'f'i:1"4r,.1-,A.. , - 1 A E A OE, 4-.O-R gk-...Q 1 ' " ---r ' "A '.. A-., ' 'Nz-...fi-11 --I""' .,i'f!'-1-RH'1?.f:. . Wav. H-' A-x 'eng Y ' 'ff EQTwBi5i4'iii?fq'-xt w 9-P "-- sa.-mm -. ' . 1 jL-mv-H-.,.QQ4n- wlaggri I-'iii-'gfF'1""e,"'4fT'-Z-Sis -55"-53 , s,5K.- A f --,Q'shQff-V,--.Y R . -wg,-y., Q-225, yi.-'..::Q -'wi'-.":f. ' ' SUZANNE BOMSE 595 WEST END AVENUE NEW YORK, NEW YORK INTERCOMQ Retailing Club: Triad. THERESA BONAGURO 300 RUTLAND ROAD BROOKLYN, NEW YORK Opera Club, Book Clubg Christian Asso- ciation. HOWARD BRODSKY 231 GRAFTON STREET BROOKLYN, NEW YORK Biology Clubg Der Deutscher Vereing Dramatic Society. PAUL SAVAGE BROWN 323 NORTH ARL1NcTON AVENUE EAST QRA NGE, NEW JERSEY Thomas Woye Biography Club. BURTON E. BROWNSTEIN 188 EAST 53 STREET NEW YORK, NEW YORK PHYLLIS BROWNSTEIN 32-53 62Nn AVENUE REOO PARK, NEW YORK . . 7 'WGA ,gsm 1,n,2?', 'i133vS3 1 -',:.'2Z'K'1 MAXINE SOLINGER BURTZ 5214- NETHERLAND AVENUE RIVERDALE, NEW YORK U Psychology Clubg Delta Phi Epsilon. MANFRED WILLIAM BUTTNER PINE GROVE INN EAST PATCHOGUE, NEW YORK Varsity Track Tiefam. . , 2 . ' ie EDWARD JOHN BYRUM m" f . 60 GLENWOOD AVENUE g JERSEY CITY, NEW JERSEY Al Statistics Club. M ,O RALPH ROBERT CAVALIERI is 208-15 IOOTH AVENUE ' ' H QUEEN S, NEW YORK xg - ALLIED SCIENCE JOURNALQ Phi Beta , , I Kagpag Secretary, Beta Lambda Sigmag ,im -.M : uf., .517 S . Ca uceani Orchestra' HERBERT M. CI-IAPNICK 2198 CRUGER AVENUE NEW YORK, NEW YORK Secretary, Psychology Clubg German Clubg Biology Clubg Vice President, Alpha Phi Omega. RICHARD M. CHRENKO ESSEX STREET STIRLING, NEW JERSEY Phi Beta Kappag Sigma Pi Sigma! .Pi Mu Epsilong Physics Clubg Christwfl Association. . WN aaa" , fav'-E, ' .---FQEEQ5' iv'-45fia'?Qf. 'PS ' r W is ' -.ajh iqxwwgm-1 el ' ,hw ' .- f ., .. 1 ' 'Y ' ' g'jZf1'Er' '-"1 -ESQ' ' .. - - R . N we '-Ffsf '21 ' slew:-7. 1 H ' "W v '2?2L,.5,Qv' eww - .1 4 , A 5 1-13-E r , -fvffq ' E' Fi " f ' E2fEQaa? ' fees, vu, ' - . ' E 45i....i--.,-'. .-Jr--Egg-3 if Z7 .-rfigr,-x,- "", , , . Q .2.. .w. r-.1-sw.. f,Ae, 5.1. Sf fi. "' - S- 'gas-.:'-Lu. ERE- -- :div -wr-iz'-wr ,S -1- ' Ri, , 2'fF9.4a-2 f Pre-Law Societg Real Estate Clubg Meiiiffi . gg!" -Vp., ' :',gqg,.g7,g. mz Airlie I L M V ' 1, ,A . . ,11.:w:-Wxsfgm 'V-I, fx, fm -. ef . fl - . M . -,ew-arf? -fi gl 11 ..fw' M'ief5v::21-29.1, 'm, 'w+ ,,.,. .fa .f.. ..',,,o.' ., .. ,..g,.x,n.,w. , N. I :ta-. N -- w,-5-I 42 I Y, :uf ffm-.1-m..A. 14-QQ... , ' ' 1 - , ' . "np 5 .. 21 , ' ,,::i'h ' -N' ,,---:Qt-1, " MJ ., . - 'Ht ' A. .' ' .gawawsii-41 +4 ... 4, .. . .3..,,-,,k,.,...,,.,.,,w.. . ' :If iff . 3 f 1 Na+", f .. ' 'If' gf '. I- ff H- 13-yr, M h -'aft i I .Ia4i5 ' ffgf5 we 1 t g42?5i6iQz'?fk.1g?,'. -' wLw"A3'- S I I ifl-?:fQfM:1.'w 'diff' f .: 'fffhfik 'V ' . 5 'A 52' 1 -r. ' A-' ur I - , 'xg-, . h 3'-iw, 1 .Ry-.1-'f ,V L- , I . .. 11? mH':w-.- 1: Q4-fi' 5 f .3-Q-ga:--gas 'G gl . 1 .b'lT" 41,- -,5,f:w-- cu up ,-1 f -mlfqggz--e. wi 1 ,. . J 35:55 . .,l5f-5,,.L.49::.,. ,WJ-, 9 I f' 4 ' I L ' - fy vfmymtz .t,:.,'s, lj I 5 f 1:'47iPfv:Lf:-' 1 . '- J 3 I all ' -'.l7Y'6'-',l?f1+"'. '-fd.-if .c v' 1 ' , ,A : f .- 51.1211 iii ,zJ,'2' 5 Y .1 Ik H-' .1 1 f f fn? 'T' .' -.53-afL"'f?:1' It-.iff Q V y ,,G,,.,,, 9, ,. 1, , .513 ,I .,t,,jI It . v ' '1 '- f Yi?'1?4'2Tw-fis h' 14 2 ' 127:-N N 'v.,,'1,'6r:f9lfE 'P-WE . 4 . at . ,'3i3gefgEfi.f1v .u, '.1-2 I f- f4Isg?a5g,q!.i: I? I- 2i75""fWB4s11::I' 2 - .1 l- S337 l 92, 3 4: Q' 5'Wvl51f:f' rl' g I iff' in Q' 1 S - p? '11,9v'4W6' A 1 ' 2- " i ' 'F' I- -i w-.. ,gy ' It .I 'f1.V.,.fp:i:3'i.tm 2 W ,V M ew.. -. 'rw 1,11 W4-'.-sq.,-1,211 W f I q iilfd-I," I ii fwi-zym.,-ag-v'-5. 2 W W M -2 '5 l?'l5i9 fwfa' if "" '95 me vw W . ' fl to '-"M -f1.1b,W'7f1'- " ' , 'M ,,. U ,A.,,M,jlgYS ' O" if WS' ,L 'I 5.55-452 . f , , M32 iteggw 1 .xg - . ' ' gm . r- -1 f- .mx QW mf- I A '- 96 "VH 94' I' X gf' .1 .- .1 M5.g1X7g:1'f?-? fhhllfhb'-' 4" I5 W" ' VME. mf r" . f X51 H fi I f Q. if I .yW55,l,.,l. 4, ., :fi ,U-, - -A ' 1 ' A' '-.fed ffh ef-5.1 fl? 'Q F' E I .. , f ' . N1 -, . I 1 :L fn. -1-fzzzgr-,g.':gg,fw:.l 12' ,li ,','- I g5if3f5, ..T,:.?7E2+ ,,. 'Ja-ff -f:" 1-'f' - 'L fda' . 7 'Nf .- ' R- ' 1- :-' 1 J." .-f' . ., NV IWf5W ,..1w-Fl1 ": , " 'f 'iF' Pf- fF'2Z2":"' 7 ' f ' I A' 1 R "" ' .. ..MRb1r5lHIw2Tecaw:- '- 421- -- STANLEY CLOSTER 253 EAST 49TH STREET BROOKLYN, NEW YORK Government Club, Psychology Club. ELAINE B. COHN 3215 NETIIERLAND AVENUE NEW YORK, NEW YORK El Centro Hispanog Retailing Clubg President, Phi Tau Alpha. NICHOLAS B. COLASACCO 557 MORRIS AVENUE BRONX, NEW YORK President, Il Circolo Italianog President, Federation of Romance Language Clubs, Treasurer, Federation of College Italian Clubsg Le Cercle F rancaisg El Centro Hispanog Treasurer, Alpha Phi Delta. MARTIN A. COLEMAN 1577 LINCOLN PLACE BROOKLYN, NEW YORK President, Secretary, Student Councilg Secretary, Freshman Classg Upperclass AdUlS0TJ Sigmag Sigma Beta Phig Suss- man Medal. '? iv. 9 ., 'YK-. , f :Ma 1,1111 -' - 1,y.,4-tw! wg:',,'.,,g 4 9, f -M., x X 1 , 1 J. f ' 57 ' fx 1' , ' N 1 ,r 2 x. S X U f . gg E Q, w R V 'U I MSN, 4 gif? l U V 4' frog? 4 4 I cs Q , K 5 2 fx e 'Q fy nf yy 4. M f yy K z s Q SEM . .sf':f','122-,1: S N' 5. an X 1 ' --'- ' 'X-. ,,,L,...,, Q. .- . STUART CRANE 1235 GRAND CONCOURSE NEW YORK, NEW YORK' ALBUMQ Vice President, Economics Clubg Debating Teamg Mathematics Club' Swimming Team. 1 THEODORE J. CRIARES 105-38 64TH ROAD FOREST HILLS, NEW YORK Der Deutscher Verein. RICHARD JAY CUTLER 245 WEST 104TH STREET NEW YORK, NEW YORK Chairman, Stiulent Committee On Edu- cational Policyg Phi Beta Kappag Presi- flent, Honorary Historical Societyg Sigma Delta Omicrong ,Iustiniang Pre-Law So- :ietyg Chorus. WILLIAM ANTHONY D'ANGELO 139-19 34TH ROAD FLUSHING, NEW YORK Vice President, Senior Classg Biology Clubg Chairman, Square Showg Square Corner Playersg Zeta Taug Intermural Championship Softball, Basketball. .,.. ,A ' K gr .: af':3sg1 g?'Lty,k 'f ' I .2-Lv Ri . I 2 -4 N 3 V1 lf? 1 . . . .,.,.qv , is 4 4 .ft -.-l'J'-K4 , ,-- 1 f uf 1 .5 I , . . . ' ' :ii ,' 5' .V 'Q -. . -. , 2'.::fQn"" .lv1?144l:15ff-f.ff- 2 -21 59 -LK lg! :eww 'A -VH 2'fhwEww: W .3 ,,,. ,, " 4 . 1 114:35 ilfsl ii-"X '..w2+.a K ' ' ' "I"'-N, .,xjz7,fKQf:,?'4X:3i2w" D2 5 ' -4- Ef fie .1 -A, 'f - .-Q-.,. -mfs w,.f.., z , ,mfr -V M y 15, - -' .pfffevw I 'f'. ,.1 M f ,ii-J" 'M haw k? R.. i .W ggi?" .,,,.m,,, .wyv , V3 H472 'fy x t JfI .,N 'NZ '."'t' F ' i5fgl 'Q5l'f"' 'Mr ' s 1 1 'iw .f 'lm' ,- 1 - Us sm N , ' em . Q - .7- f um WF" , wsu ' E Nw, A-. .-v-J-1 2 5 - -4 - eww. 'V W., W... , - - .if a k ,..,'H'f " L - ' 1 . 'S ...2f1Q2fW" iff H my If f -,E Q., 1. z,wff'd! I +25 "W T' P .1 . Us H- S' ,, ' .ec .-Hiwfwf' ,,5,,,,.t,...:, 16.394 Q,-...:..,k ,,.- A ,Vg 5 5 555 41.22 52 , 1 x .Mi , ., H -f M., ,Eiga iq ,f, S ,N f p . 1f ,,.2 fi"'f.c.ig. . 5 ., ' A -1 A swf ' " f4':1'f.--Sf.. M . ff: f 'iw fs my-'f5i,,1f.1tmWA- fy 211,- , ? Zig I .,.2 J A 'fwiwa-rgfrhrsefw e .ff 5:-st-des ' f' ef . , ,.,ff:f:-:q,.,..49-yfpop,-..:x11 I vg.m4.g1: , -. ,. - ' : , f K'1'f'w.1-gl-ali' '24f"'L-fi-rffffiev 5 Fi - 1 .. ' " -- st -Q Iwi, . .. . , . J . . -s.. ,Af.-m..f-1....- . ,mmm 1-'W ra.-.'f.,r. ... ...f-.mae - ...mf 4 . -T r1..- .fe , -.bl R . Hip' M593- hf -41-,WJgffg,11-2g3kHMW,.l3h,'fwrfifag , ,. Egg- Lg 5 Wfvbgylfqs EMU N 'Rfb 5. if - ,05xm,.', H, A . Lew gnu.. , 'tg ' if '. is' '- 'tif vi mwakz-: 4,,g:'v -nf 550' - ff Marr.--2f:",f'mv9.'f1"? If -Yffxf, ei.. fw 4 .W f. . 1?-i-F ' "MP - - - -V 1 I 1' .uww,sm'aQw2:iQf9w" .4 5 3552591551-5.wQf3I'5f?1f I Ki. . . Wim mf -,W ., . if'-J. .- . Affflvfw' ifgvffvei 41"-5' '- f'--11::-.u-- V - , 1 ff .1 a. g,,,-.-,F M- ,wyfw . feb iw-gimfL'!A'lrr'.Q1. A ,.u,xr..-,Q11!fi2.4l'f-:L-:-wm96?hgs14':-- 'H -- A E mf.. ' fe . 'A Y . . - . .... . ...EM-..y.f. -..r.w:w ' - ' fw., - --m.,.R17.,,,' ' - -. ,, A-,.y:'T:'r-5-b'1-.,s.m-5j'I'5'q5-:wi-:tx-f :Rn-..TQ!:vf-11' ' - ' Mi. .,,-. -, ,, V .- - -,, 4, our is-v-rom-'Pl P41-,:aQi'f ':-21YgyA-+w1'.fx- ER .f E'-E1-f-Jared'--,g'-f:'H- : g p -.E -1'N5k5'5.'2'-'T . Qszw -E '1.w:f'I:-:il 12' A we 'ff 'Ui-W Ex' T'-":'nr R - is fag-Fw Eg i'aff:95Wa-wh ss if ,rfgskgiv N A wmgaffhi 'f:'3K2?5:i-5 gi - Sidi?-Qwkft' fffisx--f J N"3aw .KEEFEI -v,r'1f'1"' SEEQQPREEQEE -QE 1- , ' R234-g?j5.f5.Lf'15:fCFf,.fr4T-? , fig, ' ."fX'f-til" " WARREN E. DAVIS 100 LEEEERTS AVENUE BROOKLYN, NEW YORK Social Cornmittceg Assistant Chairman, Elections Committee: Co-President, Pre- A Law Societvg Treasurer, Chess Clubg Publicitv Director, Outdoor Club: Philos- ophy Club: President, Sigma Bela Phi. MANUEL DE BASTOS 129 99TH STREET BROOKLYN, NEW YORR Phi Beta Kappag Caducean: Blu Chi Sigma, Biology Clubg Christian Associa- CHARLES RUSH DENSON 68 WEST 10TH STREET NEW YORK, NEW YORK Psi Chi: Psychology Clubg Philosophy Club: Economics Clubg Nlotion Picture Club. MARVIN J. DESSLER 1005 WALTON AVENUE BRONX, NEW YORK President, Government Clubg Secretary, International Relations Clubg Public Re- lations Director, Pre-Law Societyg Eco- nomics Clubg Psychology Clubg Foreign Trade Club. BARBARA THEA DIAMOND 150 WEST 55TH STREET NEW YORK, NEW YORK Psi Chig Eclecticg Junior Advisorg'Secre- tary, Psychology Clubg Secretarv, Out- door Club. JEANETTE DIAMOND 365 WEST END AVENUE NEW YORK, NEW YORK Freshman Social Committeeg lfxclzange VA Rl ETI ESQ TEMPOQ Sof-iolog v- Anthropology Club: President, Alpha l'psLlon Phi. Av" ,Wm g 41,-,,. 215 -5353 7... T X 32,531- if 1 f .fn ,- 5 V .,,, .1 f 1. I--. ARNOLD M. DICKES 1571 SHERIDAN AVENUE BRONX, NEW YORK Biology Clubg German Clubg Photography Clubg Psychology Club. NICHOLAS DTNCECCO 248-50 VAN ZANDT AVENUE LITTLE NECK, NEW YORK ANNE DOUGLAS 77 MARY STREET Lom, NEW JERSEY ZITA LEE DUBE 5502 15TH AVENUE FBROOKLYN, NEW YORK Retailing Clubg Psychology Clubg El Centro Hispanog Roosevelt House Plang House Plan Association. HENRY S. DUNBAR 16 VALENTINE AVENUE SPARKILL, NEW YORK Biology Clubg Inter-American Relations Clubg Christian Associationg N.A.A.C.P. HARRIET EISENBERG 130-66 228TH STREET LAURELTON, NEW YORK VA RIETI ES. . .fgmt:'5S9l'i.1aSi'E'5:r.5i35LifL'.."l-'QZQ'Elkilriik.:. . " -4'-1'-.:i2sf5?'2ffQ sim-,f4f+,gf?fY:Eku-Q 1. MH?-ni'ffi?S":q Jw: ' iii' ,f LT."'1X-' ."G' J ze 'T ?.rS:l-,-T.: ,- A---sfhfazwrfih: A.-si -4 1-ff" V, ff. ,-Q-F-K., .Lac .NC K. - -,ae--1' C- A '-1-,fr ,f 2,.,,:g,',.51z..T...7,, 55, 292' Hrs wb ed fbvb ' '4"f"4 ' .,1::,. L 1? ar' '? Esiiaf-V, 5' , ' ' .Lx 14 -sw '- ,:1:"'f - , fi.-.., ,- . , -5, - 'fx-,., '-., ff 21, .. -'-'- Aff:-v':af-,. fwsrf' 5 1":'2'f7:ifffLY-'-"??L.3'-7:'1411+':5:ff1'fwi'??Jvff:l if-zis5a.:.z1f:.-Hariri-V' ' 1 -Hn'--E-Lv .,6.-Effsfwfc-mia ew: cvfsfafffgega- -4- ' " .11 f"'3l1Q:t. . , .,' 'MA ' ' -'wg-ar . -Fil -y N, 1-'?," ' 'ithigvl xii? 'I3'3'15f 15' rt ::Z1:-- - -T' ' 'I . ,.1,1-rj.rJ'- ' rf. V - "Q:'1-F-'-Qvfhrm H.-fg71"L15IkL2,. 4 .rw V-:few .. ff. -.:.,fg- . t -'ami-1 .7',yp.x'.1,fi- R .. .2542 ' -1f.g1:?p3,1..M. 45. .' V I 5,:e',j..g:gi?-:A I 753 ' A-ying., "Hg531:4- . .I , 3 ,H , , 4 f,r.l,ff ,Lf x , .Ar O wl- , 4-1 "-.-ral' fgfdg- ,M GQ! -'-1-"' 1 -5-. -,L ' -:WW 1-' ASW- "ui "Q,,.vf"y'Nf"' jf ' ,,.gS:4i.'.-. 'JZ-pg, M .,:: 1,a:5r:zi4 'iv 4-A 'wg.gy'?f.l -.'211-.f-g:-- 'ffm ' - 'fhij ' I V,-vvfx'- .wiv c-if f 'RN'-" ,rv,,i' - 'f .H--if if 533215 61'---714552lf4:::'1f:fM5 'haf' W-sw ? 4 . " '-fr'-wif' f - f-J, 72' x 5 ' " Z "LE2'gV' 5 kt l"'1x',""'9" 1L 'gps if it Q'- 'wr-Lg .H if 2 ' w H , " -I M -2 '-r,v54?:sW2, -4,,p,"fM5-f-W 231 9 - nw? gm f. .1 H tml 5 "2 jhf K2 35.-fiffi' " vi 'Lf V957 'x 'I 9 'nf-' 'iv zfhfiii-li - - 15,11 ' ,1 gi 'vi I 1-,,+rasj1'c Q W. f Q XV? JJ" Vi Llyjiizwffi f '. 1 -' ,-'15-t 4- 3 uf' ' :PQ-,,v-, ,A . ' 5, if- r- L 5 if f f f Ef O' gi ' f Qy?i51?.+if52?i.i e A.: f T' .. 7 f-wit ? 'wi I O' -1 E ., fs Q- ,., . 1 -4' -mfr-:v.:fw:--tnfwfmaiff'-' fm+.1 ' if it 4 3 fS ,da'fLi.E-if ii P' qv- '.4f'l'35i5 1 1414-ww"'E 1 - Mi' ' W' f W-i .9 it f f1f4:'i7',fgff ' ow -. go -1 . ' f 7. vR5i-Heyy. 1 A il - M -mx. I 'qs M-fx iw Y vw if az., -affmii , ,W W -2 :'r'9sx:stf M fiyilzlvgffiwf'-'Q-2? ww J, ' ,uv 5 .gr -. ::,,n, NE mum , giggfb-A ,, . . gl Q9?,Q2itfi..' ,R ,,, M .. , .A 1 5 W f"'Zf'fi , " 5. ' ,- . . TRY 1 w e? '1,iy2?i6.'- ii' 93 "ww ,fr 1 . rT:' g'ff,- T by rr- ff: A. 'MH-1'f,' - . .- im.-..-2 'A Q ""' ' " v "' V 1 " . .u-if ffl' L, A f. -' ZYWGH -- ' I mf - . ..... 'E EJQGHL w. - - Fyl , - R. 1, O . f, . , 5' -wwf-W if n f --.wff f zf 2 .3, M -. .ff A "5 A 'Q t .zs A S.i' 5"2,4. . Q ff ' . .41 - R. - - ' ' - 1., ,,-ng., 4,04 k -5. ww., :,ffH..1w r- "- ---- , ., -f .. H- 1- ARNOLD ENGEL 74-2 MONTGODIERY STREET BROOKLYN, NEW YORK ALLIED SCIENCE JOURNALQ Varsity De- bating Teamg Phi Beta Kappag Outdoor V Clubg Biology Clubg Tau Kappa Alpha. A x W .TACQUELINE ETTINGER ' 1 1 308 MONNIOUTH ROAD ' EL1zABET1-I, NEW JERSEY 3 German Club: Sociology Clubg Philatelic Society. SAMUEL FELDMAN 2161 BROWN STREET BROOKLYN, NEW YORK Student Councilg NSA Delegateg Chair- man., Sophomore Social Committeeg Beta Lambda Sigmag Sigma Beta Phi. ANTHONY PAUL FEULA 39 VIRGINIA AVENUE WEST ORANGE, NEW JERSEY x W .. :,1.,,.:A.. , . .mdk fa, 4,6 I , ,gif 4 4 gg :Q .M 1- 1 Ev if Y hfxwi talk W , ".,:?f:" , :Fw .T AVI. CARL FIELD 1890 EAST 2ND STREET BROOKLYN, NEW YORK Junior Class Newspaperg Pi Phig Freshman Football Team. Lambda ELLA FINKLER 20 ELMORA AVENUE ELIZABETH, NEW JERSEY Phi Beta Kappag Vice President, Hon- orary Historical Societyg Book Clubg Der Deunscher Verein. WALLACE H. FLAX 1320 51s'r STREET BROOKLYN, NEW YORK NSA Delegateg Associate Editor, Sopho- more Class Neills aperg Pre-Law Society: Freedom Clubg igma Alpha Mu. BYRON FOX 755 CHANCELLOR AVENUE IRVINGTON, NEW JERSEY Circulation Manager, ALBUMQ F Editor, WAVERLYQ President, Sigma Alpha Mu. raternity P"',AfQf" mh :ii 59 " A 55 'gl-My f .,-1 K' 5 i 5.1 32 '1 i -,. ' I, . 5,6 E W J -af ver, 5 :gig W, A meg g,,Afe,1fi,34S ,QI 'F ' V ff' 5 ' mfpim 4 ' ' f 'A ' f-af"ig:1N '2:v . .,,, ' ' ff, 1-, :,.' 7-fr-'2 1 f- ff1-f':L1a2-:f'ff6f,1',,L:O,,- :ef-iff'.115Ej'ff'Yig,h,ffl-5-,L., Q . ' H517 'Y3-11--J ' .L 3- 54- 1 " " 5 2 E ff. 5 - .figggii-' ,ff5i52y'5 5L?' . 1 MM" 1 ,. --. ' A an .,- Y-c 5""'-, -an ' I, :, 4 . W 1 f LSWWGIJ W ' f ' V 11.- .-Z an . Q-A , 1 . ,..- .. -- E ga ,J E.. em, - M 4 - . Anh ..,. 1N A ' fd . W E.. ' ef ,Mgr 2 is Y V, .455a,,k,w-vm 'I 1 1 .,vjS,,,.uMPf-1 .E mga f , Am M iwffq' . E' 'R .,-f'--'-'H 7 sw- 1 ,. ,. . "-., 5 L 5239, " -, J fsif- A skis -,fi 3 ' hiki Wffif . f i Ear.: 'ffm' ' 'Egg 65' ,,,.22Ew.ggg1-14.:.lg12,':f-fe,..1 fy Y 2 2 E55 Egfr . 15 - 0" , " '57Hi?v.V' ,,'aL"'1"-5 'fig 77'15'17?ff J 'Tf5', .--fA: " " 1 Si xrf. . 5, 3 .mv 4 , f,.. lv.-.-.,,1,...T.., , 1, - . , ,, V Mio- A. -1 1- , IVF, JE-11,1 xr,--. n"l's1' . .s - Lf. 1 .T-u. Y- MAA-,.'v .v..7s"'m,4.f up T ? J ww-- -3,vw4m ,f vw :J,g,Q,:.j J 1 2 wsvlgh qmq I " -Lg 'f fr -', f ea:-wif. fi 42-fifrvi:--E ma . "' : . 11'9'..' .. xv, fra. . , 1 y,-Q,-, ' ' ' . - ' V -2 . ' 11-,mi.5-,W ,ii-wa" 1.- jsgf1z+a:+1 21 Q f -Y M? ff i:7f'ff'Wz24,v3iQiai s f f'4-5653 -5' - '3 iii' 5 if' fY'+-w1u"',1'zrffhqfafy . , s .1 In w we . . MM, ,. ' i v qm I fri, , . .ww ,,i.,I2,:pe g iiggiggjgl , , m335QL hw. mme, 1' . , - " fu , .z,Z.,.Mi.,A f,g'f-:.i':5 .2 .sk'f"':-1'-r. -M 'F -Q.: E 'I' ' f f-Lyn eE.,.ffSi?f'5 f- N'"',z'1':'qwba:1.m-. 1 -. , S Y 'em' '-f-ff?,.A 2::m..'.j-,':-?'ff-frgmyo ,.'Gis'e,Qi.H1s-t-riff, V ,mmV-'ffvffva-w?2a:P.ff'rff'i1'Sf?EG:E5 N. , ' 'ww-ifsixelfiffavfz ' 177+ " 1, mugs, ' -'sffnasaxagg T . F ,- A ' P .I'1cx:.,f-'- ,L -'----31 .2 Q, . rf?-fQifi?3k'L-VXP'-'SEL N' FQFN. " 'pl' ,-NH.. ., . A . If-E "Q: vncfki.-.:,: fi Ifswfzff-wwe E wffvsgsb. I: f swag Aww' fi Egfgffs Ax 51 YA' ' Nbr P92-wif? . if'-5fbY'!2-f7fq .-E-:ffl -sr-fu , .- f -.,'f- v-- - E.-E.-qv -,1i,,,i,fE..KJ:.':g3 ass, jf .--'va-, :N -4 v-. 14 . SQ-:J . Q.,,:B-.....'5.f as N' --M -fn . " 'ifiu' ' . 3.111-:::.v.:?,j,f Q 51, jj-,-y,:iq4.,,g::-.:gf' 'RA 111 5 . - NORMA FRANK 240 WEST 98TH STREET NEW YORK, NEW YORK Book Club. JEANINE FRANCO 845 WEST END AVENUE NEW YORK, NEW YORK Le Cercle Francaisg Pi Alpha Tau. ELSA FRANKO 277 INDIANA STREET UNION, NEW JERSEY Book Clubg Economics Clubg Delta Zeta. FRED FRIEDEN 742 EAST 51ST STREET BROOKLYN, NEW YORK Feature Editor, Sophomore Class News- paperg Phi Beta Kappag Carluceang Bi- ology Clubg Motion Picture Clubg Der Deutscher Vercin.. JUDITH FRIEMAN 244 STEGMAN STREET JERSEY CITY, NEW JERSEY Psycholog Clubg Sociology Clubg Jewish Culture Fliundation. FLORENCE GAMPEL 3217 FISH AVENUE NEW YORK, NEW YORK .llfwish Culture Foundation.. X SX 3 is fm. IM x :,, 5 if A,, l,EQ ,f J NORMA GAMPEL 3217 FISH AVENUE NEW YORK, NEW YORK Jewish Culture Foundation. CECILE DARYNE GARET 123 STAGGWALK BROOKLYN, NEW YORK Le Cercle F rancaisg Lambda Gamma Phi M. BRUNIE GARLAND 23 ROOKRTDOE ROAD MOUNT VERNON, NEW YORK Psychology Clubg Opera Clubg Book Clubg Christian Association. RAYMOND GERSON 1 SICKLES STREET NEW YORK, NEW YORK ROY GHERARDI 32-25 111TH STREET CORONA, NEW YORK German Clubg Mathematics Club. PETER GIGLIO 22 GRANITE STREET BROOKLYN, NEW YORK President, Senior Classg Secretary, .lllflifff Classg Upper Class Advisorg Vice Presl- derlt, Caduceang President, Der Deutscher Vereing Ehrenkreisg Photography Club- .,. x 35 A ,-fl-af E.-mg ,g 1 .,- 1 ,- ,:fff.,,,, '.Ai"ffQfi"' 54: "1-'va vw", f E ,835 m BETH W, W Ref Fw Q . - - ..,, W, 5. ,,, -'T '..' HOA 5 'R-, fi '53 gffbk, V bg,-v 1:56 " , J-f-"-f'1' A , -, , ' .rf we 3g5"'Ef-i.'-N..,ff"i ,C ,J 'e' . .E MQQZE- 'Q-+"3.:,t54"' f-er:-:WSQQE5ieig:6?.f,JiQm2J3g-.f+2f:::fR.:f- ' 43671 4? ,g. fs, x ff ' .. eg'.af' , Q A :ga . -T, .f i-L' fqifigaiffii , , -If ff , .f W. ,,V:- " "':!?'zi.5v,. - 4 .-'irrlfivh ll'5'll!"lff":'Q"f'lgl - 'cizifi-, 2- .- 'bw " V 's"f"-,,.-f'f- ,QA-511 q-bf, '-'mf '- .gh b T- 4 1gff.,f"yf"ff' WJ. ' -mf, E .1..35!4'E4.f - f3.f'f?'f',N ,. ' ' 'Af ' ff i:V'l'l fi--" V '5?reb-Eels..-.l1ff' A ,'1'.' Fm,-' 1' rn! ':r-Vv 'Ylizei-15:13-.51-,r 3:01-z"nf-ga' mlb,-1",f"i"' fig ' :wig , lf!!-5 fr:-5l61p,5zs-'.1C1. 'SY-'l','12.s f . in ,f I-,wg , 5. - " 34,1 , -- ---Lrqvggeg-.1fm-:.3:'3: - A 45? nu' 'ff H 4: ' ' w' aaza+.fgfQ?g1:,-1 .ai ,zf"""'M'l. fl? I .r"' ,C if . 1'EffP5:5L:1EEZQ U , fg---Vw 2 I 4 YmszW5fl,5fz41 W' 'wg 2,1 .Q 1 yq43ff,Qf.If5gQr - f f I Y uf M gm-' , 1 , 1 X gl-2: li -e21z!s,f,Qg, ,, ye gffvfiwi f -'If vmf- -we VH aaa hpzrhfafz J I l i fi -fl J", Q :ffM?"5?5?i'1 lwlnylir v . 1 - . .2 Q3 . , -ae n,M,g 15351 ' E, 117 ' Q -' 'i:."ZiJ2f3,E'1, : ,Z . '-3f'11-WM' 5 ,525 s fl fgfz lf liiir-fgfii , 19-.. R.: s as-"wx:-H-fllifi f A" iwgufa-r'-Ewa' A--me f 'A l' : sf ef- -:,,-'f:,:,-:- I ,.,f":f--.,.9fxf'ef12w-159 , yr 1"-ml. x V""4l? : A55-'if-al?-Eli? 4,H2'fBl?2"' 'Q Qs' . ' ' ow l., ,',,. ,X ...,. X w' E:-vb-' e-- ' . : 'A' - 5' .V :,gm:,wzcaairggm-.a:,.- . ' 2 e :a"f4s--2 ' Q -.L--Aqyk' 4 -p.p.- ,. 52,5-Q:-:ku-Ep:-: ff : - 1 .9551 Jfwrf ' f 'C " ' g - 925- ui-qw. f. si 'JK 5 Iss'f5'f'- bt . - "w I E ' . if-' 'T l:. 431vf.af," f 5' - 1 359 -..X:f2?f,, - an , vi wi 1335 ' ' -.1 in 44 . ' W I z ' 45,-21.-.23 I 1, jp.. 5- 'I -1 - 'j:gg'!::- W 1 ' I 1-I F1 ffwqf, 'M' - ,.f- hes'-1 ' 1- 3 . L 3 A 1-31,1-vsA..'g. 1 . , 1. ,f -W I , if T5 asl,gf,r,. www iw 'W W '35 I .rye I ir: ,. ' bbw I.. ' . a fi , -Qyivbzr 9 . .- EI' ' . . H- my ', R . , .5 :J ,yr-, 7,9 1, -..,. .EF Lf 1. uf.-.Rh ,K 13, K- J, J, qpgqn. " .maj fb -422155 fam' 4 21,51 Y W. A W , dz:-YQ.,-, . 5 . ,. 1' -5 qfpabi JL., Qfigz- -i' six- .. J' - , , ' .4..qE.fs:1-.. :msg-2 H L , N -::.f--wg .gr I .fl an ,r miner .E'1v:q. .135 -4 jk eff?3+1f.f:sf4 ' ff , W, .I , ' . ,., - 1i,g!r,' f -' .W - .. -- 1 5 W 22-' .E,f1,x- lhliifflk-' '1'.' W5 Q. , - I ..:.v.f-11.,n ,,, N . I '- ' ' 1., -.-,..L,..,4,,,-M E., V- H g ' , .,.ww,fg,'4g.1q:'f3:ss:,f::gguL,.ygrg:'q::p-E-W ' 9-'if- PW - 1 -f' - ' Cy '-. Maia? ' i l u f-' 1-, i- " M I N' 'A H ARLENE GINSBURG 3448 WILSON AVENUE BRONX, NEW YYORK Sociology Clubg Jewish Culture Founda- tion. DAVID Cf GLASS 40-39 48TH STREET LONG ISLAND CITY, NEW YORK Siurleni Council CScl1ool :J Educationjg 5, Alpha Kappa Deltag Psychology Club. ELENORE CLICK 687 WEST 204TH STREET NEW YORK, NEW YORK Social Committeeg Book Clubg Spanish Club. HELENE CLICK MAN 627 GRAND STREET BROOKLYN, NEW YORK Vice President, Lambda Gamma Phi. I Q R. 51' S "! v ,- .. A . .-up-VME.. gigw- 1 :uF4:':a' ' GLORIA GLIKIN 30 KROTIK PLACE IRVINGTON, NEW JERSEY Assistant Editor, ALBUM, Book Club. SONDRA GOLDBERG 2015 CRESTON AVENUE NEW YORK, NEW YORK Biology Clubg President, Doll Plan. BRUCE HAROLD GOLDSTONE 909 SHERIDAN AVENUE NEW YORK, NEW YORK President, Debate Team, Vice President, Pre-Law Society, Secretary, Economics Club. MORRIS M. GOLUB 777 EAST 18OTH STREET NEW YORK, NEW YORK . 'Z-'g' W iz. Zyffbngpf 1 L . fl 4-sv : if-Q?5. 2lf:"?1 . 5 -4 .2 - . , ' 'g1,z::5- :qL1:.7L 'ie, ,. vi. E J ,ff " L ' A45 Q PP'4:v'+ it- 23396 ,,,..:,- ,Q-55353 : , ,..QZ65e f - -Y fgyar b w: rf V . "Im-1:2 ' Jail gf. f. - ,R .f-t.r.:1-11 egwwefwsffe c -U ef? 'fl fbi".--,eww ffaf-6-f f if--fe "- W H1 -'-vivid : -- -zum fa-M -4 5 . 5 V- -A -..,1? ,s,JSr?W??4?' ' 9 -1 : 'Jv zfgs e'- , V r Q ' +-- rkwmf 127 J L ' - W' f-f"""K -:wifi :Tn " 'W 'Qt' j Fbi ASX: '- , .E .. -- , - My ff ' wwf- ,R . A . 4 'R -.. 1 qrlw. -.. ' W, . :-4 : 1 V, .Q-gg.,1.5f, ,N 'Q " .g M . ff' " , , .amy " j liljf- '1".f,7.5f4f"Q,r. .2J:E"' 7'3"-S14-'ff'?if15e, ...'-'14 Q .2 -' 3 5 ' 'Yi 5. :Q 1 ,-r' Jr' Q -'Ac pgwlr'-' 'M 2: . . , , -fig' 5 , 5? j 5 ,c,gf, vzzkwfwisgfggyjiiwdffih' " ff" 'Sf' 5135- 4'39E53"W ' 1 'g"1'5'V'j'i1, f ' 4 " V' TW? vife',?:f, 'L iff 45, 413-Nf" We ' Eg.-safr' -.sf-I -- f Q uf5,Wf+xff2vf22g219 ' 5? 'i f- MFW' a'3?n"' bf' - 3- '-v- if" ifi qii. Jww ,7"f?i941-vii" .........,..,,..,,Af-v 1491-5-:lf I 4 - 4,47 when" -1 F, 'fm-gfymaii gig: 1 . . - g'F?1'yg1sf'1M..?,iwr' 'fiiqwgzm '?,17M1g,mp?FQ x., , 4:21 '23, tf5,6Q23g.egXwf-"'fef '-Q I E , ffwwgffaYggH2xyk5ggf,ip,,H-135145Q E me-f-f1 f1g 06.f., -A W1 we Hia- lf ' .', .'U"17"1'i1:5?A- Q. ,,vf',."f. 7' ' '-" ', I'-'iL. -- 4 'ii " 5? R' ,su-I 1, 4.. R. V.-.,, , p ' U,---... f- - ,-i f --!f1Q1f..Jq.f,,,az-Q41 9-, : per- fn 44.1-112. M 11,9 " -0-fm ,ffm .4-4-ev., y.WXc fw- R ..,. Q --fx.-E-141.21-2-ff. ', 'rv--Mi15j':" mf - T,-:fa 1 '-P A-.1 :, " -V. ,- .. '-'mff:f45 H' H R 2 EM -L i f 'X' 1 . . . rf 1. an '-. 542 "--gf:"reiQ..-ffm '--w:.:.:'3'. :.f-- F'-:Tb ,. g 52- iffe-4 W? ' "--' 1. '-NH 'rw-1'f":-7 Plant- -' y.-. ,. fp .. -sy! . - r L. v f 'Sv-f-we' -s:r--'14f41:-- 'vF'91'- - -"fs-f . A'-f-M 4.3.-.A--f.-.,.. - -. ., ie, . ...1-.f M... 1155.1 ,. -'-.i.,-'-im.,- ,kg--9:-Q-f".7s .- gb-V1-Y .vm-. I2-'I-1.41 . N 2 If ,, W.4EfQx+v,3eSx . ' 1 ' A J? House Y.-:. 4,14 . QA cya,-9,51 ' ,. -:ga 9,36-2,i,.'if' 'Q- -fiigg-girllfl I ' 'fi ,, ES W. if-ere -' ' , KF iefagtfz f'N1-y1f.ggxgf:f. hr?" S' 4'-4 1. " zxrszg,-f 45-'Pi-..w 1-if:-'r RTA-':fgj-fi... - Eg .ef-wif -- iw' -wh' su .,-ff... R5 'TREE T ---+'..f.aEf:i:z-4' r,-54-ws" wif' Q-if? b?'1fif"' ' -f"'4'i'EeQf.QEm5,,.,'. 1 A i?"f -ag ' ' - . f-' ---"X -L --L--..---R, an-1 -La .1-1 ,-R -:J+r'Sf-5 ': "v-4-- f--'-- .-,t,,-.L-'f - f -L1 ' fl. -1-swf-'-" ' A - ' JEROME GOODKIN 2928 1'l0LLAND AVENUE NEW YORK, NEW YORK RICHARD COULD 2310 CRESTON AVENUE NEW YORK, NEW YORK Der Deuwcher 1 'erein. MICHAEL L. GRANDELLI 680 EAST 21sT STREET BROOKLYN, NEW YORK ARLENE WERTHEIM GRANET 901 AVENUE H BROOKLYN, NEW YORK. BULLETIN1, Psychology Clubg Della Phi Epsilon. FRANCIS L. GRAVES 58 FREMONT STREET JERSEY CITY, NEW JERSEY Government Clubg Economics Cl ternational Relations Club. MICHAEL GRAY 327 CENTRAL PARK WEST NEW YORK, NEW YORK Square Corner Playersg Square Show. ubg In TE. H:-1--:if SF!" N 'vii lf' 1215121 ...N 1 iz I7LqN", qs-Q .city Hhallulgi Mi,-Th:- 7 Q01 'UK!5.Q,-ipfiiiiii 'J'M:'E55 ' - A .'f1'fj-1'IE?":x 1- 4 """2Z?. ' 0 A2i"11:f1?i-iimfflfgxz16515 -5 Q RUTH LILA GREENBAUM 83-14 MIDLAND PARKWAY JAMAICA, NEW YORK . Secretary, Psychology Clubg El Centro Hispanog Sociology-Anthropology Club. IRENE GRODY 105-28 65TH AVENUE FOREST HILLS, NEW YORK Sociology-Anthropology Club, Psychology Club. IRWIN ELLIOT GROSS 185 PEMBROKE STREET BROOKLYN, NEW YORK Club Editor, WAVERLYQ BULLETIN3 Vice President, Camera Clubg Psychology Clubg Biology Club. JACQUELINE GRUNDSTEIN 1490 EAST AVENUE BRONX, NEW YORK Secretary, Aesclepiadg Chorusg Orchestra. WILLIA RUTH HARDGROW 408 MANHATTAN AVENUE NEW YORK, NEW YORK L.0.W.g Chorus, Delta Sigma, N.A.A. C.P. ELEANOR C. HECHT 147-45 71 ST ROAD KEW GARDEN HILLS, NEW YORK Speech Department Dramatic Group. , ..,:fxfN"?.,M f' - . -'W-sry., ,,. --1--- sf-A-,Q ---.r1:A-Q"'3gr4mUK1-- J- ,..:,,1?-A-3:59 PTA., , w:5fgge?AffQA,:,1R-'gffwr-,f A--A: ,RAS-598:-5-9 .,--v..x,,r'K4-, 4,f,:gg5" mg -r,'r'ig?,..v:,5',.L?Z.: - -fi-1. .4 ..--s- .1 :Q -4' 'ff",A,f',"-' .O " 5 .-:Off-N .Amr iz- :.+f'4 -rziue' ga X.,-f QQ, U, 4,--vi.--1,-gig: sg,Gqa.....fvf A ' 5 xwfgf'N"g,'gQ We . QITFQ-i?i'R 1. 1- :,- Q 1-a'9z'2-Zfff-'ffN:-j..'- 5?lS5,S:4f.,-lc"-J .. N..- . -.,..,., .. we ,J ' ,. A-Eiessf .- ...rivv .- -A6-...A .Ig-.A .. .-. 1 .,N.,,,:.-- :' -' -- ' - , 'W 439666, -H- eaif-' . ,,' . fm, ' M. ' 16' ' T irifif. . . ,116 -QLgS'Qg . ' iriin ggi? .,. . mms- -WE 'W --. ,P ,.' . ,dfqgifssu I' 1: " '5' 497'- 0 WS f . . 4 - 'W ' ie., , yfgivt ,T -f S3 ffm-5-. L' 'K ,Jw . 1:2495 -' ..:' ' -4 U - N' , - D . Es?" If fi" . tw- Q ' 1 1546.43-,1.'f "fm new f 1 f' 1 '- 1. if '- FH1-3 41 Q ff- 3, ..,,,, ' -Na' 25,0 f ' f' I f 1 fNj,.nyj3,, ff'-9"-xH2:g55gp'A 3' l WEE? I . Q 1, E, ,..:'-JF' g2?ib4fY:1-'z F' .ef ' 1f5l?1Ef?12,Q4w1-. ,qw 1- 4 Ift'y.5115.jq:xf,:' .fa ' . 91, . ,f.:.q 5 1 -hz 334.31 Q T jvU,:x.: ,. ,E.!.3,3f,?1f S! 'ZJIJSY .x .. Q 'CEL ,f : A ff '.- V -Q. qw,e,.:,1f ' ,. MW X, ,, ,g?3f" c . , Egg-yWij2s5'ggQ1Q51 3121 3 f yn 1 1 . ltyigfgwf- fel. 'K . - I U 3 -Q14 "ff, ".p':fw'--'1fi,u-- f ig f 5 1 5 .-Q gif'-514.11-S-afut 1, . -1 .' 4 - . . ' 1,2 - V ' " 2, :gn-f 3:-: f. ,jk , ..j.,p- ' my 5 Q 2 J" 5 ff Fi 2. sp 1 5- 1 4 1 , Jgssgexxsamgtsgt.mfs .nv .:. K- -5. ax ,, - ..,- Q.: T ' rx'r.f'5'- 'Y-' ' . . 1 ' 1.1, . W4'-A1-1L4jfi4J,w.f .J-'fvw7Q'.-' 'E 1 1 :L -I . - -H V f.'mv-y 4-2' . -' ' "' ' E' 1 , , . -' -r9.2.w:. ma, , ' f 1 1 2 "Y' S1642"f f -fl' L g .-5. 9,3 I ,ig gag15g,gfgfQAs,s. 'gf . ff Q . :f y 14-fXwff'x1'1.f-'E .1 2 J ., w YL Q. . - E 1' -E 'X f' I ' 'A 1 f."f?'1'2'f.lfFf"v1 'f 2 Ef- . il gafqq , 5 ff',?1ffq5521'11'E.f5igz1 ' 4 W, Q .:L1 - -fd? t iid , fzqfl gf! GE...-K' - fl I W C A , a '1itg:.a' gy, 34g'l3fZ5cf.u,1-f-254511 ,,...-mF1,ff,t,, W 'We 1 -L ' " 4. f-'12 ."1':-"iii" E- K--' "' ' W sg w r 1 TEE . -T-3"h' .E :nw-1 24' f 5 13? 3 ijqg, X ... . . , K Y' , 1. :Q . , wma 1 1-. W... .. QL-'Zvi E j f 1 31-E was imnzf-2 -vt , L, 'v p f' , 'Hd -Eb3'f'-4771 ffffif-fi ' ff W' ' , pzfHf"'2v,g' Q- 9.-4542. :. wreak Fi . . w"7VA.' " g3'-ff2ff2i?i, 'Ei.- 1' '5 f-EVM' 51.5, 'T 'dwg ff' ' '5"f. ff. , -i- 4Q.wy24:'J" 1 L'lw'?kf3.2::,'-:WW,,-Mg...ft ., - ' - 2 CHARLES WALTER HECKROTH 75-4-2 186TH STREET FLUSHING, NEW YORK V ice President, Writer's Roundtable. FREDERICK A. HELLER 100 WEST 45TH STREET NEW YORK, NEW YORK DOLORES E, HEYMAN 99-18 62ND DRIVE FOREST HILLS, NEW YORK Le Cercle Francais. STANLEY H. HOFFMAN 545 WEST 111111 STREET NEW YORK, NEW YORK Student Councilg lV.S.A. Deleguteg Pres- ulent, Club Councilg President, Students gor Derrtocratic Actiong Vice President, nternattonal Relatwns Club, Secretary, Government Club. X ,.,1-2.4 " i ll' Ei 4 1 -ifiii ei . .X 54 A N A.. ,,.x 5.2- 9425-, S Q 'a M, . ' 11.5 .sf 'vga' 23-3-- ,i,,1q.. 93 94 MARGOT GAIL HOFFNER 697 WEST END AVENUE NEW YORK, NEW YORK BULLETIN, Pre-Law Society, Alpha Epsi- lon Phi. MAE S. HONG 525 EAST 14TH STREET M NEW YORK, NEW YORK ALBUM, VIOLETZ, BULLETIN' COMMERCE , BU LLETINQ Writer's Roundtable. -Q-.M A Q ' i E 1 at ,...1f"'i NONA JANE HOROWITZ 941 WASHINGTON AVENUE BROOKLYN, NEW YORK Feature Editor, ALBUM, Junior Advisor, Eclectic, Fourth Estate Club, Le Cercle Francais, Book Club, President, Lambda Gamma Phi. ROBERT HOROWITZ 181 ROCKAWAY PARKWAY BROOKLYN, NEW YORK Co-Sports Editor, ALBUM, Student Coun- cil, Alumni Vice President, Sigma, Chairman, Undergraduate Athletic Board, Upperclass Advisor, President, Pre-Law Society, Treasurer, Debate Team, Pi Lambda Phi, Secretary-Treasurer, Tau Kappa Alpha. , gf O . '35 ,fa ' IQ Y f l ,, H !" . 1 2 ,., ,if--. 'Q i Rial ' ' .- ' 'a is if ' .., YQ VY 5 N- Ev 'is 1 1 15-. ' ma -I if me w uf ' ' 2. 3 -.si fi Y Q 4 " if " ' Y 6 .1 E 1 , , . Y , ' .1 :E-A41 2, ' - ' fggffxi Mizg -. .514 L 2 if he qu. ?5,.e, Q- .5 . . 1 -1, .,ww.- 4, I - , ,EH -,, ,R , N Y ,'-,F :tr-. 'Y 1..,i,. , p 'Q355 lfx"'P77Y'f1"' Ai 11 E ruf ifrg -was Lim? ' -,411 ot- "1?7R'f7Z:f g ' . ,K-'f f -5 . fy- qv. ' i - .iilgw-ff'.w f wif jg .- AM -me 1 ' 04-14" Eiqm ' gif- 2-I5 L -we :ff JR. 4,541 e g . Le. ,, N. -'rx L. ' e - , , WE WM we .1 , M44 'I' ,- in 'w-.L Kgm as 5 .1 - fwgo a .A-.iv L62 .""' .. 5 if- M E we ' 1 J'-'i"'2erm 5 ' Q N 5 Q29 . .. .., .35 5 2 L .sw . ' 1 fr ,MM H" . f -E ' " ffl'-rw se? . . ' .1 -f'1"f Ya. - V 1 3 I A f JE. ' -':. - - A ' -'2 Eb A -sn.: v ,,1r2w-W.,-:ff'f'1" Hui- fl 734: 1 I -A 1 ', R. -EZ-,Y , Eh' '-ag. Wdwyi :li 7 . Y,-7"' ,.-:.f., w.,f.J.,,e,,:.-,-T,5,wa-ay., .R 15-1-L -1--ez'-.:JEi:r HAM' we-'.. : '-vans.-Inf?-kw:n-1 lf 4 ES fe F-- 1 4"f"" T pw .,. "rn-gg ""'3:'f5Cfvh" , f fm.-f fs' ..r-ff?" i':s4i'Q!1gg,wg- ' i . J A .- he 3'5' 541m l4k,w:qf-5l'365'g YEELQYYQQ'-' 1 " 1 R: . ' ti, 51911- ,-gg... - 25 "fs:-5' 5 v,v,"1.,f.f,i-'1. -YA .K - 2 fig: E ,T ' , iii "i2..19T'-Wil Y 5 . . ' ' ff-" ' ' - 3' 'il-U if-1 ' ' " ' " "A ' 1 - it sz.:OM?i'1 :Q.1w,,s -if lf'-ff: -E ,i,4-AJff,i4:g,,R:- .- -iahigaaa-2 - -r , " sri-.' ' 1 --L., 1 yy- 3 1--:gf-R+..-1-.ulwgwff1:11-.:f1f4f!w:ffa,+mEw,syf,, . -. - WEN,-.,,,, , ,':5-,11yNp5cA15gi5f.g.'.,:--fmf3e3Q,x,5g? , - , T .. E2-7,y, ?f?'1'13?i'2255 :gig 'm, "w-is - ?f1'43Vf.f"':'f1Ii"'f-"'- 'lC4QL4J M ' f- A " TW? A?" 4' ' '.-1 . " :.- "1't"' HV- ' , 45 5 'aff' ff' . V' fa --:fF'::f'-'W e:5gMy:51.- .Q Hai... 'S '-Lea31Eepfqf:,.. ,4f.pi,g:1,. -. 91 -f ?.giy.,r?S ' ' ' . ' -- fr ,E -4 41-,,',q-v .4 --1.443-..y'-.,g-42. - - a'-3,354-.R g,.:1f??- ' 4- .5 -. H A . , p Qf:-2. 5, fc? . , . . 'fF'm5LG9-S?-,MLN-. P L' 4 -cgi, - -'a..fg.m ' ' f:'I,- .. 1 '- rw- .4 R:-. .Q--f. -f , E M-4'1:'gM-fE':.:Gf'EW-7 'A ' 1 -52-f . x af' ' ,...-,sz1'fa-wif. w.,mi4Hl. -' vf . -4f-9?2:y!-we-arg --"' 4-"vw-i:f-'4f":. wal-. E.. Y... -gk , f ,ff .. -1" "-I 'Nfl' ' 11-7455? 'AE'5A'fi-'-H1,i:vlnLi-- - . - ..i-1725, ...,Q,-1-.ibnlv -- -.,!:iQf,,fC'f,,5d.5,q -?.c-,R-+J5K:.1,., -1.-gif-fm' ww. rAy:'3if"4-' .. - wg, ,...e"!1-vf2- 'E'-:fe I-'l.,'?Q'eT-'I .L Y.-:T 'mio Q 9'f-TE-bfi-Jf"f,F3?15'f ' -: W- 1 -- -1 ,mf--' :Htx K- V- f' Tfiigrf Qgvgggfx . , " -Q-El' : 7"-V'ef+E."' "Q 'N-.+"-'if' N ' Assgrff-Ewxri-f?.4.E:2f5-':'54r1! :G-,'.. .-H. --'-1 ,..,yg.,.-,,-1.,.,. f,- . -- - - SYLVIA ENID I-IOROWITZ 110 EAST END AVENUE NEW YORK, NEW YORK MARVIN JABIN 7 ST. MARKS PLACE NEW YORK, NEW YORK QUINTON C. JAMES 243 PHELPS AVENUE BERGENFIELD, NEW JERSEY American Chemical Society. KHOSROW JAMSHIDI 7 PARKXAVENUE NEW YORK, NEW YORK President, Middle Eastern Clubg Chris- tian Association. OLGA PEGGY JOHNIDES 6211 BROADWAY NEW YORK, NEW YORK Secretary, Russian Culture Clubg Le Cercle Francaisg Radio Clubg Delphi- Hellenic Society. HAROLD KAILES 1 OVERLOOK AVENUE GREAT NECK, NEW YORK Economics Club. .f"""m . lv. sf .:. -.FM "W: .uhh Z., .,., , " ?Na. 4 4 , gy, Q 45, 1 ' fs, a f ff 1 W' ,, W 5 ag-Qfgvff egg fe . 235.1321315- Qgrifilfi yp:fza5:1.51q , -1 '-,.-.rff - W GY--,fu -.sf " " gif" 'w2fm:s:-.17 . ,f e '. fmwwmnmewna R v.f-:.v:f:,.t,,.-qvz: z::4:m'-'- st, , -- ., .- tiff 371.15-2 sfliiw rl- "f1P'i'l,- 33511. 'ONQEQWQWWR :-V zf: .1-:f-.R-,-1, fffwizzramws.-Sw: 1 6 . Q , 15, 62 4 5 , 3, V--vggmg.-':q1, S 1. -143511.-ve: " .a:.',f,.s-,q:z,e:.2Zgg3:t- 5.5 ' :R .: M1 -.:::':f:aQ?6:eqE X ' '5lEIEE?1s':::Ef:'EEiE5i5555f5 i A . Emgmwwwwmz QWMQEWEMW .. ., ..... . 1, .,:.,p.,,:.-,,M:, --me--1--,.1s:v:--y--'-gm I -A ::1:t22:sw:2G1?::2.1'1? . -V ' L-i'EI:!:2:'s' 2123125 3:-2123351254--Avi.. . :Qc tw. .. 11p,.:.:.,,g'-ms M151 -, ,35,f5.t, :xref-,.., -..- K .1-siif' . 5 A we-2512: 5:22. .i me- -EQEQEEE-Y 9' . Q ABL! ,xt wx U Y Y C. af. 235' S'3Si5g:: g' 'QQ5:I5f'1: ..,,.n,....E,E1,3 .v,t . 5: xx " QQ . . .fl Q5kQBQf5 page f X' y 'iffy A, f 7 1,1 J ,HMI I 1 if Y 39 f, '54 ,, ,,., , - W , if t s:,,,,.,, . 6 my ,,,, . . A., , . .gs 5555355315 "zz V f t 4 . . "S-X ?: ' f fw Y ,, - , 1 'Y' E 4 ,,. , . ..,. V- 4. ---- 31,4 5 A, 2,4 ,Q ! . - L 25- tgsa rv gg h . .A ,. ., Q, 1 "f 1- . . X -, - ,w.,. .,, ,1 - ,Z , Lv '. ,f - 2315.21 -f c '-: I' A ' '. .':-'C' ' 'vc' '-,-2.54, , T f,,.5.fWt,,,.,. ,f gegfipfv f g 4 V A A, ' i Wm-1fZ?"f: .Eew,wEe . 9 324 ? .. E' ff- , , 2 ,,.,,,:,,,, ,,t.,. 1 "rfb in ' A '-wail. . ' , -1,274 SY. , 1.2'a,e'1m -. 46' 9.17. 47. .1 P . 4 , f -fiaff-"Gees: :as f 1' ' f- ., um .: , .f ,QL-,z'.:5.'::11.11--es,'.:ee,.--1 HOWARD P. KATZ 1947 60TH STREET BROOKLYN, NEW YORK Biology Clubg Delta Gamma Rhog I.F.C. IRVING KATZ 18 AMBOY STREET BROOKLYN, NEW YORK Associate Editor, MATH XQ Mathernatics ' L Club, Account ng Club, German Clubg Saddle Club. SHEILA KATZ 511 EASTERN PARKWAY BROOKLYN, NEW YORK BULLETINQ Student Committee on Educa- tional Policyg Junior Advisorg Phi Beta Kappag ,fustiniang Honorary Historical Societyg Si ma Delta Omicrong President, Eclecticg peech Department Dramatic Group: Pre-Law Societyg Book Clubg Alpha Epsilon Phi. LESLIE L. KELMINSON 287 SOUTH 5TH STREET BROOKLYN, NEW YORK Phi Beta Kappag Caduceang Biology Clubg University Band. JOSEPH J. KELMIS 30 DIAMOND STREET BROOKLYN, NEW YORK American Society for Public Adminis- tration, Government Club. GOLDIE KERZMAN 223 LOOMIS STREET ELIZABETH, NEW JERSEY Mana ver, Day Organization Ojiceg Chair- man, Senior Prom Committeeg Chairman, Senior Social Committeeg Chairman, Junior Prom Committeeg Election Com- mitteeg International Relations Clubg Sociology-Anthropology Clubg Book Club. ..ffQwwsG5waeFa New ,ueQHi555,wNfFSwQS33ExaH , .--.,1g-.riff .M-rr. JN t x V.- .-:s3E.7T'i-135'-2-...f-,Q -Mm. f -: v1w.5?ew-w.'::,wN.-43,512 ..s:Ep'i1'r2-f 2i?"?1'f-vfesr-L-fkig., .. . - H:'.t.- 41' aff- WSW Fe: ":'f.z1'?:.-:Lf-Q1:.1 ,vi 'tv' -5- ' Tv: is ' 'Q-'if-P" leefggpifa- gi ' 7' "-1-"',2Za.,w. -, 14j.:gg-sian'-K? 5-if 5333-5 E -, ' -"rw,-3B'5.xf:r .,.y.,:g.w3 E 2 - -.255-l gg -4.4-figif, Lf .' 215 -fi 31' 'gllfv' .-.,. , guy, 45:5-4,-J ,..,,.s-M - - 15'--,kr-. wafer.- . -1-Reef fam ers? ZS-Q -,ig . .QRMEE-if-E: SSSQEEQR mimwf 5?W9fL ' ' Exeeh ev ' 'Y "it , , yt ,. . 1- -0 - we 335'-+-T-ff:13---PZQETQ.-Tz...'-ee--.we 1 ,.MQ5Q5Q3iEsEQeeEwrf An xgigeievwefsvwfkazfvi e2,9:':-:?t1,:35o1,!?Q-3:-..3:?f - .-,nfs-f-ts--A. A- .- V 1 1 mg, ,,.f- ,, Wg, I , .FJ 1,2 ??"N W' . ' -' .wifi f . 5 ,ff - f" w. ' W " '1 ,- gafws,- 2-H f f i v " Awe5::wg'1 1, , yi fs vgmz-" 9' Q i, 17 .7115 44 . g a gow g. f, yvw Q ff. 1 ' Q L 1 - - ,cv-ffzf ,, ,f z9'2 - f r ig: ' , ffm" 571155, mi ff L K I f iffwfew ga. new 4 ?Pf 'W . ,, .,-.,,.z.f'-i""9f' :Jim E ' Wi 5 19,1 'I 'ai .5 A ' " A ' ' " 'Lfif??SQs?E'i'R2'vt4524:21' 4 '.- wif' ' ' f fi me , .M R1 5 A 59.55,,.wmrf W IM 5,841 44-MM mn fm? .W R Q, -. I 3, .57 ,M J. ' , if - fp.: -'QW' M E. M 5 -W. S - -. ' 'T 5 ,.-Q' L55 W7 N51 'slam , . T T Q ,,.,,L3gg:z1iM 7 - I -, in-4531. .uw iW1,,,.,w1 K 1... ,,. ,111-1 - , -Q .R . -Ta., ., ,. 3 -' :wh V7 mfs-1, ,ren 'wif 1 fgf51"2fi. 1 ,Ji j g , . , A 133. .,Jfi3,.f 5 331 A 5' -43.49 -,fyf,qgg31ggAgvgywgazggmm 1 . ,,. ? 4 ,x-se-' , -411' .v N- f-1,41 -'S '3f4:F'l J il ' -- Qgir p ' , 5411, l,:x,f5q-R5151Q1,iQfyjfpa,qm'4f 1 1 1 -T --:Tw A ' A EW ff f 15" A 1' .A 1 ,--- w - 2 'Eiga is - . fi 525: f fiffzil-MWJL' f g hv ii ' N .52f?'f'wv'f 'ax '-: fa-Qrgf qfi -. 4."'1Vrf?'Ffi-Hia -A M H , A-qf44'f,5,,,,,,,irlj,vf.-if ,g.3,,E5-,,.j' .,., :.n... ...-J g pp ,, A+-gmgggg'Ef2f1EizgE1.1,A.gffffHfvf:?2t2g.awQ1f, , ' WW, ?"2f1-A . A - 2"f25s:.f,'ilLifTf.fi:2w1f:-:gm-5"T"fi11Tf:Jfw- f w f Q' 'i? 1iC:,1 43fm 4'u'4..zwQ1" :Q'6gM35'Pf'fl: W 5 5:44-QQ . , .J " , f" 'e3m,Ji3 ' ' , iff' T ,f .Y , Q ' . -,..,j5g?5g?j g1551'5: Mix-H: ,A'xT:IL',m ,5:133,L L,.x.af,5Qx,:57f5:g P ff V. , T A w1m6f,y,37i1Q,.f g5gq3f,f45f!.3C52f! ,,,.y5x. - T V . ., .N Ev. -M T-1,-,.,.J-mf. ,nv --M. up-X A i f i1,'.bZj -nf A , ,T 3' 'fb .EH-r+ 25:15 ' '- fi. Q Q1 1 J T gxifp, gtg? ",4fyi54ii,,1 5 rif f A -.W -,-55. ,-,. ,, h ,v R. ., , - -X W Y fy 7, 'H ffhq,jLLQw 31::Swwg-, ' ., .41-3: ff - " 5 -. -' :L ""f?L5jfff7 f- "i'.'-wJ??1'5f'4."i1"if 4- A A ' 1-ii, rl T fi ' ""' - " 4- E---ff1sf4,,.'1.T,,.1Fi2'a ""'W f-MES: ,MQ-f , A i,, . T-H W ALICE KETIVE 450 WEST END AVENUE NEW YORK, NEW. YORK El Centro Hispano. HUGO G. KIEL 84-27 PENIQLOPE AVENUE FOREST HILLS, NEW YORK ARMAND KIRSCHENBAUM 204 WEST 106TH STREET NEW YORK, NEW YORK Editor-in-Chief, ALBUMQ Managing Edi- tor, WAVERLYQ Sigma Alpha Mug Pres- iflent, I.F.C. SARAH KIVELEVICH 138 ASHBURTON AVENUE YONKERS, NEW YORK Retailing Clubg El Centro H is pano. If ,A .4 123.57 " 1.12 .'1,-: ," ' .5 ,f syfwiwf' - - 'N 4432: G+. ff' , . 1-, ' .:-V: I I .rv 7 5s-. "'ig ' . ,,.. . WEE ' f1a:'gf3fXf- YW?-, 1'-HT ' - .. 5gy,:'1Zf',f 4 -'42, , 4 ' ,-'1,:,rlZz?g'.:?e ' ' ,,, "' I ' :.'f,1-2.?-mfg ' ' ' " ' ' , 1' 3 Z1 ,11 I' - 1 1 , . g if-fyfzeggq ' 5. , , 3:.u,,g,.::,:5z2,: ggifimfy vw' '. V ' .H-'fsrzfqeeg-"-,'f, 1 -my-4-A I f.:1a1'w-, 2 L M,-.T ,. pq. A 7531 , MV15,f,,' 'ggg.,.-:tif-4 ,l SEQ, 3 Y 7 7 -..v,.w-fzfzww-Z. - 'HEY J' M -43,-'SHEZY Q E V. 5 :gi-'41 f 1-.Qi :wiv 1 ,, ,. , -.E-yy: 1 "" ' ' QQ.,-3' ,gi N 4 ff fx JE Q, if , ie V fc nt Q,-5-yy '.:4..,,.,.M,,,Q L, Si. . .M 5 E4 no -v.-. ffl-,:2cf9?'1' if 2-v ' .1:,:,.,,fi2,-aw-. . :-gf N 9' ':"f-15.5.-.5311-"' ' 5 My ----ff QQ: my -mei, ,-E H, , '..:i.x:f:f-zwgm K 55,521.1-...-4 Y. . ,- 3,,5.g.,,,..Z,W - "4 1.-Q Der Deutscher Vereing Psychology Club. GERALD KLEBANOFF 945 LENOX ROAD BROOKLYN, NEW YORK Biology Clubg NOEL H. KLEPPEL 1658 WEST 11TH STREET BROOKLYN, NEW YORK Comptroller of the Budgezg Student Coun- cilg Upperclass Aflvisorg Editor, Class Newspaperg Sigmag Caduceang Mu Chi Sigmag Psi Chig Psychology Clubg Bi- ology Clubg Sigma Alpha Mug I.F.C. BERNARD M. KLERSFELD 8405 BAY PARKWAY BROOKLYN, NEW YORK s Secretary, Psychology Clubg Biology Club' Glee Clubg Economics Clubg Chorus. CYNTHIA KOHUT 174 PROSPECT PLACE BROOKLYN, NEW YORK ,M.t,, V4k 1 Secretary, Psi Chig Psychology Clubg -' ,.,.,.1,.f, ,,' X 1.5 . 1 Sociology Club. N Eff' , --"'-zf!"'r" L' 'FP-' 1' . ,' ei pmia, " 2: A f l fd . J .me .R-fn Rf .Ei g,.,'- 25 e, H ,. 3 4?1v: ff: 1 R-f-. ii.,-1. .fp -av., .... 1 ...I ., Q- y , g 52:1 - W g 9 E 'i f' 51. - . I ' ' 5s'L4E2gS. ', R g p -A Q .35 51-. ., . .. , 1. . 3, avg' 5 J Pr Pf1:sfns,,.af4,,E-ami.. V 15" ,-,'5?E'fJ3f5?i5 1. , fbf 'T 'v?'l'13 1 " .' ,. ,5,,,m:Rwgg 5 51 , ME G: A Lg- fx ian! , 5 -R 'Q E, ll" fffif 4 . My we g -' ug fwawb mx-2 3, 414172 'Effl h " g ':k!q2.4:. P - qs s Q . sf. qs, W.. if f W 2 ',"' M . , 5 : ,Zi R- W- A ' 1? - VT' 44' V'- Lfi, . iwL,,.,1ff-ff9'v'."f'67? SSW L .. A my ,..,, ,gf Z, 51.141 'I 1 lgrfff -.f ,,,.'. -- .. Qi.-A if-,H .QQ -I ,L 5,11-?:'l',. ' f' -."-531'-if 5,-,v ' 412.35-1' '-v-i,gf- 'Mix-lvl. J Q :ixg I 5. -'ig I If V Mghv I . jf ' .uaiill Q' ffm 1 isa. ' Q - ' H -4.-...-pwi,-, . . A ' ' 4 1 J .mo-afsafg::+zezi4.m':f.f.: - fe- 1?-ffff-.-, W2 :PW-fy - +1 Dv: ff- "-'Mba ' ' 'F"-- , - mv- ,, ., QW A 3 ,gre "ia?A155""'wig4 ...E , ' . JET--.. !cG'? 7TMHQ:fY'41tA. '7 "Y-W'JllTf"-fxu ""- .' L?" V, -141 . Mfr? L V f fflr' fr-n " ' ' 'EW' "V ' 7" J -N 73' - 'Q ' - 5 - "Wi-7lYYW.f'l.1:' URM T -5 - 5- 'ii . ,L I vf - ,xi .v . :.v1I"""J'-G+'-,." ' , 2 fix,w,iQ.f2iQ'Y ' ' .gg -R,J.ff::,4aA.14'L-4,mwqanf-'my ..3zl..,,.f -'+- ' ": -- - ,C ' " ' " ' 1-'syvzggmff -r .1 .iq ' a env, , M-Mv'9'5af2mi' v "?1"5 35?:mp:1,F , cy. A ,W , cw' 1' ,. , V Rm ...ri A, W My fl .4 1 .--,4,.4,..,,,,,-1.-:QQ-t -sp:-in W-W.-....-,.,...1,-E-tm-yr. ... ' ' - Q F 1-51.4 ' 'W , in rm.: ' -' waz' ex X r 4 ' ' J ., , " ' Af, . . , 'W'-fffQfSF7'f4-:': ,pq -:J .Ln -:Lg-AA-1-'-J. A. .-wffvs-if :... X-w-+3 'X - N'- --.,.tL1-w--- Jig , . --1 :.w:,if. gr fgxezs-PS. ig, ,x,.,,hQ.w-nisl,-.fbzggi-...Nxt -Jig.-w::.',.-.-, ,f1::f'-.Ar-fsssfgfyg-Q-4,' ' 'N-.-fi-r , N-1--. ..---f-1-'w -: - . ' - :E 'f' U A 14:55-Lrf' id-TJ' ww -AJS? 11- 'fa"'-:mfr-1 . N- .- Ri--A ..-f " 1- ""A Y. 'iii R . rk':+-f'- 1 E-asf. -1-42if"f:f Q 163,11 -EAW Ov, A,...e.--Q. ff - +I- rm, 'W 1' ' 5- f 3, ,rem -- 6,..f.l,z. ..w-- mg:-A: -VYI . 5,,,..,:.- -g45f:'4p-iai? 3.1" 1.x A Ip: -. F, . T. -Q-Q.:-:..:.1-J -EY,.x.A-43 .,,-1. -,-.v,c'!9"'m g47,9g.:,:3 ,A : ,ml .311 ',3'p,w:--' vX1g-Q-,1g,1.g1rg,-n+x.ffjL.x.-r.,AL-"Fi-,'Y-M -gf A ' -. ,:::zf4f:'-',+:5. :'.L...L1-fm Ulf-r..r1-'Q yr:GX' X' .,- A . - . W. RONALD KOPS 174-0 GRAND AVENUE BRONX, NEW YORK Der Deutscher I 'orein EDITH KOSSOFF 333 LINCOLN AVENUE NEW Roc:-IELLE, NEW YORK ALBUMQ Psychology Clubg Retailing Clubg Jewish Culture Founclaliong House Plan Association. FLORENCE L. KOTZEN 309 EAST MOSHOLU PARKVVAY NORTII NEW YORK, NEW YORK Psychology Clubg Democratic Club. ROBERT LESLIE KOZAM 529 29'rR STREET UNION C1TY, NEW JERSEY Allied Science Journolg Biology Club. RUBIN KRAMER 531 DUMONT AVENUE 1 BROOKLYN, NEW YORK Fauchardiang Biology Clubg House Plan Association. ALDONA KRAVNAITIS 78-63 82ND STREET GLENDALE, NEW YORK Der Deutscher lferein. MORTON KULA 225 ROGERS AVENUE BROOKLYN, NEW YORK Chorus. BERNARD KULIK 54 EAST 182ND STREET NEW YORK, NEW YORK HAROLD KURTE 330 EAST 79TH STREET NEW YORK, NEW YORK Senior Prom Committeeg ALBUMQ Student Discount Committeeg Der Deutscher Verein. SONYA GERALDINE KURTZACK 2865 UNIVERSITY AVENUE BRONX, NEW YORK Publicity Director, Future Teachers of Arnericag Secretary, Le Cercle Francaisg Social Chairman, Velvet House Plan. F ELIX LAKS R.F.D. BLACKWOOD, NEW JERSEY LEWIS JAY LANE 325 WEST END AVENUE NEW YORK, NEW YORK Vice President, Math Clubg Secretary, Der Deutscher Vereing Psychology Clubg Biology Clubg President, Stuyvesant Alumni Association. ..,si1,W-x3.,.,,. is ML, r an-an ..,W . ..m:.g,5-.,,, "-.5355 :NH 'XFJF' Q-.awmgf Ewan? j ' ' K' f.qg.k5-,. ,H .:-...:.,, ',.,,... '53, 3 ..-. J, ff, , ,c .. ,,., ...- ..,.. .ofivf V ' 95 1 'Q ' 'L- Jifgi' WR A 1 ' - "'f HV. T535 I - . qdiP?", ,. 55355241-,f ' . .,fff'2wv :.v.ff:r11 :Graf 1 , mia .. .NJ ff.. , .... -, V, . Q., ,rx . ' , -4,41 ff.,-Q .1 H ' f :..65f- W. .- r figv. T.,..-1.-.---v -. -, T - To f I ' ' 5 2' Q. fri 1 fm vii? f-' " 1 lu 1: .'- A " 7119 f'3ZgPi'32'Q33fQfm5f':. 53515 gm: 5,4 'jig!1s3E4'gg5f.'TE ' JV. ,-, .- 1-,Y I vgzxw x falyrn .ww Ayr., -Tamar. 3 ptgjnffff toafff' . WRMEZ:f?tSg:5.Ef 'wtf',.?. vgpxt. WT , ' ,fi " ' 4:1 L - 1 . . ' , 5:2-I 5i'l' 'gf . L. 5 ww' S f '.f-,xl A e 5Q7fi'."'TLf5' limb if K xx: A s :-11:11 -P T " A 11 ' 1 f 1 U .aigami-fhff' . x 1431, A 2 551-,:'.w:f.1. 2' 1 . -' ,zs'Qg?'f'2-SATL. , .1 1 ' ' 1'-sjrli k - ,f 'i-"Y,1""rf' .r, - E2 Jfa ,N '5 5ifQgg3sR,f2"'?3a.f1f,r,fz r 2 - . A' f"-'-R'-:ew 1 v .-'11 me 111- vf A ,. .. I' '35 U s.,g,g,fy:.- ,w 5 , 3 1 . T 1-,c11.,, .5 I 2 MR, ..f ,L w ..g- igiifefwi? if We ggegihgfs 1 mf xv 1' " wx - ' , 43 . .' '-fwfnqff ,Q . .: Ha i.-:nw ,lt -L t n: f'- frw:KS:f.1 . .. mf . ' A iq, Z.. T A..,,,.,v W: X. ,X - 4 T ,Q M T at 21 ,115.4 Q ,Q W W -. ,, nn, 3x 3'!1,,, N-,g, ,EW L ggi ,J f M.: ,,7g1,,'-1.9 '1- - M. M ia 155121 " gf A . 'f if 5 f is fig? n. T I - 69:21 ' f A A A1552- A " Z H35 1- Wg iFi'?553.i-1 K' YF? r - " 'avg 5 1 7 -A rijgfxjf: a aj wg, fwgitrwiv my 553' , -. .. it 'f tw- .- .- .. . ,Q-away " f42Ff. 4V-23' 5'i2si5-.5 . . qv" - , . A , , -7 J., ai .",,f 'L J" yn. 5 '-T-Q 53' -f .,, -, m e ' - .. . RENEE LAST 172 WEST 79TH STREET NEW YORK, NEW YORK Sociology Clubg French Club. BERTRAM LEFKOWITZ 2010 OCEAN AVENUE BROOKLYN, NEW YORK Photo Editor, BULLETINQ ALBUMQ Presi- dent, Photogra hic Societyg Dramatic So- cietyg Square how. SEYMOUR LEFKOWITZ 258 KINGS HIGHWAY BROOKLYN, NEW YORK Section. Editor, ALBUMQ Editor, Junior Class Newspaperg Treasurer, Faucharfl- lang Biology Clubg Psychology Club: Secretary, Sigma Alpha Mu. GERALD LEITZES 100 THAYER STREET NEW YORK, NEW YORK at ABRAHAM M. LENOBEL 1574 57TH STREET BROOKLYN, NEW YORK ALBUMQ Sigmag Vice President, Dramanc Societyg Le Cercle Francaisg Der Deux , , scher Vereing Sigma Alpha Mu MARLENE DAVID LEVENSON 784 PARK AVENUE NEW YORK, NEW YORK Psychology Clubg El Centro Hlspano GEORGE LEVINE 2116 GRAND AVENUE NEW YORK, NEW YORK Book Club. MORTON ELLIOT LEVINE I ,Rf .! E" 704 MADISON STREET BROOKLYN, NEW YORK TN F .J-so ' ww ge - ' iw 'A :K'j.-egg' Q, Q 'I gg ' " , 5:12 25 iz . + L 5, , MM T 1.4 . , ,E , vw- 'fe 51 . Q 52?-2 5 -an -as : .. 13: " X. " 2 '. I ' ,.-P" '?,A49W3E4.q f F:2f"' 5 if ,T 1 4' 'frivc " 'fi' I: 0 , 2 251555951 1 O., - -rgsxg , ,uQL'fm.a Q za-. -4 - '-.fa-.4-fd H":,x"f nm , ., . ,, T. , wwf ' 5 QQQEW m' L-12' - -A V, . A Y "f.k-JaK5w"f'3',L 9M.:mf'ffa1 7 52 2 23551 '4 '5 'UI ix:-,:p.:L7smE--jf21-5:WQf-233"nf '-"U W" IYFW U t-'v'iHE"'Y1:- .L . 14 'NL 4' -5-. -14 4- H 5 1755? 551' " "1 2 g , mb? ' Q A ,.. ...Ry ' Easy '.',g .5.,, F-411 , . A ,ww -W' ,:.f"L' -Qu ' V: g., awww WM' "'- ff-V - 3 if M, 1 , 1 1 s1ur g"?3p " 1 ' 5 I ia , .11 ff TH" T-- .5 5 5 R- f 5515 -' P 4' 41 ,J-Q Qw- 7 ' X ' lsir kl '1 ff' We . V , .- ' 5 , ,W -f,Zfi2,pw1 w s1 f, b? W W -KZ? , Ez,-M, . 1 iml,-wf""T""w' " ' . -alf iii-a 55 -. R,,Ji51- mi? .""'f.w '- 'A 3'-4 ' . 'x f?f1' if 'f" . if, jf .21 - W 1, gm J" an l 2 Eli? ' El ' sig 1' ,. -W , . . 1 , my E+ V f , ,u w ,uwwf-41'-f'2wa1::14wm:rf:w . ' 2 r. - 1, V-: -5-:ef Hmm: . '1-.-' -.1 . , - ' 2 ', -7 '- V . " -,: , we, Sfv3fMy",w .--fmipf ,, 1 A .t,e3?'Y, 1,-.,5l,z, ,. -, JZ-J3s,e,g,u H sf , , E fgfy- J. .. w59,vf,,,, 1 g- .' -1 -' riff, . '4,.'4'A- wiv. ' +1-ir ff -z 41 54. , '17 ' 14',':.xA'?.E3"7": --5i'1f'Vi5k iff,-ff' A 5 fn- fi ' ,7V f5'5, ' - 525- sg'25?ffI5vZ5" , "'E1,w 'ZX-Z'f'f6'f"'"'Qi"Mf'-1 . '-'I ."'. ' . bln " ', 11gZ" ' " W" 71233 0 .eFP??a:" ef-,R f 'e?1T1fT?w9f53:fA?4"f'fu f 5Wf""WM V -'zi i fg -1' "wwf.,:f,'?a4ifg.fmEf--15. . gf, , fi u:1Ew:as:-?- - Qfwnffg'wgfF2:?2.1:f:f "' ,, .- -ua' . 'L :L zu-, " ,-5 : -nag4451,,w.1ye.s. .,..,---- 'r:.' -V - 1' 13: -- - , 55' L" ife:J:,w' W'-'f:. '51 f 51, 4. 413 T-A f-v"'fh-M " " h, 'fix wi 1 ' 3 . . . . uf. 'fziw-' 'raw-H -Eg., . .--14 -Q. .sw E, a - .fl415523.25e4ym5jffpqQr:xfqf.-'5 V' w yvff1g"M41'.- " 5 'WWF?-H" H'1ZQvg5?::fawssw+,-f-IL 2' .. ae' .edu-if A file' Q ' fr 19: .yiiagywfm 5111.-mfvf, Nfl.. -ww T -I, gf ya, 1 uid f A - xg: gb wxwam, '1-wrr5':'i15,gMW:-' nf l 61 1+45?f,'?,1ff Qagg, 2, 1 yu- M- Wjixrbi ?gWw?QVgi:f3fQ,EM .:3?Qf4i.g4y,:35w ,pw V. EMC .himvgp,fya:,g4f7fiMggZ,.,gyiew ,,,,,.,n.21f'1+.,f.,-.f Aggfe -, ,4?, Ar 9, x 21'.f,f.k,,?Zg7,7F , ,,?f,L?5-kp x jy .x 5 . 4 - 7.5! ggi m,.,,..:,,.,....1 .. . . ' 1 -figs! - Vp." lqgwip, f- Avigfiizik-, 511: :'34 '- . ,.. ' wwwasi mx , -"wfi'ff vii-z: " "--115 a,f" '-2-, 'E' My 'Qi.'?f975a55p-vim.,Etyeitwrilwfsfsasififfwiwepzg. N., E . . .v .,, Q, 1 . A RS? 2..,M,,Z J ffgmh 5551, ww . -011:52-Li1gsg,'ST' i',52a0,5+.v,-,fx-lggJ54i51:.vALir,,- .. ,, . A ,'LrAa1i1f-vtgrxffs--534:53A ?Ef::1-J --'s-fm.-ire--':L--1.1:- 1" . -' 41:25 2 1- 1 ' ' wi E555-Qf?l+1'E552e,f, Q L M A ,?l411,""-v 25:5 L:-fl ,xwii 'TUQQS-,.:j1-il A. ..,'1:v1Qe1m bf -rf Evgsf'-ar. P:-W '-:Aff -ipfs-LEC -nz gg .s:iv.-NEW l '-iisea-5255 g4f.h.'.Qi11-,3.. .b--'1-"rf Eu .. '1-:' ,WH ,Ffh T-xi, .f ,r'm':'-?'1'E--+f1'. 33, inf?-g2f gsfgmf O-ws-fmkv-f.nq 'Of -'w- "TI-R-' L :-'ST'- " .51 '...:w Ni -"TY-f5,'?'A . - --:'z:3Z?-wire 72112 mhgiw. Ymwzw- 1. Agggew.-hm N' 'T"v- "- v-4: N: .mii--,f:A.'--, -et -gf. Af ,QM-"'.' -xv A e-'S-.--J -'-.-f--rfvpxzm fzew'.:,f',:fAb or wr 'Sd 'fffitx-..w ,V Ayr.. ,.,.emw ,su ,ff-"'?' - . 5 ' vg-wSeaaHzb1w'2:fs'14vmQIP-Eqgffiwi-fvff-gf-1 M-. .-lm--.., -f f- ff- .-.M-1-f.,-, fe: fe. rf,-1, ' ' .t.,,..',N,f...- .. .- ., ARLYNE LEVY 880 FxFT1-1 AVENUE NEW YORK, NEW YORK JERI LIDSKY 179-28 TUDOR ROAD - JAMAICA, NEW YORK Student Councilg N.S.A.g Chairman, Stu- dent Discount Committee, President, Philosophy Club. I JOAN ARLENE LIPTEN 250 CABRINI BOULEVARD NEW YORK, NEW YORK Sociology Clubg Jewish Culture Founda- tiong N.A.A.C.P. JUDITH LOBEL 281 WEST 12TH STREET NEW YORK, NEW YORK A PPRENTICE. BELLA LOIVI 410 QHAVELOCK STREET MATTAPAN, MASSACHUSETTS President, Psychology Clubg Vice Presi dent, J ewish Culture Foundation, Execu tive Board, Sociology-Anthropology Club. DOLORES Nl. LOPEZ 319 PEARL STREET BROOKLYN, NEW YORK lil Centro Hispanog Retailing Cluthg Or- clwstrrtg Christian Association. .mf ,,,, Q Q MARIANNE LOSER 62-29 84TH STREET MIDDLE VILLAGE, NEW YORK Phi Beta Kappag Beta Lambda Sigma. JEROME L. LUSKIN 253 SOUTH 3RD STREET BROOKLYN, NEW YORK HOWARD MAKER 1635 UNION STREET BROOKLYN, NEW YORK Class Social Committeeg Psychology Edi- tor, ALLIED SCIENCE JOURNALQ Phi Beta Kappag Caduceang Psi Chig Biology Clubg Psychology Clubg University Bandg Book Club. I RICHARD CHARLES MALFITAN 311 TREMONT AVENUE EAST ORANGE, NEW JERSEY Fauchardiang Der Deutscher Verein Newman Club. JOHN MANOLIS 666 EAST FORD!-IAM ROAD NEW YORK, NEW YORK Pre-Law Societyg Classics Clubg Delphi- Hellenic Societyg Russian Cultural So- cietyg Le Cercle Francaisg Der Deutscher Vereiu. LUCIANO MARTINUCC1 69 GRANITE STREET BROOKLYN, NEW YORK Der Deutscher V erein. . ,.,,,....,q::,m F- ,. ,Ep-J -My A-Ex---1 .- 4- ,, - "' " -:i527,w-.2-s ' mfr. """ SL'-E5-'faq-:-.-I Pfam- L-:ew -.R SQ... -1-- he E 41-E53 ,-,341 :T-X, ,445 , '1--it-if-, gvffsx 115-'f ,.a ,if-:1s-"-ggig,-w Q vera-1' w"f'l5i?gcr?-sf, -:I-f-.1-,gi,,s4gL1?"'.,1,a-,4g wa -,-sg,--:sf .ggfggg ..J-1. .. sa. rim-- ,, j:pgfqi1Qtf-,"f3AiSgf Lb-5,-.' -ww ,gf 'ffifgsg--1 E212--123---rev, ' 129556 L"'.Ia-XY' A J .- . .,- f.. Jw, 2- R... .f.,. - 1'-2 . fa,-31'-,Mkt-Asif-F,-:-ivQ:: Q :1'-- 1 f' is- 'T--1:2 -' - A , qfgfg , . "YK 16" i f f., 1' . 4- J3g1,g'4q sam 1 ' ' f A-f I Jr Q .'3Qi " ?fCf ,V ' W lv 'V ' . . A V 21 -- f' V-1 'f yin.-, '-si, v. 133556 91 A H ,piE'::,,i 'hvikfnff 4. 1 w, , ,wif-,545 ' 'rffgb ,.-:x'q,,,.v 2 V , my :H-, ..L'f"4'4 ,,-2:54 .L5"51i?mi. h "' F 'H . Q1 'X yin" ,. nf jd 'Rif f 1 Riff 19234817 , ' K fn gg ' -bf., ,J ,, 1' , fQjfu'P' ,Q :Hs .. 'M JT. : .. ' Z -' .109 ,.,+f"gV'I Z.-',1fI'W -f My ' Q54 +1 .---.glq - EVN- f ,. ,I ,,, - . .-m,,,fE.,:EJ'u--www.-E-fm, --y. . f'M,.f" VW ' N wixfii' mil- 4' Q: l 12 ,fi5Qiq35ff1Jy -4 4:2-" 1,5 1 1 - - gs' " mm. ' ' gf if L' --'M .w.'!5',1,vp,f 'H,,. f wf nf' 3 if ', ,L av T mf agllr-5 ,'AQv-:"--.- 1 '. " f . f- V: ' n,. . v 'cyl , .1 ' ,cw'JT','- -f.fff':,cw f 'fl' sfo .f X, 1 ,,g1 3 :-- ' ' l f ' 1 ffm, 'jlw' 'Eff ,.:.'Zf' A ' W 1 ?:.?Z.fA.' 4, ,' , 51 ,, ',5.fnWw,:',.5-, fp- L I3 I 5 I aiewzwkt 2-'Q J f 252 M-fhgm .wx-H .1 4 0 f - f' ' Ima lf' f ':fg'4:v..:f'v,- on 2 .. Q if -. I nz- ,-1, 1- V ' '9 1- 'H' K RQ- an 5-ililfqlif '-t V -R bs:-2-'f:f'v,-A , li ,E 1 4-lla-law' 'ya'-,. Q: 51' fm iff'-Q4fwaf1f:.l fn: ,g 5 Mgr 1g'4,f:l-gh Q, yg aff ,J-iJQMl9Q,5,p,5,3D,lf, X. 1,4 T 2 ,ig 5 :e ,,W 1lsw.1+wg4z:14r' Elf' 1' E. 1 iff- , .rw '?1s'w'qZ1 .. 'nh 'wh 115' ' E T' 14' Q23-fix ' J. , g , ,y A-, g ,T 1 ,Q ., V f rf. , x --,ff-A ig. 3-5r:,y. ,,.,W 1 I , vw- ,- I . .J . 1,4--yf,f4,zfli.g,:5fqf,w,Lrm1.A'pi"N,g---, f 4 - V.: . , .zvzelv--Qld 2Rxf+?'g3i!j r f . "W m . 9- xt W 3.4 11 G , , . if ,JEQ3-:4.3',5mv3gg5f5'sg,ff ,. My, ,141-5,-9 Qnmfry, . Wim, 1 4 A'RZ4Tfw'Qfc15g4f1' rf: i fivv Mig? 'A l alfa 12122-V af g y "R m-Q.e E' '-Qawvgiwtfr 1 , in ,I -'fl ,,j,1"' 'sq O'f - gf 1 V 'Aa.fn'.I.?x-512 3' 5 4 Q-if , M: 5' 'K 'z' my 1-nw E 5- ". -.k'F JP W"13l!YZ.l'3l?ll Q W QF? 5 'H . " T-2rL'5I-Tw W W EN' ,gig 7l"'m . . '1 ' " fl' HY V ' ' , rr ff 'f fw'e"U," , ' ,. W4 ' ' 3:1 whit ,-QM: '- ga Yi -. i My l gif :-2' ' 5, t5:'.s5 QV5'g j1,:-HJ. 4' .Q LW ' f,, - - , v -- .. few- R mx ' ' wp '- lf: P' J'r 1'-f . ,-Mn 4'--T4 . . R V .- V .- .5 . - A .msn -5 g pv- TJ, ' . . , , - . ,wi-2 -.1:-,R 1- - , , - 6 ,,,L.,M eb WN fmir lggf, ,- , I J 9, Y . if -4 4- - mm 54" f" ' w- f "fl 1'f1?'?' : 1" V, . k Q , M - .. , , B K-1 V, , . ..,,, - :R .Eu ' . -p wfi , 57:-1-gy, R.-Th., 11- nm ? , .,fa E. . FW ' Z 4. f,S'v3?4341fJQ!QfgET,1ffE!?iiH, 2,1 ' .'r':" 1.---mp , 'f "-if:-.-ff? -if ' 'A BERNICE CAROL MASSIMI 11 HILDRETH PLACE YONKERS, NEW YORK Honorary Historical Societyg Pre Societyq Alpha Omicron Pi. ELEANOR VIRGINIA MASTERSON 163 LINWOOD STREET BROOKLYN, NEw YORK Biology Clubg Psychology Club. GEORGE LOUIS MAYER 330 WEST 95TH STREET NEW YORK, NEW YORK Cllorusg Opera Club. LEO MCCALLUM 104 SOMERSET STREET NEWARK, NEW JERSEY President, G 1 '- Cl ly C , " Wrestling Teajgijp en LL 7 apmmi -Law 34 A af 54, 4 :vp Wi? . g. ,vw 3 Ry :-1-:m fr Q Q bg fs Ms Q ' , . ,.,h,.. 1 UM N f ,iz X Q' 1 of 352 f ' JOHN P. MOCARTHY 442 STERLING PLACE BROOKLYN, NEW YORK President, Newman Clubg John Henry Newman Honor Key. ARNOLD R. MENDELL 5502' 14TH AVENUE BROOKLYN, NEW YORK ROBERT MEYERS 215 WEST 90TH STREET NEW YORK, NEW YORK President, Tau Delta Phig I .F .C. PHYLLIS MICHLEWITZ 2282 EAST 27TH STREET BROOKLYN, NEW YORK Phi Beta Kappag Secretary, Honorary Historical Societyg President, Holiday House Plan. F NL !" k ewl , 1' . N 51,9 ,Y Rr.,,.,3A 455 'sg gi , 4 S - We,'H ff gg , be fi S? 'i?i5Q' , Y V 4? .. ' -4 -1-se i f ' 'J -yfwaz' +5- gi f 1- ,u , ,Fi ' -1. -- 9 ' .-I 2 "uf ' Q - J " - UM? P gps, ,hi Egg' f f." 217 3 rr W- " iglxf f f,,yf5'5Qpfg5- Ye, ,- ' 3 s . .,.. ,K+- L,,55q ,n-, .,. Kg- .msg ,MAY vw,.LaQ33.f1. ls, Q 45 V f Y?l??f3E3 Z M 53 at :R O. , ., ...O ,M , W. ? QQHJa,,, F Q. 1, ' 'ff I-'Jw ""ff,.m- L . -RQ, M5 . 21 12 ' - fa. W? .. 5 " - ' IR Ki awww mae" ' .1 L '2' , f a 11 1' l M 5 4 M-- R Q 3 - I if .M 2. wt. - i 5 g i . Q W , . -, W 5 , ',5,,.,-'- , rw V Q-im , , .wt-gg? V y , -- Ni' -wwf: - f-1 .22127 A-1 'T 1 the G-" " " .Aga L 531555, 2 fn 'QMJW-A ' i+:'m,.,,-: L:.,' Mt N ,,?,,7+,1u ., m fg Rang- G nf.-D Ki, 'mv U 5 i ' Legg-kiwi Y. ft Ev if O- was f hL '1g ff' J'FH' Y- W .. T. O, A ' 5--F A 1' " 2 if gf ,Y E .iv ff' w- ffsfw-w, 'bPme1xz:f' 9 f 'M -' if 17 "gy f ,"""2ffw1fz:.'ffa: 12Q:.wf M..-A---':.J "x',f .. ..e4bw4.F? Lf ' 'K-'DRY ff: ' mm-eg, vhwrw.-,,'f?V6-', fafiigfmw. .v,f, :-:em-ff. av -f-' :f.fag'f212:EMwfaf2fffax fvs'afifi'izvw5egYfw H fl 3 4 . - A ' f :wif ' W1 if V F ' FW 19:-,s - sq-,,4!4.ffN,-AMT za V. Q - sag H Qs. .ISM .. . . -. M- A ff . z w flflgkei ' '- ' Q K a, 'f' fEJ.i:"+sflZ'p,mf . f ' P , 'vfafff Rf n f, 3 " fe- ' - Rf" 'Q'-5.6 ' , tm ,a 1 f 4 ., we ' -' Lffw ' ve- T w., -5: -I -ml . - - ff-. em-1,, , 4 ...,, f-gv.g,"'-gpg uv,-3-.-.Q A .. . ..-, -2'Q'2:1r.ws5?-vewiliyAiprm-fzaf::4x1fAfT- A - -QREEQQL.-.Q-mow:--.-. Tzu,-ex -- -Y . LANL. , . ,YL-W.,-:Q -,HN . V-Q.. AA, "O-1:"m',:.:L Qwgfm -1- K-,f'g1:k,. - ,','gZT'OJ , - - " ., Liv? 3 :FI ,315 . -.'-92542-fm iii? 1. W: Rftivaf-ima-' fit!-it E ff'-Sfqfmizfme aow- -.,. D, A-.nl-.iw 1 -4. ,.-A. v -yr 5-, - 5?-'fm if-Rx i555 E5'fif13.Q1,, -'.?5rgf:2s?:f-:- 3 'ilfalbrfi-Sf gs-:R+ Q-Eur' 4191:-f,f.wQf:..:f M ,YQESF efagffzsgffs Ow:tg,?f'fE' NSF ' Tiszzgs - ff'1-cQ24,"35ff"'n1fg2Q'u drfoiisbelxa--Qi,vQ:, , .,f,,5Q Qfififs-Y Elf-:NRL -V - -hf3v35ff'- 'Tmqijsalxixgli viii! - R-MEw"1,wa::QQ1-4fwfE2'eF-Rf:.f?:Erf-H, swf. -N315-. f- ' - .-7iwa5'.s,'s-:gmv2zvsi11.Y-'S-r.'2':l'- 1'-If:- iw-cf V ' WILLIAM LENTON MILLERING 64 NVEBB AVENUE OCEAN GROVE, NEW JERSEY adgj 2 LEONA MILSTEIN 3054 BARKER AVENUE NEW YORK, NEW YORK President, L.0.W.g Student Council: Eclecticg Psi Chig Alpha Kappa Della: Sociology-AnLhropology Club. WILLARD LEE NIIHANKER 230 BRIGHTON ZND LANE I BROOKLYN, NEW YORK Phi Beta Kuppag Director, Pi Mu lffpsilong Sigma Pi Sigmug Mu Chi Sigmag Tau Alpha Omega. LITA MJTTEL MAN 89 THAYER STREET NEW YORK, NEW YORK DANIEL MOREINES 315 GOLDSMITH AVENUE NEWARK, NEW JERSEY BULLETINQ Psvcholo y Clubg American , 3, Malzugelnerzt Associationg Book Club: Der Deutscher Vereing Tau Epsilon Phi. GEORGE MORRISON 902 CONEY ISLAND AVENUE BROOKLYN, NEW YORK Radio Club , gg. ' I . 'iff ,,3. X I -' E H: ' t x . if" fs A A ' ix, 4 N X A ' 'Thi-NE' . ' Z.-f' . 5' .5 - -fx, 'mix A , , . lsgsfz' 6:31 ,. xc Ghz' . Q , SXSW XA, Q , im X 3 f " 4 sm' , V 'W J X . A . ' . A . :V ,Leif ggi? 2 vxvfg sg., A I f 3 so 4 564+ f'ff':': fs 'f 0 N N9 . s- S ,Z 2 J X 13 , Y 1 V , ' Y 5 gt. ,,. . JILL B. NADELL 750 OCEAN AVENUE BROOKLYN, NEW YORK Book Clubg Psychology Clubg President, Hamilton House Plang Executive Council, House Plan Association. h SANDRIA E. NARDEN 103 SCHLEY STREET NEWARK, NEW JERSEY Phi Beta Kappag Psi Chig Alpha Kappa Delta. MARJORIE NARINS 825 WEST END AVENUE NEW YORK, NEW YORK Book Club. HAROLD O. NATHAN 717 HIGH STREET NEWARK, NEW JERSEY Editor-in-Chief, ALLIED SCIENCE JOUR- NALQ Mathernutics Clubg Psychology Club. EILEEN NEEDLEMAN 695 EAST 38TH STREET BROOKLYN, NEW YORK Editor, Freshman Class Newspaperg Co- Chairman, Senior Social Committeeg Booster Clubg Democratic Clubg Violet House Plang House Plan Associationg Jewish Culture Founflationg Womenls Varsity Tennis. PAUL NEUSTADT 284-5 UNIVERSITY AVENUE NEW YORK, NEW YORK Student Committee on Educational Pol- icyg President, Pre-Law Societyg Der Deutscher Vereing Psychology Club: Cov- ernment Clubg Phi Alpha. R.. , - :'- . 'O 2 'I . , .1 Lfgfzs-' wif- 'T'-.cr :-2 , :.1i4qz:" , EFZ2' 59:25 E5i5Q5Lx'1L'T40E HY- giffm, -af 'F -A-1.-2... -:,-,ff-1' - .fr-LLf,r ...-rf-:Rf GT "'f"T.4'j-x'ZT.z. :bcuz rw, Ks' -.5-Ngi , L.-53' 'C ' Mfs51'Sgzffz'--25.5-LTP Sf.,-1,15 21- ilifrifl' 'L,S51t,.g,I, wif'-3:1 '- f ' .JN :,-:pawn JY, . W. mf f I .rf":' V 'if ' .M ww N ff! I . 445' Q f' 4 V 1 'L r " GMA wg.. QQAA Yg- f r'f 'rf' L wh ""F" - -f Q R- , f,wsL'+w ' If ies A X ,mr-,-,Q",3f.'--1,1 ,, M113 ' gf., --1551! ,Nw -1-3.53, .l V X f' w"',.,,i EQ52zf'2Fii7fS?WfifXw2i'fK5v'W"'r':-35 BETH' .1-0 '. ' all-1 , 1 A W' 'Q ,L it ' "5-1 725' ,, ,. , ,Q fu- . . .1 14-:,.,:.. .-.:f. 5 -K, , I -' 1'.:f,5 ''LQFHTXQL--?Emk:5eg?i".Q'rj f I 3 1 ,ci i Q gs NL1 1 'Q 1 ff Af if ' Quin n P. ai ff Q fa is ,qi 5 . .1 it msg, V .M Q.. , ig5f,g.i,wfst : ., .Wm L: . wr ' P- . Jhwfx SQ-L ' xikix .. 1. ft -3 www 'wa .5 Q f' ,I-5g5w.sq,1 F5 ' . pLf,.f',em '73?,. a iwifitfw - aww , t 0 55? -1213 ,aff ai mist -f flffwfix-E3 'gm ff-Q " Q, " Tu," Nflsy, mf tigatfffvwf M 'zi' - ,.,g 'W' W WA. 'r 'QL' gn.-jv -sw-1: " 'if,if!f.L" 'S V-18 , . - 'V ,' ' .dfjj .g1:f:,I' " f air?-'fS"'Q:f 'i'f2?7iQ.h .. . , IA Mn, -, , . 4 S 5, 515'- R. P445 1 '- - .: f 4, 4 , ,. k l, ' f- yffzfif n. -M, if ,,wfzzPf4,i2ii'IfIwfififf-2112: :J f-A 5 4 KT Q c - 1 'rx N U' 3' ff 43 N , , Si' iw? 'I 'NW ' i J 3 2,5 QQQQQ ,Ml '1 Q. A PM I 94 1 Q fv F W I K E 5 N.., H,,f w? MJ. ,i I x I 1 9, :v,,.U, 4, x Q41 1 2 , ff- x 4 qs f f-1 Q V y " it :NA xi 'wi i' L I ' 6 ,fin E 'W . ff .1555 af' ff. ' 1 'SAW -ff g' ' if f xwif if , 1 4 it ,. ky ,j wh' ll' C 1 I 1 ' J 1 br I 4, , ,, ,, M V .r 4 , 4 'ji , I Y . v ' s ru wa Vi: 2 1 4 ' ' f U " 1 H., . 1 ,f x ' 1 .ll I M A 1 ffm s fi R R A P fr 1 av A ' R ' ' X ,x X ' -:Q C WW ' Wu 4 LSR: ' 'f ive 3 'Jw T , 4. X f , P' ' W f ' A x f WI' 'w 5 v5 1,: H Q v ' f at ,L .1 r tggw av X in, Vg ,uh . 5.1 Q55 71 X A fjgluf . M'9y 1,1 FAUX RPL -gr A M24 "Y 'xv L 1 'L 1'-9 ww xx L LM ' A , e , HQ7- ' it A X if A5-Tian, w I Q M , A I mn axe: eq Q , 1,90 N hy 8 J 2 pririfr, ? 1 . .,' '-U . ' X A, , 16 mm fi flfn N - 3. J rl , RR if A - Q R ' f- P 'W w P af, iz , l xx , X L-,P H K ., 753, , ,1J?Q X , ' ,W 1 ' 1-1 M-f N , A .e 'J 'Q mf 1 5 . -.r '.- - ,.1 'Huw ' -1' 9-'ngem-,fn--g..k f'1.-.eager . ' ,. ..,fnf'47,'?f:-I '11 L? , mv , 1' L ' . A25 17hQ'g,g'j'fQf779i1f5EL 'Q"5-W e "1 I ' Nh WL wM'fff"'-P' . .. A 1 3,-af ' -1 V' 3 -".g-'.y7M'r.- .uxigzc-R 1 f T , g,.....,-.M , 4 f rg' L, , N-ufw,,.z,.'-gf,f:, , ,,,, fy: "H K - s"""' H 1. an-Q.'f"'T"'55:ffaifavf' 'f ff' "' 1" ' , I ,Q 1, l,i,,M,i.L..g5f0. , . A, .. V E ty 43, . , MICHAEL PRIEST NEWMAN 205 AUDREY LANE WASHINGTON, D. C. 1. W M, ..f 1-:A .V ',,r,', . fry,-.,,u,g, wh "ff-fvmlyg ml:-N., V ggalg-,fW::4 1'.'-'VM 'i fn .. ., -, "WW--A 4 160112 ,-mg, v ', 'F7':'.f-, -L1 4 ,. - ,J -",.!'q.e':- f- Pf.nvq-wwqfw f . . .. ., V' ,. .zs,, . , A , .4 .,,, A V ,V J-yug:f,.,,r -41,5 3 J:-.',.-41,351 h,:j.,.Qg ab. Q- :'fg.g', VA 1 ',"1,t'!.,Q-,1x.:::3ff! ' ' ' , 111, pf: trip ,,,, gn41f,5fy'-.emi . L Y, .E v:.1.k..LE c , , 'EME X -.vw vg,,f,4,45gf.1?.. ,dwg 1Z, .1 : :it 1 ,' 'W' Q, ' V 'YA A Wm! Q in 2-R33 GW H Mmm L V "'-:wx "f X 1 . , , , . ,Emi-:. -, -r' .N , X ' ' W --1 fi!! 1 ,ii . A , ' Z4 , ' -5 ' , 1- -3 13553 M- 5: 7545:- .ff-QF-., ' ffjffl Ltjif . .i -1, ,fx , ,Af- 'CSF' Business Manager, ALBUM5 Election Committeeg Sigmag Government Clubg Pre-Law Societyg President, Sigma Alpha Mug I .F .C. GEORGE ARTHUR NIEBOUR 223-03 l35Tl-I AVENUE LAURELTQN, N EW YORK Christian Association. gary:-:,::.11:Q:,,, -nw. -' .... F 5 A ,. J,-.W 9? 9 r A , Kim 554.gif ,halt dy ff , ' 'fi gf 3 M 2 ' P 7 S' 8353. A2 ,gf 1, 4 7 7 15 ,, '55 iv- ,J ,U 3, , A., ,,,,,,,,.,.,,5 .,.,.,.,,, , , ff , fi g ,. ff- - ' -. -nu n . f x- Km' 2 ' -- V A 'Qz,,y7f?ff' ,?'Q-'fax 2 ' ' .. - , 1" .5a,,,.,:x E T ' 25, 5 5:59 Hg , M X., ,. . , v,,mq,5,i5qh I .9 1, sp Ag QAHE5 , gpg ---m,,,k,,3. 1 --3 H4 by 1 ,ff - ,,.V..,V ' 7 LAWRENCE G. NOVICK ' A A, I .V , '--' A NEW YORK? NEW YORK J 2,1 ,. , , ,V 1 f:.5,:,:v-VV A Sophomore Social Committeeg President, R. 'V ' Pre-Law Societyg Economics Clubg Pres- " ' A j I , ident, Phi Alphag Treasurer, I .F .C. Q' 1 N P EDWARD OLIFF "" 2750 UNIvERs1TY AVENUE -- ",, NEW YORK, NEW YORK .i,. Eduof, N.Y.U. DEMOCRAT? Democratic ' "" Club! Chess Tearng Ryle Team. ,J , Q 'x ' "-1 -H zwiszqi. 2' 5 1 . , . Q 7 f Aa, 4 b :vr .,..,. 2 i ,1,.k 1 :V- bx ,.,, 1 . 35? h ' O, , A , .gi 1 ,fff av ' f2i:.':,.:4.4.Q arf if ,V . , A , I. , N 1-.1-1.1-1' . ' M- .W .. .i ffm , ,M, ,, .. f'fZ:5,f . ,gif 46 H .2-wav---is?fS1aQ?z,f.g 24?-fsawfw. V4 ' ff"7,.f3"."'?, U.--iffz' ' fj,'5"?g4iQ5x '0 '52 -' '2 V 'R 2--11 , ir f- ,::M:ggg3,,gm,:g5::j3-A 'V , em .. -4 5 , na. 1' 4' : 1:I-V:-.if2127:vv.WW'5i1"?'V -. ' 2. ul'-1T.4.Y,f5y i' ' Wi " 1. 1.515'A'Tf:2":5v1'15f72?35'- if ' ' '. 35127:'icki'-i'l'L"f,..fTY:-H. .-Af - 2' X 'Pf V' ii: -'Il.- 7 4' Oi' .2236 59"-CL, ' ' " - A.11.:'-15212-11,-'i.":1'E.Q13-' ,gffl .jizgi f - " 'agig-233. 1'fvjv2j3f'11i'i'::-. 1 'i ii '25, "ld " V ' , v v ,Rfk F55 14" 5 axgf N 'Q , Wm 'R '-fniihv 'SN -.,. arfikfgv 'hw Tkifeir'-Qfvffi-, Nw , -2-A - ' 'rf ikfm if xx., :ma G.. 1 1 .1 5 -F' 1 if' ,.5f5,ba. , : -' , 'iz .Y 1- .- - 1 -f, qfa: .-, ,T , ax fr 1 5 A fa, 1 jr f Q, X305 1 1 ' H , ., f 'IE 725 if ,gi ' ' W 1 f ---" .,.2..Qne,f4 s e :55ggw.5:1m, 1 ,N , Q -- . ws? 'fm -1. 1 xl. DAVID J. PASSAMANECK 1586 BAYVIEW AVENUE HILLSIDE, NEW JERSEY ALBUMQ President, Young Republicans Clubg Pre-Law Societyg Government Clubg Tau Kappa Alphag Manager, De- bate Team. ETHEL PEARLMAN 1097 EAST 17TH STREET BROOKLYN, NEW YORK Honorary Historical Societyg Le Cercle Francaisg Alpha Epsilon Phi. MARVIN AARON PERKEL 77 RIVERDALE AVENUE BROOKLYN, NEW YORK ESTELLE PFEFFER 2190 BRONX PARK EAST NEW YORK, NEW YORK Sophomore Social Committee. 1, ,V ,- 5-:fa I , - 4',',", ,:5gf'-:bl-IRES., x"' 196355 'fm,, .,.- , ,..v.,..4f:,-. M,-'NU4 pg - w f c-Q f Af' X" . - . 1 1 ... 1-51-'za 1' : fl . . , at 5 .dw if - -,f - ,.- .- 1. - T , - .,.g5gs:.4q:H.,.Quay.-Q,f,6.j,Q1V.-5-m.,.Q-63. 9 ' Aggie - - 'Quill if .-V Y .,-Wag- f-A ,sh 'Hs' 1 -: 1 2 - if 'QCQWPQZL3 h- , as .1 w we ' V ami " "l?wa:e:-Ea.. Q-ifgf-w"'4ff , v'fQ?25i2gi4es ' " 'if1:.,.i1 5 . H sin-gg2i1Afa3i2.i." , '.,'1 35? ' 1481 E . 5 -iiiiiw -'Q E-x2a1'7'2i'i,Z" Xl" ' r" " ' 11.21-' N- vw: 1 c 35,5-I. .v . fri! '. -41 4' R? f 1 H2133 ' i1gig3'11b:7.'Q?"'I I gg? Xi f 1 "fA3:1'91,- --.xv ,. - ' A 'L 'Q F' J? 3E:'j:.":' -:aj 31 'Q fl V 'Ji' - " 2 3535 '. A f'Llf'b??'1W.' 277:15 73 v., 'iguffruwk-Kew.. .Q .1 ' -' .qgffkmf-xg Hg- . we r , 5h.4g:f22:a ui G. 1 gg - Hbaggfi ' kriwmyf,-1-N1'aSS: 1 1' 1 'Fr' J - Wa: 'Z . .. --n+::1, , W:-' f-up 5 5 R33 :gs H i :Mia-'g ki, 5 A ' xii " 5 " 1f1f34"yf 4s... A 3 'N A A gar- 2 . X?-gg-5 .. OK- Hwy: A, ' .., -' " ' 1 5 'J' .2 . 'df N 11245 af' K. ,1 2 4-'fi 92, QW" W1 : I , Qgofvpiigiiiif 3' , QIQQYQW' 1' ' fi 1 ' we 12155, 1332, kg' 4,Q3gni'iifizm 'ge 54- A , , 4 . 25 fiwfimg-.:54?' .3 W' me 1 -' mv gs' Ll. 2-2 Lf, Q31 Ugg , 1 me M K' qi.. fgzfgiset A:1:.m5-Wm W t . . 1'-5..W'!1 1' 1 "' g152vH:i 1 JI: 1 -,riff ' -fm-N , ww pk W 52? I, 1.22 li K 5 351 flak, , .... we . A , f K ' f Q14 rf -M' H .9 A 1 .,' - M .'- W' 35755 Q, K. iw-MY. . - W. -Jw.. .. .-Q, ,nga - .Q W' . g .. :ai -f, : -345.2 xy. ry, yg .-,sf Iwi -Q . Eu .ml-. ""f lf' -f--- 557' ' I! 'f1'1- A 6 - fp' .1-Q7-WSE? "--5 f " 'K . fm f 11: 431 521, 2. 'I - A . .. W, r Q . .277 1,2 iq. , . m f" + H' ' it ? . ' 3 . , . .., , fp . . N usswigaf 9 xg, ....,.1f, ...-,..:,.5g5:5E.iii::LIE . q!..vf7..:-:,4.3,:.1-'Im-,Q n n f x 2 .... , .M-... 1 if 1. - 1' M924 '-- -' f " Agf a" if -f K' . .4-Simi-fl":-di'3"5'f'5li5f""EL41' I-l" 'ue ,- ey. Xgusq, 'EA-X B Q Q- N -E--, far.-115: .5g'1jff'..'.::--.g, Qisf:-1-.qwglfr 113C':i.Q.,x1f n U, w,'...x5 -,..,f.,3:Q-..- 1, 'ri .-sg. ---A ,L-7,33 5--L. .. A A -- .1 gsrgqhp I-+:f.E'1-.rf--'fx E4i?'f--'- wgqf-g.,,5,. .4 'EA . 'kj :T wr: 1-4,-g:.f.m 'Qf -ETi?u4:'vw. vfiugv-'.,.f.rf--R ,Agfa E? -. glffgfqnm 'f' a.. gm:-., - '-a,Q,.-:-1535 F5-Za.P:vgg,,.. .--:-' f .- ':""'S 44""'N -4' .- 'w-f2'-S.1"2- pg-,wir-f 9 -f.Q .. 13, - t .J may Kg' , --:- , N.q.,.,,..f fi52ff.,.g'-cf' -f Enzo: -v -wx:-1:-if-Q4,g'PQ,-5 'wiiisg-iq-13' ..15g"' ' .Nt 'iZf"f"' v:'L,-':ff?3f'1'Qg4:'v.y,'g:'fwT.f3g2ff" ff' .J .1-Sc"Q3?mm'af1::-::'1"'5'V-.--f9g'vKEbf:7-"':fT-034315 ,Tv ?'le'L:,f'f 'Ze-259-iL'E3MMKNm'a'ffh15i'5'T?Qw-NY-' " '-':TQS:-rf:-Em-ifw'-1.'I.1Y.- . T' 'qygggje-fl,-jxii-3T.'1':j.f1f1. ji-,M A '-1' -R Lf ' HARTLEY LEE POLASKY 586 SOUTHERN BOULEVARD BRONX, NEW YORK ALBUMQ Editor-in-Chief, ,u.1,1En SCIENCE JOURNALQ Chairman, .Soplwmore Sofia! Committee: junior Prom cl0lIlII1illl'l'I Senior Prom Committee: Clxnirnznn, Freshman, Athletic Committee: Freslunnn Basketball Team. JOHN R. POLLACK 35-04 160TH STREET FLUSHING, NEW YORK Election Committceg Social Committee: Caduceang'Psycholog.v Clubg Philosophy Club. FELIX PORTELLI 2119 67TH STREET BROOKLYN, NEW YORK Der Deutscher Vereing Psyclzolo y Clubg Il Circolo Italianog Newman C ab. JOHN P. PRESSEL 393 WEST END AVENUE NEW YORK, NEW YORK Outfloor Clhbg Le Cercle Francaisg Dra- matic Societyg WN YUg Pi Delta Phi. ALAN PRINCE 323 RENNER AVENUE NEWARK, NEW JERSEY Juunior Prom Committeeg Sophomore So- cial Committeeg So homore Class News- paperg Booster Clui Sigma Beta Phi. MARGARET PYTLIK Q SANDERS AVENUE SOUTH BOUND BROOK, NEW JERSEY gf? Deutscher Vereing Le Cercle Francaisg ' nology Club: Newman Club. dfx 14.1 YQK., ff' F ELAINE RAND 72-36 112TH STREET FOREST HILLS,,NEW YORK Psychology Clubg El Centro Hispano. SHELDON RAPPAPORT 172 EAST 87TH STREET BROOKLYN, NEW YORK gmlcial Committeeg President, Pi Lambda 1.. PHYLLIS RASKIN 350 EAST 54TH STREET NEW YORK, NEW YORK El Centro Hispano. KATHLEEN REDMOND 391 FIRST STREET BROOKLYN, NEW YORK Christian Associationg Alpha Omicron Pi MARILYN REISMAN 1715 NELSON AVENUE NEW YORK, NEW YORK Treasurer, Ashby House Plan. GORDON REISS 1726 EAST 22ND STREET BROOKLYN, NEW YORK Chairman, Election Committeeg Senior Prom Committeeg Student Activities C0- orclinating Committeeg Biology Club! Psychology Clubg Motion Picture Clubi Philosophy Clubg Alpha Phi Omega. H A .2 155 'i+g17kf:,L:iL,fgJI1:g:-ggi," if-r.i bf-rail-,-.,, Q- M- "J K' , "4" ,."" ,"f 535,-gg-'FW' ,fatzf-1g?wff:,,,gqm Q-5 If-5' fav?-, xr: -M-S 54 ,. . ' ,o,grf4'l:,,fQQ-Q, mils N Q --f Szulf - ff"-S..- X-gk N ' EM -+L' gt, "WK gg - - Rf ,,,- -W-'llfef A-.vw gtuvg, .,! - ,,,,, I-,,,,, H, - - ' - ' 1 g'-.3253 - 5 , -4"L"+1 A , ,..'.-'f- re . W "'fQ,f,-,,fSw,,9.aie2fwa-Orig. , .i X., f - V. 4, .,., ILA ' J Mtv' ,J ,, ' an . R ' - . 1. ,Q A S 1 ff' M- 2 : Pc. E., .V .swf 12 f zf, fb 1 A VQHPSAYQ1 4155. E: - l i 2 V-G ,Z z5Qm4.rV,, . ll, 'J I A-aw 4 WJ WHQV er fx ., -as f 'Y-V W ir?" 'lil' . A AQ, ,,, . m f ffm--1 ffffv fzgv - Q: , v :Q - .' V A .Egg-3. 1 5- Q, V 11' A Q . 1- barn-: -' 4 'e 5 1 ' T--" fy1?fC9'a9- ' Zigi' -" . Q fl ' Y df" -Vp . . 234.35535 MS - '1 f"'w 1,4556 ' V -. gig 24,-E544 ,mg iv Q if , Q 3 . 4., qrz.? an V .:4iig',-5163" ' 4F?i!Qgf'pwg3,g Q ' . ' '51 V g W-nw y f., -f x' wa- ' , ' ' ' " " , ,. ' 5,131 :P7 ,' V E. 2 'wfwie' -E4 . gy in ..55u,5Es A ., ' -ff '- V- '- -VM - , . , ,nv '., T, W Z V.-gg , 'AWK "HAZ, QFW ' f 3 Ligibfqigf 'U ...., :- S V Q' gjlff , A 'Rf , . . ., , , , , ,,,,,,. , :El WF, - K Q v V, Qw gg xfi' ., rw- saw. U Ghlv 5 , - 4 ,g9V3If,naigyig M ,f ' I ,, f-2' f4:?T' f'5- f V gw Gwnww ff -"' V - 1 ' ,.-'lf' J. GF. : -vw . .jf-' ., ' 1 A ' .ieaqizd " E ' ' sa m, 'haf f,- A , 2 1 , AJ-' :"'f7fl" .EZFHR '4?Q2f3Il"f vp, " 5 P, T2-V . .Q rs-E- . A , 1 :f,v..3.- ,-'fwfasva-fp.:a-Q11 - We-' ff s . a 1 '1 www:a2ffwv?:ffw4fm E, , ..,. ,., wrt. ...VL , .. .P ,- . , J 1 V Rf, 1... did .W 3 '.V:,,?a,5-Ry. ,V,.:.,,ffyl,4,.,, y, 1 ' ,g1.,'f. .mg , .L4 Q 1wA5'l41g5iggnq5fgg51w2Qf,f' 1 - vw. 1 s,-ziwwz-Q 4- ' 92.22 3.4 ww, 12' ,,4v,554gg.i'1LfA'-i'fe"- . 2 1V. E -fu ug-.::,4,-, ' +w'V'V. 'ewan 2 4-4,5 wwf eff iv gg ww. -:-'fvefscml J' ' .E-s'11ieG2'::ga'???'gl-aff ' -1'f.g'T"r,24,. f 1 ..-f ' '1:'iQi1'?."-1, 'frm iw' 'f74W'vfw11'v.1' - .Eff -' . :nf-' muff. -. .1 e - 14's 5. -:sw 1 :mlb -1. ffifiwlifs-1-wigs E' Q W 4"fQ.1..:'2'-fffjflqelelviafe. 1 3 Q? "'i12V'vI 35'11fs'wE3P: ,..?i4zQ2,,, 1 W'l7 '94i limp, T3MWLwEs,Fz-1. ' W"':"f' NY' " f -'aw-14. 'V.f,viw lieu-,!vbv, 1 . ' - - ' 2 V. V V. ,dz--.z4V.-A::,v,s.' i. ffm. .I V. jf,.,4.5. pf, 5.f1:gy-:iam 4 -T1 4 I 5-V, 'R' f V- . V 5 ,Q Yilfiei f ,wimwfegxvfzfa fw "1 : 'Nm-493''jf-wiv?-5-L:-.. - 'Sf-Au3-ff-'fiyjcxf'16 Jw: :V 14r'g1f-Qgrgeq ,K 5 Q. ' 1: if-H.. ,ur 4,1 . an .. T 4 4, f 'w..N,f, , ' dw '-fe-.QQSN 1-',--:M-.14-.-...E 14? -.-kfv6w'94A ,. Mm., MV' 5.4,-rf-1. . ' 1, w .waz-2, Wg? gf' QQVAF f-.1 ,.s:-nw, ,..v , dftiwffuf ' --Vg,-'-.V,wuVV'.-VJ5Cf31fff--.w 91-'::Esfw.'., 4111 V 1' ': 'lxi-R214 - rv ' ' 4 -' - ngh,5A4fEQ- -V:5- MwwihmhgghofwgwayifmhMwfqaq- 1 J www-WEN -VIE , :L,,T 'Wi A -1. - f.Vfw,4Qfn 3353-A1V"" a-. e:M'4q,-gf, wp. fem ,. - -' 1 .1 M - ' ' .. f- T. 1' -FG'SBgQ2.a:g,n9- fm:::4f':m1::v:, .- .,w4b-wi' 1 -' VJ," flu! if 1.-1.33-:, 1:31. -.E AQ . gag , , v- W .nf 11:1-"' 'f"'Af1D5,?N ?'.- ' kl!"'721:9"l54'f.f1. 'J -4.,,H. 5' Wg -. V, -,,.,r,mgae+:eLqf:,' '-1f' f'l5'?'P1'2'nS1'5f' el'4:1:2Q4j,, 1' "l " '9 ?:gP , L' ' M A - ' A ' A f-j r -- 4'1 1--Fw 1- 1 --I-Pa'-ww Ar-4-'W 7 -:,--5!L1S,--- -J' rv.wk-1, 1 pn. 1. -'--:E ' -' - wa- 1- V :fs - ff V -' ,isa . 'H' 'F " " "q'4mEmM. ROSALIND RICHMAN 700-80TH STREET NORTH BERGEN, NEW I Psychology Clubg Violet House Plan. ELMER A. RIDDLE 32-03 212TH STREET BAYSIDE, NEW YORK SHERMAN RIESEL 2055 CRUGER AVENUE NEW YoRK, NEW YORK SAUNDRA RUTH RIESENBERG 111-32 76TH AVENUE FOREST HILLS, NEW YORK Retailing Club. . ,- ,Vwyf 5-C. .N 5 f . ...V lm . . A 4 rigs f1l.l2sa.ff 11 E5 ERSEY df' K - N , ---' 1 E. E: "pi 9 I 'iy I, , QW 3 X 6 gf --:,f.:. 59: .-:-:.' ,.- M2 .Wa Q M. Q N E Raw 35 sa A ww W " , -2 X 5 . ig . -1 , 1,- " J f , A A 9 CHES ER FRANKLYN RITTER 131-42 26TH STREET LAURELTON, NEW YORK GRETTA HAILA ROFFMAN 455 COLLINS AVENUE HASBROUCK HEIGHTS, NEW JERSEY Secretary, Le Cercle Francaisg Futun Teachers of Americag Book Club. JOSHUA ROSENBERG 579 SARATOGA AVENUE BROOKLYN, NEW YORK Secretary- Treasurer, Pre-Law Society. WILLIAM ROSENCRANS 2370 OCEAN AVENUE BROOKLYN, NEW YORK Government Clubg Pre-Law Societyg Sigma Beta Phi. x . -V . ,E g.5m,f 5:5515 -.a- 3 254,-giml ,A :U f' - .-:'p?:-va" J-x ' h.G'1:':71'-H1445 "' ' 'nfflf AN- ,-" -:i-G4'.-- -T' I 'V ' . . wif R A - 1 1' '- If -5 ' 'i15:AsQa,.fQ1nv:LiH,3,2fil-?::-- :wav f-EIR ' ' ? ,,1:f554SiM rrA" ,ff A 5' 1, J ai " Y ,arid-f ,J'f-, , .1 1 Perf' -2gff'fs 'd!f:f-?'v:dr2f?f: v- , mi' ,wif-" .-f.. "N j sir - 6635! M:-z!fL4'4-'--,Y- , , -,ggif ff' .qv sam' 436' :Sw ,nge - -,nev , '44 f,+6' sez , wry fgffzvn '1-2,.f G -ui 1645! 5 USL ' f ' f2i5Lis':ff:.:'K , 7- rf'-: 'J' - 1 ' A-., . . .'.A25'v7.. '.1:P: :Zn 1 , iii W-'1+4"m,9' 1fY:s1 , L . wiiiizfik ef 4 1 f Mef2Ef11q51f , 1 . .. . 12 ,E 4 j' 4.511139-12.4--1 jqf N 5 2 gs f 5 tv 4 S gf ,A 3 .. Y ! g gg i?553.13:iggg,, fg,g.,.f E fe . ' '15,:g1:ifaz:f.,' ,191 2' Y- A L fi, ,:, hi. A F ,, , 3 f w bffgqiwwi U,f3,. L . 2 fl-E fi :E . RQ-"EF , g., Q .1 . . .4-.W i J , , ,E .gym--fifaissvx.-fe:, E.. ,f, u E - " at -1 -F ' ' " 4 - I Ni- 5" 1 'si:?Lif" :" '-'1'E:1.-7 51 52 T V . 1vEf:eL:,4ef" - ':.1". 4 . .,,'q . f, ' A 5, ia mfr 325555332 Q- Q ,. -. 1' " "H D' , .1 . ff' AW' "' Y. 45:5 'Ye9L5'f'4f- --v 1 f ' 4, gi , uQgak,3239f1jf ' ,. f 1 Sw ' E Q - las 52163 mr 5, J KL a'r"Q5f's-5 -. -y 'W' , Q je zzzefzpl , 'f ,fF?yefygga:za52, .3 Q fm- f ef 2 -5922 f 4.1 .21 Q1 smaf115,2H.H Y- 'fi wg W M 'M F if M 5 if 'W -" Ji? 'f- fbf31?nFdff',, R W .., L-E A4M.F,J.,,,M "V 1' , fi V5 1- -1 L , - . A ' J ' -f:'5i?"5-VUL - . rw' . A A ww" , . H5225 :fi-1 "h I ' . -f 44 A ' ' - " V ' ,. V .. f ' 'W' Civ f e w-U4 M . -,3?"m,a,..., 12 ' - v- ' ' " " ' T di? "i.s3k'1.J-,-'KEYSWI rihif' 4??13.':7':" . L -elf' -' gm- rlifi Q' - Effzw, -aj:--' ,.'-1 :qLf"iI. -fu. " 'f1' . -' - Ut'-VLH, . 9--,.".?- I gf' X, via " "N" 'O"" 'Q 5 111: . 1 'Y F,f,EZ'?A-zixfrvinsbim-gear?-' 1 +R' , im... Q., ,QV , EQ...-. , :i1..m ,.-.- .,d Aki.-'11 -.v -y 1 eq ' 11142:-,JET FE , --R' .'S'-.ik-'ff g-nf!,454ZykQ-f.1Rx.r,:--.-- Siiilqwf fiwwwf 'Y' - -' - 1 'LJ effww-vqO.??Q2:A1fWY9?-E?1:'lfL+?frerl'21.-Af- 21 if' - T . - :..:A,.,3---4Is"fff:1-,.m:f kgf,x4kr23,+--4-v5.:.x,'3ff.r:q-1- fl f -M2 -girly. 5:1331 - -.E:::.g.-L, - S511 ' ' - f, . ' " -- lim " 4' 1 f QI, T in ALFRED RICHARD ROSENTHAL fq- ,I 3455 CORSA AVENUE "" N!-'L' BRONX, NEW YORK American Chemical Society: llflatlxomatics Clubg Biology Clubg Der Dvulschor I 'erein . J. ROBERT ROSENTHAL 599 MONTGOBIERY STREET BROOKLYN, NEW YORK N.S.A. Delegateg Biology Clubg President, Boys High Alumni Association. FRIEDA RUBIN 53 WASHINGTON SQUARE SOUTH NEW YORK, NEW YORK MYRON RUBIN 173 OSBORNE TERRACE NEWARK, NEW JERSEY Election Cvmrnitteeg ALBUM, Secretary Biology Clubg Psychology Clubg "lWri Sophomore", Sigma Alpha Mu. PATRICIA JEAN RYDELL 227 EAST 33Rn STREET NEW YORK, NEW YORK Retailing Clubg Der Doutsclwr - Biology Club. SAMUEL SALANDER 601 WEST 180Tu STREET NEW YORK, NEW YORK .Faucllarrliang Honorurv Historical So- ciety. T I 'orain: .fmff Mfr T aff, I-K. W' 2? U6 :gi ffyj 1 f ,Y Q2 X5 y I z 'A 45 2 f 4 9 if 1 V iw, ,. . . . ,. W' aff. ' ' , .,,, V I 43-':.Q?3' 2, ' iii or :' vii? . THEODORE EDWIN SARTOIAN 53 DIVISION STREET TARRYTOWN, NEW YORK Chorus. GEORGE SCH-NEIDER 367 EAST 95TH STREET BROOKLYN, NEW YORK President, Junior Classy Vice President Sophomore Classg President, Fauchard. iang Sigmag Beta Lambda Sigmag PL Lambda Phi. IRA JERRY SCHNEIDER 497 JELLIFF AVENUE NEWARK, NEW JERSEY Vice President, Student Councilg Presi- dent, Sophomore Classg Vice President, Freshman Classg Upperclass Advisor' Sigmag Biology Clubg Sigma Alpha Mu s BARBARA RENEE SCHWARTZ 650 OCEAN AVENUE BROOKLYN, NEW YORK Junior Advisor, Treasurer, Biolo y Clubg Alpha Epsilon Phi. 5. BARRY M. SCHWARTZ 3045 OCEAN PARKWAY BROOKLYN, NEW YORK Radio Clubg Jazz Clubg Production Su- pervisor, Square Show. VICTORIA SEARLES 218 EAST 67TH STREET NEW YORK, NEW YORK American Chemical' Societyg Biologv Clubg Der Deutscher Vereing Newman Club. Q-ff-A1111--5NfS1f'nT4fi1l?fv"ifPS'L , . .E::5J,5w'-552' f-2132? ' -' KE- :zl?fS5f'.if-AF' -fame e ' - if?" ---.--Q-1z1a7ef.,A-.,. gy? -R :LS - - I-.55 Ifeffswep sv , . PH' A A , 'gsm- '1J"' . ' A 'N '24-ff. f 'I Rm? A on Ravi' A :meg Hee Sf' A fe w .A 53'-W' V ..,., ,-A -V ' ' ., I' x,j:..azn ',,S,, I. My y ,,,-p.,21. 7 -' 1- , " " .,'-:ASQ f'W5Q"'2 WS?"-Ps-?F3iL' RQ-f:':-J-mfg, ' iv.:1,4?.i:i,.q:.-7'3?f.e1L:q.' f f'-:X " ' ,,. :Z c .E-0 .. I' . . . .,.- 1 W ,. .,. " "' A-w:i'f1l' fb ' " E, ,. , In I7 A r Ein 45 f A .r , A 4 A. . ' 451' 'l5vKf':- 'mf' li Jia 5.12: 'If-7 if 'f Q1 2 Y 'M.,.,f 44- 1 57 ,- ish' - '? , idk !. 1 iz ' 5 . F6 :' ii 4 If 55 I5 - - -AL 'fy Arg -Ama. zz- if JIM Y' -' -iffy, 5-ani? fri . ,fkaq -- w, ' fzffjp 5-g' 3. ' Y' .. . 5!2:1'31,12?- fvif- .1 P. -I I y,.1s.,'M1a1g.'l. 1:-,:.s A- fe A 1 '1 , I ,.i..1E:u , 1:52. .1 . fy ' '1i:i"g, .1 - -45, - 1 52 .' f gffiff f if ' fzfifli' . . - vu up 1 Q A24-fr' .ner .. if A-3 V- .Af im-' .. 11. f,?,r,,i 4.15559 '.-2-viz' ,-,'I?lfi5"-'J' 'Sa 'Q .55 .25 MI'-:J 1-Qu" ,Lv-A-QQ.: . , I - 25331 - A E'f2.f-'f- 3 .-:Lv ia?-91'-.. i 1, E ,lf aff,-.ziaisiflarbilfr 1- - '5' 1 xf' ",1-1-wgg-525221, --,fm 2 P23 5, .gg1f5f.aEe61'affa.s'- 'Tm 1-' H A -"' H, 5 5 1 . A E E- ffnz?5!3:.--R fjffio A is iwpfg 1' 952:- -. 4. vi,-,--..1:A--Q 1-I-555:-f -1 G' '-NE! 1.2 A P- .ff- iic. 55 Ge' .- '- -if HS- -' ' R5 may msn-,,.g:ff4:fx,f1qk93151. --5.1-piiewng-,H - A-911 , ,frfzw-1eS1".1:Isw1 ' A 1-,TA ., :les ff. 1-wi -i-?+.f..,- :fi-x 74254 ..., 1 1 - 11,151-:1 -Q n?1hfNf--:r?:f"1W-11"QMzf A 9 M50- . A Us ,.'. .5562 ggqmgaz " "'-cf' 61?-I -VE-i' , "'v:S1-"'Q5.rl::Y '- 7 -1 .,,,...A ...,..-A-A.-ish.--Asak . ff LE agw--T. -'vi e :Q-5142?-' -'9i"11-'GAS'-F.-' tix ,, A-4'-"f".A 2 H- , .. ' - 'H' Q"-2 " " ' H 1 1 gr- . -- A .ffm .X ' T -1-gg 'ff sw: - 41-x ' - -i?5'w". uf. ' A-f-M HX 'fs Q. A3 .. ,mirzw 2 ggqsmiw, Q, Wy, 'Wil , . -if 7 E..i.,-..E.., '3,.m,,,,-,. - -.-4 U- Aw..ff .. , f Wag., , 1: if' P Nw" .g2"??Ac- ' J 'fix -swf 'K-1 gs" W '+L .,-15-:ffm ...nf 124-22 rf zfzf' ., qi- ,153 RL, Pj- +' car 12- -1: : .A.:'g'-1:-.-,--1-f:xA '-,fra F91 V I N - , ', LJ -- 'Y '-.zffwmguxe .1 Rm' .Qfw5Am1-- r-ii?-S-29956 sA,f..3??:??AL.D:3- ' og Hwy - 5. -- 4- - 1 ' -3 nzlssfzmi-.ffff Aw- .Www N 2 2 fm - 2, 1 'I 1' -AM' -. f ' ' a , .fffwfav-. -.nf-A f"X'X,:-fwgv s-3.33: 2 ' 15 ' ' 4535-:. '- 5.1 ,Ja 5 1629-1.5533 2' 5m"f.5 . 2 'Asc f -- es Q ' i ' Th "' I fx 3' X. 1 v K., A S: Lf C5 -fe SELMA SEIFER 246 BEACH 13TH STREET FAR ROCKAWAY, NEW YORK El Centro Hispano. SYLVIA SEIGEL 17 CHESHAM ROAD BROOKLINE, MASSACHUSETTS Psychology Clubg Sociology Clubg Philos- ophy Clubg Jewish Culture Foundation. ARNOLD IRWIN SHAPIRO 700 WEST 172ND S NEW YORK, NEW YORK ALBUMQ ALLIED SCI chardiang Mu Chi Sigma. ALVIN SHULKLAPPER 2309 HOLLAND AVENUE NEW YORK, NEW YORK Fauchardiang Biology Club. TREET ENCE JOURNALQ Fau- V . .ff , - 'MX A' 13 ' f ,ll X JI - fl .1 I I 1 I fi Tw fm ff JOSEPH SHUTER 186 EAST 57TH STREET BROOKLYN, NEW YORK Accounting Club. DEREK S. SINGER 57 KNOLLWOOD ROSLYN, NEW YORK Phi Beta Kappag Honorary Historical Societyg President, Inter-American Rela- tions Clubg President, Russian Cultural Society, Le Cercle Francais, El Centro r. T H ispano. ' .,.., A .lf-?1":22:1if:fredii - Q MARK MURRAY SINGER 1 H 47 DUNCAN AVENUE , JERSEY CITY, NEW JERSEY ALBUM, APPRENTICEQ Phi Beta Kappa, ' P H Q President, Caduceang Secretary, Mu Chl 4 M. fu Sigma, Chemistry Club, Biology Club. XM-' ' DONALD SKLARIN , x A 124-5 EAST 13TH STREET X BROOKLYN, NEW YORK ,fzfig -E, ' . nw. -F-LE 91 .- -'if' 5525 - 5 " pavififf' ,-A-1" -,rgge-:13a,. A "11':11ga53i:fw,c-',-. -f +,ige:f" 'P' 5 " '-w " fy' .,:q5,.-v ..-1 ,.--3,3 ' A Y! , , ,-qaggafm',f.-i15g5ey,-:f.-yg.::,.- 21125, 'f ' 4 Q If f, ,' r..fialzztefsviirq-11:63AM-32:15:92: 1-ay. 1 .-f:12f - 3 5+ Y Y ' H' J .. 'K '.:-. J' ' I ' Zn , --. , .x .'v 'rn . - ,J ,f 1 ww' ,f'f,5Q3fo,,. P , ' f ,,4,,,-', :f-- gms, kfis .flff 4: 1 sEis',,i:aS:f - ' 1- ,,, fr-.1 . wg? L., 4 2.-Mgt H! Q ,. -I--f 4. ---. ' 5' A'-Yi " iii 2 4 5 JMQQJ ' f aww - we A REE?-:e4f5i4'1 are fi it 5 1 3? f' 537 ' ,f Y i :Q 1 , f'g' -2:51 K e 2 1 1: .T y 2 iw-3t35':.'L',1glgi A ' 5 4' 5 - " 1 E 15 iP1"'f?ifi1" 'H'-'il ,f e 5 A GSW 1. w Q.'3IfnE'f,,v?.?1- - -1-" X ' "-F. B ' ' .Iv '-" Jgi E 5 ug 3. lift ,-4'i1'3fjS'g-ful, ,Jyiti 5 f fi V., fl. E5 ' - H -rf - . ' .1 ,,.QGi"3',"'i-I-fa - ' .. ' ' z Q31 1, A 1 of - 'i 153251.15 2 ""' ' ff - -A .. T- , gy tax g y , 3 -f. A - f- '- 1 . ,t . ,:. N A W 2 45555 fig--"qu,' A' A Q Swv zlabfiiifr Q . W-' e ff ,i'2?PQfM-j . T- W' V,-'rsh mfr A-',f ,4g.fgNQ4gZ.H-,GX-, . e QW .1 -Hyfqr J. A fum 1:5 15- , s.V,.5-,iw R -fs , 1 A V,--'sf' 1 a R. 'w-ffiypilw A . -W ' wk g ggfggq -mi I A gg , f,?wMjwf,, gl :-MMs Km: Q! 4531114 rpg' 1 E fweiffiax qf- A-'T 'wM3Z23'f' ' ' """"- .L A , , I ,fn-sig -,E Q 711 Y -- , , - rvpggn 531' "" '-- ' -' ' T: 1 -' 1H551WP'?"5. Li .W ' flu I vm Q zz. ez- A- .fe,s..fA ,1 ,..-g 41 - H f v.4,E,J 1 . o A, I, w A ag Qg gywg gf ff .L ,- X .. rar " .ni ' ' .. ' . , aes? ' ,1 V' . '.w.,,.1 . , . ' 5. 'T , .' -- 4 114: -ya. . An ivan I 'ssN .i.gZ ,'vig:g?n,!. f r Sf, l h i - A---Jr ,jYRP4'1fyv?eS,:Ulv, Jw . 'I+ ' ' 1-1 " ., mg 4. 4522,-,.-ga-2'-A-wi --" .Z"?'7"f?i:- nf- f 'J 't""' " ' , ,. . ,,2.-Y '. - 55-4555-- -'-u -4.:.1-A...-1:-.wmzv JP 1 ' -Y 1 A' - -3 ' on ' " 'main ' , V -A it ..- , - - .5 .. ., Rw.,m-.,.g4.,1,f.f.x . S.- ".A'??53fiEbf-QSF'-?s'fL':f"'J?:3f1'Sp 'l'1.J,-S lL5?'I:-?i'Qii5jfEA, '- '--f:'c:f, F-:-H-r 'wg-55' R., .-7,T4-'v.,- .. . N -ww , 'J rr, ii: Y,f.x zzgxzgl 'S fawigx 2,.....X a .--.-v'S?2f-SARS? kwa.. ef-vilambsai-.2 , ,En , .M OW. ,,,.,., - aw, afiafsgsi Effifm if .44-ff W ,Q A qhr, 5 ' ' - .ma .ff A - :QQ-me-as-A 5 121' fHEcl'iff?f1fgE-.T ,:'ffi47:-.,::,-.R-.. 'Q' I5 ' 338 EAST 20TH STREET NEW YORK, NEW YORK Secretary-Treasurer, Senior Class, V ice President, Junior Classg Secretr1rv-Troas- urer, Sophomore Classy Slpparclass Ad- uisorg ALBUM, Sigma: 'reedom Club: Vice President, Opera Clubg Phi Epsilon Alpha. JOAN ELLEN SLAYTON 2300 BRONX PARK EAST NEW YORK, NEW YORK BULLETIN, Le Cercle Francais, Saddle Clubg Opera Club. PAUL SPECTERMAN 62-95 SAUNDERS STREET FOREST HILLS, NEW YORK JOSEPHINE SPERRAZZA 335 EAST 32ND STREET NEW YORIQ, NEW YORK Geology Club, Der Deutscher Vereing Il Circolo Italiano. KAY F. SPINDEL 1530 SHERIDAN AVENUE NEW YORK, NEW YORK - Junior Aflvisorg Secretary., Psi Chi, Violet House Plan. RUTH A. STEIN 96-18 163Rn AVENUE HOWARD BEACH, NEW YORK L .0.W.g Dramatic. Societyg Biology Club. ,gn-. J. r li LEWIS DONALD STEINGESSER 504 EAST STH STREET NEW YORK, NEW YORK Biology Clubg Stage Manager, Speech Department Dramatic Group. HELEN SZILVASI 30-63 33RD STREET N ASTORIA, NEW YORK Opera Club, Book Clubg Couernmem gulf, Newman Clubg Historiang Delta! eta. GERDA TARANOW 117 SHERMAN AVENUE NEW YORK, NEW YORK Junior Aduisorg President, Der Deutscher V erein. ALVIN K. TARRAN 255 HART STREET BROOKLYN, NEW YORK Speech Department Dramatic Group. HELENE TERHANIAN 1851 BOGART AVENUE BRONX, NEW YORK BULLETINQ Secretary, Opera Club, Book Club, Le Cercle F ramzaisg Newman Clubg Christian Association. CLARENCE D. TERPENNING 74 BRINKERHOFF STREET JERSEY CITY, NEW JERSEY Psi Chi. , M ,, E,Qig5raw1:.:af..u1:53,Q.-4,.:-1-.-. , . 33,4 3 M If ax-'ni -L .-55-.H,,31" mA M. tv:-iggarfzvj 'Lf' it H ' . 'L -..- AP3:E3i::1:,5 'fit' R ,. .-nf. ' if X942 456 ffzsf'-g,,,1'f15Ef, img? 5 ' 'QZ.4i'+54e ig A amxdfff .va-'?' WH' ua.-. V 1:1 .r-. 11..- . 1 . .. -"age .Efff..:r'- ,, , f-,:1'0v""- - , --'- - A rf: if :RRY Q-EAEQSEE3 ggi-, 214 5-i f-2122" 1 N 120 ,f Lal www - ' '71 '1 E r. .Q M1551 ifzelwq , ... . :F 091'- " n f P r H i "FW . . 6,1 fp I 11 eh 5 ,-1 gVL,j'i'g:.:' ,.g-, if . 2.19 fgxf-ggi SV ,L L15 M ., , ,. w2.: ig I- . A -lv L 62 ' '-, , Q ' f --1 1 f ,Q 5'-. If 1 . ' -1 j..,,,g,' , V-gg, , , 5' 1-9' fv.m.,1: V MV... xgwVV 135, f-- fffig ? YZ'H,ffVH21 ill 1' ' .1 h -LL' +V A .VV-Aowfo wwe 2 1 5 52355 -1.-an ,- lg'lfN.AU",f'.flm5?ff5,Q', F A - V13 if .ay L25 ,W . ., 4. I ,720-3' 55: ' 3, -we jM.'4,,,,,,V- uiigjf 2 nik Rwmn. vviviq l k wcvfzflfff en. 4 . I A . 2 I, ' ,Q 2 ' r' 1 Win 7 1 -lgrsff - I' W.. 1 f , ,-f ix I, .,,,, -:., M E , 5. V Sfg flf-4.2 4 "HQ Wh m M , sg- 5 :Fe j 7 V., ' 1 ,r i W" 3 V iw 155 V . . Q 5, .fgilmrp , 7: yM.,2L-:lQM,j HW i, f Mew., .F ' 1 M' ' a ' '1l,.s-MWF fbi.-- nn is: 'A' f ,fr , ' 'uw-v '21 .eE'im'sE?131'+,:,. R Y H .1 V" fL,? "' 'N A-?m,,..i,,' 4 1, V553 1 ., -M ,-,, V . 5 H 13 ,ff-Q ff. 5 1 HW? 1 V ' 1 f-W " I it 1' i l f' f A'19A21v'41s1wyf:fwymvw--new , ..,, .. 14. ww- 1..1:,,,.:- . . ug., -,--1 , V , -1:4 , - f . ' ' '1Vm,,,4,"Vf1, -ff . .1 , EL -A ,.fggf?:::vg:Sg1'-52553551-' 2 1- i5 . V p? w,3f22Ga5aQ'f!fg?Q! , 5 3653? H aa-fafA.,,,, ' fw ggi, wr--1:.E'iNs:5Eg5ygm egg. 5 '- .a .,g,, -' F'-P-:w5P,5's'-f: :fi s -v.f-11!'?LMe,f':1'V- fi-fgfkwmnr 1 V wif.,-5 - 'H '-Zvi .. -., -S11-F is-4: .H - '- -1 " -'1gl'1.'f'A :WV "?"VF1,,:1-' - ,E"'AET"11' 5f'f??13'9Q"- ' 7 ' V51 L1 L' 9 ' 424.1 7 A -, , . " - 'ffm '-mf' 'fE5'ff15i5vQE'VViz.4,f"'53355294,Ui'-' 4' :fc-if ' W 1 - . 'fu e!.i"kiWE'?Fa-1r'+'e GJ'-."-.J.'l'r'V .MQ -M f-L f "'?.'iff1Y'- . 0 '1f 'fGf .174"' 'mit -'fl'-' 1 " XP' 'di 4 3335-"iff Tfti-M-iilq. ""-N' 'f"fl'Z-Qllaiffk Uma-. ivifmfaffs iz ' -5. 'V4qlY'iYI.9G LM" N 91 1 ' 5 -V ,. :Q-fi-f,j1 41gq4z g,'.':r ML ' - V, f:ai5fa:S2 1,5 ,, K' . ' .F V- , Y N .S be.t,,,W.251XfNx?'ViflIVR4VX .K ERA, i5,I,:P5,5i,SE aqihgijlgv, 35, V Z. xii V . .. - , ..., 3.13 . ,, '- . .V " '-n'2gVfE':2. a ' 'kfiriw 1213-159931, 3 ' 'Q i- " V '. 'f ' ' V ' A , Y. -,.,.1,1,, ggu .,f fV'.-1 My - --wwqfwznouffiinv ufmivfuwg. ' -gQg".V,1 3f.g,2m "' ' 1 X ff'-- my WN' 'ifffifwi .' ' ' P " .:df, 1,,,.1opfQs21MaHg V. V 1- .4 4. -...S-. 4 ,gp .,. -me 'i..wes,..., Bmmfes WVVR:-.1-.,, -Vs. -'- 5171 -- 4-.fm M-V- f,:"4 ' ,f H-Qfiwrgaaspezg-:33gsy.:....,1m V ' " 'W' ' A 3551 'F--Wiz , ,finw . 1751: 1 .1-'f V . I f . 1 1 ADRIENNE CLARK THOET , 270 PARKSIDE AVENUE " ':' ,gf.,i, "" N 1 .. .A-gl . if " ' BROOKLYN, NEW YORK 1- Alumni Secretaryg Copy Editor, BULLE- V.- TINQ Junior Arluiserg Phi Beta Kappa: Treasurer, Honorary Historical Societyg " Eclectic: Pi Delta Plzig Book Club. I fy '.j'q5s:"s.,, V. ' -A PETER M. TOCZEK ,M ' "" 391 BERGEN STREET NEWARK, NEW JERSEY K' 1 Exe ager, WAVERLYQ President, Yloung Re- ,, publican-,Clubq President, Freedom Clubg ixjxx President, Joint Anti-Totalitarian Fed- ' erationg Secretary, Economics Club. ' cutive Editor, Auaumg Business Man- Y X., . MARK J. TROTTO 1360 WEST 6TH STREET BROOKLYN, NEW YORK Biology Clubg Il Circolo Italianog Opera Clubg Phi Epsilon Alpha. GERALD M. TRUSSEL 1057 NEW MCNEIL AVENUE LAWRENCE, NEW YORK ALBUMg Club Editor, VVAVERLYQ Secre- mfy, Freedom Clubg EI Centro Hispalzog Psychology Club, 1 VF , V - " 'Qf"W"'5f 170 if .,,.'ar5L.:: Q . E ,ref of .:--ef,VVf:V1Vseo..11 .. . , .. ,. .,,., ,bfi A , Wakfzfa 1 I, ,, , .,,f N. ' V,5f,.f'?Q :z.,f,.,.,sg,:-:, ' , 1. .- V-:qv 'i:"".I'ifo f 7 , any y 1132535 , j,'?,'i 1 f X 7 I, 4 Qi? r Aff , af f f ',f , f fi! gg ,Q Q1 , 25" 2 f 4 ff j ,W ni 4.14. 1,2 .1"V:2w'y -X Alf. 'YV'-off ,Q , W .wif y fi SEZ? :iff-' f f. :fi ' VM! 4fV..4,1,.,.. ,Z rw. Q' f ,, .. 492.425 1.1 wr: -r-:xv .' 1 : 4 . :Q-y.-7.-,-..:,' 7' no ',wV-'1ffV1i:V' , ,i',1.-4, V. , pr ,., 77, ..,,,,z A . - '-VF 5' '-"xiii u, :2 4'. 5'113L'i:2E:E:':E2.1tV' ' ,QP 55125131 1.1f',2"V'ff4r1'4-' yPV2f"3'.'!1n IQQW' XE" , ' , , f ,112 7,4 " -, 3 " 'e3gL.c'V- 4'-1 1 jf . . . -.egisff ' L, Q.:oV" " ,, I " " A- -f.Vf.7,',1,W24f 1- V- V . 1V , ., 525 4 - V QV - J. 651' 17, .. . - ' ' ' 4, 141 5 , - . f., , EV. A ' Vy,Jgs.fk4Vzn -V ,,:y.V. V . , fffmzifl 434 V, J. ' , .JV .,.4g::'2m':Q VV rf VV .V 'ffq-f.,1:Li4., 55,Zf,,-fy , ,VI '-fzjv .,,,g'-::1,Hig,1v'7f, ,ff ,l w 3 A, 1.2.5 .Vg?'1V!,V Z 5, .y 1 V, . . ., , .. 32 ' 35 2- 1V-1 -24 1 x Us V V1 H- . "ia ,JV V1 5 ..,-i,:Jfyz"-sz, .1 ,V 1 - 1 la , 1 C no 1 I 'V -.rf-f,f:.:eW..Q-1'2'VVy'1Pm? ,V ZV f ' -- WL' :I '-7"--7'ffifiiffbfi'44'77"Q4Kj9Z'wff2?jgQ5-,QM,f VR f , A '- WNYUg Chorusg Government iw AlphaP -r , G 4'f?eT'TE::.:Aif3Ii"i'x5 -.,f..,--,-.-.-:MA wg. W f. V. E, .---mx - 'lbw-,+.'-::n2::f'h aixffzi v3i1bf1u'f5aZfz.:m:11fs15Qs:ww 540 ARTHUR A. ULLMAN 7522 249TI-I STREET BELLEROSE, NEW YORK Clubg hi Omega. MARTIN VALINS 3720 AVENUE L BROOKLYN, NEW YORK Business Manager, WAVERLYQ President, Fauchardiang Sigmag chology Clubg Biology Club. MELECIO G. VERA WEST 157TH STREET NEW YORK, NEW YORK GEORGE SOLON VLASTO NORTH STREET GREENWIC1-1, CONNECTICUT Va.. ,iff 9. .L ,. V-sis" th, .Eff - V .TA'4..1'- . Ex 2,5 - , 1' ' a 1434-9Hw52'1 1?EN1E'-:2'5? cw. ,. - .eww .. REE- +- Hf ., Pm We rf" . inf-rv". Es' 'fi . -4 'g pg-1--' I a,.' -2 gamefl'1-ax-.:sz'5:23I51iq, . I. . 395' ! - - 1- A-" e ., ,..f-4,-1. ' ---'aiausnfskrf S--',.fg..f:X :- ,i fa e ffffgf-f 5 1 f f . ff A f m. ' gee 1 I ef- f f, 1 -, eff :eff -. -.swf L1-f-:12'15-:ssrv- " " ,,a--4:5152 -A' ,A 5:4 ' T 'fit--: "w:,6S-migfs-::g:?a1:f f . ,w.".f3,f" M 5 2 ' ix'r'if5ff,q?d:h-,ifwp fi . ' f-5 -f 'Ti X:-.2 2 115535, , VW:-ilifgq-f LS' E wfff Q '- ' , f w..1fgw,'f wx:-1. Eff -. 1 if 1? W A giixigifi fx v -" X 1 2: . 2 ' ,i?. 'L -.Tis ig-T 'qiffp 1-11. ' .::r'mS.5"l- :4-- M. J ,-': f "hLf"'. .z, H.: eh. 55 ' ex R 4 nf: 2 1 'fxflxqg . L: .9 Ig sg 'ig :. 1. I -a.-V . rain 1 1 -sms: awp- -E 11 ' few- . -I' 'nf 'K--5 - E 564 is nifff w E'ggR1 ,f ,- 5'--.ivrfiz Q:,.ss 2122 ' 'wi f' 5. Q e..mz,A,' ' S354:3f,..f41-.g' 2, '22 5 '2F':ifvw "5 ii-Q" V ,, , fm - " N - -- ' 4 - - ' -E: " web:-s11:'.f.r. "M 1 1-,'6-"'4'-2l:- :f A H 1+ "fe: - 2 ' E i ff ew -- - ' 2 af 'Fai' . 1 :sm-. - av-'L . ,S Q5 ,gg-11,15 ,.,-g- ,g -.ggqifi 1 -.1,.u..fvm- H T. w. 2. 3 ' ' . .7 - lV.,.3iw.?3, .e ,Mg . ' 2 x BJ ' mfjsbfiggf r ,,g : P :J Q ., ,' i:-Yf'i,f- - . - , M, W ' Wig, F s::g': :efw W W ' 1 . .: .-ww 1 13 :sir ' I 1-T',. 'rw'-vf v. ,,,.,..,.. ,W ,E e 'Ziff ,www E- ,,. J-A. - 'z " , . , - . zrsfqs a' 33154 .gf- Eff. x- QA, 3 - . I , . ' ' '-frrw"-"'- ' 1- fm- ,,,, ' - Fiu puf . , ww nw ,-N .v w ' "'Qkw:.., .'-www' . , ,- , . :yr f . - f- AQ? . ' 'fem -1 .--.1 my... ,,f.'-+ Ji' , .- -. , ,fl giyg i , 7 3 i,,f, f.., + , ' L' Vice Psy- '-fizifgi Q-7 11-- U .I 4- . V' ggi f'.:f.rs4z ,, wEE5?..?vf2w- .QA -M ... . . - . -EV L Ami: ,V M A :"',Zi,': ' 5' Y? N 1" 'gg "-1" "'::"'if' QQ-1-:EI E ziflfim .- R W w 'Q 53:,L73,h- l miwaik, RE, .QW X, -4 . Az. Eze .1-emu:-'zz A - f",. . rx ' K- My Qi .. ' YQ.: 5 , A " DALE VOLTTER 160 CENTRAL PARK SOUTH NEW YORK, NEW YORK IRA M. WALLACE 1814 67TH STREET BROOKLYN, NEW YORK President, Zeta Tau, I.F.C. FRANCINE WATTMAN 1585 ODELL STREET NEW YORK, NEW YORK Vice President, L.O. W .5 Junior Advisor, BULLETIN, Phi Beta Kappa, Eclecticg Sigma Delta Pig El Centro Hispano. ALAN D. WEBER 1700 EAST 15TH STREET BROOKLYN, NEW YORK Alumni Presidentg F auohardiang Biology Club, Psychology Club. SEYMOUR LEONARD WEINGART 2781 GRAND CONCOURSE NEW YORK, NEW YORK President, Freshman Class, Co-Chairman Day Organization Social Committee: President, Sigma Beta Phi. RENATE WEINREICH 680 WEST 204-TR STREET NEW YORK, NEW YORK Sophomore Social Committee. V ,if ryan, I , E , V " f z' - v - - f .'?6r1E'1".IlIL . Ph- -.' i3' M ' " 'W '7' ' v 4 ff f V, 0 .V , ' 4 I-" so var: ', Q , . f ' 'if 1 Pw6' ff . ' - "3 . " 3'!.' 1:' 1 Q , ' . z 4 awzzifl' H .ff.,f3f,yff ,, ' . ..::2M:22-,11,....,.2' . . , ' .--.isa I ' r -' : , 1- ' ' -Qamtgjififfliiiwq - ,fx-1: f '- --fe-We 29 1 , .fs - f. ,gg 4. ,QACWZ aw., . ,E-, , ,4,1.::. ,'f-:rgm -Fx' 1:-W.':"ifA 6242113 if. -' vasfz2a'f-g:1f::ae.z V :::'1z..:1-I:-.Mim-,qi M. 1 --v::..:p:yr: .1vf-r-,-c:x- '-u.w.f4--gprvz. V-y,,Er.g::':5, , f-fy:-fs - - .ut-iw-. -. 31 , if Q' .eggf rf ,SI E-.H Q :5,...:,. 5,,3?.:Er.:kE,EE-,vin.V :.: -.f aw , -ag: -' 34, 1- . 144. '. - f 1,51-' fig f -. 12 MONROE M. WEINSTEIN 132 CRYSTAL AVENUE STATEN ISLAND, NEW YORK ALBUMQ Manager, Freshman Basketballg Secretary, Sigma Alpha Mu. MILDRED WEISHAUS 2825 CLAEL1N AVENUE NEW YORK, NEW YORK El Centro Hispano. MADELINE WEISSBROT 109 JOHNSON AVENUE NEWARK, NEW JERSEY Copy Editor, ALBUMQ Copy Board, BUL- LETINQ Phi Beta Kappag Vice President, Honorary Economics Societyg Sigma Delta Omicrong President, Economics Club. MARGARET WELCH 68 WOODWORTH AVENUE YONKERS, NEW YORK ' American Chemical Societyg Der Deut scher V ereing Christian Association. N.A.A.C.P. LAWRENCE WENDROFF 1829 EAST 14TH STREET BROOKLYN, NEW YORK GILBERT H. WETTER 264 GRAHAM AVENUE PATERSON, NEW JERSEY 1 ,Eg ,. 'Mw- ' Q -e. '55 'R n -, .,1f'4fLQE,:a2f- ' 3 LQ 3 ' rf .gb fx 5 1 '57 f 4, 1. fra. i, f d:f' 1 f Jw f T 2,2141 HP. -'z K' wi: S rf:-s-4' mm if f L14-, M -f., F- 4.9, 5 H: '- ' ffQr'af'5' , .. 3 . f 'J wh.,-H w w . ' D, .. Mfg? 17,42 51 4. . ' "' ?u'Of2,bf"Q ', 5255 f .Q.. fi5s' ' ww- . , 1 V w.,:55v- f'. -"mv-g E --'M'-rv Q23-f2f,.34Qfw. .' if , R 'if ,, Q A, E Q . jf "PW S ' ' ,w-sf' 7f1?51. 1551 ' ' M, T., 3 v tw-:iw Tu mi - .M ag., yn . fc M- - . ' L :Ffa jni. "faq, wh 'N . r ' ' ' ww 1 , 4 '--- " 6 'V M1234 ,F gi! ,135 W' , 'If' ' 2 ' tid- A- wv f lf' W' E- gsm . . H --sf .- ' ff . ' mm" 2 -TH., wt I. fa int ,vu l,.,f..w . 5 'A ,fm fish- ,- gi-yi m M .51-' . - 4" f" ' ..-ie 2 ' ZTWWTW -ff 1-we . ,gp - -s,,1..- U9 - -wtf - " J ' IN.-ls' -'neggnt I i. ."-.1 4 5 S -' A 'V ,T ey .. x:,q.,, .. -,g,:.':1.f .-44-,m,':, , fs V -1 I ' . 4 gf - I T gf. 'A fm" . ., ,. ,. . f -. ,434 ,g2'Qfv-egzglarpfnm. 5 ,ff . 1 3 my E. , ? tuners 1 1. ' -. P' -35,71 . -gif" ? I-E51 -' as Q few Www 1- .wg ' mmf: fa-rr ni.. W, J- :Sgr f"1.'1a 11.-N-f,,'mQ.f.D1'aK W IEW? ' - , ., 'E L. Q ,E Q t:'Fi:2f5.i .:fsw'2L',g-ai-1 ' we '-w.,7:fHX2:m?zLW .-.M ,,., t5I1.Ff3f31W'a'iV"vifff.. Will-'13?lf1i5F32iQ1f5f 1 'f' ' 3 - 5 we .-..- H ,- My rw . -w,f.rfr '- 'f2a,1:Q...., ' 'f -' ww' , gf. , . f - A-V 4:31 'Q' fggjlfiii W Sgeeifg -- -VY!"-" YS! 'A' . . ' " NWNi5U?i.'li'N2fc-.-- - ! ' MW 541- - .5 'T' 'T -4 , 1 11.62 W www! Jwnw ,.,,.g,,g51T,,., . .QV .,,,..,1.,f,Qbe .s- rg. ,, ,Nj have ,, ,,,...,,t..x,,r,Zg. '- ., - .. ., mfs, .ff f .af..r:1fr. 11- wi-rm .,- -. A -- ' ' . A, D , A. 43.154504 :QW 1 R i...,.,4.,1zKA.,,, . Uubgg. 4,3 ?4,,,,,,, 35. ,. ,ky 1 . f e - .. :. .- 'We ' - fra .3 .--Us' f b vm - 1, , , , glylrl . 'w ifcfbliiwir ml ' ,f:2."."""""" -.-:-1xg.-.g,,.f- - ' f -f' -i bm! 4' -'-'.B-.f-,N4,1f- --'hwy-f-1-..gL3:.L?qf,.1, 6.4.-.ffy,e.,5-new-T-,fe-fng,:f3.,.,.-, "9 . ' X " - f' kvewgI1.y1f5g:1fy 3"-:-i91g62k:x9g5L1'?x-,- ,Jess5059493213:-nKI.f.g-:..294'f+-1.-:,.. -I ,., I HB, ,fs kwlh .,g,,.:.5f my K -.E - sv Q' Y H .fi 5 2 EDITH R WHITMAN I 'M ' Q? 645 LEXINGTON AVENUE NEW YORK, NEW YORK S f Cultural Director, El Centro Government Clubg President, Alpha. Hispanog Phi Tau MITCHELL B. WIENER 825 EAST 179Tu STREET NEW YORK, NEW YORK SHELDON WINKLER 504 GRAND STREET NEW YORK, NEW YORK NSA Delegateg Executive Editor, ALBUMQ Editor-in-Chief, WAVERLYQ Associate Board, BULLETINQ APPRENTICEQ Senior Prom Committeeg Secretary, Sigmag Sec- retary, F auchardiang President, Club. Freedom RICHARD VERNON WORRELL 1350 PACIFIC STREET BROOKLYN, NEW YORK Biology Clubg El Centro H ispanog Chris- tian Assoeiationg N.A.A.C.P.g Chorusg Orchestra.. 6 T - j il I 41 4 :.,:.:1:.-- e3y:vf'-w- - y'f-gh, EQ, 51525255 .:11?5::tie'afz?v'5:Q'Qa A WSI' iffw-1-:f'4::'mw'xi+z ' 'K-21f'w:frm ':-F.-4.1'Mf.1rf-fwvzv 5a:z1p'2g4:M21gZf4 T Qqizzmzx .11-,-,fem egg, W,-L-1 .. :qu-' 121:---:Mb R5Raw,ff,f Lf, gg,-'vs 55.1 , Egg.. -Q . 535 .- ...wg-.-. Mx-E..A-:m.., ff Tl. X f , if LARRY YAEGER 5023 14TH AVENUE BROOKLYN, NEW YORK Student Councilg Senior Delegate-an Largeg Alumni Historiang Student Ac- tivities Coordinating Committeeg Sigmag Secretary, Alpha Phi Omegag Outdoor Clubg Biology Clubg Swimming Team. SEYMOUR YELLIN 23 HARDING TERRACE NEWARK, NEW JERSEY Sociology-Anthropology Clubg Philosophy Clubg Psychology Club. SYLVIA I. ZECKENDORF 485 GRANATAN AVENUE FLEETWOOD, MOUNT VERNON, NEW YORK ALBUMQ Lambda Gamma Phig Chorus. LEO ZIETCHICK 900 HOPKINSON AVENUE BROOKLYN, NEW YORK Alpha Beta Sigma. ELAINE ZIMMERS 3235 GRAND CONCOURSE BRONX, NEW YORK DAVID I. ZUCKERMAN 125 EAST 168Tu STREET BRONX, NEW YORK Biology Clubg Der Deutscher l 'ereil1. W- X. ., . ff 4-f"' 114- .LW - Kiiamesfizzng 'ow ' ' .A V-z' Q2 '- YGIEQ-,. --"W 377 54 Eggs' 2.-M' -IM: F on 1: :J 414 ' "".- :- .?5:237'5s -35-12" - Mt. 3. " 1 F- ?7L11 ,zgwaffgg . 5:.:s1v"f"5f.' -ELS' .. -f ' of ,A-. S, --2 . , .f - .. Er., - . 234,141-R -..N - Ag ' ' ... 1 1? A 'W' 'L - RA. W ,.., uw' 'R 4 ' 'f'f'M-Ae?f.+f2EMmEfh" ' I J . ', L4 ' - "' '11 'Q u ,, ' -'S,,a-gl.: . 's-,,, - R -.. K .,.-, ?,PL,,f'::w?3?3f?.4:wiywp Afx-4:1-...Q-:ei '-Limfmfgw-vhs-v,v :raw-A 5-ffm. QC" A SOLOMON FOX 1546 ST. JOHNS PLACE BROOKLYN, NEW YORK Student Conunitwo On Educational Pol- icy: Secretary., Beta Lambda Sigma: President, Pi Della Plzig Sigrnag Upper- cluss Advisor: Prosirlvrzt, Lv Circlv Francais: SPL'l'1'fflIi'V, Sociology-Antlzro- pologfv Clubg Socrvlarv, Der Doulsclwr I 'erving Secretary, Ill Centro H ispano, CAMERA SHY FREDERICK FREEDMAN POPLAR GROVE STELTON, NEW JERSEY lYIllll10If'lUllCS Clubg Chorus. JOAN CAROL HEYL 34-05 I49Tu STREET FLUSIIING., NEW YORK BERNARD KASPER 302 ROCKA WAY. PA RK WAY BROOKLYN, N EW YORK Co-Chairman, Dtiv Organization Social Committceg Sophomore Class Nowspaperg I Jer Deutscher I '0fl'iIl,Q' Booster Club., STUART SCHER 2036 EAST 35TH STREET BROOKLYN, NEW YORK ALBUMQ Pi Lanzlula Plzi. HADASSAH INSELBUCH 800 WEST END AVENUE NEW YORK, NEW YORK Phi Bvio Kappug COMMERCE BULLETINQA Cultural Chairman, ,Ivwish Cultural Foundation. GERALD QUENTZEL 443 BERCEN AVENUE JERSEY CITY, NEW JERSEY ANITA C. WEINREB 900 80TH STREET NORTl'I BERGEN, NEW JERSEY Sociology-Anthropology Club: l'-iVffl1"l ogy Clubg Le Cerclv Francais. Mi gfa J alolaa GEORGE LOUIS AJJAN GLORIA ASTOR PHILIP ALVIN BARENFELD IRA BENJAMIN ETHEL BERZON RALPH J. BILLS CHARLES S. BLINDERMAN JEROME HARRIS BLUMEN KURT BOCHNER DIANE LOUISE BOUCHARD' SIDNEY BRODY JACQUELINE JOYCE BURR DONALD JACK CASPER RALPH ROBERT CAVALIERI JOSEPH PHILIP CHILLEMI RICHARD M. CHRENKO INGRAM COHEN DONALD HOWARD CROSBY RICHARD JAY CUTLER MANUEL DE BASTOS HARRY DRUCKMAN PAULYNE LESLIE ELLANEY ARNOLD ENGEL ELLA FINKLER TOBA SCHACHTER FISCHER JUNE BARBARA FOLKART JAY FOX FRED HARRIS FRIEDEN SUSAN RACHEL FUCHS ZELDA ENID GALE PETER GAMMELLA BERNARD GARDNER PAUL GASTON ANITA DORIS GOLDRICH ROBERT PHILIP GRANT HENRY GABRIEL HEALY TERENCE KILBOURNE HOPKINS ELIZABETH WEBB HUGHSTON HADASSAH INSELBUCH SHEILA BARBARA KATZ LESLIE LEE KELMINSON IRVIN KLEINBERG BARBARA M. KNORR WALTER KOPPELMAN ARLENE ESTELLE KURLANDER GEORGE J. LIEBER MARIANNE LOSER HOWARD MAKER ELINORE MARGOLIS PHYLLIS MICHLEWITZ WILLARD L. MIRANKER MICHELINE MIRIAM OSTROVSKY IRWIN REICHMAN SPENCER A. RICH LILI EVA RONAI RALPH CARMEN SCHINDLER JOAN SCHWARTZ NOEL SHERMAN EVELINE LEAH SHUCHATOWITZ DAVID SIMAN DEREK S. SINGER MARK SINGER MARTIN BORIS SMOLLER MARK EMMET STERN MARY ANN SUGG ADRIENNE CLARK THOET EDWARD PHILIP TOBER FRANCINE HARRIET WATTMAN MADELINE WEISSBROT WALTER BERNARD WILDSTEIN WILLIAM GARFIELD ZOELLNER .-i U U W I EAST SHPE , vvf.-ST Sm: E EU ,I Af R Yi- E ng L Q D UU DD U U J L ' I Q U B 5 U If 1:1 E U I U U 6 U D E Q U U I H I U L U H I III I 3 1 U U P U , En' JJMUIEHEHILLEMI D U UUE A TN.. ONAAIVI COIIENRENKO Q U gg S DU J HARRY DlI2IIgCl?iA151ic13IS Linn U U B , PAULYNE LESLIE ELLANEY RAL I D D U D U ARNOLD ENGEL JOAN' U E I I ELLA EINKLER gg? A U D D U P I 2113? 12igfEigiEPfiOIEIscRER DAVIIIE U U A D U EJ I JAY FOX KART DEREK D U U I: U I UU I U U U D C u . T355 U I" E U L I A-. PAUL GASTON EDVK U . Hsu QASIIARQIQIIIIOIQIRH iii U u U xg I A WILLIAM GA! is U K6 ' NOV ' LLLRRR ,IA ,fff J fa' I IEQW U U U fp U 1 U WWWG ' EA I BA D 5. 'B 1 xy f - -D ' 1 Q "1 9 M- L-Rh AM AP fY"4n F1 fYYN V - V - A- - f fY'vvy5n -- A U- ,, . - I pyfmfsnp. flfi ' f 7 ' - K ' A fvC-.-Q'vQ7P'l Ad.16'f'-rg A'J-511,15-xgfp-N fvqfggw-.arf-F. f 1, f1f7Af1 A f1fYW ALL AROUND THE Tow M y ' Aji, W R U 0 I lnu ffm g, 5 SPURTS PROLOGUE Two events occurred during the past year which temporarily eclipsed all sports results. In December, ,lake w'iClI1llClIIlCF, beloved Athletic Business Manager, died suddenly of a heart attack. Several months later, in the early part of the new year, Professor Frances V. Froatz, longtime director of WVOUlCI'l,S athletics, passed away, also of a heart attack. The contributions of these two to NYU athletics were many. They will not be easy to replace. Although the overall sports picture at NYU in 1951-'52 was far from bright, there were definite signs that some relief for the long-suffering Violet sports fans is soon forthcoming. The football squad, which has been losing rather badly of late, has been fortified by the addition of several large and speedy players which bodes well for that sport. Basketball, after starting off in fabulous style by winning twelve straight, finally finished up with a good 17-7 record. Although three key men-Captain Mel Seeman, Dick Bunt, and Jim Brasco- were lost via graduation, the return of several promising juniors and sophs from last yearfs varsity may offset the loss. Handicapped by a predominately green team, Coach Bill McCarthy was unable to do much with his baseball squad,,finishing out of the running for the Met championships. How- ever, with a yearfs experience under their belts, they can be expected to help restore the Palisaders to the baseball heights they dominated only two short years ago. The track team was almost a complete-loss. With the incoming talent dwindling to almost nothing, it will be several years before NYU can place anything even remotely resembling a winner on the cinders. By far the outstanding team at NYU in the past year was fencing. Compiling their best record in years, the foilsmen swept their nine' dual matches and went on to win the IQCFA post season tourney. Their winning ways were stopped in the NCAA tourney when they were edged out by one point. The remainder of the minor sports-swimming, wrestling, and wornen's sports compiled good records with the mermen's 7-2-1 record featuring. The 1951-52 Violet Basketball Team COACH HOWARD CANN CAPTAIN MEL SEEMAN BASKETBALL What could have turned out to be one of the greatest seasons in recent Violet basketball history became just another hoop campaign as Howard Cann's highly touted five started off sensationally and then fell apart in the latter half of the campaign. Although the season ended with but a 17-7 record, the Hrst twelve games will be long remembered by NYU cage fans. Breaking fast at the start of the season and playing masterly ball, the Violets, cap- tained by Mel Seeman, ran up twelve straight victories, including wins over Colgate, Temple, and Holy Cross. The piece deresislance came in the twelfth game. Pitted against the Borderline Conference champion, University of Arizona, New York set a new team and Madison Square Garden scoring record. The 103-76 drubbing handed to the Wildcats represents the greatest heights attained by a Violet hoop aggregation since NYU was in the finals of the 19417-'48 National Invitational Tournament. ffl 'N A , Q , X -J' - '- -r We llli f 5 '!5 l fb 4 L I QQ X ,, ff Q g - FL- Then came the annual exam period layoff. Dick Bunt, who had been the team sparkplug, twisted his knee in practice soon after the start of the spring semester. Minus Bunt, the Violets came up against the West Virginia Mountaineers led by All-American Mark Work- man. The 100-75 trouncing NYU took that night at the Garden was the Worst defeat the Violets have suffered in twenty years. From that point on, the New Yorkers, who had even been Con- sidered up among the top ten in the country for a short while. became just another ball club. Bunt remained on the sidelines for six weeks and although Jim Brasco took over the sparkplugging job as best he could, the fire seemed to have died. Duke came into the Garden boasting little more than the prowess of its All-American, Dick Groat. Even though Groat was held score- less during the greater part of the first half, the Blue Devils came out on the long end of a 74-72 count. Fans at the game were given a mild heart attack as, with only one second to go, Mel Seeman missed a long one hander which could have tied the game up. "On two-hikew "Look out lavlowf' JIMMY Bimsco ' A W 7 4 JQMW Dick BUNT Poosh 'em up, Tony." Wh lx 'I I A "Hey Jimmy, over there." Five days later, the famed St. Louis Billikens were the opposition. The pace was fast and furious, but the Violets just couldn't come through when the chips were down, and lost the game, 75-66. Two quick wins were scored over Syracuse and Niagara. Then, as the sea- son drew toward its close, the annual intra-city championship matches came along. The llrst all-city contest saw the Violets go down to de- feat at the hands of Manhattan's ,Iaspers alter a cleverly played game that went into overtime. Q The next week was the most important one of the season. Those two arch rivals, Notre Dame and St. Johns, faced the Cannmen on the MSG hardwood. The week ended with both games lost. The Notre Dame score was 75-74, while the Redmen topped NYU 78-75, in a game that saw many fans go home with hoarse throats. The sea- "Eh, eh-you're running." A I "C'mon, c'mon, open your eyes." son finally ended with a victory over the de-emphasized City College Beavers and a loss to Fordham, when the Ram's Mike Keane scored the winning basket with seconds remaining in the game. The payoff came after the season had ended. A last minute invita- tion to the NIT was accepted. Hopes rose for another "miracle team" as the Violets were pitted against the University of Dayton in the Opening round. Playing inspired ball, the Violets kept even with the Flyers for almost the entire game. But the visitors, led by All-Ameri- can Don Meineke, pulled away in the closing minutes to eliminate the New Yorkers, 81-66. Meineke netted 30 points. Although the '51-752 hoopmen didn't live up to all of their advance press notices, a new individual scoring record was set by Jim Brasco. Both Bunt and Brasco were later drafted by pro teams in the N ational Basketball Association. GRID COACH HUGH J. DEVORE FOOTBALL as " -1. X.:-T.: 3 i 4, 5 U fy!-W r -ta 4 ' T' I ' an r ,Q Q The 1951 football season was just another in a long series of dismal failures. Managing to post only one win in eight tries, the '51 squad finished the year with the worst record made by a Violet grid team in the last thirty-eight years. After putting up a good struggle in the opener against a powerful Princeton club, the Violets continued from week to Week, showing little. Their sole victory over Kings Point was disappointing. Except for a brief moment of joyous delirium at Lehigh-NYU lost in the last minute of play-the remainder of the season was a flop to all concerned. New York University 1951 Varsity Football Team .Speedy Temple back eludes N Y U tackler jar another Owl touchdown. Week after week, the players were treated to a clobbering by their opponents. They had their noses pushed in the dirt by Princeton, Holy Cross, Boston U., Temple, Rutgers, and lastly, Fordham. What hurt more than the wholesale shoving around was the fact that they couldn't do anything about it. However, as far as football-1952 is concerned, there is reason for fslight optimism. To a degree things are definitely looking up. Only eight seniors are graduating from last year's squad. Although they linclude some of the mainstays of the '51 team-Captain Art Kalaka, lflhrarley Apkarian, John Baldasaor, Ed Ballerini, Matt Bomanno, and iTf0i1yMalanka who did the lionis share of the work on the line, and lgillilianieri and Howie Dryer, who supplied some much needed assist- iliilie in the bacldgleld-enough undergrads are returning to partially liflset this loss. , The freshmen and sophomores on the squad will have another year if eirperience under their belts. The regular offensive backfield will letllfil in toto with a complete knowledge of the capabilities and lalflfslof their running mates. In Frank Sauchelli, the Violets have a ,puarterbaek who can be depended upon to call a steady game and NY U line blocks Fordham first down attempt. A Qin ,I Wax' "Oops, excuse thefeet, please." leach his pass receivers a good percentage of the time. Boots Burney, A M . Q, r Q V 1 ' 'Wig .391 ' . - , 17' I A . N- 12.7.3 V, -.gg i i , -. L i K :V Pol . will Matthews, and Tony Fernicola supply some much needed speed. : ta g il From there on 111, ms one big question mark. The future of the M V F , .IL , - pf , A . V'-ff -351 kmr ffik 3- 1 ' -- 1 af ti - . ' 1 '. , +J0tba11 squad rests upon the line which, last year, was completely f ,,f,1 .. :ft yi ' ' Q . if ' la , -'?Ea451Vw..:,1 " fg,' e - 1 5 , - . . . , I ' if '- E - -safest.. ,Q-My ,, ,gi f ' ':4i,g.'5,5:,,', ,gag f pleffectual. If the line lmproves to any extent, 1952 might well be the V L1 - . . . 'fit . if lbar NYU will pick itself up off the floor. K 1 f - gf a'4- 1 ' 132-'.,,lT 4:- -5 , ff " " .g,.pH3.j". f .i . - .- e e 1. . l "Here I come, f ellasf, 5 , Q A ,gag , k-5.11-' 4' -3 A 'fv . - - . My ' ' ' - N ' -- 'Hgh' - px . KQ V ' VA -A . ,, In :, , ,iz N X ,L ' 451 .S-'Q , , ,Wy , :K . .1 -N -5- M bf . ..:, xA -, , ku V. - ,A 4 ,mx wg ,Q A ., X, . f 1- 'IW' if 4-'-4 fn,-gi X35 in 1, , fi. , ": ag ' - X ' ' . 1 'ffj 'P-351: , 'Z ' .- - ' ' -. 'G YL. - " I V- . , . t . : X , I 2 f . , Il. :zum Q - 'efi-" vL:gf"b ' 15' 1-5. 1, , ' V -. 'mfs-3 . 2. 14,335-.yg , '..-gm... ?.1,:,,g21g -ff' 51,-',-xl' 7' -, - N A',2Q.:f,1:J'5i:tj . ,3:.'4,1eff2-,5-'fZT:1'. Q-iffy.. A -., ' Q ff H:-few -fn . ' xi"'-:'V556fSr- 6' 2 ,. W. ,, 0 ,wa ,. A., W, .A M .I , rx asvx , , rw, by' , ,. 1M45,z5f5..gy:'Q,-,gd-Qmfz,: -swf. P 1-f-141:-w-"fagf,2L,gs-5s.f:p-.'.erz3r?-QEg43z4Q,,'. "':e:3QzM2f+f mis? N - 1, 1. ' X' ' - A 1-'- : ' ' ' 'f ' k . ,,:: .,A, ,ZAAZ ,:,.A ,V.l. I K ,bm A, 35 .,.,6 X, ' ,V iv., .ww Nw. ,,,:z my , -Y . 1459, wbxkiiiizx Q x fi ,E 4' rg 2113 7 'Z A XX x , SS QWX Xa A L x W w J 5 41' .: my-fu . .. N f X396 2:5125 31:13--' f t :BK --Q-: tx 5 ,ij L 1 ll ,, , - xx., , ' S 5,5 , aye-iv Y, A 1 'V ' " Q- 271 H 5255 11 K T" ,Qifil-11 " -Cg fx' afll f '- '22 4 -- ' W ,,: : . " Qs 1 kv wwf- 1 , V F . we V sexi , Q , f ' - -- as Wi f . X A ,- X ...,.. , Qx,,2,A,, , 1 f,1 , , v M WQ' ' 4 . N, E ff ff K I we QQQEWM: ' - f , '-1 1 ..,, Q ME l QPQ' V 'xy A large NYU delegation at Temple watches the Violets lose their third 1 XR',f CAPTAIN ART KALAKA Tackle BOB BLAZWICK Left End e - 4 ,QF 'iff ff " If . .N , I ,-Qgggx EM 4 , ., 'L 'J r Je' 7? J . 'Q r X J 1 5, . 1 ,Q TONY FERNICOLA F ullback straight. . y , ' K . .S K. X , Af i K , ,..5k.'i.5X, i. .-,fn -'Z Varsity Cross Country Team ,sf-.,,, , "fx 411- xshi:-. if ,gf Yr- Yi - JH . 'fig 5 ',,..1,N X . 2 g t W J' I Q. , . , ,. ..4,,,f4,4 1 J J 'ff . m r .. :z P2f'Q2f'f122f2Q swf 4:-23 1:9 tix: 1 -, ,V - -' vu 3'-' "7ff""-'lffiii' 'f-,HI C ,ik-!,'ii"' COACH EMIL VON ELLING DICK Maiocco TRACK With the graduation of Dick Maiocco, the last of the track greats, it is feared that NYU will experience lean pickings for the next few years. Gone are Reggie Pearman, Stan Lampert, ,Iim Gilhooley, and Hugo Maiocco who once helped the Violets win countless team titles and establish meet records all over the country. Now that Dick has taken off his spikes for the last time at NY U, Coach Emil Von Elling may have to depend on his memories of days gone by to keep him going. In the past few years, only the brilliant running of Maiocco in the 440 and 660 dashes and the mile relay quartet has kept Von smiling. Occasionally, a boy like 6 ft. Marty Engel will appear on the scene to show the track mentor that hope for the Palisaders as a track and field entry is still possible. The indoor campaign was a complete failure as far as the Violet hoardsmen were concerned. In the Philadelphia Inquirer meet, NYU managed to finish second in the mile relay to a strong Morgan State foursome anchored by the speedy George Rhoden. In the Held events of the Jr. AAU Metropohtan Championships, Charley Stephenson surprised the track experts by capturing first place for N YU in the pole vault competition setting a meet record with a Vault of 12 ft- mf""" f- Www -QM -sf , , li W 'ww 9. .,:.. ,G., , ., .. .,,,.. f - .1 4 . , ,.,. . . ,. ' 1. c. . . M' V9 .V .- 'V-EZ -fy ,SNV 4. . -744 4,,1V.Vg0,- si-1.-30.17 ,-is ,-,, ,,- 1 Magi! Inq.-wghl' . - ., . - JM 1,41 N '- ,,..rV- - ' so - ' .-rV"1f'I :-,V'f f5:g,,?Vf'iz5-33:.9Q1qV .'-xsf.-Ifyiisrwivdff1fL,Vscx,9..yV13,cinf':::v ' - : . V 1 , - . . p w. wwf 1 - 1 ff-' ., .1 A., ..,.V,,,..:,m2 fgiwf- ...Q--V,-V.-4Vpgcmid,.f4,-.5-ails - -Q .V V -V f sw - . wfrwfw--+ . .- 1:0 ef-5-Q, .L-1.-4-1Vr'-' V :Q-ia.-0 - fy' 30 ,- 1 0 23,8 V. Vt ' L.-,.Wfe::Vs.1w . t.-5-, igf an 1 .,..x . 53 viwife-Wg., i P ..,. 'f' -X ste- '-:za . s. .,,Vfwr,s:ga5,,..x V -f. V -fs aa- ?5.,e- Hg.,- , trA.-,x- Q . 4 sw, .K "'.i1xNf'l,9dii i .xt .Vw-Y. :fa xi' fwfr, M4 .0 H ..-.. x, X- V. gs. it .. 1 ymsckgfs A , A .za--'.z an N- ' v X, .-. g ,-:.-11V:3f'xb"-' A-2,1 xixf- Hb.- K .-...,1 'iii'-,-51,-Pals--.we . ' -2 - :Viz 'iff :,- 5 ev" W V 1-us a 1"-'e'i1, --X, 1- pi :-1.4: xv? 1.Q5GgI.. - Vie: -xr K., . 1: rigs- 3 , ' me 8 -R wb. 1, ff, V wx X, w X X X 555 Q V . X i X -.Q ew A fir ,Q fx wwf N I ,fs L QM, x fffff 1 , W aff: f Q ff mtv y lf ,rf ...M .haf jpg -.., fwjzf ,em ef Q www- 5-7' f we v Fw mfr rifle: 5 .. ,,,' U up 1 pig , 1 Wi: fi ' '- 13' l L 4-A my rl -Q . - f -,Q -1 f ' if 0' W -Q A+' 4. 14 L IWQQZ' Vf .- K -- V-VVf:,,V- wma . 3 . ,RW 1 +A- 1 rg "T1'.'LQ. "X t "926w:'41- ,, 3 "c"14Ev:-. A' 'ul' A V .-snr-ur..-.,..,a,--eww-ns.: - F is r l v vwtk '-I . , . . . kr, ., ,, QS f W4 Q E l Ag' Y 'AN -xi X is .:,, ' ft-rw 'Jef-MV-' :fa-'-:ez.VVWVMV-'fi' - V ' 1 "5 .. 9 . - if M- ,f-slam' " ., c.4'1z.4?:m-'-V'22 . '- ff. '- ' 'ls QNJQ mi - - I-V was5zfSa2txfa:s1.:.?s.ts4: Mg-.,f1, aff-,aw-.'.-1-' ,gz5Vs:.z1:.-1,,V..,, 24 ,xr y...,5t1g .4 -5 V ' ' 4 Q- ,,.!::9:,.,,cgi'fw+,frV:,..:-f' ..j i51fH7iZ63f9A1'?f' M w 35 +P 5 f,-w4f.- ' W. 1,:2f2f:Z-V-rs:-na' - .V"m"4 'N' . 1 .Wm-':1--'WSW-1 V' ,R , . PJ M- ...QA Q. - A . , .Q,g.-.::, .f- . 4 age, :wifi 12, e-u,,rz.g-1 W, is -114,5 - .- ,, , VL- ' sgv:fQ',:'.:fr1'f :im ' ' 1 - sr- ,I an-:V-V 1.5 ,, A ,f Vf,-fjf-Vg2z.:fi:g 5 ' s f -wamia... . .. . 1 , :s-2':VfV:'.5'VfIq?6r'f He. R . yv , swf -K . at 1..,,.r.., . A , . , .. sf .- -. V 1 Q ff -xkflff-Vf ,. ,M- R ., ' r, 55,g's'f .-f ' 'V ' ' : H 25,:'gVg'f,. wg.,-m,VjL.,-1 Y 1' .Vf'?'fV,::..wfl ' ml . '-fa,,.'1ff - aa . . V V . 5555? Y-.Vfgffvisz rfif 1' :Q 1.1 ' 4 W. N - 2' ' - I V- , P' 527259 .M .- 5 sw' -f, -' A1127 N91-'7' 'f f -' . Q 4 V + 'V 1. , V' 4. - V. 1 - 1 'ff 'CV-A: ,aa f L w- . . " V- - 5. , ?.i2,'Vtf'1 f-ff' xi' Wf' X CQ' N ' f' 'V , ' ' my '- ' AQ, I ' .V '- .4 ,Q ..., .,..,.. , . if 1 V ' W - " my W. ss X ., .:.V:3Vef1f .'g-Wibfxgtff. ...w f- ',',w 1" - f E 1 ,V shes -' . ,,.. ' , -1 'F-r,.,.f??TN2f1 Wig lx ' , , .r 0:4 'IGI , gf' L k L . m xtcj 1 ' .: '- in .VM - , . ..,... V : . J. -f,,,..4-1 4 Nm - 5 K- X '- V 1 V is -2 --sl yr-f 1 , 1 E"""f?rfY4Vfg'-.1 x . . ' xN..N ., ' K- -4 ' - f fi "'4-,,,., ..,141iw fy- ,A .- A K -v .X A -2 ri- ,gg-V',V ,X ' or , V, ,,,5,3-V: 53: X sr X Q all I . . ,M ,A I ,g --1352.1 V- ff - - V V VV 1 - a I ,.V,w,f..Vg2a- isa- .. -1 V nigh' . , . - 1 , 2 I, up K .1 - , f . . . 1rVVV V , ,fm '.,VVaq,.-'24 V- , - . . V - l I V ' -- V - -- ' - ' e'?:f:Xeg.l'z,3,jg..z Q M . ' - A, . ' uv- ".: 4 53.5.-rj fgffftaf' , - N , . . , , ..- .a-.SJW-w,: I X. ' f' -. '.f5i:-Q '-xfr e,:"i .r -A - - V - ,V - gr4.nw-:fn g F ,, fx 5 4 . V , I V f k - ,',m5,p. g.,..3-I,t,4f,t,..5 ,ya QQ: ,'- 3,1 . .Q ' A . '-fw5'-.',- f M in. John McGrath and Dick Lynn tied for second place by jump- ing an even 12 feet to give NYU a sweep in the pole vault division. McGrath and Lynn repeated their feat in the Outdoor Met Inter- collegiate Championships as they took lirst and second place honors Anchorman Maiocco Lakes another hrst place in mile relay. against their New York rivals. Marty Engel topped his opposition in the shot put event in the AAU Championships with a strong toss of 54 feet. It was only when he ran up against men like ,lim Fuchs, na- tional shot put champ, that Marty was noticeably outclassed. Maiocco, the workhorse of Von's sparse track team, added a few more medals to the batch he and his brother have won running under the Violet colors. Maiocco won the Met Intercollegiate 600 and, la ter in the outdoor season, repeated his victory in the Met 440. ln this race, Dick had a couple of the best runners in the country against him in Vern Dixon and Lou Jones of Manhattan's all-conquering track squad. Dick beat both of them to the wire, but it took a photo- timer to separate them. Von Elling anal ace Maiorrcrz .lt's Maiocco by a nose in the 440 at the IC4A Championships. gs -21V-.Qs-Q.. V - .nr-1 ..fn Y' -XV, 1241,-. V X-V. V. ,.,'q..ss .. ..,. -,, - V 4 . V . . .. .. .-...VN . V . Y .-IX -- W A. V . -- - . - V, 5, -gy, 1 -A ., 53 Aga., -:ss..,VgQM if .V- V - ' if 'tlff-1-. , '. . " 3 ' - 1 5 . 52.16. -V ff- E , 'if:'r1"f X ff 3 'L" -- '- V 1.12 rw 'V- ' -. 'V V ye- 1 -V f Q V . ,,f-gg.. If . , , lm-: iv, ,. ., . V Vs. VL x Nm., P VR 5? I J ,. 5. 55, ,WSE Q 3 . ' 'www 2- ,1-V: ,.g.-V. , .V g . - 5 - -f if-1-1 V,l'2f:V -as 'S-.'-r V V V. VM' VV,g.. 1- .. F MV - V -1 -.ri V. -1 D V V ss-N23 - . , . V . V- - 5 ,J . , V f .f . V -- .. if .gs is-'Aka V -- - - 0 an H -I ,V,1z5.V,w . f ' ' . - , 4. .Vg---,st -- - - 1-' '- -: as- :X,ga-:.s-14,,Q-7,3-::r1g-3-'gear':,. wr 1, , - ,-: -N ,jeu-. visa: - . , K . '95 -A 21183-'UW-1" " ' 'PNV - " Fw :V- - lf' - 'I ' .. - .f 1 ' . T. '. W? A 1- Wei' . . .Q .. ii.. A NS., yfm.V,,.., V A... , Q 53 NV V .. .. ...V ,.- ., V , ,VT , ,. V. Q... VV ..f.V-.W -0--, V,,VNa,.,,w 1 -VI ,f 5+ V V- .V -' Iefzrf.. Vg ff.. V .gr ' - V-igge X -as 1,- -V V .V f ' Q -. -. .. 1 1 , . .V I ,Z VV-fV.V.V .. ' J - -. -J: 'YV -11 - 42- -1, .i , VV S: 1:5-, wife:-ff-fs V, ' - fee -V 'ii " ", ff :-V - 17? :V .: wma Mgt ' fr' .-5 - :- ga. V ' 1VV -:rr -. 'ir 4 M. aw "-xzay. . ' -A .. " .KM ' V- V ' ' ,. 1' " -., , A :, V -- - - . V. 1, 5.-Q.. 1 .....'- f . 1 --V, - ,, ' -V ey , V ' r V 1 ' - ' . -MN ,, If-'s, if 1, 6 I V - 5- N V. f V . ax V ' ' .V ly 5 j , jVjgf:..,,.. 1 . YV N1 QV. -- W gif' - avg . - 2 V V- -L gi -X Hqfifii . .1 . . 1- -Gy' - --vV.V.z-Q am- V VM ,,V .. :Vg V It Q, , 9 ,A , I . V :Y QQ? I --a t jx t:gz,!":- Qxgg s xwjt V- , N36 my ' , f ' U' - -sg ' ' . 1 - ' ' fir i gg, -S .V , Q -, . - jI'ff'-:'g - Vigg-V-2-5353 V , , .. .5 ' ' - -- V., , . 1 2:.:V."V .V .. V' V- Tf -in V'-' ' lf - 'Q ' B7 "4 ' . - Vz2gfgV-iffz' ir- - W - .V:'-saf '.V.mV.m ima- .is s-V V K 1 " 'A 5 ' .. . 'X ' . ' I 1' ' -"' i .V . ' " g V' ' -it f ' ' X 2 ., V ga V . I E V -.5 .. - . V- Q'-3, 1 - v- ' -V K - . V' .- -. 16.11704 ' 59g A "Y . 1 1 'V in -- Vxi--fi ow- - . " 1 VV W ff -fi-i'Q,Wi?l0 f - V Vf . - -.-ZFX ,V gi - 3. A ' ' ' .VI f 1 V 2 ,Vg-. ..s V12. K-V . -- f L. - wp Vi VA . F ,QV V, .Z vi,- 5 ., V mvi A -3 N , E . Mug-5,613 VV X A a. yy x -S 3, I 2.1 I 4 . as 'f- 2 1 ' - 25221 2' V- f i ' V -.3 V. . rf-V. V -V V5.8 gy- .Aj 4, .NVS-4' - X V , p X - P:..:.,,'-5.5. 12145 fi. wV-- .V..-ffsa. -1 V . 1 We :sq-Q-q5'f.'zif:..2a: - A ' 1,3 PV. .... .V.V,:1,.- ' ...,, 'f ,, Ve,-if ,. .V .V -gg . Va QQV., -5... C. f, V- " ' N, . 1 - " "" " - 'V -- ' 's 'V 11.V ' ' ig., . JV V It tr I t V V -, ., ,, V 17557 V,W'f::1t-V523ftiritti V:fs.5.4'1',J:.eg1i'- AA-:fl VV.'fa.kb'i1geLi:gQ?im-iVVz.w fr'-V4-QIYSEQ:V512-fm??::-115'-2... :wi'V'f2ffafV5l-HJ-IV?-'111::VY5-"::i':'--'22 7'5f'-fx-'EW'14-W51:51,.-"d2V35S2.'P-5i?1i'2f1V:f'V-VV.C2:""1V-1Cf3':Zf'. - 5533gvgiVfa,Vf3f...fg,-,V.:eQ,x4:g1f-...XXV ...e V-.w,,W..--4,-,.VVg,y-my-g ye 5 ...V.1'Vn.gi-.sg .sigh-a...rwsag1afizfifwgww V.V:QV-,gas .1.fer-QV.bq.s2,.vVs-wg..-svV-V-,cya SVVW-f-a..Vq.g1w.V. ,Q e,V....VVwm...:- Q. MV.Ve.-Q.,A.?,,V..4.+VV.--QV--NaywfM-VV.w.sV..V .V paw - V-27,-.. 244251.-3-1:1-'fa.m:': ,,V'.'.w V2-4f'pr2.-if L22-ZVQZV-up ,x22?f-'f'fffV:"f:K,v -,i-sg':f1.,,: 1:13d'2,2Z, 9 Q, f.g5Vf-we-isff"-:QMyyw-egyse--fa..mx,.".-"g',w3-zVsf-g--.-L-. .-.afffav:a.::c:-.1f..,f,3?egg-aes'-as 1 - VV .f eu - .V1e:ff-f--wm5-f1::-f-V--.12 -X Pre-VX-Q-5,5g:,93a1,,Q,ae.f2-:.QV.fwgQ.,-A-:-Vs--1w-av 5,-ws:-aw: saw-VfVfW----Y :fwsfss-Va-K Q-ewes:-1.5.-rem.-1.2-W-Xa-V.-we.-Vf.f-stV1Vs-WV mw--fare-V-s ,,,,25gigX,.,,mfwQ? fi V,,M,V,V,g.-aszwaiae-..--fawfwfay f2:w:V.3-V-:.-- ,-..12sSwV-,fg+?23ifw.aea.i,--w:a:,,sVw- .V.-T-fiefilaf-V+-:am4496VV:--1-fm.fVv:..f-,.:,.1.VV.wifi--axV.feV.V.,5:V44-Qs,5,.aa:,w1a...zw-saga.-wg-9- ff-:ga-a.V ' - -' 1 New York University 1952 Varsity Baseball Team Up to 1951, NYU's baseball team won thirteen out of twenty-two Metropolitan Collegiate Baseball Championships. But in the last two years, Coach Bill McCarthy's boys have been losing as many games ASEBALL as they have managed to win. With the end of the 1950 season, the entire infield graduated. Their replacements needed time to click. Tony Lembo on first, Tom De Luca at second, John Mihalcze at COACH BILL MCCARTHY JOHN KUHARETZ V i .V.. . V ,V 1 -' Vw-- -'-.V' -i-ws. '--:gV,., . "Iss 15- 4- f --'- 2 or A' .-a ...-:w-:5:5 wg,x w, . As'-v -:Sr-g .- " . 1 "' """"" ' f ""' W " 1 V . .V 11'-is-'.2:' -'.21612-,-:wErfrEV.r.r1irEf - - " 3s:2:?'V-. 39frr?:1:I:1V::f H2 V -I V.e:' I -V V, -3- :Egg t V ,Lk Vf ' - 1 xl' -: --- ':-. 11: Vi .XX -2-3.-.-fm.,-V':V-2:.:f:.V---1-yy? , ' V ,,,, .,,- if , 'Vw ,V 1- 1 ..VV s Q 132- ---- 'E l V I ' fffi'-"5'VZ7i251wfV i55 -:i l . -V . 'I " . "f':I:2"':"5"f''i.F5:2'.?5 1:5252.fQiii5T'lf5"3-352-f':-,'.i'Z':Z5"2IE-I ....V V. 1 - -V - . g ..... . , . Q V .... , . . V V r f ,-, I 5, 3. -5 I . '-f'.f,'1c33f'1i'??i-jV:L4.'mf' EV:Vz7?4325'i-I-P71-"iii1-ST. 512 - -31? ,Q , ., '93-5? .CWWQK7 . . .3 1,5 .V- I ,A z A 140 4 I 4 - .:. V.... 1 VVV- V V -"" gflfs: .V 124. if-f'-1 VV . ,a29A22AV45'g,jPeffm3g:35-zr..4f,.2.1':fiE::- V V:V -Zg'26w.-2-.miami-F - ,..V,...,k,V55-,- Jos Toiumo short, and Mike DiAngelis at third gave the Violets both a strong hitting and fielding combination. Charley frace, Chuck Payerle, and Emil Raad comprised the NYU outfield, with Payerle providing the power from his cleanup slot. His graduation this year left a big gap for Coach McCarthy to fill. Johnny Kuharetz has been the consistent performer on the pitching staff, finishing with a winning percentage the last two seasons and pitching in all the "big', games for the Violet nine in '52. Vinnie Lupica and southpaw Bill Oster have shown a lot of pitching promise and with a little more experience both should become polished hurlers for the Palisaders. The catching was capahly taken care of by Joe Totaro and Frank Carillo, both of whom will return for the '53 season. CHARLEY IRACE l . ' 5 Sei.. -, if :f y 154 1 .2f'5'f'.,:?:1-"' 'I iii' ,xi-Vmf9'f"' 3 ' x F .g , , ' .' Vi ...-LMHQ. 15' f C. ,, jg r.,i .,,,,, i . HZ , , ? 4 1 4 dy ,Wy ,465 if f, , 1, 4, ,, , ,ja awk I I y 15? 4 , 711 1, ' ,Q f , . . If . I Q , M ' 'if1.4,3-If N . .1-W, .234 . . , 5 3 , , , , ss ., fa 4 Springtime at Ohio F ield 'A F MIKE DIANGELIS " f",f.:,f ' ,. 1. Q-1 , ,. I V' ---:-'-s:-1:-1-vzrmf-','s 4.41,-' f- -rf . COACH SAL VARIELLO The Swimming Team SWUMMING TENNIS The Tennis Team Coach Sal Variello's mermen added to the trend of successful minor sports by taking the Metropolitan Intercollegiate Swimming Cham- pionship after piling up a record of 7-2-1 in the regular season dual competition. Six meet records were broken at this year's Met Cham- pionship with NYU providing four of the new marks. Jerry Markoff was elected team captain and was an outstanding point getter along with Frank Lewis and Frosh Don Mateijka. One of the consistently top teams at NYU, the Tennis Squad fin- ished its 195l-'52 season with a good 7-3 record. After defeating Temple, St. Johnls, Rutgers, CCNY, Seton Hall, Wagner, and Brooklyn, the racketeers lost to West Point and Columbia and were edged out by one point at Fordham. Coached by Carlos Henriquez, now completing his third year as head mentor of the netmen, the squad has, during his tenure, racked up an impressive 20-5-1 won- lost total. CoAcH CARLOS HENRIQUEZ :gg-:.,5y:j5a,1 r any 5-,f ' I ..1:v:'..-:L ..: - M ., -gs..-:..:.-:mi-:f-,4,ga:g.p,:g9,rx-'gm' gglvp-3:-s ,rel - " ' ' ' "Sf 'ffl Q A Y fa V 4 'S Q' is 4 Af '71 A 4- 9.2-fif-215"ci1 A X if , . ,, ' ,V-:"i.'-Eff' , Us W X V . :KV-L-.2 '- 'f: " -1 , ,W-.V 1 ff. I -' '-Clif. ' . "i:f'Z2:5?'?f?5fZ 1 . '5 I , - , V ' 4 . " -, ,.:-.-afwg-1-:xp 1:1117 .f HA- 'g-411.256g,af4yei.::'.f-1 -1:-We s ' f M ,awk 2 f is .-.:. r,., ' ',-,a ' , ' ".' aff f,-.? f.1 7 Q ,M A.,, ,. .., . - R A KX lk NA :M X s 'Q ffqw X ff f a N vt, X f fc' if Q 'ha W M, 'f-' e VM tx .RQ 4 X S I W 'X is 'lb' Jkt J til as i f 1+ X x X . A ww K W , X sox lx sg? 's tw Neff? ,Q Kgs 1 :yo u - 9 A y a, MZ vs, xxx A A 3,532 X -K at . Q: WW . 1' 1 " A ga X My x ,, ., ax wax Q V , ,K N kv 1 -2 A, , L. COACH Huco CASTELLO FENCING Under the fine tutelage of Coach Hugo Castello, NYU's l.95l-'52 fencing team compiled their best record in years. The sworclsmcn finished the regular season undefeated in nine dual matches and then continued to capture the Eastern Intercollegiate Three Weapon Championship. The squad, however, lost its last meet, taking second place in the tough NCAA competition. Cusumano, Thomas, Burgess, Wallner, and Schoeck were the top scorers. WOMENS SPORTS Major changes in womenis sports occurred during the past year which pushed the team results temporarily into the background. The athletic department suffered a great loss when Professor Frances V. Froatz, director of women's athletics, died suddenly in January. Miss Amanda Caldwell, veteran bowling, fencing, and basketball instruc- tor,.replaced Prof. Froatz. Florence Chadwick, first woman to swim the English Channel both ways, was named head coach of the womenis swimming team. W OTH-C1298 Fencing Team 1 BING MILLER Graduate Manager of Athletics UNDERGRADUATE ATHLETIC BOARD JAMES GILLOON Director of Athletics 144 BOB Honowifrz UAB Chairman The Undergraduate Athletic Board, led by the WSC delegation 4 Robert Horowitz, chairman, and Gerald Yusen, secretary, has rapidl become one of the outstanding student organizations on campui Composed of ten members, two from each college in the Universitj this small group meets weekly to discuss NYU's athletic problem Working in close association with the athletic administration, th UAB has written a fine record, the most important of which are th first homecoming game in Violet football history to be played 2 Triborough Stadium and permission to allow co-eds to join th regular cheering squad. H 43 M EA ST 5uDE-'LJ WEST Sm Q , ,, ww , M UB U U Q an U I l UU U H U U u n Q A ag Lfllil AAA4' 'Q,,jl13'f'fA, E ff V 5 E Q 'lf gm Q E G G E E E Em U D U UM fi U BUD Un V UU E U nu DU W , 5 Q , W 1 ' mas nu Unbw UD V n U ' 1 ' an LFNX. mfr. ..,.!,5QiE f' .- X L Um w"14'1fx1-q..,... f. ,LL AP O U ND A ' K , A f I 5 3 an n In M 4 A ' E un D U 1 D gl 0 Q 74e emi toad a few dame, tie Zeqammg lace afmoet fun gecne. fffacidteeemeeiaedlfmangldgdtgeazeeepafzazeelaeoffweetdwtle- gehaazgtatdeendblemgeaaedefm. Vawafetqetwmmeeamadm afafew dimmed mawzfee. Weemdwmdeoftdwe mmuzfeewdaz' am meldacklacd ,ameanczfdtiee eammcmded mmf eondonecd 7760415 of aewafzeeafonffaamonegeaztadenezzifeefeugtdaltdeeadwaefaa aff We dadffeaf writ! ecnpfuiee only when am eme caeze ,erfmeecf Zack mmf we fzealgeaf 5445 amz eoifege 65494 came coming Za 4 efoee, 'Me ,fewer edge of me dee: meeezee me :Ae announcement of Me pzam.7VeaaauZoi5e9aeh9Zanaaf5meaZZe9ecZ4neeaeamcZezgaacle czftw Me pfcam--65 waeaefdeafaeafftiad Zentfatieczffadzanandezloaeafeemfneeewieeimangafaebzdenf weka6,Wemm5em9 pa tie Zcwlteme, 6wwewaa!cZ5ee1gbeeZedto5e4aaeZe16emenmw!caamea,natloq4 ffffwtie 77wm,z!5eeacZeczmew6Z4e4afzZez5fzeat4,?6na6exam eezedwe:4aem44afeaezeeuzez4e,feezzdezgw4ieezemD4e caaa!el,dfaeeeaZ6ZeeZfebaczmat5mafmaon4.70ecouZdnoZ4ta,e 7e2ne,eacaeeaaZoiao1f4Z0p 74e Da,g,70ezea6'qedz'4cu!z'4ewc2z9e 44aeZa5eZzdeeleoonmazZa,Z0z--eaulei5emed6e!a'Zeaeneeen!w6n9e afdwczfd f'i"aqwaq,6fqoa'aeeowwZeZed7257,eamte6nt4emamee'z dazuwdweeewwgeedmw--z4eepwzme'zwmwqeemmw 44006, fave 77. 7752, dloameaf--cond wang, and 746 744daa,feeagt4e6la4eaf252zeee6uedtdeae4dem6ee4ZaZe,'fwm We wmeeedmmdeezwwedezwczdezueagzdezedeedeeefmll- eci9e2n9c'4egeeL'aze.70eeaeze7zadcmZee, weeweqzdedegcmaeg. . Sheila and her escorts fa 49 Q K xy 9' f AO. 5' f 235,812 fff' is Qs' :Alfa V it 'L ,Jw A3352 MMR 'N K X Wwe, x fn -'H ,fl ., 3 S!- ,1 -.E Q, 4? r as ,V , i zf I V ..,g5,,.,, Mfg. . , 1 ,iii Y: 144' I v ir z u 51,5 E -' 7' J K ' ak fi? And Jana Jones sang . . . 146 In between dances we ate . . . SENIOR PROM What started it all? The yen for a chance to air those extra special duds in an extra special atmosphere. The big it: the combined sophis- tication and elegance that make up any senior prom. But this Wasn't any prom?-as far as history or posterity is concerned, the Prom of the Class of '52 was different just because it was that, the Prom of the Class of '52. Any recount of so glamorous a night can consist of just so many distinguishing bits.describing what molded this particular affair in its own peculiar cast. The dressing process? N o one but the utterly blase could say, "I got dressed as usual," because this was no "usual" affair. -that fold in her gown just had to be pressed one gore time-care- fully polished fingernails had to be carefully checked-his tie was examined with critical eyes to see Whether it was absolutely straight- plans were made not to arrive too early-that final, long look in the mirror, resulting in complete self-satisfaction- And THEY were there, too. ou 'S 'N ...inn-A-. W Ka if 4 ' Jr?- 'E 'QU ,Qc ww-- i ' Z4- ff'-as fs ,if 'MN' J' 1 1 'Q-'G' g gm Eli :Tren Dpi' ... I4 ,v N1 lf! U x 'f X 0 , X- M M A 7 A, I 4-1-i,"Xl '-E-F X s 57 X . 1 -, . - B ll JL' With the knowledge of our beauty smugly tucked under our belts we bulged with pride on the night of May 3. Later, we bulged with delicacies garnered from seven course lobster thermidor or roast tur- key dinners. To aid digestion in between courses Marv Kurz's and Hal Etkin's bands played smooth fox trots or bumpy Latin rhythms, according to the amount of exertion needed to help down the par- ticular morsels consumed. However, this orderly routine of sitting down to eat and getting up to dance and sitting down to eat and getting up to dance began to atrophy the creative talents of the pro- fessional table hoppers Cthey just couldn't condone this type of be- haviorl. And yet this so called evil, table hopping, had its good points, for it helped to make the affair merely a tuxedoed rendition of the gab fests that took place in the classrooms ust before the interruption 148 Strains of the romantic of the late bell. After Sheila Katz was crowned as queen of the Prom, someone suggested that Mike Gray and Barry Schwartz, the creators of "Up An' Atomf' do a bit from the show to continue the entertainment program that had been cut short by the hasty exit of vocalists Jana Jones and Bob Haymes. Mike and Barry began to sing, and from there on in the party turned into a jamboree. Listening . . . 5 3 1 u n 1 ,, i N l l w I l l F ,X Sxxgffl 4 1 ff, V I EL Ut ' ,,.- -,, Q. -ff? W 5 N ' W. ,. 'l . '1lT'isl..-' , , lA-.. .""'A'T"l " . Lobster or turkey, please? But even on a night such as that was time takes its toll, and the guys and dolls who looked so crisp for the photographers at the begin- ning of the Prom began to look and feel a little worn at the edges. Favors, ashtrays, matchbook covers, candles, and some "souvenir', silverware were deposited in pockets and evening bags. People prom- ised to write, to phone, to meet one another "soon'l-and with each promise the feelings of nostalgia were deepened, the awareness of a bond of kinship increased. May 3-one of the most memorable nights for the Class of '52! For these special hours all thoughts of an academic nature were spurned, and we concentrated only on having a good time, a good time, a good time In between courses we danced . . . .1 p H771 z y X What, no blackface? 31X-??X iffy -i?Nk.v1x i 9 Leading the procession Crarluation ceremonies at Ohio Field. Lining up for the big event 1 . , 0 , Ai-N-qR"""" """-ww-M.,.,, ,P cp lilurching into tlivjivld With mixed feelings of elation and regret, 1,037 Seniors from Washington Square College gathered together on Wednesday morning, June ll, at Ohio Field for the final and greatest event of the Senior year-Commencement. Elation-at the prospect of receiving their hard- earned bachelor degrees, regret-at the thought of leaving behind them their college days. Commencement activities were among the most impressive happenings of our four college years. Everything was massive, almost overwhelming in scope-7,000 students from fourteen divisions of the University receiving degrees. Realizing that you were part of this production was a wondrous experience. Pomp and circumstance got under way after the processional and the seating of the candi- dates. With due ceremony the oHicials of the University and the guests marched to the platform in their academic regalia. This year the-graduation exercises marked the formal installation of Dr. Henry T. Heald as ninth Chancellor of New York Uniyersity, as well as the one hundred and twentieth Com- Chuncellor Henry Townley Heulrl 1 3211.37 W, . 1 ?'ff'2 52 5, Q , BK-ich 'M ww. 4 15 Color guard leading the procession Here WE come mencement of New York University. Dr. Heald, who solemnlylac- cepted the Chancellorship of one of the world's largest universities, struck a grave but thought-provoking note in his 'inaugural address. F We listened and waited i He emphasized that our basic freedom is threatened by the substitu- tion of group thinking for individual thinking. The great need in our time, he stressed, is, "for more educated men and women who, being properly equipped to perform the tasks upon which the maintenance of our society depends, bring to those tasks and to their role as citizens a high sense of personal morality and individual responsibility." As Chancellor, Dr. Heald promised to work for the improvement of the University not only for the institution itself but also for the contri- butions that it could make through its graduates to the American people. k"Let's see, I was standing behind George . . .', 4 ,N J ..-gg 'f-5:4 5,35 5. .J-, ,A 1-,,t , i 'V' cup- ismfrilling ou, Sir." No one knows exactly what the future holds for us, but we know that hope for great and wonderful things to come is nourished daily by us all. We have wished for many things in our lifetime, especially during the last four years. Now, at the most important point in our lives, we are suffused with hope-hope for the years to come-hope that life will be as clear and bright as the day of our Commencement. The outlook for the graduates of 1952 is troubled. The peoples of the world are engulfed in strife and chaos. At the very beginning of life we are stymied and confused by the world which we thought would open its arms to us in glorious admiration. However, if this be our challenge, then most assuredly we will meet it. Only then will we and others be able to judge the worth of our education. Chancellor and honorurv degree recipients before the ceremonies . . -- ,.- -.x f -'Eff - -23? 7?'2- Q'-L.v 'QA Ti '++'x4?ff1, 6 1 V 1 0 r . -'-,- v , '- 1- - - '11, . f.fZ'::'zf5:,.- ,..,:ffiaQ-.fffl-VIl::f'3:'Gj"7. ,.,,,f, . - '- 1 Q V 1 1 is-435+-5,-.-,a " ' , f . + v'+u'f-JAWMW--M ww: --"--261 14 44 ,, at-'llflgf 7-Liaffflil hfl:"l'3,zF i',5'f'1K'L:5263 iygrfiiyitg-5?, 4,,.:,.,y,M43r. -- 1 - . - - - we at . - '.,'mv faq- ,fam 1,5Sff.S'Mff -.1 i. .,g,Q's?fr' I ' ' ? M - 1. ,f f' ' . , I ,qgjaxij Q 'rf . ' ' i 1 g QT A., 1. Q, . ".,l jf' -J ,"J,, ' ""' -1. ' ' - " - 'v. i ' Half .uf ,, 1 - ...--zdwgwl 'Wit , 4 ....,Z7f'Ni-5 .. T . -,a -:'f"Ysj2i?iQ??ag,5,, fa-' " 'ts 5 'i.:..Qlg: .ars "ff V H.. , "W-" Hifi' :" Q!" Q " M VS. l":E-., Z2 f'Z.i?7'f a- ' P. if "'3EufGQ..?- f - A -.:4...1.-.-' if ' fff ...-f.4- 1 1. ' gas 2 ."',.5 -1L7',.qj": . -'fr PM-Aa. , 2, . ,I A -31- .mf .ff - were pawn , . -'1"'4?5'fwf -' f ' Q f . q i. . V- ., . ..... . . .- . . A. w1...,s. 1: ,,. , fl Our parents watched proudly F I x',, I Sf' - "--xi? -il 1 EU. .L-3 it R k 'ef fl- i 4- W" -ffl' " ' 5552353 . :luv ,Lg --43353: -3, ,,, .- .. , -gif.-E':Qv 151 'afzfw - -i q:-:a.g,a 1 ,l . N 1' E f N - trivia 2539- aS exwfi S+YW'.4eY g - 7 e .2 - -. api. 1 if , e.'f- , ' - - 1. ,, I ,lf . V. .gr . ,. -T.. -- '- -r .-f-H ' . ' ' ' .L-:ii i .agar I. pi I :.x.iA'x .a?la,.c8'..gPQX . , .- .-w-.wry ..: - H . - . H . R X, i n l"gQS:.:Q GE. lla x, P ,l - W' X Yi ! 31 mf .Af X X' 3-x ,X-" - .t . Y' zz., ,, -up ' ' :S f Sri' -l? 1 -T 'X F fl- . '-- Q- ' -' - -. - .V 1 .W ..... , , , , - . , ,, ,, gl., J, . ,M-ar,SAfr - - X V " 4 , . sw:-f f rl 1 ' V .V':ffv,-:,a1xe 'X ' Q- A. x X X -f ft ,. .lax o..,M.cs?. mga, ,N .e . s, X L X ieaifwz. -- "min 'Sri 1':,J.:k!:?5:" ..- .. '. 'ki- N133 1' W -'x-'f-.WX .W 1 A iff! -.fQQ?2QQ12"'efQeg1.Af-. 2-+2fr'e1w,QeQwrX X K my ' ,.X,X 1 ,,. .l .. .V , .. , X. 1' ,, . mm..-. ".-,W -. New 1" .."t:xQ.-'1 ww ,V XJ. 1 Ney N ,ggfff!...g1g9Spkg-.-,:yr'-.-Q'1:-ggf1.'354sm-5j2?"w?Q-+3,:.,eg3:?yemV,fg,e '5Qi'w: eqf'f-Sbgxigixxxygxvl, :Nm - ' 5, c- 55 -- V. ' -V - We strained to catch every word yn., ix E55 Discussing . . . the future? The Great Day is past and with it the excitement and novelty Of all such occasions. We have finished writing and describing events, ideas, emotions, thoughts. It remains now only to look for that tiny, glowing thing far away. It will come nearer and nearer. Stretch out your hand to it-touch-grasp-hold-the unknown. H' ,.'.'t1 - ' n ,?5i,ffv.'ffv -' -' - .JW ffa2f'?' Q - - . ,-1. ..- ., - ,N A , . ., 1 ,Y ,,..i,,-Fw-. ,.... -. Q --,- wf:M,..-- ' Q-:Q vp.. , v,1v,.. ,, -- 4r2'5::1.2,1+v-2: Wm: .. . , fr-21f:eia1:z S, ,,,,,,4,:.,.,:- , I . fs, mfs- aww. l'- :--1 .yn , , fy, M 'Zz - 3.5 : '15 - : -f' :fF,'1",.,'i' 'E' NJ- Hi" . gk-'.-X ri" - 0W,, , '. , . ...x-,,,p,P35. 53- , . 3 .PQY M fe v f ,b + - -. 'K '-12" ."" mln ' QA! Y N, 42 ' U.. nr H fu Q' -of 'iffvf M ' -n , ' . ., HX . A W2 wr 1, ' ,g .' 7rfm':1i.' 5-2' A- , t - mm, , 1 My V A vw , H ,, 5 I-1 1 V Q "' . F 2' P,k , axrwf' f f "fb "' ' if X M " 4 4- "' , 3-X Q M , , fu- H Sf U 4 My L: 5 X -L if x "' ' J' V 2 X xa-"H -' , Q A P W.. Af Nl? Mr .X xf. Q X, ,, ,f Fx - fa,-.f air? K1 N 1, gg:fig5g1:57:'lf-- .yu .-,mf A. .vm :fra- ll, - -fr-r ix , ., Q J, Q 5 , - xv ' 1 AGL. .S , o ,, 1 f 1 .g .cl 'EX 2- 1'-'Bic' 7: in I1 x-"f 'x 'lx V D, .,.. AH' , -WSL. H .Q -'Q M.v!1al:s.Q!gx '-' ' A ,I . , ' 1 . Q 'r La ina Yffwge- In "N ,E - 122'-- 953' ,- QV!! fa- ,, ' ' L- 1-215-f+.1fxf " , -N G '.g,w?f..:'lj.'-, , 'P me w Q'Q':4 -LA V , -,J fe'-,1qg,, 1 . ' mf ' '-JL, ' . ' , '. 5 -, Mig? ,Q 'Lf' .If K eg. f 'uf'ff" ff- 1' fx ,.-', :G-':': ".' wj"'l: f, 5 if 45-:, ,...fa 4. WFS: -H... .-- '. 4'-'av , 1 . . F55 W ., 5,54 gf-fig y P71 W' 'eiillfif Vigir 52 :EIT , ' 4 find' ' "lg-zjgikifzf " b 1 1,--f L2 lf'f,5':,gg ' ,-jxjf 4 , 3 ' . ., Wai!! fir? . . 525,52 gin? "'?'-Mr 0" vw ' , "7 ,' fl' .:, ' ' , . 4 g'uf91'1- ii 1 Ai ,341 ' "-' " fm.. ,Q -mi? ' W jf"X5L3Ef, , ' , .W 'in' -j - .' 354 701 - ff ' 2 .f ', . --W' , V M x - f H Y - Q 24 M , 1' 2, ' ,.'+ -ww ., ., -ffl-3 ,,fQ...,.., . . , I , - :fn 5 f'lf?:ff ' 'gm ,i Q 1 f1.f,fgg',2f'Q" ,' Lg 2 W' in QW -' 'f f . j ,541-ww: ' -' f 1 J f , f ,. f 1 1 W frf " 1 'f ,fy. f,-,g fdw ' , . Q, fp --gn.: ' if A Q2 4 I I yu I f If 25 1 , . f i Z , Q ' , i afw' --....,,,,,w,,,,.,, , f A ' ,, ffm' Ik - , f - WW, . A QM, 'N mf f' V. .f f .?FW'?4!5ff1:ZI , "' I I I , WW , , f w Yu "g""h. 3 lu' ,M W Q gm wr". W -.1 .IN 1 759' ki 5 Z2 f F ,A 1 3 ff Q 4 W in sl 4 1 F J ri ,171 GMI' jo . Our parents who patiently listened to our complaints and kept our suppers Warm when we were late. DEAN ARNOLD, DEAN MCCLOSKEY, PROFESSOR BEAU- MONT and PROFESSOR CASSON who gave invaluable aid to our book. The Managing Board of the 1952 ALBUM who gave un- selfishly of their time, effort and energy to produce this book. GRACE MCKEAGE and FLORENCE MOLINARO who were constant sources of information and consolation in our trying hours. WARREN KRAETZER, OSCAR CALHOUN, THOMAS BROPHY and KEN BATES of BPI whose statistics and photographs were a great help. IRWVIN SPIVAK, GEORGE DAVIES, BOB LEAHY and EDUARDO RICCI for their excellent photography. GEORGE HEFFERNAN, BOB LOVELL, MRS. GERTRUDE SIMPSON and the entire stall of Baker, Jones, Hausauer 81 Savage's College Annual Department for their cooperation. All the members of the Associate Board and the staff for their fine work. All those who have stood behind us with encouragement in spite of all the seeming adversity. The many Albumites who have come before leaving us the heritage of the future. Armand and Shelly 19 2 ALB M STAFF ARNLAND KIRSCHENBAUBI SHELDON WINKLER Edu0"'m'Cl'wf Executive Editor MICIJAEL NEVN'MAN Business M anager ROY S. AZARNOFF, Managing Editor MADELINE WEISSBROT, Copy Editor NONA .l- H0R0WlTZ, Features Editor ROBERT H. GELENTER, Photography Editor ASSOCIATE BOARD NIARIA BAMPOUCIS, Assistant Editor HOWVARD FRIEDMAN, Assistant Photography Editor ROBERT HOROWITZ, Co-Sports Editor MARK CARROLL SIDNEY GUTSTEIN SEYMOUR LEFKOVVITZ STAFF GLORIA GLIKIN, Assistant Editor BYRON FOX, Circulation Manager CHARLES MANGEL, Co-Sports Editor NIARCIA MERKER SYLVIA MERKER HARTLEY POLASKY Estelle Addis, James David Auslander, Mitchell Badler, Joan Bush, Saul Cooper, Stuart Crane, Bernard Finklestein, Susan Friedman, ,lack Clazer, Al Goldstein, Seymour Corelick, Claire Haas, Mae S. Hong, Harold Kurte, Abraham Lenobel, Eduardo Ricci, Stuart Scher, Robert Schwarzbart, ,loan Shalack, Arnold Shapiro, Claire Siegel, Rosalyn Simon, Marvin Smalheiser, Robert Weltman, Paul Wyflan. ISHI E YU 5 IIIIESS ANU LUT5 UF L Eli! L L Z Z N KWTWY We wish you well and hoping, too, that happiness and real success Are both in STORE for you! . . . And with your diploma and other souvenirs, May you keep happy memories of this STORE, for years and years NEW YIJHK UNIVERSITY BUUHSTUHE DELMA STUDIOS Our Ofhciaf Wargoi l9AofograIoAer 521 Fifth Avenue lVIUrray Hill 2-3139 New York City The Center For New York University Activities . . . We cordially invite you to consider this charming hostelry near Washington Square for your home . . . when you dine . . . or when you are planning a function. , FIFTH AVENUE HOTEL 24 FIFTH AVENUE AT NINTH STREET T. PHOTOGRAPI-IE HYOUR SENIOR PROM PHOTOGRAPHERN Vfllley Stream 5-6933 22 Wood Lane RS VALLEY STREAM, L. I.


Suggestions in the NYU Washington Square College - Album Yearbook (New York, NY) collection:

NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection, 1936 Edition, Page 1

1936

NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection, 1937 Edition, Page 1

1937

NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection, 1944 Edition, Page 1

1944

NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection, 1949 Edition, Page 1

1949

NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection, 1951 Edition, Page 1

1951

NYU Washington Square College - Album Yearbook (New York, NY) online yearbook collection, 1985 Edition, Page 1

1985

1985 Edition, online yearbooks, online annuals 1970 Edition, online yearbooks, online annuals 1972 Edition, online yearbooks, online annuals 1965 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.